3CXHD

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 71
structure length 246
sequence length 246
chains with identical sequence O
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cxhD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cxhD02
5KLVD 3SXTA 4L3GA 4FA5A 5B5EV 3FWLA 1LMSA 1H32A 1CC5A 4FANA 1N50A 5CYTR 3KZIV 2L4DA 2C9XB 1LC1A 3DP5A 1FI9A 2D0WA 3O5CA 2CE0A 1HZVA 1CNOA 1I5TA 1K3GA 1HROA 5CIDB 3SJLA 1M60A 1CCRA 3HQ8A 1KB9D 3H1ID 4UB6V 2I8FA 1E2RA 1I6EA 2Y0CA 3TDKA 1C2RA 1QYZA 5GTHV 3L73D 4MU8A 2QJYB 2OZ1A 1BGYD 4L3HA 1MG2D 1OAEA 1EB7A 1HCMA 2V07A 2ORLA 4NFGB 3PXSA 1I8OA 2C1DA 1CRCA 1GDVA 4L1QA 1HJ4A 4EDFA 1AKKA 2B12B 3PH2B 3VYMA 1MZ4A 4RSZA 2YIUB 2QJPB 3RMZA 1NTZD 1SQXD 3ZOYA 1CRGA 1CYIA 5DJQB 3ZBMA 3CX5D 3SWSA 3NBSA 5C0ZA 2ZONG 2JQRA 3NBTA 3WFCC 1C6RA 5EXQA 1I55A 3VRDA 4AX3A 2BPBB 4PJ0V 1H33A 1A2SA 3A0BV 3OA8B 2C1UA 1OCDA 4P4QB 1YNRA 1W5CT 4H0JA 1F1CA 5DF5A 3OCDA 2BLFB 1E8EA 1C7MA 1B7VA 2Q3EA 1GKSA 2BCCD 1SQQD 3PXWA 3SVWA 1M70A 1MG3D 1QL4A 1CYJA 3CXHW 3O1YA 3L70D 1H1OA 1YFCA 1CORA 4WQ9A 1E29A 4WQDA 2B11B 1CTJA 1IQCA 1CIGA 1SQPD 4AALA 3RN0A 2QG4A 1M6ZA 1DW1A 3PXTA 3WFBC 2RN0A 1DW2A 2AIUA 1ETPA 4WQ7A 4WQEA 4D6TD 3PHLA 1NMLA 1ZRTD 1KYOD 1CCHA 2MTAC 3L72D 1QL3A 4FA9A 1BE3D 2PCCB 5CIFB 5KAFV 3NWVA 3TF5A 4FA1A 1GJQA 4EIFA 4YE1A 2C1VA 5H2FV 1CHJA 5GTIV 2FWLA 1DT1A 1N90A 3JBTB 1KB0A 2L91A 3CP5A 4FAVA 1KX2A 1RAQA 1CRYA 2XTSB 2B4ZA 1CSUA 2D0SA 1BCCD 4DY9A 2FYUD 1DW3A 5DJQC 2OZ1B 3L74D 1CRIA 1HZUA 1IZL0 2AXTV 1DVVA 2CA4B 3PTZA 1N9CA 1SQVD 1PP9D 1CSWA 3WC8A 5C9MA 3HQ9A 1YEBA 1QN2A 1WEJF 2N18C 1C6SA 2DGEA 1I8PA 2N3BA 3KHUA 4U3FD 1CTZA 4IL6V 1IO3A 2C1DB 4V2KA 2LIRA 1SQBD 351CA 3ZOWA 1I6DA 1GU2A 2VHDA 4XXLA 3ORVA 1YEAA 2QJKB 4J20A 4AANA 4FB1A 5AURA 1EZVD 2N9JA 4O1QA 1GQ1A 5KLIB 3GG2A 2HV4A 1CXCA 4GEDB 3TGUD 1FI3A 1FHBA 5KKZB 4PW9B 1A8CA 2N9YB 1L0LD 2B0ZB 3DR0A 1YICA 1HRCA 1I54A 2C2CA 1A56A 3WFDC 3TYIA 1H31B 5IY51 3DMIA 4AAOA 1CRJA 1CXAA 2Y0EA 1H33B 2ZXYA 4WQCA 2YQBA 3RN1A 1LS9A 4FA4A 1CIHA 3CU4A 2BGVX 2YCCA 4PD4D 3CYTI 3SLEA 2KS1A 4H0KA 1L9BC 1NIRA 1L9JC 2A06D 3RLMA 1CEDA 3C2CA 2CXBA 2GC7D 1YIQA 1FCDC 1U74B 2GB8B 1AOFA 1RZ5A 1YTCA 3O0RC 3CWBD 5B6QA 1K3HA 1DW0A 2FRCA 4GYDA 3H1KD 4Q5PA 3HQ6A 2JTIB 1KX7A 1CSVA 3ZIYA 4WQAA 3PRJA 3WU2V 451CA 3H1JD 1IRVA 4A7PA 4RJTA 1PPJD 1CIEA 3O20A 4JCGA 1CHHA 1CTYA 1KV9A 3L71D 4K3IA 2B10B 1COTA 1AYGA 2O3JA 1QKSA 3OA8A 3VNWA 1NNOA 1DIQC 2IBZD 5TISV 1H32B 1RAPA 2CA3B 2GC4D 2MHMA 3WFEC 1HH7A 3ITKA 1KYOW 1S6VB 1ZZHA 2ZZS1 1HJ5A 4XYDB 2ZBOA 3H1LD 3ZOOA 1CSXA 1FI7A 1H9YA 1C2NA 4EIEA 1AOQA 1P84D 5CIEB 2BH5X 1N15A 1S5LV 4EIDA 1F1FA 4O1WA 3CXHD 3L4OA 3ZCFA 3HQ7A 3OCDB 4WQBA 155CA 4KMGA 1WVEC 2V08A 3MK7C 2N18B 3A9FA 2K9JB 4Y5RA 5KAIV 4EICA 1NU1D 1YCCA 2C8SA 3CX5W 4N0KA 3VMAA 4LJIA 1FOCA 5TJHA 4UB8V 1C6OA 5CIBB 1CIFA 1DIIC 4WQ8A 3GW6A 1LC2A 1BL9A 1FJ0A 2Y0DA 3L4MA 1KIBA 2PACA 2FYNB 5DFSA 2PCBB 2DVHA 1IRWA 2CE1A 1DVHA 3A0HV 2EXVA 5CIGB 2AI5A 3H1HD 3BCCD 2BH4X 1C75A 1NMIA 2RMZA 5CIHB 4PWAA 1HJ3A 4QAOA 1RZ6A 1GIWA 3L75D 3PLNA 1NTMD 1L0ND 3WUIA 1H31A 3M97X 4AAMA 1NTKD 1CHIA 1JDLA 1CRHA 1CO6A 2N3YA 1R0QA 2YK3A 3MK7B 2JWAA 2BCNB 5CICB 5E79V 3X39A 2ZOOA 1C52A 1U75B 1VYDA 3ZOXA 1CYCA 2LITA 2GIWA 2N9IA 2KNCB 1LFMA 1H9XA 1W2LA 1J3SA 5B66V
chains in the Genus database with same CATH superfamily
5M1BA 3JC22 3G4SP 3SXTA 1L0LG 3MIWA 4L3GA 1NVOA 5CYTR 4PV1D 3DP5A 2WQYC 3TGUE 5CMZA 1HZVA 3OJAB 2V7QJ 1HROA 5CIDB 4IFMA 3SJLA 1M60A 1NTKJ 2ZVNB 2O01N 3VN0A 2PFXA 3H1ID 2E75C 1I6EA 5CCGC 2Y0CA 3CPWO 1C2RA 2R3SA 1JY3N 2Z4EA 1CW5A 3TGUJ 1L0LK 2Z5HA 1KB9I 1PGOA 4I2LC 4K3AA 1VQ8P 1OAEA 1EB7A 4GKGA 2ORLA 2C1DA 1CRCA 1LNQA 3H32B 3S9OA 3VYIA 1NTZD 2GUVA 1T8ZA 2H88C 1CRGA 2NZ2A 1BDDA 2WSEH 1JY3P 1N73B 4OH8B 5C0ZA 1JTHB 1M7LA 3NBTA 1R8EA 1KD1Q 3WFCC 1JNMA 3CX5E 1J1EC 1KQFB 3VRDA 1NU1K 3G71P 3WU2H 3L71G 1M1JB 1OCDA 1H89A 3MZWB 1F1CA 5DF5A 3OCDA 4OGQB 1DX7A 2BLFB 1MUUA 4H44B 1GD2E 5APTA 1LP1A 3GHGB 2R5BA 1K04A 1AQ5A 1GKSA 1HVVA 2RH0A 1X0TA 2W6BA 1ZLLA 3U59A 1QL4A 5AW7B 1GZLA 4N3YB 1S5LE 2A45G 1CI6B 3LW5J 1ZMEC 1E29A 4WQDA 2WMMA 2B11B 4I1LA 2E42A 2Y9YA 4AALA 1S3JA 3QH9A 4GOEA 2WZ7A 1EXIA 4I6MC 1K73Q 3PXTA 2IFMA 3CCRP 4LC1A 1NTMG 2J5UA 2FKWB 1OVVA 4K35A 3CX5H 4DCKA 1CCHA 4RESB 2MTAC 1L4AC 2WPRA 1R5SA 2WT7A 2JP3A 1IFNA 5CIFB 5KAFV 1JMMA 3FXEA 3M91A 4EIFA 1QGKB 2C1VA 3VMZA 1FOSF 1HBWA 2FWLA 4N78D 1QX8A 1RF1B 3LIDA 4FAVA 4PJ0H 1RAQA 1CRYA 2B4ZA 4WY4A 3RK3B 3MGNA 4O9BA 2H89C 1DW3A 5DJQC 2YKPA 2C9LY 1OIPA 1IZL0 2AXTV 3AEDC 2CPBA 5AVXB 1T2KC 3PTZA 1SQVD 1MV8A 1HJ0A 1NTZG 2ZT9D 2VRSA 4OWFA 4HH2A 2UWJE 4C7NA 3L73J 2N18C 1PL5A 1I8PA 3D0WA 4AQRD 3L75E 1OW7A 5AW9B 4GDOA 1I6DA 3ZOWA 1YEAA 5AURA 1ZOYC 3RK3D 3V2QA 2LXBA 1SQVK 1QL2A 2M8RA 1USDA 1GQ1A 3BCCE 1CXCA 2JJLA 3BATA 1A8CA 3B5NA 3CWBE 1SQPG 1YYCA 2N9YB 1S1CX 1QL1A 2POHA 4WY4D 1KQSO 2W8ZA 3WFDC 3TSIA 3W68A 3TYIA 4H44D 3Q5RA 1VQ6P 5IY51 1KILE 1SP4A 1Q86Q 1SQQE 2FBWC 5AW3B 2Y0EA 1H33B 2KSJA 5CCHD 5AVTB 2O1JA 4NPEA 4C7NB 2QRXA 2IYOA 1N2DC 3G9RA 1CIHA 3CU4A 3D71A 1E79H 2KNCA 1FZGA 2ZJSE 4W7YA 2WVRA 2KS1A 3SLEA 3R2PA 1L9BC 1VQNP 2QA4P 3KDPB 3RLMA 3C2CA 3SWFA 2B87B 2KUBA 3D70A 1FCDC 2GB8B 5APXA 3HUSA 2WSCH 1YTCA 1KV4A 3CWBD 5B6QA 4W7ZA 1DW0A 2FRCA 5AVZB 4GYDA 3H1KD 4Q5PA 1CSVA 4XFJA 4YXWH 3MUDA 1DD4A 1W5CE 3RK3C 1KN7A 1FAVA 3O20A 1J1EB 5EFWB 1KV9A 1IFJA 3MHVA 1AYGA 1MFTA 2O3JA 2HODB 1M1JC 3OA8A 2I1KA 3M9HA 3L72E 3MD0A 1SQPK 1YBKA 1H32B 2GC4D 2MHMA 3GHGC 3H1HG 1VF5B 3L70J 1S6VB 1ZZHA 3H1LJ 1Y8AA 1HJ5A 2ZBOA 3H1LD 3RL0g 5AW6B 4ZMDA 1H9YA 4W80A 2OYIC 1P84D 1M56D 2MKVA 1D7MA 5CCGA 1S5LV 2W83C 2N1TD 2O01H 3RK3E 3CXHD 3ZCFA 3SWKA 1BSHA 3RGUA 3JCUH 5B66H 1WVEC 4ZNCA 3MK7C 3A9FA 2K9JB 2I1JA 2W90A 4U3FE 2KIKA 3BVHA 2C8SA 3CX5W 1G2CB 3AEEC 4EI2A 3H1IJ 3CCSP 4PD4I 1OWAA 4XA4A 2H7HA 3ZDMA 2FYNB 1VQ9P 2N1TB 2WSSH 1JY2O 1PGJA 2B9BA 1RF1C 2KP8A 3P8CD 2CK3H 5KTBA 1DVHA 3A0HV 2AI5A 2QM7A 3T97B 1SQPE 3CCQP 1FDMA 1HH0A 1NTMD 1L2PA 1L0ND 2PRRA 1AA0A 4AAMA 1BDCA 1JDLA 2ZYGA 3WU2E 2N3YA 4EOTA 1J2JB 2JWAA 4XE5B 5CICB 4CPGA 5E79V 3SFDC 1U75B 3ZOXA 3B5NB 2WPQA 2LITA 4RO0A 3M9BA 3OW2O 1LT9C 3CLQA 1BCCG 3L74E 2C0XA 1DEBA 1H9XA 1W2LA 2FYUE 1URQD 4ZKUA 2Q6QA 1NTKG 5B5EV 3FWLA 4JYBA 1PP9G 4FANA 4RKUJ 1PGPA 1FBMA 3H1JG 1S5LX 1H0TB 3QWOC 2D0WA 2XKMA 3O5CA 2CE0A 2CPSA 3EFGA 1CCRA 1G1IA 4UB6V 1MKMA 1YHQP 5GTHV 1EZVG 1LWUA 3L73D 1LT9B 2OZ1A 1BGYD 4L3HA 3V2RA 3CC4P 2YXRB 4NFGB 3CD6P 3PXSA 1I8OA 1GL2B 1PPJE 5KAIE 1GDVA 1HJ4A 4EDFA 2FFDB 2B12B 1KILD 3VYMA 3MP7B 1CZQA 5CBNA 1WT6A 3HTKA 3ZBMA 1KYOH 2IPPA 2P7JA 1NWQA 3SWSA 1KYOI 3C1LA 5AVVB 2JO1A 1FU1A 2ZONG 2FXMA 1N7SA 1C6RA 5L8RJ 4BXLA 4AX3A 1FOSE 1NH4A 4N78E 3BRVB 1NOHA 1A2SA 2FYZA 3OA8B 1URQC 1PV3A 4IFFA 2K9YA 2YNYA 3L35A 2KLVA 2ZAEB 2BCCD 1S4XA 1L0NE 3H1JJ 4I7ZB 1MG3D 5KKZC 1CYJA 2ZFCA 2NPSD 2E43A 2ZXXA 3IAOA 5AW0B 2J59M 3IFMA 3GMAA 1SQPD 1AQTA 2QG4A 1M6ZA 1GK6A 1EZVE 2RN0A 3H1LE 4JBZA 1WMKA 3RK2B 1LP1B 3GHGA 3GLMA 2OYIB 1BGYG 2N1TA 1G2CA 4D6TD 2FXOA 3P32A 4JYCA 1ZRTD 1KYOD 3L72D 3AEAC 1ZXGA 3VP9A 1QL3A 4KT0J 2ZVOB 2P10A 2M5AB 4WB4A 1GJQA 4YE1A 3ABVC 2FYUG 1LWUC 5H2FV 1CHJA 3TYYA 3A0BH 3VOPA 1L0LJ 1DT1A 1N90A 3JBTB 2Q9IA 2L91A 1OX3A 4PV1C 2XTSB 1Z56A 1NTKK 1BCCD 2OYHA 1H88A 3V2NA 1N73C 4H0LC 5KLVE 3L74D 1DVVA 1HGZA 1J1DC 2YKOA 5H2FH 1N9CA 5TISE 1PP9D 5C9MA 2XNDH 1OW8A 2D2CB 3UIAA 3E1IA 2DGEA 3VMXA 1VQOP 3KHUA 4IL6V 1IO3A 2C1DB 2LIRA 1Q81Q 2RKLA 2VHDA 3H6PA 4XXLA 4WY4B 3ORVA 2HPCA 1T6AA 3M06A 2N9JA 3GG2A 1IZNB 1OXZA 1KQGB 4GEDB 3CCEP 1P84E 1FHBA 3PH0A 5KKZB 3CI9A 4L74A 1YI2P 4KHXA 3G6EP 2B0ZB 2K9JA 5B5EH 1YICA 3M9QA 2QJYC 2E5YA 3B5ND 1H31B 1U7JA 3CL3D 4EIJA 1EXJA 4AAOA 5KLVG 2XZRA 1CRJA 1CXAA 3HUSC 2K1AA 2WSEJ 3RN1A 1BE3E 1LS9A 4FA4A 3H1KJ 2BGVX 2OYHB 5AVQB 4PD4D 3L75J 3SSUA 3VP8A 1GU5A 5AW5B 2K37A 5KLIC 2AEMA 2R32A 3MUDC 3AE5C 3N7NA 2CXBA 2GC7D 3L72G 1AOFA 4PJ0E 2KLUA 3M0DC 1RE3C 1LTJA 1PGQA 2QIWA 2OARA 1L0NJ 1U57A 3Q5SA 3HQ6A 2FYUK 3AE4C 2Y9ZA 4WQAA 3HE4B 1YJWP 3PRJA 2LXCB 3WU2V 2R44A 1AVYA 1Q90D 3U1CA 1P84H 2A06E 1FZEA 2O1KA 1IRVA 4A7PA 4C7RA 1VL2A 2OYHC 1CIEA 4JCGA 2HPCB 2E76C 1KILB 2G8YA 3H1LG 3S4RA 5CCHC 3VNWA 1W2EA 5KAIH 2R5DA 2WT7B 2GUSA 3H32A 4H44C 2CA3B 2W6JH 3HD7D 3C8VA 4UB6H 1HH7A 2OTKE 1KFMA 2XNXA 1Q2NA 4KJMA 2ZZS1 5C39A 3CC2P 3FGAD 1Y9BA 1CSXA 1Q82Q 3CCLP 2C0WA 4EIEA 3RL0D 1AOQA 1S5LH 5CIEB 1N15A 3H1HJ 1G1JA 4EIDA 1NTMK 3L4OA 1SQXE 2JWDA 155CA 1PIXA 1X9VA 3H1KG 3AEFC 4L73A 3CWBG 2WPVB 4Y5RA 4EICA 2OYOA 4N0KA 1KB9H 1JEKA 3A0BE 3Q2YA 1VF5D 3CCJP 2NRGA 3L4FA 1PZQA 1SFCB 1CIFA 1N73A 1DIIC 1LC2A 1ZRTE 1GU4A 3L75G 2Y0DA 1NTZK 1KIBA 2ZYAA 1VQMP 1RF0C 2PACA 5DFSA 1PPJG 2PCBB 2NPSB 3B4SA 1TU3F 1JCCA 5KAFH 1YJ9P 2EXVA 2BH4X 1RE4C 1NMIA 2RMZA 3H25A 3KYQA 2Q5UA 1NO4A 4QAOA 3KZIE 1RZ6A 2HYNA 3PLNA 2QEXP 3WUIA 1NTKD 1CI6A 1T3UA 3CMAP 1IK9A 4PD4E 2YK3A 3MK7B 2W27A 3D6YA 1S9KE 3LIEA 1C52A 1LTTC 1J1DB 2DW3A 3V6IA 2IBZI 1PP9E 1NTKE 1KMIZ 3I5CA 1AFOA 4NPFX 4BRYB 2KNCB 1J3SA 2KZIA 3L74G 2QM8A 5DJUB 2NPSA 4UB8E 1LMSA 1JOCA 1CC5A 3Q5PA 1N50A 1YIJP 1FZFA 2KYVA 3P8CE 1VF5C 5DJTB 5B66E 3AE6C 3CCVP 4ZKPA 1CNOA 2NPSC 1I5TA 4DOJA 1K3GA 3P8MC 2C9NY 4DZOA 5AVUB 1PP9J 1YQ3C 5CJ4A 1KB9D 1E2RA 1SFCD 4M3LA 1NKNA 1QYZA 1OFCX 4MU8A 2QJYB 2OTLP 4TLFA 1MG2D 1KTMA 3B71A 3Q3DA 4D6TE 3KQGA 1SQXG 1GK4A 1LJ2A 3PH2B 4RSZA 1LTSC 3VTPC 2BCCJ 1IC2A 1KZUB 2IFNA 2E74B 3FWNA 3CX5D 1WRGA 3NBSA 1KILA 4JF7A 1E5WA 1I55A 1OVRA 3R4YA 2XV5A 2BPBB 4PJ0V 4U3FG 2P1JA 3AE2C 5CCHA 5AVWB 2OTJP 3A0BV 3E7KA 1OZHA 2E75D 2R3CA 3F5HA 4P4QB 1GW4A 1SQBJ 3M0DA 1E8EA 4R4LA 4LGDE 1C7MA 3BASA 4H0LD 1SQQJ 2Q3EA 2A45I 5TISH 2QJPC 1SQXJ 4NPDA 1SQQD 3PXWA 1OVUA 4TT3H 4HB1A 3SVWA 4GIFA 3WUTA 2FYUJ 5AVSB 3IN6A 1JCDA 3H1HE 1CORA 1N7LA 1A02F 3SFEC 3IR9A 1BGYJ 1K8AQ 1CSBA 3VMYA 3IF4A 1XTCC 1H8AA 3II6A 4WQEA 1R5LA 4DJGA 1BE3G 4H0LB 3O6QB 2KSEA 1RQUA 1NYHA 1T3JA 4FA9A 1BE3D 1YITP 2E75B 3TF5A 1SFCA 4FA1A 1IFMA 1NU1E 1NGMB 2XDJA 1IO4A 1RF1A 4WVZA 1X8YA 3LW5H 5E79E 1FJKA 3SWYA 5APUA 4HKZH 2Q3IA 3CP5A 1FDOA 4AYCA 5APQA 2BCCG 2D0SA 2KK7A 3FX0A 3U1AA 1ZR2A 2FYNC 4DY9A 1JM0A 4LLHA 1M1KQ 2OZ1B 4YXDC 3Q1MA 1KQLA 1SQQG 2V4HA 3AEBC 1P84I 3AE1C 1LTAC 2CA4B 3RK2C 4B86A 1QVFO 1X22A 1CSWA 2E76D 3A5TA 4L75A 1JTHA 3OA7A 1HTLC 1WEJF 3HTKB 1HUCA 1C6SA 2N3BA 3NMDA 4H13B 3BCCG 4U3FD 1CTZA 2IZ1A 3GF3A 351CA 1OMIA 3A0HE 4J20A 2WITA 3CMEP 1SQVG 4O1QA 4IL6X 1K9MQ 5KLIB 3TGUD 1FI3A 3BRTB 4YPCA 4PW9B 4IOIH 1FJPA 5E79H 2JDIH 2L5GB 1NTZE 2KS1B 1DEEG 1Q7YQ 1HGVA 2C2CA 3RBXA 1YQ4C 2B89A 4PD4H 1LTGC 2ZXYA 4H13D 2YQBA 4OVNF 3V4WA 1BGYE 2YCCA 1KB9E 4H0KA 3GF7A 2E76B 1NIRA 2ZXEB 4Y28J 2I8DA 2A06D 2WSCJ 1CEDA 1GL2C 1HJBA 3N4XA 1YIQA 5KJ7C 3A0HH 1RZ5A 3O0RC 2HODA 3JCUE 5CJ0A 1K3HA 1LTJB 1ZW0A 1OW6A 2AXTE 2ITAA 3RBZA 4PV1B 1L0NG 451CA 3AEGC 5KLVJ 1PPJD 1NKZB 2IBZE 1CHHA 2W6AA 1GTWA 2IDBA 3L71D 3CWBJ 4K3IA 1COTA 2Q7CA 5AW2B 5APSA 1FZBA 1UIXA 4WBAA 1H0TA 1VDFA 1DIQC 1IFDA 2IBZD 1YTZI 5BU5A 2G3AA 4MN4C 1KYOW 4U7JA 1KORA 1PFIA 1U7MA 3OAKA 4XYDB 5KLVK 4IL6E 1FE6A 4IL6H 1ZN5A 5K5GB 2WSFJ 3WUVA 2BEQD 5B5EE 1KC8Q 2E5TA 3HQ7A 3OCDB 4EYYQ 3O8ZA 4KMGA 5AW1B 2V08A 2N18B 1GL2D 1AJYA 1IFIA 3KPEA 3E1RA 5KJ7A 1RQVA 1VQ4P 3FXDA 1NU1D 1QEXA 3VMAA 4LJIA 1FOCA 3T97A 3L73E 2ZT9B 4AUWA 4UB8V 5CIBB 1JB0J 3F89A 5APVA 5BU8B 2FXPA 3HUSB 1FJ0A 3H1IE 3H1JE 5GTHH 2H8PD 1S72P 1VQLP 2A45H 2CE1A 2YMYA 1BCCE 3L37A 1C75A 1DH3A 5CIHB 4PWAA 1GMJA 1ZP0C 3AE8C 1KFNA 2PP6A 3M97X 1CHIA 1CO6A 1R0QA 3C9IA 1L4AD 3AE9C 3A3YB 4UB6E 3X39A 2WWWA 1VYDA 4Y99C 3NXSA 3L36A 1N8RQ 2GIWA 2N9IA 4GT1A 5KAFE 3I56P 1M90Q 5B66V 3RK2D 3V4QA 1JY2P 2QSIA 2Z5IA 5KLVD 1FDIA 2JKVA 3JSVC 4FA5A 3CXHH 1H32A 1IJDB 3CXHE 3AE3C 5AW4B 3L74J 1LGHB 2YO3A 3KZIV 2L4DA 2C9XB 1LC1A 1FI9A 1VQ7P 1DIPA 4L76A 5AVYB 3A7OA 1M57D 1SVFA 1FC2C 3HQ8A 2I8FA 1SQBE 3TNUB 2KI7B 3TDKA 3B5NC 1LWUB 4N6JA 1S9KD 1EC5A 1VQPP 4YTPC 3NFQA 2OQQA 2J58A 2O01J 1HCMA 1GL2A 1NU1G 2V07A 2QVAA 4L1QA 1LTJC 1AKKA 2FY8A 5BVZA 1MZ4A 2KB7P 1N86A 2YIUB 2QJPB 2D2CC 3RMZA 1SQXD 3ZOYA 3O6QA 4D6TJ 1CYIA 5DJQB 1L4AA 4H13C 4QMAA 2M3BA 3L71J 2JEEA 2JQRA 1IK7A 5EXQA 1RH5B 2AEJA 1NAFA 1SQPJ 1AVOA 1ZR4A 1H33A 2HLOA 2C1UA 2V7QH 5CBOA 3NTNA 1YNRA 1W5CT 4H0JA 1BE3J 3M0AA 1B7VA 1JO5A 1SQXK 1SQQK 2AXCA 5APYA 1VQ5P 1M70A 1EDLA 3HE5B 3CXHW 2K3RA 3O1YA 1SQBK 2B88A 2SPZA 3L70D 1H1OA 1YFCA 1AV1A 2IYPA 3CX5I 4WQ9A 1CTJA 1IQCA 1CIGA 3RN0A 4JPZB 1DW1A 2E74C 3WFBC 1K05A 1DW2A 4OGQC 2AIUA 3L70E 1ETPA 1FZAA 1USEA 4R4MA 4WQ7A 1LTIC 1QVGO 2OYIA 3PHLA 1NMLA 5CCGD 3I55P 2YO2A 3KZIH 3HD7B 2IX7C 1MZ9A 2PCCB 1BSNA 1ZV8A 1NAYA 3V5BA 4D6TG 3NWVA 1FS0E 1RF0A 2QJKC 2LKMA 5GTIV 3B8EB 3RL0B 1DD3A 2ZYDA 4GODA 1SFCC 1KB0A 1RE4A 1EZVI 1KX2A 3HE4A 1SQVJ 2FFDA 1CSUA 1URQA 1M1JA 2IZ0A 2M5AA 1UIIA 2FYUD 3USSA 3V2PA 2YMKA 5CHXA 3PP5A 2AEFA 1CRIA 1HZUA 4JQ0D 3A2AA 3TK1A 2XU6A 2GA1A 1EDIA 2N9BA 3WC8A 1YTZT 2KZJA 3HQ9A 1YEBA 1N7SC 1HF9A 1QN2A 2H43A 2YXQB 1EDJA 3H1IG 4V2KA 3AECC 3PJSK 4HJGH 2PGDA 1SQBD 1GU2A 2YKQA 3CCUP 3HRNA 4FB1A 4AANA 2QJKB 2OGUA 3G3ZA 3L73G 1EZVD 2ZT9C 2HV4A 3RL0C 3HD7A 4ASVA 2M0BA 1L0LD 2HR3A 3DR0A 1JY2N 2KOGA 5AW8B 1HRCA 1I54A 1A56A 1NTZJ 3DMIA 2PAJA 5H2FE 4WQCA 5GTIE 3BCCJ 2HG5D 1NTME 1KILC 3CYTI 4BRYA 3CC7P 1KYOE 2N1TC 1L9JC 1U74B 5APWA 3H1KE 1EDKA 2GM4A 4WWIA 3HE5A 1NTMJ 3D6ZA 1NJIQ 2JTIB 1KX7A 3ZIYA 2IBZG 3P7KA 3W67A 1RHZB 1SLQA 4Z1MH 2P58A 1LT9A 3H1JD 1JMBA 4RJTA 2WPSA 1T2KD 1SS1A 3AE7C 1CTYA 3L70G 2B10B 2JR8A 1GW3A 1EQ7A 4I7ZC 1QKSA 1S2EA 5AVRB 3KXDA 3L71E 1NNOA 3EQ2A 5TISV 1RAPA 3WFEC 1NU1J 1YJNP 3WMM0 1RY3A 1FZCB 3ITKA 4DT0A 5GTIH 1M8OB 1N7SB 3EFFK 2M3EA 1A02J 3ZOOA 1FI7A 1JY3O 1C2NA 2BEZF 2A06G 1HWTC 3L72J 5KJ7D 2P2UA 3TNUA 2BH5X 2YIUC 2LR2A 1F1FA 4O1WA 2Q1KA 5GTHE 1VQKP 1N7SD 1L0NK 4IFDK 3WUUA 4WQBA 1X79B 3S1KA 2B87A 5KAIV 1YCCA 3CCMP 2FFDC 4WY4C 2E74D 5TJHA 1SQVE 4OGQD 1QLED 4UB8H 1C6OA 1FZCA 4WQ8A 1RE3A 3GW6A 4C46A 2K88A 1L4AB 4GOFA 2BASA 3K5BA 3TGUG 1BL9A 2KXPB 4Y99B 2MJZA 3L4MA 3EWKA 1FZCC 1MFZA 1L0LE 1LT1A 1URQB 2DVHA 3MTUE 1IRWA 2AXTH 4ASWA 5CIGB 1Y47A 3H1HD 3BCCD 1LTBC 3CXHI 2D2CD 2WTYA 1VPCA 1HJ3A 2HFED 1NHLA 1SQBG 4BWNA 1GIWA 3L75D 2QE7H 1H31A 2WSFH 1BCCJ 1CRHA 1IFPA 2BCCE 2P67A 4U3FJ 2BCNB 1GDTA 2ZOOA 1JUNA 1CYCA 4HYTB 3HD7C 1XTGB 1W2BO 1LFMA
chains in the Genus database with same CATH topology
5KLVD 3SXTA 4L3GA 4FA5A 5B5EV 3FWLA 1LMSA 1H32A 1CC5A 4FANA 1N50A 5CYTR 3KZIV 2L4DA 2C9XB 1LC1A 3DP5A 1FI9A 2D0WA 3O5CA 2CE0A 1HZVA 1CNOA 1I5TA 1K3GA 1HROA 5CIDB 3SJLA 1M60A 1CCRA 3HQ8A 1KB9D 3H1ID 4UB6V 2I8FA 1E2RA 1I6EA 2Y0CA 3TDKA 1C2RA 1QYZA 5GTHV 3L73D 4MU8A 2QJYB 2OZ1A 1BGYD 4L3HA 1MG2D 1OAEA 1EB7A 1HCMA 2V07A 2ORLA 4NFGB 3PXSA 1I8OA 2C1DA 1CRCA 1GDVA 4L1QA 1HJ4A 4EDFA 1AKKA 2B12B 3PH2B 3VYMA 1MZ4A 4RSZA 2YIUB 2QJPB 3RMZA 1NTZD 1SQXD 3ZOYA 1CRGA 1CYIA 5DJQB 3ZBMA 3CX5D 3SWSA 3NBSA 5C0ZA 2ZONG 2JQRA 3NBTA 3WFCC 1C6RA 5EXQA 1I55A 3VRDA 4AX3A 2BPBB 4PJ0V 1H33A 1A2SA 3A0BV 3OA8B 2C1UA 1OCDA 4P4QB 1YNRA 1W5CT 4H0JA 1F1CA 5DF5A 3OCDA 2BLFB 1E8EA 1C7MA 1B7VA 2Q3EA 1GKSA 2BCCD 1SQQD 3PXWA 3SVWA 1M70A 1MG3D 1QL4A 1CYJA 3CXHW 3O1YA 3L70D 1H1OA 1YFCA 1CORA 4WQ9A 1E29A 4WQDA 2B11B 1CTJA 1IQCA 1CIGA 1SQPD 4AALA 3RN0A 2QG4A 1M6ZA 1DW1A 3PXTA 3WFBC 2RN0A 1DW2A 2AIUA 1ETPA 4WQ7A 4WQEA 4D6TD 3PHLA 1NMLA 1ZRTD 1KYOD 1CCHA 2MTAC 3L72D 1QL3A 4FA9A 1BE3D 2PCCB 5CIFB 5KAFV 3NWVA 3TF5A 4FA1A 1GJQA 4EIFA 4YE1A 2C1VA 5H2FV 1CHJA 5GTIV 2FWLA 1DT1A 1N90A 3JBTB 1KB0A 2L91A 3CP5A 4FAVA 1KX2A 1RAQA 1CRYA 2XTSB 2B4ZA 1CSUA 2D0SA 1BCCD 4DY9A 2FYUD 1DW3A 5DJQC 2OZ1B 3L74D 1CRIA 1HZUA 1IZL0 2AXTV 1DVVA 2CA4B 3PTZA 1N9CA 1SQVD 1PP9D 1CSWA 3WC8A 5C9MA 3HQ9A 1YEBA 1QN2A 1WEJF 2N18C 1C6SA 2DGEA 1I8PA 2N3BA 3KHUA 4U3FD 1CTZA 4IL6V 1IO3A 2C1DB 4V2KA 2LIRA 1SQBD 351CA 3ZOWA 1I6DA 1GU2A 2VHDA 4XXLA 3ORVA 1YEAA 2QJKB 4J20A 4AANA 4FB1A 5AURA 1EZVD 2N9JA 4O1QA 1GQ1A 5KLIB 3GG2A 2HV4A 1CXCA 4GEDB 3TGUD 1FI3A 1FHBA 5KKZB 4PW9B 1A8CA 2N9YB 1L0LD 2B0ZB 3DR0A 1YICA 1HRCA 1I54A 2C2CA 1A56A 3WFDC 3TYIA 1H31B 5IY51 3DMIA 4AAOA 1CRJA 1CXAA 2Y0EA 1H33B 2ZXYA 4WQCA 2YQBA 3RN1A 1LS9A 4FA4A 1CIHA 3CU4A 2BGVX 2YCCA 4PD4D 3CYTI 3SLEA 2KS1A 4H0KA 1L9BC 1NIRA 1L9JC 2A06D 3RLMA 1CEDA 3C2CA 2CXBA 2GC7D 1YIQA 1FCDC 1U74B 2GB8B 1AOFA 1RZ5A 1YTCA 3O0RC 3CWBD 5B6QA 1K3HA 1DW0A 2FRCA 4GYDA 3H1KD 4Q5PA 3HQ6A 2JTIB 1KX7A 1CSVA 3ZIYA 4WQAA 3PRJA 3WU2V 451CA 3H1JD 1IRVA 4A7PA 4RJTA 1PPJD 1CIEA 3O20A 4JCGA 1CHHA 1CTYA 1KV9A 3L71D 4K3IA 2B10B 1COTA 1AYGA 2O3JA 1QKSA 3OA8A 3VNWA 1NNOA 1DIQC 2IBZD 5TISV 1H32B 1RAPA 2CA3B 2GC4D 2MHMA 3WFEC 1HH7A 3ITKA 1KYOW 1S6VB 1ZZHA 2ZZS1 1HJ5A 4XYDB 2ZBOA 3H1LD 3ZOOA 1CSXA 1FI7A 1H9YA 1C2NA 4EIEA 1AOQA 1P84D 5CIEB 2BH5X 1N15A 1S5LV 4EIDA 1F1FA 4O1WA 3CXHD 3L4OA 3ZCFA 3HQ7A 3OCDB 4WQBA 155CA 4KMGA 1WVEC 2V08A 3MK7C 2N18B 3A9FA 2K9JB 4Y5RA 5KAIV 4EICA 1NU1D 1YCCA 2C8SA 3CX5W 4N0KA 3VMAA 4LJIA 1FOCA 5TJHA 4UB8V 1C6OA 5CIBB 1CIFA 1DIIC 4WQ8A 3GW6A 1LC2A 1BL9A 1FJ0A 2Y0DA 3L4MA 1KIBA 2PACA 2FYNB 5DFSA 2PCBB 2DVHA 1IRWA 2CE1A 1DVHA 3A0HV 2EXVA 5CIGB 2AI5A 3H1HD 3BCCD 2BH4X 1C75A 1NMIA 2RMZA 5CIHB 4PWAA 1HJ3A 4QAOA 1RZ6A 1GIWA 3L75D 3PLNA 1NTMD 1L0ND 3WUIA 1H31A 3M97X 4AAMA 1NTKD 1CHIA 1JDLA 1CRHA 1CO6A 2N3YA 1R0QA 2YK3A 3MK7B 2JWAA 2BCNB 5CICB 5E79V 3X39A 2ZOOA 1C52A 1U75B 1VYDA 3ZOXA 1CYCA 2LITA 2GIWA 2N9IA 2KNCB 1LFMA 1H9XA 1W2LA 1J3SA 5B66V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV D;  3SXT A;  4L3G A;  4FA5 A;  5B5E V;  3FWL A;  1LMS A;  1H32 A;  1CC5 A;  4FAN A;  1N50 A;  5CYT R;  3KZI V;  2L4D A;  2C9X B;  1LC1 A;  3DP5 A;  1FI9 A;  2D0W A;  3O5C A;  2CE0 A;  1HZV A;  1CNO A;  1I5T A;  1K3G A;  1HRO A;  5CID B;  3SJL A;  1M60 A;  1CCR A;  3HQ8 A;  1KB9 D;  3H1I D;  4UB6 V;  2I8F A;  1E2R A;  1I6E A;  2Y0C A;  3TDK A;  1C2R A;  1QYZ A;  5GTH V;  3L73 D;  4MU8 A;  2QJY B;  2OZ1 A;  1BGY D;  4L3H A;  1MG2 D;  1OAE A;  1EB7 A;  1HCM A;  2V07 A;  2ORL A;  4NFG B;  3PXS A;  1I8O A;  2C1D A;  1CRC A;  1GDV A;  4L1Q A;  1HJ4 A;  4EDF A;  1AKK A;  2B12 B;  3PH2 B;  3VYM A;  1MZ4 A;  4RSZ A;  2YIU B;  2QJP B;  3RMZ A;  1NTZ D;  1SQX D;  3ZOY A;  1CRG A;  1CYI A;  5DJQ B;  3ZBM A;  3CX5 D;  3SWS A;  3NBS A;  5C0Z A;  2ZON G;  2JQR A;  3NBT A;  3WFC C;  1C6R A;  5EXQ A;  1I55 A;  3VRD A;  4AX3 A;  2BPB B;  4PJ0 V;  1H33 A;  1A2S A;  3A0B V;  3OA8 B;  2C1U A;  1OCD A;  4P4Q B;  1YNR A;  1W5C T;  4H0J A;  1F1C A;  5DF5 A;  3OCD A;  2BLF B;  1E8E A;  1C7M A;  1B7V A;  2Q3E A;  1GKS A;  2BCC D;  1SQQ D;  3PXW A;  3SVW A;  1M70 A;  1MG3 D;  1QL4 A;  1CYJ A;  3CXH W;  3O1Y A;  3L70 D;  1H1O A;  1YFC A;  1COR A;  4WQ9 A;  1E29 A;  4WQD A;  2B11 B;  1CTJ A;  1IQC A;  1CIG A;  1SQP D;  4AAL A;  3RN0 A;  2QG4 A;  1M6Z A;  1DW1 A;  3PXT A;  3WFB C;  2RN0 A;  1DW2 A;  2AIU A;  1ETP A;  4WQ7 A;  4WQE A;  4D6T D;  3PHL A;  1NML A;  1ZRT D;  1KYO D;  1CCH A;  2MTA C;  3L72 D;  1QL3 A;  4FA9 A;  1BE3 D;  2PCC B;  5CIF B;  5KAF V;  3NWV A;  3TF5 A;  4FA1 A;  1GJQ A;  4EIF A;  4YE1 A;  2C1V A;  5H2F V;  1CHJ A;  5GTI V;  2FWL A;  1DT1 A;  1N90 A;  3JBT B;  1KB0 A;  2L91 A;  3CP5 A;  4FAV A;  1KX2 A;  1RAQ A;  1CRY A;  2XTS B;  2B4Z A;  1CSU A;  2D0S A;  1BCC D;  4DY9 A;  2FYU D;  1DW3 A;  5DJQ C;  2OZ1 B;  3L74 D;  1CRI A;  1HZU A;  1IZL 0;  2AXT V;  1DVV A;  2CA4 B;  3PTZ A;  1N9C A;  1SQV D;  1PP9 D;  1CSW A;  3WC8 A;  5C9M A;  3HQ9 A;  1YEB A;  1QN2 A;  1WEJ F;  2N18 C;  1C6S A;  2DGE A;  1I8P A;  2N3B A;  3KHU A;  4U3F D;  1CTZ A;  4IL6 V;  1IO3 A;  2C1D B;  4V2K A;  2LIR A;  1SQB D;  351C A;  3ZOW A;  1I6D A;  1GU2 A;  2VHD A;  4XXL A;  3ORV A;  1YEA A;  2QJK B;  4J20 A;  4AAN A;  4FB1 A;  5AUR A;  1EZV D;  2N9J A;  4O1Q A;  1GQ1 A;  5KLI B;  3GG2 A;  2HV4 A;  1CXC A;  4GED B;  3TGU D;  1FI3 A;  1FHB A;  5KKZ B;  4PW9 B;  1A8C A;  2N9Y B;  1L0L D;  2B0Z B;  3DR0 A;  1YIC A;  1HRC A;  1I54 A;  2C2C A;  1A56 A;  3WFD C;  3TYI A;  1H31 B;  5IY5 1;  3DMI A;  4AAO A;  1CRJ A;  1CXA A;  2Y0E A;  1H33 B;  2ZXY A;  4WQC A;  2YQB A;  3RN1 A;  1LS9 A;  4FA4 A;  1CIH A;  3CU4 A;  2BGV X;  2YCC A;  4PD4 D;  3CYT I;  3SLE A;  2KS1 A;  4H0K A;  1L9B C;  1NIR A;  1L9J C;  2A06 D;  3RLM A;  1CED A;  3C2C A;  2CXB A;  2GC7 D;  1YIQ A;  1FCD C;  1U74 B;  2GB8 B;  1AOF A;  1RZ5 A;  1YTC A;  3O0R C;  3CWB D;  5B6Q A;  1K3H A;  1DW0 A;  2FRC A;  4GYD A;  3H1K D;  4Q5P A;  3HQ6 A;  2JTI B;  1KX7 A;  1CSV A;  3ZIY A;  4WQA A;  3PRJ A;  3WU2 V;  451C A;  3H1J D;  1IRV A;  4A7P A;  4RJT A;  1PPJ D;  1CIE A;  3O20 A;  4JCG A;  1CHH A;  1CTY A;  1KV9 A;  3L71 D;  4K3I A;  2B10 B;  1COT A;  1AYG A;  2O3J A;  1QKS A;  3OA8 A;  3VNW A;  1NNO A;  1DIQ C;  2IBZ D;  5TIS V;  1H32 B;  1RAP A;  2CA3 B;  2GC4 D;  2MHM A;  3WFE C;  1HH7 A;  3ITK A;  1KYO W;  1S6V B;  1ZZH A;  2ZZS 1;  1HJ5 A;  4XYD B;  2ZBO A;  3H1L D;  3ZOO A;  1CSX A;  1FI7 A;  1H9Y A;  1C2N A;  4EIE A;  1AOQ A;  1P84 D;  5CIE B;  2BH5 X;  1N15 A;  1S5L V;  4EID A;  1F1F A;  4O1W A;  3CXH D;  3L4O A;  3ZCF A;  3HQ7 A;  3OCD B;  4WQB A;  155C A;  4KMG A;  1WVE C;  2V08 A;  3MK7 C;  2N18 B;  3A9F A;  2K9J B;  4Y5R A;  5KAI V;  4EIC A;  1NU1 D;  1YCC A;  2C8S A;  3CX5 W;  4N0K A;  3VMA A;  4LJI A;  1FOC A;  5TJH A;  4UB8 V;  1C6O A;  5CIB B;  1CIF A;  1DII C;  4WQ8 A;  3GW6 A;  1LC2 A;  1BL9 A;  1FJ0 A;  2Y0D A;  3L4M A;  1KIB A;  2PAC A;  2FYN B;  5DFS A;  2PCB B;  2DVH A;  1IRW A;  2CE1 A;  1DVH A;  3A0H V;  2EXV A;  5CIG B;  2AI5 A;  3H1H D;  3BCC D;  2BH4 X;  1C75 A;  1NMI A;  2RMZ A;  5CIH B;  4PWA A;  1HJ3 A;  4QAO A;  1RZ6 A;  1GIW A;  3L75 D;  3PLN A;  1NTM D;  1L0N D;  3WUI A;  1H31 A;  3M97 X;  4AAM A;  1NTK D;  1CHI A;  1JDL A;  1CRH A;  1CO6 A;  2N3Y A;  1R0Q A;  2YK3 A;  3MK7 B;  2JWA A;  2BCN B;  5CIC B;  5E79 V;  3X39 A;  2ZOO A;  1C52 A;  1U75 B;  1VYD A;  3ZOX A;  1CYC A;  2LIT A;  2GIW A;  2N9I A;  2KNC B;  1LFM A;  1H9X A;  1W2L A;  1J3S A;  5B66 V; 
#chains in the Genus database with same CATH topology
 5M1B A;  3JC2 2;  3G4S P;  3SXT A;  1L0L G;  3MIW A;  4L3G A;  1NVO A;  5CYT R;  4PV1 D;  3DP5 A;  2WQY C;  3TGU E;  5CMZ A;  1HZV A;  3OJA B;  2V7Q J;  1HRO A;  5CID B;  4IFM A;  3SJL A;  1M60 A;  1NTK J;  2ZVN B;  2O01 N;  3VN0 A;  2PFX A;  3H1I D;  2E75 C;  1I6E A;  5CCG C;  2Y0C A;  3CPW O;  1C2R A;  2R3S A;  1JY3 N;  2Z4E A;  1CW5 A;  3TGU J;  1L0L K;  2Z5H A;  1KB9 I;  1PGO A;  4I2L C;  4K3A A;  1VQ8 P;  1OAE A;  1EB7 A;  4GKG A;  2ORL A;  2C1D A;  1CRC A;  1LNQ A;  3H32 B;  3S9O A;  3VYI A;  1NTZ D;  2GUV A;  1T8Z A;  2H88 C;  1CRG A;  2NZ2 A;  1BDD A;  2WSE H;  1JY3 P;  1N73 B;  4OH8 B;  5C0Z A;  1JTH B;  1M7L A;  3NBT A;  1R8E A;  1KD1 Q;  3WFC C;  1JNM A;  3CX5 E;  1J1E C;  1KQF B;  3VRD A;  1NU1 K;  3G71 P;  3WU2 H;  3L71 G;  1M1J B;  1OCD A;  1H89 A;  3MZW B;  1F1C A;  5DF5 A;  3OCD A;  4OGQ B;  1DX7 A;  2BLF B;  1MUU A;  4H44 B;  1GD2 E;  5APT A;  1LP1 A;  3GHG B;  2R5B A;  1K04 A;  1AQ5 A;  1GKS A;  1HVV A;  2RH0 A;  1X0T A;  2W6B A;  1ZLL A;  3U59 A;  1QL4 A;  5AW7 B;  1GZL A;  4N3Y B;  1S5L E;  2A45 G;  1CI6 B;  3LW5 J;  1ZME C;  1E29 A;  4WQD A;  2WMM A;  2B11 B;  4I1L A;  2E42 A;  2Y9Y A;  4AAL A;  1S3J A;  3QH9 A;  4GOE A;  2WZ7 A;  1EXI A;  4I6M C;  1K73 Q;  3PXT A;  2IFM A;  3CCR P;  4LC1 A;  1NTM G;  2J5U A;  2FKW B;  1OVV A;  4K35 A;  3CX5 H;  4DCK A;  1CCH A;  4RES B;  2MTA C;  1L4A C;  2WPR A;  1R5S A;  2WT7 A;  2JP3 A;  1IFN A;  5CIF B;  5KAF V;  1JMM A;  3FXE A;  3M91 A;  4EIF A;  1QGK B;  2C1V A;  3VMZ A;  1FOS F;  1HBW A;  2FWL A;  4N78 D;  1QX8 A;  1RF1 B;  3LID A;  4FAV A;  4PJ0 H;  1RAQ A;  1CRY A;  2B4Z A;  4WY4 A;  3RK3 B;  3MGN A;  4O9B A;  2H89 C;  1DW3 A;  5DJQ C;  2YKP A;  2C9L Y;  1OIP A;  1IZL 0;  2AXT V;  3AED C;  2CPB A;  5AVX B;  1T2K C;  3PTZ A;  1SQV D;  1MV8 A;  1HJ0 A;  1NTZ G;  2ZT9 D;  2VRS A;  4OWF A;  4HH2 A;  2UWJ E;  4C7N A;  3L73 J;  2N18 C;  1PL5 A;  1I8P A;  3D0W A;  4AQR D;  3L75 E;  1OW7 A;  5AW9 B;  4GDO A;  1I6D A;  3ZOW A;  1YEA A;  5AUR A;  1ZOY C;  3RK3 D;  3V2Q A;  2LXB A;  1SQV K;  1QL2 A;  2M8R A;  1USD A;  1GQ1 A;  3BCC E;  1CXC A;  2JJL A;  3BAT A;  1A8C A;  3B5N A;  3CWB E;  1SQP G;  1YYC A;  2N9Y B;  1S1C X;  1QL1 A;  2POH A;  4WY4 D;  1KQS O;  2W8Z A;  3WFD C;  3TSI A;  3W68 A;  3TYI A;  4H44 D;  3Q5R A;  1VQ6 P;  5IY5 1;  1KIL E;  1SP4 A;  1Q86 Q;  1SQQ E;  2FBW C;  5AW3 B;  2Y0E A;  1H33 B;  2KSJ A;  5CCH D;  5AVT B;  2O1J A;  4NPE A;  4C7N B;  2QRX A;  2IYO A;  1N2D C;  3G9R A;  1CIH A;  3CU4 A;  3D71 A;  1E79 H;  2KNC A;  1FZG A;  2ZJS E;  4W7Y A;  2WVR A;  2KS1 A;  3SLE A;  3R2P A;  1L9B C;  1VQN P;  2QA4 P;  3KDP B;  3RLM A;  3C2C A;  3SWF A;  2B87 B;  2KUB A;  3D70 A;  1FCD C;  2GB8 B;  5APX A;  3HUS A;  2WSC H;  1YTC A;  1KV4 A;  3CWB D;  5B6Q A;  4W7Z A;  1DW0 A;  2FRC A;  5AVZ B;  4GYD A;  3H1K D;  4Q5P A;  1CSV A;  4XFJ A;  4YXW H;  3MUD A;  1DD4 A;  1W5C E;  3RK3 C;  1KN7 A;  1FAV A;  3O20 A;  1J1E B;  5EFW B;  1KV9 A;  1IFJ A;  3MHV A;  1AYG A;  1MFT A;  2O3J A;  2HOD B;  1M1J C;  3OA8 A;  2I1K A;  3M9H A;  3L72 E;  3MD0 A;  1SQP K;  1YBK A;  1H32 B;  2GC4 D;  2MHM A;  3GHG C;  3H1H G;  1VF5 B;  3L70 J;  1S6V B;  1ZZH A;  3H1L J;  1Y8A A;  1HJ5 A;  2ZBO A;  3H1L D;  3RL0 g;  5AW6 B;  4ZMD A;  1H9Y A;  4W80 A;  2OYI C;  1P84 D;  1M56 D;  2MKV A;  1D7M A;  5CCG A;  1S5L V;  2W83 C;  2N1T D;  2O01 H;  3RK3 E;  3CXH D;  3ZCF A;  3SWK A;  1BSH A;  3RGU A;  3JCU H;  5B66 H;  1WVE C;  4ZNC A;  3MK7 C;  3A9F A;  2K9J B;  2I1J A;  2W90 A;  4U3F E;  2KIK A;  3BVH A;  2C8S A;  3CX5 W;  1G2C B;  3AEE C;  4EI2 A;  3H1I J;  3CCS P;  4PD4 I;  1OWA A;  4XA4 A;  2H7H A;  3ZDM A;  2FYN B;  1VQ9 P;  2N1T B;  2WSS H;  1JY2 O;  1PGJ A;  2B9B A;  1RF1 C;  2KP8 A;  3P8C D;  2CK3 H;  5KTB A;  1DVH A;  3A0H V;  2AI5 A;  2QM7 A;  3T97 B;  1SQP E;  3CCQ P;  1FDM A;  1HH0 A;  1NTM D;  1L2P A;  1L0N D;  2PRR A;  1AA0 A;  4AAM A;  1BDC A;  1JDL A;  2ZYG A;  3WU2 E;  2N3Y A;  4EOT A;  1J2J B;  2JWA A;  4XE5 B;  5CIC B;  4CPG A;  5E79 V;  3SFD C;  1U75 B;  3ZOX A;  3B5N B;  2WPQ A;  2LIT A;  4RO0 A;  3M9B A;  3OW2 O;  1LT9 C;  3CLQ A;  1BCC G;  3L74 E;  2C0X A;  1DEB A;  1H9X A;  1W2L A;  2FYU E;  1URQ D;  4ZKU A;  2Q6Q A;  1NTK G;  5B5E V;  3FWL A;  4JYB A;  1PP9 G;  4FAN A;  4RKU J;  1PGP A;  1FBM A;  3H1J G;  1S5L X;  1H0T B;  3QWO C;  2D0W A;  2XKM A;  3O5C A;  2CE0 A;  2CPS A;  3EFG A;  1CCR A;  1G1I A;  4UB6 V;  1MKM A;  1YHQ P;  5GTH V;  1EZV G;  1LWU A;  3L73 D;  1LT9 B;  2OZ1 A;  1BGY D;  4L3H A;  3V2R A;  3CC4 P;  2YXR B;  4NFG B;  3CD6 P;  3PXS A;  1I8O A;  1GL2 B;  1PPJ E;  5KAI E;  1GDV A;  1HJ4 A;  4EDF A;  2FFD B;  2B12 B;  1KIL D;  3VYM A;  3MP7 B;  1CZQ A;  5CBN A;  1WT6 A;  3HTK A;  3ZBM A;  1KYO H;  2IPP A;  2P7J A;  1NWQ A;  3SWS A;  1KYO I;  3C1L A;  5AVV B;  2JO1 A;  1FU1 A;  2ZON G;  2FXM A;  1N7S A;  1C6R A;  5L8R J;  4BXL A;  4AX3 A;  1FOS E;  1NH4 A;  4N78 E;  3BRV B;  1NOH A;  1A2S A;  2FYZ A;  3OA8 B;  1URQ C;  1PV3 A;  4IFF A;  2K9Y A;  2YNY A;  3L35 A;  2KLV A;  2ZAE B;  2BCC D;  1S4X A;  1L0N E;  3H1J J;  4I7Z B;  1MG3 D;  5KKZ C;  1CYJ A;  2ZFC A;  2NPS D;  2E43 A;  2ZXX A;  3IAO A;  5AW0 B;  2J59 M;  3IFM A;  3GMA A;  1SQP D;  1AQT A;  2QG4 A;  1M6Z A;  1GK6 A;  1EZV E;  2RN0 A;  3H1L E;  4JBZ A;  1WMK A;  3RK2 B;  1LP1 B;  3GHG A;  3GLM A;  2OYI B;  1BGY G;  2N1T A;  1G2C A;  4D6T D;  2FXO A;  3P32 A;  4JYC A;  1ZRT D;  1KYO D;  3L72 D;  3AEA C;  1ZXG A;  3VP9 A;  1QL3 A;  4KT0 J;  2ZVO B;  2P10 A;  2M5A B;  4WB4 A;  1GJQ A;  4YE1 A;  3ABV C;  2FYU G;  1LWU C;  5H2F V;  1CHJ A;  3TYY A;  3A0B H;  3VOP A;  1L0L J;  1DT1 A;  1N90 A;  3JBT B;  2Q9I A;  2L91 A;  1OX3 A;  4PV1 C;  2XTS B;  1Z56 A;  1NTK K;  1BCC D;  2OYH A;  1H88 A;  3V2N A;  1N73 C;  4H0L C;  5KLV E;  3L74 D;  1DVV A;  1HGZ A;  1J1D C;  2YKO A;  5H2F H;  1N9C A;  5TIS E;  1PP9 D;  5C9M A;  2XND H;  1OW8 A;  2D2C B;  3UIA A;  3E1I A;  2DGE A;  3VMX A;  1VQO P;  3KHU A;  4IL6 V;  1IO3 A;  2C1D B;  2LIR A;  1Q81 Q;  2RKL A;  2VHD A;  3H6P A;  4XXL A;  4WY4 B;  3ORV A;  2HPC A;  1T6A A;  3M06 A;  2N9J A;  3GG2 A;  1IZN B;  1OXZ A;  1KQG B;  4GED B;  3CCE P;  1P84 E;  1FHB A;  3PH0 A;  5KKZ B;  3CI9 A;  4L74 A;  1YI2 P;  4KHX A;  3G6E P;  2B0Z B;  2K9J A;  5B5E H;  1YIC A;  3M9Q A;  2QJY C;  2E5Y A;  3B5N D;  1H31 B;  1U7J A;  3CL3 D;  4EIJ A;  1EXJ A;  4AAO A;  5KLV G;  2XZR A;  1CRJ A;  1CXA A;  3HUS C;  2K1A A;  2WSE J;  3RN1 A;  1BE3 E;  1LS9 A;  4FA4 A;  3H1K J;  2BGV X;  2OYH B;  5AVQ B;  4PD4 D;  3L75 J;  3SSU A;  3VP8 A;  1GU5 A;  5AW5 B;  2K37 A;  5KLI C;  2AEM A;  2R32 A;  3MUD C;  3AE5 C;  3N7N A;  2CXB A;  2GC7 D;  3L72 G;  1AOF A;  4PJ0 E;  2KLU A;  3M0D C;  1RE3 C;  1LTJ A;  1PGQ A;  2QIW A;  2OAR A;  1L0N J;  1U57 A;  3Q5S A;  3HQ6 A;  2FYU K;  3AE4 C;  2Y9Z A;  4WQA A;  3HE4 B;  1YJW P;  3PRJ A;  2LXC B;  3WU2 V;  2R44 A;  1AVY A;  1Q90 D;  3U1C A;  1P84 H;  2A06 E;  1FZE A;  2O1K A;  1IRV A;  4A7P A;  4C7R A;  1VL2 A;  2OYH C;  1CIE A;  4JCG A;  2HPC B;  2E76 C;  1KIL B;  2G8Y A;  3H1L G;  3S4R A;  5CCH C;  3VNW A;  1W2E A;  5KAI H;  2R5D A;  2WT7 B;  2GUS A;  3H32 A;  4H44 C;  2CA3 B;  2W6J H;  3HD7 D;  3C8V A;  4UB6 H;  1HH7 A;  2OTK E;  1KFM A;  2XNX A;  1Q2N A;  4KJM A;  2ZZS 1;  5C39 A;  3CC2 P;  3FGA D;  1Y9B A;  1CSX A;  1Q82 Q;  3CCL P;  2C0W A;  4EIE A;  3RL0 D;  1AOQ A;  1S5L H;  5CIE B;  1N15 A;  3H1H J;  1G1J A;  4EID A;  1NTM K;  3L4O A;  1SQX E;  2JWD A;  155C A;  1PIX A;  1X9V A;  3H1K G;  3AEF C;  4L73 A;  3CWB G;  2WPV B;  4Y5R A;  4EIC A;  2OYO A;  4N0K A;  1KB9 H;  1JEK A;  3A0B E;  3Q2Y A;  1VF5 D;  3CCJ P;  2NRG A;  3L4F A;  1PZQ A;  1SFC B;  1CIF A;  1N73 A;  1DII C;  1LC2 A;  1ZRT E;  1GU4 A;  3L75 G;  2Y0D A;  1NTZ K;  1KIB A;  2ZYA A;  1VQM P;  1RF0 C;  2PAC A;  5DFS A;  1PPJ G;  2PCB B;  2NPS B;  3B4S A;  1TU3 F;  1JCC A;  5KAF H;  1YJ9 P;  2EXV A;  2BH4 X;  1RE4 C;  1NMI A;  2RMZ A;  3H25 A;  3KYQ A;  2Q5U A;  1NO4 A;  4QAO A;  3KZI E;  1RZ6 A;  2HYN A;  3PLN A;  2QEX P;  3WUI A;  1NTK D;  1CI6 A;  1T3U A;  3CMA P;  1IK9 A;  4PD4 E;  2YK3 A;  3MK7 B;  2W27 A;  3D6Y A;  1S9K E;  3LIE A;  1C52 A;  1LTT C;  1J1D B;  2DW3 A;  3V6I A;  2IBZ I;  1PP9 E;  1NTK E;  1KMI Z;  3I5C A;  1AFO A;  4NPF X;  4BRY B;  2KNC B;  1J3S A;  2KZI A;  3L74 G;  2QM8 A;  5DJU B;  2NPS A;  4UB8 E;  1LMS A;  1JOC A;  1CC5 A;  3Q5P A;  1N50 A;  1YIJ P;  1FZF A;  2KYV A;  3P8C E;  1VF5 C;  5DJT B;  5B66 E;  3AE6 C;  3CCV P;  4ZKP A;  1CNO A;  2NPS C;  1I5T A;  4DOJ A;  1K3G A;  3P8M C;  2C9N Y;  4DZO A;  5AVU B;  1PP9 J;  1YQ3 C;  5CJ4 A;  1KB9 D;  1E2R A;  1SFC D;  4M3L A;  1NKN A;  1QYZ A;  1OFC X;  4MU8 A;  2QJY B;  2OTL P;  4TLF A;  1MG2 D;  1KTM A;  3B71 A;  3Q3D A;  4D6T E;  3KQG A;  1SQX G;  1GK4 A;  1LJ2 A;  3PH2 B;  4RSZ A;  1LTS C;  3VTP C;  2BCC J;  1IC2 A;  1KZU B;  2IFN A;  2E74 B;  3FWN A;  3CX5 D;  1WRG A;  3NBS A;  1KIL A;  4JF7 A;  1E5W A;  1I55 A;  1OVR A;  3R4Y A;  2XV5 A;  2BPB B;  4PJ0 V;  4U3F G;  2P1J A;  3AE2 C;  5CCH A;  5AVW B;  2OTJ P;  3A0B V;  3E7K A;  1OZH A;  2E75 D;  2R3C A;  3F5H A;  4P4Q B;  1GW4 A;  1SQB J;  3M0D A;  1E8E A;  4R4L A;  4LGD E;  1C7M A;  3BAS A;  4H0L D;  1SQQ J;  2Q3E A;  2A45 I;  5TIS H;  2QJP C;  1SQX J;  4NPD A;  1SQQ D;  3PXW A;  1OVU A;  4TT3 H;  4HB1 A;  3SVW A;  4GIF A;  3WUT A;  2FYU J;  5AVS B;  3IN6 A;  1JCD A;  3H1H E;  1COR A;  1N7L A;  1A02 F;  3SFE C;  3IR9 A;  1BGY J;  1K8A Q;  1CSB A;  3VMY A;  3IF4 A;  1XTC C;  1H8A A;  3II6 A;  4WQE A;  1R5L A;  4DJG A;  1BE3 G;  4H0L B;  3O6Q B;  2KSE A;  1RQU A;  1NYH A;  1T3J A;  4FA9 A;  1BE3 D;  1YIT P;  2E75 B;  3TF5 A;  1SFC A;  4FA1 A;  1IFM A;  1NU1 E;  1NGM B;  2XDJ A;  1IO4 A;  1RF1 A;  4WVZ A;  1X8Y A;  3LW5 H;  5E79 E;  1FJK A;  3SWY A;  5APU A;  4HKZ H;  2Q3I A;  3CP5 A;  1FDO A;  4AYC A;  5APQ A;  2BCC G;  2D0S A;  2KK7 A;  3FX0 A;  3U1A A;  1ZR2 A;  2FYN C;  4DY9 A;  1JM0 A;  4LLH A;  1M1K Q;  2OZ1 B;  4YXD C;  3Q1M A;  1KQL A;  1SQQ G;  2V4H A;  3AEB C;  1P84 I;  3AE1 C;  1LTA C;  2CA4 B;  3RK2 C;  4B86 A;  1QVF O;  1X22 A;  1CSW A;  2E76 D;  3A5T A;  4L75 A;  1JTH A;  3OA7 A;  1HTL C;  1WEJ F;  3HTK B;  1HUC A;  1C6S A;  2N3B A;  3NMD A;  4H13 B;  3BCC G;  4U3F D;  1CTZ A;  2IZ1 A;  3GF3 A;  351C A;  1OMI A;  3A0H E;  4J20 A;  2WIT A;  3CME P;  1SQV G;  4O1Q A;  4IL6 X;  1K9M Q;  5KLI B;  3TGU D;  1FI3 A;  3BRT B;  4YPC A;  4PW9 B;  4IOI H;  1FJP A;  5E79 H;  2JDI H;  2L5G B;  1NTZ E;  2KS1 B;  1DEE G;  1Q7Y Q;  1HGV A;  2C2C A;  3RBX A;  1YQ4 C;  2B89 A;  4PD4 H;  1LTG C;  2ZXY A;  4H13 D;  2YQB A;  4OVN F;  3V4W A;  1BGY E;  2YCC A;  1KB9 E;  4H0K A;  3GF7 A;  2E76 B;  1NIR A;  2ZXE B;  4Y28 J;  2I8D A;  2A06 D;  2WSC J;  1CED A;  1GL2 C;  1HJB A;  3N4X A;  1YIQ A;  5KJ7 C;  3A0H H;  1RZ5 A;  3O0R C;  2HOD A;  3JCU E;  5CJ0 A;  1K3H A;  1LTJ B;  1ZW0 A;  1OW6 A;  2AXT E;  2ITA A;  3RBZ A;  4PV1 B;  1L0N G;  451C A;  3AEG C;  5KLV J;  1PPJ D;  1NKZ B;  2IBZ E;  1CHH A;  2W6A A;  1GTW A;  2IDB A;  3L71 D;  3CWB J;  4K3I A;  1COT A;  2Q7C A;  5AW2 B;  5APS A;  1FZB A;  1UIX A;  4WBA A;  1H0T A;  1VDF A;  1DIQ C;  1IFD A;  2IBZ D;  1YTZ I;  5BU5 A;  2G3A A;  4MN4 C;  1KYO W;  4U7J A;  1KOR A;  1PFI A;  1U7M A;  3OAK A;  4XYD B;  5KLV K;  4IL6 E;  1FE6 A;  4IL6 H;  1ZN5 A;  5K5G B;  2WSF J;  3WUV A;  2BEQ D;  5B5E E;  1KC8 Q;  2E5T A;  3HQ7 A;  3OCD B;  4EYY Q;  3O8Z A;  4KMG A;  5AW1 B;  2V08 A;  2N18 B;  1GL2 D;  1AJY A;  1IFI A;  3KPE A;  3E1R A;  5KJ7 A;  1RQV A;  1VQ4 P;  3FXD A;  1NU1 D;  1QEX A;  3VMA A;  4LJI A;  1FOC A;  3T97 A;  3L73 E;  2ZT9 B;  4AUW A;  4UB8 V;  5CIB B;  1JB0 J;  3F89 A;  5APV A;  5BU8 B;  2FXP A;  3HUS B;  1FJ0 A;  3H1I E;  3H1J E;  5GTH H;  2H8P D;  1S72 P;  1VQL P;  2A45 H;  2CE1 A;  2YMY A;  1BCC E;  3L37 A;  1C75 A;  1DH3 A;  5CIH B;  4PWA A;  1GMJ A;  1ZP0 C;  3AE8 C;  1KFN A;  2PP6 A;  3M97 X;  1CHI A;  1CO6 A;  1R0Q A;  3C9I A;  1L4A D;  3AE9 C;  3A3Y B;  4UB6 E;  3X39 A;  2WWW A;  1VYD A;  4Y99 C;  3NXS A;  3L36 A;  1N8R Q;  2GIW A;  2N9I A;  4GT1 A;  5KAF E;  3I56 P;  1M90 Q;  5B66 V;  3RK2 D;  3V4Q A;  1JY2 P;  2QSI A;  2Z5I A;  5KLV D;  1FDI A;  2JKV A;  3JSV C;  4FA5 A;  3CXH H;  1H32 A;  1IJD B;  3CXH E;  3AE3 C;  5AW4 B;  3L74 J;  1LGH B;  2YO3 A;  3KZI V;  2L4D A;  2C9X B;  1LC1 A;  1FI9 A;  1VQ7 P;  1DIP A;  4L76 A;  5AVY B;  3A7O A;  1M57 D;  1SVF A;  1FC2 C;  3HQ8 A;  2I8F A;  1SQB E;  3TNU B;  2KI7 B;  3TDK A;  3B5N C;  1LWU B;  4N6J A;  1S9K D;  1EC5 A;  1VQP P;  4YTP C;  3NFQ A;  2OQQ A;  2J58 A;  2O01 J;  1HCM A;  1GL2 A;  1NU1 G;  2V07 A;  2QVA A;  4L1Q A;  1LTJ C;  1AKK A;  2FY8 A;  5BVZ A;  1MZ4 A;  2KB7 P;  1N86 A;  2YIU B;  2QJP B;  2D2C C;  3RMZ A;  1SQX D;  3ZOY A;  3O6Q A;  4D6T J;  1CYI A;  5DJQ B;  1L4A A;  4H13 C;  4QMA A;  2M3B A;  3L71 J;  2JEE A;  2JQR A;  1IK7 A;  5EXQ A;  1RH5 B;  2AEJ A;  1NAF A;  1SQP J;  1AVO A;  1ZR4 A;  1H33 A;  2HLO A;  2C1U A;  2V7Q H;  5CBO A;  3NTN A;  1YNR A;  1W5C T;  4H0J A;  1BE3 J;  3M0A A;  1B7V A;  1JO5 A;  1SQX K;  1SQQ K;  2AXC A;  5APY A;  1VQ5 P;  1M70 A;  1EDL A;  3HE5 B;  3CXH W;  2K3R A;  3O1Y A;  1SQB K;  2B88 A;  2SPZ A;  3L70 D;  1H1O A;  1YFC A;  1AV1 A;  2IYP A;  3CX5 I;  4WQ9 A;  1CTJ A;  1IQC A;  1CIG A;  3RN0 A;  4JPZ B;  1DW1 A;  2E74 C;  3WFB C;  1K05 A;  1DW2 A;  4OGQ C;  2AIU A;  3L70 E;  1ETP A;  1FZA A;  1USE A;  4R4M A;  4WQ7 A;  1LTI C;  1QVG O;  2OYI A;  3PHL A;  1NML A;  5CCG D;  3I55 P;  2YO2 A;  3KZI H;  3HD7 B;  2IX7 C;  1MZ9 A;  2PCC B;  1BSN A;  1ZV8 A;  1NAY A;  3V5B A;  4D6T G;  3NWV A;  1FS0 E;  1RF0 A;  2QJK C;  2LKM A;  5GTI V;  3B8E B;  3RL0 B;  1DD3 A;  2ZYD A;  4GOD A;  1SFC C;  1KB0 A;  1RE4 A;  1EZV I;  1KX2 A;  3HE4 A;  1SQV J;  2FFD A;  1CSU A;  1URQ A;  1M1J A;  2IZ0 A;  2M5A A;  1UII A;  2FYU D;  3USS A;  3V2P A;  2YMK A;  5CHX A;  3PP5 A;  2AEF A;  1CRI A;  1HZU A;  4JQ0 D;  3A2A A;  3TK1 A;  2XU6 A;  2GA1 A;  1EDI A;  2N9B A;  3WC8 A;  1YTZ T;  2KZJ A;  3HQ9 A;  1YEB A;  1N7S C;  1HF9 A;  1QN2 A;  2H43 A;  2YXQ B;  1EDJ A;  3H1I G;  4V2K A;  3AEC C;  3PJS K;  4HJG H;  2PGD A;  1SQB D;  1GU2 A;  2YKQ A;  3CCU P;  3HRN A;  4FB1 A;  4AAN A;  2QJK B;  2OGU A;  3G3Z A;  3L73 G;  1EZV D;  2ZT9 C;  2HV4 A;  3RL0 C;  3HD7 A;  4ASV A;  2M0B A;  1L0L D;  2HR3 A;  3DR0 A;  1JY2 N;  2KOG A;  5AW8 B;  1HRC A;  1I54 A;  1A56 A;  1NTZ J;  3DMI A;  2PAJ A;  5H2F E;  4WQC A;  5GTI E;  3BCC J;  2HG5 D;  1NTM E;  1KIL C;  3CYT I;  4BRY A;  3CC7 P;  1KYO E;  2N1T C;  1L9J C;  1U74 B;  5APW A;  3H1K E;  1EDK A;  2GM4 A;  4WWI A;  3HE5 A;  1NTM J;  3D6Z A;  1NJI Q;  2JTI B;  1KX7 A;  3ZIY A;  2IBZ G;  3P7K A;  3W67 A;  1RHZ B;  1SLQ A;  4Z1M H;  2P58 A;  1LT9 A;  3H1J D;  1JMB A;  4RJT A;  2WPS A;  1T2K D;  1SS1 A;  3AE7 C;  1CTY A;  3L70 G;  2B10 B;  2JR8 A;  1GW3 A;  1EQ7 A;  4I7Z C;  1QKS A;  1S2E A;  5AVR B;  3KXD A;  3L71 E;  1NNO A;  3EQ2 A;  5TIS V;  1RAP A;  3WFE C;  1NU1 J;  1YJN P;  3WMM 0;  1RY3 A;  1FZC B;  3ITK A;  4DT0 A;  5GTI H;  1M8O B;  1N7S B;  3EFF K;  2M3E A;  1A02 J;  3ZOO A;  1FI7 A;  1JY3 O;  1C2N A;  2BEZ F;  2A06 G;  1HWT C;  3L72 J;  5KJ7 D;  2P2U A;  3TNU A;  2BH5 X;  2YIU C;  2LR2 A;  1F1F A;  4O1W A;  2Q1K A;  5GTH E;  1VQK P;  1N7S D;  1L0N K;  4IFD K;  3WUU A;  4WQB A;  1X79 B;  3S1K A;  2B87 A;  5KAI V;  1YCC A;  3CCM P;  2FFD C;  4WY4 C;  2E74 D;  5TJH A;  1SQV E;  4OGQ D;  1QLE D;  4UB8 H;  1C6O A;  1FZC A;  4WQ8 A;  1RE3 A;  3GW6 A;  4C46 A;  2K88 A;  1L4A B;  4GOF A;  2BAS A;  3K5B A;  3TGU G;  1BL9 A;  2KXP B;  4Y99 B;  2MJZ A;  3L4M A;  3EWK A;  1FZC C;  1MFZ A;  1L0L E;  1LT1 A;  1URQ B;  2DVH A;  3MTU E;  1IRW A;  2AXT H;  4ASW A;  5CIG B;  1Y47 A;  3H1H D;  3BCC D;  1LTB C;  3CXH I;  2D2C D;  2WTY A;  1VPC A;  1HJ3 A;  2HFE D;  1NHL A;  1SQB G;  4BWN A;  1GIW A;  3L75 D;  2QE7 H;  1H31 A;  2WSF H;  1BCC J;  1CRH A;  1IFP A;  2BCC E;  2P67 A;  4U3F J;  2BCN B;  1GDT A;  2ZOO A;  1JUN A;  1CYC A;  4HYT B;  3HD7 C;  1XTG B;  1W2B O;  1LFM A; 
#chains in the Genus database with same CATH homology
 5KLV D;  3SXT A;  4L3G A;  4FA5 A;  5B5E V;  3FWL A;  1LMS A;  1H32 A;  1CC5 A;  4FAN A;  1N50 A;  5CYT R;  3KZI V;  2L4D A;  2C9X B;  1LC1 A;  3DP5 A;  1FI9 A;  2D0W A;  3O5C A;  2CE0 A;  1HZV A;  1CNO A;  1I5T A;  1K3G A;  1HRO A;  5CID B;  3SJL A;  1M60 A;  1CCR A;  3HQ8 A;  1KB9 D;  3H1I D;  4UB6 V;  2I8F A;  1E2R A;  1I6E A;  2Y0C A;  3TDK A;  1C2R A;  1QYZ A;  5GTH V;  3L73 D;  4MU8 A;  2QJY B;  2OZ1 A;  1BGY D;  4L3H A;  1MG2 D;  1OAE A;  1EB7 A;  1HCM A;  2V07 A;  2ORL A;  4NFG B;  3PXS A;  1I8O A;  2C1D A;  1CRC A;  1GDV A;  4L1Q A;  1HJ4 A;  4EDF A;  1AKK A;  2B12 B;  3PH2 B;  3VYM A;  1MZ4 A;  4RSZ A;  2YIU B;  2QJP B;  3RMZ A;  1NTZ D;  1SQX D;  3ZOY A;  1CRG A;  1CYI A;  5DJQ B;  3ZBM A;  3CX5 D;  3SWS A;  3NBS A;  5C0Z A;  2ZON G;  2JQR A;  3NBT A;  3WFC C;  1C6R A;  5EXQ A;  1I55 A;  3VRD A;  4AX3 A;  2BPB B;  4PJ0 V;  1H33 A;  1A2S A;  3A0B V;  3OA8 B;  2C1U A;  1OCD A;  4P4Q B;  1YNR A;  1W5C T;  4H0J A;  1F1C A;  5DF5 A;  3OCD A;  2BLF B;  1E8E A;  1C7M A;  1B7V A;  2Q3E A;  1GKS A;  2BCC D;  1SQQ D;  3PXW A;  3SVW A;  1M70 A;  1MG3 D;  1QL4 A;  1CYJ A;  3CXH W;  3O1Y A;  3L70 D;  1H1O A;  1YFC A;  1COR A;  4WQ9 A;  1E29 A;  4WQD A;  2B11 B;  1CTJ A;  1IQC A;  1CIG A;  1SQP D;  4AAL A;  3RN0 A;  2QG4 A;  1M6Z A;  1DW1 A;  3PXT A;  3WFB C;  2RN0 A;  1DW2 A;  2AIU A;  1ETP A;  4WQ7 A;  4WQE A;  4D6T D;  3PHL A;  1NML A;  1ZRT D;  1KYO D;  1CCH A;  2MTA C;  3L72 D;  1QL3 A;  4FA9 A;  1BE3 D;  2PCC B;  5CIF B;  5KAF V;  3NWV A;  3TF5 A;  4FA1 A;  1GJQ A;  4EIF A;  4YE1 A;  2C1V A;  5H2F V;  1CHJ A;  5GTI V;  2FWL A;  1DT1 A;  1N90 A;  3JBT B;  1KB0 A;  2L91 A;  3CP5 A;  4FAV A;  1KX2 A;  1RAQ A;  1CRY A;  2XTS B;  2B4Z A;  1CSU A;  2D0S A;  1BCC D;  4DY9 A;  2FYU D;  1DW3 A;  5DJQ C;  2OZ1 B;  3L74 D;  1CRI A;  1HZU A;  1IZL 0;  2AXT V;  1DVV A;  2CA4 B;  3PTZ A;  1N9C A;  1SQV D;  1PP9 D;  1CSW A;  3WC8 A;  5C9M A;  3HQ9 A;  1YEB A;  1QN2 A;  1WEJ F;  2N18 C;  1C6S A;  2DGE A;  1I8P A;  2N3B A;  3KHU A;  4U3F D;  1CTZ A;  4IL6 V;  1IO3 A;  2C1D B;  4V2K A;  2LIR A;  1SQB D;  351C A;  3ZOW A;  1I6D A;  1GU2 A;  2VHD A;  4XXL A;  3ORV A;  1YEA A;  2QJK B;  4J20 A;  4AAN A;  4FB1 A;  5AUR A;  1EZV D;  2N9J A;  4O1Q A;  1GQ1 A;  5KLI B;  3GG2 A;  2HV4 A;  1CXC A;  4GED B;  3TGU D;  1FI3 A;  1FHB A;  5KKZ B;  4PW9 B;  1A8C A;  2N9Y B;  1L0L D;  2B0Z B;  3DR0 A;  1YIC A;  1HRC A;  1I54 A;  2C2C A;  1A56 A;  3WFD C;  3TYI A;  1H31 B;  5IY5 1;  3DMI A;  4AAO A;  1CRJ A;  1CXA A;  2Y0E A;  1H33 B;  2ZXY A;  4WQC A;  2YQB A;  3RN1 A;  1LS9 A;  4FA4 A;  1CIH A;  3CU4 A;  2BGV X;  2YCC A;  4PD4 D;  3CYT I;  3SLE A;  2KS1 A;  4H0K A;  1L9B C;  1NIR A;  1L9J C;  2A06 D;  3RLM A;  1CED A;  3C2C A;  2CXB A;  2GC7 D;  1YIQ A;  1FCD C;  1U74 B;  2GB8 B;  1AOF A;  1RZ5 A;  1YTC A;  3O0R C;  3CWB D;  5B6Q A;  1K3H A;  1DW0 A;  2FRC A;  4GYD A;  3H1K D;  4Q5P A;  3HQ6 A;  2JTI B;  1KX7 A;  1CSV A;  3ZIY A;  4WQA A;  3PRJ A;  3WU2 V;  451C A;  3H1J D;  1IRV A;  4A7P A;  4RJT A;  1PPJ D;  1CIE A;  3O20 A;  4JCG A;  1CHH A;  1CTY A;  1KV9 A;  3L71 D;  4K3I A;  2B10 B;  1COT A;  1AYG A;  2O3J A;  1QKS A;  3OA8 A;  3VNW A;  1NNO A;  1DIQ C;  2IBZ D;  5TIS V;  1H32 B;  1RAP A;  2CA3 B;  2GC4 D;  2MHM A;  3WFE C;  1HH7 A;  3ITK A;  1KYO W;  1S6V B;  1ZZH A;  2ZZS 1;  1HJ5 A;  4XYD B;  2ZBO A;  3H1L D;  3ZOO A;  1CSX A;  1FI7 A;  1H9Y A;  1C2N A;  4EIE A;  1AOQ A;  1P84 D;  5CIE B;  2BH5 X;  1N15 A;  1S5L V;  4EID A;  1F1F A;  4O1W A;  3CXH D;  3L4O A;  3ZCF A;  3HQ7 A;  3OCD B;  4WQB A;  155C A;  4KMG A;  1WVE C;  2V08 A;  3MK7 C;  2N18 B;  3A9F A;  2K9J B;  4Y5R A;  5KAI V;  4EIC A;  1NU1 D;  1YCC A;  2C8S A;  3CX5 W;  4N0K A;  3VMA A;  4LJI A;  1FOC A;  5TJH A;  4UB8 V;  1C6O A;  5CIB B;  1CIF A;  1DII C;  4WQ8 A;  3GW6 A;  1LC2 A;  1BL9 A;  1FJ0 A;  2Y0D A;  3L4M A;  1KIB A;  2PAC A;  2FYN B;  5DFS A;  2PCB B;  2DVH A;  1IRW A;  2CE1 A;  1DVH A;  3A0H V;  2EXV A;  5CIG B;  2AI5 A;  3H1H D;  3BCC D;  2BH4 X;  1C75 A;  1NMI A;  2RMZ A;  5CIH B;  4PWA A;  1HJ3 A;  4QAO A;  1RZ6 A;  1GIW A;  3L75 D;  3PLN A;  1NTM D;  1L0N D;  3WUI A;  1H31 A;  3M97 X;  4AAM A;  1NTK D;  1CHI A;  1JDL A;  1CRH A;  1CO6 A;  2N3Y A;  1R0Q A;  2YK3 A;  3MK7 B;  2JWA A;  2BCN B;  5CIC B;  5E79 V;  3X39 A;  2ZOO A;  1C52 A;  1U75 B;  1VYD A;  3ZOX A;  1CYC A;  2LIT A;  2GIW A;  2N9I A;  2KNC B;  1LFM A;  1H9X A;  1W2L A;  1J3S A;  5B66 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...