3CXHD

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 71
structure length 246
sequence length 246
chains with identical sequence O
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cxhD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cxhD02
1DIQC 1YNRA 1NTZD 1LC2A 1CIGA 1I54A 5CIDB 5C0ZA 1I6DA 5KAIV 2N9JA 1KB9D 3CYTI 1CYCA 5KAFV 1HRCA 3L72D 3O20A 3WUIA 1GQ1A 2XTSB 1HCMA 4DY9A 5CICB 3O5CA 5AURA 1CRIA 4PW9B 3NWVA 2N3BA 2LIRA 5CYTR 3TGUD 1FI7A 3ZOXA 1RZ6A 2JQRA 3WFCC 5KLVD 2JTIB 1CCHA 1S6VB 3HQ9A 1KB0A 2Y0EA 4QAOA 1HJ4A 4Y5RA 1GIWA 3HQ6A 1LMSA 2N3YA 451CA 1IRVA 1DW2A 2QG4A 3BCCD 4A7PA 3L4OA 4RJTA 3ITKA 1F1FA 1ETPA 3OCDA 1SQQD 2L91A 2CXBA 1QKSA 3H1JD 3NBSA 1F1CA 4KMGA 1HROA 5TISV 4FAVA 2KS1A 3PHLA 1LFMA 4XXLA 3CX5W 1CIFA 2ZBOA 2QJPB 3O0RC 1NNOA 1KYOD 3A0BV 1DW3A 1IQCA 2FWLA 4FA4A 2GC7D 2EXVA 2ZXYA 4AX3A 4EDFA 3L71D 3WC8A 4EIEA 1RAQA 5GTHV 1PP9D 3MK7B 3TF5A 3X39A 1H1OA 1I8PA 1J3SA 1E2RA 1LS9A 2MTAC 4N0KA 3A0HV 1H31B 1NMLA 3HQ8A 4AAOA 1CSUA 1QN2A 2PCCB 3DMIA 4PJ0V 1M6ZA 1DT1A 1N50A 1SQBD 5E79V 2N9IA 1C7MA 3H1HD 1LC1A 1A2SA 3CXHD 3H1KD 1H9YA 1I5TA 1JDLA 3DR0A 1FOCA 1KX2A 1NIRA 3GG2A 1N90A 1NU1D 1IRWA 4D6TD 2RN0A 2Q3EA 4WQ7A 3ZIYA 1CTZA 4FA9A 1A56A 2AXTV 1K3GA 5CIEB 1SQXD 3WFEC 3SJLA 1H32B 3RN1A 5CIBB 3RN0A 1K3HA 1I8OA 2QJYB 3VNWA 1CRGA 1SQVD 4FA5A 5DF5A 4WQAA 5DJQC 1S5LV 4V2KA 4WQEA 4AALA 1HZUA 1L9JC 3ZOWA 2ORLA 5H2FV 1H9XA 1QYZA 4H0KA 2OZ1B 3WFDC 2B0ZB 1IO3A 3L70D 1CTYA 3RMZA 1C75A 3KZIV 1CHJA 2DVHA 3L74D 3SLEA 1ZRTD 2K9JB 1N15A 1H33B 2CE1A 2LITA 4J20A 5KLIB 3L4MA 1YICA 4O1WA 5DFSA 4EICA 3TYIA 1FCDC 4U3FD 1H31A 5B6QA 2DGEA 4L3GA 2N18B 1CRHA 1P84D 3PLNA 1NTMD 2FRCA 4GYDA 2FYNB 4WQ9A 3ZBMA 3FWLA 1W2LA 3ZCFA 1A8CA 4UB6V 4XYDB 1CRJA 3ORVA 3PTZA 1CYIA 1COTA 4PD4D 1YFCA 1W5CT 1DW1A 1DVHA 5CIHB 4WQDA 1MG2D 2GC4D 3SWSA 1CNOA 1B7VA 2GIWA 2QJKB 1CC5A 1H32A 2CA3B 3HQ7A 3ZOOA 1CSWA 1OCDA 3O1YA 3ZOYA 5CIGB 1BCCD 3CP5A 2B12B 1AKKA 1CCRA 1HJ3A 4WQBA 1GU2A 2A06D 1U75B 4L3HA 5GTIV 5C9MA 2AI5A 2AIUA 2B4ZA 5TJHA 1FJ0A 3RLMA 1NMIA 2Y0CA 1E29A 1RZ5A 2D0WA 1AOFA 2Y0DA 5KKZB 3JBTB 4GEDB 5IY51 1MG3D 2PCBB 4NFGB 3TDKA 2CE0A 2GB8B 1HZVA 2VHDA 3CU4A 1FI3A 1H33A 1CTJA 2B11B 1YEAA 2C1DB 3L75D 4FB1A 2ZOOA 3MK7C 1C6RA 5B5EV 1CORA 1C52A 2BCCD 4Q5PA 5CIFB 1YEBA 1N9CA 3KHUA 1FI9A 3CX5D 3H1LD 2CA4B 3PRJA 2JWAA 3PXWA 1DW0A 1L0ND 3A9FA 2MHMA 4PWAA 3CWBD 2C9XB 5EXQA 2ZONG 4O1QA 4JCGA 3WU2V 4RSZA 1RAPA 1QL3A 1KYOW 3OA8B 1L9BC 1CSVA 4WQ8A 3L73D 2IBZD 1KX7A 2RMZA 2BCNB 4WQCA 1AOQA 1E8EA 2BH4X 1I55A 1M60A 4AANA 1CHHA 2C8SA 1IZL0 4EIDA 3SVWA 4H0JA 1I6EA 4K3IA 2BGVX 4IL6V 3GW6A 3VMAA 1YCCA 1YIQA 1BL9A 1GDVA 4LJIA 1GJQA 3PH2B 2BPBB 2HV4A 3NBTA 1CXCA 1C6OA 1VYDA 2YK3A 2BH5X 1CXAA 3CXHW 1KV9A 2YIUB 155CA 3H1ID 1CIHA 1CHIA 1CSXA 1ZZHA 1CO6A 2B10B 5B66V 2V07A 2C1DA 2V08A 2D0SA 4L1QA 2BLFB 3VYMA 4UB8V 1M70A 4MU8A 3C2CA 1EZVD 1CRYA 1DIIC 4FA1A 3WFBC 351CA 1FHBA 3PXSA 2N18C 2PACA 2I8FA 1U74B 4P4QB 2O3JA 3M97X 1PPJD 1CEDA 3VRDA 4FANA 2OZ1A 1CIEA 1YTCA 3OA8A 1BE3D 1DVVA 1C2RA 1WVEC 1KIBA 2ZZS1 1CYJA 1WEJF 1SQPD 2N9YB 1NTKD 1BGYD 1R0QA 1QL4A 3PXTA 4AAMA 4YE1A 3OCDB 1CRCA 5DJQB 1MZ4A 1AYGA 2L4DA 2C1VA 2FYUD 2KNCB 1C2NA 1L0LD 1OAEA 4EIFA 1C6SA 2YQBA 1HH7A 2YCCA 2C1UA 1GKSA 3DP5A 2C2CA 1EB7A 3SXTA 1HJ5A
chains in the Genus database with same CATH superfamily
3T97B 2XKMA 4YPCA 5CIDB 1I6DA 3CCQP 2N9JA 3GF7A 5KAFV 1HRCA 3O20A 2XTSB 2FXPA 1AFOA 1RH5B 4WWIA 3WU2E 3O5CA 1X79B 3H6PA 2N3BA 5AVQB 4YXWH 4GOFA 4L75A 1EZVE 4H44D 3ZOXA 2JQRA 2OTKE 2WPRA 2JTIB 1CCHA 2B87B 4ASWA 2JDIH 2WSCJ 1GL2B 2IX7C 2W6AA 2A06E 2XNXA 5BU8B 2D2CC 1JOCA 2WQYC 2QG4A 2E5YA 2FXMA 3P8CE 3BASA 3RGUA 3OCDA 1ETPA 2LKMA 1R5LA 2I1JA 1QKSA 2IDBA 3NBSA 2Q3IA 4KMGA 1AVOA 4FAVA 2KS1A 2QIWA 3FWNA 5B66E 4GOEA 1CIFA 2ZBOA 1EDJA 1SLQA 1SQQG 2K9YA 1GMJA 2BCCE 4IFFA 3CX5I 3A0BV 1N7SC 2BEQD 2N1TD 3LIDA 1ZOYC 5KJ7A 1SQQK 1H8AA 3CWBE 3HE5A 2P2UA 3AEFC 1KB9I 3NTNA 1FDMA 3VP8A 3L73E 4N0KA 1LWUB 1RE3C 3HQ8A 4AAOA 3RK2D 2PCCB 1M6ZA 1N50A 2ZVOB 2N9IA 4OWFA 2MKVA 1NVOA 1KILB 3H1KD 3RBXA 1JDLA 2KSJA 5CCHC 2N9BA 1Q2NA 3TNUA 1SQBG 4R4LA 3ZIYA 2E74C 1KB9H 1VQKP 1OX3A 1K3GA 1GK6A 5CIEB 5KKZC 1W2EA 3RN0A 1JY2N 2YKPA 1SQBK 3B5NB 1NU1G 2ZT9C 2JJLA 5APQA 3VNWA 1CRGA 4FA5A 1IO4A 4V2KA 4C7NB 1Q90D 4AALA 1HZUA 2HG5D 3ZOWA 5H2FV 1N8RQ 1Q7YQ 3Q5PA 2C9LY 1NU1K 4H0KA 1VQ6P 1VQ7P 3L70D 1NKZB 1QGKB 3AE4C 2Q6QA 1IZNB 1IFJA 3FXEA 4N6JA 1CHJA 4C7RA 2IZ1A 2CPSA 1ZRTD 1KMIZ 1PGOA 2K9JB 3MIWA 2LITA 3GHGB 3L4MA 1LGHB 3TYIA 3HTKB 3L74G 5C39A 2DGEA 3AE3C 4L73A 4WQ9A 2P58A 4BRYA 1N86A 1A8CA 3O8ZA 4XYDB 3ORVA 1T8ZA 1CYIA 1E79H 1PP9J 1XTCC 2Q1KA 1BE3J 1NTMG 4H0LC 3H1KE 3KXDA 5TISE 1DVHA 5CIHB 3V5BA 2BEZF 3S9OA 3M0DC 1URQB 3GLMA 1NTMK 3ZOOA 4NPDA 4AYCA 2FYUJ 3HD7B 3SWFA 3H1HJ 1CCRA 1HJ3A 1GU2A 2HODB 1OW8A 2E75D 2YO3A 3S1KA 2K88A 1G1IA 2Y0DA 5KKZB 1BCCG 1LTJC 4KT0J 1RF1B 1FZFA 1MG3D 3A3YB 4NFGB 2GB8B 2ZT9B 2VHDA 3CU4A 2YXRB 1VL2A 2B11B 3M9HA 4AQRD 1YEAA 3C9IA 1SQVJ 5AW4B 1ZRTE 1C6RA 2JKVA 5B5EV 5EFWB 1A02F 1C52A 1BGYG 3KPEA 1J1DB 5CIFB 1N9CA 3CX5D 3H1LD 4YTPC 4I7ZC 3PRJA 3PXWA 1N7LA 2MHMA 4ZKUA 2HR3A 4O1QA 3CCUP 3WU2V 1RQUA 1KYOW 1L9BC 4WY4C 4WQ8A 3CC4P 2FFDC 1M1JC 1KX7A 4WQCA 1AOQA 1E8EA 2BH4X 3H32A 3A5TA 3GF3A 2M3EA 3KZIE 1OWAA 4EYYQ 1NAFA 1FZCA 5B5EH 1I6EA 1FDOA 1LWUA 1YTZI 2QJYC 1BL9A 1N7SD 5CHXA 1S5LH 4H44C 1LP1B 2H43A 3CXHI 4L76A 3A2AA 1K8AQ 5B66V 3G3ZA 2D0SA 4L1QA 5L8RJ 1IK9A 2BLFB 3VP9A 2DW3A 4IOIH 2JR8A 2LXCB 2OYIC 1PV3A 4MU8A 3HUSC 3A0BE 3G6EP 1PIXA 1DIIC 3B5NA 4EOTA 3WFBC 1SFCD 4ZKPA 351CA 1FHBA 2I8FA 4P4QB 2FYNC 2J5UA 3H1LE 2NZ2A 1LT9C 2IPPA 3CC7P 4OGQC 1W2BO 2HYNA 2E74D 2LR2A 3CXHH 1C2RA 5GTIE 3V2NA 2ZFCA 1NTKD 3AE1C 3OCDB 1DD3A 5DJQB 3W68A 1AYGA 1JO5A 4GT1A 2KS1B 1VF5D 5AW1B 2WSFJ 1LJ2A 3MZWB 2G3AA 2RKLA 2L5GB 3M06A 1JY3P 3S4RA 3QH9A 1EB7A 3L70J 1ZR4A 3RK2C 3WMM0 1HJ5A 1NKNA 1CIGA 3MTUE 2UWJE 4WBAA 2K37A 3HE5B 2E42A 3L72D 2GA1A 1X9VA 1YQ4C 1RE3A 1UIXA 5CICB 1NTZG 5APSA 2NPSD 1FZGA 3SFDC 4DZOA 1URQA 1VQOP 4H44B 2PP6A 1NTZK 4QMAA 3RK3D 3CPWO 1NYHA 1S6VB 1RF0C 4KHXA 5CCHA 3HQ9A 3H1IJ 3TK1A 2ZYDA 1KD1Q 2N3YA 1M1KQ 2Z5HA 1MUUA 1IRVA 3TNUB 2E76D 3CCRP 4A7PA 4I1LA 4RJTA 1DIPA 1SQQD 2L91A 5AVRB 1NTKE 4HYTB 1F1CA 4M3LA 5TISV 2FY8A 5KLIC 2YNYA 2GUVA 4PV1D 1WRGA 3CCSP 1NNOA 2YO2A 4UB8E 1IQCA 4FA4A 1USEA 2V7QH 3TSIA 2OYHC 1YQ3C 3PH0A 4W7YA 2N1TB 2ZXYA 1SQPJ 4AX3A 4EDFA 2QM8A 4IL6H 1VQMP 4JQ0D 1PP9D 3D6ZA 1OMIA 2YIUC 3HE4A 3JC22 1H1OA 2I1KA 1DH3A 1J3SA 4YXDC 1L0LJ 3L72E 3A0HV 1NMLA 3L71G 1CSUA 3DMIA 1EQ7A 2ZYAA 4BRYB 1DT1A 2NRGA 1SQBD 2JWDA 4EI2A 3H1HD 1LC1A 1LTBC 1VQ9P 5APVA 3CXHD 2KSEA 1CZQA 5APUA 1AQTA 5APYA 3RK3E 2J58A 1AVYA 1FOCA 1NIRA 2E75C 1L4AD 3M0DA 5AVVB 1NU1D 2RN0A 5M1BA 2KLUA 1CTZA 1A56A 1LP1A 1SQXD 3NMDA 1J1EB 3NFQA 4XFJA 1OW6A 2O01H 2GUSA 3LW5J 1SQVD 5KLVJ 5KAIE 4WQAA 1NAYA 3IF4A 2K3RA 1U7MA 1LTJA 3Q2YA 4K3AA 1H9XA 3RL0D 3V2PA 2OZ1B 4Y99C 3WFDC 2B0ZB 1IFIA 1CTYA 3RMZA 1JM0A 3KZIV 4OH8B 3BCCJ 1HGVA 2C0XA 1KYOI 3L74D 3SLEA 1D7MA 5KLIB 1PP9E 1YICA 2AEJA 1IFDA 2IBZG 4XE5B 1BE3E 1FCDC 1H31A 5B6QA 4L3GA 1CRHA 1P84D 1Y47A 1H89A 1NTMD 2FRCA 5CMZA 5KAFH 4H13B 1W2LA 3ZCFA 4I6MC 1CRJA 2Y9YA 5CBNA 1LNQA 4U3FG 2FYUE 4WY4A 4OGQD 2FFDA 3H1HE 1HWTC 1KYOH 1YFCA 1M1JA 3BRTB 1DW1A 3JCUH 1JY2O 3L35A 1HJ0A 1NTKJ 3KZIH 4IFMA 1H32A 2CA3B 1MKMA 2P1JA 1FBMA 3H32B 3O1YA 3ZOYA 5CIGB 1SQXE 3A7OA 1BCCD 1FZCB 5GTHE 4L3HA 5GTIV 2IFMA 2AIUA 1SQVE 3CI9A 2B4ZA 1EZVG 1IJDB 1FJ0A 2Y0CA 1E29A 1RZ5A 2KI7B 1WMKA 1SFCC 2QJPC 1NGMB 4GEDB 5IY51 2A06G 1K73Q 2PCBB 2CE0A 4PJ0E 3L72J 1OVRA 3D0WA 2XZRA 5E79E 3LIEA 2OYIA 3A0BH 3AEDC 4FB1A 3HUSA 3MK7C 1PZQA 2PRRA 3RBZA 1HUCA 1X8YA 2R32A 4Q5PA 3PP5A 1QLED 2ZVNB 2M3BA 1LT9A 1P84E 3L75G 2AXTE 1L0ND 3FX0A 2W8ZA 4PWAA 5EXQA 2D2CB 1VF5C 2BCCG 1KN7A 1RAPA 1CSVA 3USSA 2N1TA 1VQ5P 4NPFX 3CWBG 1SQQJ 3W67A 2RMZA 2R3SA 2BCNB 3RL0g 1FOSF 1MFTA 3E1RA 2IZ0A 2QE7H 1JB0J 3L73G 1OFCX 4W7ZA 4EIDA 4JF7A 3MP7B 2NPSC 2HLOA 3Q5SA 1ZMEC 3CLQA 1N7SB 1GDVA 4LJIA 1G1JA 1GL2D 2O1JA 3PH2B 3AEBC 1M8OB 3U59A 2OARA 3CMAP 1CXAA 2Q9IA 1KV9A 4PD4H 3WUVA 3RK3C 1QVFO 3H1ID 1NHLA 5H2FH 1CHIA 3MD0A 4JYCA 2OGUA 1ZZHA 4UB6E 2V07A 3NXSA 3CL3D 3JSVC 3I56P 3C8VA 2E76C 4UB8V 1A02J 2KIKA 2J59M 4XA4A 4FA1A 1JCDA 3M9QA 1SQBJ 1KQSO 1RF0A 1YTZT 1U7JA 2N18C 1PPJD 2JEEA 3CMEP 1CEDA 1L0NE 3AEEC 4FANA 1Q82Q 1NU1J 2OZ1A 4PV1C 3UIAA 2E74B 1IFMA 1DVVA 3A0HE 1K05A 1RY3A 2QRXA 1SQXJ 1WEJF 2FYZA 3L70E 1SQPD 1NH4A 2IBZI 1R0QA 1QL4A 2OTLP 4OVNF 2VRSA 1CRCA 1NOHA 4JBZA 1S9KD 1VF5B 1DEBA 1L0LD 1OAEA 1C6SA 1EXJA 1AJYA 1HH7A 2YCCA 1H88A 2OYHA 1KILD 3DP5A 2W83C 5AW2B 1DIQC 1KZUB 1NTZD 3L74J 1LC2A 1I54A 1IK7A 5C0ZA 3P32A 5KAIV 1KB9D 4LLHA 3H1KG 3WUTA 1CYCA 3HE4B 3AECC 1ZLLA 2M0BA 1CI6B 1YI2P 3WUIA 1GQ1A 1YYCA 5APWA 2NPSB 3H1IE 2B9BA 1L4AC 1FJKA 3EWKA 5AURA 1GTWA 1NTMJ 2LIRA 4IFDK 1EZVI 3TGUD 1MFZA 3RK3B 3WFCC 5KLVD 2WVRA 1BDDA 4H0LB 1SVFA 1KB0A 2Y0EA 4QAOA 1QL2A 2A45G 1LMSA 1H0TB 1PPJE 3RL0C 1DW2A 1GDTA 1BSNA 3HRNA 4I2LC 3MHVA 5CCGD 1JTHB 3CD6P 1SP4A 1R5SA 3BCCD 3WU2H 3ITKA 1F1FA 3L36A 2WPQA 3M9BA 1SQPE 1NJIQ 3SSUA 5AW7B 1BCCJ 2CXBA 3H1JD 2WSEJ 3PHLA 2V7QJ 1LFMA 1UIIA 3CX5W 1LTJB 2KYVA 1YIJP 1JUNA 1L0LE 3O0RC 1X0TA 2C9NY 4BWNA 1KILE 3CX5E 2EXVA 1BGYJ 3L71D 1JMBA 4EIEA 2OTJP 2C0WA 5GTHV 3O6QB 1Y9BA 3X39A 5BVZA 1KB9E 1T2KD 1E2RA 1TU3F 3HD7D 1OXZA 2ZYGA 3D71A 2MTAC 4DCKA 4I7ZB 1H31B 1QN2A 3I5CA 2IYPA 5B66H 4PJ0V 1L0NJ 3Q5RA 5E79V 2W27A 3D6YA 1A2SA 4KJMA 3TGUE 3CCLP 4EIJA 4WY4B 1H9YA 1I5TA 1N7SA 1WT6A 2FFDB 5KLVE 3CC2P 3GG2A 1M1JB 3K5BA 1N90A 1IRWA 4TT3H 2O01J 2Q3EA 4JYBA 3OA7A 1RE4C 1FZEA 2AXTV 1HH0A 4HKZH 3WFEC 3SJLA 1H32B 5GTHH 5CIBB 3BCCE 3H25A 2ZXXA 1K3HA 4D6TG 2QJYB 3KQGA 5CJ4A 1N73C 5AW8B 3H1JE 1L9JC 5APXA 3MGNA 3AE2C 1FAVA 1SFCA 2BASA 3C1LA 4DOJA 2QSIA 4PJ0H 3H1LG 3VMXA 1S5LX 2DVHA 3VMYA 1U57A 2KZJA 3VOPA 3AE5C 2ZJSE 4J20A 3E1IA 4GIFA 2OYIB 3HUSB 1GD2E 1M57D 4O1WA 5DFSA 4EICA 3F5HA 4U3FD 5AVWB 3PLNA 3M0AA 4GYDA 2FYNB 3ZBMA 2G8YA 1LT9B 2CK3H 4GODA 4UB6V 3PTZA 1KORA 3V6IA 4OGQB 1GU4A 1COTA 1OW7A 2XV5A 3V4WA 3CCVP 1T6AA 1KQGB 2ZXEB 1GL2C 2R5DA 3OW2O 5CJ0A 1S4XA 4NPEA 2YMKA 1MV8A 1Z56A 2GIWA 4WB4A 1CC5A 3HQ7A 1CSWA 1CI6A 3N4XA 3B71A 1ZR2A 2NPSA 1M7LA 3IR9A 2R44A 3CP5A 1AKKA 1HJBA 2A06D 2KXPB 3RK2B 1KQLA 5C9MA 2AI5A 1FJPA 5TJHA 3U1CA 1NMIA 2A45I 1NTZJ 2D0WA 1AOFA 4ZMDA 3P8MC 1S2EA 3JBTB 5TISH 3TDKA 1N73B 1XTGB 1VQ4P 1QVGO 1QX8A 1H0TA 2O1KA 1H33A 1CTJA 1HF9A 3L75D 1RHZB 1JTHA 4HH2A 1CORA 3IN6A 1JY3N 4O9BA 2WT7A 2BCCD 1NTKG 3TGUJ 1R8EA 1FI9A 4L74A 1SQQE 2JWAA 1JY2P 3G71P 1K04A 3OJAB 2A45H 3MUDC 1NTKK 3CWBD 2WSFH 3A0HH 1X22A 2ZONG 4JCGA 3B8EB 1BSHA 1QL3A 5KJ7D 1KILC 1S5LE 3L73D 3EFGA 2P67A 4C46A 2HPCA 3O6QA 1KQFB 3H1JJ 1I55A 3B4SA 3Q3DA 1KV4A 3L72G 1LTSC 2LXBA 2PFXA 1FS0E 2IFNA 3B5NC 1PGQA 3AE8C 1YCCA 2HFED 2KB7P 4K35A 3N7NA 2OYHB 1YIQA 3NBTA 1CXCA 1HGZA 1C6OA 1VYDA 2BH5X 1J2JB 2KOGA 3CXHW 3L71J 2YIUB 4IL6X 1SQBE 3Q1MA 1YJNP 5AVXB 1L4AA 3CXHE 2Z4EA 1CSXA 2P7JA 3R2PA 1CO6A 2B10B 4DJGA 3BATA 2C1DA 1OZHA 4Z1MH 1VQNP 1NU1E 3VYMA 3VTPC 1EDKA 1M70A 3L75E 5CCGC 1GK4A 1Y8AA 5AW5B 2KP8A 3GHGC 2AEFA 1DD4A 3ABVC 3PXSA 2PACA 1U74B 2O3JA 2E75B 1JEKA 1E5WA 3CCJP 2ITAA 1FZBA 1CIEA 1YTCA 1IFPA 3OA8A 2P10A 2PGDA 1YITP 1WVEC 1KIBA 3BRVB 5AVZB 2H89C 1BGYD 1FZAA 4AAMA 3PXTA 4YE1A 1MZ9A 4RO0A 2YMYA 1PP9G 3L74E 1ZV8A 3U1AA 1MZ4A 1BE3G 1URQC 2C1VA 1AA0A 1C2NA 1T2KC 1IC2A 4Y99B 2W6BA 3HD7C 3AEGC 3CX5H 5AVSB 2GM4A 3VYIA 2C1UA 3WUUA 2POHA 1PGPA 3SXTA 1EDIA 1NTME 1YNRA 2FYUG 2Q5UA 3SWYA 3H1HG 5GTIH 1AV1A 3CYTI 4PD4I 1RF1C 1VQ8P 5CBOA 2FYUK 1HCMA 4DY9A 4U3FJ 3SWKA 2XU6A 1CRIA 4PW9B 3NWVA 1SQXG 2WTYA 5CYTR 1QL1A 1OIPA 3L37A 3LW5H 1FI7A 3V4QA 1Q81Q 1RZ6A 1J1DC 1SQVG 1BCCE 1SQXK 1W5CE 2B89A 1HJ4A 4Y5RA 4TLFA 2ZAEB 1GIWA 3HQ6A 1RE4A 451CA 1KTMA 2W90A 1SQVK 4IL6E 2WSCH 5AW3B 3L4OA 1LTAC 1N73A 2CPBA 3AE9C 2WPSA 1BGYE 4H13D 3V2QA 2KNCA 1NWQA 1YJWP 4HB1A 1HROA 3TYYA 2QVAA 2E5TA 4XXLA 1KC8Q 1SFCB 2QJPB 1KYOD 1DW3A 2FWLA 2GC7D 3T97A 2O01N 2M5AB 3WC8A 1RAQA 3FGAD 3MK7B 2OYOA 2I8DA 5K5GB 3L75J 3TF5A 2FXOA 1I8PA 1M56D 4Y28J 1EDLA 1LS9A 2WITA 2BCCJ 3ZDMA 4DT0A 2R3CA 1K9MQ 1G2CB 5APTA 2M8RA 2QJKC 5AW9B 2JO1A 2KUBA 3KDPB 1C7MA 4RKUJ 1S3JA 3CWBJ 1FE6A 1VQLP 4UB8H 2B87A 1GL2A 2WWWA 3DR0A 3F89A 2WPVB 1KX2A 4N3YB 2V4HA 3L73J 1N2DC 4D6TD 4R4MA 2JP3A 5AW0B 4WQ7A 4WVZA 4ASVA 4FA9A 1S1CX 4RESB 4GDOA 3RN1A 4AUWA 1CW5A 1I8OA 3B5ND 3IAOA 1EC5A 3AEAC 5DF5A 5DJQC 1S5LV 3GMAA 2PAJA 1ZN5A 4WQEA 5KAFE 4ZNCA 1LT1A 2ORLA 2D2CD 1QYZA 1IO3A 1C75A 1L0NG 1JMMA 1KYOE 2AXCA 3JCUE 3EFFK 1N15A 1H33B 2CE1A 2E76B 3G9RA 5KJ7C 3L70G 1L0NK 2XDJA 2FKWB 5KAIH 5BU5A 2WT7B 2N18B 3FWLA 3G4SP 4LC1A 3MUDA 1FU1A 1SS1A 1Q86Q 2E43A 4PV1B 1ZW0A 1S9KE 1KILA 4PD4D 2MJZA 1OVVA 1W5CT 1KFNA 3II6A 2YKQA 2OQQA 1VPCA 4WQDA 1NO4A 1MG2D 2GC4D 3SWSA 4D6TE 1CNOA 1NTZE 1B7VA 2QJKB 2HPCB 1URQD 1PGJA 1OCDA 3H1IG 4W80A 3CCEP 3L4FA 1S72P 2B12B 4WQBA 2K1AA 1HBWA 4C7NA 1U75B 3H1KJ 4LGDE 1GW4A 1LTIC 5CCHD 1FC2C 3FXDA 5KTBA 3RLMA 2R5BA 1FDIA 2W6JH 1M90Q 1BDCA 3AE6C 1JCCA 1HTLC 1HZVA 1PPJG 1L4AB 2N1TC 2K9JA 1FI3A 1LTGC 2ZT9D 3VN0A 5CCGA 2C1DB 2ZOOA 3GHGA 3HTKA 1SQPG 1USDA 2SPZA 1YEBA 3KHUA 1ZP0C 1P84I 2CA4B 1DW0A 1PL5A 3A9FA 1JNMA 2QM7A 1SQPK 1OVUA 1T3UA 2C9XB 1L0LG 3D70A 3RL0B 2AEMA 5AVYB 4RSZA 4BXLA 1AQ5A 3OA8B 3V2RA 4PD4E 5E79H 2IBZD 1L0LK 3QWOC 5DJUB 5H2FE 2M5AA 2WSSH 4N78D 3L71E 3BVHA 4B86A 1ZXGA 1M60A 2B88A 3HD7A 4AANA 1CHHA 2C8SA 4HJGH 1J1EC 1IZL0 2XNDH 3SVWA 2YXQB 3E7KA 4H0JA 4MN4C 1P84H 2KLVA 2HODA 4K3IA 2AXTH 2BGVX 4IL6V 3GW6A 3IFMA 3VMAA 2H7HA 1YJ9P 5AVUB 1G2CA 4H0LD 1DX7A 1GJQA 2BPBB 2HV4A 2KZIA 3PJSK 2RH0A 1YBKA 2YK3A 3EQ2A 3TGUG 1KFMA 1RF1A 2WMMA 5KLVG 1GW3A 3CCMP 1YHQP 155CA 1T3JA 1CIHA 1JY3O 2V08A 2Q7CA 5AW6B 5KLVK 1CSBA 1L2PA 3AE7C 2QEXP 5DJTB 3C2CA 3BCCG 1EZVD 4JPZB 1CRYA 2WSEH 1RQVA 3H1JG 1LTTC 3M97X 1FOSE 4H13C 1GZLA 2Y9ZA 3VRDA 2Z5IA 3R4YA 3M91A 4D6TJ 1VDFA 2KK7A 3P7KA 1BE3D 3KYQA 3P8CD 4UB6H 2ZZS1 5AVTB 1CYJA 2FBWC 2N9YB 2IYOA 1DEEG 2IBZE 3SFEC 3I55P 2WZ7A 3H1LJ 4N78E 1IFNA 1VQPP 4CPGA 2L4DA 2H88C 2FYUD 2QA4P 2YKOA 2KNCB 3OAKA 4EIFA 3VMZA 2YQBA 1FZCC 4GKGA 1GKSA 4U3FE 2C2CA 1GU5A 4WY4D 2H8PD 1LWUC 4U7JA 1EXIA 1PFIA 1HVVA 5B5EE 1QEXA
chains in the Genus database with same CATH topology
1DIQC 1YNRA 1NTZD 1LC2A 1CIGA 1I54A 5CIDB 5C0ZA 1I6DA 5KAIV 2N9JA 1KB9D 3CYTI 1CYCA 5KAFV 1HRCA 3L72D 3O20A 3WUIA 1GQ1A 2XTSB 1HCMA 4DY9A 5CICB 3O5CA 5AURA 1CRIA 4PW9B 3NWVA 2N3BA 2LIRA 5CYTR 3TGUD 1FI7A 3ZOXA 1RZ6A 2JQRA 3WFCC 5KLVD 2JTIB 1CCHA 1S6VB 3HQ9A 1KB0A 2Y0EA 4QAOA 1HJ4A 4Y5RA 1GIWA 3HQ6A 1LMSA 2N3YA 451CA 1IRVA 1DW2A 2QG4A 3BCCD 4A7PA 3L4OA 4RJTA 3ITKA 1F1FA 1ETPA 3OCDA 1SQQD 2L91A 2CXBA 1QKSA 3H1JD 3NBSA 1F1CA 4KMGA 1HROA 5TISV 4FAVA 2KS1A 3PHLA 1LFMA 4XXLA 3CX5W 1CIFA 2ZBOA 2QJPB 3O0RC 1NNOA 1KYOD 3A0BV 1DW3A 1IQCA 2FWLA 4FA4A 2GC7D 2EXVA 2ZXYA 4AX3A 4EDFA 3L71D 3WC8A 4EIEA 1RAQA 5GTHV 1PP9D 3MK7B 3TF5A 3X39A 1H1OA 1I8PA 1J3SA 1E2RA 1LS9A 2MTAC 4N0KA 3A0HV 1H31B 1NMLA 3HQ8A 4AAOA 1CSUA 1QN2A 2PCCB 3DMIA 4PJ0V 1M6ZA 1DT1A 1N50A 1SQBD 5E79V 2N9IA 1C7MA 3H1HD 1LC1A 1A2SA 3CXHD 3H1KD 1H9YA 1I5TA 1JDLA 3DR0A 1FOCA 1KX2A 1NIRA 3GG2A 1N90A 1NU1D 1IRWA 4D6TD 2RN0A 2Q3EA 4WQ7A 3ZIYA 1CTZA 4FA9A 1A56A 2AXTV 1K3GA 5CIEB 1SQXD 3WFEC 3SJLA 1H32B 3RN1A 5CIBB 3RN0A 1K3HA 1I8OA 2QJYB 3VNWA 1CRGA 1SQVD 4FA5A 5DF5A 4WQAA 5DJQC 1S5LV 4V2KA 4WQEA 4AALA 1HZUA 1L9JC 3ZOWA 2ORLA 5H2FV 1H9XA 1QYZA 4H0KA 2OZ1B 3WFDC 2B0ZB 1IO3A 3L70D 1CTYA 3RMZA 1C75A 3KZIV 1CHJA 2DVHA 3L74D 3SLEA 1ZRTD 2K9JB 1N15A 1H33B 2CE1A 2LITA 4J20A 5KLIB 3L4MA 1YICA 4O1WA 5DFSA 4EICA 3TYIA 1FCDC 4U3FD 1H31A 5B6QA 2DGEA 4L3GA 2N18B 1CRHA 1P84D 3PLNA 1NTMD 2FRCA 4GYDA 2FYNB 4WQ9A 3ZBMA 3FWLA 1W2LA 3ZCFA 1A8CA 4UB6V 4XYDB 1CRJA 3ORVA 3PTZA 1CYIA 1COTA 4PD4D 1YFCA 1W5CT 1DW1A 1DVHA 5CIHB 4WQDA 1MG2D 2GC4D 3SWSA 1CNOA 1B7VA 2GIWA 2QJKB 1CC5A 1H32A 2CA3B 3HQ7A 3ZOOA 1CSWA 1OCDA 3O1YA 3ZOYA 5CIGB 1BCCD 3CP5A 2B12B 1AKKA 1CCRA 1HJ3A 4WQBA 1GU2A 2A06D 1U75B 4L3HA 5GTIV 5C9MA 2AI5A 2AIUA 2B4ZA 5TJHA 1FJ0A 3RLMA 1NMIA 2Y0CA 1E29A 1RZ5A 2D0WA 1AOFA 2Y0DA 5KKZB 3JBTB 4GEDB 5IY51 1MG3D 2PCBB 4NFGB 3TDKA 2CE0A 2GB8B 1HZVA 2VHDA 3CU4A 1FI3A 1H33A 1CTJA 2B11B 1YEAA 2C1DB 3L75D 4FB1A 2ZOOA 3MK7C 1C6RA 5B5EV 1CORA 1C52A 2BCCD 4Q5PA 5CIFB 1YEBA 1N9CA 3KHUA 1FI9A 3CX5D 3H1LD 2CA4B 3PRJA 2JWAA 3PXWA 1DW0A 1L0ND 3A9FA 2MHMA 4PWAA 3CWBD 2C9XB 5EXQA 2ZONG 4O1QA 4JCGA 3WU2V 4RSZA 1RAPA 1QL3A 1KYOW 3OA8B 1L9BC 1CSVA 4WQ8A 3L73D 2IBZD 1KX7A 2RMZA 2BCNB 4WQCA 1AOQA 1E8EA 2BH4X 1I55A 1M60A 4AANA 1CHHA 2C8SA 1IZL0 4EIDA 3SVWA 4H0JA 1I6EA 4K3IA 2BGVX 4IL6V 3GW6A 3VMAA 1YCCA 1YIQA 1BL9A 1GDVA 4LJIA 1GJQA 3PH2B 2BPBB 2HV4A 3NBTA 1CXCA 1C6OA 1VYDA 2YK3A 2BH5X 1CXAA 3CXHW 1KV9A 2YIUB 155CA 3H1ID 1CIHA 1CHIA 1CSXA 1ZZHA 1CO6A 2B10B 5B66V 2V07A 2C1DA 2V08A 2D0SA 4L1QA 2BLFB 3VYMA 4UB8V 1M70A 4MU8A 3C2CA 1EZVD 1CRYA 1DIIC 4FA1A 3WFBC 351CA 1FHBA 3PXSA 2N18C 2PACA 2I8FA 1U74B 4P4QB 2O3JA 3M97X 1PPJD 1CEDA 3VRDA 4FANA 2OZ1A 1CIEA 1YTCA 3OA8A 1BE3D 1DVVA 1C2RA 1WVEC 1KIBA 2ZZS1 1CYJA 1WEJF 1SQPD 2N9YB 1NTKD 1BGYD 1R0QA 1QL4A 3PXTA 4AAMA 4YE1A 3OCDB 1CRCA 5DJQB 1MZ4A 1AYGA 2L4DA 2C1VA 2FYUD 2KNCB 1C2NA 1L0LD 1OAEA 4EIFA 1C6SA 2YQBA 1HH7A 2YCCA 2C1UA 1GKSA 3DP5A 2C2CA 1EB7A 3SXTA 1HJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DIQ C;  1YNR A;  1NTZ D;  1LC2 A;  1CIG A;  1I54 A;  5CID B;  5C0Z A;  1I6D A;  5KAI V;  2N9J A;  1KB9 D;  3CYT I;  1CYC A;  5KAF V;  1HRC A;  3L72 D;  3O20 A;  3WUI A;  1GQ1 A;  2XTS B;  1HCM A;  4DY9 A;  5CIC B;  3O5C A;  5AUR A;  1CRI A;  4PW9 B;  3NWV A;  2N3B A;  2LIR A;  5CYT R;  3TGU D;  1FI7 A;  3ZOX A;  1RZ6 A;  2JQR A;  3WFC C;  5KLV D;  2JTI B;  1CCH A;  1S6V B;  3HQ9 A;  1KB0 A;  2Y0E A;  4QAO A;  1HJ4 A;  4Y5R A;  1GIW A;  3HQ6 A;  1LMS A;  2N3Y A;  451C A;  1IRV A;  1DW2 A;  2QG4 A;  3BCC D;  4A7P A;  3L4O A;  4RJT A;  3ITK A;  1F1F A;  1ETP A;  3OCD A;  1SQQ D;  2L91 A;  2CXB A;  1QKS A;  3H1J D;  3NBS A;  1F1C A;  4KMG A;  1HRO A;  5TIS V;  4FAV A;  2KS1 A;  3PHL A;  1LFM A;  4XXL A;  3CX5 W;  1CIF A;  2ZBO A;  2QJP B;  3O0R C;  1NNO A;  1KYO D;  3A0B V;  1DW3 A;  1IQC A;  2FWL A;  4FA4 A;  2GC7 D;  2EXV A;  2ZXY A;  4AX3 A;  4EDF A;  3L71 D;  3WC8 A;  4EIE A;  1RAQ A;  5GTH V;  1PP9 D;  3MK7 B;  3TF5 A;  3X39 A;  1H1O A;  1I8P A;  1J3S A;  1E2R A;  1LS9 A;  2MTA C;  4N0K A;  3A0H V;  1H31 B;  1NML A;  3HQ8 A;  4AAO A;  1CSU A;  1QN2 A;  2PCC B;  3DMI A;  4PJ0 V;  1M6Z A;  1DT1 A;  1N50 A;  1SQB D;  5E79 V;  2N9I A;  1C7M A;  3H1H D;  1LC1 A;  1A2S A;  3CXH D;  3H1K D;  1H9Y A;  1I5T A;  1JDL A;  3DR0 A;  1FOC A;  1KX2 A;  1NIR A;  3GG2 A;  1N90 A;  1NU1 D;  1IRW A;  4D6T D;  2RN0 A;  2Q3E A;  4WQ7 A;  3ZIY A;  1CTZ A;  4FA9 A;  1A56 A;  2AXT V;  1K3G A;  5CIE B;  1SQX D;  3WFE C;  3SJL A;  1H32 B;  3RN1 A;  5CIB B;  3RN0 A;  1K3H A;  1I8O A;  2QJY B;  3VNW A;  1CRG A;  1SQV D;  4FA5 A;  5DF5 A;  4WQA A;  5DJQ C;  1S5L V;  4V2K A;  4WQE A;  4AAL A;  1HZU A;  1L9J C;  3ZOW A;  2ORL A;  5H2F V;  1H9X A;  1QYZ A;  4H0K A;  2OZ1 B;  3WFD C;  2B0Z B;  1IO3 A;  3L70 D;  1CTY A;  3RMZ A;  1C75 A;  3KZI V;  1CHJ A;  2DVH A;  3L74 D;  3SLE A;  1ZRT D;  2K9J B;  1N15 A;  1H33 B;  2CE1 A;  2LIT A;  4J20 A;  5KLI B;  3L4M A;  1YIC A;  4O1W A;  5DFS A;  4EIC A;  3TYI A;  1FCD C;  4U3F D;  1H31 A;  5B6Q A;  2DGE A;  4L3G A;  2N18 B;  1CRH A;  1P84 D;  3PLN A;  1NTM D;  2FRC A;  4GYD A;  2FYN B;  4WQ9 A;  3ZBM A;  3FWL A;  1W2L A;  3ZCF A;  1A8C A;  4UB6 V;  4XYD B;  1CRJ A;  3ORV A;  3PTZ A;  1CYI A;  1COT A;  4PD4 D;  1YFC A;  1W5C T;  1DW1 A;  1DVH A;  5CIH B;  4WQD A;  1MG2 D;  2GC4 D;  3SWS A;  1CNO A;  1B7V A;  2GIW A;  2QJK B;  1CC5 A;  1H32 A;  2CA3 B;  3HQ7 A;  3ZOO A;  1CSW A;  1OCD A;  3O1Y A;  3ZOY A;  5CIG B;  1BCC D;  3CP5 A;  2B12 B;  1AKK A;  1CCR A;  1HJ3 A;  4WQB A;  1GU2 A;  2A06 D;  1U75 B;  4L3H A;  5GTI V;  5C9M A;  2AI5 A;  2AIU A;  2B4Z A;  5TJH A;  1FJ0 A;  3RLM A;  1NMI A;  2Y0C A;  1E29 A;  1RZ5 A;  2D0W A;  1AOF A;  2Y0D A;  5KKZ B;  3JBT B;  4GED B;  5IY5 1;  1MG3 D;  2PCB B;  4NFG B;  3TDK A;  2CE0 A;  2GB8 B;  1HZV A;  2VHD A;  3CU4 A;  1FI3 A;  1H33 A;  1CTJ A;  2B11 B;  1YEA A;  2C1D B;  3L75 D;  4FB1 A;  2ZOO A;  3MK7 C;  1C6R A;  5B5E V;  1COR A;  1C52 A;  2BCC D;  4Q5P A;  5CIF B;  1YEB A;  1N9C A;  3KHU A;  1FI9 A;  3CX5 D;  3H1L D;  2CA4 B;  3PRJ A;  2JWA A;  3PXW A;  1DW0 A;  1L0N D;  3A9F A;  2MHM A;  4PWA A;  3CWB D;  2C9X B;  5EXQ A;  2ZON G;  4O1Q A;  4JCG A;  3WU2 V;  4RSZ A;  1RAP A;  1QL3 A;  1KYO W;  3OA8 B;  1L9B C;  1CSV A;  4WQ8 A;  3L73 D;  2IBZ D;  1KX7 A;  2RMZ A;  2BCN B;  4WQC A;  1AOQ A;  1E8E A;  2BH4 X;  1I55 A;  1M60 A;  4AAN A;  1CHH A;  2C8S A;  1IZL 0;  4EID A;  3SVW A;  4H0J A;  1I6E A;  4K3I A;  2BGV X;  4IL6 V;  3GW6 A;  3VMA A;  1YCC A;  1YIQ A;  1BL9 A;  1GDV A;  4LJI A;  1GJQ A;  3PH2 B;  2BPB B;  2HV4 A;  3NBT A;  1CXC A;  1C6O A;  1VYD A;  2YK3 A;  2BH5 X;  1CXA A;  3CXH W;  1KV9 A;  2YIU B;  155C A;  3H1I D;  1CIH A;  1CHI A;  1CSX A;  1ZZH A;  1CO6 A;  2B10 B;  5B66 V;  2V07 A;  2C1D A;  2V08 A;  2D0S A;  4L1Q A;  2BLF B;  3VYM A;  4UB8 V;  1M70 A;  4MU8 A;  3C2C A;  1EZV D;  1CRY A;  1DII C;  4FA1 A;  3WFB C;  351C A;  1FHB A;  3PXS A;  2N18 C;  2PAC A;  2I8F A;  1U74 B;  4P4Q B;  2O3J A;  3M97 X;  1PPJ D;  1CED A;  3VRD A;  4FAN A;  2OZ1 A;  1CIE A;  1YTC A;  3OA8 A;  1BE3 D;  1DVV A;  1C2R A;  1WVE C;  1KIB A;  2ZZS 1;  1CYJ A;  1WEJ F;  1SQP D;  2N9Y B;  1NTK D;  1BGY D;  1R0Q A;  1QL4 A;  3PXT A;  4AAM A;  4YE1 A;  3OCD B;  1CRC A;  5DJQ B;  1MZ4 A;  1AYG A;  2L4D A;  2C1V A;  2FYU D;  2KNC B;  1C2N A;  1L0L D;  1OAE A;  4EIF A;  1C6S A;  2YQB A;  1HH7 A;  2YCC A;  2C1U A;  1GKS A;  3DP5 A;  2C2C A;  1EB7 A;  3SXT A;  1HJ5 A; 
#chains in the Genus database with same CATH topology
 3T97 B;  2XKM A;  4YPC A;  5CID B;  1I6D A;  3CCQ P;  2N9J A;  3GF7 A;  5KAF V;  1HRC A;  3O20 A;  2XTS B;  2FXP A;  1AFO A;  1RH5 B;  4WWI A;  3WU2 E;  3O5C A;  1X79 B;  3H6P A;  2N3B A;  5AVQ B;  4YXW H;  4GOF A;  4L75 A;  1EZV E;  4H44 D;  3ZOX A;  2JQR A;  2OTK E;  2WPR A;  2JTI B;  1CCH A;  2B87 B;  4ASW A;  2JDI H;  2WSC J;  1GL2 B;  2IX7 C;  2W6A A;  2A06 E;  2XNX A;  5BU8 B;  2D2C C;  1JOC A;  2WQY C;  2QG4 A;  2E5Y A;  2FXM A;  3P8C E;  3BAS A;  3RGU A;  3OCD A;  1ETP A;  2LKM A;  1R5L A;  2I1J A;  1QKS A;  2IDB A;  3NBS A;  2Q3I A;  4KMG A;  1AVO A;  4FAV A;  2KS1 A;  2QIW A;  3FWN A;  5B66 E;  4GOE A;  1CIF A;  2ZBO A;  1EDJ A;  1SLQ A;  1SQQ G;  2K9Y A;  1GMJ A;  2BCC E;  4IFF A;  3CX5 I;  3A0B V;  1N7S C;  2BEQ D;  2N1T D;  3LID A;  1ZOY C;  5KJ7 A;  1SQQ K;  1H8A A;  3CWB E;  3HE5 A;  2P2U A;  3AEF C;  1KB9 I;  3NTN A;  1FDM A;  3VP8 A;  3L73 E;  4N0K A;  1LWU B;  1RE3 C;  3HQ8 A;  4AAO A;  3RK2 D;  2PCC B;  1M6Z A;  1N50 A;  2ZVO B;  2N9I A;  4OWF A;  2MKV A;  1NVO A;  1KIL B;  3H1K D;  3RBX A;  1JDL A;  2KSJ A;  5CCH C;  2N9B A;  1Q2N A;  3TNU A;  1SQB G;  4R4L A;  3ZIY A;  2E74 C;  1KB9 H;  1VQK P;  1OX3 A;  1K3G A;  1GK6 A;  5CIE B;  5KKZ C;  1W2E A;  3RN0 A;  1JY2 N;  2YKP A;  1SQB K;  3B5N B;  1NU1 G;  2ZT9 C;  2JJL A;  5APQ A;  3VNW A;  1CRG A;  4FA5 A;  1IO4 A;  4V2K A;  4C7N B;  1Q90 D;  4AAL A;  1HZU A;  2HG5 D;  3ZOW A;  5H2F V;  1N8R Q;  1Q7Y Q;  3Q5P A;  2C9L Y;  1NU1 K;  4H0K A;  1VQ6 P;  1VQ7 P;  3L70 D;  1NKZ B;  1QGK B;  3AE4 C;  2Q6Q A;  1IZN B;  1IFJ A;  3FXE A;  4N6J A;  1CHJ A;  4C7R A;  2IZ1 A;  2CPS A;  1ZRT D;  1KMI Z;  1PGO A;  2K9J B;  3MIW A;  2LIT A;  3GHG B;  3L4M A;  1LGH B;  3TYI A;  3HTK B;  3L74 G;  5C39 A;  2DGE A;  3AE3 C;  4L73 A;  4WQ9 A;  2P58 A;  4BRY A;  1N86 A;  1A8C A;  3O8Z A;  4XYD B;  3ORV A;  1T8Z A;  1CYI A;  1E79 H;  1PP9 J;  1XTC C;  2Q1K A;  1BE3 J;  1NTM G;  4H0L C;  3H1K E;  3KXD A;  5TIS E;  1DVH A;  5CIH B;  3V5B A;  2BEZ F;  3S9O A;  3M0D C;  1URQ B;  3GLM A;  1NTM K;  3ZOO A;  4NPD A;  4AYC A;  2FYU J;  3HD7 B;  3SWF A;  3H1H J;  1CCR A;  1HJ3 A;  1GU2 A;  2HOD B;  1OW8 A;  2E75 D;  2YO3 A;  3S1K A;  2K88 A;  1G1I A;  2Y0D A;  5KKZ B;  1BCC G;  1LTJ C;  4KT0 J;  1RF1 B;  1FZF A;  1MG3 D;  3A3Y B;  4NFG B;  2GB8 B;  2ZT9 B;  2VHD A;  3CU4 A;  2YXR B;  1VL2 A;  2B11 B;  3M9H A;  4AQR D;  1YEA A;  3C9I A;  1SQV J;  5AW4 B;  1ZRT E;  1C6R A;  2JKV A;  5B5E V;  5EFW B;  1A02 F;  1C52 A;  1BGY G;  3KPE A;  1J1D B;  5CIF B;  1N9C A;  3CX5 D;  3H1L D;  4YTP C;  4I7Z C;  3PRJ A;  3PXW A;  1N7L A;  2MHM A;  4ZKU A;  2HR3 A;  4O1Q A;  3CCU P;  3WU2 V;  1RQU A;  1KYO W;  1L9B C;  4WY4 C;  4WQ8 A;  3CC4 P;  2FFD C;  1M1J C;  1KX7 A;  4WQC A;  1AOQ A;  1E8E A;  2BH4 X;  3H32 A;  3A5T A;  3GF3 A;  2M3E A;  3KZI E;  1OWA A;  4EYY Q;  1NAF A;  1FZC A;  5B5E H;  1I6E A;  1FDO A;  1LWU A;  1YTZ I;  2QJY C;  1BL9 A;  1N7S D;  5CHX A;  1S5L H;  4H44 C;  1LP1 B;  2H43 A;  3CXH I;  4L76 A;  3A2A A;  1K8A Q;  5B66 V;  3G3Z A;  2D0S A;  4L1Q A;  5L8R J;  1IK9 A;  2BLF B;  3VP9 A;  2DW3 A;  4IOI H;  2JR8 A;  2LXC B;  2OYI C;  1PV3 A;  4MU8 A;  3HUS C;  3A0B E;  3G6E P;  1PIX A;  1DII C;  3B5N A;  4EOT A;  3WFB C;  1SFC D;  4ZKP A;  351C A;  1FHB A;  2I8F A;  4P4Q B;  2FYN C;  2J5U A;  3H1L E;  2NZ2 A;  1LT9 C;  2IPP A;  3CC7 P;  4OGQ C;  1W2B O;  2HYN A;  2E74 D;  2LR2 A;  3CXH H;  1C2R A;  5GTI E;  3V2N A;  2ZFC A;  1NTK D;  3AE1 C;  3OCD B;  1DD3 A;  5DJQ B;  3W68 A;  1AYG A;  1JO5 A;  4GT1 A;  2KS1 B;  1VF5 D;  5AW1 B;  2WSF J;  1LJ2 A;  3MZW B;  2G3A A;  2RKL A;  2L5G B;  3M06 A;  1JY3 P;  3S4R A;  3QH9 A;  1EB7 A;  3L70 J;  1ZR4 A;  3RK2 C;  3WMM 0;  1HJ5 A;  1NKN A;  1CIG A;  3MTU E;  2UWJ E;  4WBA A;  2K37 A;  3HE5 B;  2E42 A;  3L72 D;  2GA1 A;  1X9V A;  1YQ4 C;  1RE3 A;  1UIX A;  5CIC B;  1NTZ G;  5APS A;  2NPS D;  1FZG A;  3SFD C;  4DZO A;  1URQ A;  1VQO P;  4H44 B;  2PP6 A;  1NTZ K;  4QMA A;  3RK3 D;  3CPW O;  1NYH A;  1S6V B;  1RF0 C;  4KHX A;  5CCH A;  3HQ9 A;  3H1I J;  3TK1 A;  2ZYD A;  1KD1 Q;  2N3Y A;  1M1K Q;  2Z5H A;  1MUU A;  1IRV A;  3TNU B;  2E76 D;  3CCR P;  4A7P A;  4I1L A;  4RJT A;  1DIP A;  1SQQ D;  2L91 A;  5AVR B;  1NTK E;  4HYT B;  1F1C A;  4M3L A;  5TIS V;  2FY8 A;  5KLI C;  2YNY A;  2GUV A;  4PV1 D;  1WRG A;  3CCS P;  1NNO A;  2YO2 A;  4UB8 E;  1IQC A;  4FA4 A;  1USE A;  2V7Q H;  3TSI A;  2OYH C;  1YQ3 C;  3PH0 A;  4W7Y A;  2N1T B;  2ZXY A;  1SQP J;  4AX3 A;  4EDF A;  2QM8 A;  4IL6 H;  1VQM P;  4JQ0 D;  1PP9 D;  3D6Z A;  1OMI A;  2YIU C;  3HE4 A;  3JC2 2;  1H1O A;  2I1K A;  1DH3 A;  1J3S A;  4YXD C;  1L0L J;  3L72 E;  3A0H V;  1NML A;  3L71 G;  1CSU A;  3DMI A;  1EQ7 A;  2ZYA A;  4BRY B;  1DT1 A;  2NRG A;  1SQB D;  2JWD A;  4EI2 A;  3H1H D;  1LC1 A;  1LTB C;  1VQ9 P;  5APV A;  3CXH D;  2KSE A;  1CZQ A;  5APU A;  1AQT A;  5APY A;  3RK3 E;  2J58 A;  1AVY A;  1FOC A;  1NIR A;  2E75 C;  1L4A D;  3M0D A;  5AVV B;  1NU1 D;  2RN0 A;  5M1B A;  2KLU A;  1CTZ A;  1A56 A;  1LP1 A;  1SQX D;  3NMD A;  1J1E B;  3NFQ A;  4XFJ A;  1OW6 A;  2O01 H;  2GUS A;  3LW5 J;  1SQV D;  5KLV J;  5KAI E;  4WQA A;  1NAY A;  3IF4 A;  2K3R A;  1U7M A;  1LTJ A;  3Q2Y A;  4K3A A;  1H9X A;  3RL0 D;  3V2P A;  2OZ1 B;  4Y99 C;  3WFD C;  2B0Z B;  1IFI A;  1CTY A;  3RMZ A;  1JM0 A;  3KZI V;  4OH8 B;  3BCC J;  1HGV A;  2C0X A;  1KYO I;  3L74 D;  3SLE A;  1D7M A;  5KLI B;  1PP9 E;  1YIC A;  2AEJ A;  1IFD A;  2IBZ G;  4XE5 B;  1BE3 E;  1FCD C;  1H31 A;  5B6Q A;  4L3G A;  1CRH A;  1P84 D;  1Y47 A;  1H89 A;  1NTM D;  2FRC A;  5CMZ A;  5KAF H;  4H13 B;  1W2L A;  3ZCF A;  4I6M C;  1CRJ A;  2Y9Y A;  5CBN A;  1LNQ A;  4U3F G;  2FYU E;  4WY4 A;  4OGQ D;  2FFD A;  3H1H E;  1HWT C;  1KYO H;  1YFC A;  1M1J A;  3BRT B;  1DW1 A;  3JCU H;  1JY2 O;  3L35 A;  1HJ0 A;  1NTK J;  3KZI H;  4IFM A;  1H32 A;  2CA3 B;  1MKM A;  2P1J A;  1FBM A;  3H32 B;  3O1Y A;  3ZOY A;  5CIG B;  1SQX E;  3A7O A;  1BCC D;  1FZC B;  5GTH E;  4L3H A;  5GTI V;  2IFM A;  2AIU A;  1SQV E;  3CI9 A;  2B4Z A;  1EZV G;  1IJD B;  1FJ0 A;  2Y0C A;  1E29 A;  1RZ5 A;  2KI7 B;  1WMK A;  1SFC C;  2QJP C;  1NGM B;  4GED B;  5IY5 1;  2A06 G;  1K73 Q;  2PCB B;  2CE0 A;  4PJ0 E;  3L72 J;  1OVR A;  3D0W A;  2XZR A;  5E79 E;  3LIE A;  2OYI A;  3A0B H;  3AED C;  4FB1 A;  3HUS A;  3MK7 C;  1PZQ A;  2PRR A;  3RBZ A;  1HUC A;  1X8Y A;  2R32 A;  4Q5P A;  3PP5 A;  1QLE D;  2ZVN B;  2M3B A;  1LT9 A;  1P84 E;  3L75 G;  2AXT E;  1L0N D;  3FX0 A;  2W8Z A;  4PWA A;  5EXQ A;  2D2C B;  1VF5 C;  2BCC G;  1KN7 A;  1RAP A;  1CSV A;  3USS A;  2N1T A;  1VQ5 P;  4NPF X;  3CWB G;  1SQQ J;  3W67 A;  2RMZ A;  2R3S A;  2BCN B;  3RL0 g;  1FOS F;  1MFT A;  3E1R A;  2IZ0 A;  2QE7 H;  1JB0 J;  3L73 G;  1OFC X;  4W7Z A;  4EID A;  4JF7 A;  3MP7 B;  2NPS C;  2HLO A;  3Q5S A;  1ZME C;  3CLQ A;  1N7S B;  1GDV A;  4LJI A;  1G1J A;  1GL2 D;  2O1J A;  3PH2 B;  3AEB C;  1M8O B;  3U59 A;  2OAR A;  3CMA P;  1CXA A;  2Q9I A;  1KV9 A;  4PD4 H;  3WUV A;  3RK3 C;  1QVF O;  3H1I D;  1NHL A;  5H2F H;  1CHI A;  3MD0 A;  4JYC A;  2OGU A;  1ZZH A;  4UB6 E;  2V07 A;  3NXS A;  3CL3 D;  3JSV C;  3I56 P;  3C8V A;  2E76 C;  4UB8 V;  1A02 J;  2KIK A;  2J59 M;  4XA4 A;  4FA1 A;  1JCD A;  3M9Q A;  1SQB J;  1KQS O;  1RF0 A;  1YTZ T;  1U7J A;  2N18 C;  1PPJ D;  2JEE A;  3CME P;  1CED A;  1L0N E;  3AEE C;  4FAN A;  1Q82 Q;  1NU1 J;  2OZ1 A;  4PV1 C;  3UIA A;  2E74 B;  1IFM A;  1DVV A;  3A0H E;  1K05 A;  1RY3 A;  2QRX A;  1SQX J;  1WEJ F;  2FYZ A;  3L70 E;  1SQP D;  1NH4 A;  2IBZ I;  1R0Q A;  1QL4 A;  2OTL P;  4OVN F;  2VRS A;  1CRC A;  1NOH A;  4JBZ A;  1S9K D;  1VF5 B;  1DEB A;  1L0L D;  1OAE A;  1C6S A;  1EXJ A;  1AJY A;  1HH7 A;  2YCC A;  1H88 A;  2OYH A;  1KIL D;  3DP5 A;  2W83 C;  5AW2 B;  1DIQ C;  1KZU B;  1NTZ D;  3L74 J;  1LC2 A;  1I54 A;  1IK7 A;  5C0Z A;  3P32 A;  5KAI V;  1KB9 D;  4LLH A;  3H1K G;  3WUT A;  1CYC A;  3HE4 B;  3AEC C;  1ZLL A;  2M0B A;  1CI6 B;  1YI2 P;  3WUI A;  1GQ1 A;  1YYC A;  5APW A;  2NPS B;  3H1I E;  2B9B A;  1L4A C;  1FJK A;  3EWK A;  5AUR A;  1GTW A;  1NTM J;  2LIR A;  4IFD K;  1EZV I;  3TGU D;  1MFZ A;  3RK3 B;  3WFC C;  5KLV D;  2WVR A;  1BDD A;  4H0L B;  1SVF A;  1KB0 A;  2Y0E A;  4QAO A;  1QL2 A;  2A45 G;  1LMS A;  1H0T B;  1PPJ E;  3RL0 C;  1DW2 A;  1GDT A;  1BSN A;  3HRN A;  4I2L C;  3MHV A;  5CCG D;  1JTH B;  3CD6 P;  1SP4 A;  1R5S A;  3BCC D;  3WU2 H;  3ITK A;  1F1F A;  3L36 A;  2WPQ A;  3M9B A;  1SQP E;  1NJI Q;  3SSU A;  5AW7 B;  1BCC J;  2CXB A;  3H1J D;  2WSE J;  3PHL A;  2V7Q J;  1LFM A;  1UII A;  3CX5 W;  1LTJ B;  2KYV A;  1YIJ P;  1JUN A;  1L0L E;  3O0R C;  1X0T A;  2C9N Y;  4BWN A;  1KIL E;  3CX5 E;  2EXV A;  1BGY J;  3L71 D;  1JMB A;  4EIE A;  2OTJ P;  2C0W A;  5GTH V;  3O6Q B;  1Y9B A;  3X39 A;  5BVZ A;  1KB9 E;  1T2K D;  1E2R A;  1TU3 F;  3HD7 D;  1OXZ A;  2ZYG A;  3D71 A;  2MTA C;  4DCK A;  4I7Z B;  1H31 B;  1QN2 A;  3I5C A;  2IYP A;  5B66 H;  4PJ0 V;  1L0N J;  3Q5R A;  5E79 V;  2W27 A;  3D6Y A;  1A2S A;  4KJM A;  3TGU E;  3CCL P;  4EIJ A;  4WY4 B;  1H9Y A;  1I5T A;  1N7S A;  1WT6 A;  2FFD B;  5KLV E;  3CC2 P;  3GG2 A;  1M1J B;  3K5B A;  1N90 A;  1IRW A;  4TT3 H;  2O01 J;  2Q3E A;  4JYB A;  3OA7 A;  1RE4 C;  1FZE A;  2AXT V;  1HH0 A;  4HKZ H;  3WFE C;  3SJL A;  1H32 B;  5GTH H;  5CIB B;  3BCC E;  3H25 A;  2ZXX A;  1K3H A;  4D6T G;  2QJY B;  3KQG A;  5CJ4 A;  1N73 C;  5AW8 B;  3H1J E;  1L9J C;  5APX A;  3MGN A;  3AE2 C;  1FAV A;  1SFC A;  2BAS A;  3C1L A;  4DOJ A;  2QSI A;  4PJ0 H;  3H1L G;  3VMX A;  1S5L X;  2DVH A;  3VMY A;  1U57 A;  2KZJ A;  3VOP A;  3AE5 C;  2ZJS E;  4J20 A;  3E1I A;  4GIF A;  2OYI B;  3HUS B;  1GD2 E;  1M57 D;  4O1W A;  5DFS A;  4EIC A;  3F5H A;  4U3F D;  5AVW B;  3PLN A;  3M0A A;  4GYD A;  2FYN B;  3ZBM A;  2G8Y A;  1LT9 B;  2CK3 H;  4GOD A;  4UB6 V;  3PTZ A;  1KOR A;  3V6I A;  4OGQ B;  1GU4 A;  1COT A;  1OW7 A;  2XV5 A;  3V4W A;  3CCV P;  1T6A A;  1KQG B;  2ZXE B;  1GL2 C;  2R5D A;  3OW2 O;  5CJ0 A;  1S4X A;  4NPE A;  2YMK A;  1MV8 A;  1Z56 A;  2GIW A;  4WB4 A;  1CC5 A;  3HQ7 A;  1CSW A;  1CI6 A;  3N4X A;  3B71 A;  1ZR2 A;  2NPS A;  1M7L A;  3IR9 A;  2R44 A;  3CP5 A;  1AKK A;  1HJB A;  2A06 D;  2KXP B;  3RK2 B;  1KQL A;  5C9M A;  2AI5 A;  1FJP A;  5TJH A;  3U1C A;  1NMI A;  2A45 I;  1NTZ J;  2D0W A;  1AOF A;  4ZMD A;  3P8M C;  1S2E A;  3JBT B;  5TIS H;  3TDK A;  1N73 B;  1XTG B;  1VQ4 P;  1QVG O;  1QX8 A;  1H0T A;  2O1K A;  1H33 A;  1CTJ A;  1HF9 A;  3L75 D;  1RHZ B;  1JTH A;  4HH2 A;  1COR A;  3IN6 A;  1JY3 N;  4O9B A;  2WT7 A;  2BCC D;  1NTK G;  3TGU J;  1R8E A;  1FI9 A;  4L74 A;  1SQQ E;  2JWA A;  1JY2 P;  3G71 P;  1K04 A;  3OJA B;  2A45 H;  3MUD C;  1NTK K;  3CWB D;  2WSF H;  3A0H H;  1X22 A;  2ZON G;  4JCG A;  3B8E B;  1BSH A;  1QL3 A;  5KJ7 D;  1KIL C;  1S5L E;  3L73 D;  3EFG A;  2P67 A;  4C46 A;  2HPC A;  3O6Q A;  1KQF B;  3H1J J;  1I55 A;  3B4S A;  3Q3D A;  1KV4 A;  3L72 G;  1LTS C;  2LXB A;  2PFX A;  1FS0 E;  2IFN A;  3B5N C;  1PGQ A;  3AE8 C;  1YCC A;  2HFE D;  2KB7 P;  4K35 A;  3N7N A;  2OYH B;  1YIQ A;  3NBT A;  1CXC A;  1HGZ A;  1C6O A;  1VYD A;  2BH5 X;  1J2J B;  2KOG A;  3CXH W;  3L71 J;  2YIU B;  4IL6 X;  1SQB E;  3Q1M A;  1YJN P;  5AVX B;  1L4A A;  3CXH E;  2Z4E A;  1CSX A;  2P7J A;  3R2P A;  1CO6 A;  2B10 B;  4DJG A;  3BAT A;  2C1D A;  1OZH A;  4Z1M H;  1VQN P;  1NU1 E;  3VYM A;  3VTP C;  1EDK A;  1M70 A;  3L75 E;  5CCG C;  1GK4 A;  1Y8A A;  5AW5 B;  2KP8 A;  3GHG C;  2AEF A;  1DD4 A;  3ABV C;  3PXS A;  2PAC A;  1U74 B;  2O3J A;  2E75 B;  1JEK A;  1E5W A;  3CCJ P;  2ITA A;  1FZB A;  1CIE A;  1YTC A;  1IFP A;  3OA8 A;  2P10 A;  2PGD A;  1YIT P;  1WVE C;  1KIB A;  3BRV B;  5AVZ B;  2H89 C;  1BGY D;  1FZA A;  4AAM A;  3PXT A;  4YE1 A;  1MZ9 A;  4RO0 A;  2YMY A;  1PP9 G;  3L74 E;  1ZV8 A;  3U1A A;  1MZ4 A;  1BE3 G;  1URQ C;  2C1V A;  1AA0 A;  1C2N A;  1T2K C;  1IC2 A;  4Y99 B;  2W6B A;  3HD7 C;  3AEG C;  3CX5 H;  5AVS B;  2GM4 A;  3VYI A;  2C1U A;  3WUU A;  2POH A;  1PGP A;  3SXT A;  1EDI A;  1NTM E;  1YNR A;  2FYU G;  2Q5U A;  3SWY A;  3H1H G;  5GTI H;  1AV1 A;  3CYT I;  4PD4 I;  1RF1 C;  1VQ8 P;  5CBO A;  2FYU K;  1HCM A;  4DY9 A;  4U3F J;  3SWK A;  2XU6 A;  1CRI A;  4PW9 B;  3NWV A;  1SQX G;  2WTY A;  5CYT R;  1QL1 A;  1OIP A;  3L37 A;  3LW5 H;  1FI7 A;  3V4Q A;  1Q81 Q;  1RZ6 A;  1J1D C;  1SQV G;  1BCC E;  1SQX K;  1W5C E;  2B89 A;  1HJ4 A;  4Y5R A;  4TLF A;  2ZAE B;  1GIW A;  3HQ6 A;  1RE4 A;  451C A;  1KTM A;  2W90 A;  1SQV K;  4IL6 E;  2WSC H;  5AW3 B;  3L4O A;  1LTA C;  1N73 A;  2CPB A;  3AE9 C;  2WPS A;  1BGY E;  4H13 D;  3V2Q A;  2KNC A;  1NWQ A;  1YJW P;  4HB1 A;  1HRO A;  3TYY A;  2QVA A;  2E5T A;  4XXL A;  1KC8 Q;  1SFC B;  2QJP B;  1KYO D;  1DW3 A;  2FWL A;  2GC7 D;  3T97 A;  2O01 N;  2M5A B;  3WC8 A;  1RAQ A;  3FGA D;  3MK7 B;  2OYO A;  2I8D A;  5K5G B;  3L75 J;  3TF5 A;  2FXO A;  1I8P A;  1M56 D;  4Y28 J;  1EDL A;  1LS9 A;  2WIT A;  2BCC J;  3ZDM A;  4DT0 A;  2R3C A;  1K9M Q;  1G2C B;  5APT A;  2M8R A;  2QJK C;  5AW9 B;  2JO1 A;  2KUB A;  3KDP B;  1C7M A;  4RKU J;  1S3J A;  3CWB J;  1FE6 A;  1VQL P;  4UB8 H;  2B87 A;  1GL2 A;  2WWW A;  3DR0 A;  3F89 A;  2WPV B;  1KX2 A;  4N3Y B;  2V4H A;  3L73 J;  1N2D C;  4D6T D;  4R4M A;  2JP3 A;  5AW0 B;  4WQ7 A;  4WVZ A;  4ASV A;  4FA9 A;  1S1C X;  4RES B;  4GDO A;  3RN1 A;  4AUW A;  1CW5 A;  1I8O A;  3B5N D;  3IAO A;  1EC5 A;  3AEA C;  5DF5 A;  5DJQ C;  1S5L V;  3GMA A;  2PAJ A;  1ZN5 A;  4WQE A;  5KAF E;  4ZNC A;  1LT1 A;  2ORL A;  2D2C D;  1QYZ A;  1IO3 A;  1C75 A;  1L0N G;  1JMM A;  1KYO E;  2AXC A;  3JCU E;  3EFF K;  1N15 A;  1H33 B;  2CE1 A;  2E76 B;  3G9R A;  5KJ7 C;  3L70 G;  1L0N K;  2XDJ A;  2FKW B;  5KAI H;  5BU5 A;  2WT7 B;  2N18 B;  3FWL A;  3G4S P;  4LC1 A;  3MUD A;  1FU1 A;  1SS1 A;  1Q86 Q;  2E43 A;  4PV1 B;  1ZW0 A;  1S9K E;  1KIL A;  4PD4 D;  2MJZ A;  1OVV A;  1W5C T;  1KFN A;  3II6 A;  2YKQ A;  2OQQ A;  1VPC A;  4WQD A;  1NO4 A;  1MG2 D;  2GC4 D;  3SWS A;  4D6T E;  1CNO A;  1NTZ E;  1B7V A;  2QJK B;  2HPC B;  1URQ D;  1PGJ A;  1OCD A;  3H1I G;  4W80 A;  3CCE P;  3L4F A;  1S72 P;  2B12 B;  4WQB A;  2K1A A;  1HBW A;  4C7N A;  1U75 B;  3H1K J;  4LGD E;  1GW4 A;  1LTI C;  5CCH D;  1FC2 C;  3FXD A;  5KTB A;  3RLM A;  2R5B A;  1FDI A;  2W6J H;  1M90 Q;  1BDC A;  3AE6 C;  1JCC A;  1HTL C;  1HZV A;  1PPJ G;  1L4A B;  2N1T C;  2K9J A;  1FI3 A;  1LTG C;  2ZT9 D;  3VN0 A;  5CCG A;  2C1D B;  2ZOO A;  3GHG A;  3HTK A;  1SQP G;  1USD A;  2SPZ A;  1YEB A;  3KHU A;  1ZP0 C;  1P84 I;  2CA4 B;  1DW0 A;  1PL5 A;  3A9F A;  1JNM A;  2QM7 A;  1SQP K;  1OVU A;  1T3U A;  2C9X B;  1L0L G;  3D70 A;  3RL0 B;  2AEM A;  5AVY B;  4RSZ A;  4BXL A;  1AQ5 A;  3OA8 B;  3V2R A;  4PD4 E;  5E79 H;  2IBZ D;  1L0L K;  3QWO C;  5DJU B;  5H2F E;  2M5A A;  2WSS H;  4N78 D;  3L71 E;  3BVH A;  4B86 A;  1ZXG A;  1M60 A;  2B88 A;  3HD7 A;  4AAN A;  1CHH A;  2C8S A;  4HJG H;  1J1E C;  1IZL 0;  2XND H;  3SVW A;  2YXQ B;  3E7K A;  4H0J A;  4MN4 C;  1P84 H;  2KLV A;  2HOD A;  4K3I A;  2AXT H;  2BGV X;  4IL6 V;  3GW6 A;  3IFM A;  3VMA A;  2H7H A;  1YJ9 P;  5AVU B;  1G2C A;  4H0L D;  1DX7 A;  1GJQ A;  2BPB B;  2HV4 A;  2KZI A;  3PJS K;  2RH0 A;  1YBK A;  2YK3 A;  3EQ2 A;  3TGU G;  1KFM A;  1RF1 A;  2WMM A;  5KLV G;  1GW3 A;  3CCM P;  1YHQ P;  155C A;  1T3J A;  1CIH A;  1JY3 O;  2V08 A;  2Q7C A;  5AW6 B;  5KLV K;  1CSB A;  1L2P A;  3AE7 C;  2QEX P;  5DJT B;  3C2C A;  3BCC G;  1EZV D;  4JPZ B;  1CRY A;  2WSE H;  1RQV A;  3H1J G;  1LTT C;  3M97 X;  1FOS E;  4H13 C;  1GZL A;  2Y9Z A;  3VRD A;  2Z5I A;  3R4Y A;  3M91 A;  4D6T J;  1VDF A;  2KK7 A;  3P7K A;  1BE3 D;  3KYQ A;  3P8C D;  4UB6 H;  2ZZS 1;  5AVT B;  1CYJ A;  2FBW C;  2N9Y B;  2IYO A;  1DEE G;  2IBZ E;  3SFE C;  3I55 P;  2WZ7 A;  3H1L J;  4N78 E;  1IFN A;  1VQP P;  4CPG A;  2L4D A;  2H88 C;  2FYU D;  2QA4 P;  2YKO A;  2KNC B;  3OAK A;  4EIF A;  3VMZ A;  2YQB A;  1FZC C;  4GKG A;  1GKS A;  4U3F E;  2C2C A;  1GU5 A;  4WY4 D;  2H8P D;  1LWU C;  4U7J A;  1EXI A;  1PFI A;  1HVV A;  5B5E E;  1QEX A; 
#chains in the Genus database with same CATH homology
 1DIQ C;  1YNR A;  1NTZ D;  1LC2 A;  1CIG A;  1I54 A;  5CID B;  5C0Z A;  1I6D A;  5KAI V;  2N9J A;  1KB9 D;  3CYT I;  1CYC A;  5KAF V;  1HRC A;  3L72 D;  3O20 A;  3WUI A;  1GQ1 A;  2XTS B;  1HCM A;  4DY9 A;  5CIC B;  3O5C A;  5AUR A;  1CRI A;  4PW9 B;  3NWV A;  2N3B A;  2LIR A;  5CYT R;  3TGU D;  1FI7 A;  3ZOX A;  1RZ6 A;  2JQR A;  3WFC C;  5KLV D;  2JTI B;  1CCH A;  1S6V B;  3HQ9 A;  1KB0 A;  2Y0E A;  4QAO A;  1HJ4 A;  4Y5R A;  1GIW A;  3HQ6 A;  1LMS A;  2N3Y A;  451C A;  1IRV A;  1DW2 A;  2QG4 A;  3BCC D;  4A7P A;  3L4O A;  4RJT A;  3ITK A;  1F1F A;  1ETP A;  3OCD A;  1SQQ D;  2L91 A;  2CXB A;  1QKS A;  3H1J D;  3NBS A;  1F1C A;  4KMG A;  1HRO A;  5TIS V;  4FAV A;  2KS1 A;  3PHL A;  1LFM A;  4XXL A;  3CX5 W;  1CIF A;  2ZBO A;  2QJP B;  3O0R C;  1NNO A;  1KYO D;  3A0B V;  1DW3 A;  1IQC A;  2FWL A;  4FA4 A;  2GC7 D;  2EXV A;  2ZXY A;  4AX3 A;  4EDF A;  3L71 D;  3WC8 A;  4EIE A;  1RAQ A;  5GTH V;  1PP9 D;  3MK7 B;  3TF5 A;  3X39 A;  1H1O A;  1I8P A;  1J3S A;  1E2R A;  1LS9 A;  2MTA C;  4N0K A;  3A0H V;  1H31 B;  1NML A;  3HQ8 A;  4AAO A;  1CSU A;  1QN2 A;  2PCC B;  3DMI A;  4PJ0 V;  1M6Z A;  1DT1 A;  1N50 A;  1SQB D;  5E79 V;  2N9I A;  1C7M A;  3H1H D;  1LC1 A;  1A2S A;  3CXH D;  3H1K D;  1H9Y A;  1I5T A;  1JDL A;  3DR0 A;  1FOC A;  1KX2 A;  1NIR A;  3GG2 A;  1N90 A;  1NU1 D;  1IRW A;  4D6T D;  2RN0 A;  2Q3E A;  4WQ7 A;  3ZIY A;  1CTZ A;  4FA9 A;  1A56 A;  2AXT V;  1K3G A;  5CIE B;  1SQX D;  3WFE C;  3SJL A;  1H32 B;  3RN1 A;  5CIB B;  3RN0 A;  1K3H A;  1I8O A;  2QJY B;  3VNW A;  1CRG A;  1SQV D;  4FA5 A;  5DF5 A;  4WQA A;  5DJQ C;  1S5L V;  4V2K A;  4WQE A;  4AAL A;  1HZU A;  1L9J C;  3ZOW A;  2ORL A;  5H2F V;  1H9X A;  1QYZ A;  4H0K A;  2OZ1 B;  3WFD C;  2B0Z B;  1IO3 A;  3L70 D;  1CTY A;  3RMZ A;  1C75 A;  3KZI V;  1CHJ A;  2DVH A;  3L74 D;  3SLE A;  1ZRT D;  2K9J B;  1N15 A;  1H33 B;  2CE1 A;  2LIT A;  4J20 A;  5KLI B;  3L4M A;  1YIC A;  4O1W A;  5DFS A;  4EIC A;  3TYI A;  1FCD C;  4U3F D;  1H31 A;  5B6Q A;  2DGE A;  4L3G A;  2N18 B;  1CRH A;  1P84 D;  3PLN A;  1NTM D;  2FRC A;  4GYD A;  2FYN B;  4WQ9 A;  3ZBM A;  3FWL A;  1W2L A;  3ZCF A;  1A8C A;  4UB6 V;  4XYD B;  1CRJ A;  3ORV A;  3PTZ A;  1CYI A;  1COT A;  4PD4 D;  1YFC A;  1W5C T;  1DW1 A;  1DVH A;  5CIH B;  4WQD A;  1MG2 D;  2GC4 D;  3SWS A;  1CNO A;  1B7V A;  2GIW A;  2QJK B;  1CC5 A;  1H32 A;  2CA3 B;  3HQ7 A;  3ZOO A;  1CSW A;  1OCD A;  3O1Y A;  3ZOY A;  5CIG B;  1BCC D;  3CP5 A;  2B12 B;  1AKK A;  1CCR A;  1HJ3 A;  4WQB A;  1GU2 A;  2A06 D;  1U75 B;  4L3H A;  5GTI V;  5C9M A;  2AI5 A;  2AIU A;  2B4Z A;  5TJH A;  1FJ0 A;  3RLM A;  1NMI A;  2Y0C A;  1E29 A;  1RZ5 A;  2D0W A;  1AOF A;  2Y0D A;  5KKZ B;  3JBT B;  4GED B;  5IY5 1;  1MG3 D;  2PCB B;  4NFG B;  3TDK A;  2CE0 A;  2GB8 B;  1HZV A;  2VHD A;  3CU4 A;  1FI3 A;  1H33 A;  1CTJ A;  2B11 B;  1YEA A;  2C1D B;  3L75 D;  4FB1 A;  2ZOO A;  3MK7 C;  1C6R A;  5B5E V;  1COR A;  1C52 A;  2BCC D;  4Q5P A;  5CIF B;  1YEB A;  1N9C A;  3KHU A;  1FI9 A;  3CX5 D;  3H1L D;  2CA4 B;  3PRJ A;  2JWA A;  3PXW A;  1DW0 A;  1L0N D;  3A9F A;  2MHM A;  4PWA A;  3CWB D;  2C9X B;  5EXQ A;  2ZON G;  4O1Q A;  4JCG A;  3WU2 V;  4RSZ A;  1RAP A;  1QL3 A;  1KYO W;  3OA8 B;  1L9B C;  1CSV A;  4WQ8 A;  3L73 D;  2IBZ D;  1KX7 A;  2RMZ A;  2BCN B;  4WQC A;  1AOQ A;  1E8E A;  2BH4 X;  1I55 A;  1M60 A;  4AAN A;  1CHH A;  2C8S A;  1IZL 0;  4EID A;  3SVW A;  4H0J A;  1I6E A;  4K3I A;  2BGV X;  4IL6 V;  3GW6 A;  3VMA A;  1YCC A;  1YIQ A;  1BL9 A;  1GDV A;  4LJI A;  1GJQ A;  3PH2 B;  2BPB B;  2HV4 A;  3NBT A;  1CXC A;  1C6O A;  1VYD A;  2YK3 A;  2BH5 X;  1CXA A;  3CXH W;  1KV9 A;  2YIU B;  155C A;  3H1I D;  1CIH A;  1CHI A;  1CSX A;  1ZZH A;  1CO6 A;  2B10 B;  5B66 V;  2V07 A;  2C1D A;  2V08 A;  2D0S A;  4L1Q A;  2BLF B;  3VYM A;  4UB8 V;  1M70 A;  4MU8 A;  3C2C A;  1EZV D;  1CRY A;  1DII C;  4FA1 A;  3WFB C;  351C A;  1FHB A;  3PXS A;  2N18 C;  2PAC A;  2I8F A;  1U74 B;  4P4Q B;  2O3J A;  3M97 X;  1PPJ D;  1CED A;  3VRD A;  4FAN A;  2OZ1 A;  1CIE A;  1YTC A;  3OA8 A;  1BE3 D;  1DVV A;  1C2R A;  1WVE C;  1KIB A;  2ZZS 1;  1CYJ A;  1WEJ F;  1SQP D;  2N9Y B;  1NTK D;  1BGY D;  1R0Q A;  1QL4 A;  3PXT A;  4AAM A;  4YE1 A;  3OCD B;  1CRC A;  5DJQ B;  1MZ4 A;  1AYG A;  2L4D A;  2C1V A;  2FYU D;  2KNC B;  1C2N A;  1L0L D;  1OAE A;  4EIF A;  1C6S A;  2YQB A;  1HH7 A;  2YCC A;  2C1U A;  1GKS A;  3DP5 A;  2C2C A;  1EB7 A;  3SXT A;  1HJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...