3L70D

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
total genus 70
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l70D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l70D02
4L1QA 3PLNA 3WFEC 5KLIB 1CSUA 2CA4B 1SQXD 1GKSA 1CXAA 1LC2A 1J3SA 3PRJA 1I54A 2N3BA 4WQ8A 1ZRTD 1L9BC 1GIWA 2EXVA 1NU1D 1AYGA 5TISV 1A2SA 2D0WA 5C0ZA 1L0LD 1OAEA 1LFMA 1C6RA 1EZVD 2ZXYA 1HZVA 2QJPB 1MG3D 4PW9B 2DVHA 3ZOYA 2Y0EA 3L4MA 3DP5A 3A0HV 3CWBD 4A7PA 2BLFB 1A8CA 3ZOOA 1CORA 4NFGB 2N9YB 1KV9A 1YTCA 1PPJD 4FA1A 1H33A 2KNCB 3VRDA 1FI9A 2LITA 2BCNB 155CA 1FI7A 2ZBOA 5H2FV 4FANA 1N50A 2C1UA 2Y0CA 3CYTI 3PHLA 3CX5W 4WQBA 2CE1A 4PJ0V 2VHDA 3WC8A 2N9JA 2L91A 4FB1A 2AXTV 3ITKA 3CXHW 2V08A 2YQBA 3HQ6A 1PP9D 2YCCA 2N9IA 1RAPA 2L4DA 3RN0A 5CIDB 1F1FA 1H1OA 2B10B 3HQ8A 3WFDC 3O20A 1C6SA 1CCRA 1K3GA 1DW0A 1YICA 2FRCA 1W5CT 3WUIA 3H1KD 2ZONG 3NBTA 1I55A 1YCCA 1HRCA 1SQVD 1WEJF 3CX5D 1P84D 3TDKA 3FWLA 2B11B 1N90A 3CXHD 5B6QA 3VYMA 4RJTA 3O5CA 1QL4A 3SXTA 2QJKB 1DW2A 1H33B 1QYZA 4XYDB 5KLVD 2BCCD 1CYCA 1DIQC 2ZZS1 5DFSA 3RLMA 3VMAA 2Y0DA 2GIWA 1CYIA 4GEDB 4XXLA 1SQQD 1QKSA 4JCGA 3ZOWA 1KYOW 3OCDA 4AAMA 2C9XB 1I8PA 3WFCC 5IY51 4IL6V 4D6TD 2RN0A 1K3HA 2YIUB 5E79V 2BH4X 3H1JD 5CIFB 1U75B 4U3FD 1FOCA 5KKZB 3L75D 3ZBMA 3SJLA 3GG2A 1CC5A 3PTZA 1BCCD 2D0SA 3SVWA 2QJYB 1S5LV 4WQ7A 3ORVA 1CIEA 2YK3A 3RMZA 1NTMD 3L70D 3PXSA 4L3GA 1OCDA 4Q5PA 1W2LA 1KYOD 1LS9A 5CIHB 1FJ0A 2DGEA 5GTIV 1CRYA 1I5TA 2BH5X 3NWVA 1CTZA 2CXBA 1BL9A 1KB9D 3PXWA 2ORLA 4DY9A 2O3JA 2LIRA 1QL3A 4FAVA 3SWSA 4FA4A 2N3YA 5CYTR 4PD4D 3PXTA 3L4OA 5TJHA 1NIRA 1NTZD 1DW1A 2OZ1A 1NNOA 1CO6A 1EB7A 1HJ3A 1AKKA 1CNOA 3OCDB 3TGUD 3BCCD 3PH2B 4Y5RA 1IRVA 1BGYD 1HROA 3KHUA 3C2CA 4EIEA 3M97X 2PCBB 3O1YA 2QG4A 1CTYA 1GQ1A 4O1QA 4J20A 5KAFV 3H1LD 3L74D 5DF5A 2PACA 1CRHA 3O0RC 351CA 2KS1A 1HJ4A 1L0ND 1CIFA 1H31A 4K3IA 1IO3A 2C8SA 1CIHA 2PCCB 1CRGA 4WQDA 5GTHV 1CHHA 4EIDA 1DVHA 2GC4D 1C75A 2ZOOA 1N15A 1HJ5A 5CIBB 2C1VA 451CA 4KMGA 5DJQB 1KX2A 2FYUD 3ZIYA 4FA9A 4EDFA 1IZL0 1COTA 1R0QA 2A06D 3OA8A 1LMSA 2OZ1B 2FWLA 3SLEA 1DIIC 3NBSA 2MHMA 1CXCA 1H32B 4EIFA 5KAIV 1YNRA 3WU2V 1CHJA 1NTKD 1S6VB 1SQPD 3CP5A 3ZOXA 2IBZD 4UB6V 1C2NA 3RN1A 3CU4A 2C1DA 1FHBA 5CICB 1CSXA 3L73D 3VNWA 5B5EV 1CRIA 3TF5A 1RAQA 4WQEA 4RSZA 1I6DA 2RMZA 4FA5A 1I6EA 5CIGB 1H9YA 1HH7A 1RZ5A 2BPBB 1KB0A 1C7MA 1DW3A 2Q3EA 1YEAA 1KX7A 2MTAC 5DJQC 4V2KA 1QN2A 2CA3B 2C2CA 1H31B 4WQAA 1GJQA 1CYJA 4WQ9A 2XTSB 3JBTB 5AURA 1E29A 2JTIB 2JWAA 2CE0A 1M70A 1FCDC 2N18B 1A56A 2B12B 5CIEB 1U74B 4UB8V 2B4ZA 1HZUA 2FYNB 4O1WA 3OA8B 4WQCA 1CRCA 1GU2A 1E8EA 2JQRA 1CEDA 1H32A 1NMLA 3HQ7A 5B66V 1IQCA 1CHIA 1B7VA 1NMIA 1IRWA 1GDVA 4L3HA 3X39A 4GYDA 1MG2D 3MK7B 3L72D 3KZIV 1I8OA 2C1DB 1C52A 1YIQA 1AOFA 4N0KA 3DR0A 4YE1A 1LC1A 1E2RA 4PWAA 4AX3A 1JDLA 1C6OA 1CCHA 1DT1A 2AI5A 1ETPA 2N18C 5C9MA 3H1HD 3H1ID 3HQ9A 1CTJA 2BGVX 1SQBD 1H9XA 4AAOA 1AOQA 1C2RA 1MZ4A 3A0BV 3L71D 1FI3A 4P4QB 1CIGA 1CRJA 1HCMA 3GW6A 4EICA 2AIUA 3A9FA 1VYDA 3ZCFA 2GB8B 1YFCA 2GC7D 4H0JA 4H0KA 4LJIA 3MK7C 1WVEC 1F1CA 2I8FA 1CSVA 2K9JB 4AALA 1M60A 1DVVA 1M6ZA 1N9CA 2HV4A 3DMIA 4AANA 3TYIA 1CSWA 1RZ6A 2B0ZB 2V07A 3WFBC 1BE3D 4QAOA 1ZZHA 4MU8A 5EXQA 1L9JC 1YEBA 1KIBA
chains in the Genus database with same CATH superfamily
2QM7A 1NJIQ 3WFEC 2JP3A 4ASVA 4GODA 1VQPP 3GMAA 2YO3A 4RO0A 1J3SA 3PRJA 2N3BA 1VF5B 1ZRTD 1KN7A 3LIDA 1YIJP 1YJ9P 1SLQA 2EXVA 1NU1D 1ZW0A 1ZV8A 3HRNA 3A5TA 4PJ0E 1QX8A 5L8RJ 1C6RA 1EZVD 3VN0A 4PW9B 3ZOYA 1BGYG 2AEFA 3V5BA 3DP5A 1UIIA 2E76B 2QA4P 3A0HV 2BLFB 1A8CA 2N9YB 1N8RQ 1JEKA 1KV9A 1YTCA 1MFZA 1PPJD 3B71A 1HGZA 2E74C 4CPGA 2KNCB 155CA 1FI7A 1FDIA 4DOJA 1QVGO 3H1LG 1N50A 2Y0CA 3PHLA 1VF5C 3EQ2A 3WC8A 4XE5B 4FB1A 5KKZC 3ITKA 1M8OB 2V08A 2YCCA 1EZVI 2N9IA 2QM8A 1FZEA 1F1FA 3O6QA 1NKZB 2E76C 3WFDC 1C6SA 1CCRA 2YMKA 3S4RA 1K3GA 1IJDB 1H0TB 1KILD 1JY2N 1VQ9P 4WB4A 1URQA 4TT3H 3H1KD 1SQXK 3C8VA 3AE1C 3HTKA 1X79B 1RY3A 1BE3E 1P84D 1M7LA 1NTKG 2GUVA 1SQPG 3L71J 2FY8A 1VQ6P 4L75A 2YXRB 2I1KA 1L4AD 3VMXA 1SQVJ 1FOSE 3L75G 4WY4B 4RJTA 3D6ZA 2WSCJ 2QJKB 4PD4H 1FDMA 3MUDA 3H1JE 3RLMA 1HBWA 3VMAA 1RE4C 2W6JH 2GIWA 1CYIA 2BCCJ 2POHA 1SQQD 3OCDA 3C9IA 1YITP 1GZLA 1J2JB 3K5BA 2YMYA 2HODA 3AEAC 1KORA 3SFEC 3E1IA 5E79V 1PIXA 3CWBE 5CCGD 1JM0A 1S3JA 4ASWA 2MJZA 3HD7B 1HH0A 3CX5H 4U3FD 1M56D 1FOCA 3Q1MA 4W7ZA 2WSCH 4WY4C 2QJKC 1EDKA 2QJYB 3CCEP 1CIEA 3RMZA 2GM4A 2B88A 4PD4E 1XTGB 3L36A 2J58A 2PAJA 1ZR2A 1LS9A 1R5SA 1LJ2A 2KS1B 1FAVA 3JSVC 1PP9E 2PP6A 1I5TA 3L70J 4WBAA 1HVVA 2HLOA 2CXBA 3G4SP 5CJ4A 5KJ7C 2LIRA 4PV1D 2HPCB 4UB6H 3D0WA 1QL3A 1IZNB 4FA4A 3H1IG 2N3YA 5CYTR 5TJHA 1FZCA 1EDJA 2Q3IA 1K8AQ 4GT1A 4W7YA 3CLQA 4H44C 1K05A 3WUTA 1SQVE 1NHLA 3CX5E 1KILA 3RL0D 1IRVA 1BGYD 3D71A 5KJ7D 3BCCJ 1IC2A 2PCBB 5EFWB 1IFIA 5AW6B 1KYOH 4J20A 1U7MA 2NRGA 4H44D 1S72P 3H1LD 1NH4A 3HE5B 2E75C 5APWA 4UB8H 351CA 2J5UA 4JYBA 1CIFA 2V7QJ 1CIHA 2PCCB 4UB6E 1N7SD 1DVHA 2GC4D 2K9YA 4I2LC 5AVTB 2ZOOA 1KD1Q 4XFJA 3HUSB 1J1DB 4KMGA 1IO4A 5DJQB 1EQ7A 3WMM0 2E75D 3ZIYA 3V2PA 3BVHA 1ZMEC 4FA9A 4EDFA 1COTA 1UIXA 4H13B 1FJKA 3SLEA 3GHGA 2G8YA 1L0LG 2W6AA 5CCGA 2P58A 3B5NB 4C7RA 5KAIV 3LW5H 1OFCX 3WU2V 4GOFA 1W2EA 5CMZA 1NTKD 1SQPD 3TNUB 1KYOE 1FZFA 3CP5A 4D6TJ 1FHBA 3A0BH 3G3ZA 4IFDK 1CRIA 4UB8E 4EIJA 2N1TB 1H88A 1CZQA 1JO5A 1JMMA 2RMZA 1I6EA 1R5LA 5CIGB 1HF9A 2WSFJ 1HH7A 2BPBB 3KXDA 1YEAA 1ZOYC 3CCJP 2QE7H 5DJQC 4V2KA 1QN2A 3L72G 3VMZA 2C2CA 1KV4A 2WPQA 3BCCE 4WQ9A 1SQVK 1M90Q 3V4QA 1E29A 2WZ7A 3B5NC 4ZMDA 1FS0E 1SS1A 3O8ZA 2H8PD 1SFCD 2WITA 5CIEB 2B4ZA 4YTPC 4C7NB 2W90A 1FZAA 2K9JA 4WQCA 1OMIA 1GK6A 1RH5B 2Q6QA 5E79H 1Y9BA 2N1TC 3GF7A 2KIKA 1NMLA 5B66V 3H1HE 1N73C 1IQCA 3A0BE 1GDVA 4L3HA 1SQBE 1NOHA 4DCKA 2QIWA 1L0NE 1X0TA 3KZIV 2O01N 5TISH 1I8OA 3IF4A 1C52A 1TU3F 1YIQA 1AOFA 1GL2C 3DR0A 1LTSC 5KLVG 1NWQA 1E79H 3QWOC 1VL2A 4DZOA 3H1ID 1CTJA 2BGVX 4AAOA 1N7SA 2M3EA 4HB1A 1T3JA 2IDBA 1C2RA 1MZ4A 5H2FH 3L71D 1FI3A 3UIAA 1RF1B 3SWFA 3VTPC 1CRJA 1GL2D 3EFGA 4EICA 3SSUA 1JTHA 5CHXA 3RK2D 2IBZE 1DEEG 5AVQB 2JKVA 2AXTH 4H0JA 5E79E 1WMKA 4LJIA 1NU1G 4AALA 3Q5PA 1M6ZA 2HV4A 1EZVG 1N86A 2B0ZB 2B87B 2OTLP 2V07A 5TISE 1NTMG 5K5GB 1ZZHA 5EXQA 1L9JC 1VQMP 1Q90D 3M0AA 1PPJG 2B9BA 1JCCA 4ZNCA 4IFMA 5KLIB 2CA4B 2KK7A 2ZT9B 3M06A 1CXAA 3O6QB 1I54A 4TLFA 5H2FE 1SQXJ 2IFNA 1PZQA 1NTZG 1P84H 1GIWA 4NPEA 2Y9ZA 4Y99B 1AYGA 1LWUA 1A2SA 3VP8A 2D0WA 3TGUG 1LP1A 1L0LD 1SFCA 1M57D 2AXTE 2QJPB 2DVHA 2NZ2A 2KI7B 1SQBK 1N2DC 4JF7A 4OGQD 1L0NK 3L35A 3CC2P 4BWNA 2FKWB 4AYCA 1H33A 2OGUA 2V4HA 3VRDA 2FFDB 2LITA 1IFMA 5AVSB 2ZBOA 5KAIH 1GU5A 1IFPA 2YIUC 5DJUB 3L74G 4FANA 2KB7P 4O9BA 4BRYB 3CX5W 2ZYAA 2JDIH 2L91A 1GW4A 1URQC 2CPSA 4Y99C 2BASA 1S5LH 1VPCA 1RAPA 2L4DA 5CIDB 2YO2A 1P84E 2WWWA 1HUCA 4LGDE 1FZGA 2MKVA 5AVYB 3HQ8A 2WQYC 2CPBA 5GTIH 1DW0A 2FYUG 3WUIA 1KTMA 3MIWA 2P67A 3Q3DA 2JR8A 2FFDC 3G71P 2R32A 3MUDC 2K1AA 3AEEC 4L74A 3TDKA 3AE9C 3FWLA 2B11B 2NPSA 3FX0A 5KAIE 5B6QA 2M0BA 5AW7B 3VYMA 2PRRA 4JYCA 3L73G 1IK7A 5APUA 1DW2A 5KLVD 2FYZA 3CI9A 1CYCA 1DIQC 2ZZS1 1XTCC 2OYIA 3ABVC 5C39A 4EOTA 3E7KA 5APYA 2BEQD 1LTIC 2O1JA 1OW7A 3V4WA 5KTBA 1S5LE 3AEBC 3KZIH 5AVXB 1MZ9A 5APQA 4WWIA 3ZOWA 1KYOW 1BE3J 5KAFH 4AAMA 3HE4A 3GLMA 1CI6B 4D6TD 4IL6V 5GTIE 1CSBA 1KILB 5AVZB 2E5TA 3A7OA 5KKZB 3ZBMA 3H1JJ 3CXHH 5AW5B 1AVOA 2KXPB 1RE3A 3PTZA 2KYVA 2D0SA 3SVWA 3H32B 5APXA 1L4AB 4KHXA 3ORVA 2ZAEB 1NTMD 2P7JA 1BCCJ 3P8MC 1OCDA 1NYHA 4Q5PA 1W2LA 4N78E 1FZCC 2DGEA 3VYIA 3CWBJ 2BH5X 1CTZA 3KZIE 3KQGA 1KB9D 3PXWA 2KLVA 2XZRA 1BGYE 1KILC 3B8EB 5KAFE 2WT7A 3PXTA 3L4OA 3N7NA 1HTLC 5B5EH 1NTZD 1NNOA 1EB7A 1HJ3A 3P7KA 1CNOA 1T3UA 3GHGB 3TGUD 1LT9A 3H1LE 4Y5RA 1L4AC 1YHQP 1HROA 3KHUA 1PP9J 1QLED 3M97X 2R5DA 3CXHE 2KUBA 1EXJA 2QG4A 3RGUA 1Q86Q 1KB9I 2OTJP 3CL3D 5CBNA 2AXCA 1ZN5A 3CMEP 2O1KA 3PH0A 3L74D 5DF5A 2PACA 1CRHA 2Q7CA 2M5AB 3NMDA 1N7LA 1QL1A 1M1JA 3TSIA 2D2CD 3MD0A 4NPDA 5GTHV 4PV1B 3GHGC 4OVNF 4EIDA 5CCGC 1OW6A 2Z5IA 5AW1B 5B5EE 5APTA 2K3RA 5AVVB 1JMBA 3SWKA 5CIBB 1JNMA 1FOSF 3L75E 2FYUD 3AE7C 1IZL0 1R0QA 3OA8A 1LMSA 2OZ1B 1BCCE 3RL0B 1DIIC 2MHMA 3CCQP 1CHJA 2AEJA 1S6VB 3VOPA 3ZOXA 3N4XA 3M0DA 3RN1A 2WPSA 2C1DA 1CSXA 4H44B 3L73D 3VNWA 4Z1MH 2Q1KA 4U7JA 2CK3H 1RF0A 3TF5A 4PV1C 2E42A 1I6DA 4FA5A 3ZDMA 1PL5A 1KB0A 1M1KQ 1C7MA 1DW3A 2Q3EA 2MTAC 3T97B 1G2CA 1N7SB 3M9QA 1YTZI 3KPEA 1H31B 1YI2P 1GJQA 3RL0C 1LNQA 2XTSB 3IAOA 3BRTB 4XA4A 2YNYA 2JWAA 1MKMA 2E75B 1FCDC 2N18B 1A56A 4B86A 2AEMA 1HZUA 1KQGB 2FYNB 1SP4A 1LTTC 1YJNP 2IX7C 1CRCA 3L71G 1E8EA 2IYPA 1CEDA 5AVUB 1R8EA 1SQVG 1H32A 3RBXA 1JY3O 1IRWA 3V2NA 2M8RA 3BASA 1N7SC 2JJLA 1JY2O 4N0KA 1BSNA 1SVFA 1LC1A 1E2RA 1NGMB 1VQ4P 2IFMA 3II6A 2BCCG 5M1BA 4ZKPA 4RKUJ 2W27A 1CCHA 1KFNA 1DT1A 3VP9A 3A0HH 2N18C 2R5BA 3LW5J 3NTNA 3I56P 4L76A 1VQNP 1H9XA 2FYNC 2A45H 3HD7D 3H1HJ 1LWUB 1LP1B 1USDA 3M91A 1SFCB 1SQBJ 3GW6A 2JEEA 1L0NJ 4LLHA 1USEA 1VQOP 1YFCA 2WPRA 3A2AA 2RKLA 4N3YB 1WVEC 2KSJA 4GOEA 3V6IA 1CSVA 2KNCA 1M60A 5AW2B 3DMIA 1K04A 1CSWA 3V2QA 4JPZB 1NAYA 1BE3D 1Q7YQ 1KMIZ 1DIPA 3L70G 3U1AA 3A0HE 1L0LE 1CSUA 1LWUC 5BU8B 1SFCC 3IFMA 1WRGA 3CC7P 2R3SA 1N73B 4WQ8A 2B89A 1G1JA 3S9OA 3MP7B 3AEDC 1GL2B 4HH2A 2Z4EA 3BCCG 2KZIA 1LFMA 4AQRD 1T2KC 2Y0EA 3L4MA 3CWBD 3ZOOA 1CORA 1OVVA 4NFGB 3L72E 2H88C 3FXEA 1AVYA 1DX7A 2I8DA 2BCNB 2KZJA 3A3YB 4N6JA 1T2KD 2C1UA 1A02J 2XNDH 1JB0J 1PGQA 1W5CE 4PJ0V 1X9VA 2N9JA 1YYCA 3CXHW 2WSSH 2YQBA 1JY3P 3GF3A 3HQ6A 1PP9D 1T8ZA 3RK2C 4R4LA 3R2PA 2WMMA 1X8YA 1W2BO 1H1OA 3O20A 1JY2P 3HD7A 1S9KE 3CMAP 2OTKE 1W5CT 2NPSC 2ZYDA 2A06G 5KLVE 3SFDC 2ZONG 3NBTA 1I55A 1YCCA 4OH8B 4DJGA 1HRCA 4D6TG 1SQVD 1WEJF 2OYHA 3CX5D 3P8CD 2P10A 1LTGC 3H1KJ 1KB9H 4EYYQ 1N90A 2IBZG 3SWYA 2I1JA 3TYYA 3O5CA 3L4FA 1L0LK 4K35A 2QSIA 1RHZB 2NPSD 2BCCD 1ZLLA 5DFSA 1AQ5A 3I5CA 3W68A 1ZRTE 4GEDB 4ZKUA 3AE4C 2WT7B 1NU1E 1FC2C 2Q5UA 3F89A 1S5LX 2C9XB 1MUUA 1EZVE 3NXSA 1OZHA 1RE3C 1I8PA 3WFCC 2RN0A 2XDJA 3CX5I 1FZBA 1SQQJ 2YIUB 3FWNA 4OGQC 1QGKB 2BH4X 5CIFB 3CCUP 1U75B 1LGHB 1PPJE 2ITAA 1LT1A 1URQB 3SJLA 2YKQA 1X22A 1CC5A 1OIPA 1BDDA 4OWFA 4U3FJ 3HTKB 2ZXXA 4WQ7A 3L37A 5AVRB 2YK3A 4HKZH 1NVOA 3L70D 4L3GA 1NTZE 1KYOD 3RK3C 1FJ0A 1M1JB 1CRYA 4M3LA 3TGUE 1KC8Q 3AEFC 1VQ5P 1BL9A 3WU2H 2ORLA 4DY9A 1QL2A 2O3JA 3HUSA 5AVWB 2C9LY 4FAVA 1KILE 1NIRA 1KFMA 1AA0A 1DW1A 3H1KE 3H6PA 4H0LD 1OXZA 1AKKA 5KLVK 3AECC 3RK3D 3OCDB 3OW2O 3BCCD 4RESB 2JWDA 2R44A 3WUVA 3L74E 2HODB 2LXBA 5AW9B 1KYOI 1PGOA 3F5HA 1KQLA 1H89A 1L2PA 1M1JC 1GQ1A 1BGYJ 4O1QA 2IZ1A 3JC22 1RQVA 4QMAA 1Y8AA 1GW3A 4KJMA 1FJPA 3O0RC 1Y47A 2FYUE 3U59A 1SQQE 2GA1A 1NU1K 1PV3A 3H1LJ 3WU2E 1L0ND 4K3IA 1IO3A 2C8SA 1GMJA 2Q9IA 3CCSP 2OYOA 1CHHA 5B66H 1SQXG 1C75A 1Q2NA 1HJ5A 4GKGA 5BVZA 3V2RA 4U3FE 1S2EA 2IZ0A 4C7NA 3M0DC 4R4MA 1FZCB 3L73E 2A06D 5CCHD 2FWLA 1IFJA 2C0XA 3NBSA 1RF0C 4HJGH 1CXCA 2ZVOB 1H32B 2W8ZA 1YNRA 1LTJA 3IN6A 2IBZD 4UB6V 1C2NA 1NTZK 2GUSA 2LR2A 1EDLA 2FXPA 1NTKJ 1SQPJ 1RAQA 1DD3A 4RSZA 2M3BA 3L75J 1H9YA 1GDTA 2D2CB 2FBWC 4Y28J 1LTBC 1KX7A 2RH0A 5B66E 1DH3A 1J1EB 3AE6C 2C9NY 1CYJA 1RF1A 2WSEH 3JBTB 5AURA 1FDOA 1S4XA 2CE0A 1M70A 2LXCB 4HYTB 2IBZI 4UB8V 4O1WA 1BSHA 1GU2A 4YXDC 2ZXEB 2JQRA 1K73Q 2B87A 3OJAB 2KLUA 2FXOA 1CHIA 1NMIA 2D2CC 1GD2E 2FYUK 1SQQK 2XV5A 1MG2D 1J1EC 1OWAA 3AE5C 4K3AA 4YE1A 1HGVA 4PWAA 3M9HA 1JY3N 1NO4A 2HR3A 3I55P 2E74D 1JUNA 1ETPA 1BE3G 3CPWO 3HQ9A 1AOQA 1QEXA 3Q5RA 1VF5D 3USSA 3A0BV 3H1IJ 2KSEA 1CIGA 1HCMA 2AIUA 3MTUE 1U57A 1NTKE 1SQPE 3A9FA 3H1JG 4I7ZB 2W6BA 2GB8B 5CCHA 2GC7D 3CCMP 1FE6A 3LIEA 2E76D 5APSA 1F1CA 2I8FA 4W80A 2K9JB 4IL6X 2FFDA 1GU4A 1VQKP 1DVVA 1BCCG 4AANA 4YPCA 2J59M 3CWBG 4BRYA 4BXLA 1YEBA 2XNXA 4AUWA 4L1QA 4KT0J 3PLNA 5CBOA 4EI2A 1SQXD 1GKSA 1P84I 3B4SA 3IR9A 1LC2A 3E1RA 1CW5A 4I7ZC 1L9BC 2YKOA 1BDCA 2HFED 3FGAD 3KDPB 5TISV 1PP9G 2H43A 5C0ZA 1OAEA 1QVFO 2ZXYA 1HZVA 3D70A 1MG3D 2K37A 2OYHB 1JTHB 1PGJA 3AE2C 2Y9YA 1L0LJ 4A7PA 1JOCA 4YXWH 2QEXP 4LC1A 2PGDA 3M9BA 4FA1A 4IL6H 1FI9A 1JCDA 4WY4D 5H2FV 3OA7A 2H89C 1HJBA 3H1IE 3CYTI 1G1IA 5AW8B 3HD7C 4WQBA 2CE1A 1AQTA 2VHDA 5APVA 1HWTC 1GK4A 4N78D 2AXTV 1WT6A 3L71E 2WTYA 1CI6A 1PFIA 2QJYC 3RN0A 3L72J 3P8CE 3WUUA 2R3CA 1NTKK 1SQPK 3CCRP 2OYHC 2B10B 2WPVB 3AE8C 1YICA 1EC5A 2FRCA 3R4YA 2BCCE 3CCLP 3D6YA 3H32A 2K88A 1L4AA 2LKMA 2E5YA 1D7MA 4IL6E 3CXHD 2E43A 2C0WA 2QRXA 1QL4A 3SXTA 1EDIA 1H33B 1QYZA 4XYDB 3PJSK 1NKNA 1Z56A 2Y0DA 5KLVJ 4XXLA 1S1CX 1ZR4A 1QKSA 4JCGA 4WVZA 3CCVP 1YBKA 1FU1A 5IY51 1GTWA 1K3HA 2IYOA 1RE4A 3L70E 2BEZF 3H1JD 4I1LA 3CXHI 4IFFA 2A45G 1H0TA 1AV1A 3H25A 2V7QH 1RQUA 3U1CA 3L75D 5GTHH 2ZFCA 3GG2A 3JCUH 4MN4C 2G3AA 3RK2B 1BCCD 1S5LV 1HJ0A 3EWKA 2L5GB 3S1KA 1NU1J 2M5AA 3HUSC 1J1DC 3PXSA 3P32A 3TK1A 2FXMA 2NPSB 5CIHB 4WY4A 5GTIV 1H8AA 4H13C 3RK3E 4C46A 1OX3A 2UWJE 1MV8A 1NTMJ 3NWVA 5DJTB 2OYIB 2W83C 1Q82Q 5AW3B 3H1HG 3SWSA 3W67A 1AJYA 4PD4D 1SQBG 2OZ1A 1L0NG 1CO6A 2SPZA 1NAFA 3HE4B 1OVUA 3PH2B 4H13D 5KJ7A 2WSFH 1NTZJ 1OVRA 2ZVNB 5GTHE 1LTJB 3C2CA 4EIEA 3B5ND 3TGUJ 3JCUE 1VDFA 1IFDA 3O1YA 2OQQA 1CTYA 1PGPA 3EFFK 4I6MC 1E5WA 1K9MQ 2HYNA 5KAFV 4OGQB 2OYIC 2P1JA 3NFQA 4PD4I 2N1TD 3AEGC 2N9BA 1FBMA 1YQ4C 3T97A 2KS1A 2A06E 1HJ4A 4GDOA 1H31A 3L74J 1VQ8P 5BU5A 1CRGA 4WQDA 4D6TE 1DD4A 2HPCA 4DT0A 1N15A 4L73A 1LTJC 3MZWB 3VMYA 2KOGA 1VQLP 5AW4B 4H0LB 2C1VA 451CA 3RK3B 1KX2A 1EXIA 3AE3C 3MHVA 2XU6A 1DEBA 1LT9B 2FYUJ 2H7HA 4EIFA 1NTME 3G9RA 2QVAA 4IOIH 1KZUB 5CJ0A 2KP8A 2XKMA 2WVRA 3CU4A 1Q81Q 5CICB 1YQ3C 5B5EV 3CD6P 1KB9E 3BRVB 4WQEA 1RF1C 3HE5A 3L73J 1RZ5A 3Q5SA 1VQ7P 4JQ0D 4H0LC 2ZJSE 2HG5D 1A02F 2CA3B 3Q2YA 2YKPA 4WQAA 1ZXGA 3MGNA 3PP5A 2JTIB 1LT9C 3RL0g 2B12B 2PFXA 3CC4P 2ZYGA 1U74B 3OA8B 3H1KG 3G6EP 1IFNA 5KLIC 3B5NA 2P2UA 2ZT9C 1MFTA 3HQ7A 1B7VA 3TNUA 3FXDA 3BATA 3X39A 4GYDA 4JBZA 3MK7B 3L72D 2C1DB 3RBZA 4AX3A 2N1TA 2O01J 1JDLA 1C6OA 1N73A 2QJPC 2AI5A 2A45I 5C9MA 1ZP0C 3H1HD 2ZT9D 1KQSO 5CCHC 1SQBD 1AFOA 1G2CB 1SQQG 1GL2A 1YJWP 2JO1A 4NPFX 1IK9A 2IPPA 2OARA 2Z5HA 4P4QB 1URQD 1NTMK 2DW3A 1OW8A 3QH9A 1VYDA 4PJ0H 1LTAC 3ZCFA 1U7JA 4H0KA 1S9KD 4GIFA 4U3FG 3KYQA 3MK7C 1T6AA 1KQFB 2O01H 1YTZT 1N9CA 1SQXE 5AW0B 3TYIA 1RZ6A 2WSEJ 3OAKA 3WFBC 2VRSA 4QAOA 3C1LA 2YXQB 4MU8A 1KIBA 2E74B
chains in the Genus database with same CATH topology
4L1QA 3PLNA 3WFEC 5KLIB 1CSUA 2CA4B 1SQXD 1GKSA 1CXAA 1LC2A 1J3SA 3PRJA 1I54A 2N3BA 4WQ8A 1ZRTD 1L9BC 1GIWA 2EXVA 1NU1D 1AYGA 5TISV 1A2SA 2D0WA 5C0ZA 1L0LD 1OAEA 1LFMA 1C6RA 1EZVD 2ZXYA 1HZVA 2QJPB 1MG3D 4PW9B 2DVHA 3ZOYA 2Y0EA 3L4MA 3DP5A 3A0HV 3CWBD 4A7PA 2BLFB 1A8CA 3ZOOA 1CORA 4NFGB 2N9YB 1KV9A 1YTCA 1PPJD 4FA1A 1H33A 2KNCB 3VRDA 1FI9A 2LITA 2BCNB 155CA 1FI7A 2ZBOA 5H2FV 4FANA 1N50A 2C1UA 2Y0CA 3CYTI 3PHLA 3CX5W 4WQBA 2CE1A 4PJ0V 2VHDA 3WC8A 2N9JA 2L91A 4FB1A 2AXTV 3ITKA 3CXHW 2V08A 2YQBA 3HQ6A 1PP9D 2YCCA 2N9IA 1RAPA 2L4DA 3RN0A 5CIDB 1F1FA 1H1OA 2B10B 3HQ8A 3WFDC 3O20A 1C6SA 1CCRA 1K3GA 1DW0A 1YICA 2FRCA 1W5CT 3WUIA 3H1KD 2ZONG 3NBTA 1I55A 1YCCA 1HRCA 1SQVD 1WEJF 3CX5D 1P84D 3TDKA 3FWLA 2B11B 1N90A 3CXHD 5B6QA 3VYMA 4RJTA 3O5CA 1QL4A 3SXTA 2QJKB 1DW2A 1H33B 1QYZA 4XYDB 5KLVD 2BCCD 1CYCA 1DIQC 2ZZS1 5DFSA 3RLMA 3VMAA 2Y0DA 2GIWA 1CYIA 4GEDB 4XXLA 1SQQD 1QKSA 4JCGA 3ZOWA 1KYOW 3OCDA 4AAMA 2C9XB 1I8PA 3WFCC 5IY51 4IL6V 4D6TD 2RN0A 1K3HA 2YIUB 5E79V 2BH4X 3H1JD 5CIFB 1U75B 4U3FD 1FOCA 5KKZB 3L75D 3ZBMA 3SJLA 3GG2A 1CC5A 3PTZA 1BCCD 2D0SA 3SVWA 2QJYB 1S5LV 4WQ7A 3ORVA 1CIEA 2YK3A 3RMZA 1NTMD 3L70D 3PXSA 4L3GA 1OCDA 4Q5PA 1W2LA 1KYOD 1LS9A 5CIHB 1FJ0A 2DGEA 5GTIV 1CRYA 1I5TA 2BH5X 3NWVA 1CTZA 2CXBA 1BL9A 1KB9D 3PXWA 2ORLA 4DY9A 2O3JA 2LIRA 1QL3A 4FAVA 3SWSA 4FA4A 2N3YA 5CYTR 4PD4D 3PXTA 3L4OA 5TJHA 1NIRA 1NTZD 1DW1A 2OZ1A 1NNOA 1CO6A 1EB7A 1HJ3A 1AKKA 1CNOA 3OCDB 3TGUD 3BCCD 3PH2B 4Y5RA 1IRVA 1BGYD 1HROA 3KHUA 3C2CA 4EIEA 3M97X 2PCBB 3O1YA 2QG4A 1CTYA 1GQ1A 4O1QA 4J20A 5KAFV 3H1LD 3L74D 5DF5A 2PACA 1CRHA 3O0RC 351CA 2KS1A 1HJ4A 1L0ND 1CIFA 1H31A 4K3IA 1IO3A 2C8SA 1CIHA 2PCCB 1CRGA 4WQDA 5GTHV 1CHHA 4EIDA 1DVHA 2GC4D 1C75A 2ZOOA 1N15A 1HJ5A 5CIBB 2C1VA 451CA 4KMGA 5DJQB 1KX2A 2FYUD 3ZIYA 4FA9A 4EDFA 1IZL0 1COTA 1R0QA 2A06D 3OA8A 1LMSA 2OZ1B 2FWLA 3SLEA 1DIIC 3NBSA 2MHMA 1CXCA 1H32B 4EIFA 5KAIV 1YNRA 3WU2V 1CHJA 1NTKD 1S6VB 1SQPD 3CP5A 3ZOXA 2IBZD 4UB6V 1C2NA 3RN1A 3CU4A 2C1DA 1FHBA 5CICB 1CSXA 3L73D 3VNWA 5B5EV 1CRIA 3TF5A 1RAQA 4WQEA 4RSZA 1I6DA 2RMZA 4FA5A 1I6EA 5CIGB 1H9YA 1HH7A 1RZ5A 2BPBB 1KB0A 1C7MA 1DW3A 2Q3EA 1YEAA 1KX7A 2MTAC 5DJQC 4V2KA 1QN2A 2CA3B 2C2CA 1H31B 4WQAA 1GJQA 1CYJA 4WQ9A 2XTSB 3JBTB 5AURA 1E29A 2JTIB 2JWAA 2CE0A 1M70A 1FCDC 2N18B 1A56A 2B12B 5CIEB 1U74B 4UB8V 2B4ZA 1HZUA 2FYNB 4O1WA 3OA8B 4WQCA 1CRCA 1GU2A 1E8EA 2JQRA 1CEDA 1H32A 1NMLA 3HQ7A 5B66V 1IQCA 1CHIA 1B7VA 1NMIA 1IRWA 1GDVA 4L3HA 3X39A 4GYDA 1MG2D 3MK7B 3L72D 3KZIV 1I8OA 2C1DB 1C52A 1YIQA 1AOFA 4N0KA 3DR0A 4YE1A 1LC1A 1E2RA 4PWAA 4AX3A 1JDLA 1C6OA 1CCHA 1DT1A 2AI5A 1ETPA 2N18C 5C9MA 3H1HD 3H1ID 3HQ9A 1CTJA 2BGVX 1SQBD 1H9XA 4AAOA 1AOQA 1C2RA 1MZ4A 3A0BV 3L71D 1FI3A 4P4QB 1CIGA 1CRJA 1HCMA 3GW6A 4EICA 2AIUA 3A9FA 1VYDA 3ZCFA 2GB8B 1YFCA 2GC7D 4H0JA 4H0KA 4LJIA 3MK7C 1WVEC 1F1CA 2I8FA 1CSVA 2K9JB 4AALA 1M60A 1DVVA 1M6ZA 1N9CA 2HV4A 3DMIA 4AANA 3TYIA 1CSWA 1RZ6A 2B0ZB 2V07A 3WFBC 1BE3D 4QAOA 1ZZHA 4MU8A 5EXQA 1L9JC 1YEBA 1KIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L1Q A;  3PLN A;  3WFE C;  5KLI B;  1CSU A;  2CA4 B;  1SQX D;  1GKS A;  1CXA A;  1LC2 A;  1J3S A;  3PRJ A;  1I54 A;  2N3B A;  4WQ8 A;  1ZRT D;  1L9B C;  1GIW A;  2EXV A;  1NU1 D;  1AYG A;  5TIS V;  1A2S A;  2D0W A;  5C0Z A;  1L0L D;  1OAE A;  1LFM A;  1C6R A;  1EZV D;  2ZXY A;  1HZV A;  2QJP B;  1MG3 D;  4PW9 B;  2DVH A;  3ZOY A;  2Y0E A;  3L4M A;  3DP5 A;  3A0H V;  3CWB D;  4A7P A;  2BLF B;  1A8C A;  3ZOO A;  1COR A;  4NFG B;  2N9Y B;  1KV9 A;  1YTC A;  1PPJ D;  4FA1 A;  1H33 A;  2KNC B;  3VRD A;  1FI9 A;  2LIT A;  2BCN B;  155C A;  1FI7 A;  2ZBO A;  5H2F V;  4FAN A;  1N50 A;  2C1U A;  2Y0C A;  3CYT I;  3PHL A;  3CX5 W;  4WQB A;  2CE1 A;  4PJ0 V;  2VHD A;  3WC8 A;  2N9J A;  2L91 A;  4FB1 A;  2AXT V;  3ITK A;  3CXH W;  2V08 A;  2YQB A;  3HQ6 A;  1PP9 D;  2YCC A;  2N9I A;  1RAP A;  2L4D A;  3RN0 A;  5CID B;  1F1F A;  1H1O A;  2B10 B;  3HQ8 A;  3WFD C;  3O20 A;  1C6S A;  1CCR A;  1K3G A;  1DW0 A;  1YIC A;  2FRC A;  1W5C T;  3WUI A;  3H1K D;  2ZON G;  3NBT A;  1I55 A;  1YCC A;  1HRC A;  1SQV D;  1WEJ F;  3CX5 D;  1P84 D;  3TDK A;  3FWL A;  2B11 B;  1N90 A;  3CXH D;  5B6Q A;  3VYM A;  4RJT A;  3O5C A;  1QL4 A;  3SXT A;  2QJK B;  1DW2 A;  1H33 B;  1QYZ A;  4XYD B;  5KLV D;  2BCC D;  1CYC A;  1DIQ C;  2ZZS 1;  5DFS A;  3RLM A;  3VMA A;  2Y0D A;  2GIW A;  1CYI A;  4GED B;  4XXL A;  1SQQ D;  1QKS A;  4JCG A;  3ZOW A;  1KYO W;  3OCD A;  4AAM A;  2C9X B;  1I8P A;  3WFC C;  5IY5 1;  4IL6 V;  4D6T D;  2RN0 A;  1K3H A;  2YIU B;  5E79 V;  2BH4 X;  3H1J D;  5CIF B;  1U75 B;  4U3F D;  1FOC A;  5KKZ B;  3L75 D;  3ZBM A;  3SJL A;  3GG2 A;  1CC5 A;  3PTZ A;  1BCC D;  2D0S A;  3SVW A;  2QJY B;  1S5L V;  4WQ7 A;  3ORV A;  1CIE A;  2YK3 A;  3RMZ A;  1NTM D;  3L70 D;  3PXS A;  4L3G A;  1OCD A;  4Q5P A;  1W2L A;  1KYO D;  1LS9 A;  5CIH B;  1FJ0 A;  2DGE A;  5GTI V;  1CRY A;  1I5T A;  2BH5 X;  3NWV A;  1CTZ A;  2CXB A;  1BL9 A;  1KB9 D;  3PXW A;  2ORL A;  4DY9 A;  2O3J A;  2LIR A;  1QL3 A;  4FAV A;  3SWS A;  4FA4 A;  2N3Y A;  5CYT R;  4PD4 D;  3PXT A;  3L4O A;  5TJH A;  1NIR A;  1NTZ D;  1DW1 A;  2OZ1 A;  1NNO A;  1CO6 A;  1EB7 A;  1HJ3 A;  1AKK A;  1CNO A;  3OCD B;  3TGU D;  3BCC D;  3PH2 B;  4Y5R A;  1IRV A;  1BGY D;  1HRO A;  3KHU A;  3C2C A;  4EIE A;  3M97 X;  2PCB B;  3O1Y A;  2QG4 A;  1CTY A;  1GQ1 A;  4O1Q A;  4J20 A;  5KAF V;  3H1L D;  3L74 D;  5DF5 A;  2PAC A;  1CRH A;  3O0R C;  351C A;  2KS1 A;  1HJ4 A;  1L0N D;  1CIF A;  1H31 A;  4K3I A;  1IO3 A;  2C8S A;  1CIH A;  2PCC B;  1CRG A;  4WQD A;  5GTH V;  1CHH A;  4EID A;  1DVH A;  2GC4 D;  1C75 A;  2ZOO A;  1N15 A;  1HJ5 A;  5CIB B;  2C1V A;  451C A;  4KMG A;  5DJQ B;  1KX2 A;  2FYU D;  3ZIY A;  4FA9 A;  4EDF A;  1IZL 0;  1COT A;  1R0Q A;  2A06 D;  3OA8 A;  1LMS A;  2OZ1 B;  2FWL A;  3SLE A;  1DII C;  3NBS A;  2MHM A;  1CXC A;  1H32 B;  4EIF A;  5KAI V;  1YNR A;  3WU2 V;  1CHJ A;  1NTK D;  1S6V B;  1SQP D;  3CP5 A;  3ZOX A;  2IBZ D;  4UB6 V;  1C2N A;  3RN1 A;  3CU4 A;  2C1D A;  1FHB A;  5CIC B;  1CSX A;  3L73 D;  3VNW A;  5B5E V;  1CRI A;  3TF5 A;  1RAQ A;  4WQE A;  4RSZ A;  1I6D A;  2RMZ A;  4FA5 A;  1I6E A;  5CIG B;  1H9Y A;  1HH7 A;  1RZ5 A;  2BPB B;  1KB0 A;  1C7M A;  1DW3 A;  2Q3E A;  1YEA A;  1KX7 A;  2MTA C;  5DJQ C;  4V2K A;  1QN2 A;  2CA3 B;  2C2C A;  1H31 B;  4WQA A;  1GJQ A;  1CYJ A;  4WQ9 A;  2XTS B;  3JBT B;  5AUR A;  1E29 A;  2JTI B;  2JWA A;  2CE0 A;  1M70 A;  1FCD C;  2N18 B;  1A56 A;  2B12 B;  5CIE B;  1U74 B;  4UB8 V;  2B4Z A;  1HZU A;  2FYN B;  4O1W A;  3OA8 B;  4WQC A;  1CRC A;  1GU2 A;  1E8E A;  2JQR A;  1CED A;  1H32 A;  1NML A;  3HQ7 A;  5B66 V;  1IQC A;  1CHI A;  1B7V A;  1NMI A;  1IRW A;  1GDV A;  4L3H A;  3X39 A;  4GYD A;  1MG2 D;  3MK7 B;  3L72 D;  3KZI V;  1I8O A;  2C1D B;  1C52 A;  1YIQ A;  1AOF A;  4N0K A;  3DR0 A;  4YE1 A;  1LC1 A;  1E2R A;  4PWA A;  4AX3 A;  1JDL A;  1C6O A;  1CCH A;  1DT1 A;  2AI5 A;  1ETP A;  2N18 C;  5C9M A;  3H1H D;  3H1I D;  3HQ9 A;  1CTJ A;  2BGV X;  1SQB D;  1H9X A;  4AAO A;  1AOQ A;  1C2R A;  1MZ4 A;  3A0B V;  3L71 D;  1FI3 A;  4P4Q B;  1CIG A;  1CRJ A;  1HCM A;  3GW6 A;  4EIC A;  2AIU A;  3A9F A;  1VYD A;  3ZCF A;  2GB8 B;  1YFC A;  2GC7 D;  4H0J A;  4H0K A;  4LJI A;  3MK7 C;  1WVE C;  1F1C A;  2I8F A;  1CSV A;  2K9J B;  4AAL A;  1M60 A;  1DVV A;  1M6Z A;  1N9C A;  2HV4 A;  3DMI A;  4AAN A;  3TYI A;  1CSW A;  1RZ6 A;  2B0Z B;  2V07 A;  3WFB C;  1BE3 D;  4QAO A;  1ZZH A;  4MU8 A;  5EXQ A;  1L9J C;  1YEB A;  1KIB A; 
#chains in the Genus database with same CATH topology
 2QM7 A;  1NJI Q;  3WFE C;  2JP3 A;  4ASV A;  4GOD A;  1VQP P;  3GMA A;  2YO3 A;  4RO0 A;  1J3S A;  3PRJ A;  2N3B A;  1VF5 B;  1ZRT D;  1KN7 A;  3LID A;  1YIJ P;  1YJ9 P;  1SLQ A;  2EXV A;  1NU1 D;  1ZW0 A;  1ZV8 A;  3HRN A;  3A5T A;  4PJ0 E;  1QX8 A;  5L8R J;  1C6R A;  1EZV D;  3VN0 A;  4PW9 B;  3ZOY A;  1BGY G;  2AEF A;  3V5B A;  3DP5 A;  1UII A;  2E76 B;  2QA4 P;  3A0H V;  2BLF B;  1A8C A;  2N9Y B;  1N8R Q;  1JEK A;  1KV9 A;  1YTC A;  1MFZ A;  1PPJ D;  3B71 A;  1HGZ A;  2E74 C;  4CPG A;  2KNC B;  155C A;  1FI7 A;  1FDI A;  4DOJ A;  1QVG O;  3H1L G;  1N50 A;  2Y0C A;  3PHL A;  1VF5 C;  3EQ2 A;  3WC8 A;  4XE5 B;  4FB1 A;  5KKZ C;  3ITK A;  1M8O B;  2V08 A;  2YCC A;  1EZV I;  2N9I A;  2QM8 A;  1FZE A;  1F1F A;  3O6Q A;  1NKZ B;  2E76 C;  3WFD C;  1C6S A;  1CCR A;  2YMK A;  3S4R A;  1K3G A;  1IJD B;  1H0T B;  1KIL D;  1JY2 N;  1VQ9 P;  4WB4 A;  1URQ A;  4TT3 H;  3H1K D;  1SQX K;  3C8V A;  3AE1 C;  3HTK A;  1X79 B;  1RY3 A;  1BE3 E;  1P84 D;  1M7L A;  1NTK G;  2GUV A;  1SQP G;  3L71 J;  2FY8 A;  1VQ6 P;  4L75 A;  2YXR B;  2I1K A;  1L4A D;  3VMX A;  1SQV J;  1FOS E;  3L75 G;  4WY4 B;  4RJT A;  3D6Z A;  2WSC J;  2QJK B;  4PD4 H;  1FDM A;  3MUD A;  3H1J E;  3RLM A;  1HBW A;  3VMA A;  1RE4 C;  2W6J H;  2GIW A;  1CYI A;  2BCC J;  2POH A;  1SQQ D;  3OCD A;  3C9I A;  1YIT P;  1GZL A;  1J2J B;  3K5B A;  2YMY A;  2HOD A;  3AEA C;  1KOR A;  3SFE C;  3E1I A;  5E79 V;  1PIX A;  3CWB E;  5CCG D;  1JM0 A;  1S3J A;  4ASW A;  2MJZ A;  3HD7 B;  1HH0 A;  3CX5 H;  4U3F D;  1M56 D;  1FOC A;  3Q1M A;  4W7Z A;  2WSC H;  4WY4 C;  2QJK C;  1EDK A;  2QJY B;  3CCE P;  1CIE A;  3RMZ A;  2GM4 A;  2B88 A;  4PD4 E;  1XTG B;  3L36 A;  2J58 A;  2PAJ A;  1ZR2 A;  1LS9 A;  1R5S A;  1LJ2 A;  2KS1 B;  1FAV A;  3JSV C;  1PP9 E;  2PP6 A;  1I5T A;  3L70 J;  4WBA A;  1HVV A;  2HLO A;  2CXB A;  3G4S P;  5CJ4 A;  5KJ7 C;  2LIR A;  4PV1 D;  2HPC B;  4UB6 H;  3D0W A;  1QL3 A;  1IZN B;  4FA4 A;  3H1I G;  2N3Y A;  5CYT R;  5TJH A;  1FZC A;  1EDJ A;  2Q3I A;  1K8A Q;  4GT1 A;  4W7Y A;  3CLQ A;  4H44 C;  1K05 A;  3WUT A;  1SQV E;  1NHL A;  3CX5 E;  1KIL A;  3RL0 D;  1IRV A;  1BGY D;  3D71 A;  5KJ7 D;  3BCC J;  1IC2 A;  2PCB B;  5EFW B;  1IFI A;  5AW6 B;  1KYO H;  4J20 A;  1U7M A;  2NRG A;  4H44 D;  1S72 P;  3H1L D;  1NH4 A;  3HE5 B;  2E75 C;  5APW A;  4UB8 H;  351C A;  2J5U A;  4JYB A;  1CIF A;  2V7Q J;  1CIH A;  2PCC B;  4UB6 E;  1N7S D;  1DVH A;  2GC4 D;  2K9Y A;  4I2L C;  5AVT B;  2ZOO A;  1KD1 Q;  4XFJ A;  3HUS B;  1J1D B;  4KMG A;  1IO4 A;  5DJQ B;  1EQ7 A;  3WMM 0;  2E75 D;  3ZIY A;  3V2P A;  3BVH A;  1ZME C;  4FA9 A;  4EDF A;  1COT A;  1UIX A;  4H13 B;  1FJK A;  3SLE A;  3GHG A;  2G8Y A;  1L0L G;  2W6A A;  5CCG A;  2P58 A;  3B5N B;  4C7R A;  5KAI V;  3LW5 H;  1OFC X;  3WU2 V;  4GOF A;  1W2E A;  5CMZ A;  1NTK D;  1SQP D;  3TNU B;  1KYO E;  1FZF A;  3CP5 A;  4D6T J;  1FHB A;  3A0B H;  3G3Z A;  4IFD K;  1CRI A;  4UB8 E;  4EIJ A;  2N1T B;  1H88 A;  1CZQ A;  1JO5 A;  1JMM A;  2RMZ A;  1I6E A;  1R5L A;  5CIG B;  1HF9 A;  2WSF J;  1HH7 A;  2BPB B;  3KXD A;  1YEA A;  1ZOY C;  3CCJ P;  2QE7 H;  5DJQ C;  4V2K A;  1QN2 A;  3L72 G;  3VMZ A;  2C2C A;  1KV4 A;  2WPQ A;  3BCC E;  4WQ9 A;  1SQV K;  1M90 Q;  3V4Q A;  1E29 A;  2WZ7 A;  3B5N C;  4ZMD A;  1FS0 E;  1SS1 A;  3O8Z A;  2H8P D;  1SFC D;  2WIT A;  5CIE B;  2B4Z A;  4YTP C;  4C7N B;  2W90 A;  1FZA A;  2K9J A;  4WQC A;  1OMI A;  1GK6 A;  1RH5 B;  2Q6Q A;  5E79 H;  1Y9B A;  2N1T C;  3GF7 A;  2KIK A;  1NML A;  5B66 V;  3H1H E;  1N73 C;  1IQC A;  3A0B E;  1GDV A;  4L3H A;  1SQB E;  1NOH A;  4DCK A;  2QIW A;  1L0N E;  1X0T A;  3KZI V;  2O01 N;  5TIS H;  1I8O A;  3IF4 A;  1C52 A;  1TU3 F;  1YIQ A;  1AOF A;  1GL2 C;  3DR0 A;  1LTS C;  5KLV G;  1NWQ A;  1E79 H;  3QWO C;  1VL2 A;  4DZO A;  3H1I D;  1CTJ A;  2BGV X;  4AAO A;  1N7S A;  2M3E A;  4HB1 A;  1T3J A;  2IDB A;  1C2R A;  1MZ4 A;  5H2F H;  3L71 D;  1FI3 A;  3UIA A;  1RF1 B;  3SWF A;  3VTP C;  1CRJ A;  1GL2 D;  3EFG A;  4EIC A;  3SSU A;  1JTH A;  5CHX A;  3RK2 D;  2IBZ E;  1DEE G;  5AVQ B;  2JKV A;  2AXT H;  4H0J A;  5E79 E;  1WMK A;  4LJI A;  1NU1 G;  4AAL A;  3Q5P A;  1M6Z A;  2HV4 A;  1EZV G;  1N86 A;  2B0Z B;  2B87 B;  2OTL P;  2V07 A;  5TIS E;  1NTM G;  5K5G B;  1ZZH A;  5EXQ A;  1L9J C;  1VQM P;  1Q90 D;  3M0A A;  1PPJ G;  2B9B A;  1JCC A;  4ZNC A;  4IFM A;  5KLI B;  2CA4 B;  2KK7 A;  2ZT9 B;  3M06 A;  1CXA A;  3O6Q B;  1I54 A;  4TLF A;  5H2F E;  1SQX J;  2IFN A;  1PZQ A;  1NTZ G;  1P84 H;  1GIW A;  4NPE A;  2Y9Z A;  4Y99 B;  1AYG A;  1LWU A;  1A2S A;  3VP8 A;  2D0W A;  3TGU G;  1LP1 A;  1L0L D;  1SFC A;  1M57 D;  2AXT E;  2QJP B;  2DVH A;  2NZ2 A;  2KI7 B;  1SQB K;  1N2D C;  4JF7 A;  4OGQ D;  1L0N K;  3L35 A;  3CC2 P;  4BWN A;  2FKW B;  4AYC A;  1H33 A;  2OGU A;  2V4H A;  3VRD A;  2FFD B;  2LIT A;  1IFM A;  5AVS B;  2ZBO A;  5KAI H;  1GU5 A;  1IFP A;  2YIU C;  5DJU B;  3L74 G;  4FAN A;  2KB7 P;  4O9B A;  4BRY B;  3CX5 W;  2ZYA A;  2JDI H;  2L91 A;  1GW4 A;  1URQ C;  2CPS A;  4Y99 C;  2BAS A;  1S5L H;  1VPC A;  1RAP A;  2L4D A;  5CID B;  2YO2 A;  1P84 E;  2WWW A;  1HUC A;  4LGD E;  1FZG A;  2MKV A;  5AVY B;  3HQ8 A;  2WQY C;  2CPB A;  5GTI H;  1DW0 A;  2FYU G;  3WUI A;  1KTM A;  3MIW A;  2P67 A;  3Q3D A;  2JR8 A;  2FFD C;  3G71 P;  2R32 A;  3MUD C;  2K1A A;  3AEE C;  4L74 A;  3TDK A;  3AE9 C;  3FWL A;  2B11 B;  2NPS A;  3FX0 A;  5KAI E;  5B6Q A;  2M0B A;  5AW7 B;  3VYM A;  2PRR A;  4JYC A;  3L73 G;  1IK7 A;  5APU A;  1DW2 A;  5KLV D;  2FYZ A;  3CI9 A;  1CYC A;  1DIQ C;  2ZZS 1;  1XTC C;  2OYI A;  3ABV C;  5C39 A;  4EOT A;  3E7K A;  5APY A;  2BEQ D;  1LTI C;  2O1J A;  1OW7 A;  3V4W A;  5KTB A;  1S5L E;  3AEB C;  3KZI H;  5AVX B;  1MZ9 A;  5APQ A;  4WWI A;  3ZOW A;  1KYO W;  1BE3 J;  5KAF H;  4AAM A;  3HE4 A;  3GLM A;  1CI6 B;  4D6T D;  4IL6 V;  5GTI E;  1CSB A;  1KIL B;  5AVZ B;  2E5T A;  3A7O A;  5KKZ B;  3ZBM A;  3H1J J;  3CXH H;  5AW5 B;  1AVO A;  2KXP B;  1RE3 A;  3PTZ A;  2KYV A;  2D0S A;  3SVW A;  3H32 B;  5APX A;  1L4A B;  4KHX A;  3ORV A;  2ZAE B;  1NTM D;  2P7J A;  1BCC J;  3P8M C;  1OCD A;  1NYH A;  4Q5P A;  1W2L A;  4N78 E;  1FZC C;  2DGE A;  3VYI A;  3CWB J;  2BH5 X;  1CTZ A;  3KZI E;  3KQG A;  1KB9 D;  3PXW A;  2KLV A;  2XZR A;  1BGY E;  1KIL C;  3B8E B;  5KAF E;  2WT7 A;  3PXT A;  3L4O A;  3N7N A;  1HTL C;  5B5E H;  1NTZ D;  1NNO A;  1EB7 A;  1HJ3 A;  3P7K A;  1CNO A;  1T3U A;  3GHG B;  3TGU D;  1LT9 A;  3H1L E;  4Y5R A;  1L4A C;  1YHQ P;  1HRO A;  3KHU A;  1PP9 J;  1QLE D;  3M97 X;  2R5D A;  3CXH E;  2KUB A;  1EXJ A;  2QG4 A;  3RGU A;  1Q86 Q;  1KB9 I;  2OTJ P;  3CL3 D;  5CBN A;  2AXC A;  1ZN5 A;  3CME P;  2O1K A;  3PH0 A;  3L74 D;  5DF5 A;  2PAC A;  1CRH A;  2Q7C A;  2M5A B;  3NMD A;  1N7L A;  1QL1 A;  1M1J A;  3TSI A;  2D2C D;  3MD0 A;  4NPD A;  5GTH V;  4PV1 B;  3GHG C;  4OVN F;  4EID A;  5CCG C;  1OW6 A;  2Z5I A;  5AW1 B;  5B5E E;  5APT A;  2K3R A;  5AVV B;  1JMB A;  3SWK A;  5CIB B;  1JNM A;  1FOS F;  3L75 E;  2FYU D;  3AE7 C;  1IZL 0;  1R0Q A;  3OA8 A;  1LMS A;  2OZ1 B;  1BCC E;  3RL0 B;  1DII C;  2MHM A;  3CCQ P;  1CHJ A;  2AEJ A;  1S6V B;  3VOP A;  3ZOX A;  3N4X A;  3M0D A;  3RN1 A;  2WPS A;  2C1D A;  1CSX A;  4H44 B;  3L73 D;  3VNW A;  4Z1M H;  2Q1K A;  4U7J A;  2CK3 H;  1RF0 A;  3TF5 A;  4PV1 C;  2E42 A;  1I6D A;  4FA5 A;  3ZDM A;  1PL5 A;  1KB0 A;  1M1K Q;  1C7M A;  1DW3 A;  2Q3E A;  2MTA C;  3T97 B;  1G2C A;  1N7S B;  3M9Q A;  1YTZ I;  3KPE A;  1H31 B;  1YI2 P;  1GJQ A;  3RL0 C;  1LNQ A;  2XTS B;  3IAO A;  3BRT B;  4XA4 A;  2YNY A;  2JWA A;  1MKM A;  2E75 B;  1FCD C;  2N18 B;  1A56 A;  4B86 A;  2AEM A;  1HZU A;  1KQG B;  2FYN B;  1SP4 A;  1LTT C;  1YJN P;  2IX7 C;  1CRC A;  3L71 G;  1E8E A;  2IYP A;  1CED A;  5AVU B;  1R8E A;  1SQV G;  1H32 A;  3RBX A;  1JY3 O;  1IRW A;  3V2N A;  2M8R A;  3BAS A;  1N7S C;  2JJL A;  1JY2 O;  4N0K A;  1BSN A;  1SVF A;  1LC1 A;  1E2R A;  1NGM B;  1VQ4 P;  2IFM A;  3II6 A;  2BCC G;  5M1B A;  4ZKP A;  4RKU J;  2W27 A;  1CCH A;  1KFN A;  1DT1 A;  3VP9 A;  3A0H H;  2N18 C;  2R5B A;  3LW5 J;  3NTN A;  3I56 P;  4L76 A;  1VQN P;  1H9X A;  2FYN C;  2A45 H;  3HD7 D;  3H1H J;  1LWU B;  1LP1 B;  1USD A;  3M91 A;  1SFC B;  1SQB J;  3GW6 A;  2JEE A;  1L0N J;  4LLH A;  1USE A;  1VQO P;  1YFC A;  2WPR A;  3A2A A;  2RKL A;  4N3Y B;  1WVE C;  2KSJ A;  4GOE A;  3V6I A;  1CSV A;  2KNC A;  1M60 A;  5AW2 B;  3DMI A;  1K04 A;  1CSW A;  3V2Q A;  4JPZ B;  1NAY A;  1BE3 D;  1Q7Y Q;  1KMI Z;  1DIP A;  3L70 G;  3U1A A;  3A0H E;  1L0L E;  1CSU A;  1LWU C;  5BU8 B;  1SFC C;  3IFM A;  1WRG A;  3CC7 P;  2R3S A;  1N73 B;  4WQ8 A;  2B89 A;  1G1J A;  3S9O A;  3MP7 B;  3AED C;  1GL2 B;  4HH2 A;  2Z4E A;  3BCC G;  2KZI A;  1LFM A;  4AQR D;  1T2K C;  2Y0E A;  3L4M A;  3CWB D;  3ZOO A;  1COR A;  1OVV A;  4NFG B;  3L72 E;  2H88 C;  3FXE A;  1AVY A;  1DX7 A;  2I8D A;  2BCN B;  2KZJ A;  3A3Y B;  4N6J A;  1T2K D;  2C1U A;  1A02 J;  2XND H;  1JB0 J;  1PGQ A;  1W5C E;  4PJ0 V;  1X9V A;  2N9J A;  1YYC A;  3CXH W;  2WSS H;  2YQB A;  1JY3 P;  3GF3 A;  3HQ6 A;  1PP9 D;  1T8Z A;  3RK2 C;  4R4L A;  3R2P A;  2WMM A;  1X8Y A;  1W2B O;  1H1O A;  3O20 A;  1JY2 P;  3HD7 A;  1S9K E;  3CMA P;  2OTK E;  1W5C T;  2NPS C;  2ZYD A;  2A06 G;  5KLV E;  3SFD C;  2ZON G;  3NBT A;  1I55 A;  1YCC A;  4OH8 B;  4DJG A;  1HRC A;  4D6T G;  1SQV D;  1WEJ F;  2OYH A;  3CX5 D;  3P8C D;  2P10 A;  1LTG C;  3H1K J;  1KB9 H;  4EYY Q;  1N90 A;  2IBZ G;  3SWY A;  2I1J A;  3TYY A;  3O5C A;  3L4F A;  1L0L K;  4K35 A;  2QSI A;  1RHZ B;  2NPS D;  2BCC D;  1ZLL A;  5DFS A;  1AQ5 A;  3I5C A;  3W68 A;  1ZRT E;  4GED B;  4ZKU A;  3AE4 C;  2WT7 B;  1NU1 E;  1FC2 C;  2Q5U A;  3F89 A;  1S5L X;  2C9X B;  1MUU A;  1EZV E;  3NXS A;  1OZH A;  1RE3 C;  1I8P A;  3WFC C;  2RN0 A;  2XDJ A;  3CX5 I;  1FZB A;  1SQQ J;  2YIU B;  3FWN A;  4OGQ C;  1QGK B;  2BH4 X;  5CIF B;  3CCU P;  1U75 B;  1LGH B;  1PPJ E;  2ITA A;  1LT1 A;  1URQ B;  3SJL A;  2YKQ A;  1X22 A;  1CC5 A;  1OIP A;  1BDD A;  4OWF A;  4U3F J;  3HTK B;  2ZXX A;  4WQ7 A;  3L37 A;  5AVR B;  2YK3 A;  4HKZ H;  1NVO A;  3L70 D;  4L3G A;  1NTZ E;  1KYO D;  3RK3 C;  1FJ0 A;  1M1J B;  1CRY A;  4M3L A;  3TGU E;  1KC8 Q;  3AEF C;  1VQ5 P;  1BL9 A;  3WU2 H;  2ORL A;  4DY9 A;  1QL2 A;  2O3J A;  3HUS A;  5AVW B;  2C9L Y;  4FAV A;  1KIL E;  1NIR A;  1KFM A;  1AA0 A;  1DW1 A;  3H1K E;  3H6P A;  4H0L D;  1OXZ A;  1AKK A;  5KLV K;  3AEC C;  3RK3 D;  3OCD B;  3OW2 O;  3BCC D;  4RES B;  2JWD A;  2R44 A;  3WUV A;  3L74 E;  2HOD B;  2LXB A;  5AW9 B;  1KYO I;  1PGO A;  3F5H A;  1KQL A;  1H89 A;  1L2P A;  1M1J C;  1GQ1 A;  1BGY J;  4O1Q A;  2IZ1 A;  3JC2 2;  1RQV A;  4QMA A;  1Y8A A;  1GW3 A;  4KJM A;  1FJP A;  3O0R C;  1Y47 A;  2FYU E;  3U59 A;  1SQQ E;  2GA1 A;  1NU1 K;  1PV3 A;  3H1L J;  3WU2 E;  1L0N D;  4K3I A;  1IO3 A;  2C8S A;  1GMJ A;  2Q9I A;  3CCS P;  2OYO A;  1CHH A;  5B66 H;  1SQX G;  1C75 A;  1Q2N A;  1HJ5 A;  4GKG A;  5BVZ A;  3V2R A;  4U3F E;  1S2E A;  2IZ0 A;  4C7N A;  3M0D C;  4R4M A;  1FZC B;  3L73 E;  2A06 D;  5CCH D;  2FWL A;  1IFJ A;  2C0X A;  3NBS A;  1RF0 C;  4HJG H;  1CXC A;  2ZVO B;  1H32 B;  2W8Z A;  1YNR A;  1LTJ A;  3IN6 A;  2IBZ D;  4UB6 V;  1C2N A;  1NTZ K;  2GUS A;  2LR2 A;  1EDL A;  2FXP A;  1NTK J;  1SQP J;  1RAQ A;  1DD3 A;  4RSZ A;  2M3B A;  3L75 J;  1H9Y A;  1GDT A;  2D2C B;  2FBW C;  4Y28 J;  1LTB C;  1KX7 A;  2RH0 A;  5B66 E;  1DH3 A;  1J1E B;  3AE6 C;  2C9N Y;  1CYJ A;  1RF1 A;  2WSE H;  3JBT B;  5AUR A;  1FDO A;  1S4X A;  2CE0 A;  1M70 A;  2LXC B;  4HYT B;  2IBZ I;  4UB8 V;  4O1W A;  1BSH A;  1GU2 A;  4YXD C;  2ZXE B;  2JQR A;  1K73 Q;  2B87 A;  3OJA B;  2KLU A;  2FXO A;  1CHI A;  1NMI A;  2D2C C;  1GD2 E;  2FYU K;  1SQQ K;  2XV5 A;  1MG2 D;  1J1E C;  1OWA A;  3AE5 C;  4K3A A;  4YE1 A;  1HGV A;  4PWA A;  3M9H A;  1JY3 N;  1NO4 A;  2HR3 A;  3I55 P;  2E74 D;  1JUN A;  1ETP A;  1BE3 G;  3CPW O;  3HQ9 A;  1AOQ A;  1QEX A;  3Q5R A;  1VF5 D;  3USS A;  3A0B V;  3H1I J;  2KSE A;  1CIG A;  1HCM A;  2AIU A;  3MTU E;  1U57 A;  1NTK E;  1SQP E;  3A9F A;  3H1J G;  4I7Z B;  2W6B A;  2GB8 B;  5CCH A;  2GC7 D;  3CCM P;  1FE6 A;  3LIE A;  2E76 D;  5APS A;  1F1C A;  2I8F A;  4W80 A;  2K9J B;  4IL6 X;  2FFD A;  1GU4 A;  1VQK P;  1DVV A;  1BCC G;  4AAN A;  4YPC A;  2J59 M;  3CWB G;  4BRY A;  4BXL A;  1YEB A;  2XNX A;  4AUW A;  4L1Q A;  4KT0 J;  3PLN A;  5CBO A;  4EI2 A;  1SQX D;  1GKS A;  1P84 I;  3B4S A;  3IR9 A;  1LC2 A;  3E1R A;  1CW5 A;  4I7Z C;  1L9B C;  2YKO A;  1BDC A;  2HFE D;  3FGA D;  3KDP B;  5TIS V;  1PP9 G;  2H43 A;  5C0Z A;  1OAE A;  1QVF O;  2ZXY A;  1HZV A;  3D70 A;  1MG3 D;  2K37 A;  2OYH B;  1JTH B;  1PGJ A;  3AE2 C;  2Y9Y A;  1L0L J;  4A7P A;  1JOC A;  4YXW H;  2QEX P;  4LC1 A;  2PGD A;  3M9B A;  4FA1 A;  4IL6 H;  1FI9 A;  1JCD A;  4WY4 D;  5H2F V;  3OA7 A;  2H89 C;  1HJB A;  3H1I E;  3CYT I;  1G1I A;  5AW8 B;  3HD7 C;  4WQB A;  2CE1 A;  1AQT A;  2VHD A;  5APV A;  1HWT C;  1GK4 A;  4N78 D;  2AXT V;  1WT6 A;  3L71 E;  2WTY A;  1CI6 A;  1PFI A;  2QJY C;  3RN0 A;  3L72 J;  3P8C E;  3WUU A;  2R3C A;  1NTK K;  1SQP K;  3CCR P;  2OYH C;  2B10 B;  2WPV B;  3AE8 C;  1YIC A;  1EC5 A;  2FRC A;  3R4Y A;  2BCC E;  3CCL P;  3D6Y A;  3H32 A;  2K88 A;  1L4A A;  2LKM A;  2E5Y A;  1D7M A;  4IL6 E;  3CXH D;  2E43 A;  2C0W A;  2QRX A;  1QL4 A;  3SXT A;  1EDI A;  1H33 B;  1QYZ A;  4XYD B;  3PJS K;  1NKN A;  1Z56 A;  2Y0D A;  5KLV J;  4XXL A;  1S1C X;  1ZR4 A;  1QKS A;  4JCG A;  4WVZ A;  3CCV P;  1YBK A;  1FU1 A;  5IY5 1;  1GTW A;  1K3H A;  2IYO A;  1RE4 A;  3L70 E;  2BEZ F;  3H1J D;  4I1L A;  3CXH I;  4IFF A;  2A45 G;  1H0T A;  1AV1 A;  3H25 A;  2V7Q H;  1RQU A;  3U1C A;  3L75 D;  5GTH H;  2ZFC A;  3GG2 A;  3JCU H;  4MN4 C;  2G3A A;  3RK2 B;  1BCC D;  1S5L V;  1HJ0 A;  3EWK A;  2L5G B;  3S1K A;  1NU1 J;  2M5A A;  3HUS C;  1J1D C;  3PXS A;  3P32 A;  3TK1 A;  2FXM A;  2NPS B;  5CIH B;  4WY4 A;  5GTI V;  1H8A A;  4H13 C;  3RK3 E;  4C46 A;  1OX3 A;  2UWJ E;  1MV8 A;  1NTM J;  3NWV A;  5DJT B;  2OYI B;  2W83 C;  1Q82 Q;  5AW3 B;  3H1H G;  3SWS A;  3W67 A;  1AJY A;  4PD4 D;  1SQB G;  2OZ1 A;  1L0N G;  1CO6 A;  2SPZ A;  1NAF A;  3HE4 B;  1OVU A;  3PH2 B;  4H13 D;  5KJ7 A;  2WSF H;  1NTZ J;  1OVR A;  2ZVN B;  5GTH E;  1LTJ B;  3C2C A;  4EIE A;  3B5N D;  3TGU J;  3JCU E;  1VDF A;  1IFD A;  3O1Y A;  2OQQ A;  1CTY A;  1PGP A;  3EFF K;  4I6M C;  1E5W A;  1K9M Q;  2HYN A;  5KAF V;  4OGQ B;  2OYI C;  2P1J A;  3NFQ A;  4PD4 I;  2N1T D;  3AEG C;  2N9B A;  1FBM A;  1YQ4 C;  3T97 A;  2KS1 A;  2A06 E;  1HJ4 A;  4GDO A;  1H31 A;  3L74 J;  1VQ8 P;  5BU5 A;  1CRG A;  4WQD A;  4D6T E;  1DD4 A;  2HPC A;  4DT0 A;  1N15 A;  4L73 A;  1LTJ C;  3MZW B;  3VMY A;  2KOG A;  1VQL P;  5AW4 B;  4H0L B;  2C1V A;  451C A;  3RK3 B;  1KX2 A;  1EXI A;  3AE3 C;  3MHV A;  2XU6 A;  1DEB A;  1LT9 B;  2FYU J;  2H7H A;  4EIF A;  1NTM E;  3G9R A;  2QVA A;  4IOI H;  1KZU B;  5CJ0 A;  2KP8 A;  2XKM A;  2WVR A;  3CU4 A;  1Q81 Q;  5CIC B;  1YQ3 C;  5B5E V;  3CD6 P;  1KB9 E;  3BRV B;  4WQE A;  1RF1 C;  3HE5 A;  3L73 J;  1RZ5 A;  3Q5S A;  1VQ7 P;  4JQ0 D;  4H0L C;  2ZJS E;  2HG5 D;  1A02 F;  2CA3 B;  3Q2Y A;  2YKP A;  4WQA A;  1ZXG A;  3MGN A;  3PP5 A;  2JTI B;  1LT9 C;  3RL0 g;  2B12 B;  2PFX A;  3CC4 P;  2ZYG A;  1U74 B;  3OA8 B;  3H1K G;  3G6E P;  1IFN A;  5KLI C;  3B5N A;  2P2U A;  2ZT9 C;  1MFT A;  3HQ7 A;  1B7V A;  3TNU A;  3FXD A;  3BAT A;  3X39 A;  4GYD A;  4JBZ A;  3MK7 B;  3L72 D;  2C1D B;  3RBZ A;  4AX3 A;  2N1T A;  2O01 J;  1JDL A;  1C6O A;  1N73 A;  2QJP C;  2AI5 A;  2A45 I;  5C9M A;  1ZP0 C;  3H1H D;  2ZT9 D;  1KQS O;  5CCH C;  1SQB D;  1AFO A;  1G2C B;  1SQQ G;  1GL2 A;  1YJW P;  2JO1 A;  4NPF X;  1IK9 A;  2IPP A;  2OAR A;  2Z5H A;  4P4Q B;  1URQ D;  1NTM K;  2DW3 A;  1OW8 A;  3QH9 A;  1VYD A;  4PJ0 H;  1LTA C;  3ZCF A;  1U7J A;  4H0K A;  1S9K D;  4GIF A;  4U3F G;  3KYQ A;  3MK7 C;  1T6A A;  1KQF B;  2O01 H;  1YTZ T;  1N9C A;  1SQX E;  5AW0 B;  3TYI A;  1RZ6 A;  2WSE J;  3OAK A;  3WFB C;  2VRS A;  4QAO A;  3C1L A;  2YXQ B;  4MU8 A;  1KIB A;  2E74 B; 
#chains in the Genus database with same CATH homology
 4L1Q A;  3PLN A;  3WFE C;  5KLI B;  1CSU A;  2CA4 B;  1SQX D;  1GKS A;  1CXA A;  1LC2 A;  1J3S A;  3PRJ A;  1I54 A;  2N3B A;  4WQ8 A;  1ZRT D;  1L9B C;  1GIW A;  2EXV A;  1NU1 D;  1AYG A;  5TIS V;  1A2S A;  2D0W A;  5C0Z A;  1L0L D;  1OAE A;  1LFM A;  1C6R A;  1EZV D;  2ZXY A;  1HZV A;  2QJP B;  1MG3 D;  4PW9 B;  2DVH A;  3ZOY A;  2Y0E A;  3L4M A;  3DP5 A;  3A0H V;  3CWB D;  4A7P A;  2BLF B;  1A8C A;  3ZOO A;  1COR A;  4NFG B;  2N9Y B;  1KV9 A;  1YTC A;  1PPJ D;  4FA1 A;  1H33 A;  2KNC B;  3VRD A;  1FI9 A;  2LIT A;  2BCN B;  155C A;  1FI7 A;  2ZBO A;  5H2F V;  4FAN A;  1N50 A;  2C1U A;  2Y0C A;  3CYT I;  3PHL A;  3CX5 W;  4WQB A;  2CE1 A;  4PJ0 V;  2VHD A;  3WC8 A;  2N9J A;  2L91 A;  4FB1 A;  2AXT V;  3ITK A;  3CXH W;  2V08 A;  2YQB A;  3HQ6 A;  1PP9 D;  2YCC A;  2N9I A;  1RAP A;  2L4D A;  3RN0 A;  5CID B;  1F1F A;  1H1O A;  2B10 B;  3HQ8 A;  3WFD C;  3O20 A;  1C6S A;  1CCR A;  1K3G A;  1DW0 A;  1YIC A;  2FRC A;  1W5C T;  3WUI A;  3H1K D;  2ZON G;  3NBT A;  1I55 A;  1YCC A;  1HRC A;  1SQV D;  1WEJ F;  3CX5 D;  1P84 D;  3TDK A;  3FWL A;  2B11 B;  1N90 A;  3CXH D;  5B6Q A;  3VYM A;  4RJT A;  3O5C A;  1QL4 A;  3SXT A;  2QJK B;  1DW2 A;  1H33 B;  1QYZ A;  4XYD B;  5KLV D;  2BCC D;  1CYC A;  1DIQ C;  2ZZS 1;  5DFS A;  3RLM A;  3VMA A;  2Y0D A;  2GIW A;  1CYI A;  4GED B;  4XXL A;  1SQQ D;  1QKS A;  4JCG A;  3ZOW A;  1KYO W;  3OCD A;  4AAM A;  2C9X B;  1I8P A;  3WFC C;  5IY5 1;  4IL6 V;  4D6T D;  2RN0 A;  1K3H A;  2YIU B;  5E79 V;  2BH4 X;  3H1J D;  5CIF B;  1U75 B;  4U3F D;  1FOC A;  5KKZ B;  3L75 D;  3ZBM A;  3SJL A;  3GG2 A;  1CC5 A;  3PTZ A;  1BCC D;  2D0S A;  3SVW A;  2QJY B;  1S5L V;  4WQ7 A;  3ORV A;  1CIE A;  2YK3 A;  3RMZ A;  1NTM D;  3L70 D;  3PXS A;  4L3G A;  1OCD A;  4Q5P A;  1W2L A;  1KYO D;  1LS9 A;  5CIH B;  1FJ0 A;  2DGE A;  5GTI V;  1CRY A;  1I5T A;  2BH5 X;  3NWV A;  1CTZ A;  2CXB A;  1BL9 A;  1KB9 D;  3PXW A;  2ORL A;  4DY9 A;  2O3J A;  2LIR A;  1QL3 A;  4FAV A;  3SWS A;  4FA4 A;  2N3Y A;  5CYT R;  4PD4 D;  3PXT A;  3L4O A;  5TJH A;  1NIR A;  1NTZ D;  1DW1 A;  2OZ1 A;  1NNO A;  1CO6 A;  1EB7 A;  1HJ3 A;  1AKK A;  1CNO A;  3OCD B;  3TGU D;  3BCC D;  3PH2 B;  4Y5R A;  1IRV A;  1BGY D;  1HRO A;  3KHU A;  3C2C A;  4EIE A;  3M97 X;  2PCB B;  3O1Y A;  2QG4 A;  1CTY A;  1GQ1 A;  4O1Q A;  4J20 A;  5KAF V;  3H1L D;  3L74 D;  5DF5 A;  2PAC A;  1CRH A;  3O0R C;  351C A;  2KS1 A;  1HJ4 A;  1L0N D;  1CIF A;  1H31 A;  4K3I A;  1IO3 A;  2C8S A;  1CIH A;  2PCC B;  1CRG A;  4WQD A;  5GTH V;  1CHH A;  4EID A;  1DVH A;  2GC4 D;  1C75 A;  2ZOO A;  1N15 A;  1HJ5 A;  5CIB B;  2C1V A;  451C A;  4KMG A;  5DJQ B;  1KX2 A;  2FYU D;  3ZIY A;  4FA9 A;  4EDF A;  1IZL 0;  1COT A;  1R0Q A;  2A06 D;  3OA8 A;  1LMS A;  2OZ1 B;  2FWL A;  3SLE A;  1DII C;  3NBS A;  2MHM A;  1CXC A;  1H32 B;  4EIF A;  5KAI V;  1YNR A;  3WU2 V;  1CHJ A;  1NTK D;  1S6V B;  1SQP D;  3CP5 A;  3ZOX A;  2IBZ D;  4UB6 V;  1C2N A;  3RN1 A;  3CU4 A;  2C1D A;  1FHB A;  5CIC B;  1CSX A;  3L73 D;  3VNW A;  5B5E V;  1CRI A;  3TF5 A;  1RAQ A;  4WQE A;  4RSZ A;  1I6D A;  2RMZ A;  4FA5 A;  1I6E A;  5CIG B;  1H9Y A;  1HH7 A;  1RZ5 A;  2BPB B;  1KB0 A;  1C7M A;  1DW3 A;  2Q3E A;  1YEA A;  1KX7 A;  2MTA C;  5DJQ C;  4V2K A;  1QN2 A;  2CA3 B;  2C2C A;  1H31 B;  4WQA A;  1GJQ A;  1CYJ A;  4WQ9 A;  2XTS B;  3JBT B;  5AUR A;  1E29 A;  2JTI B;  2JWA A;  2CE0 A;  1M70 A;  1FCD C;  2N18 B;  1A56 A;  2B12 B;  5CIE B;  1U74 B;  4UB8 V;  2B4Z A;  1HZU A;  2FYN B;  4O1W A;  3OA8 B;  4WQC A;  1CRC A;  1GU2 A;  1E8E A;  2JQR A;  1CED A;  1H32 A;  1NML A;  3HQ7 A;  5B66 V;  1IQC A;  1CHI A;  1B7V A;  1NMI A;  1IRW A;  1GDV A;  4L3H A;  3X39 A;  4GYD A;  1MG2 D;  3MK7 B;  3L72 D;  3KZI V;  1I8O A;  2C1D B;  1C52 A;  1YIQ A;  1AOF A;  4N0K A;  3DR0 A;  4YE1 A;  1LC1 A;  1E2R A;  4PWA A;  4AX3 A;  1JDL A;  1C6O A;  1CCH A;  1DT1 A;  2AI5 A;  1ETP A;  2N18 C;  5C9M A;  3H1H D;  3H1I D;  3HQ9 A;  1CTJ A;  2BGV X;  1SQB D;  1H9X A;  4AAO A;  1AOQ A;  1C2R A;  1MZ4 A;  3A0B V;  3L71 D;  1FI3 A;  4P4Q B;  1CIG A;  1CRJ A;  1HCM A;  3GW6 A;  4EIC A;  2AIU A;  3A9F A;  1VYD A;  3ZCF A;  2GB8 B;  1YFC A;  2GC7 D;  4H0J A;  4H0K A;  4LJI A;  3MK7 C;  1WVE C;  1F1C A;  2I8F A;  1CSV A;  2K9J B;  4AAL A;  1M60 A;  1DVV A;  1M6Z A;  1N9C A;  2HV4 A;  3DMI A;  4AAN A;  3TYI A;  1CSW A;  1RZ6 A;  2B0Z B;  2V07 A;  3WFB C;  1BE3 D;  4QAO A;  1ZZH A;  4MU8 A;  5EXQ A;  1L9J C;  1YEB A;  1KIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...