3L70D

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 70
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l70D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l70D02
3JBTB 4D6TD 4N0KA 5AURA 2N18C 2QJPB 2GC7D 1YIQA 4U3FD 2JQRA 3HQ7A 3WU2V 1CCRA 4EICA 2KNCB 4FB1A 3TDKA 2XTSB 3RLMA 3WC8A 2QG4A 2O3JA 1M6ZA 1DW0A 2RMZA 1DIIC 1N15A 1SQVD 2CA4B 5TISV 4GYDA 4Q5PA 2JWAA 1H33A 1GQ1A 4AX3A 2Y0CA 3L72D 3ZIYA 1NU1D 2KS1A 1ZRTD 3VNWA 4WQAA 1C6RA 1PPJD 4A7PA 1I5TA 2YQBA 1I6EA 1ETPA 1IRVA 3NWVA 3CU4A 3O5CA 1I6DA 4AAMA 1QL3A 1C6OA 3PTZA 3RN0A 3PH2B 2FWLA 4WQ8A 3L4OA 1BL9A 1CTZA 1KX7A 1PP9D 1RZ6A 1NMLA 5CIDB 1LS9A 1C52A 3H1JD 5B5EV 4P4QB 3WFEC 3FWLA 1GJQA 3CX5W 4MU8A 2Y0DA 1N9CA 1CXCA 1N50A 1CRGA 4YE1A 1U75B 1CYIA 1BE3D 3A0HV 5DJQB 1W5CT 1NTMD 3H1ID 4KMGA 1WVEC 3PRJA 1CXAA 2V08A 1HZVA 3SLEA 4V2KA 1B7VA 2ZZS1 2IBZD 3CYTI 3OA8A 2HV4A 1CRYA 4K3IA 1CRHA 1FI7A 1M70A 1CC5A 1C2RA 1FI3A 3PXSA 2V07A 4JCGA 4WQBA 1NNOA 2PCCB 3MK7B 1C75A 4WQDA 1FCDC 3WFBC 1CORA 3OCDA 4NFGB 1KYOD 2N9YB 5H2FV 1AOQA 4AAOA 4QAOA 3ZOXA 5CICB 1W2LA 2FYUD 3VYMA 4UB8V 5TJHA 4H0JA 1DW2A 1YNRA 3OCDB 1CYCA 1RAQA 2I8FA 2C8SA 1E2RA 2PACA 2CXBA 1EB7A 1DW1A 1YTCA 3H1LD 3ZCFA 3ITKA 5CIFB 1CSWA 5DF5A 4FAVA 1A2SA 1U74B 4DY9A 1H9XA 4WQ9A 1HRCA 3WFDC 1HCMA 5EXQA 1FHBA 3KHUA 1CSVA 1L9JC 3O1YA 3TGUD 5B6QA 351CA 3L70D 4AALA 3ZBMA 2LITA 1GKSA 4H0KA 4FA4A 2B12B 3VMAA 2B11B 1CHIA 2BPBB 1N90A 1COTA 1QN2A 1FI9A 4IL6V 2C1VA 2GB8B 1GDVA 2B10B 2CE0A 5CIGB 1CYJA 2DGEA 3VRDA 1S6VB 1YEAA 2DVHA 1HJ3A 2N9IA 1H32A 2A06D 1IQCA 5KAFV 2Y0EA 4GEDB 4WQEA 2YCCA 451CA 2C9XB 1YFCA 1MG2D 2AIUA 2B4ZA 4PW9B 1CSXA 3L4MA 4EIDA 1C2NA 1DW3A 2BLFB 3HQ6A 1KX2A 3OA8B 3A0BV 3PHLA 1CTYA 3CX5D 5CIHB 1SQPD 1OAEA 1I54A 1J3SA 3CXHW 1FJ0A 5CIEB 155CA 4PD4D 5CYTR 4FA9A 3HQ8A 1AOFA 1KB0A 2C1DA 3BCCD 3L75D 1CRIA 3RN1A 2OZ1B 1K3GA 3WUIA 2QJYB 1CIGA 2BCNB 1M60A 2YIUB 4AANA 3ZOWA 2GC4D 4PJ0V 1IO3A 1KIBA 1IZL0 3WFCC 1I8PA 1I8OA 1L0ND 4FANA 1QKSA 2YK3A 4UB6V 2ZOOA 1F1FA 2LIRA 1BCCD 1BGYD 4L1QA 4EIFA 2K9JB 1F1CA 2CE1A 1NTZD 5IY51 1KV9A 1K3HA 5KAIV 3NBTA 1CIEA 1YICA 4O1WA 3PLNA 3DR0A 1WEJF 1YEBA 3CWBD 5C0ZA 1KB9D 1HJ4A 2N3YA 4O1QA 1I55A 1MG3D 1H9YA 3M97X 5KKZB 3X39A 5KLVD 1R0QA 2FRCA 4FA1A 3KZIV 3CXHD 1DT1A 3PXTA 1CTJA 4L3HA 2RN0A 4RJTA 3SXTA 3MK7C 2OZ1A 3CP5A 2CA3B 3ORVA 3L73D 3ZOYA 3PXWA 2D0WA 2N9JA 1CIHA 2AI5A 1KYOW 1CRCA 3ZOOA 5B66V 3O0RC 2N3BA 4PWAA 1GU2A 5E79V 1RAPA 5GTHV 1CIFA 1LC2A 1SQBD 2Q3EA 4EDFA 4L3GA 2BH4X 1LMSA 4FA5A 4LJIA 2N18B 1H32B 1CEDA 2C1DB 4XXLA 1QL4A 3GG2A 1CRJA 2C1UA 1H1OA 3HQ9A 1S5LV 2AXTV 2PCBB 2L91A 1E8EA 2ZXYA 1P84D 2FYNB 2VHDA 1MZ4A 1YCCA 5DJQC 4XYDB 1E29A 1A56A 2ORLA 1HZUA 3H1HD 2MHMA 1H31B 2D0SA 1FOCA 2C2CA 4J20A 1SQQD 3A9FA 1DVHA 1L9BC 2EXVA 2L4DA 5DFSA 1NTKD 3DMIA 1CHJA 1ZZHA 3DP5A 2BCCD 3L71D 3GW6A 3L74D 1IRWA 1CHHA 1EZVD 1VYDA 3TYIA 1HJ5A 2B0ZB 2JTIB 1GIWA 4Y5RA 1C6SA 1H31A 1L0LD 1LC1A 4RSZA 2BH5X 2ZONG 3SWSA 1CCHA 1LFMA 3RMZA 2BGVX 3SVWA 1JDLA 1C7MA 4WQCA 1CSUA 1DIQC 2ZBOA 1AKKA 1NMIA 2MTAC 2GIWA 5KLIB 1AYGA 3SJLA 1H33B 2QJKB 1CNOA 3C2CA 3TF5A 1QYZA 1A8CA 3O20A 4EIEA 1DVVA 1OCDA 1HROA 1HH7A 5CIBB 3NBSA 4WQ7A 1SQXD 1RZ5A 5C9MA 3H1KD 1NIRA 5GTIV 1CO6A
chains in the Genus database with same CATH superfamily
4D6TD 1VQNP 1YJNP 1IFNA 5GTIE 1JB0J 5B66H 4U3FD 1CZQA 5KLVJ 3H1JG 1VQ8P 2KNCB 4FB1A 5CJ4A 2A45G 2XTSB 1Z56A 4H44B 3H1HE 3N7NA 2QG4A 2C0WA 3LW5H 1SP4A 1YJ9P 1DIIC 1NU1E 1FOSF 5TISV 2KK7A 1L0NJ 4ZKPA 1GQ1A 3VMYA 1N7SA 4HJGH 1AQ5A 1NU1D 2KS1A 1JMBA 1AFOA 4H0LD 1IRVA 3D0WA 2Q7CA 3AE8C 2HODB 5CCHC 1QGKB 5AVQB 3G4SP 1BCCJ 4TLFA 1YITP 1LTSC 1OVRA 1RQVA 1CTZA 2LXBA 3O6QA 1RZ6A 1C52A 4Y99B 2PAJA 2Z5IA 3H1JD 1SQVG 1G1IA 2LR2A 1S5LE 1CXCA 1KYOH 4PJ0E 1BSHA 3BRVB 3ZDMA 1AV1A 2WSFJ 4YE1A 1OIPA 4UB6E 1PP9E 3Q5RA 1EZVI 3RBXA 5DJQB 3H1ID 3HRNA 2OTJP 4KMGA 1CXAA 3M0AA 2FXOA 4V2KA 5AVYB 1A02F 1DH3A 3CYTI 1S4XA 3OA8A 1CRYA 3TK1A 1XTCC 3CCRP 1VF5C 3Q3DA 3PXSA 1C75A 1FCDC 3WFBC 3D6ZA 1KILD 2YIUC 1GMJA 1IO4A 1GK6A 5CBOA 4TT3H 1NO4A 5H2FE 3TNUA 1KQLA 5TJHA 2YNYA 1J1DC 2K9YA 1DW2A 1M7LA 3OCDB 1CYCA 2WTYA 2CXBA 1AQTA 2O01H 3ITKA 1CSWA 4U3FE 1OWAA 1LWUB 5E79E 3H1LJ 1T8ZA 4WY4A 1H9XA 5CCHA 1HRCA 3WFDC 2AXTH 1HCMA 3H1KE 4AALA 2OTKE 4N78E 1NTKK 3CC7P 4OVNF 3AE7C 4H0KA 4IL6H 2FBWC 2B11B 1FS0E 1FZCA 1N90A 1COTA 1OMIA 2K88A 2B10B 5CIGB 2FFDC 4BWNA 3CLQA 1SQVE 1HJ3A 4JYCA 1JTHA 1OZHA 5KAFV 4C7NA 3A2AA 2XV5A 4UB8E 1SQQE 2B4ZA 1LT9C 1DEEG 1FZCC 4HKZH 3N4XA 4EIDA 3UIAA 1NTZG 1DW3A 2BLFB 1NTMJ 1H0TA 3RK3E 1BE3E 1ZP0C 1CTYA 2BCCE 1OAEA 1N2DC 1SFCC 1L4AC 1KC8Q 4PD4D 3HQ8A 2GM4A 1KB0A 3HE5A 1EDKA 3HE5B 5AVVB 2OZ1B 1K3GA 3MTUE 1PZQA 2WQYC 5KTBA 2QJYB 1CIGA 1UIXA 2YIUB 4AANA 2B87A 1NTZK 2WT7A 1IO3A 4MN4C 3MZWB 1IZL0 2I1JA 1I8OA 1FBMA 1PL5A 3B8EB 2LIRA 1BGYE 1BGYD 2Q6QA 4EIFA 2K9JB 1F1CA 2DW3A 2CE1A 1NTZD 3CX5H 2E74B 4KHXA 2ZVNB 3DR0A 1WEJF 5AVWB 1YEBA 3CWBD 1MZ9A 3S1KA 3CWBG 3H25A 4PD4E 2A45H 3OAKA 4ASWA 1U7MA 5KLIC 2H7HA 5AVRB 4PV1D 3H1KG 5KKZB 1KMIZ 1RF0A 2W6AA 3RBZA 2OYIA 1S2EA 1R0QA 1KYOE 3PXTA 2FYUG 2O1KA 3HUSA 3V2PA 2Q1KA 3SXTA 1N73B 2FYZA 1RF1B 1IFMA 1JY2N 1WMKA 1KILC 1MV8A 2N9JA 1JCDA 2OYHB 3KZIH 2J59M 4N6JA 3LIDA 3WUTA 4QMAA 1N7SC 3KQGA 2WZ7A 2KSJA 1PP9G 2Q3EA 3O6QB 2BH4X 3MIWA 5AW6B 2A45I 2N18B 4GOFA 5DJTB 3CCVP 5CCGA 1RHZB 1CRJA 3HQ9A 4H13B 2AXTV 1S9KD 2E76C 2L91A 2ZXYA 1P84D 4LC1A 1MZ4A 2ZVOB 1YCCA 4XYDB 1A56A 2PRRA 2MHMA 1H31B 2CPSA 1NKZB 2FXMA 2C2CA 4J20A 2P10A 4RESB 3A3YB 3MUDC 3I56P 1NKNA 2B9BA 4YTPC 2W90A 3C8VA 1L9BC 3R2PA 4WY4C 3AEEC 5K5GB 3DMIA 5AVXB 1VYDA 2B0ZB 2JTIB 1GU5A 1BSNA 1N86A 3R4YA 4OGQC 2NPSB 1G2CA 2BH5X 1M1JA 3M0DA 2HODA 1CI6B 1CCHA 2H88C 3SVWA 3H1IG 2IFMA 3WU2H 2QM7A 2M3BA 1CSUA 2ZBOA 4GODA 2MTAC 1AYGA 2E75D 3C2CA 1JEKA 3H1IE 4N3YB 1QYZA 4EIEA 1KD1Q 1JO5A 2IX7C 1HH7A 3BRTB 3NBSA 4I2LC 5BU5A 1SQXD 4KJMA 1RZ5A 2HG5D 3TGUG 3EFFK 1OW6A 3EFGA 2C9NY 1HJ0A 5AURA 2GC7D 2FFDB 1KILE 4EIJA 3WU2V 2K1AA 2D2CD 1SQPJ 1KB9E 1MUUA 2FKWB 2I8DA 3WC8A 1JY3P 3OA7A 2O3JA 1URQC 1M6ZA 4OWFA 3U1AA 2OGUA 1H89A 1N7SD 1SQVD 1QVFO 2ZT9B 4Q5PA 1SFCB 5H2FH 1H33A 1IK7A 4DCKA 4AX3A 2QA4P 2N1TD 3EWKA 5TISE 1LWUC 1ZRTD 3CL3D 4PV1C 1FZEA 4WQAA 1PPJD 1VQPP 1I5TA 2YQBA 1I6EA 1T3UA 2XU6A 3O5CA 1QL3A 1C6OA 3HE4A 4WQ8A 1KN7A 1CSBA 3V2QA 1L2PA 1BL9A 1PP9D 1LT9A 1BDCA 3CI9A 1VDFA 1J2JB 4P4QB 3L70J 1GJQA 1X0TA 5AW7B 1OVVA 2Y0DA 4IL6E 4GKGA 3VMXA 2ZXEB 1NVOA 1CYIA 3CCEP 5CCGC 1VPCA 3A0HV 3L73G 2NPSA 3P7KA 1W5CT 3M9BA 3CCLP 1FU1A 1HZVA 3RL0C 2G8YA 2FY8A 1URQD 2IZ1A 2HV4A 1FI7A 1YTZI 1M70A 1OXZA 1A02J 1FI3A 3L71G 2V07A 1NNOA 2E75C 2AXCA 3L74E 1KYOD 2N9YB 3HTKB 1URQB 5H2FV 4D6TG 1T2KD 4N78D 2Z5HA 4QAOA 2QIWA 4UB8H 1URQA 2ZXXA 5APYA 1FDIA 2RKLA 4AYCA 1FJPA 4L75A 1NH4A 2PACA 1EXIA 1EB7A 1DW1A 4JQ0D 5CIFB 3S9OA 3I5CA 3CXHE 1G1JA 2K37A 1GL2A 4DY9A 1NTZE 1QL1A 3NMDA 3KHUA 2G3AA 1VQ5P 1L9JC 3O1YA 3TGUD 3VP8A 351CA 3L70D 3M9HA 3ZBMA 2LITA 1FDOA 4FA4A 1E5WA 4AUWA 1CHIA 2KUBA 2BPBB 1HJBA 1QN2A 3TGUJ 4IL6V 3D6YA 1N73A 3V2NA 1YQ3C 1S6VB 1YEAA 2DVHA 1OW7A 1P84I 1SQBK 2IYPA 3RL0B 2QVAA 1H32A 2A06D 5BU8B 2A06E 1HVVA 3HD7D 1L0LG 4GEDB 4WQEA 451CA 1IFDA 2WPSA 4IL6X 1SQPG 2OYHC 3IAOA 3VOPA 1SS1A 3CX5E 4I6MC 1NTMG 1SQVJ 3B71A 3V5BA 1QVGO 1L4AA 3FGAD 3HQ6A 2XKMA 1KX2A 5APVA 3GHGB 3PHLA 2NRGA 1HF9A 1SQPD 1MFTA 1DX7A 4O9BA 1J3SA 1FJ0A 1LP1B 155CA 5CYTR 1HBWA 1VL2A 4ASVA 4FA9A 1M56D 1EQ7A 1HUCA 1HGVA 3CCSP 1FZAA 3VYIA 1KV4A 3WUIA 1PIXA 4ZNCA 3GMAA 2BCNB 1NTMK 2FYNC 1M60A 4PJ0V 2JWDA 2YO3A 1KIBA 1NU1K 2V7QJ 3V4QA 2PFXA 3BCCG 3LIEA 3CXHH 5AW9B 1L0ND 1PGQA 2YK3A 1VQ6P 2WT7B 2B87B 2XDJA 1Q82Q 1PPJE 4L1QA 3GF7A 1J1DB 2JR8A 1KV9A 4U3FJ 4BRYB 1R5LA 1CIEA 4HB1A 4L73A 1TU3F 1VF5D 1KB9D 1I55A 2W27A 1PP9J 3M97X 3TSIA 3TGUE 2WSEH 1ZW0A 1GW4A 3C9IA 1HTLC 2M5AB 5AVTB 2FRCA 4FA1A 3CXHD 5KAFE 1NU1G 1DEBA 1T3JA 3HD7A 3Q1MA 3LW5J 1FC2C 2KXPB 2CA3B 3KXDA 3T97A 3ZOYA 5B5EH 2E5YA 1R8EA 3B5NC 3VTPC 1EZVG 3A0BE 2D0WA 1JY3N 2AI5A 1T2KC 1GW3A 1S72P 1CRCA 5B66V 2E76D 2N3BA 1L0LJ 5APXA 2C0XA 2ZJSE 1KB9H 5GTHV 3W67A 2BCCJ 1BCCE 3QWOC 3SSUA 4DZOA 2Z4EA 1SQXG 1Y8AA 4IFFA 2N1TA 1IFJA 1LMSA 4LJIA 1H32B 2C1DB 1KQGB 4Y28J 3WU2E 3NXSA 1GTWA 1S5LV 2YKPA 1SQXJ 1DIPA 2J5UA 1KYOI 5DJQC 3A0HE 1HZUA 1R5SA 4PD4I 1NTKJ 2E5TA 2YXRB 1EDIA 1SQQD 5EFWB 1DVHA 2B88A 1GL2B 5KAIH 2XNDH 2L4DA 1NTKD 2R44A 4H13C 1SQBJ 1RE3A 3DP5A 3RK2C 1L4AD 2O1JA 2WSCH 3TYIA 1K9MQ 1HJ5A 1GIWA 3AE1C 3B5ND 1H31A 3FXEA 2BASA 4WBAA 2HPCA 4XFJA 3CWBJ 2ZONG 3SWSA 2MJZA 3L74G 1P84H 2N9BA 4K35A 1JDLA 1C7MA 1IK9A 2R5BA 2WSEJ 1DIQC 1H8AA 2IBZE 2GIWA 1PGPA 3AEFC 2QJKB 3KPEA 5GTHH 3TF5A 3IFMA 4W7YA 4H44C 1GZLA 2XZRA 5GTHE 5CIBB 4WQ7A 5C9MA 3H32B 3WMM0 5APSA 1KQFB 3JBTB 3AEDC 2N18C 2QJPB 2K9JA 4WVZA 1QLED 2JQRA 4EICA 4C7RA 2M0BA 1EXJA 1DW0A 2RMZA 1ZOYC 1N15A 3MHVA 2CA4B 1LT9B 3EQ2A 1JMMA 3HE4B 5KLVK 2HR3A 1IC2A 4EI2A 3G6EP 4A7PA 1Y9BA 3CCMP 1ETPA 1DD3A 1EC5A 5C39A 1YTZT 1T6AA 4AAMA 3L75J 1NTME 3RN0A 1USDA 3USSA 5CCHD 3PH2B 2FWLA 5CMZA 1ZR4A 3MD0A 3L4OA 5AW4B 1KX7A 3SWFA 5CIDB 3CCJP 3WFEC 3QH9A 4MU8A 1PGJA 1VQLP 1JTHB 1Q2NA 1GD2E 1N50A 3RK3C 1CRGA 3E1RA 1U75B 3JCUH 4IFDK 5KJ7A 1D7MA 1BE3D 4JYBA 2FFDA 2OYOA 1ZR2A 1PGOA 1FZCB 5AW8B 2WMMA 3F5HA 4R4LA 1LTGC 2FYUE 2E74C 1OX3A 1P84E 1K8AQ 3AE2C 3PRJA 3SLEA 2V08A 4HYTB 2MKVA 3PH0A 3AE9C 2ZZS1 2IBZD 3V6IA 2BEZF 4W80A 2CK3H 3AE5C 1LWUA 2E42A 4JCGA 4WQBA 2PCCB 3MK7B 1EZVE 5KJ7C 2XNXA 1CORA 2OTLP 5AW2B 2I1KA 2KLUA 4C7NB 3OCDA 1S5LH 1YQ4C 1NYHA 1LGHB 1YYCA 3I55P 5CICB 2IBZI 2Y9ZA 1W2LA 1M90Q 1N7LA 3JSVC 3VYMA 2O01J 2GUSA 4UB8V 2IZ0A 2KIKA 3A0HH 3BVHA 4PV1B 1NTKG 3H1IJ 3L72G 1RAQA 4C46A 2I8FA 2WSSH 3Q5SA 1E2RA 3RK2B 1JUNA 1YTCA 1RQUA 2W6BA 3RK3D 4FAVA 3M91A 2KI7B 1U74B 1WT6A 4WQ9A 3AE4C 5EXQA 4L76A 3U59A 2J58A 2HPCB 3WUUA 5B5EE 5CBNA 1PFIA 2B12B 4BXLA 2C1VA 1Q86Q 1CYJA 2AXTE 1W2BO 3A0BH 2FYUK 3WUVA 3GLMA 3H1LG 3L71E 1YJWP 5APQA 1N73C 3AE3C 2N9IA 3OJAB 1IQCA 3H1HG 4YXWH 4WB4A 2Y0EA 2HLOA 3CMEP 2YCCA 3U1CA 3E7KA 4D6TE 1YFCA 2OARA 1MG2D 2AIUA 1SLQA 4I1LA 4PW9B 5KAFH 1PPJG 1AVOA 1L0NG 2P1JA 1LTIC 1USEA 3OA8B 1SQPK 1SFCD 2OYHA 5CIHB 1GU4A 1NJIQ 1I54A 3H1JE 4YXDC 3G9RA 1S5LX 4NPFX 1SVFA 1AOFA 2IYOA 2C1DA 1KTMA 2KS1B 1CRIA 3RN1A 1RF1A 1SQVK 2OQQA 4HH2A 2AEFA 4YPCA 1SQBE 1E79H 4GIFA 3VMZA 3ZOWA 2GC4D 1YIJP 2V4HA 1FOSE 3M9QA 4IOIH 3W68A 1JY3O 1QKSA 3GHGC 1VQMP 4UB6V 2KNCA 1F1FA 3FX0A 4EYYQ 2P7JA 1QL2A 1VQ4P 5L8RJ 1RF1C 5KJ7D 5B66E 3T97B 1YBKA 4LGDE 1ZMEC 1IFIA 5AVUB 2QRXA 2A06G 1K3HA 5KAIV 3AEAC 1YICA 4O1WA 1J1EC 3AE6C 3PLNA 1FZBA 1JNMA 3GF3A 5C0ZA 1RY3A 2W8ZA 2RH0A 2N3YA 4O1QA 3H1KJ 1H9YA 2BEQD 2E74D 4I7ZC 1U57A 1NTKE 1SQXE 4XE5B 1DT1A 2R3CA 2ZT9C 1EDJA 4L3HA 2QEXP 1K04A 2RN0A 3MK7C 2OZ1A 3L4FA 3PP5A 2IPPA 4GOEA 3ORVA 5AVZB 3L73D 3PXWA 1K05A 1HGZA 2Y9YA 1FZFA 1CIHA 3ZOOA 1JOCA 3O0RC 4WY4D 1SQQK 3FXDA 1H0TB 4PWAA 1GU2A 5E79V 1RAPA 2YKOA 1CIFA 5KLVG 4U7JA 4ZKUA 1CW5A 1M1KQ 4EDFA 4L3GA 1GK4A 1RH5B 4D6TJ 3OW2O 1L0LK 1RE4A 2HYNA 1NOHA 1Q81Q 1H1OA 3L70E 1X9VA 2B89A 2H8PD 3G71P 2FYNB 2VHDA 4BRYA 3GHGA 1L0NE 3H1HJ 1NHLA 2ORLA 3H1HD 2D0SA 2IFNA 1FOCA 1Q90D 2Q9IA 4H0LC 2ZYAA 3A9FA 4OGQB 1LNQA 2M8RA 2ZAEB 1CHJA 1ZZHA 5GTIH 3CD6P 3L71D 3GW6A 1IRWA 1EZVD 1KFNA 1IJDB 1U7JA 2R5DA 1C6SA 1LC1A 1KB9I 3L74J 1LT1A 3TNUB 4OGQD 2D2CC 4IFMA 4GDOA 1LFMA 3RMZA 3H32A 4R4MA 3L73J 5AW5B 1KZUB 1OVUA 5KLIB 2ZFCA 3B5NB 5TISH 1NGMB 3SJLA 1CNOA 1A8CA 3O20A 1OCDA 1NAFA 2NZ2A 4LLHA 1KFMA 2PP6A 3H1KD 2SPZA 2ZT9D 3CC4P 2ITAA 4N0KA 2NPSC 4DT0A 1S1CX 3P8CE 3CCUP 1YIQA 2QJKC 3HQ7A 3MUDA 1CCRA 2KOGA 2FXPA 1RE4C 2JDIH 3TDKA 3MGNA 3RLMA 3P32A 4CPGA 2OYIC 3D71A 2YMKA 4GYDA 2JWAA 1H88A 5KKZC 1LTJA 1JY2P 1LTAC 2Y0CA 3L72D 3ZIYA 3VNWA 3VN0A 1C6RA 1NTZJ 2IBZG 1FE6A 4I7ZB 3NWVA 1FAVA 1KORA 3CU4A 3O8ZA 1I6DA 1BGYJ 5AW0B 3PTZA 1GL2C 1HH0A 1QEXA 1UIIA 2HFED 3A7OA 3HTKA 1N7SB 1DD4A 1NMLA 1LS9A 5B5EV 3FWLA 2QE7H 2R32A 3CX5W 3BATA 2KZJA 1N9CA 2H43A 4WWIA 4M3LA 3L37A 3C1LA 3HUSC 1NAYA 2P58A 2R3SA 3JCUE 1X8YA 3AECC 1NTMD 2JEEA 1IFPA 3SFEC 1WVEC 4ZMDA 1JY2O 1W5CE 3HD7B 1B7VA 1M57D 4K3IA 1CRHA 1SQXK 2N1TB 2QJPC 5DJUB 1CC5A 1C2RA 2JP3A 4WQDA 3BCCJ 4NFGB 4K3AA 1AOQA 4AAOA 1LTJC 2IDBA 4EOTA 3KZIE 3ZOXA 4DOJA 1X79B 2W6JH 4KT0J 5APUA 2QSIA 2FYUD 3H1LE 2O01N 3P8CD 4L74A 1VQOP 2WPQA 5CCGD 4H0JA 1YNRA 2M3EA 2C8SA 1VQ7P 3H1LD 3ZCFA 3ABVC 4B86A 1OFCX 1SFCA 3L70G 5DF5A 1RE3C 5AW3B 1A2SA 2KYVA 3L75E 3B4SA 3RL0D 5KAIE 2M5AA 1HWTC 2AEMA 2WPVB 1FHBA 2ZYGA 1CSVA 4RO0A 5AVSB 5B6QA 2YXQB 3F89A 4JF7A 1JM0A 4U3FG 4PD4H 1GKSA 3VMAA 3RK3B 2WWWA 3SFDC 1LP1A 3JC22 2H89C 1FI9A 2GB8B 1BGYG 1J1EB 1GDVA 4NPEA 2CE0A 2YKQA 1M1JC 3M0DC 2DGEA 3VRDA 2PGDA 3HD7C 2QM8A 1ZRTE 2WVRA 1GL2D 1BE3J 1W2EA 2NPSD 2LKMA 1FJKA 4DJGA 3D70A 2C9XB 1AJYA 1CSXA 3L4MA 1C2NA 1KILB 2WSFH 2FYUJ 2JJLA 1JCCA 1BDDA 2L5GB 3A0BV 2KSEA 2LXCB 3IR9A 3CX5D 3CXHI 2W83C 1CI6A 3CXHW 5CIEB 2C9LY 2WPRA 1G2CB 3BCCD 4PJ0H 2Q5UA 3L75D 1FZGA 1LTJB 3KDPB 4OH8B 2E75B 1BCCG 1YI2P 3H1JJ 2BCCG 3CPWO 1L4AB 2Q3IA 1M8OB 3WFCC 1I8PA 4FANA 1BE3G 2JKVA 3L72E 1ZLLA 2E76B 2ZOOA 3Q2YA 1VQKP 2AEJA 1S9KE 3CC2P 1BCCD 3L35A 1N8RQ 3L73E 5IY51 3SWKA 2KP8A 3MP7B 4Y99C 5AW1B 1NU1J 3NBTA 2K3RA 3HUSB 2D2CB 4AQRD 3G3ZA 4W7ZA 4JBZA 1K73Q 1L0NK 1HJ4A 2OYIB 1MG3D 1X22A 1LJ2A 3KYQA 2P2UA 3B5NA 2JO1A 3X39A 3L71J 5KLVD 3CMAP 2WITA 1VQ9P 3KZIV 1SQPE 1ZXGA 1CTJA 4RJTA 1GDTA 3CP5A 3NFQA 3L72J 1MFZA 1MKMA 2N1TC 3RGUA 3PJSK 3H6PA 5APWA 3Q5PA 1KYOW 1ZN5A 1EDLA 4H13D 1AA0A 1IZNB 1KILA 3CWBE 3II6A 2P67A 1XTGB 2KB7P 1S3JA 4XA4A 5E79H 1LC2A 1SQBD 4Z1MH 1WRGA 1ZV8A 1LTBC 3S4RA 4FA5A 5CHXA 1CEDA 4XXLA 3FWNA 1QL4A 3VP9A 2CPBA 1QX8A 1AVYA 1SQQJ 2WSCJ 3GG2A 3V2RA 2C1UA 4H0LB 2PCBB 1RF0C 1VF5B 2KZIA 1OW8A 1SQBG 1E8EA 5CJ0A 2GUVA 3RL0g 1KQSO 1E29A 1YHQP 3BASA 2UWJE 2QJYC 2VRSA 3NTNA 3TYYA 2GA1A 3CCQP 2E43A 3SWYA 2EXVA 5DFSA 3AEGC 4NPDA 2V7QH 2BCCD 3L74D 1CHHA 1SQQG 3M06A 5APTA 3RK2D 4GT1A 4Y5RA 3AEBC 1L0LD 1L0LE 3K5BA 2ZYDA 4RSZA 1Y47A 2BGVX 3L36A 3CX5I 4WQCA 1FDMA 3L75G 2YO2A 4WY4B 1AKKA 1NMIA 3BCCE 1LTTC 3A5TA 4UB6H 1H33B 4RKUJ 3IF4A 5BVZA 5M1BA 3P8MC 3V4WA 1NWQA 1DVVA 4H44D 3E1IA 3IN6A 1HROA 4JPZB 2YMYA 2KLVA 1PV3A 1Q7YQ 5KLVE 1NIRA 5GTIV 1CO6A 2POHA 1M1JB
chains in the Genus database with same CATH topology
3JBTB 4D6TD 4N0KA 5AURA 2N18C 2QJPB 2GC7D 1YIQA 4U3FD 2JQRA 3HQ7A 3WU2V 1CCRA 4EICA 2KNCB 4FB1A 3TDKA 2XTSB 3RLMA 3WC8A 2QG4A 2O3JA 1M6ZA 1DW0A 2RMZA 1DIIC 1N15A 1SQVD 2CA4B 5TISV 4GYDA 4Q5PA 2JWAA 1H33A 1GQ1A 4AX3A 2Y0CA 3L72D 3ZIYA 1NU1D 2KS1A 1ZRTD 3VNWA 4WQAA 1C6RA 1PPJD 4A7PA 1I5TA 2YQBA 1I6EA 1ETPA 1IRVA 3NWVA 3CU4A 3O5CA 1I6DA 4AAMA 1QL3A 1C6OA 3PTZA 3RN0A 3PH2B 2FWLA 4WQ8A 3L4OA 1BL9A 1CTZA 1KX7A 1PP9D 1RZ6A 1NMLA 5CIDB 1LS9A 1C52A 3H1JD 5B5EV 4P4QB 3WFEC 3FWLA 1GJQA 3CX5W 4MU8A 2Y0DA 1N9CA 1CXCA 1N50A 1CRGA 4YE1A 1U75B 1CYIA 1BE3D 3A0HV 5DJQB 1W5CT 1NTMD 3H1ID 4KMGA 1WVEC 3PRJA 1CXAA 2V08A 1HZVA 3SLEA 4V2KA 1B7VA 2ZZS1 2IBZD 3CYTI 3OA8A 2HV4A 1CRYA 4K3IA 1CRHA 1FI7A 1M70A 1CC5A 1C2RA 1FI3A 3PXSA 2V07A 4JCGA 4WQBA 1NNOA 2PCCB 3MK7B 1C75A 4WQDA 1FCDC 3WFBC 1CORA 3OCDA 4NFGB 1KYOD 2N9YB 5H2FV 1AOQA 4AAOA 4QAOA 3ZOXA 5CICB 1W2LA 2FYUD 3VYMA 4UB8V 5TJHA 4H0JA 1DW2A 1YNRA 3OCDB 1CYCA 1RAQA 2I8FA 2C8SA 1E2RA 2PACA 2CXBA 1EB7A 1DW1A 1YTCA 3H1LD 3ZCFA 3ITKA 5CIFB 1CSWA 5DF5A 4FAVA 1A2SA 1U74B 4DY9A 1H9XA 4WQ9A 1HRCA 3WFDC 1HCMA 5EXQA 1FHBA 3KHUA 1CSVA 1L9JC 3O1YA 3TGUD 5B6QA 351CA 3L70D 4AALA 3ZBMA 2LITA 1GKSA 4H0KA 4FA4A 2B12B 3VMAA 2B11B 1CHIA 2BPBB 1N90A 1COTA 1QN2A 1FI9A 4IL6V 2C1VA 2GB8B 1GDVA 2B10B 2CE0A 5CIGB 1CYJA 2DGEA 3VRDA 1S6VB 1YEAA 2DVHA 1HJ3A 2N9IA 1H32A 2A06D 1IQCA 5KAFV 2Y0EA 4GEDB 4WQEA 2YCCA 451CA 2C9XB 1YFCA 1MG2D 2AIUA 2B4ZA 4PW9B 1CSXA 3L4MA 4EIDA 1C2NA 1DW3A 2BLFB 3HQ6A 1KX2A 3OA8B 3A0BV 3PHLA 1CTYA 3CX5D 5CIHB 1SQPD 1OAEA 1I54A 1J3SA 3CXHW 1FJ0A 5CIEB 155CA 4PD4D 5CYTR 4FA9A 3HQ8A 1AOFA 1KB0A 2C1DA 3BCCD 3L75D 1CRIA 3RN1A 2OZ1B 1K3GA 3WUIA 2QJYB 1CIGA 2BCNB 1M60A 2YIUB 4AANA 3ZOWA 2GC4D 4PJ0V 1IO3A 1KIBA 1IZL0 3WFCC 1I8PA 1I8OA 1L0ND 4FANA 1QKSA 2YK3A 4UB6V 2ZOOA 1F1FA 2LIRA 1BCCD 1BGYD 4L1QA 4EIFA 2K9JB 1F1CA 2CE1A 1NTZD 5IY51 1KV9A 1K3HA 5KAIV 3NBTA 1CIEA 1YICA 4O1WA 3PLNA 3DR0A 1WEJF 1YEBA 3CWBD 5C0ZA 1KB9D 1HJ4A 2N3YA 4O1QA 1I55A 1MG3D 1H9YA 3M97X 5KKZB 3X39A 5KLVD 1R0QA 2FRCA 4FA1A 3KZIV 3CXHD 1DT1A 3PXTA 1CTJA 4L3HA 2RN0A 4RJTA 3SXTA 3MK7C 2OZ1A 3CP5A 2CA3B 3ORVA 3L73D 3ZOYA 3PXWA 2D0WA 2N9JA 1CIHA 2AI5A 1KYOW 1CRCA 3ZOOA 5B66V 3O0RC 2N3BA 4PWAA 1GU2A 5E79V 1RAPA 5GTHV 1CIFA 1LC2A 1SQBD 2Q3EA 4EDFA 4L3GA 2BH4X 1LMSA 4FA5A 4LJIA 2N18B 1H32B 1CEDA 2C1DB 4XXLA 1QL4A 3GG2A 1CRJA 2C1UA 1H1OA 3HQ9A 1S5LV 2AXTV 2PCBB 2L91A 1E8EA 2ZXYA 1P84D 2FYNB 2VHDA 1MZ4A 1YCCA 5DJQC 4XYDB 1E29A 1A56A 2ORLA 1HZUA 3H1HD 2MHMA 1H31B 2D0SA 1FOCA 2C2CA 4J20A 1SQQD 3A9FA 1DVHA 1L9BC 2EXVA 2L4DA 5DFSA 1NTKD 3DMIA 1CHJA 1ZZHA 3DP5A 2BCCD 3L71D 3GW6A 3L74D 1IRWA 1CHHA 1EZVD 1VYDA 3TYIA 1HJ5A 2B0ZB 2JTIB 1GIWA 4Y5RA 1C6SA 1H31A 1L0LD 1LC1A 4RSZA 2BH5X 2ZONG 3SWSA 1CCHA 1LFMA 3RMZA 2BGVX 3SVWA 1JDLA 1C7MA 4WQCA 1CSUA 1DIQC 2ZBOA 1AKKA 1NMIA 2MTAC 2GIWA 5KLIB 1AYGA 3SJLA 1H33B 2QJKB 1CNOA 3C2CA 3TF5A 1QYZA 1A8CA 3O20A 4EIEA 1DVVA 1OCDA 1HROA 1HH7A 5CIBB 3NBSA 4WQ7A 1SQXD 1RZ5A 5C9MA 3H1KD 1NIRA 5GTIV 1CO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JBT B;  4D6T D;  4N0K A;  5AUR A;  2N18 C;  2QJP B;  2GC7 D;  1YIQ A;  4U3F D;  2JQR A;  3HQ7 A;  3WU2 V;  1CCR A;  4EIC A;  2KNC B;  4FB1 A;  3TDK A;  2XTS B;  3RLM A;  3WC8 A;  2QG4 A;  2O3J A;  1M6Z A;  1DW0 A;  2RMZ A;  1DII C;  1N15 A;  1SQV D;  2CA4 B;  5TIS V;  4GYD A;  4Q5P A;  2JWA A;  1H33 A;  1GQ1 A;  4AX3 A;  2Y0C A;  3L72 D;  3ZIY A;  1NU1 D;  2KS1 A;  1ZRT D;  3VNW A;  4WQA A;  1C6R A;  1PPJ D;  4A7P A;  1I5T A;  2YQB A;  1I6E A;  1ETP A;  1IRV A;  3NWV A;  3CU4 A;  3O5C A;  1I6D A;  4AAM A;  1QL3 A;  1C6O A;  3PTZ A;  3RN0 A;  3PH2 B;  2FWL A;  4WQ8 A;  3L4O A;  1BL9 A;  1CTZ A;  1KX7 A;  1PP9 D;  1RZ6 A;  1NML A;  5CID B;  1LS9 A;  1C52 A;  3H1J D;  5B5E V;  4P4Q B;  3WFE C;  3FWL A;  1GJQ A;  3CX5 W;  4MU8 A;  2Y0D A;  1N9C A;  1CXC A;  1N50 A;  1CRG A;  4YE1 A;  1U75 B;  1CYI A;  1BE3 D;  3A0H V;  5DJQ B;  1W5C T;  1NTM D;  3H1I D;  4KMG A;  1WVE C;  3PRJ A;  1CXA A;  2V08 A;  1HZV A;  3SLE A;  4V2K A;  1B7V A;  2ZZS 1;  2IBZ D;  3CYT I;  3OA8 A;  2HV4 A;  1CRY A;  4K3I A;  1CRH A;  1FI7 A;  1M70 A;  1CC5 A;  1C2R A;  1FI3 A;  3PXS A;  2V07 A;  4JCG A;  4WQB A;  1NNO A;  2PCC B;  3MK7 B;  1C75 A;  4WQD A;  1FCD C;  3WFB C;  1COR A;  3OCD A;  4NFG B;  1KYO D;  2N9Y B;  5H2F V;  1AOQ A;  4AAO A;  4QAO A;  3ZOX A;  5CIC B;  1W2L A;  2FYU D;  3VYM A;  4UB8 V;  5TJH A;  4H0J A;  1DW2 A;  1YNR A;  3OCD B;  1CYC A;  1RAQ A;  2I8F A;  2C8S A;  1E2R A;  2PAC A;  2CXB A;  1EB7 A;  1DW1 A;  1YTC A;  3H1L D;  3ZCF A;  3ITK A;  5CIF B;  1CSW A;  5DF5 A;  4FAV A;  1A2S A;  1U74 B;  4DY9 A;  1H9X A;  4WQ9 A;  1HRC A;  3WFD C;  1HCM A;  5EXQ A;  1FHB A;  3KHU A;  1CSV A;  1L9J C;  3O1Y A;  3TGU D;  5B6Q A;  351C A;  3L70 D;  4AAL A;  3ZBM A;  2LIT A;  1GKS A;  4H0K A;  4FA4 A;  2B12 B;  3VMA A;  2B11 B;  1CHI A;  2BPB B;  1N90 A;  1COT A;  1QN2 A;  1FI9 A;  4IL6 V;  2C1V A;  2GB8 B;  1GDV A;  2B10 B;  2CE0 A;  5CIG B;  1CYJ A;  2DGE A;  3VRD A;  1S6V B;  1YEA A;  2DVH A;  1HJ3 A;  2N9I A;  1H32 A;  2A06 D;  1IQC A;  5KAF V;  2Y0E A;  4GED B;  4WQE A;  2YCC A;  451C A;  2C9X B;  1YFC A;  1MG2 D;  2AIU A;  2B4Z A;  4PW9 B;  1CSX A;  3L4M A;  4EID A;  1C2N A;  1DW3 A;  2BLF B;  3HQ6 A;  1KX2 A;  3OA8 B;  3A0B V;  3PHL A;  1CTY A;  3CX5 D;  5CIH B;  1SQP D;  1OAE A;  1I54 A;  1J3S A;  3CXH W;  1FJ0 A;  5CIE B;  155C A;  4PD4 D;  5CYT R;  4FA9 A;  3HQ8 A;  1AOF A;  1KB0 A;  2C1D A;  3BCC D;  3L75 D;  1CRI A;  3RN1 A;  2OZ1 B;  1K3G A;  3WUI A;  2QJY B;  1CIG A;  2BCN B;  1M60 A;  2YIU B;  4AAN A;  3ZOW A;  2GC4 D;  4PJ0 V;  1IO3 A;  1KIB A;  1IZL 0;  3WFC C;  1I8P A;  1I8O A;  1L0N D;  4FAN A;  1QKS A;  2YK3 A;  4UB6 V;  2ZOO A;  1F1F A;  2LIR A;  1BCC D;  1BGY D;  4L1Q A;  4EIF A;  2K9J B;  1F1C A;  2CE1 A;  1NTZ D;  5IY5 1;  1KV9 A;  1K3H A;  5KAI V;  3NBT A;  1CIE A;  1YIC A;  4O1W A;  3PLN A;  3DR0 A;  1WEJ F;  1YEB A;  3CWB D;  5C0Z A;  1KB9 D;  1HJ4 A;  2N3Y A;  4O1Q A;  1I55 A;  1MG3 D;  1H9Y A;  3M97 X;  5KKZ B;  3X39 A;  5KLV D;  1R0Q A;  2FRC A;  4FA1 A;  3KZI V;  3CXH D;  1DT1 A;  3PXT A;  1CTJ A;  4L3H A;  2RN0 A;  4RJT A;  3SXT A;  3MK7 C;  2OZ1 A;  3CP5 A;  2CA3 B;  3ORV A;  3L73 D;  3ZOY A;  3PXW A;  2D0W A;  2N9J A;  1CIH A;  2AI5 A;  1KYO W;  1CRC A;  3ZOO A;  5B66 V;  3O0R C;  2N3B A;  4PWA A;  1GU2 A;  5E79 V;  1RAP A;  5GTH V;  1CIF A;  1LC2 A;  1SQB D;  2Q3E A;  4EDF A;  4L3G A;  2BH4 X;  1LMS A;  4FA5 A;  4LJI A;  2N18 B;  1H32 B;  1CED A;  2C1D B;  4XXL A;  1QL4 A;  3GG2 A;  1CRJ A;  2C1U A;  1H1O A;  3HQ9 A;  1S5L V;  2AXT V;  2PCB B;  2L91 A;  1E8E A;  2ZXY A;  1P84 D;  2FYN B;  2VHD A;  1MZ4 A;  1YCC A;  5DJQ C;  4XYD B;  1E29 A;  1A56 A;  2ORL A;  1HZU A;  3H1H D;  2MHM A;  1H31 B;  2D0S A;  1FOC A;  2C2C A;  4J20 A;  1SQQ D;  3A9F A;  1DVH A;  1L9B C;  2EXV A;  2L4D A;  5DFS A;  1NTK D;  3DMI A;  1CHJ A;  1ZZH A;  3DP5 A;  2BCC D;  3L71 D;  3GW6 A;  3L74 D;  1IRW A;  1CHH A;  1EZV D;  1VYD A;  3TYI A;  1HJ5 A;  2B0Z B;  2JTI B;  1GIW A;  4Y5R A;  1C6S A;  1H31 A;  1L0L D;  1LC1 A;  4RSZ A;  2BH5 X;  2ZON G;  3SWS A;  1CCH A;  1LFM A;  3RMZ A;  2BGV X;  3SVW A;  1JDL A;  1C7M A;  4WQC A;  1CSU A;  1DIQ C;  2ZBO A;  1AKK A;  1NMI A;  2MTA C;  2GIW A;  5KLI B;  1AYG A;  3SJL A;  1H33 B;  2QJK B;  1CNO A;  3C2C A;  3TF5 A;  1QYZ A;  1A8C A;  3O20 A;  4EIE A;  1DVV A;  1OCD A;  1HRO A;  1HH7 A;  5CIB B;  3NBS A;  4WQ7 A;  1SQX D;  1RZ5 A;  5C9M A;  3H1K D;  1NIR A;  5GTI V;  1CO6 A; 
#chains in the Genus database with same CATH topology
 4D6T D;  1VQN P;  1YJN P;  1IFN A;  5GTI E;  1JB0 J;  5B66 H;  4U3F D;  1CZQ A;  5KLV J;  3H1J G;  1VQ8 P;  2KNC B;  4FB1 A;  5CJ4 A;  2A45 G;  2XTS B;  1Z56 A;  4H44 B;  3H1H E;  3N7N A;  2QG4 A;  2C0W A;  3LW5 H;  1SP4 A;  1YJ9 P;  1DII C;  1NU1 E;  1FOS F;  5TIS V;  2KK7 A;  1L0N J;  4ZKP A;  1GQ1 A;  3VMY A;  1N7S A;  4HJG H;  1AQ5 A;  1NU1 D;  2KS1 A;  1JMB A;  1AFO A;  4H0L D;  1IRV A;  3D0W A;  2Q7C A;  3AE8 C;  2HOD B;  5CCH C;  1QGK B;  5AVQ B;  3G4S P;  1BCC J;  4TLF A;  1YIT P;  1LTS C;  1OVR A;  1RQV A;  1CTZ A;  2LXB A;  3O6Q A;  1RZ6 A;  1C52 A;  4Y99 B;  2PAJ A;  2Z5I A;  3H1J D;  1SQV G;  1G1I A;  2LR2 A;  1S5L E;  1CXC A;  1KYO H;  4PJ0 E;  1BSH A;  3BRV B;  3ZDM A;  1AV1 A;  2WSF J;  4YE1 A;  1OIP A;  4UB6 E;  1PP9 E;  3Q5R A;  1EZV I;  3RBX A;  5DJQ B;  3H1I D;  3HRN A;  2OTJ P;  4KMG A;  1CXA A;  3M0A A;  2FXO A;  4V2K A;  5AVY B;  1A02 F;  1DH3 A;  3CYT I;  1S4X A;  3OA8 A;  1CRY A;  3TK1 A;  1XTC C;  3CCR P;  1VF5 C;  3Q3D A;  3PXS A;  1C75 A;  1FCD C;  3WFB C;  3D6Z A;  1KIL D;  2YIU C;  1GMJ A;  1IO4 A;  1GK6 A;  5CBO A;  4TT3 H;  1NO4 A;  5H2F E;  3TNU A;  1KQL A;  5TJH A;  2YNY A;  1J1D C;  2K9Y A;  1DW2 A;  1M7L A;  3OCD B;  1CYC A;  2WTY A;  2CXB A;  1AQT A;  2O01 H;  3ITK A;  1CSW A;  4U3F E;  1OWA A;  1LWU B;  5E79 E;  3H1L J;  1T8Z A;  4WY4 A;  1H9X A;  5CCH A;  1HRC A;  3WFD C;  2AXT H;  1HCM A;  3H1K E;  4AAL A;  2OTK E;  4N78 E;  1NTK K;  3CC7 P;  4OVN F;  3AE7 C;  4H0K A;  4IL6 H;  2FBW C;  2B11 B;  1FS0 E;  1FZC A;  1N90 A;  1COT A;  1OMI A;  2K88 A;  2B10 B;  5CIG B;  2FFD C;  4BWN A;  3CLQ A;  1SQV E;  1HJ3 A;  4JYC A;  1JTH A;  1OZH A;  5KAF V;  4C7N A;  3A2A A;  2XV5 A;  4UB8 E;  1SQQ E;  2B4Z A;  1LT9 C;  1DEE G;  1FZC C;  4HKZ H;  3N4X A;  4EID A;  3UIA A;  1NTZ G;  1DW3 A;  2BLF B;  1NTM J;  1H0T A;  3RK3 E;  1BE3 E;  1ZP0 C;  1CTY A;  2BCC E;  1OAE A;  1N2D C;  1SFC C;  1L4A C;  1KC8 Q;  4PD4 D;  3HQ8 A;  2GM4 A;  1KB0 A;  3HE5 A;  1EDK A;  3HE5 B;  5AVV B;  2OZ1 B;  1K3G A;  3MTU E;  1PZQ A;  2WQY C;  5KTB A;  2QJY B;  1CIG A;  1UIX A;  2YIU B;  4AAN A;  2B87 A;  1NTZ K;  2WT7 A;  1IO3 A;  4MN4 C;  3MZW B;  1IZL 0;  2I1J A;  1I8O A;  1FBM A;  1PL5 A;  3B8E B;  2LIR A;  1BGY E;  1BGY D;  2Q6Q A;  4EIF A;  2K9J B;  1F1C A;  2DW3 A;  2CE1 A;  1NTZ D;  3CX5 H;  2E74 B;  4KHX A;  2ZVN B;  3DR0 A;  1WEJ F;  5AVW B;  1YEB A;  3CWB D;  1MZ9 A;  3S1K A;  3CWB G;  3H25 A;  4PD4 E;  2A45 H;  3OAK A;  4ASW A;  1U7M A;  5KLI C;  2H7H A;  5AVR B;  4PV1 D;  3H1K G;  5KKZ B;  1KMI Z;  1RF0 A;  2W6A A;  3RBZ A;  2OYI A;  1S2E A;  1R0Q A;  1KYO E;  3PXT A;  2FYU G;  2O1K A;  3HUS A;  3V2P A;  2Q1K A;  3SXT A;  1N73 B;  2FYZ A;  1RF1 B;  1IFM A;  1JY2 N;  1WMK A;  1KIL C;  1MV8 A;  2N9J A;  1JCD A;  2OYH B;  3KZI H;  2J59 M;  4N6J A;  3LID A;  3WUT A;  4QMA A;  1N7S C;  3KQG A;  2WZ7 A;  2KSJ A;  1PP9 G;  2Q3E A;  3O6Q B;  2BH4 X;  3MIW A;  5AW6 B;  2A45 I;  2N18 B;  4GOF A;  5DJT B;  3CCV P;  5CCG A;  1RHZ B;  1CRJ A;  3HQ9 A;  4H13 B;  2AXT V;  1S9K D;  2E76 C;  2L91 A;  2ZXY A;  1P84 D;  4LC1 A;  1MZ4 A;  2ZVO B;  1YCC A;  4XYD B;  1A56 A;  2PRR A;  2MHM A;  1H31 B;  2CPS A;  1NKZ B;  2FXM A;  2C2C A;  4J20 A;  2P10 A;  4RES B;  3A3Y B;  3MUD C;  3I56 P;  1NKN A;  2B9B A;  4YTP C;  2W90 A;  3C8V A;  1L9B C;  3R2P A;  4WY4 C;  3AEE C;  5K5G B;  3DMI A;  5AVX B;  1VYD A;  2B0Z B;  2JTI B;  1GU5 A;  1BSN A;  1N86 A;  3R4Y A;  4OGQ C;  2NPS B;  1G2C A;  2BH5 X;  1M1J A;  3M0D A;  2HOD A;  1CI6 B;  1CCH A;  2H88 C;  3SVW A;  3H1I G;  2IFM A;  3WU2 H;  2QM7 A;  2M3B A;  1CSU A;  2ZBO A;  4GOD A;  2MTA C;  1AYG A;  2E75 D;  3C2C A;  1JEK A;  3H1I E;  4N3Y B;  1QYZ A;  4EIE A;  1KD1 Q;  1JO5 A;  2IX7 C;  1HH7 A;  3BRT B;  3NBS A;  4I2L C;  5BU5 A;  1SQX D;  4KJM A;  1RZ5 A;  2HG5 D;  3TGU G;  3EFF K;  1OW6 A;  3EFG A;  2C9N Y;  1HJ0 A;  5AUR A;  2GC7 D;  2FFD B;  1KIL E;  4EIJ A;  3WU2 V;  2K1A A;  2D2C D;  1SQP J;  1KB9 E;  1MUU A;  2FKW B;  2I8D A;  3WC8 A;  1JY3 P;  3OA7 A;  2O3J A;  1URQ C;  1M6Z A;  4OWF A;  3U1A A;  2OGU A;  1H89 A;  1N7S D;  1SQV D;  1QVF O;  2ZT9 B;  4Q5P A;  1SFC B;  5H2F H;  1H33 A;  1IK7 A;  4DCK A;  4AX3 A;  2QA4 P;  2N1T D;  3EWK A;  5TIS E;  1LWU C;  1ZRT D;  3CL3 D;  4PV1 C;  1FZE A;  4WQA A;  1PPJ D;  1VQP P;  1I5T A;  2YQB A;  1I6E A;  1T3U A;  2XU6 A;  3O5C A;  1QL3 A;  1C6O A;  3HE4 A;  4WQ8 A;  1KN7 A;  1CSB A;  3V2Q A;  1L2P A;  1BL9 A;  1PP9 D;  1LT9 A;  1BDC A;  3CI9 A;  1VDF A;  1J2J B;  4P4Q B;  3L70 J;  1GJQ A;  1X0T A;  5AW7 B;  1OVV A;  2Y0D A;  4IL6 E;  4GKG A;  3VMX A;  2ZXE B;  1NVO A;  1CYI A;  3CCE P;  5CCG C;  1VPC A;  3A0H V;  3L73 G;  2NPS A;  3P7K A;  1W5C T;  3M9B A;  3CCL P;  1FU1 A;  1HZV A;  3RL0 C;  2G8Y A;  2FY8 A;  1URQ D;  2IZ1 A;  2HV4 A;  1FI7 A;  1YTZ I;  1M70 A;  1OXZ A;  1A02 J;  1FI3 A;  3L71 G;  2V07 A;  1NNO A;  2E75 C;  2AXC A;  3L74 E;  1KYO D;  2N9Y B;  3HTK B;  1URQ B;  5H2F V;  4D6T G;  1T2K D;  4N78 D;  2Z5H A;  4QAO A;  2QIW A;  4UB8 H;  1URQ A;  2ZXX A;  5APY A;  1FDI A;  2RKL A;  4AYC A;  1FJP A;  4L75 A;  1NH4 A;  2PAC A;  1EXI A;  1EB7 A;  1DW1 A;  4JQ0 D;  5CIF B;  3S9O A;  3I5C A;  3CXH E;  1G1J A;  2K37 A;  1GL2 A;  4DY9 A;  1NTZ E;  1QL1 A;  3NMD A;  3KHU A;  2G3A A;  1VQ5 P;  1L9J C;  3O1Y A;  3TGU D;  3VP8 A;  351C A;  3L70 D;  3M9H A;  3ZBM A;  2LIT A;  1FDO A;  4FA4 A;  1E5W A;  4AUW A;  1CHI A;  2KUB A;  2BPB B;  1HJB A;  1QN2 A;  3TGU J;  4IL6 V;  3D6Y A;  1N73 A;  3V2N A;  1YQ3 C;  1S6V B;  1YEA A;  2DVH A;  1OW7 A;  1P84 I;  1SQB K;  2IYP A;  3RL0 B;  2QVA A;  1H32 A;  2A06 D;  5BU8 B;  2A06 E;  1HVV A;  3HD7 D;  1L0L G;  4GED B;  4WQE A;  451C A;  1IFD A;  2WPS A;  4IL6 X;  1SQP G;  2OYH C;  3IAO A;  3VOP A;  1SS1 A;  3CX5 E;  4I6M C;  1NTM G;  1SQV J;  3B71 A;  3V5B A;  1QVG O;  1L4A A;  3FGA D;  3HQ6 A;  2XKM A;  1KX2 A;  5APV A;  3GHG B;  3PHL A;  2NRG A;  1HF9 A;  1SQP D;  1MFT A;  1DX7 A;  4O9B A;  1J3S A;  1FJ0 A;  1LP1 B;  155C A;  5CYT R;  1HBW A;  1VL2 A;  4ASV A;  4FA9 A;  1M56 D;  1EQ7 A;  1HUC A;  1HGV A;  3CCS P;  1FZA A;  3VYI A;  1KV4 A;  3WUI A;  1PIX A;  4ZNC A;  3GMA A;  2BCN B;  1NTM K;  2FYN C;  1M60 A;  4PJ0 V;  2JWD A;  2YO3 A;  1KIB A;  1NU1 K;  2V7Q J;  3V4Q A;  2PFX A;  3BCC G;  3LIE A;  3CXH H;  5AW9 B;  1L0N D;  1PGQ A;  2YK3 A;  1VQ6 P;  2WT7 B;  2B87 B;  2XDJ A;  1Q82 Q;  1PPJ E;  4L1Q A;  3GF7 A;  1J1D B;  2JR8 A;  1KV9 A;  4U3F J;  4BRY B;  1R5L A;  1CIE A;  4HB1 A;  4L73 A;  1TU3 F;  1VF5 D;  1KB9 D;  1I55 A;  2W27 A;  1PP9 J;  3M97 X;  3TSI A;  3TGU E;  2WSE H;  1ZW0 A;  1GW4 A;  3C9I A;  1HTL C;  2M5A B;  5AVT B;  2FRC A;  4FA1 A;  3CXH D;  5KAF E;  1NU1 G;  1DEB A;  1T3J A;  3HD7 A;  3Q1M A;  3LW5 J;  1FC2 C;  2KXP B;  2CA3 B;  3KXD A;  3T97 A;  3ZOY A;  5B5E H;  2E5Y A;  1R8E A;  3B5N C;  3VTP C;  1EZV G;  3A0B E;  2D0W A;  1JY3 N;  2AI5 A;  1T2K C;  1GW3 A;  1S72 P;  1CRC A;  5B66 V;  2E76 D;  2N3B A;  1L0L J;  5APX A;  2C0X A;  2ZJS E;  1KB9 H;  5GTH V;  3W67 A;  2BCC J;  1BCC E;  3QWO C;  3SSU A;  4DZO A;  2Z4E A;  1SQX G;  1Y8A A;  4IFF A;  2N1T A;  1IFJ A;  1LMS A;  4LJI A;  1H32 B;  2C1D B;  1KQG B;  4Y28 J;  3WU2 E;  3NXS A;  1GTW A;  1S5L V;  2YKP A;  1SQX J;  1DIP A;  2J5U A;  1KYO I;  5DJQ C;  3A0H E;  1HZU A;  1R5S A;  4PD4 I;  1NTK J;  2E5T A;  2YXR B;  1EDI A;  1SQQ D;  5EFW B;  1DVH A;  2B88 A;  1GL2 B;  5KAI H;  2XND H;  2L4D A;  1NTK D;  2R44 A;  4H13 C;  1SQB J;  1RE3 A;  3DP5 A;  3RK2 C;  1L4A D;  2O1J A;  2WSC H;  3TYI A;  1K9M Q;  1HJ5 A;  1GIW A;  3AE1 C;  3B5N D;  1H31 A;  3FXE A;  2BAS A;  4WBA A;  2HPC A;  4XFJ A;  3CWB J;  2ZON G;  3SWS A;  2MJZ A;  3L74 G;  1P84 H;  2N9B A;  4K35 A;  1JDL A;  1C7M A;  1IK9 A;  2R5B A;  2WSE J;  1DIQ C;  1H8A A;  2IBZ E;  2GIW A;  1PGP A;  3AEF C;  2QJK B;  3KPE A;  5GTH H;  3TF5 A;  3IFM A;  4W7Y A;  4H44 C;  1GZL A;  2XZR A;  5GTH E;  5CIB B;  4WQ7 A;  5C9M A;  3H32 B;  3WMM 0;  5APS A;  1KQF B;  3JBT B;  3AED C;  2N18 C;  2QJP B;  2K9J A;  4WVZ A;  1QLE D;  2JQR A;  4EIC A;  4C7R A;  2M0B A;  1EXJ A;  1DW0 A;  2RMZ A;  1ZOY C;  1N15 A;  3MHV A;  2CA4 B;  1LT9 B;  3EQ2 A;  1JMM A;  3HE4 B;  5KLV K;  2HR3 A;  1IC2 A;  4EI2 A;  3G6E P;  4A7P A;  1Y9B A;  3CCM P;  1ETP A;  1DD3 A;  1EC5 A;  5C39 A;  1YTZ T;  1T6A A;  4AAM A;  3L75 J;  1NTM E;  3RN0 A;  1USD A;  3USS A;  5CCH D;  3PH2 B;  2FWL A;  5CMZ A;  1ZR4 A;  3MD0 A;  3L4O A;  5AW4 B;  1KX7 A;  3SWF A;  5CID B;  3CCJ P;  3WFE C;  3QH9 A;  4MU8 A;  1PGJ A;  1VQL P;  1JTH B;  1Q2N A;  1GD2 E;  1N50 A;  3RK3 C;  1CRG A;  3E1R A;  1U75 B;  3JCU H;  4IFD K;  5KJ7 A;  1D7M A;  1BE3 D;  4JYB A;  2FFD A;  2OYO A;  1ZR2 A;  1PGO A;  1FZC B;  5AW8 B;  2WMM A;  3F5H A;  4R4L A;  1LTG C;  2FYU E;  2E74 C;  1OX3 A;  1P84 E;  1K8A Q;  3AE2 C;  3PRJ A;  3SLE A;  2V08 A;  4HYT B;  2MKV A;  3PH0 A;  3AE9 C;  2ZZS 1;  2IBZ D;  3V6I A;  2BEZ F;  4W80 A;  2CK3 H;  3AE5 C;  1LWU A;  2E42 A;  4JCG A;  4WQB A;  2PCC B;  3MK7 B;  1EZV E;  5KJ7 C;  2XNX A;  1COR A;  2OTL P;  5AW2 B;  2I1K A;  2KLU A;  4C7N B;  3OCD A;  1S5L H;  1YQ4 C;  1NYH A;  1LGH B;  1YYC A;  3I55 P;  5CIC B;  2IBZ I;  2Y9Z A;  1W2L A;  1M90 Q;  1N7L A;  3JSV C;  3VYM A;  2O01 J;  2GUS A;  4UB8 V;  2IZ0 A;  2KIK A;  3A0H H;  3BVH A;  4PV1 B;  1NTK G;  3H1I J;  3L72 G;  1RAQ A;  4C46 A;  2I8F A;  2WSS H;  3Q5S A;  1E2R A;  3RK2 B;  1JUN A;  1YTC A;  1RQU A;  2W6B A;  3RK3 D;  4FAV A;  3M91 A;  2KI7 B;  1U74 B;  1WT6 A;  4WQ9 A;  3AE4 C;  5EXQ A;  4L76 A;  3U59 A;  2J58 A;  2HPC B;  3WUU A;  5B5E E;  5CBN A;  1PFI A;  2B12 B;  4BXL A;  2C1V A;  1Q86 Q;  1CYJ A;  2AXT E;  1W2B O;  3A0B H;  2FYU K;  3WUV A;  3GLM A;  3H1L G;  3L71 E;  1YJW P;  5APQ A;  1N73 C;  3AE3 C;  2N9I A;  3OJA B;  1IQC A;  3H1H G;  4YXW H;  4WB4 A;  2Y0E A;  2HLO A;  3CME P;  2YCC A;  3U1C A;  3E7K A;  4D6T E;  1YFC A;  2OAR A;  1MG2 D;  2AIU A;  1SLQ A;  4I1L A;  4PW9 B;  5KAF H;  1PPJ G;  1AVO A;  1L0N G;  2P1J A;  1LTI C;  1USE A;  3OA8 B;  1SQP K;  1SFC D;  2OYH A;  5CIH B;  1GU4 A;  1NJI Q;  1I54 A;  3H1J E;  4YXD C;  3G9R A;  1S5L X;  4NPF X;  1SVF A;  1AOF A;  2IYO A;  2C1D A;  1KTM A;  2KS1 B;  1CRI A;  3RN1 A;  1RF1 A;  1SQV K;  2OQQ A;  4HH2 A;  2AEF A;  4YPC A;  1SQB E;  1E79 H;  4GIF A;  3VMZ A;  3ZOW A;  2GC4 D;  1YIJ P;  2V4H A;  1FOS E;  3M9Q A;  4IOI H;  3W68 A;  1JY3 O;  1QKS A;  3GHG C;  1VQM P;  4UB6 V;  2KNC A;  1F1F A;  3FX0 A;  4EYY Q;  2P7J A;  1QL2 A;  1VQ4 P;  5L8R J;  1RF1 C;  5KJ7 D;  5B66 E;  3T97 B;  1YBK A;  4LGD E;  1ZME C;  1IFI A;  5AVU B;  2QRX A;  2A06 G;  1K3H A;  5KAI V;  3AEA C;  1YIC A;  4O1W A;  1J1E C;  3AE6 C;  3PLN A;  1FZB A;  1JNM A;  3GF3 A;  5C0Z A;  1RY3 A;  2W8Z A;  2RH0 A;  2N3Y A;  4O1Q A;  3H1K J;  1H9Y A;  2BEQ D;  2E74 D;  4I7Z C;  1U57 A;  1NTK E;  1SQX E;  4XE5 B;  1DT1 A;  2R3C A;  2ZT9 C;  1EDJ A;  4L3H A;  2QEX P;  1K04 A;  2RN0 A;  3MK7 C;  2OZ1 A;  3L4F A;  3PP5 A;  2IPP A;  4GOE A;  3ORV A;  5AVZ B;  3L73 D;  3PXW A;  1K05 A;  1HGZ A;  2Y9Y A;  1FZF A;  1CIH A;  3ZOO A;  1JOC A;  3O0R C;  4WY4 D;  1SQQ K;  3FXD A;  1H0T B;  4PWA A;  1GU2 A;  5E79 V;  1RAP A;  2YKO A;  1CIF A;  5KLV G;  4U7J A;  4ZKU A;  1CW5 A;  1M1K Q;  4EDF A;  4L3G A;  1GK4 A;  1RH5 B;  4D6T J;  3OW2 O;  1L0L K;  1RE4 A;  2HYN A;  1NOH A;  1Q81 Q;  1H1O A;  3L70 E;  1X9V A;  2B89 A;  2H8P D;  3G71 P;  2FYN B;  2VHD A;  4BRY A;  3GHG A;  1L0N E;  3H1H J;  1NHL A;  2ORL A;  3H1H D;  2D0S A;  2IFN A;  1FOC A;  1Q90 D;  2Q9I A;  4H0L C;  2ZYA A;  3A9F A;  4OGQ B;  1LNQ A;  2M8R A;  2ZAE B;  1CHJ A;  1ZZH A;  5GTI H;  3CD6 P;  3L71 D;  3GW6 A;  1IRW A;  1EZV D;  1KFN A;  1IJD B;  1U7J A;  2R5D A;  1C6S A;  1LC1 A;  1KB9 I;  3L74 J;  1LT1 A;  3TNU B;  4OGQ D;  2D2C C;  4IFM A;  4GDO A;  1LFM A;  3RMZ A;  3H32 A;  4R4M A;  3L73 J;  5AW5 B;  1KZU B;  1OVU A;  5KLI B;  2ZFC A;  3B5N B;  5TIS H;  1NGM B;  3SJL A;  1CNO A;  1A8C A;  3O20 A;  1OCD A;  1NAF A;  2NZ2 A;  4LLH A;  1KFM A;  2PP6 A;  3H1K D;  2SPZ A;  2ZT9 D;  3CC4 P;  2ITA A;  4N0K A;  2NPS C;  4DT0 A;  1S1C X;  3P8C E;  3CCU P;  1YIQ A;  2QJK C;  3HQ7 A;  3MUD A;  1CCR A;  2KOG A;  2FXP A;  1RE4 C;  2JDI H;  3TDK A;  3MGN A;  3RLM A;  3P32 A;  4CPG A;  2OYI C;  3D71 A;  2YMK A;  4GYD A;  2JWA A;  1H88 A;  5KKZ C;  1LTJ A;  1JY2 P;  1LTA C;  2Y0C A;  3L72 D;  3ZIY A;  3VNW A;  3VN0 A;  1C6R A;  1NTZ J;  2IBZ G;  1FE6 A;  4I7Z B;  3NWV A;  1FAV A;  1KOR A;  3CU4 A;  3O8Z A;  1I6D A;  1BGY J;  5AW0 B;  3PTZ A;  1GL2 C;  1HH0 A;  1QEX A;  1UII A;  2HFE D;  3A7O A;  3HTK A;  1N7S B;  1DD4 A;  1NML A;  1LS9 A;  5B5E V;  3FWL A;  2QE7 H;  2R32 A;  3CX5 W;  3BAT A;  2KZJ A;  1N9C A;  2H43 A;  4WWI A;  4M3L A;  3L37 A;  3C1L A;  3HUS C;  1NAY A;  2P58 A;  2R3S A;  3JCU E;  1X8Y A;  3AEC C;  1NTM D;  2JEE A;  1IFP A;  3SFE C;  1WVE C;  4ZMD A;  1JY2 O;  1W5C E;  3HD7 B;  1B7V A;  1M57 D;  4K3I A;  1CRH A;  1SQX K;  2N1T B;  2QJP C;  5DJU B;  1CC5 A;  1C2R A;  2JP3 A;  4WQD A;  3BCC J;  4NFG B;  4K3A A;  1AOQ A;  4AAO A;  1LTJ C;  2IDB A;  4EOT A;  3KZI E;  3ZOX A;  4DOJ A;  1X79 B;  2W6J H;  4KT0 J;  5APU A;  2QSI A;  2FYU D;  3H1L E;  2O01 N;  3P8C D;  4L74 A;  1VQO P;  2WPQ A;  5CCG D;  4H0J A;  1YNR A;  2M3E A;  2C8S A;  1VQ7 P;  3H1L D;  3ZCF A;  3ABV C;  4B86 A;  1OFC X;  1SFC A;  3L70 G;  5DF5 A;  1RE3 C;  5AW3 B;  1A2S A;  2KYV A;  3L75 E;  3B4S A;  3RL0 D;  5KAI E;  2M5A A;  1HWT C;  2AEM A;  2WPV B;  1FHB A;  2ZYG A;  1CSV A;  4RO0 A;  5AVS B;  5B6Q A;  2YXQ B;  3F89 A;  4JF7 A;  1JM0 A;  4U3F G;  4PD4 H;  1GKS A;  3VMA A;  3RK3 B;  2WWW A;  3SFD C;  1LP1 A;  3JC2 2;  2H89 C;  1FI9 A;  2GB8 B;  1BGY G;  1J1E B;  1GDV A;  4NPE A;  2CE0 A;  2YKQ A;  1M1J C;  3M0D C;  2DGE A;  3VRD A;  2PGD A;  3HD7 C;  2QM8 A;  1ZRT E;  2WVR A;  1GL2 D;  1BE3 J;  1W2E A;  2NPS D;  2LKM A;  1FJK A;  4DJG A;  3D70 A;  2C9X B;  1AJY A;  1CSX A;  3L4M A;  1C2N A;  1KIL B;  2WSF H;  2FYU J;  2JJL A;  1JCC A;  1BDD A;  2L5G B;  3A0B V;  2KSE A;  2LXC B;  3IR9 A;  3CX5 D;  3CXH I;  2W83 C;  1CI6 A;  3CXH W;  5CIE B;  2C9L Y;  2WPR A;  1G2C B;  3BCC D;  4PJ0 H;  2Q5U A;  3L75 D;  1FZG A;  1LTJ B;  3KDP B;  4OH8 B;  2E75 B;  1BCC G;  1YI2 P;  3H1J J;  2BCC G;  3CPW O;  1L4A B;  2Q3I A;  1M8O B;  3WFC C;  1I8P A;  4FAN A;  1BE3 G;  2JKV A;  3L72 E;  1ZLL A;  2E76 B;  2ZOO A;  3Q2Y A;  1VQK P;  2AEJ A;  1S9K E;  3CC2 P;  1BCC D;  3L35 A;  1N8R Q;  3L73 E;  5IY5 1;  3SWK A;  2KP8 A;  3MP7 B;  4Y99 C;  5AW1 B;  1NU1 J;  3NBT A;  2K3R A;  3HUS B;  2D2C B;  4AQR D;  3G3Z A;  4W7Z A;  4JBZ A;  1K73 Q;  1L0N K;  1HJ4 A;  2OYI B;  1MG3 D;  1X22 A;  1LJ2 A;  3KYQ A;  2P2U A;  3B5N A;  2JO1 A;  3X39 A;  3L71 J;  5KLV D;  3CMA P;  2WIT A;  1VQ9 P;  3KZI V;  1SQP E;  1ZXG A;  1CTJ A;  4RJT A;  1GDT A;  3CP5 A;  3NFQ A;  3L72 J;  1MFZ A;  1MKM A;  2N1T C;  3RGU A;  3PJS K;  3H6P A;  5APW A;  3Q5P A;  1KYO W;  1ZN5 A;  1EDL A;  4H13 D;  1AA0 A;  1IZN B;  1KIL A;  3CWB E;  3II6 A;  2P67 A;  1XTG B;  2KB7 P;  1S3J A;  4XA4 A;  5E79 H;  1LC2 A;  1SQB D;  4Z1M H;  1WRG A;  1ZV8 A;  1LTB C;  3S4R A;  4FA5 A;  5CHX A;  1CED A;  4XXL A;  3FWN A;  1QL4 A;  3VP9 A;  2CPB A;  1QX8 A;  1AVY A;  1SQQ J;  2WSC J;  3GG2 A;  3V2R A;  2C1U A;  4H0L B;  2PCB B;  1RF0 C;  1VF5 B;  2KZI A;  1OW8 A;  1SQB G;  1E8E A;  5CJ0 A;  2GUV A;  3RL0 g;  1KQS O;  1E29 A;  1YHQ P;  3BAS A;  2UWJ E;  2QJY C;  2VRS A;  3NTN A;  3TYY A;  2GA1 A;  3CCQ P;  2E43 A;  3SWY A;  2EXV A;  5DFS A;  3AEG C;  4NPD A;  2V7Q H;  2BCC D;  3L74 D;  1CHH A;  1SQQ G;  3M06 A;  5APT A;  3RK2 D;  4GT1 A;  4Y5R A;  3AEB C;  1L0L D;  1L0L E;  3K5B A;  2ZYD A;  4RSZ A;  1Y47 A;  2BGV X;  3L36 A;  3CX5 I;  4WQC A;  1FDM A;  3L75 G;  2YO2 A;  4WY4 B;  1AKK A;  1NMI A;  3BCC E;  1LTT C;  3A5T A;  4UB6 H;  1H33 B;  4RKU J;  3IF4 A;  5BVZ A;  5M1B A;  3P8M C;  3V4W A;  1NWQ A;  1DVV A;  4H44 D;  3E1I A;  3IN6 A;  1HRO A;  4JPZ B;  2YMY A;  2KLV A;  1PV3 A;  1Q7Y Q;  5KLV E;  1NIR A;  5GTI V;  1CO6 A;  2POH A;  1M1J B; 
#chains in the Genus database with same CATH homology
 3JBT B;  4D6T D;  4N0K A;  5AUR A;  2N18 C;  2QJP B;  2GC7 D;  1YIQ A;  4U3F D;  2JQR A;  3HQ7 A;  3WU2 V;  1CCR A;  4EIC A;  2KNC B;  4FB1 A;  3TDK A;  2XTS B;  3RLM A;  3WC8 A;  2QG4 A;  2O3J A;  1M6Z A;  1DW0 A;  2RMZ A;  1DII C;  1N15 A;  1SQV D;  2CA4 B;  5TIS V;  4GYD A;  4Q5P A;  2JWA A;  1H33 A;  1GQ1 A;  4AX3 A;  2Y0C A;  3L72 D;  3ZIY A;  1NU1 D;  2KS1 A;  1ZRT D;  3VNW A;  4WQA A;  1C6R A;  1PPJ D;  4A7P A;  1I5T A;  2YQB A;  1I6E A;  1ETP A;  1IRV A;  3NWV A;  3CU4 A;  3O5C A;  1I6D A;  4AAM A;  1QL3 A;  1C6O A;  3PTZ A;  3RN0 A;  3PH2 B;  2FWL A;  4WQ8 A;  3L4O A;  1BL9 A;  1CTZ A;  1KX7 A;  1PP9 D;  1RZ6 A;  1NML A;  5CID B;  1LS9 A;  1C52 A;  3H1J D;  5B5E V;  4P4Q B;  3WFE C;  3FWL A;  1GJQ A;  3CX5 W;  4MU8 A;  2Y0D A;  1N9C A;  1CXC A;  1N50 A;  1CRG A;  4YE1 A;  1U75 B;  1CYI A;  1BE3 D;  3A0H V;  5DJQ B;  1W5C T;  1NTM D;  3H1I D;  4KMG A;  1WVE C;  3PRJ A;  1CXA A;  2V08 A;  1HZV A;  3SLE A;  4V2K A;  1B7V A;  2ZZS 1;  2IBZ D;  3CYT I;  3OA8 A;  2HV4 A;  1CRY A;  4K3I A;  1CRH A;  1FI7 A;  1M70 A;  1CC5 A;  1C2R A;  1FI3 A;  3PXS A;  2V07 A;  4JCG A;  4WQB A;  1NNO A;  2PCC B;  3MK7 B;  1C75 A;  4WQD A;  1FCD C;  3WFB C;  1COR A;  3OCD A;  4NFG B;  1KYO D;  2N9Y B;  5H2F V;  1AOQ A;  4AAO A;  4QAO A;  3ZOX A;  5CIC B;  1W2L A;  2FYU D;  3VYM A;  4UB8 V;  5TJH A;  4H0J A;  1DW2 A;  1YNR A;  3OCD B;  1CYC A;  1RAQ A;  2I8F A;  2C8S A;  1E2R A;  2PAC A;  2CXB A;  1EB7 A;  1DW1 A;  1YTC A;  3H1L D;  3ZCF A;  3ITK A;  5CIF B;  1CSW A;  5DF5 A;  4FAV A;  1A2S A;  1U74 B;  4DY9 A;  1H9X A;  4WQ9 A;  1HRC A;  3WFD C;  1HCM A;  5EXQ A;  1FHB A;  3KHU A;  1CSV A;  1L9J C;  3O1Y A;  3TGU D;  5B6Q A;  351C A;  3L70 D;  4AAL A;  3ZBM A;  2LIT A;  1GKS A;  4H0K A;  4FA4 A;  2B12 B;  3VMA A;  2B11 B;  1CHI A;  2BPB B;  1N90 A;  1COT A;  1QN2 A;  1FI9 A;  4IL6 V;  2C1V A;  2GB8 B;  1GDV A;  2B10 B;  2CE0 A;  5CIG B;  1CYJ A;  2DGE A;  3VRD A;  1S6V B;  1YEA A;  2DVH A;  1HJ3 A;  2N9I A;  1H32 A;  2A06 D;  1IQC A;  5KAF V;  2Y0E A;  4GED B;  4WQE A;  2YCC A;  451C A;  2C9X B;  1YFC A;  1MG2 D;  2AIU A;  2B4Z A;  4PW9 B;  1CSX A;  3L4M A;  4EID A;  1C2N A;  1DW3 A;  2BLF B;  3HQ6 A;  1KX2 A;  3OA8 B;  3A0B V;  3PHL A;  1CTY A;  3CX5 D;  5CIH B;  1SQP D;  1OAE A;  1I54 A;  1J3S A;  3CXH W;  1FJ0 A;  5CIE B;  155C A;  4PD4 D;  5CYT R;  4FA9 A;  3HQ8 A;  1AOF A;  1KB0 A;  2C1D A;  3BCC D;  3L75 D;  1CRI A;  3RN1 A;  2OZ1 B;  1K3G A;  3WUI A;  2QJY B;  1CIG A;  2BCN B;  1M60 A;  2YIU B;  4AAN A;  3ZOW A;  2GC4 D;  4PJ0 V;  1IO3 A;  1KIB A;  1IZL 0;  3WFC C;  1I8P A;  1I8O A;  1L0N D;  4FAN A;  1QKS A;  2YK3 A;  4UB6 V;  2ZOO A;  1F1F A;  2LIR A;  1BCC D;  1BGY D;  4L1Q A;  4EIF A;  2K9J B;  1F1C A;  2CE1 A;  1NTZ D;  5IY5 1;  1KV9 A;  1K3H A;  5KAI V;  3NBT A;  1CIE A;  1YIC A;  4O1W A;  3PLN A;  3DR0 A;  1WEJ F;  1YEB A;  3CWB D;  5C0Z A;  1KB9 D;  1HJ4 A;  2N3Y A;  4O1Q A;  1I55 A;  1MG3 D;  1H9Y A;  3M97 X;  5KKZ B;  3X39 A;  5KLV D;  1R0Q A;  2FRC A;  4FA1 A;  3KZI V;  3CXH D;  1DT1 A;  3PXT A;  1CTJ A;  4L3H A;  2RN0 A;  4RJT A;  3SXT A;  3MK7 C;  2OZ1 A;  3CP5 A;  2CA3 B;  3ORV A;  3L73 D;  3ZOY A;  3PXW A;  2D0W A;  2N9J A;  1CIH A;  2AI5 A;  1KYO W;  1CRC A;  3ZOO A;  5B66 V;  3O0R C;  2N3B A;  4PWA A;  1GU2 A;  5E79 V;  1RAP A;  5GTH V;  1CIF A;  1LC2 A;  1SQB D;  2Q3E A;  4EDF A;  4L3G A;  2BH4 X;  1LMS A;  4FA5 A;  4LJI A;  2N18 B;  1H32 B;  1CED A;  2C1D B;  4XXL A;  1QL4 A;  3GG2 A;  1CRJ A;  2C1U A;  1H1O A;  3HQ9 A;  1S5L V;  2AXT V;  2PCB B;  2L91 A;  1E8E A;  2ZXY A;  1P84 D;  2FYN B;  2VHD A;  1MZ4 A;  1YCC A;  5DJQ C;  4XYD B;  1E29 A;  1A56 A;  2ORL A;  1HZU A;  3H1H D;  2MHM A;  1H31 B;  2D0S A;  1FOC A;  2C2C A;  4J20 A;  1SQQ D;  3A9F A;  1DVH A;  1L9B C;  2EXV A;  2L4D A;  5DFS A;  1NTK D;  3DMI A;  1CHJ A;  1ZZH A;  3DP5 A;  2BCC D;  3L71 D;  3GW6 A;  3L74 D;  1IRW A;  1CHH A;  1EZV D;  1VYD A;  3TYI A;  1HJ5 A;  2B0Z B;  2JTI B;  1GIW A;  4Y5R A;  1C6S A;  1H31 A;  1L0L D;  1LC1 A;  4RSZ A;  2BH5 X;  2ZON G;  3SWS A;  1CCH A;  1LFM A;  3RMZ A;  2BGV X;  3SVW A;  1JDL A;  1C7M A;  4WQC A;  1CSU A;  1DIQ C;  2ZBO A;  1AKK A;  1NMI A;  2MTA C;  2GIW A;  5KLI B;  1AYG A;  3SJL A;  1H33 B;  2QJK B;  1CNO A;  3C2C A;  3TF5 A;  1QYZ A;  1A8C A;  3O20 A;  4EIE A;  1DVV A;  1OCD A;  1HRO A;  1HH7 A;  5CIB B;  3NBS A;  4WQ7 A;  1SQX D;  1RZ5 A;  5C9M A;  3H1K D;  1NIR A;  5GTI V;  1CO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...