3L70D

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 70
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l70D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l70D02
1IQCA 1FCDC 1MG2D 2DGEA 1P84D 1CYJA 4Y5RA 2GC4D 5TISV 2A06D 4AX3A 2RN0A 3SXTA 1WVEC 2MTAC 4EIEA 1NMIA 1DIIC 2C9XB 5TJHA 2QJPB 2D0WA 1NTZD 1BCCD 2V08A 1QYZA 1IRVA 2B10B 5DFSA 4PW9B 1W2LA 1K3GA 1H32A 1M70A 2QJKB 1CRGA 5E79V 4NFGB 1L0LD 2N3BA 3CX5D 1N50A 1COTA 5H2FV 1OAEA 1CSWA 1QN2A 3L73D 3OCDB 1I6DA 1CIEA 1AOFA 1RAPA 1C52A 2JQRA 1A8CA 5B5EV 1H31A 2Y0CA 3L72D 3H1LD 3VNWA 1FI9A 1H1OA 4A7PA 2LITA 3O5CA 3WUIA 3WFBC 1CHJA 2B12B 1NNOA 2ZOOA 3CX5W 1A56A 2CXBA 1I5TA 3SJLA 1CYCA 3KZIV 1LS9A 2B4ZA 2GB8B 3ZBMA 5AURA 4QAOA 2DVHA 2OZ1B 3HQ9A 1E8EA 3CP5A 3PLNA 2C1UA 3OA8B 1QL4A 1FI7A 2KNCB 5GTIV 1DIQC 1HJ3A 1YCCA 4D6TD 1HH7A 3MK7C 5C9MA 4O1WA 1C2RA 5CIGB 4PJ0V 2O3JA 1HRCA 1KYOD 1A2SA 3CYTI 2C1VA 2BPBB 3PXSA 3KHUA 3CXHD 5CIDB 2C1DA 5KKZB 2B0ZB 3TGUD 5KAIV 4WQEA 4FA1A 1N9CA 1KB0A 4FAVA 4H0KA 3A0HV 3TF5A 4P4QB 3L4MA 4AAMA 1I54A 1C7MA 3ZOYA 1HJ4A 5C0ZA 1KYOW 1N90A 2BCNB 2IBZD 2QG4A 2GIWA 3CXHW 1FI3A 5DJQB 4L1QA 1CO6A 1CSXA 1GU2A 1BE3D 2D0SA 3WU2V 2YIUB 3FWLA 3PXTA 1CC5A 5EXQA 4FA5A 1C6SA 1B7VA 1OCDA 1CRYA 1CXCA 1AKKA 1H33B 1WEJF 3H1JD 1FJ0A 1S5LV 1W5CT 3HQ6A 1CTYA 3HQ7A 1SQPD 4N0KA 3RMZA 5KLIB 3MK7B 1CIGA 1H9YA 1HZVA 1IZL0 3NBSA 1LC2A 3RLMA 4DY9A 1KV9A 1HCMA 4WQAA 1DW1A 1CRCA 1SQQD 4IL6V 2L91A 4EIFA 4GYDA 1NTMD 5DF5A 1CRHA 1CNOA 4WQCA 2AIUA 4XYDB 451CA 4L3HA 1NU1D 1YEAA 1IO3A 1C75A 4H0JA 1DT1A 5KLVD 1H31B 2EXVA 1U75B 1MG3D 3PRJA 1QKSA 1LMSA 1QL3A 1CORA 4KMGA 2BLFB 3CWBD 3WFEC 4WQBA 351CA 3M97X 1RAQA 1ZZHA 1GDVA 2N18C 1C2NA 5CIFB 3WFDC 5B66V 3ZOOA 1CIHA 2CE0A 2L4DA 2C2CA 4EDFA 1YICA 1CHIA 2PACA 1HJ5A 1CIFA 3ZIYA 1PPJD 1DW3A 1GQ1A 1H9XA 4RJTA 2B11B 3GG2A 4AAOA 5CYTR 4XXLA 3L71D 4AALA 4GEDB 5CIEB 1LC1A 1C6RA 3RN1A 3VRDA 2ZONG 1YEBA 2C1DB 2N9IA 4FA4A 4J20A 3GW6A 2BH5X 4WQ8A 1NIRA 1LFMA 3HQ8A 2ORLA 3PHLA 1IRWA 1I8PA 1KX2A 1PP9D 4AANA 2Y0DA 5IY51 1I55A 1CCRA 5B6QA 2N18B 4L3GA 5CICB 2N9YB 3DP5A 2CA3B 1AOQA 2KS1A 1JDLA 4FA9A 3H1KD 1N15A 2PCBB 1NMLA 2Q3EA 1GIWA 3JBTB 3PXWA 1EZVD 1RZ5A 3H1ID 4LJIA 1K3HA 1R0QA 3OCDA 1CEDA 1CRIA 1DVVA 1U74B 3ORVA 5KAFV 3SLEA 1CCHA 1MZ4A 3CU4A 4MU8A 1H32B 2FYNB 4UB8V 1GKSA 4PD4D 3O1YA 2FWLA 1E29A 4JCGA 2LIRA 2PCCB 2I8FA 1DW0A 3DMIA 4EIDA 2BCCD 1YNRA 2QJYB 4WQ7A 1YFCA 1I8OA 5CIBB 3VYMA 3ZOWA 1M60A 3VMAA 3ZCFA 2OZ1A 3ITKA 1CSUA 3DR0A 3O20A 2FRCA 1HZUA 1FOCA 4EICA 3OA8A 1GJQA 3O0RC 3TYIA 1ZRTD 5DJQC 1E2RA 1F1CA 1L9JC 1SQXD 3L75D 3RN0A 1YIQA 2YCCA 4FANA 1CHHA 2N9JA 1DVHA 1I6EA 2Y0EA 3NWVA 3L70D 1CTZA 4WQ9A 3SVWA 1VYDA 1BGYD 2AXTV 1AYGA 1NTKD 3L4OA 2V07A 155CA 3C2CA 2XTSB 2C8SA 1ETPA 1YTCA 2YQBA 1RZ6A 1DW2A 1HROA 2BH4X 3X39A 3WFCC 3NBTA 2BGVX 2YK3A 1FHBA 3SWSA 4K3IA 1SQVD 1C6OA 2N3YA 5CIHB 3PTZA 2JTIB 4Q5PA 3TDKA 1CTJA 2AI5A 2RMZA 1SQBD 2CE1A 1KX7A 3A9FA 4YE1A 3WC8A 1EB7A 2VHDA 4RSZA 2HV4A 2K9JB 2FYUD 1CSVA 4U3FD 4UB6V 1S6VB 2JWAA 2GC7D 3A0BV 4V2KA 4O1QA 1J3SA 1BL9A 3ZOXA 4PWAA 1CXAA 1M6ZA 1KB9D 2ZBOA 3H1HD 1CYIA 1KIBA 5GTHV 3L74D 1H33A 4WQDA 2MHMA 1L9BC 2CA4B 3PH2B 4FB1A 1F1FA 1CRJA 3BCCD 2ZXYA 2ZZS1 1L0ND
chains in the Genus database with same CATH superfamily
1IQCA 2OTLP 1WT6A 1P84D 2YKQA 4WY4B 2KS1B 3IAOA 1CYJA 2IZ0A 1JUNA 1AVYA 2KOGA 1SQVG 1T2KD 3KZIH 1WVEC 1DIIC 1R5SA 1GL2A 2M5AA 2ZJSE 2E76C 1QYZA 2B10B 1K3GA 2K37A 1M70A 5E79V 1L0LD 3E7KA 3CCQP 3G4SP 2V4HA 5H2FV 1LWUA 3OCDB 1I6DA 1AOFA 2IBZG 1H31A 1AV1A 1N2DC 2Y0CA 2JEEA 1SFCC 3L74G 2LITA 1IFMA 1SQVJ 1X9VA 1LT9C 1A56A 2CXBA 1I5TA 1SVFA 2POHA 2E74B 2B4ZA 1JNMA 3ZBMA 4QAOA 1ZOYC 3CP5A 1QLED 2C1UA 3OA8B 1LTSC 2G8YA 3G6EP 1KC8Q 4ASWA 2P2UA 3SFDC 3L74J 1VQPP 5C9MA 4O1WA 5L8RJ 1RHZB 1C2RA 1NWQA 2LR2A 2FBWC 1FZBA 2C1VA 2BPBB 1J2JB 4ZNCA 1KZUB 3L36A 1L4AC 1M56D 1M1KQ 3WMM0 4EIJA 1PPJE 3JCUE 1S5LH 3TSIA 1KYOE 2KZJA 3CCUP 1YJWP 3A0HV 1M90Q 3WUUA 3L4MA 5KLVK 1I54A 4DZOA 1HJ4A 1KYOW 1HGVA 3L71E 1JY2P 1LT9B 4BRYA 1FI3A 2A45H 4IL6H 4PD4H 3CWBG 1M8OB 1BE3D 3WU2V 5CCHC 5M1BA 2E74D 2K1AA 1B7VA 3AE6C 2BEQD 2P67A 1AKKA 1H33B 4WY4A 2QVAA 4AUWA 3H1JD 1W5CT 3HD7C 1SQPD 3RMZA 5C39A 3O8ZA 3B5NA 2CPSA 3CWBJ 5AW2B 2E76D 5CCGA 1ZR4A 1PGJA 2KXPB 1ZN5A 1DD3A 1FZGA 1AA0A 4HJGH 1SQQE 451CA 1KILC 4JF7A 4L3HA 1JB0J 5DJTB 1LGHB 1BE3G 1CW5A 3E1RA 2HYNA 1BDCA 1C75A 4H0JA 1SFCD 1FOSF 1N7SA 3I55P 3AEEC 1QKSA 2IZ1A 1QL3A 3CCRP 3SSUA 2B89A 2BLFB 1VF5D 1KB9I 1SQPG 1IO4A 3WFDC 5B66V 3ZOOA 1CIHA 2CE0A 1U57A 2FFDC 1FDIA 1X8YA 1YICA 2PACA 1HJ5A 1CIFA 1VQ5P 1BE3J 1GQ1A 5AVWB 2OGUA 1FDMA 1YITP 4RJTA 3V2PA 1P84H 5CJ4A 1KN7A 3H32B 3K5BA 2LKMA 4GDOA 5CIEB 1HTLC 1SQPJ 1L4AD 1KILB 1YEBA 2C1DB 1S9KE 1OZHA 4J20A 3CX5I 5BU8B 1HBWA 2KZIA 3FXDA 1PP9D 4N78D 1VQNP 4EI2A 5KAFH 3GF3A 1PGPA 5KAIE 1SQXG 5AW5B 1CCRA 5B6QA 5CCHD 1R8EA 1FS0E 2FFDB 1NTKK 5CBOA 3M06A 1QL2A 2OQQA 5AVUB 5AW9B 1GIWA 1S3JA 1H0TB 3HD7D 3H1KE 3H1ID 1SQVK 3HTKA 1K3HA 4KJMA 4EYYQ 1SQXJ 1L0NE 3ORVA 4I7ZC 1SQBG 1EZVE 2PAJA 1T3UA 1OVUA 1YIJP 2PRRA 5KJ7A 5AVVB 1FAVA 1ZXGA 5KKZC 2PCCB 4XE5B 3CCSP 2I8FA 1DW0A 1EC5A 1UIIA 3PH0A 3V6IA 1HUCA 2Y9YA 3GLMA 2OZ1A 1FBMA 3ITKA 1ZW0A 1JMMA 1S5LX 2FRCA 3SWKA 2IBZI 1L0NK 1GJQA 1SQBJ 1F1CA 1L9JC 1AFOA 1LTTC 4FANA 3MGNA 3H1IG 2AEJA 4UB6H 3Q5RA 2XV5A 3RK3E 4IL6X 4NPEA 1ZRTE 2AXTV 1NAYA 4DT0A 2AXCA 1ETPA 2ZAEB 3Q2YA 1HROA 2E75B 2BH4X 1L0LK 4R4MA 3L70E 1VQLP 3X39A 2OTJP 5KLIC 1BGYE 3VP9A 3CC2P 3H32A 4I7ZB 3SWSA 1IJDB 1VQOP 1RF0C 3TDKA 2RMZA 1EXJA 2H7HA 1YI2P 1EB7A 3H1IJ 3JSVC 2FYUD 1GL2C 3P8MC 3ZDMA 1Q90D 2JWDA 1S6VB 2GC7D 1H89A 4V2KA 1FU1A 3BASA 4O1QA 3A2AA 2ZT9B 1CXAA 1KB9D 1PGQA 3H1HD 4UB8H 5E79H 5GTHV 2N1TC 1DEEG 3AEBC 4FB1A 3V2RA 1X0TA 1MUUA 3TNUB 2WVRA 1T2KC 1FCDC 1MG2D 2H89C 2QSIA 2A06D 4AX3A 2IFMA 3SXTA 4EIEA 5TJHA 5CHXA 2QJPB 3A7OA 1M1JB 1NTZD 2V08A 4YXWH 1IRVA 1YTZI 1CSBA 3RK2C 1W2LA 1SLQA 3GHGC 4H44C 2J5UA 4NFGB 3CX5D 1QN2A 3L73D 3HRNA 3CPWO 1CIEA 1BCCE 2JQRA 1OVVA 1HF9A 3L72D 2QA4P 3H1LD 1RF1A 4IFMA 3IFMA 3M0DA 1NNOA 4I1LA 2MJZA 5AVSB 2N1TB 2WSCH 1BSHA 4GIFA 1FZCB 4HKZH 2GB8B 2DVHA 2P58A 3A0HH 3LIDA 1E8EA 3V5BA 3PLNA 1SQPK 2I8DA 2NPSC 1YJNP 5GTIV 1DIQC 1YCCA 3CD6P 1OMIA 2R3SA 2KK7A 3AEDC 3AEFC 1HH7A 2XDJA 3WU2H 4PJ0V 3RK2B 1A2SA 3M9HA 3GHGB 2V7QJ 3U59A 2H43A 4D6TE 2FXMA 3KHUA 3AEGC 3S1KA 3L72G 3H1LG 3M91A 5AW6B 1NU1G 3B5NC 1IFJA 4FAVA 2WT7B 1LTJA 3CXHE 4WWIA 3VOPA 1JY3P 3VTPC 2E42A 1GL2D 4WVZA 4NPDA 3TGUE 2ZFCA 3I56P 2BCNB 2IBZD 1GU4A 3CXHW 5DJQB 1EXIA 4L1QA 1E79H 3O6QA 3Q1MA 2OYIB 1MFZA 2QJYC 1NKZB 1CSXA 2Q3IA 1SQXK 2YIUB 2DW3A 4FA5A 1GD2E 2WWWA 1FZFA 3L72J 3H1LJ 1CRYA 1CXCA 1NU1J 1S72P 1VQ6P 1PP9E 3HQ6A 1CTYA 3HQ7A 1YBKA 2GUVA 1CIGA 1H9YA 3FWNA 4LLHA 3NBSA 1NAFA 2I1JA 4WQAA 2W6JH 1CRCA 2W6BA 3CL3D 5B66H 2ZVOB 3RK2D 1BDDA 4H44D 4I2LC 3HUSB 1NTMD 4ZKUA 2AIUA 5TISE 4GODA 4XYDB 2XNXA 5AVXB 1W5CE 3LW5J 1RE3A 1VF5C 1MG3D 2O01N 3CWBD 3WFEC 1KILE 5B5EE 2YMYA 1RAQA 5KLVE 1ZZHA 2E5YA 1GDVA 1C2NA 5CIFB 3NFQA 1KB9H 3BRTB 2IDBA 4OGQC 1CHIA 2HFED 1EZVG 2RKLA 4CPGA 2NPSD 3UIAA 3IR9A 3KZIE 4Y99C 1JY3O 4L76A 2E76B 3T97B 3RL0C 1H9XA 1YYCA 1NTMG 3AECC 2V7QH 1RE4A 3GG2A 4AAOA 1GZLA 4IOIH 3M0AA 4IFDK 4XXLA 2HLOA 2R44A 2HPCB 2K9JA 3SFEC 3EFFK 3VRDA 2HODB 2FYNC 1SFCB 2G3AA 1E5WA 2WSFJ 3B5ND 2N9IA 1KFNA 3GW6A 3G71P 1Q2NA 3CCJP 2ZYAA 3CX5H 2ORLA 1DX7A 3PHLA 4JYBA 1VF5B 1JTHA 5K5GB 2OYIA 2O1JA 5CCGD 1HGZA 1NTMJ 3VMYA 3MZWB 4AANA 2Y0DA 3HE4B 2FYUE 1M7LA 5APTA 2N9YB 3VYIA 3DP5A 2YXQB 1AOQA 2KS1A 1LP1B 5AW7B 4OGQB 2OYHC 1OWAA 1N7SD 3H1HE 1VL2A 1GU5A 2AEMA 4Y99B 1NMLA 2R3CA 1GMJA 3A3YB 1USDA 2P7JA 1FZAA 1QX8A 2IYOA 3CCLP 1L4AB 1DH3A 4KT0J 3OCDA 1DVVA 1CRIA 2CPBA 1U74B 4LGDE 2Z5IA 1LTGC 4JBZA 3HUSA 2FYUK 1H32B 1S5LE 2FYNB 1KYOI 2AXTH 3CCVP 2C9LY 5AVZB 3D71A 2FWLA 2LIRA 3LW5H 1NTZE 1LNQA 3DMIA 4WQ7A 2W27A 3C9IA 1I8OA 2B88A 4IL6E 4ZKPA 3HE5B 4PD4E 3ZCFA 2KP8A 2H88C 3G9RA 2BCCE 3P32A 4EICA 3OA8A 3TYIA 3BCCG 1E2RA 1SQXD 1K04A 2YCCA 3HD7B 2OYHB 1ZMEC 2D2CC 2Y0EA 4TT3H 2E43A 2OTKE 1VYDA 1GK6A 4HH2A 3L75E 4OGQD 1NTZK 1AYGA 1N73C 3Q5SA 3E1IA 2V07A 5APXA 1YTCA 2YQBA 2C9NY 1RZ6A 3P8CE 1DW2A 5GTHH 1BCCG 3RL0D 2W6AA 3WFCC 1FHBA 5BU5A 2HPCA 1NTKE 4KHXA 4K3IA 2M3BA 1EQ7A 3BCCJ 5CIHB 2JTIB 2QE7H 3H25A 3H6PA 2NRGA 1SQBD 2CE1A 2WPSA 3F5HA 2RH0A 3WC8A 1BSNA 2VHDA 1LT9A 1G2CB 3CC4P 2FYZA 4Y28J 4GT1A 1SQVE 4C46A 3W67A 1BL9A 3MTUE 3M9QA 4RO0A 3KDPB 1BCCJ 3MUDA 1URQC 1KQGB 4RESB 4U3FE 1NOHA 5KJ7D 5BVZA 1CZQA 1H33A 4WQDA 1PGOA 2YXRB 1RF1C 1EDLA 5AVTB 1K05A 2ZXYA 4GKGA 1JCCA 3L74E 2DGEA 1N73B 4HB1A 2WSEJ 3PJSK 2OYOA 1J1EC 4U7JA 3BVHA 2MTAC 4K3AA 1L4AA 3MD0A 2C9XB 2KLVA 2D0WA 2Q7CA 1P84E 1Z56A 3B4SA 3FGAD 1H32A 3TK1A 1CRGA 2B87B 1JOCA 2KYVA 1OAEA 5GTIH 1HJ0A 1JCDA 1SS1A 1A8CA 1L0LE 2ITAA 5APSA 3VNWA 1FI9A 1H1OA 4PJ0H 1KQFB 5KAFE 4GOEA 1CHJA 4YPCA 2R32A 1URQB 2B12B 2ZOOA 3BATA 4JPZB 3AE8C 1NYHA 1FJKA 2Y9ZA 1AVOA 5AURA 3HD7A 3HQ9A 5APWA 3V4WA 3AE9C 2C0XA 2HG5D 1QL1A 4MN4C 1S1CX 1Y8AA 2Q6QA 2D2CD 3EFGA 2KNCB 2GM4A 1T3JA 3CWBE 3GF7A 1MKMA 1NKNA 5CIGB 1VQKP 3D6YA 1GDTA 2O1KA 1KYOD 1NTMK 1TU3F 3CYTI 2MKVA 1KILA 1VQ4P 1EZVI 5CIDB 2C1DA 2QEXP 5KKZB 1U7JA 5KAIV 1KB0A 4H0KA 3TF5A 2QM8A 1PL5A 2B9BA 1FJPA 3U1CA 1C7MA 3ZOYA 3AE5C 2GUSA 5KLVG 1N90A 1LWUC 5AW3B 3L35A 1CI6B 2QG4A 2K3RA 2WPVB 5H2FH 2FFDA 1URQD 1GU2A 3Q3DA 3P7KA 3PXTA 4JQ0D 3V2QA 3AE1C 1CC5A 1RQUA 1IC2A 4UB6E 1OCDA 1FDOA 1VQMP 3KPEA 1H0TA 1RE3C 2BASA 2YKOA 1BE3E 1G1IA 2WSEH 1WEJF 1PPJG 5KLIB 5KLVJ 1VQ8P 1QVGO 4K35A 4XA4A 1NHLA 1LC2A 1H88A 3RLMA 4DY9A 3AEAC 1KV9A 3H1JE 3L71G 1DW1A 1SQPE 1SQQD 3CC7P 1NVOA 1ZP0C 4EIFA 4GYDA 1GL2B 5CBNA 2KI7B 2M5AB 5DF5A 4H13C 1CNOA 1YQ3C 2HR3A 2QIWA 3MHVA 1NU1D 3VMXA 1LWUB 2JDIH 1OVRA 3NMDA 4UB8E 5E79E 3CXHH 1H31B 3R4YA 3CMAP 2EXVA 2PFXA 3L71J 3Q5PA 1DD4A 4WQBA 351CA 3M97X 2Z5HA 2N18C 2FKWB 2J58A 2L4DA 1QEXA 4EDFA 4ZMDA 1ZV8A 1SQQG 3ZIYA 1IK7A 1DW3A 1SQXE 2IPPA 4H44B 4WY4C 5KTBA 5CYTR 2Z4EA 3KYQA 3D0WA 2KSEA 4H13B 2WTYA 1LC1A 1C6RA 3RN1A 3L37A 1QGKB 2XKMA 2M3EA 2ZONG 2R5BA 2BCCG 2YKPA 1K8AQ 1IZNB 5AVQB 5CCGC 4FA4A 3CCEP 1NIRA 3RL0g 4IFFA 1LFMA 1CI6A 1LJ2A 1SQQJ 2L5GB 3HQ8A 1IRWA 4WBAA 2O01J 1I8PA 1LTAC 1ZR2A 1GW4A 4O9BA 3L75G 3TNUA 4BRYB 2I1KA 1GTWA 5IY51 3A0BE 3A0HE 1W2BO 2JR8A 2KIKA 2NPSB 2N18B 1N7SC 2XNDH 4N78E 1JDLA 1N86A 4FA9A 3H1KD 1N15A 2BCCJ 1NTKG 5APYA 1IFDA 1KTMA 4L73A 2Q3EA 1M1JA 3PXWA 1EZVD 3L4FA 1RZ5A 3WU2E 1RF0A 3B8EB 1R0QA 3CLQA 1SQBK 1CEDA 3L75J 5APQA 3B5NB 3VMZA 1MZ4A 3H1IE 4TLFA 3W68A 3CMEP 3FX0A 4UB8V 1D7MA 4C7NB 4U3FG 4H13D 2AEFA 3O1YA 1K73Q 3JCUH 4JCGA 1NTKJ 1KYOH 2KSJA 3CXHI 4EIDA 3R2PA 2N1TA 2QJYB 1LT1A 4DCKA 1YFCA 1FZCA 3VYMA 1Q81Q 3DR0A 2E5TA 3H1KG 1NJIQ 2NZ2A 1HZUA 3SWYA 1N7SB 3RK3D 1JY2N 3O0RC 1ZRTD 4OWFA 2N9BA 1L0NG 3RN0A 1YIQA 2YO3A 3D6ZA 1CHHA 2KB7P 3G3ZA 1AJYA 1DVHA 4H0LD 4U3FJ 3NWVA 3L70D 3MUDC 4NPFX 1BGYD 3NTNA 1WMKA 3L4OA 1MFTA 155CA 3C2CA 2XTSB 1VPCA 2C8SA 4PV1D 3GHGA 1HJBA 2LXCB 1W2EA 2K9YA 4GOFA 3N4XA 2WPQA 2YK3A 1J1DC 3H1KJ 4WY4D 1L0LG 5B66E 1L2PA 1HH0A 2WT7A 1QVFO 4RKUJ 2N3YA 2QJKC 2W90A 2YMKA 4Q5PA 1L0NJ 2AI5A 4YE1A 1IFIA 1GK4A 4BXLA 1VQ7P 2WZ7A 3A0BV 1T6AA 1J3SA 1OXZA 2O01H 5KJ7C 4I6MC 1GW3A 1X79B 2ZBOA 1H8AA 2M8RA 1CYIA 1L0LJ 2NPSA 1LTIC 3L70G 1OX3A 1S4XA 1BGYG 2CA4B 1KB9E 1F1FA 2OARA 1KQSO 1CRJA 3BCCD 2ZZS1 2BEZF 4OH8B 4W80A 3RL0B 4Y5RA 3EQ2A 2GC4D 5TISV 1JO5A 3OW2O 2RN0A 2CK3H 4QMAA 1NMIA 1J1DB 1S2EA 2ZXEB 5AW1B 1K9MQ 1BCCD 5DFSA 3VN0A 4PW9B 2FXOA 4M3LA 3L70J 2A06E 2QJKB 4XFJA 4DOJA 2N3BA 1BGYJ 2YNYA 2GA1A 3HTKB 1N50A 1COTA 4C7NA 5APUA 1CSWA 2W83C 2IFNA 1RAPA 2FY8A 4N6JA 1C52A 4Z1MH 5B5EV 4YTPC 1LTBC 1EDJA 3CX5E 3AE3C 4N3YB 4JYCA 1HWTC 3RBXA 3C1LA 4W7YA 4A7PA 3L73E 3O5CA 3WUIA 2P10A 3WFBC 4WB4A 3IF4A 3CX5W 3SJLA 1CYCA 3BRVB 3KZIV 3JC22 1LS9A 3L72E 4L75A 3H1LE 1DEBA 1HVVA 5KAIH 2C0WA 3TYYA 1NU1E 2OZ1B 3H1JG 3ABVC 3T97A 2W8ZA 1QL4A 4YXDC 5DJUB 1FI7A 1XTGB 3AE4C 1RQVA 1HJ3A 4R4LA 3NXSA 4D6TD 1N8RQ 1SQQK 2QM7A 3MIWA 3MK7C 1X22A 5AW4B 1OIPA 2O3JA 2QRXA 1HRCA 1OW6A 5EFWB 2HODA 1JY2O 1SFCA 3PXSA 3CXHD 4HYTB 2WSFH 2B0ZB 1NU1K 2AXTE 3TGUD 1NGMB 4WQEA 4FA1A 1PIXA 3H1JJ 1Y47A 1N9CA 3EWKA 4P4QB 4AAMA 1NO4A 4L74A 5AW8B 4B86A 1AQTA 5C0ZA 3HE4A 5AVRB 2JP3A 2A45I 2GIWA 4PD4I 1XTCC 1LP1A 3S9OA 1CO6A 1KORA 2D0SA 2D2CB 2P1JA 3FWLA 2IBZE 2KUBA 5EXQA 3M0DC 1YHQP 1C6SA 4D6TG 3KQGA 4C7RA 3CI9A 1FJ0A 1S5LV 4N0KA 2VRSA 5APVA 3MK7B 5GTHE 3IN6A 1HZVA 1IZL0 1R5LA 1T8ZA 1NH4A 3TGUG 1HCMA 3OAKA 1ZLLA 2ZVNB 1KFMA 2ZYGA 3A5TA 1FZEA 5CMZA 3CCMP 4IL6V 2WSSH 2E75C 2L91A 2WQYC 3USSA 4AYCA 3I5CA 4D6TJ 1CRHA 4WQCA 4ASVA 1Y9BA 5CCHA 3HE5A 1PZQA 3QWOC 1WRGA 3M9BA 2WITA 2PP6A 1PP9G 1YEAA 1IO3A 1NTME 4BWNA 1KILD 1DT1A 5KLVD 1LTJC 3TGUJ 1U75B 1RF1B 3PRJA 1LMSA 2OYHA 3D70A 2ZT9C 1CORA 4KMGA 1AQ5A 4LC1A 3RGUA 5AW0B 2WSCJ 2Q1KA 1J1EB 2C2CA 3SWFA 1JEKA 1FE6A 3B71A 1PP9J 1Q86Q 1VQ9P 1PPJD 3GMAA 2PGDA 1EDIA 1P84I 1VDFA 1KV4A 2B11B 3N7NA 2XU6A 4AQRD 1YJ9P 2WMMA 2Q9IA 3L71D 4OVNF 1G2CA 4AALA 2QJPC 4GEDB 1JM0A 5GTIE 1M1JC 1G1JA 1PV3A 1YQ4C 4PJ0E 2BH5X 4WQ8A 1LTJB 1KX2A 3RBZA 1N7LA 1I55A 3II6A 1OW7A 4L3GA 5CICB 1OW8A 3O6QB 1N73A 2CA3B 3V4QA 1DIPA 1Q7YQ 1FZCC 2PCBB 2JO1A 1A02F 1JMBA 3FXEA 1KQLA 3JBTB 1PFIA 1OFCX 1Q82Q 4DJGA 4LJIA 3AE2C 3WUVA 3BCCE 3U1AA 2WPRA 2B87A 3KXDA 5KAFV 3SLEA 1CCHA 2K88A 3CU4A 5CJ0A 4MU8A 2E75D 2FYUG 1RE4C 1FOSE 2JKVA 1GKSA 4PD4D 2YO2A 1RH5B 2Q5UA 3F89A 1E29A 2XZRA 1URQA 2BCCD 1YNRA 1MV8A 1EDKA 3PP5A 3H1HG 5CIBB 5H2FE 2FXPA 4W7ZA 3RK3C 3ZOWA 1M60A 3VMAA 5AVYB 1YTZT 1KD1Q 1CSUA 2J59M 1JY3N 3O20A 1IFNA 1KMIZ 1FOCA 2H8PD 4H0LC 5DJQC 2ZT9D 3L75D 2KNCA 3C8VA 2OYIC 2FYUJ 3P8CD 2N9JA 4PV1C 2YIUC 1SP4A 1I6EA 3A0BH 4WQ9A 1CTZA 3SVWA 1A02J 1IFPA 2A06G 3S4RA 2M0BA 3V2NA 2ZYDA 1NTKD 2SPZA 3MP7B 3H1HJ 1NTZG 1S9KD 4EOTA 2KLUA 3NBTA 2BGVX 2A45G 1M57D 2R5DA 3AE7C 1SQVD 1C6OA 3L73G 3QH9A 3LIEA 3PTZA 1CTJA 2UWJE 1KX7A 3A9FA 3OA7A 4RSZA 2HV4A 1IK9A 2K9JB 5TISH 1U7MA 1CSVA 3HUSC 4U3FD 4UB6V 2JWAA 2IYPA 1UIXA 3RK3B 1SQBE 2ZXXA 2IX7C 3VP8A 1NTZJ 3ZOXA 4PWAA 1M6ZA 2JJLA 1MZ9A 1KIBA 1USEA 4H0LB 1RY3A 3L74D 2E74C 1JTHB 3L73J 2MHMA 1L9BC 1FC2C 3PH2B 2LXBA 4PV1B 5B5EH 2N1TD 3WUTA 3OJAB 1L0ND
chains in the Genus database with same CATH topology
1IQCA 1FCDC 1MG2D 2DGEA 1P84D 1CYJA 4Y5RA 2GC4D 5TISV 2A06D 4AX3A 2RN0A 3SXTA 1WVEC 2MTAC 4EIEA 1NMIA 1DIIC 2C9XB 5TJHA 2QJPB 2D0WA 1NTZD 1BCCD 2V08A 1QYZA 1IRVA 2B10B 5DFSA 4PW9B 1W2LA 1K3GA 1H32A 1M70A 2QJKB 1CRGA 5E79V 4NFGB 1L0LD 2N3BA 3CX5D 1N50A 1COTA 5H2FV 1OAEA 1CSWA 1QN2A 3L73D 3OCDB 1I6DA 1CIEA 1AOFA 1RAPA 1C52A 2JQRA 1A8CA 5B5EV 1H31A 2Y0CA 3L72D 3H1LD 3VNWA 1FI9A 1H1OA 4A7PA 2LITA 3O5CA 3WUIA 3WFBC 1CHJA 2B12B 1NNOA 2ZOOA 3CX5W 1A56A 2CXBA 1I5TA 3SJLA 1CYCA 3KZIV 1LS9A 2B4ZA 2GB8B 3ZBMA 5AURA 4QAOA 2DVHA 2OZ1B 3HQ9A 1E8EA 3CP5A 3PLNA 2C1UA 3OA8B 1QL4A 1FI7A 2KNCB 5GTIV 1DIQC 1HJ3A 1YCCA 4D6TD 1HH7A 3MK7C 5C9MA 4O1WA 1C2RA 5CIGB 4PJ0V 2O3JA 1HRCA 1KYOD 1A2SA 3CYTI 2C1VA 2BPBB 3PXSA 3KHUA 3CXHD 5CIDB 2C1DA 5KKZB 2B0ZB 3TGUD 5KAIV 4WQEA 4FA1A 1N9CA 1KB0A 4FAVA 4H0KA 3A0HV 3TF5A 4P4QB 3L4MA 4AAMA 1I54A 1C7MA 3ZOYA 1HJ4A 5C0ZA 1KYOW 1N90A 2BCNB 2IBZD 2QG4A 2GIWA 3CXHW 1FI3A 5DJQB 4L1QA 1CO6A 1CSXA 1GU2A 1BE3D 2D0SA 3WU2V 2YIUB 3FWLA 3PXTA 1CC5A 5EXQA 4FA5A 1C6SA 1B7VA 1OCDA 1CRYA 1CXCA 1AKKA 1H33B 1WEJF 3H1JD 1FJ0A 1S5LV 1W5CT 3HQ6A 1CTYA 3HQ7A 1SQPD 4N0KA 3RMZA 5KLIB 3MK7B 1CIGA 1H9YA 1HZVA 1IZL0 3NBSA 1LC2A 3RLMA 4DY9A 1KV9A 1HCMA 4WQAA 1DW1A 1CRCA 1SQQD 4IL6V 2L91A 4EIFA 4GYDA 1NTMD 5DF5A 1CRHA 1CNOA 4WQCA 2AIUA 4XYDB 451CA 4L3HA 1NU1D 1YEAA 1IO3A 1C75A 4H0JA 1DT1A 5KLVD 1H31B 2EXVA 1U75B 1MG3D 3PRJA 1QKSA 1LMSA 1QL3A 1CORA 4KMGA 2BLFB 3CWBD 3WFEC 4WQBA 351CA 3M97X 1RAQA 1ZZHA 1GDVA 2N18C 1C2NA 5CIFB 3WFDC 5B66V 3ZOOA 1CIHA 2CE0A 2L4DA 2C2CA 4EDFA 1YICA 1CHIA 2PACA 1HJ5A 1CIFA 3ZIYA 1PPJD 1DW3A 1GQ1A 1H9XA 4RJTA 2B11B 3GG2A 4AAOA 5CYTR 4XXLA 3L71D 4AALA 4GEDB 5CIEB 1LC1A 1C6RA 3RN1A 3VRDA 2ZONG 1YEBA 2C1DB 2N9IA 4FA4A 4J20A 3GW6A 2BH5X 4WQ8A 1NIRA 1LFMA 3HQ8A 2ORLA 3PHLA 1IRWA 1I8PA 1KX2A 1PP9D 4AANA 2Y0DA 5IY51 1I55A 1CCRA 5B6QA 2N18B 4L3GA 5CICB 2N9YB 3DP5A 2CA3B 1AOQA 2KS1A 1JDLA 4FA9A 3H1KD 1N15A 2PCBB 1NMLA 2Q3EA 1GIWA 3JBTB 3PXWA 1EZVD 1RZ5A 3H1ID 4LJIA 1K3HA 1R0QA 3OCDA 1CEDA 1CRIA 1DVVA 1U74B 3ORVA 5KAFV 3SLEA 1CCHA 1MZ4A 3CU4A 4MU8A 1H32B 2FYNB 4UB8V 1GKSA 4PD4D 3O1YA 2FWLA 1E29A 4JCGA 2LIRA 2PCCB 2I8FA 1DW0A 3DMIA 4EIDA 2BCCD 1YNRA 2QJYB 4WQ7A 1YFCA 1I8OA 5CIBB 3VYMA 3ZOWA 1M60A 3VMAA 3ZCFA 2OZ1A 3ITKA 1CSUA 3DR0A 3O20A 2FRCA 1HZUA 1FOCA 4EICA 3OA8A 1GJQA 3O0RC 3TYIA 1ZRTD 5DJQC 1E2RA 1F1CA 1L9JC 1SQXD 3L75D 3RN0A 1YIQA 2YCCA 4FANA 1CHHA 2N9JA 1DVHA 1I6EA 2Y0EA 3NWVA 3L70D 1CTZA 4WQ9A 3SVWA 1VYDA 1BGYD 2AXTV 1AYGA 1NTKD 3L4OA 2V07A 155CA 3C2CA 2XTSB 2C8SA 1ETPA 1YTCA 2YQBA 1RZ6A 1DW2A 1HROA 2BH4X 3X39A 3WFCC 3NBTA 2BGVX 2YK3A 1FHBA 3SWSA 4K3IA 1SQVD 1C6OA 2N3YA 5CIHB 3PTZA 2JTIB 4Q5PA 3TDKA 1CTJA 2AI5A 2RMZA 1SQBD 2CE1A 1KX7A 3A9FA 4YE1A 3WC8A 1EB7A 2VHDA 4RSZA 2HV4A 2K9JB 2FYUD 1CSVA 4U3FD 4UB6V 1S6VB 2JWAA 2GC7D 3A0BV 4V2KA 4O1QA 1J3SA 1BL9A 3ZOXA 4PWAA 1CXAA 1M6ZA 1KB9D 2ZBOA 3H1HD 1CYIA 1KIBA 5GTHV 3L74D 1H33A 4WQDA 2MHMA 1L9BC 2CA4B 3PH2B 4FB1A 1F1FA 1CRJA 3BCCD 2ZXYA 2ZZS1 1L0ND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQC A;  1FCD C;  1MG2 D;  2DGE A;  1P84 D;  1CYJ A;  4Y5R A;  2GC4 D;  5TIS V;  2A06 D;  4AX3 A;  2RN0 A;  3SXT A;  1WVE C;  2MTA C;  4EIE A;  1NMI A;  1DII C;  2C9X B;  5TJH A;  2QJP B;  2D0W A;  1NTZ D;  1BCC D;  2V08 A;  1QYZ A;  1IRV A;  2B10 B;  5DFS A;  4PW9 B;  1W2L A;  1K3G A;  1H32 A;  1M70 A;  2QJK B;  1CRG A;  5E79 V;  4NFG B;  1L0L D;  2N3B A;  3CX5 D;  1N50 A;  1COT A;  5H2F V;  1OAE A;  1CSW A;  1QN2 A;  3L73 D;  3OCD B;  1I6D A;  1CIE A;  1AOF A;  1RAP A;  1C52 A;  2JQR A;  1A8C A;  5B5E V;  1H31 A;  2Y0C A;  3L72 D;  3H1L D;  3VNW A;  1FI9 A;  1H1O A;  4A7P A;  2LIT A;  3O5C A;  3WUI A;  3WFB C;  1CHJ A;  2B12 B;  1NNO A;  2ZOO A;  3CX5 W;  1A56 A;  2CXB A;  1I5T A;  3SJL A;  1CYC A;  3KZI V;  1LS9 A;  2B4Z A;  2GB8 B;  3ZBM A;  5AUR A;  4QAO A;  2DVH A;  2OZ1 B;  3HQ9 A;  1E8E A;  3CP5 A;  3PLN A;  2C1U A;  3OA8 B;  1QL4 A;  1FI7 A;  2KNC B;  5GTI V;  1DIQ C;  1HJ3 A;  1YCC A;  4D6T D;  1HH7 A;  3MK7 C;  5C9M A;  4O1W A;  1C2R A;  5CIG B;  4PJ0 V;  2O3J A;  1HRC A;  1KYO D;  1A2S A;  3CYT I;  2C1V A;  2BPB B;  3PXS A;  3KHU A;  3CXH D;  5CID B;  2C1D A;  5KKZ B;  2B0Z B;  3TGU D;  5KAI V;  4WQE A;  4FA1 A;  1N9C A;  1KB0 A;  4FAV A;  4H0K A;  3A0H V;  3TF5 A;  4P4Q B;  3L4M A;  4AAM A;  1I54 A;  1C7M A;  3ZOY A;  1HJ4 A;  5C0Z A;  1KYO W;  1N90 A;  2BCN B;  2IBZ D;  2QG4 A;  2GIW A;  3CXH W;  1FI3 A;  5DJQ B;  4L1Q A;  1CO6 A;  1CSX A;  1GU2 A;  1BE3 D;  2D0S A;  3WU2 V;  2YIU B;  3FWL A;  3PXT A;  1CC5 A;  5EXQ A;  4FA5 A;  1C6S A;  1B7V A;  1OCD A;  1CRY A;  1CXC A;  1AKK A;  1H33 B;  1WEJ F;  3H1J D;  1FJ0 A;  1S5L V;  1W5C T;  3HQ6 A;  1CTY A;  3HQ7 A;  1SQP D;  4N0K A;  3RMZ A;  5KLI B;  3MK7 B;  1CIG A;  1H9Y A;  1HZV A;  1IZL 0;  3NBS A;  1LC2 A;  3RLM A;  4DY9 A;  1KV9 A;  1HCM A;  4WQA A;  1DW1 A;  1CRC A;  1SQQ D;  4IL6 V;  2L91 A;  4EIF A;  4GYD A;  1NTM D;  5DF5 A;  1CRH A;  1CNO A;  4WQC A;  2AIU A;  4XYD B;  451C A;  4L3H A;  1NU1 D;  1YEA A;  1IO3 A;  1C75 A;  4H0J A;  1DT1 A;  5KLV D;  1H31 B;  2EXV A;  1U75 B;  1MG3 D;  3PRJ A;  1QKS A;  1LMS A;  1QL3 A;  1COR A;  4KMG A;  2BLF B;  3CWB D;  3WFE C;  4WQB A;  351C A;  3M97 X;  1RAQ A;  1ZZH A;  1GDV A;  2N18 C;  1C2N A;  5CIF B;  3WFD C;  5B66 V;  3ZOO A;  1CIH A;  2CE0 A;  2L4D A;  2C2C A;  4EDF A;  1YIC A;  1CHI A;  2PAC A;  1HJ5 A;  1CIF A;  3ZIY A;  1PPJ D;  1DW3 A;  1GQ1 A;  1H9X A;  4RJT A;  2B11 B;  3GG2 A;  4AAO A;  5CYT R;  4XXL A;  3L71 D;  4AAL A;  4GED B;  5CIE B;  1LC1 A;  1C6R A;  3RN1 A;  3VRD A;  2ZON G;  1YEB A;  2C1D B;  2N9I A;  4FA4 A;  4J20 A;  3GW6 A;  2BH5 X;  4WQ8 A;  1NIR A;  1LFM A;  3HQ8 A;  2ORL A;  3PHL A;  1IRW A;  1I8P A;  1KX2 A;  1PP9 D;  4AAN A;  2Y0D A;  5IY5 1;  1I55 A;  1CCR A;  5B6Q A;  2N18 B;  4L3G A;  5CIC B;  2N9Y B;  3DP5 A;  2CA3 B;  1AOQ A;  2KS1 A;  1JDL A;  4FA9 A;  3H1K D;  1N15 A;  2PCB B;  1NML A;  2Q3E A;  1GIW A;  3JBT B;  3PXW A;  1EZV D;  1RZ5 A;  3H1I D;  4LJI A;  1K3H A;  1R0Q A;  3OCD A;  1CED A;  1CRI A;  1DVV A;  1U74 B;  3ORV A;  5KAF V;  3SLE A;  1CCH A;  1MZ4 A;  3CU4 A;  4MU8 A;  1H32 B;  2FYN B;  4UB8 V;  1GKS A;  4PD4 D;  3O1Y A;  2FWL A;  1E29 A;  4JCG A;  2LIR A;  2PCC B;  2I8F A;  1DW0 A;  3DMI A;  4EID A;  2BCC D;  1YNR A;  2QJY B;  4WQ7 A;  1YFC A;  1I8O A;  5CIB B;  3VYM A;  3ZOW A;  1M60 A;  3VMA A;  3ZCF A;  2OZ1 A;  3ITK A;  1CSU A;  3DR0 A;  3O20 A;  2FRC A;  1HZU A;  1FOC A;  4EIC A;  3OA8 A;  1GJQ A;  3O0R C;  3TYI A;  1ZRT D;  5DJQ C;  1E2R A;  1F1C A;  1L9J C;  1SQX D;  3L75 D;  3RN0 A;  1YIQ A;  2YCC A;  4FAN A;  1CHH A;  2N9J A;  1DVH A;  1I6E A;  2Y0E A;  3NWV A;  3L70 D;  1CTZ A;  4WQ9 A;  3SVW A;  1VYD A;  1BGY D;  2AXT V;  1AYG A;  1NTK D;  3L4O A;  2V07 A;  155C A;  3C2C A;  2XTS B;  2C8S A;  1ETP A;  1YTC A;  2YQB A;  1RZ6 A;  1DW2 A;  1HRO A;  2BH4 X;  3X39 A;  3WFC C;  3NBT A;  2BGV X;  2YK3 A;  1FHB A;  3SWS A;  4K3I A;  1SQV D;  1C6O A;  2N3Y A;  5CIH B;  3PTZ A;  2JTI B;  4Q5P A;  3TDK A;  1CTJ A;  2AI5 A;  2RMZ A;  1SQB D;  2CE1 A;  1KX7 A;  3A9F A;  4YE1 A;  3WC8 A;  1EB7 A;  2VHD A;  4RSZ A;  2HV4 A;  2K9J B;  2FYU D;  1CSV A;  4U3F D;  4UB6 V;  1S6V B;  2JWA A;  2GC7 D;  3A0B V;  4V2K A;  4O1Q A;  1J3S A;  1BL9 A;  3ZOX A;  4PWA A;  1CXA A;  1M6Z A;  1KB9 D;  2ZBO A;  3H1H D;  1CYI A;  1KIB A;  5GTH V;  3L74 D;  1H33 A;  4WQD A;  2MHM A;  1L9B C;  2CA4 B;  3PH2 B;  4FB1 A;  1F1F A;  1CRJ A;  3BCC D;  2ZXY A;  2ZZS 1;  1L0N D; 
#chains in the Genus database with same CATH topology
 1IQC A;  2OTL P;  1WT6 A;  1P84 D;  2YKQ A;  4WY4 B;  2KS1 B;  3IAO A;  1CYJ A;  2IZ0 A;  1JUN A;  1AVY A;  2KOG A;  1SQV G;  1T2K D;  3KZI H;  1WVE C;  1DII C;  1R5S A;  1GL2 A;  2M5A A;  2ZJS E;  2E76 C;  1QYZ A;  2B10 B;  1K3G A;  2K37 A;  1M70 A;  5E79 V;  1L0L D;  3E7K A;  3CCQ P;  3G4S P;  2V4H A;  5H2F V;  1LWU A;  3OCD B;  1I6D A;  1AOF A;  2IBZ G;  1H31 A;  1AV1 A;  1N2D C;  2Y0C A;  2JEE A;  1SFC C;  3L74 G;  2LIT A;  1IFM A;  1SQV J;  1X9V A;  1LT9 C;  1A56 A;  2CXB A;  1I5T A;  1SVF A;  2POH A;  2E74 B;  2B4Z A;  1JNM A;  3ZBM A;  4QAO A;  1ZOY C;  3CP5 A;  1QLE D;  2C1U A;  3OA8 B;  1LTS C;  2G8Y A;  3G6E P;  1KC8 Q;  4ASW A;  2P2U A;  3SFD C;  3L74 J;  1VQP P;  5C9M A;  4O1W A;  5L8R J;  1RHZ B;  1C2R A;  1NWQ A;  2LR2 A;  2FBW C;  1FZB A;  2C1V A;  2BPB B;  1J2J B;  4ZNC A;  1KZU B;  3L36 A;  1L4A C;  1M56 D;  1M1K Q;  3WMM 0;  4EIJ A;  1PPJ E;  3JCU E;  1S5L H;  3TSI A;  1KYO E;  2KZJ A;  3CCU P;  1YJW P;  3A0H V;  1M90 Q;  3WUU A;  3L4M A;  5KLV K;  1I54 A;  4DZO A;  1HJ4 A;  1KYO W;  1HGV A;  3L71 E;  1JY2 P;  1LT9 B;  4BRY A;  1FI3 A;  2A45 H;  4IL6 H;  4PD4 H;  3CWB G;  1M8O B;  1BE3 D;  3WU2 V;  5CCH C;  5M1B A;  2E74 D;  2K1A A;  1B7V A;  3AE6 C;  2BEQ D;  2P67 A;  1AKK A;  1H33 B;  4WY4 A;  2QVA A;  4AUW A;  3H1J D;  1W5C T;  3HD7 C;  1SQP D;  3RMZ A;  5C39 A;  3O8Z A;  3B5N A;  2CPS A;  3CWB J;  5AW2 B;  2E76 D;  5CCG A;  1ZR4 A;  1PGJ A;  2KXP B;  1ZN5 A;  1DD3 A;  1FZG A;  1AA0 A;  4HJG H;  1SQQ E;  451C A;  1KIL C;  4JF7 A;  4L3H A;  1JB0 J;  5DJT B;  1LGH B;  1BE3 G;  1CW5 A;  3E1R A;  2HYN A;  1BDC A;  1C75 A;  4H0J A;  1SFC D;  1FOS F;  1N7S A;  3I55 P;  3AEE C;  1QKS A;  2IZ1 A;  1QL3 A;  3CCR P;  3SSU A;  2B89 A;  2BLF B;  1VF5 D;  1KB9 I;  1SQP G;  1IO4 A;  3WFD C;  5B66 V;  3ZOO A;  1CIH A;  2CE0 A;  1U57 A;  2FFD C;  1FDI A;  1X8Y A;  1YIC A;  2PAC A;  1HJ5 A;  1CIF A;  1VQ5 P;  1BE3 J;  1GQ1 A;  5AVW B;  2OGU A;  1FDM A;  1YIT P;  4RJT A;  3V2P A;  1P84 H;  5CJ4 A;  1KN7 A;  3H32 B;  3K5B A;  2LKM A;  4GDO A;  5CIE B;  1HTL C;  1SQP J;  1L4A D;  1KIL B;  1YEB A;  2C1D B;  1S9K E;  1OZH A;  4J20 A;  3CX5 I;  5BU8 B;  1HBW A;  2KZI A;  3FXD A;  1PP9 D;  4N78 D;  1VQN P;  4EI2 A;  5KAF H;  3GF3 A;  1PGP A;  5KAI E;  1SQX G;  5AW5 B;  1CCR A;  5B6Q A;  5CCH D;  1R8E A;  1FS0 E;  2FFD B;  1NTK K;  5CBO A;  3M06 A;  1QL2 A;  2OQQ A;  5AVU B;  5AW9 B;  1GIW A;  1S3J A;  1H0T B;  3HD7 D;  3H1K E;  3H1I D;  1SQV K;  3HTK A;  1K3H A;  4KJM A;  4EYY Q;  1SQX J;  1L0N E;  3ORV A;  4I7Z C;  1SQB G;  1EZV E;  2PAJ A;  1T3U A;  1OVU A;  1YIJ P;  2PRR A;  5KJ7 A;  5AVV B;  1FAV A;  1ZXG A;  5KKZ C;  2PCC B;  4XE5 B;  3CCS P;  2I8F A;  1DW0 A;  1EC5 A;  1UII A;  3PH0 A;  3V6I A;  1HUC A;  2Y9Y A;  3GLM A;  2OZ1 A;  1FBM A;  3ITK A;  1ZW0 A;  1JMM A;  1S5L X;  2FRC A;  3SWK A;  2IBZ I;  1L0N K;  1GJQ A;  1SQB J;  1F1C A;  1L9J C;  1AFO A;  1LTT C;  4FAN A;  3MGN A;  3H1I G;  2AEJ A;  4UB6 H;  3Q5R A;  2XV5 A;  3RK3 E;  4IL6 X;  4NPE A;  1ZRT E;  2AXT V;  1NAY A;  4DT0 A;  2AXC A;  1ETP A;  2ZAE B;  3Q2Y A;  1HRO A;  2E75 B;  2BH4 X;  1L0L K;  4R4M A;  3L70 E;  1VQL P;  3X39 A;  2OTJ P;  5KLI C;  1BGY E;  3VP9 A;  3CC2 P;  3H32 A;  4I7Z B;  3SWS A;  1IJD B;  1VQO P;  1RF0 C;  3TDK A;  2RMZ A;  1EXJ A;  2H7H A;  1YI2 P;  1EB7 A;  3H1I J;  3JSV C;  2FYU D;  1GL2 C;  3P8M C;  3ZDM A;  1Q90 D;  2JWD A;  1S6V B;  2GC7 D;  1H89 A;  4V2K A;  1FU1 A;  3BAS A;  4O1Q A;  3A2A A;  2ZT9 B;  1CXA A;  1KB9 D;  1PGQ A;  3H1H D;  4UB8 H;  5E79 H;  5GTH V;  2N1T C;  1DEE G;  3AEB C;  4FB1 A;  3V2R A;  1X0T A;  1MUU A;  3TNU B;  2WVR A;  1T2K C;  1FCD C;  1MG2 D;  2H89 C;  2QSI A;  2A06 D;  4AX3 A;  2IFM A;  3SXT A;  4EIE A;  5TJH A;  5CHX A;  2QJP B;  3A7O A;  1M1J B;  1NTZ D;  2V08 A;  4YXW H;  1IRV A;  1YTZ I;  1CSB A;  3RK2 C;  1W2L A;  1SLQ A;  3GHG C;  4H44 C;  2J5U A;  4NFG B;  3CX5 D;  1QN2 A;  3L73 D;  3HRN A;  3CPW O;  1CIE A;  1BCC E;  2JQR A;  1OVV A;  1HF9 A;  3L72 D;  2QA4 P;  3H1L D;  1RF1 A;  4IFM A;  3IFM A;  3M0D A;  1NNO A;  4I1L A;  2MJZ A;  5AVS B;  2N1T B;  2WSC H;  1BSH A;  4GIF A;  1FZC B;  4HKZ H;  2GB8 B;  2DVH A;  2P58 A;  3A0H H;  3LID A;  1E8E A;  3V5B A;  3PLN A;  1SQP K;  2I8D A;  2NPS C;  1YJN P;  5GTI V;  1DIQ C;  1YCC A;  3CD6 P;  1OMI A;  2R3S A;  2KK7 A;  3AED C;  3AEF C;  1HH7 A;  2XDJ A;  3WU2 H;  4PJ0 V;  3RK2 B;  1A2S A;  3M9H A;  3GHG B;  2V7Q J;  3U59 A;  2H43 A;  4D6T E;  2FXM A;  3KHU A;  3AEG C;  3S1K A;  3L72 G;  3H1L G;  3M91 A;  5AW6 B;  1NU1 G;  3B5N C;  1IFJ A;  4FAV A;  2WT7 B;  1LTJ A;  3CXH E;  4WWI A;  3VOP A;  1JY3 P;  3VTP C;  2E42 A;  1GL2 D;  4WVZ A;  4NPD A;  3TGU E;  2ZFC A;  3I56 P;  2BCN B;  2IBZ D;  1GU4 A;  3CXH W;  5DJQ B;  1EXI A;  4L1Q A;  1E79 H;  3O6Q A;  3Q1M A;  2OYI B;  1MFZ A;  2QJY C;  1NKZ B;  1CSX A;  2Q3I A;  1SQX K;  2YIU B;  2DW3 A;  4FA5 A;  1GD2 E;  2WWW A;  1FZF A;  3L72 J;  3H1L J;  1CRY A;  1CXC A;  1NU1 J;  1S72 P;  1VQ6 P;  1PP9 E;  3HQ6 A;  1CTY A;  3HQ7 A;  1YBK A;  2GUV A;  1CIG A;  1H9Y A;  3FWN A;  4LLH A;  3NBS A;  1NAF A;  2I1J A;  4WQA A;  2W6J H;  1CRC A;  2W6B A;  3CL3 D;  5B66 H;  2ZVO B;  3RK2 D;  1BDD A;  4H44 D;  4I2L C;  3HUS B;  1NTM D;  4ZKU A;  2AIU A;  5TIS E;  4GOD A;  4XYD B;  2XNX A;  5AVX B;  1W5C E;  3LW5 J;  1RE3 A;  1VF5 C;  1MG3 D;  2O01 N;  3CWB D;  3WFE C;  1KIL E;  5B5E E;  2YMY A;  1RAQ A;  5KLV E;  1ZZH A;  2E5Y A;  1GDV A;  1C2N A;  5CIF B;  3NFQ A;  1KB9 H;  3BRT B;  2IDB A;  4OGQ C;  1CHI A;  2HFE D;  1EZV G;  2RKL A;  4CPG A;  2NPS D;  3UIA A;  3IR9 A;  3KZI E;  4Y99 C;  1JY3 O;  4L76 A;  2E76 B;  3T97 B;  3RL0 C;  1H9X A;  1YYC A;  1NTM G;  3AEC C;  2V7Q H;  1RE4 A;  3GG2 A;  4AAO A;  1GZL A;  4IOI H;  3M0A A;  4IFD K;  4XXL A;  2HLO A;  2R44 A;  2HPC B;  2K9J A;  3SFE C;  3EFF K;  3VRD A;  2HOD B;  2FYN C;  1SFC B;  2G3A A;  1E5W A;  2WSF J;  3B5N D;  2N9I A;  1KFN A;  3GW6 A;  3G71 P;  1Q2N A;  3CCJ P;  2ZYA A;  3CX5 H;  2ORL A;  1DX7 A;  3PHL A;  4JYB A;  1VF5 B;  1JTH A;  5K5G B;  2OYI A;  2O1J A;  5CCG D;  1HGZ A;  1NTM J;  3VMY A;  3MZW B;  4AAN A;  2Y0D A;  3HE4 B;  2FYU E;  1M7L A;  5APT A;  2N9Y B;  3VYI A;  3DP5 A;  2YXQ B;  1AOQ A;  2KS1 A;  1LP1 B;  5AW7 B;  4OGQ B;  2OYH C;  1OWA A;  1N7S D;  3H1H E;  1VL2 A;  1GU5 A;  2AEM A;  4Y99 B;  1NML A;  2R3C A;  1GMJ A;  3A3Y B;  1USD A;  2P7J A;  1FZA A;  1QX8 A;  2IYO A;  3CCL P;  1L4A B;  1DH3 A;  4KT0 J;  3OCD A;  1DVV A;  1CRI A;  2CPB A;  1U74 B;  4LGD E;  2Z5I A;  1LTG C;  4JBZ A;  3HUS A;  2FYU K;  1H32 B;  1S5L E;  2FYN B;  1KYO I;  2AXT H;  3CCV P;  2C9L Y;  5AVZ B;  3D71 A;  2FWL A;  2LIR A;  3LW5 H;  1NTZ E;  1LNQ A;  3DMI A;  4WQ7 A;  2W27 A;  3C9I A;  1I8O A;  2B88 A;  4IL6 E;  4ZKP A;  3HE5 B;  4PD4 E;  3ZCF A;  2KP8 A;  2H88 C;  3G9R A;  2BCC E;  3P32 A;  4EIC A;  3OA8 A;  3TYI A;  3BCC G;  1E2R A;  1SQX D;  1K04 A;  2YCC A;  3HD7 B;  2OYH B;  1ZME C;  2D2C C;  2Y0E A;  4TT3 H;  2E43 A;  2OTK E;  1VYD A;  1GK6 A;  4HH2 A;  3L75 E;  4OGQ D;  1NTZ K;  1AYG A;  1N73 C;  3Q5S A;  3E1I A;  2V07 A;  5APX A;  1YTC A;  2YQB A;  2C9N Y;  1RZ6 A;  3P8C E;  1DW2 A;  5GTH H;  1BCC G;  3RL0 D;  2W6A A;  3WFC C;  1FHB A;  5BU5 A;  2HPC A;  1NTK E;  4KHX A;  4K3I A;  2M3B A;  1EQ7 A;  3BCC J;  5CIH B;  2JTI B;  2QE7 H;  3H25 A;  3H6P A;  2NRG A;  1SQB D;  2CE1 A;  2WPS A;  3F5H A;  2RH0 A;  3WC8 A;  1BSN A;  2VHD A;  1LT9 A;  1G2C B;  3CC4 P;  2FYZ A;  4Y28 J;  4GT1 A;  1SQV E;  4C46 A;  3W67 A;  1BL9 A;  3MTU E;  3M9Q A;  4RO0 A;  3KDP B;  1BCC J;  3MUD A;  1URQ C;  1KQG B;  4RES B;  4U3F E;  1NOH A;  5KJ7 D;  5BVZ A;  1CZQ A;  1H33 A;  4WQD A;  1PGO A;  2YXR B;  1RF1 C;  1EDL A;  5AVT B;  1K05 A;  2ZXY A;  4GKG A;  1JCC A;  3L74 E;  2DGE A;  1N73 B;  4HB1 A;  2WSE J;  3PJS K;  2OYO A;  1J1E C;  4U7J A;  3BVH A;  2MTA C;  4K3A A;  1L4A A;  3MD0 A;  2C9X B;  2KLV A;  2D0W A;  2Q7C A;  1P84 E;  1Z56 A;  3B4S A;  3FGA D;  1H32 A;  3TK1 A;  1CRG A;  2B87 B;  1JOC A;  2KYV A;  1OAE A;  5GTI H;  1HJ0 A;  1JCD A;  1SS1 A;  1A8C A;  1L0L E;  2ITA A;  5APS A;  3VNW A;  1FI9 A;  1H1O A;  4PJ0 H;  1KQF B;  5KAF E;  4GOE A;  1CHJ A;  4YPC A;  2R32 A;  1URQ B;  2B12 B;  2ZOO A;  3BAT A;  4JPZ B;  3AE8 C;  1NYH A;  1FJK A;  2Y9Z A;  1AVO A;  5AUR A;  3HD7 A;  3HQ9 A;  5APW A;  3V4W A;  3AE9 C;  2C0X A;  2HG5 D;  1QL1 A;  4MN4 C;  1S1C X;  1Y8A A;  2Q6Q A;  2D2C D;  3EFG A;  2KNC B;  2GM4 A;  1T3J A;  3CWB E;  3GF7 A;  1MKM A;  1NKN A;  5CIG B;  1VQK P;  3D6Y A;  1GDT A;  2O1K A;  1KYO D;  1NTM K;  1TU3 F;  3CYT I;  2MKV A;  1KIL A;  1VQ4 P;  1EZV I;  5CID B;  2C1D A;  2QEX P;  5KKZ B;  1U7J A;  5KAI V;  1KB0 A;  4H0K A;  3TF5 A;  2QM8 A;  1PL5 A;  2B9B A;  1FJP A;  3U1C A;  1C7M A;  3ZOY A;  3AE5 C;  2GUS A;  5KLV G;  1N90 A;  1LWU C;  5AW3 B;  3L35 A;  1CI6 B;  2QG4 A;  2K3R A;  2WPV B;  5H2F H;  2FFD A;  1URQ D;  1GU2 A;  3Q3D A;  3P7K A;  3PXT A;  4JQ0 D;  3V2Q A;  3AE1 C;  1CC5 A;  1RQU A;  1IC2 A;  4UB6 E;  1OCD A;  1FDO A;  1VQM P;  3KPE A;  1H0T A;  1RE3 C;  2BAS A;  2YKO A;  1BE3 E;  1G1I A;  2WSE H;  1WEJ F;  1PPJ G;  5KLI B;  5KLV J;  1VQ8 P;  1QVG O;  4K35 A;  4XA4 A;  1NHL A;  1LC2 A;  1H88 A;  3RLM A;  4DY9 A;  3AEA C;  1KV9 A;  3H1J E;  3L71 G;  1DW1 A;  1SQP E;  1SQQ D;  3CC7 P;  1NVO A;  1ZP0 C;  4EIF A;  4GYD A;  1GL2 B;  5CBN A;  2KI7 B;  2M5A B;  5DF5 A;  4H13 C;  1CNO A;  1YQ3 C;  2HR3 A;  2QIW A;  3MHV A;  1NU1 D;  3VMX A;  1LWU B;  2JDI H;  1OVR A;  3NMD A;  4UB8 E;  5E79 E;  3CXH H;  1H31 B;  3R4Y A;  3CMA P;  2EXV A;  2PFX A;  3L71 J;  3Q5P A;  1DD4 A;  4WQB A;  351C A;  3M97 X;  2Z5H A;  2N18 C;  2FKW B;  2J58 A;  2L4D A;  1QEX A;  4EDF A;  4ZMD A;  1ZV8 A;  1SQQ G;  3ZIY A;  1IK7 A;  1DW3 A;  1SQX E;  2IPP A;  4H44 B;  4WY4 C;  5KTB A;  5CYT R;  2Z4E A;  3KYQ A;  3D0W A;  2KSE A;  4H13 B;  2WTY A;  1LC1 A;  1C6R A;  3RN1 A;  3L37 A;  1QGK B;  2XKM A;  2M3E A;  2ZON G;  2R5B A;  2BCC G;  2YKP A;  1K8A Q;  1IZN B;  5AVQ B;  5CCG C;  4FA4 A;  3CCE P;  1NIR A;  3RL0 g;  4IFF A;  1LFM A;  1CI6 A;  1LJ2 A;  1SQQ J;  2L5G B;  3HQ8 A;  1IRW A;  4WBA A;  2O01 J;  1I8P A;  1LTA C;  1ZR2 A;  1GW4 A;  4O9B A;  3L75 G;  3TNU A;  4BRY B;  2I1K A;  1GTW A;  5IY5 1;  3A0B E;  3A0H E;  1W2B O;  2JR8 A;  2KIK A;  2NPS B;  2N18 B;  1N7S C;  2XND H;  4N78 E;  1JDL A;  1N86 A;  4FA9 A;  3H1K D;  1N15 A;  2BCC J;  1NTK G;  5APY A;  1IFD A;  1KTM A;  4L73 A;  2Q3E A;  1M1J A;  3PXW A;  1EZV D;  3L4F A;  1RZ5 A;  3WU2 E;  1RF0 A;  3B8E B;  1R0Q A;  3CLQ A;  1SQB K;  1CED A;  3L75 J;  5APQ A;  3B5N B;  3VMZ A;  1MZ4 A;  3H1I E;  4TLF A;  3W68 A;  3CME P;  3FX0 A;  4UB8 V;  1D7M A;  4C7N B;  4U3F G;  4H13 D;  2AEF A;  3O1Y A;  1K73 Q;  3JCU H;  4JCG A;  1NTK J;  1KYO H;  2KSJ A;  3CXH I;  4EID A;  3R2P A;  2N1T A;  2QJY B;  1LT1 A;  4DCK A;  1YFC A;  1FZC A;  3VYM A;  1Q81 Q;  3DR0 A;  2E5T A;  3H1K G;  1NJI Q;  2NZ2 A;  1HZU A;  3SWY A;  1N7S B;  3RK3 D;  1JY2 N;  3O0R C;  1ZRT D;  4OWF A;  2N9B A;  1L0N G;  3RN0 A;  1YIQ A;  2YO3 A;  3D6Z A;  1CHH A;  2KB7 P;  3G3Z A;  1AJY A;  1DVH A;  4H0L D;  4U3F J;  3NWV A;  3L70 D;  3MUD C;  4NPF X;  1BGY D;  3NTN A;  1WMK A;  3L4O A;  1MFT A;  155C A;  3C2C A;  2XTS B;  1VPC A;  2C8S A;  4PV1 D;  3GHG A;  1HJB A;  2LXC B;  1W2E A;  2K9Y A;  4GOF A;  3N4X A;  2WPQ A;  2YK3 A;  1J1D C;  3H1K J;  4WY4 D;  1L0L G;  5B66 E;  1L2P A;  1HH0 A;  2WT7 A;  1QVF O;  4RKU J;  2N3Y A;  2QJK C;  2W90 A;  2YMK A;  4Q5P A;  1L0N J;  2AI5 A;  4YE1 A;  1IFI A;  1GK4 A;  4BXL A;  1VQ7 P;  2WZ7 A;  3A0B V;  1T6A A;  1J3S A;  1OXZ A;  2O01 H;  5KJ7 C;  4I6M C;  1GW3 A;  1X79 B;  2ZBO A;  1H8A A;  2M8R A;  1CYI A;  1L0L J;  2NPS A;  1LTI C;  3L70 G;  1OX3 A;  1S4X A;  1BGY G;  2CA4 B;  1KB9 E;  1F1F A;  2OAR A;  1KQS O;  1CRJ A;  3BCC D;  2ZZS 1;  2BEZ F;  4OH8 B;  4W80 A;  3RL0 B;  4Y5R A;  3EQ2 A;  2GC4 D;  5TIS V;  1JO5 A;  3OW2 O;  2RN0 A;  2CK3 H;  4QMA A;  1NMI A;  1J1D B;  1S2E A;  2ZXE B;  5AW1 B;  1K9M Q;  1BCC D;  5DFS A;  3VN0 A;  4PW9 B;  2FXO A;  4M3L A;  3L70 J;  2A06 E;  2QJK B;  4XFJ A;  4DOJ A;  2N3B A;  1BGY J;  2YNY A;  2GA1 A;  3HTK B;  1N50 A;  1COT A;  4C7N A;  5APU A;  1CSW A;  2W83 C;  2IFN A;  1RAP A;  2FY8 A;  4N6J A;  1C52 A;  4Z1M H;  5B5E V;  4YTP C;  1LTB C;  1EDJ A;  3CX5 E;  3AE3 C;  4N3Y B;  4JYC A;  1HWT C;  3RBX A;  3C1L A;  4W7Y A;  4A7P A;  3L73 E;  3O5C A;  3WUI A;  2P10 A;  3WFB C;  4WB4 A;  3IF4 A;  3CX5 W;  3SJL A;  1CYC A;  3BRV B;  3KZI V;  3JC2 2;  1LS9 A;  3L72 E;  4L75 A;  3H1L E;  1DEB A;  1HVV A;  5KAI H;  2C0W A;  3TYY A;  1NU1 E;  2OZ1 B;  3H1J G;  3ABV C;  3T97 A;  2W8Z A;  1QL4 A;  4YXD C;  5DJU B;  1FI7 A;  1XTG B;  3AE4 C;  1RQV A;  1HJ3 A;  4R4L A;  3NXS A;  4D6T D;  1N8R Q;  1SQQ K;  2QM7 A;  3MIW A;  3MK7 C;  1X22 A;  5AW4 B;  1OIP A;  2O3J A;  2QRX A;  1HRC A;  1OW6 A;  5EFW B;  2HOD A;  1JY2 O;  1SFC A;  3PXS A;  3CXH D;  4HYT B;  2WSF H;  2B0Z B;  1NU1 K;  2AXT E;  3TGU D;  1NGM B;  4WQE A;  4FA1 A;  1PIX A;  3H1J J;  1Y47 A;  1N9C A;  3EWK A;  4P4Q B;  4AAM A;  1NO4 A;  4L74 A;  5AW8 B;  4B86 A;  1AQT A;  5C0Z A;  3HE4 A;  5AVR B;  2JP3 A;  2A45 I;  2GIW A;  4PD4 I;  1XTC C;  1LP1 A;  3S9O A;  1CO6 A;  1KOR A;  2D0S A;  2D2C B;  2P1J A;  3FWL A;  2IBZ E;  2KUB A;  5EXQ A;  3M0D C;  1YHQ P;  1C6S A;  4D6T G;  3KQG A;  4C7R A;  3CI9 A;  1FJ0 A;  1S5L V;  4N0K A;  2VRS A;  5APV A;  3MK7 B;  5GTH E;  3IN6 A;  1HZV A;  1IZL 0;  1R5L A;  1T8Z A;  1NH4 A;  3TGU G;  1HCM A;  3OAK A;  1ZLL A;  2ZVN B;  1KFM A;  2ZYG A;  3A5T A;  1FZE A;  5CMZ A;  3CCM P;  4IL6 V;  2WSS H;  2E75 C;  2L91 A;  2WQY C;  3USS A;  4AYC A;  3I5C A;  4D6T J;  1CRH A;  4WQC A;  4ASV A;  1Y9B A;  5CCH A;  3HE5 A;  1PZQ A;  3QWO C;  1WRG A;  3M9B A;  2WIT A;  2PP6 A;  1PP9 G;  1YEA A;  1IO3 A;  1NTM E;  4BWN A;  1KIL D;  1DT1 A;  5KLV D;  1LTJ C;  3TGU J;  1U75 B;  1RF1 B;  3PRJ A;  1LMS A;  2OYH A;  3D70 A;  2ZT9 C;  1COR A;  4KMG A;  1AQ5 A;  4LC1 A;  3RGU A;  5AW0 B;  2WSC J;  2Q1K A;  1J1E B;  2C2C A;  3SWF A;  1JEK A;  1FE6 A;  3B71 A;  1PP9 J;  1Q86 Q;  1VQ9 P;  1PPJ D;  3GMA A;  2PGD A;  1EDI A;  1P84 I;  1VDF A;  1KV4 A;  2B11 B;  3N7N A;  2XU6 A;  4AQR D;  1YJ9 P;  2WMM A;  2Q9I A;  3L71 D;  4OVN F;  1G2C A;  4AAL A;  2QJP C;  4GED B;  1JM0 A;  5GTI E;  1M1J C;  1G1J A;  1PV3 A;  1YQ4 C;  4PJ0 E;  2BH5 X;  4WQ8 A;  1LTJ B;  1KX2 A;  3RBZ A;  1N7L A;  1I55 A;  3II6 A;  1OW7 A;  4L3G A;  5CIC B;  1OW8 A;  3O6Q B;  1N73 A;  2CA3 B;  3V4Q A;  1DIP A;  1Q7Y Q;  1FZC C;  2PCB B;  2JO1 A;  1A02 F;  1JMB A;  3FXE A;  1KQL A;  3JBT B;  1PFI A;  1OFC X;  1Q82 Q;  4DJG A;  4LJI A;  3AE2 C;  3WUV A;  3BCC E;  3U1A A;  2WPR A;  2B87 A;  3KXD A;  5KAF V;  3SLE A;  1CCH A;  2K88 A;  3CU4 A;  5CJ0 A;  4MU8 A;  2E75 D;  2FYU G;  1RE4 C;  1FOS E;  2JKV A;  1GKS A;  4PD4 D;  2YO2 A;  1RH5 B;  2Q5U A;  3F89 A;  1E29 A;  2XZR A;  1URQ A;  2BCC D;  1YNR A;  1MV8 A;  1EDK A;  3PP5 A;  3H1H G;  5CIB B;  5H2F E;  2FXP A;  4W7Z A;  3RK3 C;  3ZOW A;  1M60 A;  3VMA A;  5AVY B;  1YTZ T;  1KD1 Q;  1CSU A;  2J59 M;  1JY3 N;  3O20 A;  1IFN A;  1KMI Z;  1FOC A;  2H8P D;  4H0L C;  5DJQ C;  2ZT9 D;  3L75 D;  2KNC A;  3C8V A;  2OYI C;  2FYU J;  3P8C D;  2N9J A;  4PV1 C;  2YIU C;  1SP4 A;  1I6E A;  3A0B H;  4WQ9 A;  1CTZ A;  3SVW A;  1A02 J;  1IFP A;  2A06 G;  3S4R A;  2M0B A;  3V2N A;  2ZYD A;  1NTK D;  2SPZ A;  3MP7 B;  3H1H J;  1NTZ G;  1S9K D;  4EOT A;  2KLU A;  3NBT A;  2BGV X;  2A45 G;  1M57 D;  2R5D A;  3AE7 C;  1SQV D;  1C6O A;  3L73 G;  3QH9 A;  3LIE A;  3PTZ A;  1CTJ A;  2UWJ E;  1KX7 A;  3A9F A;  3OA7 A;  4RSZ A;  2HV4 A;  1IK9 A;  2K9J B;  5TIS H;  1U7M A;  1CSV A;  3HUS C;  4U3F D;  4UB6 V;  2JWA A;  2IYP A;  1UIX A;  3RK3 B;  1SQB E;  2ZXX A;  2IX7 C;  3VP8 A;  1NTZ J;  3ZOX A;  4PWA A;  1M6Z A;  2JJL A;  1MZ9 A;  1KIB A;  1USE A;  4H0L B;  1RY3 A;  3L74 D;  2E74 C;  1JTH B;  3L73 J;  2MHM A;  1L9B C;  1FC2 C;  3PH2 B;  2LXB A;  4PV1 B;  5B5E H;  2N1T D;  3WUT A;  3OJA B;  1L0N D; 
#chains in the Genus database with same CATH homology
 1IQC A;  1FCD C;  1MG2 D;  2DGE A;  1P84 D;  1CYJ A;  4Y5R A;  2GC4 D;  5TIS V;  2A06 D;  4AX3 A;  2RN0 A;  3SXT A;  1WVE C;  2MTA C;  4EIE A;  1NMI A;  1DII C;  2C9X B;  5TJH A;  2QJP B;  2D0W A;  1NTZ D;  1BCC D;  2V08 A;  1QYZ A;  1IRV A;  2B10 B;  5DFS A;  4PW9 B;  1W2L A;  1K3G A;  1H32 A;  1M70 A;  2QJK B;  1CRG A;  5E79 V;  4NFG B;  1L0L D;  2N3B A;  3CX5 D;  1N50 A;  1COT A;  5H2F V;  1OAE A;  1CSW A;  1QN2 A;  3L73 D;  3OCD B;  1I6D A;  1CIE A;  1AOF A;  1RAP A;  1C52 A;  2JQR A;  1A8C A;  5B5E V;  1H31 A;  2Y0C A;  3L72 D;  3H1L D;  3VNW A;  1FI9 A;  1H1O A;  4A7P A;  2LIT A;  3O5C A;  3WUI A;  3WFB C;  1CHJ A;  2B12 B;  1NNO A;  2ZOO A;  3CX5 W;  1A56 A;  2CXB A;  1I5T A;  3SJL A;  1CYC A;  3KZI V;  1LS9 A;  2B4Z A;  2GB8 B;  3ZBM A;  5AUR A;  4QAO A;  2DVH A;  2OZ1 B;  3HQ9 A;  1E8E A;  3CP5 A;  3PLN A;  2C1U A;  3OA8 B;  1QL4 A;  1FI7 A;  2KNC B;  5GTI V;  1DIQ C;  1HJ3 A;  1YCC A;  4D6T D;  1HH7 A;  3MK7 C;  5C9M A;  4O1W A;  1C2R A;  5CIG B;  4PJ0 V;  2O3J A;  1HRC A;  1KYO D;  1A2S A;  3CYT I;  2C1V A;  2BPB B;  3PXS A;  3KHU A;  3CXH D;  5CID B;  2C1D A;  5KKZ B;  2B0Z B;  3TGU D;  5KAI V;  4WQE A;  4FA1 A;  1N9C A;  1KB0 A;  4FAV A;  4H0K A;  3A0H V;  3TF5 A;  4P4Q B;  3L4M A;  4AAM A;  1I54 A;  1C7M A;  3ZOY A;  1HJ4 A;  5C0Z A;  1KYO W;  1N90 A;  2BCN B;  2IBZ D;  2QG4 A;  2GIW A;  3CXH W;  1FI3 A;  5DJQ B;  4L1Q A;  1CO6 A;  1CSX A;  1GU2 A;  1BE3 D;  2D0S A;  3WU2 V;  2YIU B;  3FWL A;  3PXT A;  1CC5 A;  5EXQ A;  4FA5 A;  1C6S A;  1B7V A;  1OCD A;  1CRY A;  1CXC A;  1AKK A;  1H33 B;  1WEJ F;  3H1J D;  1FJ0 A;  1S5L V;  1W5C T;  3HQ6 A;  1CTY A;  3HQ7 A;  1SQP D;  4N0K A;  3RMZ A;  5KLI B;  3MK7 B;  1CIG A;  1H9Y A;  1HZV A;  1IZL 0;  3NBS A;  1LC2 A;  3RLM A;  4DY9 A;  1KV9 A;  1HCM A;  4WQA A;  1DW1 A;  1CRC A;  1SQQ D;  4IL6 V;  2L91 A;  4EIF A;  4GYD A;  1NTM D;  5DF5 A;  1CRH A;  1CNO A;  4WQC A;  2AIU A;  4XYD B;  451C A;  4L3H A;  1NU1 D;  1YEA A;  1IO3 A;  1C75 A;  4H0J A;  1DT1 A;  5KLV D;  1H31 B;  2EXV A;  1U75 B;  1MG3 D;  3PRJ A;  1QKS A;  1LMS A;  1QL3 A;  1COR A;  4KMG A;  2BLF B;  3CWB D;  3WFE C;  4WQB A;  351C A;  3M97 X;  1RAQ A;  1ZZH A;  1GDV A;  2N18 C;  1C2N A;  5CIF B;  3WFD C;  5B66 V;  3ZOO A;  1CIH A;  2CE0 A;  2L4D A;  2C2C A;  4EDF A;  1YIC A;  1CHI A;  2PAC A;  1HJ5 A;  1CIF A;  3ZIY A;  1PPJ D;  1DW3 A;  1GQ1 A;  1H9X A;  4RJT A;  2B11 B;  3GG2 A;  4AAO A;  5CYT R;  4XXL A;  3L71 D;  4AAL A;  4GED B;  5CIE B;  1LC1 A;  1C6R A;  3RN1 A;  3VRD A;  2ZON G;  1YEB A;  2C1D B;  2N9I A;  4FA4 A;  4J20 A;  3GW6 A;  2BH5 X;  4WQ8 A;  1NIR A;  1LFM A;  3HQ8 A;  2ORL A;  3PHL A;  1IRW A;  1I8P A;  1KX2 A;  1PP9 D;  4AAN A;  2Y0D A;  5IY5 1;  1I55 A;  1CCR A;  5B6Q A;  2N18 B;  4L3G A;  5CIC B;  2N9Y B;  3DP5 A;  2CA3 B;  1AOQ A;  2KS1 A;  1JDL A;  4FA9 A;  3H1K D;  1N15 A;  2PCB B;  1NML A;  2Q3E A;  1GIW A;  3JBT B;  3PXW A;  1EZV D;  1RZ5 A;  3H1I D;  4LJI A;  1K3H A;  1R0Q A;  3OCD A;  1CED A;  1CRI A;  1DVV A;  1U74 B;  3ORV A;  5KAF V;  3SLE A;  1CCH A;  1MZ4 A;  3CU4 A;  4MU8 A;  1H32 B;  2FYN B;  4UB8 V;  1GKS A;  4PD4 D;  3O1Y A;  2FWL A;  1E29 A;  4JCG A;  2LIR A;  2PCC B;  2I8F A;  1DW0 A;  3DMI A;  4EID A;  2BCC D;  1YNR A;  2QJY B;  4WQ7 A;  1YFC A;  1I8O A;  5CIB B;  3VYM A;  3ZOW A;  1M60 A;  3VMA A;  3ZCF A;  2OZ1 A;  3ITK A;  1CSU A;  3DR0 A;  3O20 A;  2FRC A;  1HZU A;  1FOC A;  4EIC A;  3OA8 A;  1GJQ A;  3O0R C;  3TYI A;  1ZRT D;  5DJQ C;  1E2R A;  1F1C A;  1L9J C;  1SQX D;  3L75 D;  3RN0 A;  1YIQ A;  2YCC A;  4FAN A;  1CHH A;  2N9J A;  1DVH A;  1I6E A;  2Y0E A;  3NWV A;  3L70 D;  1CTZ A;  4WQ9 A;  3SVW A;  1VYD A;  1BGY D;  2AXT V;  1AYG A;  1NTK D;  3L4O A;  2V07 A;  155C A;  3C2C A;  2XTS B;  2C8S A;  1ETP A;  1YTC A;  2YQB A;  1RZ6 A;  1DW2 A;  1HRO A;  2BH4 X;  3X39 A;  3WFC C;  3NBT A;  2BGV X;  2YK3 A;  1FHB A;  3SWS A;  4K3I A;  1SQV D;  1C6O A;  2N3Y A;  5CIH B;  3PTZ A;  2JTI B;  4Q5P A;  3TDK A;  1CTJ A;  2AI5 A;  2RMZ A;  1SQB D;  2CE1 A;  1KX7 A;  3A9F A;  4YE1 A;  3WC8 A;  1EB7 A;  2VHD A;  4RSZ A;  2HV4 A;  2K9J B;  2FYU D;  1CSV A;  4U3F D;  4UB6 V;  1S6V B;  2JWA A;  2GC7 D;  3A0B V;  4V2K A;  4O1Q A;  1J3S A;  1BL9 A;  3ZOX A;  4PWA A;  1CXA A;  1M6Z A;  1KB9 D;  2ZBO A;  3H1H D;  1CYI A;  1KIB A;  5GTH V;  3L74 D;  1H33 A;  4WQD A;  2MHM A;  1L9B C;  2CA4 B;  3PH2 B;  4FB1 A;  1F1F A;  1CRJ A;  3BCC D;  2ZXY A;  2ZZS 1;  1L0N D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...