3CXHD

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
246
Chain Sequence
b'MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 71
structure length 246
sequence length 246
chains with identical sequence O
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cxhD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cxhD02
1FCDC 3PXWA 1DW0A 4MU8A 1CYIA 3FWLA 5KKZB 1CC5A 4J20A 1H33A 2CE1A 5H2FV 4AX3A 2OZ1A 1YEAA 1CXAA 1NNOA 2I8FA 5CYTR 1CCRA 1M60A 2AI5A 2ZONG 1MG2D 2LITA 3PXTA 1C6RA 1YIQA 1CRYA 1CRIA 4WQ8A 2DGEA 1DT1A 1YCCA 5DF5A 1CRCA 5IY51 3ZOYA 5DJQC 3PHLA 1CIHA 1PP9D 4P4QB 2N3BA 3NBTA 4XXLA 4KMGA 2OZ1B 1DIQC 2N9IA 4FA4A 1B7VA 451CA 4IL6V 4JCGA 5C9MA 5CIDB 4WQEA 5CIGB 4Q5PA 4PWAA 3SXTA 1CTYA 2C1UA 3TF5A 2Q3EA 2C1DA 3DP5A 2BGVX 2BH4X 2N18B 1AKKA 1SQPD 3CXHD 3RLMA 3RN1A 1I5TA 3H1JD 1C6OA 3A9FA 2N9YB 1H9YA 2KNCB 1DW2A 1H31A 4K3IA 1S6VB 1H32A 2QJKB 3WUIA 5B66V 3O0RC 3VMAA 1QL3A 2PCBB 5KLVD 2MTAC 1BE3D 4EICA 1DW1A 1P84D 1CHHA 3KHUA 1DVVA 3O1YA 1RZ5A 3WFBC 2EXVA 1RZ6A 1ZZHA 1QYZA 1HJ4A 4O1QA 4WQCA 2GB8B 3SWSA 1CSWA 1H32B 1SQQD 1FI7A 2BH5X 3L4OA 1SQXD 3ZOWA 1HROA 1C7MA 1QL4A 1DIIC 2CXBA 5CIHB 4EIEA 2IBZD 1L0LD 1KX7A 2MHMA 1CEDA 4XYDB 2YIUB 1CXCA 4FAVA 1N90A 2O3JA 1PPJD 2QJPB 5DJQB 1QKSA 1EB7A 3L73D 4PJ0V 1KYOD 1QN2A 1SQVD 5TJHA 1M6ZA 2B0ZB 1C2RA 3X39A 3C2CA 5DFSA 1KX2A 2C1VA 4L3HA 2Y0CA 2VHDA 3ZOXA 3CX5D 3WFCC 1W2LA 2GIWA 4L3GA 3CXHW 3WU2V 5GTHV 1GU2A 4EIFA 3CWBD 5CICB 1GQ1A 2N3YA 1HJ3A 1CTZA 1KV9A 3L74D 4YE1A 2JWAA 1H1OA 3GW6A 4UB6V 4PW9B 4A7PA 3TYIA 2JTIB 1H33B 4UB8V 351CA 4AANA 1IQCA 1IZL0 4GYDA 3BCCD 1L0ND 1I8OA 2JQRA 1N9CA 3A0HV 1CSUA 3DR0A 3PH2B 3OA8A 1WVEC 1U74B 3VNWA 1FHBA 1LC1A 2B4ZA 5KLIB 2FYUD 1GIWA 3CU4A 2K9JB 2GC4D 1BL9A 1C2NA 3H1KD 3ZOOA 3PXSA 1KYOW 3H1ID 1M70A 1CRGA 2QG4A 3RN0A 1MZ4A 3CP5A 1HH7A 1YTCA 2ZZS1 2C1DB 155CA 3RMZA 3PTZA 4FB1A 5C0ZA 2V08A 4RJTA 3CX5W 1I55A 2L91A 1BCCD 1CIEA 4PD4D 1LMSA 2FWLA 3VRDA 4AALA 1L9BC 2Y0EA 2AXTV 1H31B 3L72D 1IRWA 1HZVA 4H0JA 3DMIA 1CO6A 2C9XB 5CIBB 1EZVD 1VYDA 2D0SA 3ZBMA 2V07A 3TGUD 1OAEA 1YFCA 1CYCA 1CORA 1LFMA 2RN0A 2N9JA 3H1LD 1AOQA 1F1FA 2YK3A 4L1QA 3O20A 1I6EA 1K3GA 4O1WA 1AOFA 4LJIA 3GG2A 1CSXA 1C75A 2BCNB 2CE0A 1JDLA 1A2SA 1C52A 2ZXYA 4WQDA 1BGYD 1NMIA 3OCDA 1HZUA 1L9JC 1CCHA 3MK7B 2YQBA 2FRCA 2QJYB 1I8PA 1KIBA 1U75B 1S5LV 3L4MA 1LS9A 2B10B 2BLFB 3O5CA 1NTKD 1AYGA 1COTA 1MG3D 1RAPA 3OCDB 3L75D 4D6TD 3WFDC 2GC7D 1HCMA 3NWVA 5AURA 1NTMD 3HQ8A 1I6DA 3PLNA 2C2CA 2XTSB 1WEJF 2PCCB 2Y0DA 3SVWA 1GJQA 4AAMA 1K3HA 3VYMA 1OCDA 4U3FD 1E2RA 1DW3A 5CIEB 1A56A 5B6QA 1CIFA 1FOCA 1HRCA 2B11B 4GEDB 3MK7C 3WC8A 1YEBA 5KAIV 3SJLA 2PACA 4FANA 2ORLA 4V2KA 1IO3A 2DVHA 1LC2A 3ZIYA 3SLEA 4QAOA 3HQ9A 1NU1D 1A8CA 1E29A 2C8SA 4EIDA 1CTJA 4H0KA 3CYTI 2D0WA 3H1HD 4WQBA 1KB0A 2AIUA 3M97X 5EXQA 1DVHA 2CA3B 1ZRTD 1W5CT 3OA8B 1YICA 1CIGA 1C6SA 2ZOOA 3ITKA 4FA5A 1CNOA 4FA1A 4Y5RA 1ETPA 1E8EA 1J3SA 3ZCFA 2HV4A 2B12B 2CA4B 2LIRA 1CHIA 5KAFV 1F1CA 2BPBB 4DY9A 1N15A 1GDVA 3HQ7A 1NTZD 4FA9A 1CRJA 1KB9D 1GKSA 1R0QA 1FI9A 1I54A 1SQBD 4N0KA 3KZIV 4AAOA 1CHJA 4WQAA 5TISV 5CIFB 4EDFA 1NMLA 2BCCD 1FJ0A 3PRJA 3A0BV 3L71D 3L70D 2N18C 2FYNB 1IRVA 1N50A 1YNRA 4NFGB 4WQ9A 4WQ7A 2A06D 1CSVA 3NBSA 3HQ6A 2ZBOA 3WFEC 3TDKA 2L4DA 4RSZA 1CYJA 1FI3A 5GTIV 3JBTB 1HJ5A 1NIRA 1CRHA 2KS1A 1H9XA 1RAQA 5B5EV 5E79V 2YCCA 3ORVA 2RMZA
chains in the Genus database with same CATH superfamily
1FCDC 3A0BH 3BCCG 3G71P 4U7JA 3OA7A 1AVOA 5H2FV 2B88A 3HE5A 3CCJP 1X8YA 3H1JJ 1M1JA 1NNOA 5CYTR 3CMAP 1PGOA 2AI5A 1MG2D 1VQ7P 4OVNF 3BCCE 4WQ8A 1LT9A 5KLVJ 5DJQC 3PHLA 4P4QB 4PV1C 1M1JB 5E79H 3TSIA 3E1IA 3H1KE 1NU1E 1JB0J 1Q82Q 2AEFA 1GL2C 3OW2O 3JSVC 1CTYA 5AW7B 3DP5A 1LP1A 2YKPA 2D2CD 1NTZK 3RN1A 1BCCE 1SQXG 1SQBK 1C6OA 1VL2A 4N6JA 3L73J 1H32A 3WUIA 5B66V 3EQ2A 1DEEG 3LW5H 1QL3A 2PCBB 1LP1B 2H7HA 1P84D 5KAFE 1JY3N 1SQVG 3KHUA 2JEEA 2FFDC 1NYHA 2B87B 1MFZA 3CXHH 3RL0D 2Z4EA 1BGYG 3CI9A 3RL0C 4O1QA 4WQCA 1CZQA 3WUVA 1CSWA 1H32B 1SQXD 3ZOWA 2E76C 2W6JH 2J59M 3NMDA 3CWBJ 3L74J 1QL4A 1DIIC 1BGYE 3WUUA 2IFMA 5B66H 1GW3A 1L0LD 2I1KA 2YKQA 4XYDB 1CXCA 2O3JA 5DJQB 1EB7A 1SQVD 5TJHA 4PV1B 3X39A 5DFSA 2L5GB 2MJZA 3BCCJ 3WFCC 4EYYQ 3V5BA 2WMMA 5AW0B 4H44D 1JY2N 3CXHW 2WPQA 3CL3D 4YTPC 1L0NG 2ZYGA 4H44C 1LTJC 1OX3A 3B8EB 1IFPA 1GU2A 2FFDA 4EIFA 3H1KJ 3V2RA 3WU2E 1GQ1A 1CTZA 1HWTC 2Z5HA 4Y99C 2JWAA 2I8DA 1H1OA 2FYUG 2HR3A 2Q7CA 2JDIH 4LLHA 2QA4P 5CJ0A 5CCGD 1J2JB 4ZMDA 1BCCJ 1QGKB 5APUA 1RE3A 351CA 2FFDB 2KYVA 1IQCA 3B5ND 1IZL0 1GU5A 3RL0B 1L0ND 3B5NC 4IL6E 2Q5UA 3FWNA 1AFOA 3L72G 4GOFA 2FY8A 2WSFJ 3T97A 2QM8A 2FYUD 1GIWA 5APYA 1Q7YQ 4KHXA 1M70A 1CRGA 3Q5PA 3CC2P 3CP5A 1LTJA 1SQXK 3MUDA 1K8AQ 1HH7A 3C1LA 3H1LG 1J1DC 3PTZA 1MUUA 2GA1A 2V08A 1BGYJ 1I55A 1L0LK 4PD4D 1JMBA 1KILE 2FWLA 4AALA 2Y0EA 3GHGC 3L72D 1IRWA 5AW9B 3D6ZA 3HUSA 1SQVK 5CCGA 4H44B 3DMIA 1LTJB 1EXJA 1CO6A 3UIAA 1T2KD 5CIBB 2FKWB 1EZVD 3AE6C 3SWFA 3TGUD 1YFCA 1A02J 2KIKA 1P84H 2ZYAA 3NFQA 1CORA 3B5NA 4OH8B 1JMMA 1LFMA 1IFIA 3H1LD 3D71A 2YK3A 4L1QA 3CXHI 1I6EA 2P2UA 4LJIA 1JM0A 1CSXA 2QSIA 1C75A 1ZW0A 1NTMG 3CPWO 2WTYA 2BCNB 1IO4A 3OCDA 1HZUA 3B5NB 1L9JC 1M8OB 1CCHA 3SSUA 1FC2C 5CCHC 1IFNA 3G9RA 1RF1A 5APVA 3KZIH 2NPSD 3GHGA 1L0NK 2KXPB 3OCDB 3V2QA 1N7LA 1HF9A 1M56D 1UIIA 2K88A 4D6TD 1WT6A 1NTMD 1J1DB 3PLNA 4WY4D 2FYUK 4UB6E 3V2PA 4QMAA 2YO3A 2PCCB 1RF1B 3SVWA 1GJQA 1N2DC 1S4XA 3GHGB 2KZJA 1AVYA 5CIEB 1A56A 3AE4C 2KSJA 1U7JA 1VQNP 1CIFA 1JY3O 3KYQA 3L36A 3MK7C 3CLQA 5KAIV 3SJLA 2M5AA 4FANA 4JPZB 3CCEP 1IO3A 3P8CD 4QAOA 4MN4C 3VMZA 3VMXA 1S1CX 3H1IE 1SQQK 3KDPB 1EDKA 3CYTI 1KV4A 4O9BA 1EDIA 1Q90D 2BEZF 2O01J 1W5CT 2KUBA 3OA8B 4BXLA 2M5AB 2ZOOA 3W68A 2NPSA 1BDDA 3L70G 3A3YB 4L75A 1J3SA 5KAIH 2HV4A 2B12B 5AW6B 4W7YA 1NKNA 4WY4A 2XZRA 1FU1A 1N15A 5KJ7D 4FA9A 1CRJA 2NPSB 2RH0A 4GT1A 1GKSA 1R0QA 1PV3A 1OVUA 5AVWB 1A02F 4AYCA 2YXQB 3RK3D 2H8PD 1PZQA 2E5TA 1KYOE 5TISV 2CK3H 3RK3C 1TU3F 5CIFB 1DD4A 3M0DC 3L70D 1K9MQ 3Q5RA 2FYNB 1IRVA 2O1KA 1YNRA 4IFDK 1PGQA 5AVRB 4NPEA 1S9KE 3CX5E 1NTMK 3V2NA 3HQ6A 3H6PA 4HYTB 1IFJA 2L4DA 4H0LD 2PFXA 4IFMA 5GTIV 3AE8C 2Y9YA 1S5LE 3CCQP 3EFGA 1CRHA 4DCKA 2R3CA 3PXWA 1DW0A 4MU8A 1CYIA 1CC5A 1H33A 4AX3A 5KJ7A 1LTGC 1GTWA 3USSA 3FX0A 5H2FE 3PXTA 1ZR4A 1CRIA 1YCCA 2C0XA 1CRCA 5IY51 2WVRA 1HJ0A 2QJPC 1LWUC 5AVVB 3NBTA 4KMGA 2BEQD 1FZCC 1DIQC 1QEXA 1RQUA 2KZIA 1B7VA 2KNCA 2KLUA 5AVSB 4JCGA 3C9IA 5BU8B 3GF3A 1VQ6P 3VP8A 3AE2C 4JQ0D 3SXTA 3AE5C 1S5LX 1OIPA 1IFDA 3RK3B 2BGVX 1QL2A 1ZR2A 1G2CA 3AE3C 2FYZA 3BATA 3CXHD 4DT0A 2HFED 3H1JD 3G3ZA 1AA0A 3R4YA 2KNCB 1H31A 2LXBA 4YPCA 2B9BA 5AVTB 4WB4A 3CCMP 1T3UA 3O0RC 1KD1Q 2M3BA 3VMAA 3H25A 2HPCA 5KLVD 2MTAC 4H0LB 2W6AA 4EIJA 3L73G 1G2CB 1M1JC 2C9LY 1LTSC 1MV8A 3WFBC 2EXVA 2OGUA 2E75D 1ZZHA 1QYZA 4EOTA 1HJ4A 3SWSA 1NKZB 2A45I 2E75C 3I5CA 2FBWC 1LT9C 1FZCA 2OYIA 1C7MA 4BRYA 1NH4A 2XDJA 1CEDA 1W2BO 3QH9A 4LGDE 2K1AA 1N90A 3L74G 2QJPB 1JTHB 2YKOA 3L73D 4PJ0V 2O1JA 3L37A 4N78D 3O6QA 1FZCB 1VQOP 1KX2A 1SP4A 2OYIB 2C1VA 1NTKE 1OFCX 4L3HA 2OYHA 1UIXA 1RF0C 2WSEJ 3L75E 2GIWA 4U3FG 4IOIH 4ZNCA 4JF7A 5B5EE 5GTHV 3CWBD 4B86A 3TK1A 2K3RA 3L74D 4U3FE 4WWIA 4PJ0H 1VDFA 5CBNA 1LJ2A 2O01N 3GW6A 3H1KG 1NU1G 1S2EA 3VMYA 1VQLP 2J5UA 4PW9B 1QLED 3GMAA 3TYIA 2JTIB 4A7PA 3HE5B 2LXCB 1LNQA 3RBXA 1M57D 4AANA 1SFCD 1BCCG 1VF5D 2WSCH 3BCCD 5L8RJ 1S5LH 2WT7A 3R2PA 2E75B 3H1HE 1FZBA 1VF5C 5GTHH 5KLVK 1LT9B 1N9CA 3A0HV 3AE1C 1BSHA 3PH2B 1ZRTE 2W8ZA 2P58A 1YTZI 1U74B 1GMJA 2B4ZA 1YYCA 3CU4A 1T6AA 1L4AD 1YTZT 2D2CC 1RF0A 3H1KD 1L4AC 1KYOW 5EFWB 2WT7B 2KOGA 2P1JA 2M0BA 2ZZS1 2QIWA 155CA 3RMZA 2FXPA 4FB1A 5C0ZA 3CX5W 2L91A 1BCCD 2SPZA 1N86A 1T8ZA 3VRDA 1KB9E 1EC5A 4HKZH 3JC22 3A0HH 2AXTV 3GF7A 2OTKE 3M0AA 1OW6A 1YITP 1FDIA 2P10A 3PJSK 1NTKJ 3ZBMA 2ZJSE 4GDOA 4KJMA 3VP9A 1SFCA 1RE3C 4AQRD 1L0LE 2A06E 2RN0A 2N9JA 1F1FA 3MIWA 3FXDA 1AOFA 2BASA 1WRGA 3G6EP 2AXTH 1L4AA 4U3FJ 4GKGA 1BGYD 5AW5B 1SFCB 2XNXA 4NPFX 1VF5B 3HD7D 1JY3P 2YQBA 2FRCA 1JO5A 1U57A 3F89A 3MUDC 1KIBA 3L4MA 4ASVA 2B10B 1Q86Q 2D2CB 1NU1J 1PFIA 1L4AB 1COTA 2A45G 3H1HJ 2Q1KA 2OYOA 3Q3DA 5AURA 3JCUE 3HQ8A 1I6DA 3HUSC 1PP9E 5CCGC 1FDMA 4H13D 2C2CA 1WEJF 5DJTB 3NTNA 3VYMA 1KYOI 1OCDA 1DW3A 4UB8E 1NAFA 3MZWB 4YXWH 1FOCA 4HB1A 3KXDA 2B11B 5AW4B 3S4RA 1YEBA 5BVZA 5M1BA 3U59A 1KMIZ 2PACA 3CX5I 2DVHA 1SQPE 2YMYA 2R32A 3SLEA 2W83C 1NWQA 3HQ9A 1U7MA 5CBOA 2D0WA 3HD7A 4WQBA 3M97X 1LTTC 2YXRB 4EI2A 1N7SD 1DVHA 5KKZC 1BE3E 3QWOC 3T97B 1C6SA 4PD4E 1QL1A 2UWJE 4FA1A 1RF1C 4Y5RA 3MGNA 5CJ4A 4OWFA 3ZCFA 2IBZG 1SQQE 1N73A 1JCDA 1CHIA 3HD7B 3AECC 5KAFV 4TT3H 1JOCA 1GK6A 2LKMA 1URQD 2BPBB 4DY9A 1FJKA 2Z5IA 1T2KC 1URQC 3U1AA 4IL6X 2B89A 3TGUE 3HQ7A 2IBZE 2H43A 1KILD 2G8YA 2M3EA 3W67A 1J1EB 3KZIV 1PPJE 3U1CA 1CHJA 1PGPA 3HUSB 1N73B 2WPVB 4XE5B 2P7JA 1FJ0A 1G1JA 3MTUE 1H0TA 2Q6QA 5TISE 4H13B 2H89C 4AUWA 3VN0A 3NXSA 1OXZA 2WSFH 2C9NY 4WQ7A 2I1JA 5KAFH 1VQPP 3NBSA 1PP9J 2QJKC 1HGVA 3WFEC 1N7SA 3A2AA 1RHZB 3JBTB 1H0TB 1H89A 2KP8A 1BSNA 1D7MA 1HTLC 5CMZA 2KS1A 2NPSC 3SWKA 3ABVC 4D6TE 1X79B 2RMZA 1ZN5A 3FWLA 5KKZB 3CCRP 1URQA 1SQPJ 2CE1A 1EDLA 2OZ1A 4WY4C 1CXAA 1FE6A 4JYBA 1KILA 1M60A 2FYNC 2LITA 1C6RA 2KS1B 4HJGH 3SFDC 2DGEA 5DF5A 1AQ5A 3M9QA 3ZOYA 3H1IG 2Q9IA 1BE3J 3L4FA 4C7NA 2YO2A 2N3BA 1URQB 3IF4A 3P8CE 2OZ1B 4DZOA 2N9IA 4FA4A 451CA 4IL6V 1E79H 5AW3B 1KILB 3WU2H 4PWAA 4L73A 2Q3EA 3RL0g 2C1DA 1MFTA 3Q1MA 2BH4X 2ZFCA 1ZOYC 1HH0A 1G1IA 3ZDMA 1KORA 1AKKA 1OVRA 1I5TA 2K9YA 2N9YB 3BRVB 2A45H 4GODA 4K3IA 1FJPA 1VQ4P 2QJKB 3IAOA 1MKMA 1LTAC 1HUCA 4IL6H 3KQGA 3V4WA 1JY2O 1DVVA 3O1YA 5KJ7C 5BU5A 3B71A 1XTGB 2QRXA 2R5BA 1OW7A 1RZ6A 3RK3E 1IK9A 3MHVA 1K73Q 2BH5X 1VQKP 4N3YB 5APWA 1LTIC 4WY4B 3V6IA 1MZ9A 1RE4A 5KLIC 4OGQD 2CXBA 5CIHB 3A0BE 4OGQC 3EWKA 2OTLP 2PRRA 1XTCC 1KYOD 1QVGO 1FS0E 1KTMA 3GLMA 1JUNA 4H0LC 3C2CA 3BASA 2JKVA 1NVOA 2O01H 2JP3A 4HH2A 1S9KD 3ZOXA 3CX5D 1VQ5P 4RO0A 2V7QJ 3TNUA 3K5BA 4IFFA 1DX7A 2E74D 5E79E 1KB9I 2E74C 4JBZA 5CICB 3H1IJ 1HJ3A 1KV9A 2N1TD 5AVXB 1FOSE 4UB6V 1RY3A 2XU6A 1JEKA 2RKLA 1H33B 2K9JA 4ZKPA 4XA4A 2OYIC 4KT0J 1R5SA 3AEBC 1PIXA 2JQRA 3DR0A 2PGDA 3N7NA 3O8ZA 1KC8Q 3VNWA 1FHBA 5KLIB 3CXHE 1NJIQ 2K9JB 2JWDA 2ZXXA 1BL9A 4UB6H 1SS1A 4OGQB 1C2NA 3PXSA 1EQ7A 2OYHC 3RN0A 1MZ4A 1YTCA 2GUSA 2W27A 3PP5A 5B66E 2IYPA 4L76A 1CIEA 1NTZE 2N1TA 2PAJA 4R4MA 1ZMEC 1H31B 1SQBE 1GD2E 1AQTA 1S3JA 1Q2NA 2WWWA 2DW3A 3RBZA 2C9XB 2BCCE 4Z1MH 2E74B 1E5WA 2HPCB 3L71E 1VYDA 1OAEA 1EXIA 2R3SA 2QVAA 1NTKG 1AOQA 3E7KA 4M3LA 2OARA 1K3GA 2JO1A 3GG2A 2ITAA 3L75G 3IR9A 2E42A 2CE0A 4WQDA 1NMIA 4BRYB 3CCLP 4JYCA 5C39A 1ZV8A 3M06A 3CCVP 2J58A 1KFNA 2QJYB 1U75B 1GZLA 1S5LV 3RK2D 3AEAC 1OMIA 3O6QB 1VQ8P 1KYOH 2BLFB 3RK2C 1NOHA 3O5CA 1NTKD 4RKUJ 1AYGA 2CPSA 3LW5J 2XKMA 1YQ3C 2OYHB 4YXDC 3L75D 2ZYDA 3H32A 3WFDC 2GC7D 2W6BA 2IZ0A 3CX5H 2IBZI 2R44A 3H1HG 1JNMA 1KQFB 2XNDH 2XTSB 2IPPA 4U3FD 1E2RA 1HVVA 1KQGB 1SFCC 3LIEA 3M9HA 1KZUB 1M1KQ 3H32B 1DD3A 4GEDB 3WC8A 4PV1D 2ORLA 4V2KA 1NTZJ 3ZIYA 1VQMP 1SQBJ 1GL2D 4RESB 1NU1D 1A8CA 1E29A 4EIDA 1CTJA 3M91A 3AEGC 1IFMA 5H2FH 3H1HD 2BCCJ 2AIUA 3CC4P 3L71J 5EXQA 3C8VA 2PP6A 4ASWA 1ZRTD 2WSEH 1P84E 1YICA 4FA5A 2B87A 1CNOA 2QEXP 1E8EA 1WMKA 1VPCA 2G3AA 2CA4B 2LIRA 1L0LG 2ZAEB 2A06G 1F1CA 1ZP0C 4TLFA 1SQXE 2JJLA 1DH3A 3RK2B 4I2LC 3CC7P 5DJUB 1GDVA 2ZXEB 3S9OA 3L75J 1KB9D 3OJAB 3I55P 2E76D 3KPEA 4EDFA 1SQVE 1NMLA 2OQQA 1Y47A 3KZIE 3PRJA 1GU4A 1NTKK 1DEBA 2N18C 3CMEP 2IYOA 1N50A 1GL2A 1H88A 2A06D 1CSVA 5AVYB 2V4HA 1YJNP 1FOSF 2KB7P 3HD7C 3TDKA 4RSZA 1YJWP 1FI3A 3FGAD 3V4QA 2FXMA 3D6YA 1PP9G 1HJ5A 1NIRA 3CCUP 1GL2B 2QE7H 1H9XA 2HG5D 5B5EV 4DOJA 3ORVA 2YNYA 1J1EC 3VTPC 3EFFK 1KQLA 2GUVA 1N73C 4J20A 3L35A 1IC2A 1YEAA 2POHA 3AE9C 2I8FA 4ZKUA 1NU1K 1USEA 1NAYA 4H13C 1CCRA 2ZONG 1SQPG 3FXEA 1YIQA 1L0NE 1CRYA 1IZNB 1KQSO 1DT1A 2YIUC 1GW4A 1Y9BA 3AE7C 1CIHA 1HBWA 1PP9D 4XXLA 2N9BA 2ZVOB 2FYUE 1PL5A 5APSA 5B5EH 5KAIE 1JY2P 1BE3G 5C9MA 3BRTB 5CIDB 4WQEA 5CIGB 5AW1B 4Q5PA 1SQXJ 2C1UA 3TF5A 2E76B 2KSEA 3AEFC 1SLQA 3P32A 1FDOA 1SQQG 4I1LA 2N18B 1N7SC 1SQPD 4BWNA 3RLMA 1L0LJ 1X22A 1EZVG 3A9FA 2Y9ZA 1H9YA 1DW2A 5K5GB 3L72E 3CD6P 3TGUG 1S6VB 1KFMA 1FZEA 1YQ4C 1SQVJ 2ZT9D 1LGHB 1IJDB 1EZVE 1PPJG 2ZT9C 1BE3D 4EICA 1DW1A 4XFJA 1CHHA 4K3AA 5AW2B 1RZ5A 1L2PA 1Y8AA 1YHQP 1YIJP 1KILC 3H1LE 2HYNA 4C7RA 2GB8B 1SQQD 1FI7A 2JR8A 3L4OA 5CHXA 3IFMA 1HROA 4Y99B 4EIEA 2IBZD 3AEEC 4DJGA 1KX7A 2MHMA 1GK4A 1H8AA 2YIUB 4FAVA 1KB9H 1PPJD 1QKSA 1OZHA 1QN2A 1W2EA 4D6TG 1Z56A 1M6ZA 2HODA 3VOPA 2B0ZB 1C2RA 3IN6A 1CW5A 2M8RA 1L0NJ 1ZXGA 3VYIA 2Y0CA 5GTIE 2VHDA 4WVZA 2KLVA 5AW8B 1W2LA 2XV5A 5CCHD 4W80A 4L3GA 3B4SA 1NTME 3WU2V 2FYUJ 1N7SB 4GOEA 1S72P 2HODB 2QM7A 3HE4A 1OVVA 2N3YA 3Q5SA 4YE1A 3E1RA 3D70A 3RGUA 4R4LA 5AVQB 1FBMA 3AEDC 2VRSA 2ZT9B 1SQPK 3I56P 4UB8V 3HE4B 1SVFA 2GM4A 2WPSA 3L72J 1RE4C 1FZFA 4GYDA 1SQQJ 1OW8A 1YI2P 1I8OA 3G4SP 1QX8A 1YJ9P 4I6MC 2Q3IA 1CSUA 4C7NB 3S1KA 3OA8A 4I7ZC 1WVEC 3WUTA 3JCUH 3TGUJ 1LC1A 2GC4D 1DIPA 3H1LJ 3WMM0 3ZOOA 3H1ID 2WQYC 3II6A 2QG4A 5CCHA 4UB8H 2C1DB 1HJBA 2W90A 1M90Q 4RJTA 1LT1A 4K35A 4Y28J 3HRNA 1LMSA 1L9BC 2K37A 3BVHA 1HZVA 4H0JA 1FAVA 3TYYA 5APQA 2KI7B 3L70E 2D0SA 2V07A 2WSSH 1CYCA 1OWAA 2WZ7A 5APXA 4D6TJ 1RH5B 3A7OA 4CPGA 4PD4H 1NTMJ 3O20A 1PGJA 2ZVNB 4O1WA 2WPRA 2IDBA 1Q81Q 1EDJA 1NGMB 1AJYA 2MKVA 2LR2A 4PJ0E 1JDLA 2FXOA 1A2SA 1C52A 2ZXYA 2R5DA 3F5HA 1T3JA 1FZGA 1AV1A 5APTA 1P84I 3MK7B 2HLOA 4I7ZB 2AEMA 1I8PA 1LS9A 2AXCA 3LIDA 1IK7A 1MG3D 2IFNA 1RAPA 1K05A 5GTHE 5TISH 2N1TC 2IX7C 3OAKA 1HCMA 3NWVA 3TNUB 2C0WA 3M9BA 1X0TA 2KK7A 2IZ1A 1BDCA 3A5TA 2Y0DA 5AVZB 2P67A 1GDTA 4AAMA 1K3HA 3SWYA 1R8EA 5B6QA 1CI6A 1JCCA 1FZAA 3H1JG 1HRCA 2NRGA 3SFEC 1RQVA 3HTKA 5GTIH 3M0DA 2QJYC 3MD0A 3D0WA 1LC2A 3A0HE 5KLVG 3H1JE 2E5YA 2C8SA 1NHLA 1NTZG 4H0KA 1CI6B 2CPBA 4W7ZA 1KB0A 3N4XA 3HTKB 3CCSP 1SQBG 3L70J 5KLVE 2CA3B 1R5LA 2V7QH 2H88C 1CIGA 2BCCG 2WITA 3ITKA 1VQ9P 3L71G 1ETPA 2OTJP 1X9VA 1QVFO 1USDA 1KN7A 5AVUB 2AXTE 1N8RQ 1HGZA 3PH0A 1NTZD 2E43A 2NZ2A 2N1TB 2AEJA 1FI9A 1I54A 1SQBD 4NPDA 4N0KA 4WBAA 1JTHA 1LWUA 4AAOA 4WQAA 3L73E 1CSBA 1YBKA 2BCCD 4N78E 3P8MC 4C46A 3Q2YA 2WSCJ 3A0BV 3L71D 4LC1A 4NFGB 3MP7B 4WQ9A 3CWBG 1LTBC 1ZLLA 5KTBA 4GIFA 4L74A 2ZBOA 1LWUB 4PD4I 3P7KA 1CYJA 3CWBE 1M7LA 1W5CE 2YMKA 3L74E 1K04A 1NO4A 1RAQA 1EZVI 5E79V 2YCCA
chains in the Genus database with same CATH topology
1FCDC 3PXWA 1DW0A 4MU8A 1CYIA 3FWLA 5KKZB 1CC5A 4J20A 1H33A 2CE1A 5H2FV 4AX3A 2OZ1A 1YEAA 1CXAA 1NNOA 2I8FA 5CYTR 1CCRA 1M60A 2AI5A 2ZONG 1MG2D 2LITA 3PXTA 1C6RA 1YIQA 1CRYA 1CRIA 4WQ8A 2DGEA 1DT1A 1YCCA 5DF5A 1CRCA 5IY51 3ZOYA 5DJQC 3PHLA 1CIHA 1PP9D 4P4QB 2N3BA 3NBTA 4XXLA 4KMGA 2OZ1B 1DIQC 2N9IA 4FA4A 1B7VA 451CA 4IL6V 4JCGA 5C9MA 5CIDB 4WQEA 5CIGB 4Q5PA 4PWAA 3SXTA 1CTYA 2C1UA 3TF5A 2Q3EA 2C1DA 3DP5A 2BGVX 2BH4X 2N18B 1AKKA 1SQPD 3CXHD 3RLMA 3RN1A 1I5TA 3H1JD 1C6OA 3A9FA 2N9YB 1H9YA 2KNCB 1DW2A 1H31A 4K3IA 1S6VB 1H32A 2QJKB 3WUIA 5B66V 3O0RC 3VMAA 1QL3A 2PCBB 5KLVD 2MTAC 1BE3D 4EICA 1DW1A 1P84D 1CHHA 3KHUA 1DVVA 3O1YA 1RZ5A 3WFBC 2EXVA 1RZ6A 1ZZHA 1QYZA 1HJ4A 4O1QA 4WQCA 2GB8B 3SWSA 1CSWA 1H32B 1SQQD 1FI7A 2BH5X 3L4OA 1SQXD 3ZOWA 1HROA 1C7MA 1QL4A 1DIIC 2CXBA 5CIHB 4EIEA 2IBZD 1L0LD 1KX7A 2MHMA 1CEDA 4XYDB 2YIUB 1CXCA 4FAVA 1N90A 2O3JA 1PPJD 2QJPB 5DJQB 1QKSA 1EB7A 3L73D 4PJ0V 1KYOD 1QN2A 1SQVD 5TJHA 1M6ZA 2B0ZB 1C2RA 3X39A 3C2CA 5DFSA 1KX2A 2C1VA 4L3HA 2Y0CA 2VHDA 3ZOXA 3CX5D 3WFCC 1W2LA 2GIWA 4L3GA 3CXHW 3WU2V 5GTHV 1GU2A 4EIFA 3CWBD 5CICB 1GQ1A 2N3YA 1HJ3A 1CTZA 1KV9A 3L74D 4YE1A 2JWAA 1H1OA 3GW6A 4UB6V 4PW9B 4A7PA 3TYIA 2JTIB 1H33B 4UB8V 351CA 4AANA 1IQCA 1IZL0 4GYDA 3BCCD 1L0ND 1I8OA 2JQRA 1N9CA 3A0HV 1CSUA 3DR0A 3PH2B 3OA8A 1WVEC 1U74B 3VNWA 1FHBA 1LC1A 2B4ZA 5KLIB 2FYUD 1GIWA 3CU4A 2K9JB 2GC4D 1BL9A 1C2NA 3H1KD 3ZOOA 3PXSA 1KYOW 3H1ID 1M70A 1CRGA 2QG4A 3RN0A 1MZ4A 3CP5A 1HH7A 1YTCA 2ZZS1 2C1DB 155CA 3RMZA 3PTZA 4FB1A 5C0ZA 2V08A 4RJTA 3CX5W 1I55A 2L91A 1BCCD 1CIEA 4PD4D 1LMSA 2FWLA 3VRDA 4AALA 1L9BC 2Y0EA 2AXTV 1H31B 3L72D 1IRWA 1HZVA 4H0JA 3DMIA 1CO6A 2C9XB 5CIBB 1EZVD 1VYDA 2D0SA 3ZBMA 2V07A 3TGUD 1OAEA 1YFCA 1CYCA 1CORA 1LFMA 2RN0A 2N9JA 3H1LD 1AOQA 1F1FA 2YK3A 4L1QA 3O20A 1I6EA 1K3GA 4O1WA 1AOFA 4LJIA 3GG2A 1CSXA 1C75A 2BCNB 2CE0A 1JDLA 1A2SA 1C52A 2ZXYA 4WQDA 1BGYD 1NMIA 3OCDA 1HZUA 1L9JC 1CCHA 3MK7B 2YQBA 2FRCA 2QJYB 1I8PA 1KIBA 1U75B 1S5LV 3L4MA 1LS9A 2B10B 2BLFB 3O5CA 1NTKD 1AYGA 1COTA 1MG3D 1RAPA 3OCDB 3L75D 4D6TD 3WFDC 2GC7D 1HCMA 3NWVA 5AURA 1NTMD 3HQ8A 1I6DA 3PLNA 2C2CA 2XTSB 1WEJF 2PCCB 2Y0DA 3SVWA 1GJQA 4AAMA 1K3HA 3VYMA 1OCDA 4U3FD 1E2RA 1DW3A 5CIEB 1A56A 5B6QA 1CIFA 1FOCA 1HRCA 2B11B 4GEDB 3MK7C 3WC8A 1YEBA 5KAIV 3SJLA 2PACA 4FANA 2ORLA 4V2KA 1IO3A 2DVHA 1LC2A 3ZIYA 3SLEA 4QAOA 3HQ9A 1NU1D 1A8CA 1E29A 2C8SA 4EIDA 1CTJA 4H0KA 3CYTI 2D0WA 3H1HD 4WQBA 1KB0A 2AIUA 3M97X 5EXQA 1DVHA 2CA3B 1ZRTD 1W5CT 3OA8B 1YICA 1CIGA 1C6SA 2ZOOA 3ITKA 4FA5A 1CNOA 4FA1A 4Y5RA 1ETPA 1E8EA 1J3SA 3ZCFA 2HV4A 2B12B 2CA4B 2LIRA 1CHIA 5KAFV 1F1CA 2BPBB 4DY9A 1N15A 1GDVA 3HQ7A 1NTZD 4FA9A 1CRJA 1KB9D 1GKSA 1R0QA 1FI9A 1I54A 1SQBD 4N0KA 3KZIV 4AAOA 1CHJA 4WQAA 5TISV 5CIFB 4EDFA 1NMLA 2BCCD 1FJ0A 3PRJA 3A0BV 3L71D 3L70D 2N18C 2FYNB 1IRVA 1N50A 1YNRA 4NFGB 4WQ9A 4WQ7A 2A06D 1CSVA 3NBSA 3HQ6A 2ZBOA 3WFEC 3TDKA 2L4DA 4RSZA 1CYJA 1FI3A 5GTIV 3JBTB 1HJ5A 1NIRA 1CRHA 2KS1A 1H9XA 1RAQA 5B5EV 5E79V 2YCCA 3ORVA 2RMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCD C;  3PXW A;  1DW0 A;  4MU8 A;  1CYI A;  3FWL A;  5KKZ B;  1CC5 A;  4J20 A;  1H33 A;  2CE1 A;  5H2F V;  4AX3 A;  2OZ1 A;  1YEA A;  1CXA A;  1NNO A;  2I8F A;  5CYT R;  1CCR A;  1M60 A;  2AI5 A;  2ZON G;  1MG2 D;  2LIT A;  3PXT A;  1C6R A;  1YIQ A;  1CRY A;  1CRI A;  4WQ8 A;  2DGE A;  1DT1 A;  1YCC A;  5DF5 A;  1CRC A;  5IY5 1;  3ZOY A;  5DJQ C;  3PHL A;  1CIH A;  1PP9 D;  4P4Q B;  2N3B A;  3NBT A;  4XXL A;  4KMG A;  2OZ1 B;  1DIQ C;  2N9I A;  4FA4 A;  1B7V A;  451C A;  4IL6 V;  4JCG A;  5C9M A;  5CID B;  4WQE A;  5CIG B;  4Q5P A;  4PWA A;  3SXT A;  1CTY A;  2C1U A;  3TF5 A;  2Q3E A;  2C1D A;  3DP5 A;  2BGV X;  2BH4 X;  2N18 B;  1AKK A;  1SQP D;  3CXH D;  3RLM A;  3RN1 A;  1I5T A;  3H1J D;  1C6O A;  3A9F A;  2N9Y B;  1H9Y A;  2KNC B;  1DW2 A;  1H31 A;  4K3I A;  1S6V B;  1H32 A;  2QJK B;  3WUI A;  5B66 V;  3O0R C;  3VMA A;  1QL3 A;  2PCB B;  5KLV D;  2MTA C;  1BE3 D;  4EIC A;  1DW1 A;  1P84 D;  1CHH A;  3KHU A;  1DVV A;  3O1Y A;  1RZ5 A;  3WFB C;  2EXV A;  1RZ6 A;  1ZZH A;  1QYZ A;  1HJ4 A;  4O1Q A;  4WQC A;  2GB8 B;  3SWS A;  1CSW A;  1H32 B;  1SQQ D;  1FI7 A;  2BH5 X;  3L4O A;  1SQX D;  3ZOW A;  1HRO A;  1C7M A;  1QL4 A;  1DII C;  2CXB A;  5CIH B;  4EIE A;  2IBZ D;  1L0L D;  1KX7 A;  2MHM A;  1CED A;  4XYD B;  2YIU B;  1CXC A;  4FAV A;  1N90 A;  2O3J A;  1PPJ D;  2QJP B;  5DJQ B;  1QKS A;  1EB7 A;  3L73 D;  4PJ0 V;  1KYO D;  1QN2 A;  1SQV D;  5TJH A;  1M6Z A;  2B0Z B;  1C2R A;  3X39 A;  3C2C A;  5DFS A;  1KX2 A;  2C1V A;  4L3H A;  2Y0C A;  2VHD A;  3ZOX A;  3CX5 D;  3WFC C;  1W2L A;  2GIW A;  4L3G A;  3CXH W;  3WU2 V;  5GTH V;  1GU2 A;  4EIF A;  3CWB D;  5CIC B;  1GQ1 A;  2N3Y A;  1HJ3 A;  1CTZ A;  1KV9 A;  3L74 D;  4YE1 A;  2JWA A;  1H1O A;  3GW6 A;  4UB6 V;  4PW9 B;  4A7P A;  3TYI A;  2JTI B;  1H33 B;  4UB8 V;  351C A;  4AAN A;  1IQC A;  1IZL 0;  4GYD A;  3BCC D;  1L0N D;  1I8O A;  2JQR A;  1N9C A;  3A0H V;  1CSU A;  3DR0 A;  3PH2 B;  3OA8 A;  1WVE C;  1U74 B;  3VNW A;  1FHB A;  1LC1 A;  2B4Z A;  5KLI B;  2FYU D;  1GIW A;  3CU4 A;  2K9J B;  2GC4 D;  1BL9 A;  1C2N A;  3H1K D;  3ZOO A;  3PXS A;  1KYO W;  3H1I D;  1M70 A;  1CRG A;  2QG4 A;  3RN0 A;  1MZ4 A;  3CP5 A;  1HH7 A;  1YTC A;  2ZZS 1;  2C1D B;  155C A;  3RMZ A;  3PTZ A;  4FB1 A;  5C0Z A;  2V08 A;  4RJT A;  3CX5 W;  1I55 A;  2L91 A;  1BCC D;  1CIE A;  4PD4 D;  1LMS A;  2FWL A;  3VRD A;  4AAL A;  1L9B C;  2Y0E A;  2AXT V;  1H31 B;  3L72 D;  1IRW A;  1HZV A;  4H0J A;  3DMI A;  1CO6 A;  2C9X B;  5CIB B;  1EZV D;  1VYD A;  2D0S A;  3ZBM A;  2V07 A;  3TGU D;  1OAE A;  1YFC A;  1CYC A;  1COR A;  1LFM A;  2RN0 A;  2N9J A;  3H1L D;  1AOQ A;  1F1F A;  2YK3 A;  4L1Q A;  3O20 A;  1I6E A;  1K3G A;  4O1W A;  1AOF A;  4LJI A;  3GG2 A;  1CSX A;  1C75 A;  2BCN B;  2CE0 A;  1JDL A;  1A2S A;  1C52 A;  2ZXY A;  4WQD A;  1BGY D;  1NMI A;  3OCD A;  1HZU A;  1L9J C;  1CCH A;  3MK7 B;  2YQB A;  2FRC A;  2QJY B;  1I8P A;  1KIB A;  1U75 B;  1S5L V;  3L4M A;  1LS9 A;  2B10 B;  2BLF B;  3O5C A;  1NTK D;  1AYG A;  1COT A;  1MG3 D;  1RAP A;  3OCD B;  3L75 D;  4D6T D;  3WFD C;  2GC7 D;  1HCM A;  3NWV A;  5AUR A;  1NTM D;  3HQ8 A;  1I6D A;  3PLN A;  2C2C A;  2XTS B;  1WEJ F;  2PCC B;  2Y0D A;  3SVW A;  1GJQ A;  4AAM A;  1K3H A;  3VYM A;  1OCD A;  4U3F D;  1E2R A;  1DW3 A;  5CIE B;  1A56 A;  5B6Q A;  1CIF A;  1FOC A;  1HRC A;  2B11 B;  4GED B;  3MK7 C;  3WC8 A;  1YEB A;  5KAI V;  3SJL A;  2PAC A;  4FAN A;  2ORL A;  4V2K A;  1IO3 A;  2DVH A;  1LC2 A;  3ZIY A;  3SLE A;  4QAO A;  3HQ9 A;  1NU1 D;  1A8C A;  1E29 A;  2C8S A;  4EID A;  1CTJ A;  4H0K A;  3CYT I;  2D0W A;  3H1H D;  4WQB A;  1KB0 A;  2AIU A;  3M97 X;  5EXQ A;  1DVH A;  2CA3 B;  1ZRT D;  1W5C T;  3OA8 B;  1YIC A;  1CIG A;  1C6S A;  2ZOO A;  3ITK A;  4FA5 A;  1CNO A;  4FA1 A;  4Y5R A;  1ETP A;  1E8E A;  1J3S A;  3ZCF A;  2HV4 A;  2B12 B;  2CA4 B;  2LIR A;  1CHI A;  5KAF V;  1F1C A;  2BPB B;  4DY9 A;  1N15 A;  1GDV A;  3HQ7 A;  1NTZ D;  4FA9 A;  1CRJ A;  1KB9 D;  1GKS A;  1R0Q A;  1FI9 A;  1I54 A;  1SQB D;  4N0K A;  3KZI V;  4AAO A;  1CHJ A;  4WQA A;  5TIS V;  5CIF B;  4EDF A;  1NML A;  2BCC D;  1FJ0 A;  3PRJ A;  3A0B V;  3L71 D;  3L70 D;  2N18 C;  2FYN B;  1IRV A;  1N50 A;  1YNR A;  4NFG B;  4WQ9 A;  4WQ7 A;  2A06 D;  1CSV A;  3NBS A;  3HQ6 A;  2ZBO A;  3WFE C;  3TDK A;  2L4D A;  4RSZ A;  1CYJ A;  1FI3 A;  5GTI V;  3JBT B;  1HJ5 A;  1NIR A;  1CRH A;  2KS1 A;  1H9X A;  1RAQ A;  5B5E V;  5E79 V;  2YCC A;  3ORV A;  2RMZ A; 
#chains in the Genus database with same CATH topology
 1FCD C;  3A0B H;  3BCC G;  3G71 P;  4U7J A;  3OA7 A;  1AVO A;  5H2F V;  2B88 A;  3HE5 A;  3CCJ P;  1X8Y A;  3H1J J;  1M1J A;  1NNO A;  5CYT R;  3CMA P;  1PGO A;  2AI5 A;  1MG2 D;  1VQ7 P;  4OVN F;  3BCC E;  4WQ8 A;  1LT9 A;  5KLV J;  5DJQ C;  3PHL A;  4P4Q B;  4PV1 C;  1M1J B;  5E79 H;  3TSI A;  3E1I A;  3H1K E;  1NU1 E;  1JB0 J;  1Q82 Q;  2AEF A;  1GL2 C;  3OW2 O;  3JSV C;  1CTY A;  5AW7 B;  3DP5 A;  1LP1 A;  2YKP A;  2D2C D;  1NTZ K;  3RN1 A;  1BCC E;  1SQX G;  1SQB K;  1C6O A;  1VL2 A;  4N6J A;  3L73 J;  1H32 A;  3WUI A;  5B66 V;  3EQ2 A;  1DEE G;  3LW5 H;  1QL3 A;  2PCB B;  1LP1 B;  2H7H A;  1P84 D;  5KAF E;  1JY3 N;  1SQV G;  3KHU A;  2JEE A;  2FFD C;  1NYH A;  2B87 B;  1MFZ A;  3CXH H;  3RL0 D;  2Z4E A;  1BGY G;  3CI9 A;  3RL0 C;  4O1Q A;  4WQC A;  1CZQ A;  3WUV A;  1CSW A;  1H32 B;  1SQX D;  3ZOW A;  2E76 C;  2W6J H;  2J59 M;  3NMD A;  3CWB J;  3L74 J;  1QL4 A;  1DII C;  1BGY E;  3WUU A;  2IFM A;  5B66 H;  1GW3 A;  1L0L D;  2I1K A;  2YKQ A;  4XYD B;  1CXC A;  2O3J A;  5DJQ B;  1EB7 A;  1SQV D;  5TJH A;  4PV1 B;  3X39 A;  5DFS A;  2L5G B;  2MJZ A;  3BCC J;  3WFC C;  4EYY Q;  3V5B A;  2WMM A;  5AW0 B;  4H44 D;  1JY2 N;  3CXH W;  2WPQ A;  3CL3 D;  4YTP C;  1L0N G;  2ZYG A;  4H44 C;  1LTJ C;  1OX3 A;  3B8E B;  1IFP A;  1GU2 A;  2FFD A;  4EIF A;  3H1K J;  3V2R A;  3WU2 E;  1GQ1 A;  1CTZ A;  1HWT C;  2Z5H A;  4Y99 C;  2JWA A;  2I8D A;  1H1O A;  2FYU G;  2HR3 A;  2Q7C A;  2JDI H;  4LLH A;  2QA4 P;  5CJ0 A;  5CCG D;  1J2J B;  4ZMD A;  1BCC J;  1QGK B;  5APU A;  1RE3 A;  351C A;  2FFD B;  2KYV A;  1IQC A;  3B5N D;  1IZL 0;  1GU5 A;  3RL0 B;  1L0N D;  3B5N C;  4IL6 E;  2Q5U A;  3FWN A;  1AFO A;  3L72 G;  4GOF A;  2FY8 A;  2WSF J;  3T97 A;  2QM8 A;  2FYU D;  1GIW A;  5APY A;  1Q7Y Q;  4KHX A;  1M70 A;  1CRG A;  3Q5P A;  3CC2 P;  3CP5 A;  1LTJ A;  1SQX K;  3MUD A;  1K8A Q;  1HH7 A;  3C1L A;  3H1L G;  1J1D C;  3PTZ A;  1MUU A;  2GA1 A;  2V08 A;  1BGY J;  1I55 A;  1L0L K;  4PD4 D;  1JMB A;  1KIL E;  2FWL A;  4AAL A;  2Y0E A;  3GHG C;  3L72 D;  1IRW A;  5AW9 B;  3D6Z A;  3HUS A;  1SQV K;  5CCG A;  4H44 B;  3DMI A;  1LTJ B;  1EXJ A;  1CO6 A;  3UIA A;  1T2K D;  5CIB B;  2FKW B;  1EZV D;  3AE6 C;  3SWF A;  3TGU D;  1YFC A;  1A02 J;  2KIK A;  1P84 H;  2ZYA A;  3NFQ A;  1COR A;  3B5N A;  4OH8 B;  1JMM A;  1LFM A;  1IFI A;  3H1L D;  3D71 A;  2YK3 A;  4L1Q A;  3CXH I;  1I6E A;  2P2U A;  4LJI A;  1JM0 A;  1CSX A;  2QSI A;  1C75 A;  1ZW0 A;  1NTM G;  3CPW O;  2WTY A;  2BCN B;  1IO4 A;  3OCD A;  1HZU A;  3B5N B;  1L9J C;  1M8O B;  1CCH A;  3SSU A;  1FC2 C;  5CCH C;  1IFN A;  3G9R A;  1RF1 A;  5APV A;  3KZI H;  2NPS D;  3GHG A;  1L0N K;  2KXP B;  3OCD B;  3V2Q A;  1N7L A;  1HF9 A;  1M56 D;  1UII A;  2K88 A;  4D6T D;  1WT6 A;  1NTM D;  1J1D B;  3PLN A;  4WY4 D;  2FYU K;  4UB6 E;  3V2P A;  4QMA A;  2YO3 A;  2PCC B;  1RF1 B;  3SVW A;  1GJQ A;  1N2D C;  1S4X A;  3GHG B;  2KZJ A;  1AVY A;  5CIE B;  1A56 A;  3AE4 C;  2KSJ A;  1U7J A;  1VQN P;  1CIF A;  1JY3 O;  3KYQ A;  3L36 A;  3MK7 C;  3CLQ A;  5KAI V;  3SJL A;  2M5A A;  4FAN A;  4JPZ B;  3CCE P;  1IO3 A;  3P8C D;  4QAO A;  4MN4 C;  3VMZ A;  3VMX A;  1S1C X;  3H1I E;  1SQQ K;  3KDP B;  1EDK A;  3CYT I;  1KV4 A;  4O9B A;  1EDI A;  1Q90 D;  2BEZ F;  2O01 J;  1W5C T;  2KUB A;  3OA8 B;  4BXL A;  2M5A B;  2ZOO A;  3W68 A;  2NPS A;  1BDD A;  3L70 G;  3A3Y B;  4L75 A;  1J3S A;  5KAI H;  2HV4 A;  2B12 B;  5AW6 B;  4W7Y A;  1NKN A;  4WY4 A;  2XZR A;  1FU1 A;  1N15 A;  5KJ7 D;  4FA9 A;  1CRJ A;  2NPS B;  2RH0 A;  4GT1 A;  1GKS A;  1R0Q A;  1PV3 A;  1OVU A;  5AVW B;  1A02 F;  4AYC A;  2YXQ B;  3RK3 D;  2H8P D;  1PZQ A;  2E5T A;  1KYO E;  5TIS V;  2CK3 H;  3RK3 C;  1TU3 F;  5CIF B;  1DD4 A;  3M0D C;  3L70 D;  1K9M Q;  3Q5R A;  2FYN B;  1IRV A;  2O1K A;  1YNR A;  4IFD K;  1PGQ A;  5AVR B;  4NPE A;  1S9K E;  3CX5 E;  1NTM K;  3V2N A;  3HQ6 A;  3H6P A;  4HYT B;  1IFJ A;  2L4D A;  4H0L D;  2PFX A;  4IFM A;  5GTI V;  3AE8 C;  2Y9Y A;  1S5L E;  3CCQ P;  3EFG A;  1CRH A;  4DCK A;  2R3C A;  3PXW A;  1DW0 A;  4MU8 A;  1CYI A;  1CC5 A;  1H33 A;  4AX3 A;  5KJ7 A;  1LTG C;  1GTW A;  3USS A;  3FX0 A;  5H2F E;  3PXT A;  1ZR4 A;  1CRI A;  1YCC A;  2C0X A;  1CRC A;  5IY5 1;  2WVR A;  1HJ0 A;  2QJP C;  1LWU C;  5AVV B;  3NBT A;  4KMG A;  2BEQ D;  1FZC C;  1DIQ C;  1QEX A;  1RQU A;  2KZI A;  1B7V A;  2KNC A;  2KLU A;  5AVS B;  4JCG A;  3C9I A;  5BU8 B;  3GF3 A;  1VQ6 P;  3VP8 A;  3AE2 C;  4JQ0 D;  3SXT A;  3AE5 C;  1S5L X;  1OIP A;  1IFD A;  3RK3 B;  2BGV X;  1QL2 A;  1ZR2 A;  1G2C A;  3AE3 C;  2FYZ A;  3BAT A;  3CXH D;  4DT0 A;  2HFE D;  3H1J D;  3G3Z A;  1AA0 A;  3R4Y A;  2KNC B;  1H31 A;  2LXB A;  4YPC A;  2B9B A;  5AVT B;  4WB4 A;  3CCM P;  1T3U A;  3O0R C;  1KD1 Q;  2M3B A;  3VMA A;  3H25 A;  2HPC A;  5KLV D;  2MTA C;  4H0L B;  2W6A A;  4EIJ A;  3L73 G;  1G2C B;  1M1J C;  2C9L Y;  1LTS C;  1MV8 A;  3WFB C;  2EXV A;  2OGU A;  2E75 D;  1ZZH A;  1QYZ A;  4EOT A;  1HJ4 A;  3SWS A;  1NKZ B;  2A45 I;  2E75 C;  3I5C A;  2FBW C;  1LT9 C;  1FZC A;  2OYI A;  1C7M A;  4BRY A;  1NH4 A;  2XDJ A;  1CED A;  1W2B O;  3QH9 A;  4LGD E;  2K1A A;  1N90 A;  3L74 G;  2QJP B;  1JTH B;  2YKO A;  3L73 D;  4PJ0 V;  2O1J A;  3L37 A;  4N78 D;  3O6Q A;  1FZC B;  1VQO P;  1KX2 A;  1SP4 A;  2OYI B;  2C1V A;  1NTK E;  1OFC X;  4L3H A;  2OYH A;  1UIX A;  1RF0 C;  2WSE J;  3L75 E;  2GIW A;  4U3F G;  4IOI H;  4ZNC A;  4JF7 A;  5B5E E;  5GTH V;  3CWB D;  4B86 A;  3TK1 A;  2K3R A;  3L74 D;  4U3F E;  4WWI A;  4PJ0 H;  1VDF A;  5CBN A;  1LJ2 A;  2O01 N;  3GW6 A;  3H1K G;  1NU1 G;  1S2E A;  3VMY A;  1VQL P;  2J5U A;  4PW9 B;  1QLE D;  3GMA A;  3TYI A;  2JTI B;  4A7P A;  3HE5 B;  2LXC B;  1LNQ A;  3RBX A;  1M57 D;  4AAN A;  1SFC D;  1BCC G;  1VF5 D;  2WSC H;  3BCC D;  5L8R J;  1S5L H;  2WT7 A;  3R2P A;  2E75 B;  3H1H E;  1FZB A;  1VF5 C;  5GTH H;  5KLV K;  1LT9 B;  1N9C A;  3A0H V;  3AE1 C;  1BSH A;  3PH2 B;  1ZRT E;  2W8Z A;  2P58 A;  1YTZ I;  1U74 B;  1GMJ A;  2B4Z A;  1YYC A;  3CU4 A;  1T6A A;  1L4A D;  1YTZ T;  2D2C C;  1RF0 A;  3H1K D;  1L4A C;  1KYO W;  5EFW B;  2WT7 B;  2KOG A;  2P1J A;  2M0B A;  2ZZS 1;  2QIW A;  155C A;  3RMZ A;  2FXP A;  4FB1 A;  5C0Z A;  3CX5 W;  2L91 A;  1BCC D;  2SPZ A;  1N86 A;  1T8Z A;  3VRD A;  1KB9 E;  1EC5 A;  4HKZ H;  3JC2 2;  3A0H H;  2AXT V;  3GF7 A;  2OTK E;  3M0A A;  1OW6 A;  1YIT P;  1FDI A;  2P10 A;  3PJS K;  1NTK J;  3ZBM A;  2ZJS E;  4GDO A;  4KJM A;  3VP9 A;  1SFC A;  1RE3 C;  4AQR D;  1L0L E;  2A06 E;  2RN0 A;  2N9J A;  1F1F A;  3MIW A;  3FXD A;  1AOF A;  2BAS A;  1WRG A;  3G6E P;  2AXT H;  1L4A A;  4U3F J;  4GKG A;  1BGY D;  5AW5 B;  1SFC B;  2XNX A;  4NPF X;  1VF5 B;  3HD7 D;  1JY3 P;  2YQB A;  2FRC A;  1JO5 A;  1U57 A;  3F89 A;  3MUD C;  1KIB A;  3L4M A;  4ASV A;  2B10 B;  1Q86 Q;  2D2C B;  1NU1 J;  1PFI A;  1L4A B;  1COT A;  2A45 G;  3H1H J;  2Q1K A;  2OYO A;  3Q3D A;  5AUR A;  3JCU E;  3HQ8 A;  1I6D A;  3HUS C;  1PP9 E;  5CCG C;  1FDM A;  4H13 D;  2C2C A;  1WEJ F;  5DJT B;  3NTN A;  3VYM A;  1KYO I;  1OCD A;  1DW3 A;  4UB8 E;  1NAF A;  3MZW B;  4YXW H;  1FOC A;  4HB1 A;  3KXD A;  2B11 B;  5AW4 B;  3S4R A;  1YEB A;  5BVZ A;  5M1B A;  3U59 A;  1KMI Z;  2PAC A;  3CX5 I;  2DVH A;  1SQP E;  2YMY A;  2R32 A;  3SLE A;  2W83 C;  1NWQ A;  3HQ9 A;  1U7M A;  5CBO A;  2D0W A;  3HD7 A;  4WQB A;  3M97 X;  1LTT C;  2YXR B;  4EI2 A;  1N7S D;  1DVH A;  5KKZ C;  1BE3 E;  3QWO C;  3T97 B;  1C6S A;  4PD4 E;  1QL1 A;  2UWJ E;  4FA1 A;  1RF1 C;  4Y5R A;  3MGN A;  5CJ4 A;  4OWF A;  3ZCF A;  2IBZ G;  1SQQ E;  1N73 A;  1JCD A;  1CHI A;  3HD7 B;  3AEC C;  5KAF V;  4TT3 H;  1JOC A;  1GK6 A;  2LKM A;  1URQ D;  2BPB B;  4DY9 A;  1FJK A;  2Z5I A;  1T2K C;  1URQ C;  3U1A A;  4IL6 X;  2B89 A;  3TGU E;  3HQ7 A;  2IBZ E;  2H43 A;  1KIL D;  2G8Y A;  2M3E A;  3W67 A;  1J1E B;  3KZI V;  1PPJ E;  3U1C A;  1CHJ A;  1PGP A;  3HUS B;  1N73 B;  2WPV B;  4XE5 B;  2P7J A;  1FJ0 A;  1G1J A;  3MTU E;  1H0T A;  2Q6Q A;  5TIS E;  4H13 B;  2H89 C;  4AUW A;  3VN0 A;  3NXS A;  1OXZ A;  2WSF H;  2C9N Y;  4WQ7 A;  2I1J A;  5KAF H;  1VQP P;  3NBS A;  1PP9 J;  2QJK C;  1HGV A;  3WFE C;  1N7S A;  3A2A A;  1RHZ B;  3JBT B;  1H0T B;  1H89 A;  2KP8 A;  1BSN A;  1D7M A;  1HTL C;  5CMZ A;  2KS1 A;  2NPS C;  3SWK A;  3ABV C;  4D6T E;  1X79 B;  2RMZ A;  1ZN5 A;  3FWL A;  5KKZ B;  3CCR P;  1URQ A;  1SQP J;  2CE1 A;  1EDL A;  2OZ1 A;  4WY4 C;  1CXA A;  1FE6 A;  4JYB A;  1KIL A;  1M60 A;  2FYN C;  2LIT A;  1C6R A;  2KS1 B;  4HJG H;  3SFD C;  2DGE A;  5DF5 A;  1AQ5 A;  3M9Q A;  3ZOY A;  3H1I G;  2Q9I A;  1BE3 J;  3L4F A;  4C7N A;  2YO2 A;  2N3B A;  1URQ B;  3IF4 A;  3P8C E;  2OZ1 B;  4DZO A;  2N9I A;  4FA4 A;  451C A;  4IL6 V;  1E79 H;  5AW3 B;  1KIL B;  3WU2 H;  4PWA A;  4L73 A;  2Q3E A;  3RL0 g;  2C1D A;  1MFT A;  3Q1M A;  2BH4 X;  2ZFC A;  1ZOY C;  1HH0 A;  1G1I A;  3ZDM A;  1KOR A;  1AKK A;  1OVR A;  1I5T A;  2K9Y A;  2N9Y B;  3BRV B;  2A45 H;  4GOD A;  4K3I A;  1FJP A;  1VQ4 P;  2QJK B;  3IAO A;  1MKM A;  1LTA C;  1HUC A;  4IL6 H;  3KQG A;  3V4W A;  1JY2 O;  1DVV A;  3O1Y A;  5KJ7 C;  5BU5 A;  3B71 A;  1XTG B;  2QRX A;  2R5B A;  1OW7 A;  1RZ6 A;  3RK3 E;  1IK9 A;  3MHV A;  1K73 Q;  2BH5 X;  1VQK P;  4N3Y B;  5APW A;  1LTI C;  4WY4 B;  3V6I A;  1MZ9 A;  1RE4 A;  5KLI C;  4OGQ D;  2CXB A;  5CIH B;  3A0B E;  4OGQ C;  3EWK A;  2OTL P;  2PRR A;  1XTC C;  1KYO D;  1QVG O;  1FS0 E;  1KTM A;  3GLM A;  1JUN A;  4H0L C;  3C2C A;  3BAS A;  2JKV A;  1NVO A;  2O01 H;  2JP3 A;  4HH2 A;  1S9K D;  3ZOX A;  3CX5 D;  1VQ5 P;  4RO0 A;  2V7Q J;  3TNU A;  3K5B A;  4IFF A;  1DX7 A;  2E74 D;  5E79 E;  1KB9 I;  2E74 C;  4JBZ A;  5CIC B;  3H1I J;  1HJ3 A;  1KV9 A;  2N1T D;  5AVX B;  1FOS E;  4UB6 V;  1RY3 A;  2XU6 A;  1JEK A;  2RKL A;  1H33 B;  2K9J A;  4ZKP A;  4XA4 A;  2OYI C;  4KT0 J;  1R5S A;  3AEB C;  1PIX A;  2JQR A;  3DR0 A;  2PGD A;  3N7N A;  3O8Z A;  1KC8 Q;  3VNW A;  1FHB A;  5KLI B;  3CXH E;  1NJI Q;  2K9J B;  2JWD A;  2ZXX A;  1BL9 A;  4UB6 H;  1SS1 A;  4OGQ B;  1C2N A;  3PXS A;  1EQ7 A;  2OYH C;  3RN0 A;  1MZ4 A;  1YTC A;  2GUS A;  2W27 A;  3PP5 A;  5B66 E;  2IYP A;  4L76 A;  1CIE A;  1NTZ E;  2N1T A;  2PAJ A;  4R4M A;  1ZME C;  1H31 B;  1SQB E;  1GD2 E;  1AQT A;  1S3J A;  1Q2N A;  2WWW A;  2DW3 A;  3RBZ A;  2C9X B;  2BCC E;  4Z1M H;  2E74 B;  1E5W A;  2HPC B;  3L71 E;  1VYD A;  1OAE A;  1EXI A;  2R3S A;  2QVA A;  1NTK G;  1AOQ A;  3E7K A;  4M3L A;  2OAR A;  1K3G A;  2JO1 A;  3GG2 A;  2ITA A;  3L75 G;  3IR9 A;  2E42 A;  2CE0 A;  4WQD A;  1NMI A;  4BRY B;  3CCL P;  4JYC A;  5C39 A;  1ZV8 A;  3M06 A;  3CCV P;  2J58 A;  1KFN A;  2QJY B;  1U75 B;  1GZL A;  1S5L V;  3RK2 D;  3AEA C;  1OMI A;  3O6Q B;  1VQ8 P;  1KYO H;  2BLF B;  3RK2 C;  1NOH A;  3O5C A;  1NTK D;  4RKU J;  1AYG A;  2CPS A;  3LW5 J;  2XKM A;  1YQ3 C;  2OYH B;  4YXD C;  3L75 D;  2ZYD A;  3H32 A;  3WFD C;  2GC7 D;  2W6B A;  2IZ0 A;  3CX5 H;  2IBZ I;  2R44 A;  3H1H G;  1JNM A;  1KQF B;  2XND H;  2XTS B;  2IPP A;  4U3F D;  1E2R A;  1HVV A;  1KQG B;  1SFC C;  3LIE A;  3M9H A;  1KZU B;  1M1K Q;  3H32 B;  1DD3 A;  4GED B;  3WC8 A;  4PV1 D;  2ORL A;  4V2K A;  1NTZ J;  3ZIY A;  1VQM P;  1SQB J;  1GL2 D;  4RES B;  1NU1 D;  1A8C A;  1E29 A;  4EID A;  1CTJ A;  3M91 A;  3AEG C;  1IFM A;  5H2F H;  3H1H D;  2BCC J;  2AIU A;  3CC4 P;  3L71 J;  5EXQ A;  3C8V A;  2PP6 A;  4ASW A;  1ZRT D;  2WSE H;  1P84 E;  1YIC A;  4FA5 A;  2B87 A;  1CNO A;  2QEX P;  1E8E A;  1WMK A;  1VPC A;  2G3A A;  2CA4 B;  2LIR A;  1L0L G;  2ZAE B;  2A06 G;  1F1C A;  1ZP0 C;  4TLF A;  1SQX E;  2JJL A;  1DH3 A;  3RK2 B;  4I2L C;  3CC7 P;  5DJU B;  1GDV A;  2ZXE B;  3S9O A;  3L75 J;  1KB9 D;  3OJA B;  3I55 P;  2E76 D;  3KPE A;  4EDF A;  1SQV E;  1NML A;  2OQQ A;  1Y47 A;  3KZI E;  3PRJ A;  1GU4 A;  1NTK K;  1DEB A;  2N18 C;  3CME P;  2IYO A;  1N50 A;  1GL2 A;  1H88 A;  2A06 D;  1CSV A;  5AVY B;  2V4H A;  1YJN P;  1FOS F;  2KB7 P;  3HD7 C;  3TDK A;  4RSZ A;  1YJW P;  1FI3 A;  3FGA D;  3V4Q A;  2FXM A;  3D6Y A;  1PP9 G;  1HJ5 A;  1NIR A;  3CCU P;  1GL2 B;  2QE7 H;  1H9X A;  2HG5 D;  5B5E V;  4DOJ A;  3ORV A;  2YNY A;  1J1E C;  3VTP C;  3EFF K;  1KQL A;  2GUV A;  1N73 C;  4J20 A;  3L35 A;  1IC2 A;  1YEA A;  2POH A;  3AE9 C;  2I8F A;  4ZKU A;  1NU1 K;  1USE A;  1NAY A;  4H13 C;  1CCR A;  2ZON G;  1SQP G;  3FXE A;  1YIQ A;  1L0N E;  1CRY A;  1IZN B;  1KQS O;  1DT1 A;  2YIU C;  1GW4 A;  1Y9B A;  3AE7 C;  1CIH A;  1HBW A;  1PP9 D;  4XXL A;  2N9B A;  2ZVO B;  2FYU E;  1PL5 A;  5APS A;  5B5E H;  5KAI E;  1JY2 P;  1BE3 G;  5C9M A;  3BRT B;  5CID B;  4WQE A;  5CIG B;  5AW1 B;  4Q5P A;  1SQX J;  2C1U A;  3TF5 A;  2E76 B;  2KSE A;  3AEF C;  1SLQ A;  3P32 A;  1FDO A;  1SQQ G;  4I1L A;  2N18 B;  1N7S C;  1SQP D;  4BWN A;  3RLM A;  1L0L J;  1X22 A;  1EZV G;  3A9F A;  2Y9Z A;  1H9Y A;  1DW2 A;  5K5G B;  3L72 E;  3CD6 P;  3TGU G;  1S6V B;  1KFM A;  1FZE A;  1YQ4 C;  1SQV J;  2ZT9 D;  1LGH B;  1IJD B;  1EZV E;  1PPJ G;  2ZT9 C;  1BE3 D;  4EIC A;  1DW1 A;  4XFJ A;  1CHH A;  4K3A A;  5AW2 B;  1RZ5 A;  1L2P A;  1Y8A A;  1YHQ P;  1YIJ P;  1KIL C;  3H1L E;  2HYN A;  4C7R A;  2GB8 B;  1SQQ D;  1FI7 A;  2JR8 A;  3L4O A;  5CHX A;  3IFM A;  1HRO A;  4Y99 B;  4EIE A;  2IBZ D;  3AEE C;  4DJG A;  1KX7 A;  2MHM A;  1GK4 A;  1H8A A;  2YIU B;  4FAV A;  1KB9 H;  1PPJ D;  1QKS A;  1OZH A;  1QN2 A;  1W2E A;  4D6T G;  1Z56 A;  1M6Z A;  2HOD A;  3VOP A;  2B0Z B;  1C2R A;  3IN6 A;  1CW5 A;  2M8R A;  1L0N J;  1ZXG A;  3VYI A;  2Y0C A;  5GTI E;  2VHD A;  4WVZ A;  2KLV A;  5AW8 B;  1W2L A;  2XV5 A;  5CCH D;  4W80 A;  4L3G A;  3B4S A;  1NTM E;  3WU2 V;  2FYU J;  1N7S B;  4GOE A;  1S72 P;  2HOD B;  2QM7 A;  3HE4 A;  1OVV A;  2N3Y A;  3Q5S A;  4YE1 A;  3E1R A;  3D70 A;  3RGU A;  4R4L A;  5AVQ B;  1FBM A;  3AED C;  2VRS A;  2ZT9 B;  1SQP K;  3I56 P;  4UB8 V;  3HE4 B;  1SVF A;  2GM4 A;  2WPS A;  3L72 J;  1RE4 C;  1FZF A;  4GYD A;  1SQQ J;  1OW8 A;  1YI2 P;  1I8O A;  3G4S P;  1QX8 A;  1YJ9 P;  4I6M C;  2Q3I A;  1CSU A;  4C7N B;  3S1K A;  3OA8 A;  4I7Z C;  1WVE C;  3WUT A;  3JCU H;  3TGU J;  1LC1 A;  2GC4 D;  1DIP A;  3H1L J;  3WMM 0;  3ZOO A;  3H1I D;  2WQY C;  3II6 A;  2QG4 A;  5CCH A;  4UB8 H;  2C1D B;  1HJB A;  2W90 A;  1M90 Q;  4RJT A;  1LT1 A;  4K35 A;  4Y28 J;  3HRN A;  1LMS A;  1L9B C;  2K37 A;  3BVH A;  1HZV A;  4H0J A;  1FAV A;  3TYY A;  5APQ A;  2KI7 B;  3L70 E;  2D0S A;  2V07 A;  2WSS H;  1CYC A;  1OWA A;  2WZ7 A;  5APX A;  4D6T J;  1RH5 B;  3A7O A;  4CPG A;  4PD4 H;  1NTM J;  3O20 A;  1PGJ A;  2ZVN B;  4O1W A;  2WPR A;  2IDB A;  1Q81 Q;  1EDJ A;  1NGM B;  1AJY A;  2MKV A;  2LR2 A;  4PJ0 E;  1JDL A;  2FXO A;  1A2S A;  1C52 A;  2ZXY A;  2R5D A;  3F5H A;  1T3J A;  1FZG A;  1AV1 A;  5APT A;  1P84 I;  3MK7 B;  2HLO A;  4I7Z B;  2AEM A;  1I8P A;  1LS9 A;  2AXC A;  3LID A;  1IK7 A;  1MG3 D;  2IFN A;  1RAP A;  1K05 A;  5GTH E;  5TIS H;  2N1T C;  2IX7 C;  3OAK A;  1HCM A;  3NWV A;  3TNU B;  2C0W A;  3M9B A;  1X0T A;  2KK7 A;  2IZ1 A;  1BDC A;  3A5T A;  2Y0D A;  5AVZ B;  2P67 A;  1GDT A;  4AAM A;  1K3H A;  3SWY A;  1R8E A;  5B6Q A;  1CI6 A;  1JCC A;  1FZA A;  3H1J G;  1HRC A;  2NRG A;  3SFE C;  1RQV A;  3HTK A;  5GTI H;  3M0D A;  2QJY C;  3MD0 A;  3D0W A;  1LC2 A;  3A0H E;  5KLV G;  3H1J E;  2E5Y A;  2C8S A;  1NHL A;  1NTZ G;  4H0K A;  1CI6 B;  2CPB A;  4W7Z A;  1KB0 A;  3N4X A;  3HTK B;  3CCS P;  1SQB G;  3L70 J;  5KLV E;  2CA3 B;  1R5L A;  2V7Q H;  2H88 C;  1CIG A;  2BCC G;  2WIT A;  3ITK A;  1VQ9 P;  3L71 G;  1ETP A;  2OTJ P;  1X9V A;  1QVF O;  1USD A;  1KN7 A;  5AVU B;  2AXT E;  1N8R Q;  1HGZ A;  3PH0 A;  1NTZ D;  2E43 A;  2NZ2 A;  2N1T B;  2AEJ A;  1FI9 A;  1I54 A;  1SQB D;  4NPD A;  4N0K A;  4WBA A;  1JTH A;  1LWU A;  4AAO A;  4WQA A;  3L73 E;  1CSB A;  1YBK A;  2BCC D;  4N78 E;  3P8M C;  4C46 A;  3Q2Y A;  2WSC J;  3A0B V;  3L71 D;  4LC1 A;  4NFG B;  3MP7 B;  4WQ9 A;  3CWB G;  1LTB C;  1ZLL A;  5KTB A;  4GIF A;  4L74 A;  2ZBO A;  1LWU B;  4PD4 I;  3P7K A;  1CYJ A;  3CWB E;  1M7L A;  1W5C E;  2YMK A;  3L74 E;  1K04 A;  1NO4 A;  1RAQ A;  1EZV I;  5E79 V;  2YCC A; 
#chains in the Genus database with same CATH homology
 1FCD C;  3PXW A;  1DW0 A;  4MU8 A;  1CYI A;  3FWL A;  5KKZ B;  1CC5 A;  4J20 A;  1H33 A;  2CE1 A;  5H2F V;  4AX3 A;  2OZ1 A;  1YEA A;  1CXA A;  1NNO A;  2I8F A;  5CYT R;  1CCR A;  1M60 A;  2AI5 A;  2ZON G;  1MG2 D;  2LIT A;  3PXT A;  1C6R A;  1YIQ A;  1CRY A;  1CRI A;  4WQ8 A;  2DGE A;  1DT1 A;  1YCC A;  5DF5 A;  1CRC A;  5IY5 1;  3ZOY A;  5DJQ C;  3PHL A;  1CIH A;  1PP9 D;  4P4Q B;  2N3B A;  3NBT A;  4XXL A;  4KMG A;  2OZ1 B;  1DIQ C;  2N9I A;  4FA4 A;  1B7V A;  451C A;  4IL6 V;  4JCG A;  5C9M A;  5CID B;  4WQE A;  5CIG B;  4Q5P A;  4PWA A;  3SXT A;  1CTY A;  2C1U A;  3TF5 A;  2Q3E A;  2C1D A;  3DP5 A;  2BGV X;  2BH4 X;  2N18 B;  1AKK A;  1SQP D;  3CXH D;  3RLM A;  3RN1 A;  1I5T A;  3H1J D;  1C6O A;  3A9F A;  2N9Y B;  1H9Y A;  2KNC B;  1DW2 A;  1H31 A;  4K3I A;  1S6V B;  1H32 A;  2QJK B;  3WUI A;  5B66 V;  3O0R C;  3VMA A;  1QL3 A;  2PCB B;  5KLV D;  2MTA C;  1BE3 D;  4EIC A;  1DW1 A;  1P84 D;  1CHH A;  3KHU A;  1DVV A;  3O1Y A;  1RZ5 A;  3WFB C;  2EXV A;  1RZ6 A;  1ZZH A;  1QYZ A;  1HJ4 A;  4O1Q A;  4WQC A;  2GB8 B;  3SWS A;  1CSW A;  1H32 B;  1SQQ D;  1FI7 A;  2BH5 X;  3L4O A;  1SQX D;  3ZOW A;  1HRO A;  1C7M A;  1QL4 A;  1DII C;  2CXB A;  5CIH B;  4EIE A;  2IBZ D;  1L0L D;  1KX7 A;  2MHM A;  1CED A;  4XYD B;  2YIU B;  1CXC A;  4FAV A;  1N90 A;  2O3J A;  1PPJ D;  2QJP B;  5DJQ B;  1QKS A;  1EB7 A;  3L73 D;  4PJ0 V;  1KYO D;  1QN2 A;  1SQV D;  5TJH A;  1M6Z A;  2B0Z B;  1C2R A;  3X39 A;  3C2C A;  5DFS A;  1KX2 A;  2C1V A;  4L3H A;  2Y0C A;  2VHD A;  3ZOX A;  3CX5 D;  3WFC C;  1W2L A;  2GIW A;  4L3G A;  3CXH W;  3WU2 V;  5GTH V;  1GU2 A;  4EIF A;  3CWB D;  5CIC B;  1GQ1 A;  2N3Y A;  1HJ3 A;  1CTZ A;  1KV9 A;  3L74 D;  4YE1 A;  2JWA A;  1H1O A;  3GW6 A;  4UB6 V;  4PW9 B;  4A7P A;  3TYI A;  2JTI B;  1H33 B;  4UB8 V;  351C A;  4AAN A;  1IQC A;  1IZL 0;  4GYD A;  3BCC D;  1L0N D;  1I8O A;  2JQR A;  1N9C A;  3A0H V;  1CSU A;  3DR0 A;  3PH2 B;  3OA8 A;  1WVE C;  1U74 B;  3VNW A;  1FHB A;  1LC1 A;  2B4Z A;  5KLI B;  2FYU D;  1GIW A;  3CU4 A;  2K9J B;  2GC4 D;  1BL9 A;  1C2N A;  3H1K D;  3ZOO A;  3PXS A;  1KYO W;  3H1I D;  1M70 A;  1CRG A;  2QG4 A;  3RN0 A;  1MZ4 A;  3CP5 A;  1HH7 A;  1YTC A;  2ZZS 1;  2C1D B;  155C A;  3RMZ A;  3PTZ A;  4FB1 A;  5C0Z A;  2V08 A;  4RJT A;  3CX5 W;  1I55 A;  2L91 A;  1BCC D;  1CIE A;  4PD4 D;  1LMS A;  2FWL A;  3VRD A;  4AAL A;  1L9B C;  2Y0E A;  2AXT V;  1H31 B;  3L72 D;  1IRW A;  1HZV A;  4H0J A;  3DMI A;  1CO6 A;  2C9X B;  5CIB B;  1EZV D;  1VYD A;  2D0S A;  3ZBM A;  2V07 A;  3TGU D;  1OAE A;  1YFC A;  1CYC A;  1COR A;  1LFM A;  2RN0 A;  2N9J A;  3H1L D;  1AOQ A;  1F1F A;  2YK3 A;  4L1Q A;  3O20 A;  1I6E A;  1K3G A;  4O1W A;  1AOF A;  4LJI A;  3GG2 A;  1CSX A;  1C75 A;  2BCN B;  2CE0 A;  1JDL A;  1A2S A;  1C52 A;  2ZXY A;  4WQD A;  1BGY D;  1NMI A;  3OCD A;  1HZU A;  1L9J C;  1CCH A;  3MK7 B;  2YQB A;  2FRC A;  2QJY B;  1I8P A;  1KIB A;  1U75 B;  1S5L V;  3L4M A;  1LS9 A;  2B10 B;  2BLF B;  3O5C A;  1NTK D;  1AYG A;  1COT A;  1MG3 D;  1RAP A;  3OCD B;  3L75 D;  4D6T D;  3WFD C;  2GC7 D;  1HCM A;  3NWV A;  5AUR A;  1NTM D;  3HQ8 A;  1I6D A;  3PLN A;  2C2C A;  2XTS B;  1WEJ F;  2PCC B;  2Y0D A;  3SVW A;  1GJQ A;  4AAM A;  1K3H A;  3VYM A;  1OCD A;  4U3F D;  1E2R A;  1DW3 A;  5CIE B;  1A56 A;  5B6Q A;  1CIF A;  1FOC A;  1HRC A;  2B11 B;  4GED B;  3MK7 C;  3WC8 A;  1YEB A;  5KAI V;  3SJL A;  2PAC A;  4FAN A;  2ORL A;  4V2K A;  1IO3 A;  2DVH A;  1LC2 A;  3ZIY A;  3SLE A;  4QAO A;  3HQ9 A;  1NU1 D;  1A8C A;  1E29 A;  2C8S A;  4EID A;  1CTJ A;  4H0K A;  3CYT I;  2D0W A;  3H1H D;  4WQB A;  1KB0 A;  2AIU A;  3M97 X;  5EXQ A;  1DVH A;  2CA3 B;  1ZRT D;  1W5C T;  3OA8 B;  1YIC A;  1CIG A;  1C6S A;  2ZOO A;  3ITK A;  4FA5 A;  1CNO A;  4FA1 A;  4Y5R A;  1ETP A;  1E8E A;  1J3S A;  3ZCF A;  2HV4 A;  2B12 B;  2CA4 B;  2LIR A;  1CHI A;  5KAF V;  1F1C A;  2BPB B;  4DY9 A;  1N15 A;  1GDV A;  3HQ7 A;  1NTZ D;  4FA9 A;  1CRJ A;  1KB9 D;  1GKS A;  1R0Q A;  1FI9 A;  1I54 A;  1SQB D;  4N0K A;  3KZI V;  4AAO A;  1CHJ A;  4WQA A;  5TIS V;  5CIF B;  4EDF A;  1NML A;  2BCC D;  1FJ0 A;  3PRJ A;  3A0B V;  3L71 D;  3L70 D;  2N18 C;  2FYN B;  1IRV A;  1N50 A;  1YNR A;  4NFG B;  4WQ9 A;  4WQ7 A;  2A06 D;  1CSV A;  3NBS A;  3HQ6 A;  2ZBO A;  3WFE C;  3TDK A;  2L4D A;  4RSZ A;  1CYJ A;  1FI3 A;  5GTI V;  3JBT B;  1HJ5 A;  1NIR A;  1CRH A;  2KS1 A;  1H9X A;  1RAQ A;  5B5E V;  5E79 V;  2YCC A;  3ORV A;  2RMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...