3CXHD

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 71
structure length 246
sequence length 246
chains with identical sequence O
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cxhD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cxhD02
1I54A 2CXBA 1H1OA 1H33A 1OCDA 1N9CA 1CORA 3ZOYA 2C9XB 4PW9B 1N50A 1COTA 2K9JB 3TYIA 1EZVD 4WQAA 2YK3A 2PCCB 3HQ7A 4EICA 5C9MA 2N9JA 1NU1D 1GJQA 2RN0A 3L74D 2ZOOA 1YEAA 1KX7A 2CA4B 4WQEA 3WU2V 2C8SA 2IBZD 1QL3A 1ZRTD 1E8EA 2Y0CA 3C2CA 1CSUA 2AIUA 5KLIB 1FI9A 4GYDA 3GW6A 3PXWA 1L0ND 5B5EV 1N90A 4H0JA 1ETPA 4AANA 2C1DA 3A9FA 5GTHV 1WEJF 5CIFB 4WQ8A 3H1JD 1M70A 1HZUA 3DMIA 1LC1A 2L91A 2V08A 1CC5A 2BGVX 3SLEA 1GIWA 5DJQC 5CIHB 3VRDA 2N9YB 2GC4D 1H9YA 3KZIV 4GEDB 4IL6V 1C6SA 5TJHA 1R0QA 5KLVD 1DW2A 1FCDC 4AAMA 1PPJD 1H9XA 2CA3B 1CRIA 2QJYB 1NTZD 5B6QA 3RN1A 4DY9A 1YICA 3O5CA 2O3JA 1KX2A 4EIDA 1I8PA 3MK7B 2ZXYA 1FOCA 2DVHA 5C0ZA 3WFBC 1IRWA 4EDFA 1DW1A 3H1LD 3VYMA 1KIBA 4XYDB 1QN2A 4YE1A 1A56A 2I8FA 3ZCFA 1SQBD 4O1WA 3X39A 3CX5W 2ZBOA 1I6EA 1H33B 3CYTI 3CWBD 3L4MA 2Q3EA 2OZ1B 2JTIB 3DR0A 2BCCD 2DGEA 2N9IA 1DT1A 1LMSA 1W5CT 1DIQC 1CRHA 2XTSB 5CICB 155CA 4QAOA 1CIHA 3SJLA 1CTZA 2FWLA 3HQ6A 3SXTA 3H1KD 1LC2A 3WC8A 4MU8A 4N0KA 1DIIC 1A2SA 4L3HA 1SQPD 1CCHA 2VHDA 3L71D 1N15A 1HROA 3PTZA 1AOFA 1C2NA 3TGUD 1L9JC 1IO3A 2LITA 5KAIV 1BE3D 2C2CA 1KYOD 1YIQA 1CHJA 1CSVA 4L1QA 1E2RA 1LS9A 3VMAA 1NMLA 3VNWA 1U75B 2ZONG 2BH4X 1S6VB 1I55A 3WFDC 3OA8B 2AI5A 5AURA 3O1YA 1CYCA 4L3GA 3M97X 2BPBB 1H31A 1U74B 2B11B 5DJQB 2KS1A 1QYZA 5GTIV 1M6ZA 1GQ1A 3CXHW 1HCMA 2D0SA 1RZ6A 4WQBA 5CIEB 4Q5PA 2B0ZB 2YQBA 1IRVA 1C75A 1LFMA 3HQ8A 3L70D 5CYTR 5KKZB 1S5LV 1KV9A 4K3IA 3ZOWA 5TISV 1H32A 1RAPA 1J3SA 1NTMD 1FHBA 1FI7A 1KYOW 1IQCA 1C2RA 3L72D 1CXAA 4WQ9A 2GIWA 1JDLA 3WFEC 1CO6A 3ZOOA 5H2FV 1NMIA 3DP5A 4FA5A 5CIDB 3RMZA 5EXQA 3ITKA 2N3BA 2GC7D 2QJPB 3H1HD 2B12B 4FANA 2BLFB 1MG2D 2LIRA 1DVVA 3L75D 3CX5D 2GB8B 1YTCA 1SQQD 2C1VA 2FYNB 2FYUD 4LJIA 1YNRA 1KB0A 4JCGA 4PD4D 1CSWA 3L73D 3OCDB 4WQ7A 1CXCA 2FRCA 2MTAC 4A7PA 1HJ3A 1AOQA 2PACA 2V07A 4V2KA 4AX3A 3RN0A 3NBTA 2KNCB 1NIRA 1VYDA 1H31B 3FWLA 1BGYD 4RJTA 2JWAA 1YEBA 1HJ4A 4AALA 1CIFA 4KMGA 1CNOA 1PP9D 1SQVD 1NTKD 4P4QB 1K3GA 1CCRA 1B7VA 1P84D 3O20A 2Y0EA 1HRCA 3BCCD 4FA1A 1I5TA 5KAFV 2A06D 1QL4A 1W2LA 2OZ1A 2HV4A 1CHHA 1CYIA 1YFCA 3SWSA 1BCCD 3PLNA 1CRCA 4WQCA 5E79V 4UB8V 1CIGA 4UB6V 3A0HV 1DW3A 1H32B 1C6OA 1IZL0 1CHIA 5CIGB 1CSXA 4FA4A 5IY51 1C6RA 2BH5X 1CTYA 2QJKB 3GG2A 3CP5A 3PHLA 5CIBB 4U3FD 2BCNB 2JQRA 1QKSA 1DW0A 2Y0DA 4XXLA 1CIEA 2QG4A 4EIFA 4Y5RA 2CE1A 1CRYA 2PCBB 1BL9A 3OCDA 1C7MA 4FA9A 2MHMA 3A0BV 2CE0A 3ZIYA 1E29A 1AKKA 2N18C 1CTJA 4O1QA 4RSZA 3PRJA 1RZ5A 1EB7A 2ZZS1 4AAOA 2B10B 1SQXD 3TDKA 4PJ0V 3O0RC 1YCCA 1KB9D 4PWAA 1I6DA 1HZVA 4WQDA 1CEDA 1K3HA 3MK7C 2YIUB 3CXHD 1WVEC 4EIEA 3H1ID 4H0KA 3WFCC 3PH2B 2L4DA 351CA 5DFSA 1M60A 1CRGA 3ZBMA 3WUIA 2B4ZA 451CA 3KHUA 1GU2A 2C1UA 3OA8A 3RLMA 1I8OA 2D0WA 4FAVA 1GKSA 1OAEA 1F1CA 1MZ4A 1A8CA 4FB1A 1L9BC 1F1FA 1FJ0A 3TF5A 3CU4A 1GDVA 3ZOXA 1FI3A 3L4OA 1HH7A 2RMZA 3NBSA 2EXVA 1DVHA 2YCCA 4NFGB 1CYJA 3JBTB 5DF5A 1NNOA 5B66V 2AXTV 1CRJA 2ORLA 1MG3D 3HQ9A 1C52A 4D6TD 1L0LD 4J20A 3NWVA 1HJ5A 2N3YA 2N18B 3ORVA 3SVWA 1AYGA 3PXSA 3PXTA 1ZZHA 1RAQA 2C1DB
chains in the Genus database with same CATH superfamily
1H1OA 1L0LK 3PP5A 4O9BA 5AVZB 5AW2B 1IC2A 3H1KE 4PW9B 1JMBA 3WMM0 2WVRA 2PCCB 3M9BA 1WT6A 3HQ7A 5C9MA 1JY2N 3V4WA 1VL2A 2O1KA 2ZOOA 3CWBJ 1SQVG 1YEAA 1KX7A 1LJ2A 4WQEA 3WU2V 1ZMEC 3HTKB 1A02J 2IBZD 1QL3A 4WY4D 1NH4A 1RF0A 2C9LY 4RESB 2R3CA 4GYDA 2OQQA 3GW6A 3HE5B 1N90A 1ZW0A 2O01N 1JNMA 5GTHV 2OYIA 1JTHB 2K9YA 3L72J 4WQ8A 3H1JD 1M70A 2H7HA 1HZUA 3DMIA 5CBNA 1SFCC 2E75B 1EDJA 3SLEA 4KHXA 3VRDA 3HE5A 4IL6V 1TU3F 1S2EA 4K3AA 5KLVD 1DW2A 1FCDC 3WU2E 4AAMA 1YIJP 2CA3B 3W68A 4LC1A 3BCCG 3RN1A 4DY9A 3O5CA 1KX2A 1I8PA 5CCGA 2ZXYA 1PP9G 1T3UA 1FOCA 1IK7A 5C0ZA 4L73A 3H6PA 2BCCE 2JR8A 2AXTH 2FYUK 4JYBA 1FU1A 1L0NK 1M1JA 4HYTB 2HFED 2JO1A 1KILD 1LGHB 2LKMA 1N73C 2PFXA 4YE1A 1WMKA 3U59A 2OTLP 2I8FA 1KZUB 1SQBD 2BCCJ 1RE4A 3AE9C 1KORA 2KYVA 1HF9A 3L4MA 2OZ1B 3O6QA 4EOTA 2BCCD 4L76A 2N9IA 1NTZK 3IFMA 1SQVK 2E76D 1W5CT 3A3YB 4HB1A 2JJLA 1DIQC 3RL0D 4QAOA 3MTUE 3HQ6A 1OXZA 3SXTA 4ZNCA 5AW0B 2WSFJ 3VMXA 1LC2A 1SQVE 1URQD 1DIIC 2LR2A 4L3HA 3QWOC 1KTMA 3L70E 4TLFA 1C2NA 2QA4P 1N7LA 2FXOA 3SWKA 2IBZE 2QRXA 3H1HJ 1N7SA 3P8MC 3LW5J 3GHGB 5AVQB 2N9BA 5B5EE 1VQ6P 2D2CC 1E2RA 1E5WA 2Q7CA 2I8DA 3HRNA 1U75B 1VQ9P 1I55A 2E5TA 3MHVA 3WUVA 1NOHA 1HJ0A 4JYCA 3M97X 2IYOA 1AVOA 3HUSB 1H31A 5B66H 3II6A 2KI7B 2YO2A 1PIXA 3CC7P 1QYZA 4DJGA 5GTIV 2QIWA 1HCMA 1RZ6A 4Q5PA 2B0ZB 5BU8B 1IRVA 2AXCA 3BRVB 1T8ZA 1LFMA 3HQ8A 3L70D 1HVVA 2N1TB 4BXLA 1NU1G 1KQLA 2B87B 1NTMD 2W6BA 1PV3A 2R5DA 1CXAA 2C0XA 3H32A 1CO6A 5H2FV 3L35A 3DP5A 2YKOA 4H0LD 4C7RA 3ITKA 2N3BA 3B8EB 2B12B 2QJYC 3H1KJ 2BLFB 1SQQJ 2UWJE 3FGAD 3CCUP 2LIRA 1OW7A 1DVVA 1S5LH 1SQXG 3KZIE 3KPEA 1G2CA 3WU2H 3HD7D 1YTCA 1SQQD 2C1VA 2H88C 2IBZG 2W27A 3PJSK 5KLIC 3NFQA 4LJIA 3CCVP 1KB0A 3RK3C 2OARA 4PD4D 4H44B 3OCDB 1CXCA 2N1TC 2WPQA 1HJ3A 1AOQA 1X0TA 2V07A 2AXTE 4V2KA 4DZOA 2QSIA 5APVA 3NBTA 1BGYD 4RJTA 2JWAA 1HJ4A 2IZ1A 1PP9D 1L0NG 3HUSC 4P4QB 1PPJG 1Q7YQ 1HRCA 3BCCD 2O01J 2JEEA 1PP9J 1RE4C 1W2LA 2OZ1A 1CHHA 1KMIZ 1N7SB 4OVNF 1NKZB 1SQPJ 3TNUA 3MGNA 4LLHA 3A0HV 1ZOYC 1PP9E 3P7KA 1IZL0 1RQVA 1CHIA 1CSXA 4FA4A 3TGUJ 1C6RA 2BH5X 3CP5A 3B4SA 5CIBB 3CMEP 1QKSA 1FZFA 3RK2B 4C46A 4H44C 2CE1A 1DIPA 1C7MA 3SSUA 1DEEG 1AKKA 3E7KA 3H1JJ 4W7ZA 3PRJA 3I55P 3A2AA 2SPZA 2N1TA 3L75G 1K05A 1VQ5P 3R4YA 1YCCA 3L74E 5KLVJ 1VQMP 1S1CX 1BGYE 1JMMA 5KAFH 4WQDA 2YIUC 2B9BA 3IF4A 3BVHA 2OYIC 4EIEA 5CCGD 5AVSB 2HG5D 2FXPA 1QVFO 2YMKA 1LTGC 2KS1B 3CCLP 1JUNA 1YJ9P 4XA4A 4Y99B 3L74J 5KLVE 3MZWB 1M60A 3HUSA 1S9KE 2XDJA 4N6JA 1OIPA 1GU2A 2PAJA 1L4AC 2D0WA 1OW8A 1F1CA 2HPCA 1RH5B 2YMYA 5AW1B 3M91A 1J1EC 1WRGA 2N1TD 2HR3A 1U7MA 1GDVA 3L4OA 1UIIA 1IZNB 3TK1A 4AQRD 1BE3E 3RK2C 1DX7A 4N78D 2JKVA 1BCCG 1K8AQ 1CYJA 1SFCA 2ZYDA 2POHA 4GDOA 1G2CB 1OVVA 1MUUA 1CRJA 3V4QA 1C52A 1A02F 3NWVA 4WB4A 1M90Q 3ORVA 1AYGA 3SFEC 1ZZHA 1RAQA 1LP1A 1I54A 2CXBA 1H33A 5AVTB 1OCDA 3MP7B 4H13B 1S3JA 1URQB 2A06G 1Y47A 1CORA 1N50A 1R5SA 1EZVD 3HTKA 2YK3A 4EICA 1RF0C 1GJQA 4IFMA 5KLVK 2M8RA 2AEMA 3FXDA 3E1RA 3G3ZA 4H0LC 1CI6B 1IFJA 1T2KC 1OW6A 1J1EB 4WVZA 3CXHH 4M3LA 1W5CE 1L0NJ 1FDIA 4U3FJ 2O1JA 2LXBA 2WSFH 5KLIB 3K5BA 2ZT9C 1L0ND 1DD4A 1OVRA 4I7ZB 3CC4P 2WWWA 3V2RA 1EDKA 4U7JA 2NPSA 4KJMA 1JCDA 2A45G 2L91A 1CC5A 4IL6X 2BEQD 5DJQC 3CXHI 1C6SA 3KZIV 5TJHA 1H0TB 1OZHA 1SQQE 1PPJD 1H9XA 1NTZD 1LWUB 2H8PD 3B5NC 3F89A 3V5BA 4EIDA 1ZP0C 5GTHH 1JCCA 3MIWA 1VQPP 3KXDA 1JTHA 3L70G 3M0DC 1ZR4A 3CC2P 1DW1A 3U1CA 2ZVNB 1VQ8P 1NTZE 3V2QA 2HPCB 1R8EA 2Q1KA 1HGZA 1KILA 3R2PA 1FE6A 1A56A 1NU1J 2M5AA 1LT9C 4O1WA 1J1DB 1M1JB 1BDDA 2GA1A 1XTCC 3VMYA 5K5GB 1CW5A 2C9NY 1SVFA 1W2EA 2CK3H 3TGUE 2KSEA 5APWA 1L0NE 1LMSA 2FYUE 2XTSB 1GK6A 2W83C 1CIHA 3SJLA 3KYQA 3WC8A 1JY3P 1L0LJ 2B87A 2QM7A 2XKMA 4UB6H 4ZMDA 3LIEA 1SQPD 3N7NA 1AVYA 1CCHA 1LTAC 3RK3D 3PTZA 1IFMA 3TGUD 2LITA 5KAIV 4OGQB 1PGPA 1YQ3C 1GL2C 5B5EH 2IDBA 2V4HA 4Y28J 1NMLA 1S4XA 3SWYA 2ZONG 2XV5A 1FZCB 5CMZA 1S6VB 4D6TG 3WFDC 2G3AA 3B5NA 3OA8B 3L74G 1Y9BA 3O1YA 1SQPE 2FY8A 4EI2A 3RK3B 1JEKA 1L4AB 4NPEA 5KAFE 4ASWA 4JQ0D 2KSJA 1N73B 1LTBC 3OA7A 2D0SA 2YQBA 3L71E 4JF7A 4ZKUA 1NWQA 2WPVB 3AE3C 2YO3A 1L2PA 3HD7A 2ZT9D 3EWKA 3H1JG 3ZOWA 2P1JA 1H32A 1RAPA 1J3SA 3HD7B 2IX7C 1C2RA 1K04A 2DW3A 1EZVG 3G6EP 3ZOOA 1NMIA 5AVRB 4FA5A 3HE4B 3C1LA 2GC7D 2E74D 3H1HD 4FANA 1HJBA 3L36A 2YNYA 1X22A 2RKLA 4IL6E 4R4MA 3L75D 3CL3D 5AVXB 3IR9A 1YHQP 4UB6E 4OH8B 1KILB 1QEXA 2B89A 3D0WA 3AE1C 3T97A 4JCGA 3L75J 5GTHE 3JSVC 2R32A 4PJ0E 1JB0J 1M1KQ 3RN0A 2KXPB 2PGDA 1VYDA 3SFDC 1YTZI 3L72E 1LWUA 1YEBA 2CPBA 1EC5A 1ZLLA 3AE2C 4KMGA 1M7LA 2IPPA 2FFDA 4W80A 5B66E 2Y0EA 1H8AA 2KZJA 1NTMJ 1QL4A 5AW3B 2P67A 1NTKK 1YFCA 3SWSA 3PLNA 2OYHB 1USDA 3CXHE 3RBXA 5E79V 4UB8V 2H43A 4D6TE 3FWNA 5CIGB 5IY51 2QEXP 1EZVI 2BCCG 1MV8A 2IYPA 1VQ7P 4U3FD 1RE3C 3L72G 3A0HE 3D6ZA 2Y0DA 4XXLA 3VP9A 1MKMA 1J1DC 3JCUH 1CRYA 2WZ7A 2MHMA 3A0BV 4PD4E 1U57A 1E29A 1CTJA 1D7MA 3KZIH 1EB7A 2B10B 2E75C 2XU6A 1H89A 3CX5I 3TDKA 4PJ0V 2GUVA 3Q1MA 1KB9D 4PWAA 2P7JA 1I6DA 1FZEA 3H1IJ 1FDMA 1EXIA 3MK7C 1M57D 2GM4A 2NPSC 1W2BO 1NTMG 2E75D 3LIDA 1S5LX 3H1ID 4H0KA 1L4AD 2M5AB 3RGUA 1OWAA 1PL5A 4RKUJ 3KHUA 1R5LA 2E76B 4FAVA 3H1JE 3CCEP 1VQNP 4FB1A 4YTPC 4C7NA 1L9BC 1F1FA 1RF1B 1H88A 1MFZA 3L71G 1FJ0A 3TF5A 1L0LE 2E5YA 3OW2O 3ZOXA 1T2KD 4DCKA 2ZYAA 1HH7A 3S4RA 2RMZA 3NBSA 2EXVA 2KIKA 4PD4I 1NTME 2YCCA 5CCHA 4NFGB 2P58A 5DF5A 3OJAB 1NNOA 1U7JA 5B66V 5APXA 3L4FA 3HQ9A 1L0LD 1G1IA 3H1LE 1KV4A 1KQGB 3SVWA 3N4XA 1KC8Q 1DEBA 4MN4C 1SQPK 4BRYB 1CZQA 4GIFA 4PD4H 1SQXJ 3VTPC 1JY3O 1NU1K 4WY4A 4H13C 4LGDE 2C9XB 1ZRTE 1H0TA 4WY4B 4DOJA 2K9JB 1PGOA 1KQFB 2OTJP 4WQAA 1VPCA 4JPZB 2XNXA 2KB7P 1K9MQ 2N9JA 1LT9A 1SQBJ 1UIXA 2RN0A 2Q5UA 3AE8C 3GHGC 1KB9E 3RK2D 1KB9H 1LT9B 4C7NB 4EIJA 4H13D 1RF1C 2A45I 1P84E 3GF7A 4YXDC 1VF5C 1ZRTD 1NTKE 2WPSA 1E8EA 2Y0CA 1OFCX 1QVGO 1CSUA 2AIUA 3IAOA 1FOSF 1PGQA 5B5EV 1J2JB 4H0JA 1Y8AA 5L8RJ 3A0HH 2C1DA 1K73Q 3RL0B 5CIFB 1SQXK 4XFJA 2QJPC 2VRSA 1LC1A 2N9YB 2A45H 2FFDB 1R0QA 3H25A 2QVAA 1QL1A 2HLOA 1CRIA 2QJYB 5B6QA 3VP8A 1GU5A 5APQA 4Y99C 1YICA 2AEFA 2W8ZA 1VQKP 1G1JA 3H1LJ 2WSCJ 1KYOI 3WFBC 4WY4C 3BASA 1T6AA 3H1LD 3VYMA 3TYYA 3LW5H 3ABVC 2K1AA 3GF3A 4CPGA 4XYDB 1FZCC 1ZXGA 1GW4A 1E79H 1Q82Q 3ZCFA 2WMMA 1HUCA 1JO5A 2ZJSE 2ZVOB 3CX5W 4IFFA 3G71P 2JDIH 3RL0C 3CYTI 1NKNA 1X9VA 5KJ7C 3CWBD 2JTIB 3DR0A 1BGYG 2BEZF 1RF1A 5M1BA 1DT1A 1SQBK 1P84I 3CCSP 1NTKG 1FZBA 2WSCH 4RO0A 2PP6A 1CTZA 3S1KA 4HKZH 3H1KD 4GOEA 4MU8A 4N0KA 1A2SA 1URQA 2VHDA 3P32A 1VQLP 2E42A 1N15A 1HROA 5AW8B 2WSSH 1HGVA 2A06E 1L9JC 1YQ4C 1IO3A 2WSEJ 1QGKB 4KT0J 1BE3D 2YKPA 2C2CA 1KYOD 3H1IG 1YIQA 3JCUE 1USEA 5AW7B 1CSVA 2HODB 1IFDA 3O8ZA 4L1QA 2FYNC 3P8CD 1SQBE 1VDFA 1M1JC 3NXSA 3VNWA 1LT1A 2BH4X 2WT7B 3CLQA 1YI2P 3U1AA 3L73J 2AI5A 5AURA 4L3GA 2I1KA 1KN7A 3AE4C 1AA0A 3WUTA 1S9KD 2KS1A 2R3SA 1BCCE 5EFWB 1KYOE 3CCQP 1M6ZA 1FBMA 3L73E 5CIEB 2G8YA 2JP3A 1C75A 1FJPA 2GUSA 4JBZA 4ZKPA 2KLVA 1GZLA 5AVUB 3V2PA 5KKZB 3JC22 4K3IA 5TISV 2M3BA 2YXRB 1L0LG 3RBZA 2Q6QA 1HBWA 1KYOW 1KILE 4WQ9A 1FZGA 5KLVG 3EFGA 5H2FE 2R5BA 4ASVA 5CIDB 1NTZG 1ZR2A 2Q9IA 3NMDA 1MG2D 4YXWH 1GTWA 1RQUA 1SQXE 4GODA 4U3FE 4Z1MH 3CX5D 3L75E 2Z5HA 2E43A 2WT7A 3TNUB 3MUDA 4WQ7A 4TT3H 1HWTC 5C39A 1GW3A 2FRCA 2MTAC 3CWBE 3H1HE 5GTIH 2HODA 5GTIE 1IK9A 1SQQK 2PRRA 2PACA 5CJ0A 3VOPA 4AX3A 1IFPA 1NIRA 1NU1E 1H31B 1KB9I 3FWLA 3CX5H 1ZN5A 3G9RA 4L75A 5AW4B 1ZV8A 1LTTC 1K3GA 4DT0A 3F5HA 1CCRA 1B7VA 3O20A 5AW9B 4PV1B 2IBZI 5CHXA 5KAFV 3L70J 5APTA 1NHLA 3CCRP 1GL2A 2FBWC 1NAYA 1Z56A 1RE3A 2D2CB 1BCCD 3CPWO 4IFDK 1N73A 3D71A 1CIGA 4UB6V 2IFMA 2P10A 1DW3A 1P84H 1H32B 4IOIH 3GMAA 3IN6A 1LNQA 1CTYA 2QJKB 2V7QH 3L37A 2P2UA 2KNCA 3PHLA 1IO4A 3KDPB 5TISE 2ZXXA 2BCNB 2JQRA 3D70A 2J5UA 4HJGH 3A7OA 1CIEA 2QG4A 1PGJA 4EIFA 2FKWB 3GHGA 1BL9A 3ZIYA 1GMJA 1BDCA 2M3EA 3RK3E 1QX8A 4IL6H 3S9OA 4D6TJ 4AAOA 2W90A 5CCGC 3VYIA 2Z4EA 3O0RC 1EDLA 3P8CE 2OYHA 1CEDA 2YIUB 3HE4A 3CXHD 4UB8H 1BSNA 3USSA 4GOFA 4I2LC 3I56P 3O6QB 1BE3G 4PJ0H 2OYIB 1QLED 3WFCC 4PV1C 2BASA 4WWIA 1KD1Q 3FX0A 1EXJA 2Y9YA 4AUWA 1CRGA 1JOCA 3CX5E 3WUIA 2B4ZA 3BCCJ 4GT1A 2C1UA 3EQ2A 3QH9A 3RLMA 1SFCB 1GKSA 1OAEA 1YBKA 2E76C 2JWDA 1A8CA 2I1JA 1FS0E 5AVWB 1N8RQ 1FZAA 3CU4A 3A0BE 3AEBC 3BCCE 2ZYGA 4NPFX 2ZFCA 2QE7H 1FJKA 1AJYA 1PZQA 3JBTB 4B86A 2WTYA 3AEFC 1NYHA 3H1HG 1YTZT 2K3RA 1KFNA 1KQSO 1HJ5A 1NTZJ 2N18B 2Z5IA 4I6MC 1MZ9A 1FC2C 3PXSA 2C1DB 1SQPG 2XZRA 1N9CA 1NTKJ 3A5TA 2YXQB 1JY2P 3Q5RA 3ZOYA 5CCHD 1COTA 3KQGA 1FOSE 3TYIA 2WITA 1KYOH 1NU1D 4OGQC 4UB8E 3CD6P 3MD0A 3L74D 1LTJB 4XE5B 2WSEH 2CA4B 3H1KG 2K37A 2C8SA 1OMIA 2FYUG 3C2CA 3TGUG 1Q86Q 3L73G 1FI9A 1PPJE 4NPDA 3PXWA 3CCMP 1ETPA 4AANA 3A9FA 1SP4A 1WEJF 5AW5B 4H44D 2V08A 2BGVX 2J58A 1QL2A 2LXCB 1GIWA 5CIHB 2ZT9B 2K9JA 2GC4D 1H9YA 4GEDB 2FYZA 1OVUA 1GU4A 1IFIA 2O3JA 1M56D 3MK7B 3EFFK 2DVHA 1LTJC 2QJKC 3GLMA 1IRWA 2OTKE 1DD3A 1HH0A 1SQQG 2B88A 4EDFA 3PH0A 1KIBA 1VF5D 1OX3A 1JY3N 2IFNA 3M9HA 1QN2A 1AV1A 1N7SD 1MFTA 1YJWP 3X39A 1I6EA 2ZBOA 4QMAA 3VN0A 1H33B 1RHZB 2Q3EA 2RH0A 3AEAC 3D6YA 2DGEA 1LTSC 1LTIC 1NO4A 1CRHA 1GD2E 5CICB 155CA 2OGUA 2FWLA 2ZXEB 1BCCJ 3L71D 3ZDMA 4H0LB 1AOFA 1KFMA 5APUA 2OYHC 2C0WA 2WQYC 5CBOA 3V6IA 1CHJA 2OYOA 1Q2NA 3CMAP 5CCHC 1LS9A 3VMAA 3FXEA 4U3FG 1SS1A 3W67A 1CYCA 1EZVE 1VF5B 2BPBB 2XNDH 2K88A 1U74B 2B11B 2L5GB 5DJQB 1EQ7A 5AVYB 1GQ1A 3CXHW 4WQBA 1T3JA 1BGYJ 4AYCA 2W6AA 1YYCA 4L74A 1AQ5A 5CYTR 5APYA 5KKZC 1S5LV 1KV9A 1NAFA 1FHBA 3UIAA 1FI7A 4R4LA 1IQCA 2FFDC 1VQ4P 3L72D 1XTGB 3B5ND 5KTBA 4BRYA 5BVZA 2GIWA 1JDLA 1LP1B 3WFEC 5H2FH 3I5CA 3A0BH 5DJUB 5E79H 1FDOA 3RMZA 2H89C 3SWFA 5EXQA 3Q3DA 4W7YA 2QJPB 3NTNA 3HD7C 2CPSA 1BE3J 1IFNA 4N3YB 4YPCA 4OGQD 2FYUJ 1PFIA 3M0AA 1CSBA 3AE5C 2Q3IA 2GB8B 2FYNB 2FYUD 1N7SC 1LWUC 3B5NB 1YNRA 1NJIQ 1CSWA 3L73D 3H1IE 3E1IA 2HYNA 1JM0A 3AECC 5AW6B 2O01H 4A7PA 3CCJP 1NTMK 1Q90D 2D2CD 2KNCB 1SQVJ 2KZIA 3V2NA 1SLQA 3CWBG 3AE7C 2FXMA 4AALA 1CIFA 3VMZA 1CNOA 1SQVD 4K35A 3Q2YA 1NTKD 2ITAA 4WBAA 1P84D 2Y9ZA 3M0DA 3RL0g 4FA1A 1FAVA 1I5TA 3CI9A 1GL2B 2A06D 2HV4A 1CYIA 1CRCA 4WQCA 2KOGA 1VQOP 4GKGA 3AEGC 2ZAEB 1C6OA 3WUUA 2MJZA 5BU5A 1IJDB 2QM8A 3GG2A 3AEEC 5TISH 3MUDC 3B71A 2IZ0A 1DW0A 2KK7A 1LTJA 1M8OB 4Y5RA 1NVOA 2NZ2A 5CJ4A 2PCBB 2NPSD 3OCDA 4FA9A 1YITP 1EDIA 2CE0A 4EYYQ 3T97B 1Q81Q 2N18C 3M06A 2W6JH 4O1QA 4RSZA 4OWFA 1RZ5A 2ZZS1 1SQXD 3Q5SA 1FZCA 3AE6C 1HZVA 1K3HA 1JY2O 1SQBG 1WVEC 1N86A 1X8YA 2NPSB 5DJTB 5KJ7A 1YJNP 3PH2B 3H32B 5KJ7D 2E74B 2L4DA 351CA 3BATA 5DFSA 3AEDC 1AQTA 1GL2D 5KAIH 3ZBMA 5KAIE 2KP8A 3Q5PA 451CA 1GDTA 4N78E 3OA8A 1I8OA 1MZ4A 2KUBA 1S72P 1AFOA 1RY3A 3TSIA 1URQC 4BWNA 2NRGA 2AEJA 1GK4A 5E79E 2J59M 2MKVA 1N2DC 2R44A 1FI3A 1HTLC 1X79B 3C9IA 1DVHA 1S5LE 1L4AA 2M0BA 2WPRA 4I7ZC 3G4SP 1KILC 1SFCD 1NGMB 2AXTV 2ORLA 1MG3D 4HH2A 4D6TD 4J20A 3BRTB 2E74C 1CI6A 2YKQA 3C8VA 5APSA 2N3YA 4I1LA 3L71J 5AVVB 2KLUA 4PV1D 3H1LG 3PXTA 2V7QJ 3M9QA 3OAKA 1DH3A 1BSHA
chains in the Genus database with same CATH topology
1I54A 2CXBA 1H1OA 1H33A 1OCDA 1N9CA 1CORA 3ZOYA 2C9XB 4PW9B 1N50A 1COTA 2K9JB 3TYIA 1EZVD 4WQAA 2YK3A 2PCCB 3HQ7A 4EICA 5C9MA 2N9JA 1NU1D 1GJQA 2RN0A 3L74D 2ZOOA 1YEAA 1KX7A 2CA4B 4WQEA 3WU2V 2C8SA 2IBZD 1QL3A 1ZRTD 1E8EA 2Y0CA 3C2CA 1CSUA 2AIUA 5KLIB 1FI9A 4GYDA 3GW6A 3PXWA 1L0ND 5B5EV 1N90A 4H0JA 1ETPA 4AANA 2C1DA 3A9FA 5GTHV 1WEJF 5CIFB 4WQ8A 3H1JD 1M70A 1HZUA 3DMIA 1LC1A 2L91A 2V08A 1CC5A 2BGVX 3SLEA 1GIWA 5DJQC 5CIHB 3VRDA 2N9YB 2GC4D 1H9YA 3KZIV 4GEDB 4IL6V 1C6SA 5TJHA 1R0QA 5KLVD 1DW2A 1FCDC 4AAMA 1PPJD 1H9XA 2CA3B 1CRIA 2QJYB 1NTZD 5B6QA 3RN1A 4DY9A 1YICA 3O5CA 2O3JA 1KX2A 4EIDA 1I8PA 3MK7B 2ZXYA 1FOCA 2DVHA 5C0ZA 3WFBC 1IRWA 4EDFA 1DW1A 3H1LD 3VYMA 1KIBA 4XYDB 1QN2A 4YE1A 1A56A 2I8FA 3ZCFA 1SQBD 4O1WA 3X39A 3CX5W 2ZBOA 1I6EA 1H33B 3CYTI 3CWBD 3L4MA 2Q3EA 2OZ1B 2JTIB 3DR0A 2BCCD 2DGEA 2N9IA 1DT1A 1LMSA 1W5CT 1DIQC 1CRHA 2XTSB 5CICB 155CA 4QAOA 1CIHA 3SJLA 1CTZA 2FWLA 3HQ6A 3SXTA 3H1KD 1LC2A 3WC8A 4MU8A 4N0KA 1DIIC 1A2SA 4L3HA 1SQPD 1CCHA 2VHDA 3L71D 1N15A 1HROA 3PTZA 1AOFA 1C2NA 3TGUD 1L9JC 1IO3A 2LITA 5KAIV 1BE3D 2C2CA 1KYOD 1YIQA 1CHJA 1CSVA 4L1QA 1E2RA 1LS9A 3VMAA 1NMLA 3VNWA 1U75B 2ZONG 2BH4X 1S6VB 1I55A 3WFDC 3OA8B 2AI5A 5AURA 3O1YA 1CYCA 4L3GA 3M97X 2BPBB 1H31A 1U74B 2B11B 5DJQB 2KS1A 1QYZA 5GTIV 1M6ZA 1GQ1A 3CXHW 1HCMA 2D0SA 1RZ6A 4WQBA 5CIEB 4Q5PA 2B0ZB 2YQBA 1IRVA 1C75A 1LFMA 3HQ8A 3L70D 5CYTR 5KKZB 1S5LV 1KV9A 4K3IA 3ZOWA 5TISV 1H32A 1RAPA 1J3SA 1NTMD 1FHBA 1FI7A 1KYOW 1IQCA 1C2RA 3L72D 1CXAA 4WQ9A 2GIWA 1JDLA 3WFEC 1CO6A 3ZOOA 5H2FV 1NMIA 3DP5A 4FA5A 5CIDB 3RMZA 5EXQA 3ITKA 2N3BA 2GC7D 2QJPB 3H1HD 2B12B 4FANA 2BLFB 1MG2D 2LIRA 1DVVA 3L75D 3CX5D 2GB8B 1YTCA 1SQQD 2C1VA 2FYNB 2FYUD 4LJIA 1YNRA 1KB0A 4JCGA 4PD4D 1CSWA 3L73D 3OCDB 4WQ7A 1CXCA 2FRCA 2MTAC 4A7PA 1HJ3A 1AOQA 2PACA 2V07A 4V2KA 4AX3A 3RN0A 3NBTA 2KNCB 1NIRA 1VYDA 1H31B 3FWLA 1BGYD 4RJTA 2JWAA 1YEBA 1HJ4A 4AALA 1CIFA 4KMGA 1CNOA 1PP9D 1SQVD 1NTKD 4P4QB 1K3GA 1CCRA 1B7VA 1P84D 3O20A 2Y0EA 1HRCA 3BCCD 4FA1A 1I5TA 5KAFV 2A06D 1QL4A 1W2LA 2OZ1A 2HV4A 1CHHA 1CYIA 1YFCA 3SWSA 1BCCD 3PLNA 1CRCA 4WQCA 5E79V 4UB8V 1CIGA 4UB6V 3A0HV 1DW3A 1H32B 1C6OA 1IZL0 1CHIA 5CIGB 1CSXA 4FA4A 5IY51 1C6RA 2BH5X 1CTYA 2QJKB 3GG2A 3CP5A 3PHLA 5CIBB 4U3FD 2BCNB 2JQRA 1QKSA 1DW0A 2Y0DA 4XXLA 1CIEA 2QG4A 4EIFA 4Y5RA 2CE1A 1CRYA 2PCBB 1BL9A 3OCDA 1C7MA 4FA9A 2MHMA 3A0BV 2CE0A 3ZIYA 1E29A 1AKKA 2N18C 1CTJA 4O1QA 4RSZA 3PRJA 1RZ5A 1EB7A 2ZZS1 4AAOA 2B10B 1SQXD 3TDKA 4PJ0V 3O0RC 1YCCA 1KB9D 4PWAA 1I6DA 1HZVA 4WQDA 1CEDA 1K3HA 3MK7C 2YIUB 3CXHD 1WVEC 4EIEA 3H1ID 4H0KA 3WFCC 3PH2B 2L4DA 351CA 5DFSA 1M60A 1CRGA 3ZBMA 3WUIA 2B4ZA 451CA 3KHUA 1GU2A 2C1UA 3OA8A 3RLMA 1I8OA 2D0WA 4FAVA 1GKSA 1OAEA 1F1CA 1MZ4A 1A8CA 4FB1A 1L9BC 1F1FA 1FJ0A 3TF5A 3CU4A 1GDVA 3ZOXA 1FI3A 3L4OA 1HH7A 2RMZA 3NBSA 2EXVA 1DVHA 2YCCA 4NFGB 1CYJA 3JBTB 5DF5A 1NNOA 5B66V 2AXTV 1CRJA 2ORLA 1MG3D 3HQ9A 1C52A 4D6TD 1L0LD 4J20A 3NWVA 1HJ5A 2N3YA 2N18B 3ORVA 3SVWA 1AYGA 3PXSA 3PXTA 1ZZHA 1RAQA 2C1DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I54 A;  2CXB A;  1H1O A;  1H33 A;  1OCD A;  1N9C A;  1COR A;  3ZOY A;  2C9X B;  4PW9 B;  1N50 A;  1COT A;  2K9J B;  3TYI A;  1EZV D;  4WQA A;  2YK3 A;  2PCC B;  3HQ7 A;  4EIC A;  5C9M A;  2N9J A;  1NU1 D;  1GJQ A;  2RN0 A;  3L74 D;  2ZOO A;  1YEA A;  1KX7 A;  2CA4 B;  4WQE A;  3WU2 V;  2C8S A;  2IBZ D;  1QL3 A;  1ZRT D;  1E8E A;  2Y0C A;  3C2C A;  1CSU A;  2AIU A;  5KLI B;  1FI9 A;  4GYD A;  3GW6 A;  3PXW A;  1L0N D;  5B5E V;  1N90 A;  4H0J A;  1ETP A;  4AAN A;  2C1D A;  3A9F A;  5GTH V;  1WEJ F;  5CIF B;  4WQ8 A;  3H1J D;  1M70 A;  1HZU A;  3DMI A;  1LC1 A;  2L91 A;  2V08 A;  1CC5 A;  2BGV X;  3SLE A;  1GIW A;  5DJQ C;  5CIH B;  3VRD A;  2N9Y B;  2GC4 D;  1H9Y A;  3KZI V;  4GED B;  4IL6 V;  1C6S A;  5TJH A;  1R0Q A;  5KLV D;  1DW2 A;  1FCD C;  4AAM A;  1PPJ D;  1H9X A;  2CA3 B;  1CRI A;  2QJY B;  1NTZ D;  5B6Q A;  3RN1 A;  4DY9 A;  1YIC A;  3O5C A;  2O3J A;  1KX2 A;  4EID A;  1I8P A;  3MK7 B;  2ZXY A;  1FOC A;  2DVH A;  5C0Z A;  3WFB C;  1IRW A;  4EDF A;  1DW1 A;  3H1L D;  3VYM A;  1KIB A;  4XYD B;  1QN2 A;  4YE1 A;  1A56 A;  2I8F A;  3ZCF A;  1SQB D;  4O1W A;  3X39 A;  3CX5 W;  2ZBO A;  1I6E A;  1H33 B;  3CYT I;  3CWB D;  3L4M A;  2Q3E A;  2OZ1 B;  2JTI B;  3DR0 A;  2BCC D;  2DGE A;  2N9I A;  1DT1 A;  1LMS A;  1W5C T;  1DIQ C;  1CRH A;  2XTS B;  5CIC B;  155C A;  4QAO A;  1CIH A;  3SJL A;  1CTZ A;  2FWL A;  3HQ6 A;  3SXT A;  3H1K D;  1LC2 A;  3WC8 A;  4MU8 A;  4N0K A;  1DII C;  1A2S A;  4L3H A;  1SQP D;  1CCH A;  2VHD A;  3L71 D;  1N15 A;  1HRO A;  3PTZ A;  1AOF A;  1C2N A;  3TGU D;  1L9J C;  1IO3 A;  2LIT A;  5KAI V;  1BE3 D;  2C2C A;  1KYO D;  1YIQ A;  1CHJ A;  1CSV A;  4L1Q A;  1E2R A;  1LS9 A;  3VMA A;  1NML A;  3VNW A;  1U75 B;  2ZON G;  2BH4 X;  1S6V B;  1I55 A;  3WFD C;  3OA8 B;  2AI5 A;  5AUR A;  3O1Y A;  1CYC A;  4L3G A;  3M97 X;  2BPB B;  1H31 A;  1U74 B;  2B11 B;  5DJQ B;  2KS1 A;  1QYZ A;  5GTI V;  1M6Z A;  1GQ1 A;  3CXH W;  1HCM A;  2D0S A;  1RZ6 A;  4WQB A;  5CIE B;  4Q5P A;  2B0Z B;  2YQB A;  1IRV A;  1C75 A;  1LFM A;  3HQ8 A;  3L70 D;  5CYT R;  5KKZ B;  1S5L V;  1KV9 A;  4K3I A;  3ZOW A;  5TIS V;  1H32 A;  1RAP A;  1J3S A;  1NTM D;  1FHB A;  1FI7 A;  1KYO W;  1IQC A;  1C2R A;  3L72 D;  1CXA A;  4WQ9 A;  2GIW A;  1JDL A;  3WFE C;  1CO6 A;  3ZOO A;  5H2F V;  1NMI A;  3DP5 A;  4FA5 A;  5CID B;  3RMZ A;  5EXQ A;  3ITK A;  2N3B A;  2GC7 D;  2QJP B;  3H1H D;  2B12 B;  4FAN A;  2BLF B;  1MG2 D;  2LIR A;  1DVV A;  3L75 D;  3CX5 D;  2GB8 B;  1YTC A;  1SQQ D;  2C1V A;  2FYN B;  2FYU D;  4LJI A;  1YNR A;  1KB0 A;  4JCG A;  4PD4 D;  1CSW A;  3L73 D;  3OCD B;  4WQ7 A;  1CXC A;  2FRC A;  2MTA C;  4A7P A;  1HJ3 A;  1AOQ A;  2PAC A;  2V07 A;  4V2K A;  4AX3 A;  3RN0 A;  3NBT A;  2KNC B;  1NIR A;  1VYD A;  1H31 B;  3FWL A;  1BGY D;  4RJT A;  2JWA A;  1YEB A;  1HJ4 A;  4AAL A;  1CIF A;  4KMG A;  1CNO A;  1PP9 D;  1SQV D;  1NTK D;  4P4Q B;  1K3G A;  1CCR A;  1B7V A;  1P84 D;  3O20 A;  2Y0E A;  1HRC A;  3BCC D;  4FA1 A;  1I5T A;  5KAF V;  2A06 D;  1QL4 A;  1W2L A;  2OZ1 A;  2HV4 A;  1CHH A;  1CYI A;  1YFC A;  3SWS A;  1BCC D;  3PLN A;  1CRC A;  4WQC A;  5E79 V;  4UB8 V;  1CIG A;  4UB6 V;  3A0H V;  1DW3 A;  1H32 B;  1C6O A;  1IZL 0;  1CHI A;  5CIG B;  1CSX A;  4FA4 A;  5IY5 1;  1C6R A;  2BH5 X;  1CTY A;  2QJK B;  3GG2 A;  3CP5 A;  3PHL A;  5CIB B;  4U3F D;  2BCN B;  2JQR A;  1QKS A;  1DW0 A;  2Y0D A;  4XXL A;  1CIE A;  2QG4 A;  4EIF A;  4Y5R A;  2CE1 A;  1CRY A;  2PCB B;  1BL9 A;  3OCD A;  1C7M A;  4FA9 A;  2MHM A;  3A0B V;  2CE0 A;  3ZIY A;  1E29 A;  1AKK A;  2N18 C;  1CTJ A;  4O1Q A;  4RSZ A;  3PRJ A;  1RZ5 A;  1EB7 A;  2ZZS 1;  4AAO A;  2B10 B;  1SQX D;  3TDK A;  4PJ0 V;  3O0R C;  1YCC A;  1KB9 D;  4PWA A;  1I6D A;  1HZV A;  4WQD A;  1CED A;  1K3H A;  3MK7 C;  2YIU B;  3CXH D;  1WVE C;  4EIE A;  3H1I D;  4H0K A;  3WFC C;  3PH2 B;  2L4D A;  351C A;  5DFS A;  1M60 A;  1CRG A;  3ZBM A;  3WUI A;  2B4Z A;  451C A;  3KHU A;  1GU2 A;  2C1U A;  3OA8 A;  3RLM A;  1I8O A;  2D0W A;  4FAV A;  1GKS A;  1OAE A;  1F1C A;  1MZ4 A;  1A8C A;  4FB1 A;  1L9B C;  1F1F A;  1FJ0 A;  3TF5 A;  3CU4 A;  1GDV A;  3ZOX A;  1FI3 A;  3L4O A;  1HH7 A;  2RMZ A;  3NBS A;  2EXV A;  1DVH A;  2YCC A;  4NFG B;  1CYJ A;  3JBT B;  5DF5 A;  1NNO A;  5B66 V;  2AXT V;  1CRJ A;  2ORL A;  1MG3 D;  3HQ9 A;  1C52 A;  4D6T D;  1L0L D;  4J20 A;  3NWV A;  1HJ5 A;  2N3Y A;  2N18 B;  3ORV A;  3SVW A;  1AYG A;  3PXS A;  3PXT A;  1ZZH A;  1RAQ A;  2C1D B; 
#chains in the Genus database with same CATH topology
 1H1O A;  1L0L K;  3PP5 A;  4O9B A;  5AVZ B;  5AW2 B;  1IC2 A;  3H1K E;  4PW9 B;  1JMB A;  3WMM 0;  2WVR A;  2PCC B;  3M9B A;  1WT6 A;  3HQ7 A;  5C9M A;  1JY2 N;  3V4W A;  1VL2 A;  2O1K A;  2ZOO A;  3CWB J;  1SQV G;  1YEA A;  1KX7 A;  1LJ2 A;  4WQE A;  3WU2 V;  1ZME C;  3HTK B;  1A02 J;  2IBZ D;  1QL3 A;  4WY4 D;  1NH4 A;  1RF0 A;  2C9L Y;  4RES B;  2R3C A;  4GYD A;  2OQQ A;  3GW6 A;  3HE5 B;  1N90 A;  1ZW0 A;  2O01 N;  1JNM A;  5GTH V;  2OYI A;  1JTH B;  2K9Y A;  3L72 J;  4WQ8 A;  3H1J D;  1M70 A;  2H7H A;  1HZU A;  3DMI A;  5CBN A;  1SFC C;  2E75 B;  1EDJ A;  3SLE A;  4KHX A;  3VRD A;  3HE5 A;  4IL6 V;  1TU3 F;  1S2E A;  4K3A A;  5KLV D;  1DW2 A;  1FCD C;  3WU2 E;  4AAM A;  1YIJ P;  2CA3 B;  3W68 A;  4LC1 A;  3BCC G;  3RN1 A;  4DY9 A;  3O5C A;  1KX2 A;  1I8P A;  5CCG A;  2ZXY A;  1PP9 G;  1T3U A;  1FOC A;  1IK7 A;  5C0Z A;  4L73 A;  3H6P A;  2BCC E;  2JR8 A;  2AXT H;  2FYU K;  4JYB A;  1FU1 A;  1L0N K;  1M1J A;  4HYT B;  2HFE D;  2JO1 A;  1KIL D;  1LGH B;  2LKM A;  1N73 C;  2PFX A;  4YE1 A;  1WMK A;  3U59 A;  2OTL P;  2I8F A;  1KZU B;  1SQB D;  2BCC J;  1RE4 A;  3AE9 C;  1KOR A;  2KYV A;  1HF9 A;  3L4M A;  2OZ1 B;  3O6Q A;  4EOT A;  2BCC D;  4L76 A;  2N9I A;  1NTZ K;  3IFM A;  1SQV K;  2E76 D;  1W5C T;  3A3Y B;  4HB1 A;  2JJL A;  1DIQ C;  3RL0 D;  4QAO A;  3MTU E;  3HQ6 A;  1OXZ A;  3SXT A;  4ZNC A;  5AW0 B;  2WSF J;  3VMX A;  1LC2 A;  1SQV E;  1URQ D;  1DII C;  2LR2 A;  4L3H A;  3QWO C;  1KTM A;  3L70 E;  4TLF A;  1C2N A;  2QA4 P;  1N7L A;  2FXO A;  3SWK A;  2IBZ E;  2QRX A;  3H1H J;  1N7S A;  3P8M C;  3LW5 J;  3GHG B;  5AVQ B;  2N9B A;  5B5E E;  1VQ6 P;  2D2C C;  1E2R A;  1E5W A;  2Q7C A;  2I8D A;  3HRN A;  1U75 B;  1VQ9 P;  1I55 A;  2E5T A;  3MHV A;  3WUV A;  1NOH A;  1HJ0 A;  4JYC A;  3M97 X;  2IYO A;  1AVO A;  3HUS B;  1H31 A;  5B66 H;  3II6 A;  2KI7 B;  2YO2 A;  1PIX A;  3CC7 P;  1QYZ A;  4DJG A;  5GTI V;  2QIW A;  1HCM A;  1RZ6 A;  4Q5P A;  2B0Z B;  5BU8 B;  1IRV A;  2AXC A;  3BRV B;  1T8Z A;  1LFM A;  3HQ8 A;  3L70 D;  1HVV A;  2N1T B;  4BXL A;  1NU1 G;  1KQL A;  2B87 B;  1NTM D;  2W6B A;  1PV3 A;  2R5D A;  1CXA A;  2C0X A;  3H32 A;  1CO6 A;  5H2F V;  3L35 A;  3DP5 A;  2YKO A;  4H0L D;  4C7R A;  3ITK A;  2N3B A;  3B8E B;  2B12 B;  2QJY C;  3H1K J;  2BLF B;  1SQQ J;  2UWJ E;  3FGA D;  3CCU P;  2LIR A;  1OW7 A;  1DVV A;  1S5L H;  1SQX G;  3KZI E;  3KPE A;  1G2C A;  3WU2 H;  3HD7 D;  1YTC A;  1SQQ D;  2C1V A;  2H88 C;  2IBZ G;  2W27 A;  3PJS K;  5KLI C;  3NFQ A;  4LJI A;  3CCV P;  1KB0 A;  3RK3 C;  2OAR A;  4PD4 D;  4H44 B;  3OCD B;  1CXC A;  2N1T C;  2WPQ A;  1HJ3 A;  1AOQ A;  1X0T A;  2V07 A;  2AXT E;  4V2K A;  4DZO A;  2QSI A;  5APV A;  3NBT A;  1BGY D;  4RJT A;  2JWA A;  1HJ4 A;  2IZ1 A;  1PP9 D;  1L0N G;  3HUS C;  4P4Q B;  1PPJ G;  1Q7Y Q;  1HRC A;  3BCC D;  2O01 J;  2JEE A;  1PP9 J;  1RE4 C;  1W2L A;  2OZ1 A;  1CHH A;  1KMI Z;  1N7S B;  4OVN F;  1NKZ B;  1SQP J;  3TNU A;  3MGN A;  4LLH A;  3A0H V;  1ZOY C;  1PP9 E;  3P7K A;  1IZL 0;  1RQV A;  1CHI A;  1CSX A;  4FA4 A;  3TGU J;  1C6R A;  2BH5 X;  3CP5 A;  3B4S A;  5CIB B;  3CME P;  1QKS A;  1FZF A;  3RK2 B;  4C46 A;  4H44 C;  2CE1 A;  1DIP A;  1C7M A;  3SSU A;  1DEE G;  1AKK A;  3E7K A;  3H1J J;  4W7Z A;  3PRJ A;  3I55 P;  3A2A A;  2SPZ A;  2N1T A;  3L75 G;  1K05 A;  1VQ5 P;  3R4Y A;  1YCC A;  3L74 E;  5KLV J;  1VQM P;  1S1C X;  1BGY E;  1JMM A;  5KAF H;  4WQD A;  2YIU C;  2B9B A;  3IF4 A;  3BVH A;  2OYI C;  4EIE A;  5CCG D;  5AVS B;  2HG5 D;  2FXP A;  1QVF O;  2YMK A;  1LTG C;  2KS1 B;  3CCL P;  1JUN A;  1YJ9 P;  4XA4 A;  4Y99 B;  3L74 J;  5KLV E;  3MZW B;  1M60 A;  3HUS A;  1S9K E;  2XDJ A;  4N6J A;  1OIP A;  1GU2 A;  2PAJ A;  1L4A C;  2D0W A;  1OW8 A;  1F1C A;  2HPC A;  1RH5 B;  2YMY A;  5AW1 B;  3M91 A;  1J1E C;  1WRG A;  2N1T D;  2HR3 A;  1U7M A;  1GDV A;  3L4O A;  1UII A;  1IZN B;  3TK1 A;  4AQR D;  1BE3 E;  3RK2 C;  1DX7 A;  4N78 D;  2JKV A;  1BCC G;  1K8A Q;  1CYJ A;  1SFC A;  2ZYD A;  2POH A;  4GDO A;  1G2C B;  1OVV A;  1MUU A;  1CRJ A;  3V4Q A;  1C52 A;  1A02 F;  3NWV A;  4WB4 A;  1M90 Q;  3ORV A;  1AYG A;  3SFE C;  1ZZH A;  1RAQ A;  1LP1 A;  1I54 A;  2CXB A;  1H33 A;  5AVT B;  1OCD A;  3MP7 B;  4H13 B;  1S3J A;  1URQ B;  2A06 G;  1Y47 A;  1COR A;  1N50 A;  1R5S A;  1EZV D;  3HTK A;  2YK3 A;  4EIC A;  1RF0 C;  1GJQ A;  4IFM A;  5KLV K;  2M8R A;  2AEM A;  3FXD A;  3E1R A;  3G3Z A;  4H0L C;  1CI6 B;  1IFJ A;  1T2K C;  1OW6 A;  1J1E B;  4WVZ A;  3CXH H;  4M3L A;  1W5C E;  1L0N J;  1FDI A;  4U3F J;  2O1J A;  2LXB A;  2WSF H;  5KLI B;  3K5B A;  2ZT9 C;  1L0N D;  1DD4 A;  1OVR A;  4I7Z B;  3CC4 P;  2WWW A;  3V2R A;  1EDK A;  4U7J A;  2NPS A;  4KJM A;  1JCD A;  2A45 G;  2L91 A;  1CC5 A;  4IL6 X;  2BEQ D;  5DJQ C;  3CXH I;  1C6S A;  3KZI V;  5TJH A;  1H0T B;  1OZH A;  1SQQ E;  1PPJ D;  1H9X A;  1NTZ D;  1LWU B;  2H8P D;  3B5N C;  3F89 A;  3V5B A;  4EID A;  1ZP0 C;  5GTH H;  1JCC A;  3MIW A;  1VQP P;  3KXD A;  1JTH A;  3L70 G;  3M0D C;  1ZR4 A;  3CC2 P;  1DW1 A;  3U1C A;  2ZVN B;  1VQ8 P;  1NTZ E;  3V2Q A;  2HPC B;  1R8E A;  2Q1K A;  1HGZ A;  1KIL A;  3R2P A;  1FE6 A;  1A56 A;  1NU1 J;  2M5A A;  1LT9 C;  4O1W A;  1J1D B;  1M1J B;  1BDD A;  2GA1 A;  1XTC C;  3VMY A;  5K5G B;  1CW5 A;  2C9N Y;  1SVF A;  1W2E A;  2CK3 H;  3TGU E;  2KSE A;  5APW A;  1L0N E;  1LMS A;  2FYU E;  2XTS B;  1GK6 A;  2W83 C;  1CIH A;  3SJL A;  3KYQ A;  3WC8 A;  1JY3 P;  1L0L J;  2B87 A;  2QM7 A;  2XKM A;  4UB6 H;  4ZMD A;  3LIE A;  1SQP D;  3N7N A;  1AVY A;  1CCH A;  1LTA C;  3RK3 D;  3PTZ A;  1IFM A;  3TGU D;  2LIT A;  5KAI V;  4OGQ B;  1PGP A;  1YQ3 C;  1GL2 C;  5B5E H;  2IDB A;  2V4H A;  4Y28 J;  1NML A;  1S4X A;  3SWY A;  2ZON G;  2XV5 A;  1FZC B;  5CMZ A;  1S6V B;  4D6T G;  3WFD C;  2G3A A;  3B5N A;  3OA8 B;  3L74 G;  1Y9B A;  3O1Y A;  1SQP E;  2FY8 A;  4EI2 A;  3RK3 B;  1JEK A;  1L4A B;  4NPE A;  5KAF E;  4ASW A;  4JQ0 D;  2KSJ A;  1N73 B;  1LTB C;  3OA7 A;  2D0S A;  2YQB A;  3L71 E;  4JF7 A;  4ZKU A;  1NWQ A;  2WPV B;  3AE3 C;  2YO3 A;  1L2P A;  3HD7 A;  2ZT9 D;  3EWK A;  3H1J G;  3ZOW A;  2P1J A;  1H32 A;  1RAP A;  1J3S A;  3HD7 B;  2IX7 C;  1C2R A;  1K04 A;  2DW3 A;  1EZV G;  3G6E P;  3ZOO A;  1NMI A;  5AVR B;  4FA5 A;  3HE4 B;  3C1L A;  2GC7 D;  2E74 D;  3H1H D;  4FAN A;  1HJB A;  3L36 A;  2YNY A;  1X22 A;  2RKL A;  4IL6 E;  4R4M A;  3L75 D;  3CL3 D;  5AVX B;  3IR9 A;  1YHQ P;  4UB6 E;  4OH8 B;  1KIL B;  1QEX A;  2B89 A;  3D0W A;  3AE1 C;  3T97 A;  4JCG A;  3L75 J;  5GTH E;  3JSV C;  2R32 A;  4PJ0 E;  1JB0 J;  1M1K Q;  3RN0 A;  2KXP B;  2PGD A;  1VYD A;  3SFD C;  1YTZ I;  3L72 E;  1LWU A;  1YEB A;  2CPB A;  1EC5 A;  1ZLL A;  3AE2 C;  4KMG A;  1M7L A;  2IPP A;  2FFD A;  4W80 A;  5B66 E;  2Y0E A;  1H8A A;  2KZJ A;  1NTM J;  1QL4 A;  5AW3 B;  2P67 A;  1NTK K;  1YFC A;  3SWS A;  3PLN A;  2OYH B;  1USD A;  3CXH E;  3RBX A;  5E79 V;  4UB8 V;  2H43 A;  4D6T E;  3FWN A;  5CIG B;  5IY5 1;  2QEX P;  1EZV I;  2BCC G;  1MV8 A;  2IYP A;  1VQ7 P;  4U3F D;  1RE3 C;  3L72 G;  3A0H E;  3D6Z A;  2Y0D A;  4XXL A;  3VP9 A;  1MKM A;  1J1D C;  3JCU H;  1CRY A;  2WZ7 A;  2MHM A;  3A0B V;  4PD4 E;  1U57 A;  1E29 A;  1CTJ A;  1D7M A;  3KZI H;  1EB7 A;  2B10 B;  2E75 C;  2XU6 A;  1H89 A;  3CX5 I;  3TDK A;  4PJ0 V;  2GUV A;  3Q1M A;  1KB9 D;  4PWA A;  2P7J A;  1I6D A;  1FZE A;  3H1I J;  1FDM A;  1EXI A;  3MK7 C;  1M57 D;  2GM4 A;  2NPS C;  1W2B O;  1NTM G;  2E75 D;  3LID A;  1S5L X;  3H1I D;  4H0K A;  1L4A D;  2M5A B;  3RGU A;  1OWA A;  1PL5 A;  4RKU J;  3KHU A;  1R5L A;  2E76 B;  4FAV A;  3H1J E;  3CCE P;  1VQN P;  4FB1 A;  4YTP C;  4C7N A;  1L9B C;  1F1F A;  1RF1 B;  1H88 A;  1MFZ A;  3L71 G;  1FJ0 A;  3TF5 A;  1L0L E;  2E5Y A;  3OW2 O;  3ZOX A;  1T2K D;  4DCK A;  2ZYA A;  1HH7 A;  3S4R A;  2RMZ A;  3NBS A;  2EXV A;  2KIK A;  4PD4 I;  1NTM E;  2YCC A;  5CCH A;  4NFG B;  2P58 A;  5DF5 A;  3OJA B;  1NNO A;  1U7J A;  5B66 V;  5APX A;  3L4F A;  3HQ9 A;  1L0L D;  1G1I A;  3H1L E;  1KV4 A;  1KQG B;  3SVW A;  3N4X A;  1KC8 Q;  1DEB A;  4MN4 C;  1SQP K;  4BRY B;  1CZQ A;  4GIF A;  4PD4 H;  1SQX J;  3VTP C;  1JY3 O;  1NU1 K;  4WY4 A;  4H13 C;  4LGD E;  2C9X B;  1ZRT E;  1H0T A;  4WY4 B;  4DOJ A;  2K9J B;  1PGO A;  1KQF B;  2OTJ P;  4WQA A;  1VPC A;  4JPZ B;  2XNX A;  2KB7 P;  1K9M Q;  2N9J A;  1LT9 A;  1SQB J;  1UIX A;  2RN0 A;  2Q5U A;  3AE8 C;  3GHG C;  1KB9 E;  3RK2 D;  1KB9 H;  1LT9 B;  4C7N B;  4EIJ A;  4H13 D;  1RF1 C;  2A45 I;  1P84 E;  3GF7 A;  4YXD C;  1VF5 C;  1ZRT D;  1NTK E;  2WPS A;  1E8E A;  2Y0C A;  1OFC X;  1QVG O;  1CSU A;  2AIU A;  3IAO A;  1FOS F;  1PGQ A;  5B5E V;  1J2J B;  4H0J A;  1Y8A A;  5L8R J;  3A0H H;  2C1D A;  1K73 Q;  3RL0 B;  5CIF B;  1SQX K;  4XFJ A;  2QJP C;  2VRS A;  1LC1 A;  2N9Y B;  2A45 H;  2FFD B;  1R0Q A;  3H25 A;  2QVA A;  1QL1 A;  2HLO A;  1CRI A;  2QJY B;  5B6Q A;  3VP8 A;  1GU5 A;  5APQ A;  4Y99 C;  1YIC A;  2AEF A;  2W8Z A;  1VQK P;  1G1J A;  3H1L J;  2WSC J;  1KYO I;  3WFB C;  4WY4 C;  3BAS A;  1T6A A;  3H1L D;  3VYM A;  3TYY A;  3LW5 H;  3ABV C;  2K1A A;  3GF3 A;  4CPG A;  4XYD B;  1FZC C;  1ZXG A;  1GW4 A;  1E79 H;  1Q82 Q;  3ZCF A;  2WMM A;  1HUC A;  1JO5 A;  2ZJS E;  2ZVO B;  3CX5 W;  4IFF A;  3G71 P;  2JDI H;  3RL0 C;  3CYT I;  1NKN A;  1X9V A;  5KJ7 C;  3CWB D;  2JTI B;  3DR0 A;  1BGY G;  2BEZ F;  1RF1 A;  5M1B A;  1DT1 A;  1SQB K;  1P84 I;  3CCS P;  1NTK G;  1FZB A;  2WSC H;  4RO0 A;  2PP6 A;  1CTZ A;  3S1K A;  4HKZ H;  3H1K D;  4GOE A;  4MU8 A;  4N0K A;  1A2S A;  1URQ A;  2VHD A;  3P32 A;  1VQL P;  2E42 A;  1N15 A;  1HRO A;  5AW8 B;  2WSS H;  1HGV A;  2A06 E;  1L9J C;  1YQ4 C;  1IO3 A;  2WSE J;  1QGK B;  4KT0 J;  1BE3 D;  2YKP A;  2C2C A;  1KYO D;  3H1I G;  1YIQ A;  3JCU E;  1USE A;  5AW7 B;  1CSV A;  2HOD B;  1IFD A;  3O8Z A;  4L1Q A;  2FYN C;  3P8C D;  1SQB E;  1VDF A;  1M1J C;  3NXS A;  3VNW A;  1LT1 A;  2BH4 X;  2WT7 B;  3CLQ A;  1YI2 P;  3U1A A;  3L73 J;  2AI5 A;  5AUR A;  4L3G A;  2I1K A;  1KN7 A;  3AE4 C;  1AA0 A;  3WUT A;  1S9K D;  2KS1 A;  2R3S A;  1BCC E;  5EFW B;  1KYO E;  3CCQ P;  1M6Z A;  1FBM A;  3L73 E;  5CIE B;  2G8Y A;  2JP3 A;  1C75 A;  1FJP A;  2GUS A;  4JBZ A;  4ZKP A;  2KLV A;  1GZL A;  5AVU B;  3V2P A;  5KKZ B;  3JC2 2;  4K3I A;  5TIS V;  2M3B A;  2YXR B;  1L0L G;  3RBZ A;  2Q6Q A;  1HBW A;  1KYO W;  1KIL E;  4WQ9 A;  1FZG A;  5KLV G;  3EFG A;  5H2F E;  2R5B A;  4ASV A;  5CID B;  1NTZ G;  1ZR2 A;  2Q9I A;  3NMD A;  1MG2 D;  4YXW H;  1GTW A;  1RQU A;  1SQX E;  4GOD A;  4U3F E;  4Z1M H;  3CX5 D;  3L75 E;  2Z5H A;  2E43 A;  2WT7 A;  3TNU B;  3MUD A;  4WQ7 A;  4TT3 H;  1HWT C;  5C39 A;  1GW3 A;  2FRC A;  2MTA C;  3CWB E;  3H1H E;  5GTI H;  2HOD A;  5GTI E;  1IK9 A;  1SQQ K;  2PRR A;  2PAC A;  5CJ0 A;  3VOP A;  4AX3 A;  1IFP A;  1NIR A;  1NU1 E;  1H31 B;  1KB9 I;  3FWL A;  3CX5 H;  1ZN5 A;  3G9R A;  4L75 A;  5AW4 B;  1ZV8 A;  1LTT C;  1K3G A;  4DT0 A;  3F5H A;  1CCR A;  1B7V A;  3O20 A;  5AW9 B;  4PV1 B;  2IBZ I;  5CHX A;  5KAF V;  3L70 J;  5APT A;  1NHL A;  3CCR P;  1GL2 A;  2FBW C;  1NAY A;  1Z56 A;  1RE3 A;  2D2C B;  1BCC D;  3CPW O;  4IFD K;  1N73 A;  3D71 A;  1CIG A;  4UB6 V;  2IFM A;  2P10 A;  1DW3 A;  1P84 H;  1H32 B;  4IOI H;  3GMA A;  3IN6 A;  1LNQ A;  1CTY A;  2QJK B;  2V7Q H;  3L37 A;  2P2U A;  2KNC A;  3PHL A;  1IO4 A;  3KDP B;  5TIS E;  2ZXX A;  2BCN B;  2JQR A;  3D70 A;  2J5U A;  4HJG H;  3A7O A;  1CIE A;  2QG4 A;  1PGJ A;  4EIF A;  2FKW B;  3GHG A;  1BL9 A;  3ZIY A;  1GMJ A;  1BDC A;  2M3E A;  3RK3 E;  1QX8 A;  4IL6 H;  3S9O A;  4D6T J;  4AAO A;  2W90 A;  5CCG C;  3VYI A;  2Z4E A;  3O0R C;  1EDL A;  3P8C E;  2OYH A;  1CED A;  2YIU B;  3HE4 A;  3CXH D;  4UB8 H;  1BSN A;  3USS A;  4GOF A;  4I2L C;  3I56 P;  3O6Q B;  1BE3 G;  4PJ0 H;  2OYI B;  1QLE D;  3WFC C;  4PV1 C;  2BAS A;  4WWI A;  1KD1 Q;  3FX0 A;  1EXJ A;  2Y9Y A;  4AUW A;  1CRG A;  1JOC A;  3CX5 E;  3WUI A;  2B4Z A;  3BCC J;  4GT1 A;  2C1U A;  3EQ2 A;  3QH9 A;  3RLM A;  1SFC B;  1GKS A;  1OAE A;  1YBK A;  2E76 C;  2JWD A;  1A8C A;  2I1J A;  1FS0 E;  5AVW B;  1N8R Q;  1FZA A;  3CU4 A;  3A0B E;  3AEB C;  3BCC E;  2ZYG A;  4NPF X;  2ZFC A;  2QE7 H;  1FJK A;  1AJY A;  1PZQ A;  3JBT B;  4B86 A;  2WTY A;  3AEF C;  1NYH A;  3H1H G;  1YTZ T;  2K3R A;  1KFN A;  1KQS O;  1HJ5 A;  1NTZ J;  2N18 B;  2Z5I A;  4I6M C;  1MZ9 A;  1FC2 C;  3PXS A;  2C1D B;  1SQP G;  2XZR A;  1N9C A;  1NTK J;  3A5T A;  2YXQ B;  1JY2 P;  3Q5R A;  3ZOY A;  5CCH D;  1COT A;  3KQG A;  1FOS E;  3TYI A;  2WIT A;  1KYO H;  1NU1 D;  4OGQ C;  4UB8 E;  3CD6 P;  3MD0 A;  3L74 D;  1LTJ B;  4XE5 B;  2WSE H;  2CA4 B;  3H1K G;  2K37 A;  2C8S A;  1OMI A;  2FYU G;  3C2C A;  3TGU G;  1Q86 Q;  3L73 G;  1FI9 A;  1PPJ E;  4NPD A;  3PXW A;  3CCM P;  1ETP A;  4AAN A;  3A9F A;  1SP4 A;  1WEJ F;  5AW5 B;  4H44 D;  2V08 A;  2BGV X;  2J58 A;  1QL2 A;  2LXC B;  1GIW A;  5CIH B;  2ZT9 B;  2K9J A;  2GC4 D;  1H9Y A;  4GED B;  2FYZ A;  1OVU A;  1GU4 A;  1IFI A;  2O3J A;  1M56 D;  3MK7 B;  3EFF K;  2DVH A;  1LTJ C;  2QJK C;  3GLM A;  1IRW A;  2OTK E;  1DD3 A;  1HH0 A;  1SQQ G;  2B88 A;  4EDF A;  3PH0 A;  1KIB A;  1VF5 D;  1OX3 A;  1JY3 N;  2IFN A;  3M9H A;  1QN2 A;  1AV1 A;  1N7S D;  1MFT A;  1YJW P;  3X39 A;  1I6E A;  2ZBO A;  4QMA A;  3VN0 A;  1H33 B;  1RHZ B;  2Q3E A;  2RH0 A;  3AEA C;  3D6Y A;  2DGE A;  1LTS C;  1LTI C;  1NO4 A;  1CRH A;  1GD2 E;  5CIC B;  155C A;  2OGU A;  2FWL A;  2ZXE B;  1BCC J;  3L71 D;  3ZDM A;  4H0L B;  1AOF A;  1KFM A;  5APU A;  2OYH C;  2C0W A;  2WQY C;  5CBO A;  3V6I A;  1CHJ A;  2OYO A;  1Q2N A;  3CMA P;  5CCH C;  1LS9 A;  3VMA A;  3FXE A;  4U3F G;  1SS1 A;  3W67 A;  1CYC A;  1EZV E;  1VF5 B;  2BPB B;  2XND H;  2K88 A;  1U74 B;  2B11 B;  2L5G B;  5DJQ B;  1EQ7 A;  5AVY B;  1GQ1 A;  3CXH W;  4WQB A;  1T3J A;  1BGY J;  4AYC A;  2W6A A;  1YYC A;  4L74 A;  1AQ5 A;  5CYT R;  5APY A;  5KKZ C;  1S5L V;  1KV9 A;  1NAF A;  1FHB A;  3UIA A;  1FI7 A;  4R4L A;  1IQC A;  2FFD C;  1VQ4 P;  3L72 D;  1XTG B;  3B5N D;  5KTB A;  4BRY A;  5BVZ A;  2GIW A;  1JDL A;  1LP1 B;  3WFE C;  5H2F H;  3I5C A;  3A0B H;  5DJU B;  5E79 H;  1FDO A;  3RMZ A;  2H89 C;  3SWF A;  5EXQ A;  3Q3D A;  4W7Y A;  2QJP B;  3NTN A;  3HD7 C;  2CPS A;  1BE3 J;  1IFN A;  4N3Y B;  4YPC A;  4OGQ D;  2FYU J;  1PFI A;  3M0A A;  1CSB A;  3AE5 C;  2Q3I A;  2GB8 B;  2FYN B;  2FYU D;  1N7S C;  1LWU C;  3B5N B;  1YNR A;  1NJI Q;  1CSW A;  3L73 D;  3H1I E;  3E1I A;  2HYN A;  1JM0 A;  3AEC C;  5AW6 B;  2O01 H;  4A7P A;  3CCJ P;  1NTM K;  1Q90 D;  2D2C D;  2KNC B;  1SQV J;  2KZI A;  3V2N A;  1SLQ A;  3CWB G;  3AE7 C;  2FXM A;  4AAL A;  1CIF A;  3VMZ A;  1CNO A;  1SQV D;  4K35 A;  3Q2Y A;  1NTK D;  2ITA A;  4WBA A;  1P84 D;  2Y9Z A;  3M0D A;  3RL0 g;  4FA1 A;  1FAV A;  1I5T A;  3CI9 A;  1GL2 B;  2A06 D;  2HV4 A;  1CYI A;  1CRC A;  4WQC A;  2KOG A;  1VQO P;  4GKG A;  3AEG C;  2ZAE B;  1C6O A;  3WUU A;  2MJZ A;  5BU5 A;  1IJD B;  2QM8 A;  3GG2 A;  3AEE C;  5TIS H;  3MUD C;  3B71 A;  2IZ0 A;  1DW0 A;  2KK7 A;  1LTJ A;  1M8O B;  4Y5R A;  1NVO A;  2NZ2 A;  5CJ4 A;  2PCB B;  2NPS D;  3OCD A;  4FA9 A;  1YIT P;  1EDI A;  2CE0 A;  4EYY Q;  3T97 B;  1Q81 Q;  2N18 C;  3M06 A;  2W6J H;  4O1Q A;  4RSZ A;  4OWF A;  1RZ5 A;  2ZZS 1;  1SQX D;  3Q5S A;  1FZC A;  3AE6 C;  1HZV A;  1K3H A;  1JY2 O;  1SQB G;  1WVE C;  1N86 A;  1X8Y A;  2NPS B;  5DJT B;  5KJ7 A;  1YJN P;  3PH2 B;  3H32 B;  5KJ7 D;  2E74 B;  2L4D A;  351C A;  3BAT A;  5DFS A;  3AED C;  1AQT A;  1GL2 D;  5KAI H;  3ZBM A;  5KAI E;  2KP8 A;  3Q5P A;  451C A;  1GDT A;  4N78 E;  3OA8 A;  1I8O A;  1MZ4 A;  2KUB A;  1S72 P;  1AFO A;  1RY3 A;  3TSI A;  1URQ C;  4BWN A;  2NRG A;  2AEJ A;  1GK4 A;  5E79 E;  2J59 M;  2MKV A;  1N2D C;  2R44 A;  1FI3 A;  1HTL C;  1X79 B;  3C9I A;  1DVH A;  1S5L E;  1L4A A;  2M0B A;  2WPR A;  4I7Z C;  3G4S P;  1KIL C;  1SFC D;  1NGM B;  2AXT V;  2ORL A;  1MG3 D;  4HH2 A;  4D6T D;  4J20 A;  3BRT B;  2E74 C;  1CI6 A;  2YKQ A;  3C8V A;  5APS A;  2N3Y A;  4I1L A;  3L71 J;  5AVV B;  2KLU A;  4PV1 D;  3H1L G;  3PXT A;  2V7Q J;  3M9Q A;  3OAK A;  1DH3 A;  1BSH A; 
#chains in the Genus database with same CATH homology
 1I54 A;  2CXB A;  1H1O A;  1H33 A;  1OCD A;  1N9C A;  1COR A;  3ZOY A;  2C9X B;  4PW9 B;  1N50 A;  1COT A;  2K9J B;  3TYI A;  1EZV D;  4WQA A;  2YK3 A;  2PCC B;  3HQ7 A;  4EIC A;  5C9M A;  2N9J A;  1NU1 D;  1GJQ A;  2RN0 A;  3L74 D;  2ZOO A;  1YEA A;  1KX7 A;  2CA4 B;  4WQE A;  3WU2 V;  2C8S A;  2IBZ D;  1QL3 A;  1ZRT D;  1E8E A;  2Y0C A;  3C2C A;  1CSU A;  2AIU A;  5KLI B;  1FI9 A;  4GYD A;  3GW6 A;  3PXW A;  1L0N D;  5B5E V;  1N90 A;  4H0J A;  1ETP A;  4AAN A;  2C1D A;  3A9F A;  5GTH V;  1WEJ F;  5CIF B;  4WQ8 A;  3H1J D;  1M70 A;  1HZU A;  3DMI A;  1LC1 A;  2L91 A;  2V08 A;  1CC5 A;  2BGV X;  3SLE A;  1GIW A;  5DJQ C;  5CIH B;  3VRD A;  2N9Y B;  2GC4 D;  1H9Y A;  3KZI V;  4GED B;  4IL6 V;  1C6S A;  5TJH A;  1R0Q A;  5KLV D;  1DW2 A;  1FCD C;  4AAM A;  1PPJ D;  1H9X A;  2CA3 B;  1CRI A;  2QJY B;  1NTZ D;  5B6Q A;  3RN1 A;  4DY9 A;  1YIC A;  3O5C A;  2O3J A;  1KX2 A;  4EID A;  1I8P A;  3MK7 B;  2ZXY A;  1FOC A;  2DVH A;  5C0Z A;  3WFB C;  1IRW A;  4EDF A;  1DW1 A;  3H1L D;  3VYM A;  1KIB A;  4XYD B;  1QN2 A;  4YE1 A;  1A56 A;  2I8F A;  3ZCF A;  1SQB D;  4O1W A;  3X39 A;  3CX5 W;  2ZBO A;  1I6E A;  1H33 B;  3CYT I;  3CWB D;  3L4M A;  2Q3E A;  2OZ1 B;  2JTI B;  3DR0 A;  2BCC D;  2DGE A;  2N9I A;  1DT1 A;  1LMS A;  1W5C T;  1DIQ C;  1CRH A;  2XTS B;  5CIC B;  155C A;  4QAO A;  1CIH A;  3SJL A;  1CTZ A;  2FWL A;  3HQ6 A;  3SXT A;  3H1K D;  1LC2 A;  3WC8 A;  4MU8 A;  4N0K A;  1DII C;  1A2S A;  4L3H A;  1SQP D;  1CCH A;  2VHD A;  3L71 D;  1N15 A;  1HRO A;  3PTZ A;  1AOF A;  1C2N A;  3TGU D;  1L9J C;  1IO3 A;  2LIT A;  5KAI V;  1BE3 D;  2C2C A;  1KYO D;  1YIQ A;  1CHJ A;  1CSV A;  4L1Q A;  1E2R A;  1LS9 A;  3VMA A;  1NML A;  3VNW A;  1U75 B;  2ZON G;  2BH4 X;  1S6V B;  1I55 A;  3WFD C;  3OA8 B;  2AI5 A;  5AUR A;  3O1Y A;  1CYC A;  4L3G A;  3M97 X;  2BPB B;  1H31 A;  1U74 B;  2B11 B;  5DJQ B;  2KS1 A;  1QYZ A;  5GTI V;  1M6Z A;  1GQ1 A;  3CXH W;  1HCM A;  2D0S A;  1RZ6 A;  4WQB A;  5CIE B;  4Q5P A;  2B0Z B;  2YQB A;  1IRV A;  1C75 A;  1LFM A;  3HQ8 A;  3L70 D;  5CYT R;  5KKZ B;  1S5L V;  1KV9 A;  4K3I A;  3ZOW A;  5TIS V;  1H32 A;  1RAP A;  1J3S A;  1NTM D;  1FHB A;  1FI7 A;  1KYO W;  1IQC A;  1C2R A;  3L72 D;  1CXA A;  4WQ9 A;  2GIW A;  1JDL A;  3WFE C;  1CO6 A;  3ZOO A;  5H2F V;  1NMI A;  3DP5 A;  4FA5 A;  5CID B;  3RMZ A;  5EXQ A;  3ITK A;  2N3B A;  2GC7 D;  2QJP B;  3H1H D;  2B12 B;  4FAN A;  2BLF B;  1MG2 D;  2LIR A;  1DVV A;  3L75 D;  3CX5 D;  2GB8 B;  1YTC A;  1SQQ D;  2C1V A;  2FYN B;  2FYU D;  4LJI A;  1YNR A;  1KB0 A;  4JCG A;  4PD4 D;  1CSW A;  3L73 D;  3OCD B;  4WQ7 A;  1CXC A;  2FRC A;  2MTA C;  4A7P A;  1HJ3 A;  1AOQ A;  2PAC A;  2V07 A;  4V2K A;  4AX3 A;  3RN0 A;  3NBT A;  2KNC B;  1NIR A;  1VYD A;  1H31 B;  3FWL A;  1BGY D;  4RJT A;  2JWA A;  1YEB A;  1HJ4 A;  4AAL A;  1CIF A;  4KMG A;  1CNO A;  1PP9 D;  1SQV D;  1NTK D;  4P4Q B;  1K3G A;  1CCR A;  1B7V A;  1P84 D;  3O20 A;  2Y0E A;  1HRC A;  3BCC D;  4FA1 A;  1I5T A;  5KAF V;  2A06 D;  1QL4 A;  1W2L A;  2OZ1 A;  2HV4 A;  1CHH A;  1CYI A;  1YFC A;  3SWS A;  1BCC D;  3PLN A;  1CRC A;  4WQC A;  5E79 V;  4UB8 V;  1CIG A;  4UB6 V;  3A0H V;  1DW3 A;  1H32 B;  1C6O A;  1IZL 0;  1CHI A;  5CIG B;  1CSX A;  4FA4 A;  5IY5 1;  1C6R A;  2BH5 X;  1CTY A;  2QJK B;  3GG2 A;  3CP5 A;  3PHL A;  5CIB B;  4U3F D;  2BCN B;  2JQR A;  1QKS A;  1DW0 A;  2Y0D A;  4XXL A;  1CIE A;  2QG4 A;  4EIF A;  4Y5R A;  2CE1 A;  1CRY A;  2PCB B;  1BL9 A;  3OCD A;  1C7M A;  4FA9 A;  2MHM A;  3A0B V;  2CE0 A;  3ZIY A;  1E29 A;  1AKK A;  2N18 C;  1CTJ A;  4O1Q A;  4RSZ A;  3PRJ A;  1RZ5 A;  1EB7 A;  2ZZS 1;  4AAO A;  2B10 B;  1SQX D;  3TDK A;  4PJ0 V;  3O0R C;  1YCC A;  1KB9 D;  4PWA A;  1I6D A;  1HZV A;  4WQD A;  1CED A;  1K3H A;  3MK7 C;  2YIU B;  3CXH D;  1WVE C;  4EIE A;  3H1I D;  4H0K A;  3WFC C;  3PH2 B;  2L4D A;  351C A;  5DFS A;  1M60 A;  1CRG A;  3ZBM A;  3WUI A;  2B4Z A;  451C A;  3KHU A;  1GU2 A;  2C1U A;  3OA8 A;  3RLM A;  1I8O A;  2D0W A;  4FAV A;  1GKS A;  1OAE A;  1F1C A;  1MZ4 A;  1A8C A;  4FB1 A;  1L9B C;  1F1F A;  1FJ0 A;  3TF5 A;  3CU4 A;  1GDV A;  3ZOX A;  1FI3 A;  3L4O A;  1HH7 A;  2RMZ A;  3NBS A;  2EXV A;  1DVH A;  2YCC A;  4NFG B;  1CYJ A;  3JBT B;  5DF5 A;  1NNO A;  5B66 V;  2AXT V;  1CRJ A;  2ORL A;  1MG3 D;  3HQ9 A;  1C52 A;  4D6T D;  1L0L D;  4J20 A;  3NWV A;  1HJ5 A;  2N3Y A;  2N18 B;  3ORV A;  3SVW A;  1AYG A;  3PXS A;  3PXT A;  1ZZH A;  1RAQ A;  2C1D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...