3L70D

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 70
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l70D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l70D02
3CXHW 1CSWA 3VNWA 1GQ1A 1PPJD 1KX2A 1CYIA 5KLVD 1QL3A 1R0QA 1IO3A 1U75B 2PACA 1FCDC 1RAQA 1AKKA 4WQ9A 1NMIA 3CX5W 4AX3A 451CA 4WQBA 5CIBB 2XTSB 3NBTA 2Q3EA 1CTYA 4JCGA 2JQRA 1C6OA 1BE3D 4L1QA 3ZOYA 4WQ7A 1NTMD 3TF5A 2N18B 1I54A 1NNOA 5TISV 1KX7A 2QG4A 2KS1A 1KB0A 1GDVA 3H1HD 4DY9A 3L74D 2AIUA 5GTIV 1WVEC 1I6DA 1F1CA 1LFMA 2YCCA 1I55A 1W5CT 2C2CA 1E8EA 2DVHA 2Y0DA 1CC5A 2B0ZB 2N9YB 5TJHA 2HV4A 1BGYD 4Q5PA 3ZBMA 1QN2A 1CYCA 1H9XA 3CX5D 1SQVD 3PXTA 1DW3A 1CXAA 1NIRA 4UB6V 1SQPD 2MTAC 1OAEA 3PXSA 4QAOA 5CIDB 2EXVA 1AOQA 1LC2A 2PCBB 1CIEA 1KB9D 3FWLA 1S5LV 5GTHV 4FA9A 3L72D 1YICA 3TDKA 4AALA 3WU2V 3O5CA 4FAVA 2IBZD 1EB7A 2B11B 2BH5X 1LC1A 3DMIA 1W2LA 1CNOA 1CYJA 4L3HA 3H1KD 1L0LD 1H33A 2CA4B 3WFBC 1H31B 2YQBA 1CRCA 3L73D 1HJ4A 2BPBB 3L71D 2JWAA 1K3GA 1H32A 4P4QB 1COTA 3HQ9A 2BGVX 1CIHA 1IQCA 1RAPA 5B6QA 1MG3D 4EIEA 1CSVA 3GG2A 1IRWA 4FANA 4D6TD 1LMSA 1HJ3A 3TYIA 2LITA 1CO6A 1U74B 3SJLA 1SQXD 1ZZHA 1CSXA 1N15A 3BCCD 3WFDC 4FA1A 4YE1A 2Y0EA 5KKZB 4PWAA 2GIWA 1L9JC 4WQDA 1YTCA 1CRIA 3WFEC 2JTIB 3TGUD 5CIGB 2OZ1A 3DP5A 1OCDA 4GEDB 3O0RC 3ITKA 2BCCD 4PJ0V 2QJKB 4V2KA 2ZONG 1BCCD 3CWBD 1CSUA 4RJTA 2OZ1B 1MG2D 1K3HA 2C8SA 1CHHA 3OA8A 2GC4D 1QL4A 2N18C 3MK7B 5DF5A 4AAOA 1CRJA 4L3GA 1YNRA 2FWLA 2GB8B 3CYTI 3PH2B 3KHUA 1ETPA 1ZRTD 1A8CA 2ZZS1 3PLNA 2ZBOA 1I5TA 1WEJF 3A0HV 2LIRA 1HRCA 1HCMA 5C9MA 1A56A 1C2RA 2C1DA 1IRVA 1HROA 2AI5A 4O1QA 1N90A 1HJ5A 4LJIA 3DR0A 5EXQA 1JDLA 1NTZD 2I8FA 3ZIYA 1YCCA 1SQBD 2D0WA 1FHBA 4K3IA 2A06D 1C6RA 4WQEA 2O3JA 2BCNB 1I8PA 3WC8A 1CHIA 1KV9A 5IY51 2QJPB 3L4OA 5C0ZA 1I8OA 351CA 3L75D 4WQAA 1DVHA 1LS9A 3H1JD 155CA 3L70D 1DW2A 3ZOWA 2MHMA 5KLIB 3OCDA 1H33B 5CICB 1CCRA 1HZUA 1YIQA 2PCCB 2ORLA 2N9IA 1S6VB 2Y0CA 2ZXYA 1HH7A 4EIDA 4AANA 4U3FD 4WQCA 2YK3A 1CCHA 3JBTB 1GIWA 1KYOD 4RSZA 3SVWA 1H32B 3O1YA 4A7PA 3O20A 1CIGA 1DW1A 5DJQB 3KZIV 2FYNB 3NWVA 4NFGB 2ZOOA 4UB8V 1C7MA 1A2SA 3L4MA 2CA3B 2N3YA 4FB1A 1DVVA 3RN0A 2CXBA 1DW0A 2V08A 3HQ8A 1CHJA 2C1UA 5E79V 3PHLA 2CE0A 2D0SA 5CYTR 1L0ND 2FYUD 3X39A 1CORA 1KIBA 1H1OA 5H2FV 1FI7A 3RLMA 4EICA 1CIFA 1RZ5A 3SWSA 2C9XB 3M97X 1FJ0A 4MU8A 3ORVA 2AXTV 1CTJA 1C52A 2BLFB 1C2NA 1QYZA 1PP9D 1RZ6A 1H9YA 3HQ7A 3OA8B 4XXLA 4PW9B 1E2RA 4GYDA 2B10B 3MK7C 3A0BV 3SLEA 1CRYA 1YEBA 3A9FA 1CEDA 1C6SA 3CXHD 3HQ6A 1YFCA 1NMLA 3CU4A 3VMAA 1CTZA 1NTKD 2K9JB 1CRHA 1AOFA 1C75A 2N3BA 1BL9A 1DT1A 3H1ID 2C1VA 3ZOXA 3SXTA 3C2CA 2GC7D 3VRDA 3PXWA 4XYDB 2C1DB 4KMGA 1N9CA 1E29A 1FI3A 4FA4A 5KAIV 2RMZA 1M6ZA 1KYOW 2B4ZA 2CE1A 1F1FA 5CIFB 3RMZA 1CRGA 1AYGA 2RN0A 1GKSA 2VHDA 1N50A 4PD4D 2L4DA 4N0KA 1P84D 4AAMA 1EZVD 4EDFA 3WUIA 5KAFV 1QKSA 1CXCA 3H1LD 1M60A 4H0JA 4Y5RA 3WFCC 4FA5A 2L91A 5CIEB 3VYMA 3RN1A 2BH4X 3ZCFA 2KNCB 1B7VA 1HZVA 1MZ4A 4WQ8A 1I6EA 5B66V 1DIIC 3NBSA 1H31A 1YEAA 4H0KA 1SQQD 1VYDA 2FRCA 2DGEA 4EIFA 1DIQC 1GU2A 1GJQA 3OCDB 4J20A 1FI9A 3ZOOA 2N9JA 4O1WA 3PRJA 5CIHB 1L9BC 1J3SA 5B5EV 1IZL0 2B12B 5DFSA 3CP5A 1NU1D 3GW6A 2V07A 4IL6V 5AURA 2QJYB 3PTZA 2YIUB 1FOCA 1M70A 5DJQC
chains in the Genus database with same CATH superfamily
1CSWA 3KYQA 4YTPC 1JY2O 1JM0A 1GQ1A 1PPJD 1G2CA 1X79B 1N7SD 3HD7B 5AW1B 1X9VA 3AEBC 5DJUB 3SWYA 2KB7P 4BRYB 1FCDC 4L75A 1RAQA 1AKKA 1LNQA 3U59A 2XNXA 3ZDMA 1NTMJ 5AW9B 4R4LA 3NBTA 4DCKA 3F5HA 1U7JA 5KAIE 2WSEH 4GODA 2JO1A 4AUWA 1Y8AA 1NTMD 1NYHA 3HE4A 2N18B 5TISV 1NH4A 1OW6A 2FYUG 2Y9YA 4W80A 3EWKA 3E1RA 2ZYDA 1L0LE 3B4SA 2M8RA 4LGDE 4NPFX 1LP1B 1LFMA 1X22A 2Y0DA 1OWAA 1YYCA 2WPRA 2N9YB 4Y99B 1YJ9P 5EFWB 4IFMA 3CD6P 1DW3A 1NIRA 2WSCH 2KYVA 2IPPA 1M1JB 1VF5C 2VRSA 2MTAC 3SSUA 4ZNCA 1KYOE 2Z5HA 4U7JA 4D6TE 2D2CD 1RF1B 4ZKPA 1YICA 1L0LJ 4H13D 4AALA 1NOHA 1SQXE 3HTKB 3IFMA 5KAFH 2G8YA 2FXMA 2BH5X 1FJPA 1LC1A 2KUBA 5CJ0A 3KDPB 1E5WA 3L71J 2FFDC 1N7SB 1Q82Q 2H88C 5KLVK 2NPSD 1L0LD 1RF0C 1JO5A 3VN0A 2FKWB 1FZCA 3L71D 1JY3O 3CC4P 2WSSH 4D6TJ 4TT3H 1COTA 3HQ9A 1LT9C 1M8OB 1SQXJ 2Q5UA 1CIHA 3AEAC 1IQCA 2WPSA 2QJYC 2E43A 1T8ZA 2M3EA 2YIUC 1M7LA 4FANA 4D6TD 2J58A 1U74B 4BXLA 1SQXD 1ZZHA 3CXHE 3T97A 1JTHA 2BCCJ 2M3BA 5M1BA 4PWAA 2GIWA 3HD7C 1BCCJ 1L9JC 4WQDA 3Q1MA 3BRTB 1GK4A 1H0TA 2WWWA 1JTHB 3EFGA 2OZ1A 2BCCD 3M0AA 1SQVK 2H8PD 2QJKB 1KYOI 2ZONG 1BCCD 3FGAD 1H0TB 1D7MA 2OZ1B 1K3HA 4O9BA 1RE4C 3OA8A 5AW8B 3FX0A 4DZOA 3HUSB 1EZVE 1RH5B 2D2CB 5KLVG 2N18C 1GTWA 4H13B 4AAOA 4L3GA 3L75E 3CCUP 5TISH 2FWLA 3GF7A 1HTLC 2K9JA 3PLNA 1HWTC 1YQ3C 2HYNA 2G3AA 2NPSB 5CJ4A 3A0HV 3VOPA 1SQQE 2IZ0A 1IC2A 1A56A 1CI6A 1C2RA 3RBZA 3CPWO 1IRVA 4U3FE 5BVZA 4Y99C 4O1QA 2AI5A 2ZXEB 1OW8A 4YPCA 1N90A 1R5SA 3DR0A 1OX3A 1M1KQ 1YCCA 2E74D 1M1JC 2P2UA 1DIPA 3GLMA 4WQEA 3HRNA 2K3RA 3L75J 3A2AA 3II6A 3CXHI 2OYHC 3L37A 1RF1C 3R2PA 2KNCA 1XTGB 2W27A 2QJPB 3B8EB 4OWFA 4Z1MH 3L75D 4WQAA 1SQVG 1LS9A 1S72P 1IFJA 1DW2A 1N7SC 2RKLA 3ZOWA 2P67A 4U3FJ 4N3YB 2MHMA 5KLIB 1VQ7P 1AFOA 1MZ9A 1YIQA 2ZT9D 1HVVA 3SWFA 1T2KD 2W6BA 5E79E 5BU5A 1EDJA 2WT7A 2M5AB 2PGDA 5APQA 4AANA 4U3FD 4WQCA 2OTKE 5H2FE 1P84I 3AE8C 1S9KD 1PP9E 1EZVI 1N73A 3SVWA 1H32B 4A7PA 1CZQA 1Q2NA 1ZLLA 1CIGA 5DJQB 2FYNB 3NWVA 4EYYQ 2ZOOA 5APTA 1X8YA 1A2SA 2WSFH 2HFED 2HG5D 5AVVB 3H1HE 2N3YA 3L74E 4FB1A 1DVVA 1SS1A 2CXBA 1DW0A 2HODA 1JY3N 1FZGA 2V08A 2QRXA 3C9IA 3A0BE 2CE0A 1YHQP 2IX7C 2A45G 1KIBA 3D6YA 1H1OA 2HODB 1RZ5A 4HB1A 1EC5A 5AW6B 1PP9J 1S2EA 1NTZK 2QJKC 3VP9A 1SFCD 1CTJA 2JP3A 1KMIZ 2E74B 1AVYA 1PP9D 2WVRA 4C7NA 1KB9E 1LTSC 1U7MA 4XXLA 3HUSC 3L74J 3L72E 2YMYA 2D2CC 1KILE 1IZNB 1E2RA 1CW5A 3H1IJ 3SLEA 2QM7A 4H13C 1CRYA 2I1KA 5KJ7D 4C7NB 1GMJA 3KQGA 1YFCA 1NMLA 1LWUA 2I8DA 2YKOA 1OFCX 3H1KE 1Q7YQ 2N3BA 1LTIC 3H1ID 2NPSC 3ABVC 1YTZT 3QWOC 3C2CA 4HKZH 1LWUB 3A0HH 3AE1C 1Q86Q 2YKQA 2ZT9B 1EQ7A 1OZHA 3PXWA 5B66E 2C1DB 3V2NA 1S5LX 5AVRB 4FA4A 1FI3A 5KAIV 1M6ZA 2Q9IA 5CIFB 4PD4H 3MUDC 3H1LJ 2RN0A 1FZBA 3L72J 1N50A 1KQGB 2P58A 2B89A 2W8ZA 3VMZA 5AVXB 1CXCA 3H1LD 4H0JA 4Y5RA 2L91A 3CC7P 1FOSE 2QJPC 1HZVA 1SQPG 1MZ4A 4WQ8A 1GDTA 3NBSA 2KZIA 1YEAA 3M0DC 2FRCA 1NTZG 2DGEA 3RL0D 5KLIC 1DIQC 1GU2A 3OCDB 1FI9A 2A06G 1M56D 3PRJA 3U1AA 2B12B 1M90Q 1KB9I 3CCRP 2OYIA 1CSBA 2V07A 3D6ZA 1NGMB 4ASWA 3PTZA 1YJWP 2OGUA 1M70A 3H6PA 5DJQC 3B5NA 3TNUA 3V2QA 2FYNC 1PL5A 3VNWA 2P10A 2ZJSE 3EFFK 1G1JA 4TLFA 3N4XA 2Y9ZA 5APVA 1R8EA 4ASVA 3KXDA 2Z5IA 1AA0A 2B9BA 3FXEA 3CX5W 3K5BA 3RGUA 4WQBA 5CIBB 1CTYA 3M91A 4JCGA 2R3CA 1VQ6P 2JQRA 1OIPA 1C6OA 3CCSP 4L1QA 2E74C 2Q3IA 4WQ7A 4GDOA 3CCJP 1I54A 1KILA 2QG4A 2Z4EA 1KB0A 1DD4A 3E7KA 4DY9A 1N2DC 1ZN5A 2OYOA 1R5LA 2K37A 3CWBG 1KD1Q 1BGYJ 5GTIV 5GTHE 2E5YA 1I6DA 1KZUB 4QMAA 3I56P 1I55A 4GIFA 1E8EA 1QVGO 1EDKA 1IK7A 2HPCA 1K04A 3RL0B 1BGYD 4Q5PA 1LWUC 2R5DA 3CX5D 1HJ0A 3PXTA 2ZT9C 3AEEC 4UB6V 1KTMA 1RE3A 2SPZA 1OAEA 3PXSA 1DX7A 4WY4A 2W6JH 1PFIA 2YNYA 1LC2A 3MD0A 3MP7B 1S5LV 2B87B 3WU2V 1LTJB 2IBZD 1EB7A 2B11B 3DMIA 1W2LA 1CYJA 1VPCA 4L3HA 3P8CE 1H33A 2Q7CA 2FYUE 4MN4C 1HJ4A 1FJKA 4M3LA 2OTJP 5AW4B 3QH9A 3G9RA 2JWAA 1EDLA 1OMIA 1L4AA 2OQQA 3M06A 2GM4A 2C9LY 1FE6A 4NPEA 4PJ0E 2XNDH 1NTMK 2RH0A 4BWNA 1RAPA 1S1CX 1CSVA 2KIKA 1IRWA 3W67A 1ZRTE 1LMSA 1HJ3A 3IN6A 3TGUJ 2LITA 1CSXA 1GZLA 3JCUE 1VQ5P 5KJ7C 2JR8A 3WFDC 2Y0EA 2WMMA 1URQA 4H0LD 1G2CB 1YTCA 1IFPA 3WMM0 1CRIA 3WFEC 3TGUD 2JJLA 5CIGB 2LKMA 3IR9A 3O0RC 4K3AA 1ZR4A 1SQBE 3KPEA 1JMMA 1Q90D 1PPJG 1KN7A 4GKGA 1VL2A 2GC4D 3P7KA 2YXRB 3HE4B 3MK7B 5DF5A 1JCDA 4C7RA 5CCGA 2GB8B 3CYTI 4PV1D 1ZRTD 2ZZS1 4OGQD 1VQMP 1L0LK 5GTIH 2AEJA 1HRCA 1HCMA 2E76D 2N1TA 1SQBJ 1K05A 3RL0C 1HROA 1NTMG 1M57D 1YQ4C 1JDLA 2I8FA 2WPQA 3RK3E 4UB6H 1SQBD 2D0WA 1C6RA 3JSVC 1HJBA 5APYA 1OVUA 2O3JA 3L4FA 2BCNB 1QVFO 2KP8A 3WC8A 1S5LH 1ZMEC 5AVYB 3WU2H 1LTJC 1I8OA 1SQXK 2CPBA 1L0NE 2ZVOB 5AW2B 3D70A 4H0LB 1DVHA 1J1DB 1FDOA 3SFDC 2A45H 1YITP 1IFMA 5CICB 2P1JA 3CCVP 2KLVA 3Q5RA 2N9IA 5AVWB 1FZCB 2Y0CA 3G3ZA 3TK1A 1LTTC 2Q1KA 4L73A 1JY3P 1KYOD 1H89A 4IL6H 3O20A 3RK3D 1DW1A 2BEZF 3KZIV 4NFGB 3JC22 1L0LG 4UB8V 1VQOP 1C7MA 1L0NJ 3B71A 1AQTA 2CA3B 1OVRA 1ZW0A 1NTKE 4PV1B 3RN0A 4HYTB 3L71G 1KORA 3MIWA 3T97B 4OGQB 2Q6QA 1CHJA 3X39A 1L0ND 1CORA 1FAVA 2E76B 3V2RA 1USDA 1QL1A 2ITAA 3N7NA 4EI2A 4JQ0D 1T6AA 1JY2N 1HUCA 4MU8A 2AXTV 1P84E 2WSEJ 1VQPP 4D6TG 1VQLP 1G1IA 3RL0g 1SQXG 1LTBC 1QYZA 4CPGA 4JBZA 3OA8B 3EQ2A 1NTKJ 2JEEA 4GYDA 2B10B 3MK7C 4W7YA 1H88A 1CEDA 3CXHD 5KAFE 2HLOA 1CTZA 2BCCG 3PJSK 1NTKD 2K9JB 1CRHA 3S9OA 1BCCG 3M9QA 1BL9A 2C1VA 3SXTA 5CCGC 1VQ4P 2GC7D 2LR2A 4GOFA 4XYDB 1CI6B 1K8AQ 3MHVA 1GW4A 2B4ZA 1FS0E 3R4YA 3RMZA 4YXDC 2LXBA 4HH2A 4WWIA 1GKSA 1USEA 2DW3A 2BEQD 4R4MA 2MKVA 2L4DA 4N0KA 1P84D 3RK3B 4AAMA 1EZVD 4EDFA 3G71P 1FZAA 1AQ5A 3GHGA 1JMBA 4FA5A 2J59M 1M60A 1SQQJ 5AVUB 3C1LA 2W83C 2KNCB 2V7QH 1QEXA 3NTNA 1I6EA 3CL3D 2K1AA 1H31A 4H0LC 1J1DC 1SQQD 4AYCA 4EIFA 5APSA 1GJQA 3VMYA 3ZOOA 4O1WA 1W5CE 1BE3E 1FZCC 5B5EV 2WT7B 1T3JA 2FBWC 3GW6A 1N73B 3G6EP 3AEGC 3L75G 2ZAEB 4LLHA 3L73G 1FOCA 2FXOA 1FU1A 3KZIH 1QX8A 3RBXA 2O01H 4UB8H 4PV1C 1HGVA 5TISE 1CYIA 1R0QA 4U3FG 4OGQC 1IO3A 1U75B 3MZWB 1BE3J 1LTGC 2E76C 1WRGA 2A45I 1NAYA 1SQPE 4WQ9A 4AX3A 3A7OA 2GA1A 3OAKA 1NTZE 1IK9A 2AXTH 3H1HJ 1BE3D 1RQUA 1PV3A 2B88A 2J5UA 2YO2A 2CK3H 2V4HA 2KS1A 3B5ND 3H1HD 2ZFCA 3L74D 1OXZA 2UWJE 2H7HA 2AIUA 2IZ1A 1F1CA 5K5GB 1W5CT 2C2CA 2DVHA 5CHXA 1CC5A 1SQPJ 2B0ZB 4I2LC 3CX5H 2KK7A 4IOIH 5CCHA 3SWKA 3ZBMA 3Q2YA 1QN2A 1H9XA 1PP9G 2IYOA 1CXAA 1SQPD 1QLED 4QAOA 2WZ7A 1PZQA 3H32A 1AOQA 2PCBB 1CIEA 1YTZI 1KB9D 3FWLA 3RK3C 4B86A 3H1KJ 3L72D 1KILD 3I55P 1XTCC 2AEMA 3H1IG 4FAVA 3BCCE 4OVNF 4K35A 3P8MC 2O1JA 4JYBA 1CNOA 2MJZA 3D71A 1FOSF 3H1KD 1GL2A 3HE5A 4JPZB 1J1EB 2YQBA 1NAFA 2ZXXA 4GT1A 3CWBE 1HH0A 2BPBB 1ZR2A 1BDCA 1FC2C 2YMKA 4P4QB 3H1LG 4OH8B 1U57A 5B5EH 1SFCA 3L70G 4WY4D 2BGVX 2QVAA 2O01N 2OYIB 2L5GB 3S4RA 3BCCJ 3I5CA 1N73C 5B6QA 5BU8B 1W2BO 3O8ZA 4EIEA 3GG2A 1NKNA 2YXQB 1N8RQ 3TNUB 3B5NB 1FBMA 1ZOYC 1N15A 2FXPA 3AE7C 3BCCD 4FA1A 4YE1A 1L2PA 3RK2D 1KFNA 1JEKA 3CWBJ 3NMDA 2O1KA 3LIDA 5AVZB 2QE7H 3DP5A 2JKVA 4JYCA 3ITKA 4N78E 3A0HE 4V2KA 3CWBD 1JUNA 2QIWA 1CSUA 4RJTA 1OW7A 1L4AD 4DT0A 3V6IA 4EIJA 3CI9A 1CHHA 4H44D 1LGHB 3CC2P 3C8VA 1KILB 1CRJA 1SLQA 2CPSA 3H1JE 3PH2B 1A8CA 2ZBOA 2ZYAA 1I5TA 1WEJF 1KQLA 2LIRA 2FYZA 2HPCB 3L35A 5KAIH 2H43A 2M0BA 1HJ5A 2E42A 1NU1K 3GMAA 1H8AA 5EXQA 3D0WA 1YBKA 3MTUE 4N78D 4LC1A 1VF5B 1FHBA 4K3IA 4WY4B 3H1JJ 3USSA 3CCEP 4W7ZA 4HJGH 1KV9A 2R44A 5IY51 1QGKB 4N6JA 2FFDA 5C0ZA 1PPJE 1BSHA 1BGYG 1RF0A 5CCGD 1PGQA 1K73Q 1OVVA 3LIEA 3H1JD 155CA 5L8RJ 3RK2B 1NHLA 1LTAC 1H33B 3IF4A 1SP4A 1J1EC 2BASA 3BRVB 3G4SP 5CBNA 4L76A 2PCCB 2ORLA 1KYOH 3Q3DA 1HH7A 1LT9A 4PD4I 2GUVA 3JBTB 1L4AB 2IBZG 1KC8Q 4ZMDA 5AVSB 4H44B 2OYIC 1JY2P 2FYUJ 3L4MA 3AEDC 3B5NC 3HD7A 4Y28J 3AE4C 2WITA 3P8CD 5C39A 1NU1G 2C1UA 5E79V 1URQB 3PHLA 5CYTR 2FYUD 2IYPA 4BRYA 3CMAP 5H2FV 3SWSA 2C9XB 3LW5J 4NPDA 3M97X 1KQFB 3ORVA 1RE4A 4WBAA 1RY3A 1SQBK 1YJNP 1VQNP 1RZ6A 3A3YB 4PW9B 3VYIA 3CXHH 5AVQB 3A0BV 1KILC 3TGUG 3A9FA 1C6SA 4YXWH 1LP1A 3CU4A 1IFIA 3VMAA 1EDIA 1ZP0C 2N9BA 2PRRA 3V5BA 3VRDA 1MFZA 2N1TB 3WUTA 3AE3C 1Q81Q 3L71E 1N9CA 1M1JA 2RMZA 1KYOW 2KSJA 1CRGA 1P84H 1AYGA 1S4XA 1PGPA 2XKMA 1YIJP 1RE3C 1TU3F 2OYHA 1RF1A 3V4WA 3WUIA 4WY4C 3HTKA 4I6MC 3M9BA 5CIEB 3RN1A 4I1LA 2OYHB 3ZCFA 1YI2P 5KLVE 1N7SA 1AVOA 3FWNA 3AE6C 5B66V 5CBOA 4H0KA 2POHA 2R32A 1L0NK 1X0TA 3RK2C 1EXJA 1SQBG 2GUSA 2XDJA 3AE5C 4J20A 2BCCE 2C0WA 1DD3A 1BCCE 1L9BC 1J3SA 3BVHA 1KQSO 3CP5A 1VDFA 1Z56A 1L4AC 2XU6A 2QM8A 4H44C 5KLVJ 3L36A 3CXHW 2KLUA 2JDIH 1KX2A 4JF7A 4DOJA 5KLVD 1NTKK 1Y9BA 1QL3A 3CCMP 1URQC 2PACA 5E79H 1SQVE 3TYYA 3V4QA 5GTIE 5H2FH 1NMIA 451CA 1WMKA 2QSIA 2XTSB 2Q3EA 3CLQA 1NWQA 2XV5A 4IFFA 1FDIA 1NKZB 1MUUA 2R5BA 3ZOYA 3HUSA 1T3UA 4UB6E 3TF5A 2E5TA 1NNOA 3AE2C 3GF3A 1KX7A 1Y47A 1L0NG 1GDVA 3CCQP 3M9HA 1W2EA 1K9MQ 3A0BH 1S5LE 1PIXA 1WVEC 2NPSA 2I1JA 2YCCA 1SQVJ 3WU2E 3L73E 1MKMA 1ZV8A 1VQ9P 1SVFA 1SQQK 3OJAB 3Q5SA 5TJHA 2WSCJ 4WB4A 2HV4A 2K9YA 2YO3A 1CYCA 3MUDA 1IFDA 1AJYA 1SQVD 2N1TC 3AECC 5CIDB 1S9KE 2KI7B 1KB9H 2EXVA 2OARA 1UIIA 3E1IA 1MFTA 4RESB 1NVOA 4IL6E 5GTHV 2C9NY 5AW5B 4FA9A 4AQRD 1NTKG 3TDKA 1JB0J 4KHXA 3O5CA 3GHGB 3W68A 3P32A 3L73J 1BSNA 5APUA 2E75D 3M0DA 2ZVNB 2CA4B 3WFBC 5B66H 1H31B 1CRCA 2NZ2A 2ZYGA 3L73D 3O6QA 1NO4A 5CCHD 2M5AA 1FZEA 1EZVG 3WUUA 1VQ8P 1K3GA 3O6QB 3S1KA 3VTPC 1H32A 2K88A 2HR3A 4XA4A 1N86A 1MG3D 1QL2A 1SQQG 3TYIA 1CO6A 3SJLA 1JNMA 1HF9A 2WQYC 2OTLP 5KKZB 4IFDK 3H1IE 1GL2D 2JTIB 2P7JA 2WTYA 5AW7B 2AXCA 1OCDA 4GEDB 3TSIA 4PJ0V 3OW2O 1EXIA 1KFMA 1DEEG 5APXA 3CMEP 1SQPK 2A06E 1MG2D 2LXCB 5AVTB 2C8SA 3VP8A 1FDMA 1GD2E 1QL4A 1J2JB 2KSEA 3H1LE 3U1CA 1YNRA 2KS1B 3L70E 2KOGA 3KHUA 1ETPA 1E79H 2E75B 1ZXGA 5AW3B 1IO4A 1BDDA 1NTZJ 2WPVB 5C9MA 1GK6A 1RQVA 3H25A 3Q5PA 2C1DA 1GU4A 1BE3G 4LJIA 2PAJA 2PFXA 1NTZD 3ZIYA 3H1HG 4ZKUA 4XE5B 3L74G 2A06D 4KT0J 3H32B 2QEXP 2H89C 3L70J 1KV4A 1I8PA 5GTHH 1CHIA 3L4OA 3FXDA 3GHGC 2V7QJ 3F89A 351CA 3AEFC 3KZIE 3L70D 4UB8E 3V2PA 1DEBA 3OCDA 3CCLP 1GL2B 3HE5B 1CCRA 4IL6X 1HZUA 1GW3A 4I7ZB 4RKUJ 1S6VB 1VF5D 2ZXYA 1JOCA 4EIDA 3L72G 2YK3A 1CCHA 1GIWA 4GOEA 4RSZA 3O1YA 2R3SA 1SFCB 1MV8A 2WSFJ 2AXTE 3PP5A 3H1KG 2XZRA 4C46A 3OA7A 1FZFA 1LT1A 5KJ7A 3SFEC 2O01J 2NRGA 5APWA 3HQ8A 1DH3A 5KKZC 2D0SA 2IDBA 1FI7A 3RLMA 2KXPB 4EICA 1CIFA 4L74A 1BGYE 1PGJA 3BASA 3CX5E 2AEFA 1FJ0A 4EOTA 3MGNA 4PJ0H 4PD4E 1HBWA 1VQKP 3LW5H 1C52A 1RHZB 2W6AA 2BLFB 1C2NA 3AE9C 1H9YA 3BCCG 3HQ7A 2KZJA 2QA4P 1AV1A 3JCUH 1HGZA 3NXSA 2IBZE 1YEBA 1URQD 3HQ6A 3HD7D 2E75C 4DJGA 1AOFA 1C75A 2IFMA 5AW0B 2YKPA 1DT1A 3ZOXA 3A5TA 2IFNA 3PH0A 5DJTB 4KJMA 4KMGA 1E29A 5CCHC 3UIAA 1NU1E 2CE1A 1F1FA 2FY8A 1WT6A 1T2KC 1PGOA 3VMXA 2VHDA 4PD4D 2B87A 5KAFV 5B5EE 1A02F 4RO0A 1IJDB 1LTJA 1QKSA 3WFCC 1N7LA 3VYMA 2C0XA 1JCCA 2BH4X 1B7VA 2FFDB 3IAOA 1DIIC 2W90A 4XFJA 2N1TD 4WVZA 1VYDA 2FYUK 3CX5I 2PP6A 3TGUE 1NU1J 1A02J 1GL2C 3WUVA 5KTBA 2N9JA 4I7ZC 2JWDA 5CIHB 3BATA 1IZL0 1NJIQ 1IFNA 1S3JA 1NTME 1LT9B 5DFSA 1NU1D 4IL6V 5AURA 2QJYB 1UIXA 2IBZI 2YIUB 1SFCC 3H1JG 5CMZA 3NFQA 1GU5A 1LJ2A
chains in the Genus database with same CATH topology
3CXHW 1CSWA 3VNWA 1GQ1A 1PPJD 1KX2A 1CYIA 5KLVD 1QL3A 1R0QA 1IO3A 1U75B 2PACA 1FCDC 1RAQA 1AKKA 4WQ9A 1NMIA 3CX5W 4AX3A 451CA 4WQBA 5CIBB 2XTSB 3NBTA 2Q3EA 1CTYA 4JCGA 2JQRA 1C6OA 1BE3D 4L1QA 3ZOYA 4WQ7A 1NTMD 3TF5A 2N18B 1I54A 1NNOA 5TISV 1KX7A 2QG4A 2KS1A 1KB0A 1GDVA 3H1HD 4DY9A 3L74D 2AIUA 5GTIV 1WVEC 1I6DA 1F1CA 1LFMA 2YCCA 1I55A 1W5CT 2C2CA 1E8EA 2DVHA 2Y0DA 1CC5A 2B0ZB 2N9YB 5TJHA 2HV4A 1BGYD 4Q5PA 3ZBMA 1QN2A 1CYCA 1H9XA 3CX5D 1SQVD 3PXTA 1DW3A 1CXAA 1NIRA 4UB6V 1SQPD 2MTAC 1OAEA 3PXSA 4QAOA 5CIDB 2EXVA 1AOQA 1LC2A 2PCBB 1CIEA 1KB9D 3FWLA 1S5LV 5GTHV 4FA9A 3L72D 1YICA 3TDKA 4AALA 3WU2V 3O5CA 4FAVA 2IBZD 1EB7A 2B11B 2BH5X 1LC1A 3DMIA 1W2LA 1CNOA 1CYJA 4L3HA 3H1KD 1L0LD 1H33A 2CA4B 3WFBC 1H31B 2YQBA 1CRCA 3L73D 1HJ4A 2BPBB 3L71D 2JWAA 1K3GA 1H32A 4P4QB 1COTA 3HQ9A 2BGVX 1CIHA 1IQCA 1RAPA 5B6QA 1MG3D 4EIEA 1CSVA 3GG2A 1IRWA 4FANA 4D6TD 1LMSA 1HJ3A 3TYIA 2LITA 1CO6A 1U74B 3SJLA 1SQXD 1ZZHA 1CSXA 1N15A 3BCCD 3WFDC 4FA1A 4YE1A 2Y0EA 5KKZB 4PWAA 2GIWA 1L9JC 4WQDA 1YTCA 1CRIA 3WFEC 2JTIB 3TGUD 5CIGB 2OZ1A 3DP5A 1OCDA 4GEDB 3O0RC 3ITKA 2BCCD 4PJ0V 2QJKB 4V2KA 2ZONG 1BCCD 3CWBD 1CSUA 4RJTA 2OZ1B 1MG2D 1K3HA 2C8SA 1CHHA 3OA8A 2GC4D 1QL4A 2N18C 3MK7B 5DF5A 4AAOA 1CRJA 4L3GA 1YNRA 2FWLA 2GB8B 3CYTI 3PH2B 3KHUA 1ETPA 1ZRTD 1A8CA 2ZZS1 3PLNA 2ZBOA 1I5TA 1WEJF 3A0HV 2LIRA 1HRCA 1HCMA 5C9MA 1A56A 1C2RA 2C1DA 1IRVA 1HROA 2AI5A 4O1QA 1N90A 1HJ5A 4LJIA 3DR0A 5EXQA 1JDLA 1NTZD 2I8FA 3ZIYA 1YCCA 1SQBD 2D0WA 1FHBA 4K3IA 2A06D 1C6RA 4WQEA 2O3JA 2BCNB 1I8PA 3WC8A 1CHIA 1KV9A 5IY51 2QJPB 3L4OA 5C0ZA 1I8OA 351CA 3L75D 4WQAA 1DVHA 1LS9A 3H1JD 155CA 3L70D 1DW2A 3ZOWA 2MHMA 5KLIB 3OCDA 1H33B 5CICB 1CCRA 1HZUA 1YIQA 2PCCB 2ORLA 2N9IA 1S6VB 2Y0CA 2ZXYA 1HH7A 4EIDA 4AANA 4U3FD 4WQCA 2YK3A 1CCHA 3JBTB 1GIWA 1KYOD 4RSZA 3SVWA 1H32B 3O1YA 4A7PA 3O20A 1CIGA 1DW1A 5DJQB 3KZIV 2FYNB 3NWVA 4NFGB 2ZOOA 4UB8V 1C7MA 1A2SA 3L4MA 2CA3B 2N3YA 4FB1A 1DVVA 3RN0A 2CXBA 1DW0A 2V08A 3HQ8A 1CHJA 2C1UA 5E79V 3PHLA 2CE0A 2D0SA 5CYTR 1L0ND 2FYUD 3X39A 1CORA 1KIBA 1H1OA 5H2FV 1FI7A 3RLMA 4EICA 1CIFA 1RZ5A 3SWSA 2C9XB 3M97X 1FJ0A 4MU8A 3ORVA 2AXTV 1CTJA 1C52A 2BLFB 1C2NA 1QYZA 1PP9D 1RZ6A 1H9YA 3HQ7A 3OA8B 4XXLA 4PW9B 1E2RA 4GYDA 2B10B 3MK7C 3A0BV 3SLEA 1CRYA 1YEBA 3A9FA 1CEDA 1C6SA 3CXHD 3HQ6A 1YFCA 1NMLA 3CU4A 3VMAA 1CTZA 1NTKD 2K9JB 1CRHA 1AOFA 1C75A 2N3BA 1BL9A 1DT1A 3H1ID 2C1VA 3ZOXA 3SXTA 3C2CA 2GC7D 3VRDA 3PXWA 4XYDB 2C1DB 4KMGA 1N9CA 1E29A 1FI3A 4FA4A 5KAIV 2RMZA 1M6ZA 1KYOW 2B4ZA 2CE1A 1F1FA 5CIFB 3RMZA 1CRGA 1AYGA 2RN0A 1GKSA 2VHDA 1N50A 4PD4D 2L4DA 4N0KA 1P84D 4AAMA 1EZVD 4EDFA 3WUIA 5KAFV 1QKSA 1CXCA 3H1LD 1M60A 4H0JA 4Y5RA 3WFCC 4FA5A 2L91A 5CIEB 3VYMA 3RN1A 2BH4X 3ZCFA 2KNCB 1B7VA 1HZVA 1MZ4A 4WQ8A 1I6EA 5B66V 1DIIC 3NBSA 1H31A 1YEAA 4H0KA 1SQQD 1VYDA 2FRCA 2DGEA 4EIFA 1DIQC 1GU2A 1GJQA 3OCDB 4J20A 1FI9A 3ZOOA 2N9JA 4O1WA 3PRJA 5CIHB 1L9BC 1J3SA 5B5EV 1IZL0 2B12B 5DFSA 3CP5A 1NU1D 3GW6A 2V07A 4IL6V 5AURA 2QJYB 3PTZA 2YIUB 1FOCA 1M70A 5DJQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXH W;  1CSW A;  3VNW A;  1GQ1 A;  1PPJ D;  1KX2 A;  1CYI A;  5KLV D;  1QL3 A;  1R0Q A;  1IO3 A;  1U75 B;  2PAC A;  1FCD C;  1RAQ A;  1AKK A;  4WQ9 A;  1NMI A;  3CX5 W;  4AX3 A;  451C A;  4WQB A;  5CIB B;  2XTS B;  3NBT A;  2Q3E A;  1CTY A;  4JCG A;  2JQR A;  1C6O A;  1BE3 D;  4L1Q A;  3ZOY A;  4WQ7 A;  1NTM D;  3TF5 A;  2N18 B;  1I54 A;  1NNO A;  5TIS V;  1KX7 A;  2QG4 A;  2KS1 A;  1KB0 A;  1GDV A;  3H1H D;  4DY9 A;  3L74 D;  2AIU A;  5GTI V;  1WVE C;  1I6D A;  1F1C A;  1LFM A;  2YCC A;  1I55 A;  1W5C T;  2C2C A;  1E8E A;  2DVH A;  2Y0D A;  1CC5 A;  2B0Z B;  2N9Y B;  5TJH A;  2HV4 A;  1BGY D;  4Q5P A;  3ZBM A;  1QN2 A;  1CYC A;  1H9X A;  3CX5 D;  1SQV D;  3PXT A;  1DW3 A;  1CXA A;  1NIR A;  4UB6 V;  1SQP D;  2MTA C;  1OAE A;  3PXS A;  4QAO A;  5CID B;  2EXV A;  1AOQ A;  1LC2 A;  2PCB B;  1CIE A;  1KB9 D;  3FWL A;  1S5L V;  5GTH V;  4FA9 A;  3L72 D;  1YIC A;  3TDK A;  4AAL A;  3WU2 V;  3O5C A;  4FAV A;  2IBZ D;  1EB7 A;  2B11 B;  2BH5 X;  1LC1 A;  3DMI A;  1W2L A;  1CNO A;  1CYJ A;  4L3H A;  3H1K D;  1L0L D;  1H33 A;  2CA4 B;  3WFB C;  1H31 B;  2YQB A;  1CRC A;  3L73 D;  1HJ4 A;  2BPB B;  3L71 D;  2JWA A;  1K3G A;  1H32 A;  4P4Q B;  1COT A;  3HQ9 A;  2BGV X;  1CIH A;  1IQC A;  1RAP A;  5B6Q A;  1MG3 D;  4EIE A;  1CSV A;  3GG2 A;  1IRW A;  4FAN A;  4D6T D;  1LMS A;  1HJ3 A;  3TYI A;  2LIT A;  1CO6 A;  1U74 B;  3SJL A;  1SQX D;  1ZZH A;  1CSX A;  1N15 A;  3BCC D;  3WFD C;  4FA1 A;  4YE1 A;  2Y0E A;  5KKZ B;  4PWA A;  2GIW A;  1L9J C;  4WQD A;  1YTC A;  1CRI A;  3WFE C;  2JTI B;  3TGU D;  5CIG B;  2OZ1 A;  3DP5 A;  1OCD A;  4GED B;  3O0R C;  3ITK A;  2BCC D;  4PJ0 V;  2QJK B;  4V2K A;  2ZON G;  1BCC D;  3CWB D;  1CSU A;  4RJT A;  2OZ1 B;  1MG2 D;  1K3H A;  2C8S A;  1CHH A;  3OA8 A;  2GC4 D;  1QL4 A;  2N18 C;  3MK7 B;  5DF5 A;  4AAO A;  1CRJ A;  4L3G A;  1YNR A;  2FWL A;  2GB8 B;  3CYT I;  3PH2 B;  3KHU A;  1ETP A;  1ZRT D;  1A8C A;  2ZZS 1;  3PLN A;  2ZBO A;  1I5T A;  1WEJ F;  3A0H V;  2LIR A;  1HRC A;  1HCM A;  5C9M A;  1A56 A;  1C2R A;  2C1D A;  1IRV A;  1HRO A;  2AI5 A;  4O1Q A;  1N90 A;  1HJ5 A;  4LJI A;  3DR0 A;  5EXQ A;  1JDL A;  1NTZ D;  2I8F A;  3ZIY A;  1YCC A;  1SQB D;  2D0W A;  1FHB A;  4K3I A;  2A06 D;  1C6R A;  4WQE A;  2O3J A;  2BCN B;  1I8P A;  3WC8 A;  1CHI A;  1KV9 A;  5IY5 1;  2QJP B;  3L4O A;  5C0Z A;  1I8O A;  351C A;  3L75 D;  4WQA A;  1DVH A;  1LS9 A;  3H1J D;  155C A;  3L70 D;  1DW2 A;  3ZOW A;  2MHM A;  5KLI B;  3OCD A;  1H33 B;  5CIC B;  1CCR A;  1HZU A;  1YIQ A;  2PCC B;  2ORL A;  2N9I A;  1S6V B;  2Y0C A;  2ZXY A;  1HH7 A;  4EID A;  4AAN A;  4U3F D;  4WQC A;  2YK3 A;  1CCH A;  3JBT B;  1GIW A;  1KYO D;  4RSZ A;  3SVW A;  1H32 B;  3O1Y A;  4A7P A;  3O20 A;  1CIG A;  1DW1 A;  5DJQ B;  3KZI V;  2FYN B;  3NWV A;  4NFG B;  2ZOO A;  4UB8 V;  1C7M A;  1A2S A;  3L4M A;  2CA3 B;  2N3Y A;  4FB1 A;  1DVV A;  3RN0 A;  2CXB A;  1DW0 A;  2V08 A;  3HQ8 A;  1CHJ A;  2C1U A;  5E79 V;  3PHL A;  2CE0 A;  2D0S A;  5CYT R;  1L0N D;  2FYU D;  3X39 A;  1COR A;  1KIB A;  1H1O A;  5H2F V;  1FI7 A;  3RLM A;  4EIC A;  1CIF A;  1RZ5 A;  3SWS A;  2C9X B;  3M97 X;  1FJ0 A;  4MU8 A;  3ORV A;  2AXT V;  1CTJ A;  1C52 A;  2BLF B;  1C2N A;  1QYZ A;  1PP9 D;  1RZ6 A;  1H9Y A;  3HQ7 A;  3OA8 B;  4XXL A;  4PW9 B;  1E2R A;  4GYD A;  2B10 B;  3MK7 C;  3A0B V;  3SLE A;  1CRY A;  1YEB A;  3A9F A;  1CED A;  1C6S A;  3CXH D;  3HQ6 A;  1YFC A;  1NML A;  3CU4 A;  3VMA A;  1CTZ A;  1NTK D;  2K9J B;  1CRH A;  1AOF A;  1C75 A;  2N3B A;  1BL9 A;  1DT1 A;  3H1I D;  2C1V A;  3ZOX A;  3SXT A;  3C2C A;  2GC7 D;  3VRD A;  3PXW A;  4XYD B;  2C1D B;  4KMG A;  1N9C A;  1E29 A;  1FI3 A;  4FA4 A;  5KAI V;  2RMZ A;  1M6Z A;  1KYO W;  2B4Z A;  2CE1 A;  1F1F A;  5CIF B;  3RMZ A;  1CRG A;  1AYG A;  2RN0 A;  1GKS A;  2VHD A;  1N50 A;  4PD4 D;  2L4D A;  4N0K A;  1P84 D;  4AAM A;  1EZV D;  4EDF A;  3WUI A;  5KAF V;  1QKS A;  1CXC A;  3H1L D;  1M60 A;  4H0J A;  4Y5R A;  3WFC C;  4FA5 A;  2L91 A;  5CIE B;  3VYM A;  3RN1 A;  2BH4 X;  3ZCF A;  2KNC B;  1B7V A;  1HZV A;  1MZ4 A;  4WQ8 A;  1I6E A;  5B66 V;  1DII C;  3NBS A;  1H31 A;  1YEA A;  4H0K A;  1SQQ D;  1VYD A;  2FRC A;  2DGE A;  4EIF A;  1DIQ C;  1GU2 A;  1GJQ A;  3OCD B;  4J20 A;  1FI9 A;  3ZOO A;  2N9J A;  4O1W A;  3PRJ A;  5CIH B;  1L9B C;  1J3S A;  5B5E V;  1IZL 0;  2B12 B;  5DFS A;  3CP5 A;  1NU1 D;  3GW6 A;  2V07 A;  4IL6 V;  5AUR A;  2QJY B;  3PTZ A;  2YIU B;  1FOC A;  1M70 A;  5DJQ C; 
#chains in the Genus database with same CATH topology
 1CSW A;  3KYQ A;  4YTP C;  1JY2 O;  1JM0 A;  1GQ1 A;  1PPJ D;  1G2C A;  1X79 B;  1N7S D;  3HD7 B;  5AW1 B;  1X9V A;  3AEB C;  5DJU B;  3SWY A;  2KB7 P;  4BRY B;  1FCD C;  4L75 A;  1RAQ A;  1AKK A;  1LNQ A;  3U59 A;  2XNX A;  3ZDM A;  1NTM J;  5AW9 B;  4R4L A;  3NBT A;  4DCK A;  3F5H A;  1U7J A;  5KAI E;  2WSE H;  4GOD A;  2JO1 A;  4AUW A;  1Y8A A;  1NTM D;  1NYH A;  3HE4 A;  2N18 B;  5TIS V;  1NH4 A;  1OW6 A;  2FYU G;  2Y9Y A;  4W80 A;  3EWK A;  3E1R A;  2ZYD A;  1L0L E;  3B4S A;  2M8R A;  4LGD E;  4NPF X;  1LP1 B;  1LFM A;  1X22 A;  2Y0D A;  1OWA A;  1YYC A;  2WPR A;  2N9Y B;  4Y99 B;  1YJ9 P;  5EFW B;  4IFM A;  3CD6 P;  1DW3 A;  1NIR A;  2WSC H;  2KYV A;  2IPP A;  1M1J B;  1VF5 C;  2VRS A;  2MTA C;  3SSU A;  4ZNC A;  1KYO E;  2Z5H A;  4U7J A;  4D6T E;  2D2C D;  1RF1 B;  4ZKP A;  1YIC A;  1L0L J;  4H13 D;  4AAL A;  1NOH A;  1SQX E;  3HTK B;  3IFM A;  5KAF H;  2G8Y A;  2FXM A;  2BH5 X;  1FJP A;  1LC1 A;  2KUB A;  5CJ0 A;  3KDP B;  1E5W A;  3L71 J;  2FFD C;  1N7S B;  1Q82 Q;  2H88 C;  5KLV K;  2NPS D;  1L0L D;  1RF0 C;  1JO5 A;  3VN0 A;  2FKW B;  1FZC A;  3L71 D;  1JY3 O;  3CC4 P;  2WSS H;  4D6T J;  4TT3 H;  1COT A;  3HQ9 A;  1LT9 C;  1M8O B;  1SQX J;  2Q5U A;  1CIH A;  3AEA C;  1IQC A;  2WPS A;  2QJY C;  2E43 A;  1T8Z A;  2M3E A;  2YIU C;  1M7L A;  4FAN A;  4D6T D;  2J58 A;  1U74 B;  4BXL A;  1SQX D;  1ZZH A;  3CXH E;  3T97 A;  1JTH A;  2BCC J;  2M3B A;  5M1B A;  4PWA A;  2GIW A;  3HD7 C;  1BCC J;  1L9J C;  4WQD A;  3Q1M A;  3BRT B;  1GK4 A;  1H0T A;  2WWW A;  1JTH B;  3EFG A;  2OZ1 A;  2BCC D;  3M0A A;  1SQV K;  2H8P D;  2QJK B;  1KYO I;  2ZON G;  1BCC D;  3FGA D;  1H0T B;  1D7M A;  2OZ1 B;  1K3H A;  4O9B A;  1RE4 C;  3OA8 A;  5AW8 B;  3FX0 A;  4DZO A;  3HUS B;  1EZV E;  1RH5 B;  2D2C B;  5KLV G;  2N18 C;  1GTW A;  4H13 B;  4AAO A;  4L3G A;  3L75 E;  3CCU P;  5TIS H;  2FWL A;  3GF7 A;  1HTL C;  2K9J A;  3PLN A;  1HWT C;  1YQ3 C;  2HYN A;  2G3A A;  2NPS B;  5CJ4 A;  3A0H V;  3VOP A;  1SQQ E;  2IZ0 A;  1IC2 A;  1A56 A;  1CI6 A;  1C2R A;  3RBZ A;  3CPW O;  1IRV A;  4U3F E;  5BVZ A;  4Y99 C;  4O1Q A;  2AI5 A;  2ZXE B;  1OW8 A;  4YPC A;  1N90 A;  1R5S A;  3DR0 A;  1OX3 A;  1M1K Q;  1YCC A;  2E74 D;  1M1J C;  2P2U A;  1DIP A;  3GLM A;  4WQE A;  3HRN A;  2K3R A;  3L75 J;  3A2A A;  3II6 A;  3CXH I;  2OYH C;  3L37 A;  1RF1 C;  3R2P A;  2KNC A;  1XTG B;  2W27 A;  2QJP B;  3B8E B;  4OWF A;  4Z1M H;  3L75 D;  4WQA A;  1SQV G;  1LS9 A;  1S72 P;  1IFJ A;  1DW2 A;  1N7S C;  2RKL A;  3ZOW A;  2P67 A;  4U3F J;  4N3Y B;  2MHM A;  5KLI B;  1VQ7 P;  1AFO A;  1MZ9 A;  1YIQ A;  2ZT9 D;  1HVV A;  3SWF A;  1T2K D;  2W6B A;  5E79 E;  5BU5 A;  1EDJ A;  2WT7 A;  2M5A B;  2PGD A;  5APQ A;  4AAN A;  4U3F D;  4WQC A;  2OTK E;  5H2F E;  1P84 I;  3AE8 C;  1S9K D;  1PP9 E;  1EZV I;  1N73 A;  3SVW A;  1H32 B;  4A7P A;  1CZQ A;  1Q2N A;  1ZLL A;  1CIG A;  5DJQ B;  2FYN B;  3NWV A;  4EYY Q;  2ZOO A;  5APT A;  1X8Y A;  1A2S A;  2WSF H;  2HFE D;  2HG5 D;  5AVV B;  3H1H E;  2N3Y A;  3L74 E;  4FB1 A;  1DVV A;  1SS1 A;  2CXB A;  1DW0 A;  2HOD A;  1JY3 N;  1FZG A;  2V08 A;  2QRX A;  3C9I A;  3A0B E;  2CE0 A;  1YHQ P;  2IX7 C;  2A45 G;  1KIB A;  3D6Y A;  1H1O A;  2HOD B;  1RZ5 A;  4HB1 A;  1EC5 A;  5AW6 B;  1PP9 J;  1S2E A;  1NTZ K;  2QJK C;  3VP9 A;  1SFC D;  1CTJ A;  2JP3 A;  1KMI Z;  2E74 B;  1AVY A;  1PP9 D;  2WVR A;  4C7N A;  1KB9 E;  1LTS C;  1U7M A;  4XXL A;  3HUS C;  3L74 J;  3L72 E;  2YMY A;  2D2C C;  1KIL E;  1IZN B;  1E2R A;  1CW5 A;  3H1I J;  3SLE A;  2QM7 A;  4H13 C;  1CRY A;  2I1K A;  5KJ7 D;  4C7N B;  1GMJ A;  3KQG A;  1YFC A;  1NML A;  1LWU A;  2I8D A;  2YKO A;  1OFC X;  3H1K E;  1Q7Y Q;  2N3B A;  1LTI C;  3H1I D;  2NPS C;  3ABV C;  1YTZ T;  3QWO C;  3C2C A;  4HKZ H;  1LWU B;  3A0H H;  3AE1 C;  1Q86 Q;  2YKQ A;  2ZT9 B;  1EQ7 A;  1OZH A;  3PXW A;  5B66 E;  2C1D B;  3V2N A;  1S5L X;  5AVR B;  4FA4 A;  1FI3 A;  5KAI V;  1M6Z A;  2Q9I A;  5CIF B;  4PD4 H;  3MUD C;  3H1L J;  2RN0 A;  1FZB A;  3L72 J;  1N50 A;  1KQG B;  2P58 A;  2B89 A;  2W8Z A;  3VMZ A;  5AVX B;  1CXC A;  3H1L D;  4H0J A;  4Y5R A;  2L91 A;  3CC7 P;  1FOS E;  2QJP C;  1HZV A;  1SQP G;  1MZ4 A;  4WQ8 A;  1GDT A;  3NBS A;  2KZI A;  1YEA A;  3M0D C;  2FRC A;  1NTZ G;  2DGE A;  3RL0 D;  5KLI C;  1DIQ C;  1GU2 A;  3OCD B;  1FI9 A;  2A06 G;  1M56 D;  3PRJ A;  3U1A A;  2B12 B;  1M90 Q;  1KB9 I;  3CCR P;  2OYI A;  1CSB A;  2V07 A;  3D6Z A;  1NGM B;  4ASW A;  3PTZ A;  1YJW P;  2OGU A;  1M70 A;  3H6P A;  5DJQ C;  3B5N A;  3TNU A;  3V2Q A;  2FYN C;  1PL5 A;  3VNW A;  2P10 A;  2ZJS E;  3EFF K;  1G1J A;  4TLF A;  3N4X A;  2Y9Z A;  5APV A;  1R8E A;  4ASV A;  3KXD A;  2Z5I A;  1AA0 A;  2B9B A;  3FXE A;  3CX5 W;  3K5B A;  3RGU A;  4WQB A;  5CIB B;  1CTY A;  3M91 A;  4JCG A;  2R3C A;  1VQ6 P;  2JQR A;  1OIP A;  1C6O A;  3CCS P;  4L1Q A;  2E74 C;  2Q3I A;  4WQ7 A;  4GDO A;  3CCJ P;  1I54 A;  1KIL A;  2QG4 A;  2Z4E A;  1KB0 A;  1DD4 A;  3E7K A;  4DY9 A;  1N2D C;  1ZN5 A;  2OYO A;  1R5L A;  2K37 A;  3CWB G;  1KD1 Q;  1BGY J;  5GTI V;  5GTH E;  2E5Y A;  1I6D A;  1KZU B;  4QMA A;  3I56 P;  1I55 A;  4GIF A;  1E8E A;  1QVG O;  1EDK A;  1IK7 A;  2HPC A;  1K04 A;  3RL0 B;  1BGY D;  4Q5P A;  1LWU C;  2R5D A;  3CX5 D;  1HJ0 A;  3PXT A;  2ZT9 C;  3AEE C;  4UB6 V;  1KTM A;  1RE3 A;  2SPZ A;  1OAE A;  3PXS A;  1DX7 A;  4WY4 A;  2W6J H;  1PFI A;  2YNY A;  1LC2 A;  3MD0 A;  3MP7 B;  1S5L V;  2B87 B;  3WU2 V;  1LTJ B;  2IBZ D;  1EB7 A;  2B11 B;  3DMI A;  1W2L A;  1CYJ A;  1VPC A;  4L3H A;  3P8C E;  1H33 A;  2Q7C A;  2FYU E;  4MN4 C;  1HJ4 A;  1FJK A;  4M3L A;  2OTJ P;  5AW4 B;  3QH9 A;  3G9R A;  2JWA A;  1EDL A;  1OMI A;  1L4A A;  2OQQ A;  3M06 A;  2GM4 A;  2C9L Y;  1FE6 A;  4NPE A;  4PJ0 E;  2XND H;  1NTM K;  2RH0 A;  4BWN A;  1RAP A;  1S1C X;  1CSV A;  2KIK A;  1IRW A;  3W67 A;  1ZRT E;  1LMS A;  1HJ3 A;  3IN6 A;  3TGU J;  2LIT A;  1CSX A;  1GZL A;  3JCU E;  1VQ5 P;  5KJ7 C;  2JR8 A;  3WFD C;  2Y0E A;  2WMM A;  1URQ A;  4H0L D;  1G2C B;  1YTC A;  1IFP A;  3WMM 0;  1CRI A;  3WFE C;  3TGU D;  2JJL A;  5CIG B;  2LKM A;  3IR9 A;  3O0R C;  4K3A A;  1ZR4 A;  1SQB E;  3KPE A;  1JMM A;  1Q90 D;  1PPJ G;  1KN7 A;  4GKG A;  1VL2 A;  2GC4 D;  3P7K A;  2YXR B;  3HE4 B;  3MK7 B;  5DF5 A;  1JCD A;  4C7R A;  5CCG A;  2GB8 B;  3CYT I;  4PV1 D;  1ZRT D;  2ZZS 1;  4OGQ D;  1VQM P;  1L0L K;  5GTI H;  2AEJ A;  1HRC A;  1HCM A;  2E76 D;  2N1T A;  1SQB J;  1K05 A;  3RL0 C;  1HRO A;  1NTM G;  1M57 D;  1YQ4 C;  1JDL A;  2I8F A;  2WPQ A;  3RK3 E;  4UB6 H;  1SQB D;  2D0W A;  1C6R A;  3JSV C;  1HJB A;  5APY A;  1OVU A;  2O3J A;  3L4F A;  2BCN B;  1QVF O;  2KP8 A;  3WC8 A;  1S5L H;  1ZME C;  5AVY B;  3WU2 H;  1LTJ C;  1I8O A;  1SQX K;  2CPB A;  1L0N E;  2ZVO B;  5AW2 B;  3D70 A;  4H0L B;  1DVH A;  1J1D B;  1FDO A;  3SFD C;  2A45 H;  1YIT P;  1IFM A;  5CIC B;  2P1J A;  3CCV P;  2KLV A;  3Q5R A;  2N9I A;  5AVW B;  1FZC B;  2Y0C A;  3G3Z A;  3TK1 A;  1LTT C;  2Q1K A;  4L73 A;  1JY3 P;  1KYO D;  1H89 A;  4IL6 H;  3O20 A;  3RK3 D;  1DW1 A;  2BEZ F;  3KZI V;  4NFG B;  3JC2 2;  1L0L G;  4UB8 V;  1VQO P;  1C7M A;  1L0N J;  3B71 A;  1AQT A;  2CA3 B;  1OVR A;  1ZW0 A;  1NTK E;  4PV1 B;  3RN0 A;  4HYT B;  3L71 G;  1KOR A;  3MIW A;  3T97 B;  4OGQ B;  2Q6Q A;  1CHJ A;  3X39 A;  1L0N D;  1COR A;  1FAV A;  2E76 B;  3V2R A;  1USD A;  1QL1 A;  2ITA A;  3N7N A;  4EI2 A;  4JQ0 D;  1T6A A;  1JY2 N;  1HUC A;  4MU8 A;  2AXT V;  1P84 E;  2WSE J;  1VQP P;  4D6T G;  1VQL P;  1G1I A;  3RL0 g;  1SQX G;  1LTB C;  1QYZ A;  4CPG A;  4JBZ A;  3OA8 B;  3EQ2 A;  1NTK J;  2JEE A;  4GYD A;  2B10 B;  3MK7 C;  4W7Y A;  1H88 A;  1CED A;  3CXH D;  5KAF E;  2HLO A;  1CTZ A;  2BCC G;  3PJS K;  1NTK D;  2K9J B;  1CRH A;  3S9O A;  1BCC G;  3M9Q A;  1BL9 A;  2C1V A;  3SXT A;  5CCG C;  1VQ4 P;  2GC7 D;  2LR2 A;  4GOF A;  4XYD B;  1CI6 B;  1K8A Q;  3MHV A;  1GW4 A;  2B4Z A;  1FS0 E;  3R4Y A;  3RMZ A;  4YXD C;  2LXB A;  4HH2 A;  4WWI A;  1GKS A;  1USE A;  2DW3 A;  2BEQ D;  4R4M A;  2MKV A;  2L4D A;  4N0K A;  1P84 D;  3RK3 B;  4AAM A;  1EZV D;  4EDF A;  3G71 P;  1FZA A;  1AQ5 A;  3GHG A;  1JMB A;  4FA5 A;  2J59 M;  1M60 A;  1SQQ J;  5AVU B;  3C1L A;  2W83 C;  2KNC B;  2V7Q H;  1QEX A;  3NTN A;  1I6E A;  3CL3 D;  2K1A A;  1H31 A;  4H0L C;  1J1D C;  1SQQ D;  4AYC A;  4EIF A;  5APS A;  1GJQ A;  3VMY A;  3ZOO A;  4O1W A;  1W5C E;  1BE3 E;  1FZC C;  5B5E V;  2WT7 B;  1T3J A;  2FBW C;  3GW6 A;  1N73 B;  3G6E P;  3AEG C;  3L75 G;  2ZAE B;  4LLH A;  3L73 G;  1FOC A;  2FXO A;  1FU1 A;  3KZI H;  1QX8 A;  3RBX A;  2O01 H;  4UB8 H;  4PV1 C;  1HGV A;  5TIS E;  1CYI A;  1R0Q A;  4U3F G;  4OGQ C;  1IO3 A;  1U75 B;  3MZW B;  1BE3 J;  1LTG C;  2E76 C;  1WRG A;  2A45 I;  1NAY A;  1SQP E;  4WQ9 A;  4AX3 A;  3A7O A;  2GA1 A;  3OAK A;  1NTZ E;  1IK9 A;  2AXT H;  3H1H J;  1BE3 D;  1RQU A;  1PV3 A;  2B88 A;  2J5U A;  2YO2 A;  2CK3 H;  2V4H A;  2KS1 A;  3B5N D;  3H1H D;  2ZFC A;  3L74 D;  1OXZ A;  2UWJ E;  2H7H A;  2AIU A;  2IZ1 A;  1F1C A;  5K5G B;  1W5C T;  2C2C A;  2DVH A;  5CHX A;  1CC5 A;  1SQP J;  2B0Z B;  4I2L C;  3CX5 H;  2KK7 A;  4IOI H;  5CCH A;  3SWK A;  3ZBM A;  3Q2Y A;  1QN2 A;  1H9X A;  1PP9 G;  2IYO A;  1CXA A;  1SQP D;  1QLE D;  4QAO A;  2WZ7 A;  1PZQ A;  3H32 A;  1AOQ A;  2PCB B;  1CIE A;  1YTZ I;  1KB9 D;  3FWL A;  3RK3 C;  4B86 A;  3H1K J;  3L72 D;  1KIL D;  3I55 P;  1XTC C;  2AEM A;  3H1I G;  4FAV A;  3BCC E;  4OVN F;  4K35 A;  3P8M C;  2O1J A;  4JYB A;  1CNO A;  2MJZ A;  3D71 A;  1FOS F;  3H1K D;  1GL2 A;  3HE5 A;  4JPZ B;  1J1E B;  2YQB A;  1NAF A;  2ZXX A;  4GT1 A;  3CWB E;  1HH0 A;  2BPB B;  1ZR2 A;  1BDC A;  1FC2 C;  2YMK A;  4P4Q B;  3H1L G;  4OH8 B;  1U57 A;  5B5E H;  1SFC A;  3L70 G;  4WY4 D;  2BGV X;  2QVA A;  2O01 N;  2OYI B;  2L5G B;  3S4R A;  3BCC J;  3I5C A;  1N73 C;  5B6Q A;  5BU8 B;  1W2B O;  3O8Z A;  4EIE A;  3GG2 A;  1NKN A;  2YXQ B;  1N8R Q;  3TNU B;  3B5N B;  1FBM A;  1ZOY C;  1N15 A;  2FXP A;  3AE7 C;  3BCC D;  4FA1 A;  4YE1 A;  1L2P A;  3RK2 D;  1KFN A;  1JEK A;  3CWB J;  3NMD A;  2O1K A;  3LID A;  5AVZ B;  2QE7 H;  3DP5 A;  2JKV A;  4JYC A;  3ITK A;  4N78 E;  3A0H E;  4V2K A;  3CWB D;  1JUN A;  2QIW A;  1CSU A;  4RJT A;  1OW7 A;  1L4A D;  4DT0 A;  3V6I A;  4EIJ A;  3CI9 A;  1CHH A;  4H44 D;  1LGH B;  3CC2 P;  3C8V A;  1KIL B;  1CRJ A;  1SLQ A;  2CPS A;  3H1J E;  3PH2 B;  1A8C A;  2ZBO A;  2ZYA A;  1I5T A;  1WEJ F;  1KQL A;  2LIR A;  2FYZ A;  2HPC B;  3L35 A;  5KAI H;  2H43 A;  2M0B A;  1HJ5 A;  2E42 A;  1NU1 K;  3GMA A;  1H8A A;  5EXQ A;  3D0W A;  1YBK A;  3MTU E;  4N78 D;  4LC1 A;  1VF5 B;  1FHB A;  4K3I A;  4WY4 B;  3H1J J;  3USS A;  3CCE P;  4W7Z A;  4HJG H;  1KV9 A;  2R44 A;  5IY5 1;  1QGK B;  4N6J A;  2FFD A;  5C0Z A;  1PPJ E;  1BSH A;  1BGY G;  1RF0 A;  5CCG D;  1PGQ A;  1K73 Q;  1OVV A;  3LIE A;  3H1J D;  155C A;  5L8R J;  3RK2 B;  1NHL A;  1LTA C;  1H33 B;  3IF4 A;  1SP4 A;  1J1E C;  2BAS A;  3BRV B;  3G4S P;  5CBN A;  4L76 A;  2PCC B;  2ORL A;  1KYO H;  3Q3D A;  1HH7 A;  1LT9 A;  4PD4 I;  2GUV A;  3JBT B;  1L4A B;  2IBZ G;  1KC8 Q;  4ZMD A;  5AVS B;  4H44 B;  2OYI C;  1JY2 P;  2FYU J;  3L4M A;  3AED C;  3B5N C;  3HD7 A;  4Y28 J;  3AE4 C;  2WIT A;  3P8C D;  5C39 A;  1NU1 G;  2C1U A;  5E79 V;  1URQ B;  3PHL A;  5CYT R;  2FYU D;  2IYP A;  4BRY A;  3CMA P;  5H2F V;  3SWS A;  2C9X B;  3LW5 J;  4NPD A;  3M97 X;  1KQF B;  3ORV A;  1RE4 A;  4WBA A;  1RY3 A;  1SQB K;  1YJN P;  1VQN P;  1RZ6 A;  3A3Y B;  4PW9 B;  3VYI A;  3CXH H;  5AVQ B;  3A0B V;  1KIL C;  3TGU G;  3A9F A;  1C6S A;  4YXW H;  1LP1 A;  3CU4 A;  1IFI A;  3VMA A;  1EDI A;  1ZP0 C;  2N9B A;  2PRR A;  3V5B A;  3VRD A;  1MFZ A;  2N1T B;  3WUT A;  3AE3 C;  1Q81 Q;  3L71 E;  1N9C A;  1M1J A;  2RMZ A;  1KYO W;  2KSJ A;  1CRG A;  1P84 H;  1AYG A;  1S4X A;  1PGP A;  2XKM A;  1YIJ P;  1RE3 C;  1TU3 F;  2OYH A;  1RF1 A;  3V4W A;  3WUI A;  4WY4 C;  3HTK A;  4I6M C;  3M9B A;  5CIE B;  3RN1 A;  4I1L A;  2OYH B;  3ZCF A;  1YI2 P;  5KLV E;  1N7S A;  1AVO A;  3FWN A;  3AE6 C;  5B66 V;  5CBO A;  4H0K A;  2POH A;  2R32 A;  1L0N K;  1X0T A;  3RK2 C;  1EXJ A;  1SQB G;  2GUS A;  2XDJ A;  3AE5 C;  4J20 A;  2BCC E;  2C0W A;  1DD3 A;  1BCC E;  1L9B C;  1J3S A;  3BVH A;  1KQS O;  3CP5 A;  1VDF A;  1Z56 A;  1L4A C;  2XU6 A;  2QM8 A;  4H44 C;  5KLV J;  3L36 A;  3CXH W;  2KLU A;  2JDI H;  1KX2 A;  4JF7 A;  4DOJ A;  5KLV D;  1NTK K;  1Y9B A;  1QL3 A;  3CCM P;  1URQ C;  2PAC A;  5E79 H;  1SQV E;  3TYY A;  3V4Q A;  5GTI E;  5H2F H;  1NMI A;  451C A;  1WMK A;  2QSI A;  2XTS B;  2Q3E A;  3CLQ A;  1NWQ A;  2XV5 A;  4IFF A;  1FDI A;  1NKZ B;  1MUU A;  2R5B A;  3ZOY A;  3HUS A;  1T3U A;  4UB6 E;  3TF5 A;  2E5T A;  1NNO A;  3AE2 C;  3GF3 A;  1KX7 A;  1Y47 A;  1L0N G;  1GDV A;  3CCQ P;  3M9H A;  1W2E A;  1K9M Q;  3A0B H;  1S5L E;  1PIX A;  1WVE C;  2NPS A;  2I1J A;  2YCC A;  1SQV J;  3WU2 E;  3L73 E;  1MKM A;  1ZV8 A;  1VQ9 P;  1SVF A;  1SQQ K;  3OJA B;  3Q5S A;  5TJH A;  2WSC J;  4WB4 A;  2HV4 A;  2K9Y A;  2YO3 A;  1CYC A;  3MUD A;  1IFD A;  1AJY A;  1SQV D;  2N1T C;  3AEC C;  5CID B;  1S9K E;  2KI7 B;  1KB9 H;  2EXV A;  2OAR A;  1UII A;  3E1I A;  1MFT A;  4RES B;  1NVO A;  4IL6 E;  5GTH V;  2C9N Y;  5AW5 B;  4FA9 A;  4AQR D;  1NTK G;  3TDK A;  1JB0 J;  4KHX A;  3O5C A;  3GHG B;  3W68 A;  3P32 A;  3L73 J;  1BSN A;  5APU A;  2E75 D;  3M0D A;  2ZVN B;  2CA4 B;  3WFB C;  5B66 H;  1H31 B;  1CRC A;  2NZ2 A;  2ZYG A;  3L73 D;  3O6Q A;  1NO4 A;  5CCH D;  2M5A A;  1FZE A;  1EZV G;  3WUU A;  1VQ8 P;  1K3G A;  3O6Q B;  3S1K A;  3VTP C;  1H32 A;  2K88 A;  2HR3 A;  4XA4 A;  1N86 A;  1MG3 D;  1QL2 A;  1SQQ G;  3TYI A;  1CO6 A;  3SJL A;  1JNM A;  1HF9 A;  2WQY C;  2OTL P;  5KKZ B;  4IFD K;  3H1I E;  1GL2 D;  2JTI B;  2P7J A;  2WTY A;  5AW7 B;  2AXC A;  1OCD A;  4GED B;  3TSI A;  4PJ0 V;  3OW2 O;  1EXI A;  1KFM A;  1DEE G;  5APX A;  3CME P;  1SQP K;  2A06 E;  1MG2 D;  2LXC B;  5AVT B;  2C8S A;  3VP8 A;  1FDM A;  1GD2 E;  1QL4 A;  1J2J B;  2KSE A;  3H1L E;  3U1C A;  1YNR A;  2KS1 B;  3L70 E;  2KOG A;  3KHU A;  1ETP A;  1E79 H;  2E75 B;  1ZXG A;  5AW3 B;  1IO4 A;  1BDD A;  1NTZ J;  2WPV B;  5C9M A;  1GK6 A;  1RQV A;  3H25 A;  3Q5P A;  2C1D A;  1GU4 A;  1BE3 G;  4LJI A;  2PAJ A;  2PFX A;  1NTZ D;  3ZIY A;  3H1H G;  4ZKU A;  4XE5 B;  3L74 G;  2A06 D;  4KT0 J;  3H32 B;  2QEX P;  2H89 C;  3L70 J;  1KV4 A;  1I8P A;  5GTH H;  1CHI A;  3L4O A;  3FXD A;  3GHG C;  2V7Q J;  3F89 A;  351C A;  3AEF C;  3KZI E;  3L70 D;  4UB8 E;  3V2P A;  1DEB A;  3OCD A;  3CCL P;  1GL2 B;  3HE5 B;  1CCR A;  4IL6 X;  1HZU A;  1GW3 A;  4I7Z B;  4RKU J;  1S6V B;  1VF5 D;  2ZXY A;  1JOC A;  4EID A;  3L72 G;  2YK3 A;  1CCH A;  1GIW A;  4GOE A;  4RSZ A;  3O1Y A;  2R3S A;  1SFC B;  1MV8 A;  2WSF J;  2AXT E;  3PP5 A;  3H1K G;  2XZR A;  4C46 A;  3OA7 A;  1FZF A;  1LT1 A;  5KJ7 A;  3SFE C;  2O01 J;  2NRG A;  5APW A;  3HQ8 A;  1DH3 A;  5KKZ C;  2D0S A;  2IDB A;  1FI7 A;  3RLM A;  2KXP B;  4EIC A;  1CIF A;  4L74 A;  1BGY E;  1PGJ A;  3BAS A;  3CX5 E;  2AEF A;  1FJ0 A;  4EOT A;  3MGN A;  4PJ0 H;  4PD4 E;  1HBW A;  1VQK P;  3LW5 H;  1C52 A;  1RHZ B;  2W6A A;  2BLF B;  1C2N A;  3AE9 C;  1H9Y A;  3BCC G;  3HQ7 A;  2KZJ A;  2QA4 P;  1AV1 A;  3JCU H;  1HGZ A;  3NXS A;  2IBZ E;  1YEB A;  1URQ D;  3HQ6 A;  3HD7 D;  2E75 C;  4DJG A;  1AOF A;  1C75 A;  2IFM A;  5AW0 B;  2YKP A;  1DT1 A;  3ZOX A;  3A5T A;  2IFN A;  3PH0 A;  5DJT B;  4KJM A;  4KMG A;  1E29 A;  5CCH C;  3UIA A;  1NU1 E;  2CE1 A;  1F1F A;  2FY8 A;  1WT6 A;  1T2K C;  1PGO A;  3VMX A;  2VHD A;  4PD4 D;  2B87 A;  5KAF V;  5B5E E;  1A02 F;  4RO0 A;  1IJD B;  1LTJ A;  1QKS A;  3WFC C;  1N7L A;  3VYM A;  2C0X A;  1JCC A;  2BH4 X;  1B7V A;  2FFD B;  3IAO A;  1DII C;  2W90 A;  4XFJ A;  2N1T D;  4WVZ A;  1VYD A;  2FYU K;  3CX5 I;  2PP6 A;  3TGU E;  1NU1 J;  1A02 J;  1GL2 C;  3WUV A;  5KTB A;  2N9J A;  4I7Z C;  2JWD A;  5CIH B;  3BAT A;  1IZL 0;  1NJI Q;  1IFN A;  1S3J A;  1NTM E;  1LT9 B;  5DFS A;  1NU1 D;  4IL6 V;  5AUR A;  2QJY B;  1UIX A;  2IBZ I;  2YIU B;  1SFC C;  3H1J G;  5CMZ A;  3NFQ A;  1GU5 A;  1LJ2 A; 
#chains in the Genus database with same CATH homology
 3CXH W;  1CSW A;  3VNW A;  1GQ1 A;  1PPJ D;  1KX2 A;  1CYI A;  5KLV D;  1QL3 A;  1R0Q A;  1IO3 A;  1U75 B;  2PAC A;  1FCD C;  1RAQ A;  1AKK A;  4WQ9 A;  1NMI A;  3CX5 W;  4AX3 A;  451C A;  4WQB A;  5CIB B;  2XTS B;  3NBT A;  2Q3E A;  1CTY A;  4JCG A;  2JQR A;  1C6O A;  1BE3 D;  4L1Q A;  3ZOY A;  4WQ7 A;  1NTM D;  3TF5 A;  2N18 B;  1I54 A;  1NNO A;  5TIS V;  1KX7 A;  2QG4 A;  2KS1 A;  1KB0 A;  1GDV A;  3H1H D;  4DY9 A;  3L74 D;  2AIU A;  5GTI V;  1WVE C;  1I6D A;  1F1C A;  1LFM A;  2YCC A;  1I55 A;  1W5C T;  2C2C A;  1E8E A;  2DVH A;  2Y0D A;  1CC5 A;  2B0Z B;  2N9Y B;  5TJH A;  2HV4 A;  1BGY D;  4Q5P A;  3ZBM A;  1QN2 A;  1CYC A;  1H9X A;  3CX5 D;  1SQV D;  3PXT A;  1DW3 A;  1CXA A;  1NIR A;  4UB6 V;  1SQP D;  2MTA C;  1OAE A;  3PXS A;  4QAO A;  5CID B;  2EXV A;  1AOQ A;  1LC2 A;  2PCB B;  1CIE A;  1KB9 D;  3FWL A;  1S5L V;  5GTH V;  4FA9 A;  3L72 D;  1YIC A;  3TDK A;  4AAL A;  3WU2 V;  3O5C A;  4FAV A;  2IBZ D;  1EB7 A;  2B11 B;  2BH5 X;  1LC1 A;  3DMI A;  1W2L A;  1CNO A;  1CYJ A;  4L3H A;  3H1K D;  1L0L D;  1H33 A;  2CA4 B;  3WFB C;  1H31 B;  2YQB A;  1CRC A;  3L73 D;  1HJ4 A;  2BPB B;  3L71 D;  2JWA A;  1K3G A;  1H32 A;  4P4Q B;  1COT A;  3HQ9 A;  2BGV X;  1CIH A;  1IQC A;  1RAP A;  5B6Q A;  1MG3 D;  4EIE A;  1CSV A;  3GG2 A;  1IRW A;  4FAN A;  4D6T D;  1LMS A;  1HJ3 A;  3TYI A;  2LIT A;  1CO6 A;  1U74 B;  3SJL A;  1SQX D;  1ZZH A;  1CSX A;  1N15 A;  3BCC D;  3WFD C;  4FA1 A;  4YE1 A;  2Y0E A;  5KKZ B;  4PWA A;  2GIW A;  1L9J C;  4WQD A;  1YTC A;  1CRI A;  3WFE C;  2JTI B;  3TGU D;  5CIG B;  2OZ1 A;  3DP5 A;  1OCD A;  4GED B;  3O0R C;  3ITK A;  2BCC D;  4PJ0 V;  2QJK B;  4V2K A;  2ZON G;  1BCC D;  3CWB D;  1CSU A;  4RJT A;  2OZ1 B;  1MG2 D;  1K3H A;  2C8S A;  1CHH A;  3OA8 A;  2GC4 D;  1QL4 A;  2N18 C;  3MK7 B;  5DF5 A;  4AAO A;  1CRJ A;  4L3G A;  1YNR A;  2FWL A;  2GB8 B;  3CYT I;  3PH2 B;  3KHU A;  1ETP A;  1ZRT D;  1A8C A;  2ZZS 1;  3PLN A;  2ZBO A;  1I5T A;  1WEJ F;  3A0H V;  2LIR A;  1HRC A;  1HCM A;  5C9M A;  1A56 A;  1C2R A;  2C1D A;  1IRV A;  1HRO A;  2AI5 A;  4O1Q A;  1N90 A;  1HJ5 A;  4LJI A;  3DR0 A;  5EXQ A;  1JDL A;  1NTZ D;  2I8F A;  3ZIY A;  1YCC A;  1SQB D;  2D0W A;  1FHB A;  4K3I A;  2A06 D;  1C6R A;  4WQE A;  2O3J A;  2BCN B;  1I8P A;  3WC8 A;  1CHI A;  1KV9 A;  5IY5 1;  2QJP B;  3L4O A;  5C0Z A;  1I8O A;  351C A;  3L75 D;  4WQA A;  1DVH A;  1LS9 A;  3H1J D;  155C A;  3L70 D;  1DW2 A;  3ZOW A;  2MHM A;  5KLI B;  3OCD A;  1H33 B;  5CIC B;  1CCR A;  1HZU A;  1YIQ A;  2PCC B;  2ORL A;  2N9I A;  1S6V B;  2Y0C A;  2ZXY A;  1HH7 A;  4EID A;  4AAN A;  4U3F D;  4WQC A;  2YK3 A;  1CCH A;  3JBT B;  1GIW A;  1KYO D;  4RSZ A;  3SVW A;  1H32 B;  3O1Y A;  4A7P A;  3O20 A;  1CIG A;  1DW1 A;  5DJQ B;  3KZI V;  2FYN B;  3NWV A;  4NFG B;  2ZOO A;  4UB8 V;  1C7M A;  1A2S A;  3L4M A;  2CA3 B;  2N3Y A;  4FB1 A;  1DVV A;  3RN0 A;  2CXB A;  1DW0 A;  2V08 A;  3HQ8 A;  1CHJ A;  2C1U A;  5E79 V;  3PHL A;  2CE0 A;  2D0S A;  5CYT R;  1L0N D;  2FYU D;  3X39 A;  1COR A;  1KIB A;  1H1O A;  5H2F V;  1FI7 A;  3RLM A;  4EIC A;  1CIF A;  1RZ5 A;  3SWS A;  2C9X B;  3M97 X;  1FJ0 A;  4MU8 A;  3ORV A;  2AXT V;  1CTJ A;  1C52 A;  2BLF B;  1C2N A;  1QYZ A;  1PP9 D;  1RZ6 A;  1H9Y A;  3HQ7 A;  3OA8 B;  4XXL A;  4PW9 B;  1E2R A;  4GYD A;  2B10 B;  3MK7 C;  3A0B V;  3SLE A;  1CRY A;  1YEB A;  3A9F A;  1CED A;  1C6S A;  3CXH D;  3HQ6 A;  1YFC A;  1NML A;  3CU4 A;  3VMA A;  1CTZ A;  1NTK D;  2K9J B;  1CRH A;  1AOF A;  1C75 A;  2N3B A;  1BL9 A;  1DT1 A;  3H1I D;  2C1V A;  3ZOX A;  3SXT A;  3C2C A;  2GC7 D;  3VRD A;  3PXW A;  4XYD B;  2C1D B;  4KMG A;  1N9C A;  1E29 A;  1FI3 A;  4FA4 A;  5KAI V;  2RMZ A;  1M6Z A;  1KYO W;  2B4Z A;  2CE1 A;  1F1F A;  5CIF B;  3RMZ A;  1CRG A;  1AYG A;  2RN0 A;  1GKS A;  2VHD A;  1N50 A;  4PD4 D;  2L4D A;  4N0K A;  1P84 D;  4AAM A;  1EZV D;  4EDF A;  3WUI A;  5KAF V;  1QKS A;  1CXC A;  3H1L D;  1M60 A;  4H0J A;  4Y5R A;  3WFC C;  4FA5 A;  2L91 A;  5CIE B;  3VYM A;  3RN1 A;  2BH4 X;  3ZCF A;  2KNC B;  1B7V A;  1HZV A;  1MZ4 A;  4WQ8 A;  1I6E A;  5B66 V;  1DII C;  3NBS A;  1H31 A;  1YEA A;  4H0K A;  1SQQ D;  1VYD A;  2FRC A;  2DGE A;  4EIF A;  1DIQ C;  1GU2 A;  1GJQ A;  3OCD B;  4J20 A;  1FI9 A;  3ZOO A;  2N9J A;  4O1W A;  3PRJ A;  5CIH B;  1L9B C;  1J3S A;  5B5E V;  1IZL 0;  2B12 B;  5DFS A;  3CP5 A;  1NU1 D;  3GW6 A;  2V07 A;  4IL6 V;  5AUR A;  2QJY B;  3PTZ A;  2YIU B;  1FOC A;  1M70 A;  5DJQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...