3CXHD

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 246
sequence length 246
chains with identical sequence O
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cxhD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cxhD02
3VYMA 3KHUA 5CYTR 1H32B 1E29A 4NFGB 1I8PA 2BCCD 2I8FA 2BGVX 4WQ9A 3SVWA 3CXHD 2IBZD 1SQBD 4L3GA 3RMZA 1W2LA 2ZBOA 4O1WA 3WC8A 4WQDA 5CIEB 3BCCD 4L3HA 1S6VB 1QYZA 2N9IA 3CYTI 1FI7A 4WQCA 3L75D 1L0ND 2L4DA 4EICA 1C7MA 1VYDA 1P84D 4FA9A 1CRGA 3A0HV 1NNOA 1H9YA 1S5LV 5CIBB 4FANA 1JDLA 3MK7B 1CTZA 3TF5A 1YNRA 3ZIYA 3NWVA 3GW6A 3VRDA 1DT1A 1RAPA 2ZOOA 1A8CA 1GIWA 2QJKB 5DF5A 1GKSA 2YIUB 3ZCFA 1I5TA 3HQ7A 4IL6V 1CSUA 1CIEA 1K3HA 3H1ID 5DJQB 2CE0A 2PACA 5CICB 1NMLA 1H9XA 1DW2A 5KAFV 4UB8V 5CIGB 3L4OA 2LITA 3VNWA 5C9MA 3GG2A 2CE1A 1H33B 1DW1A 1HJ3A 3CXHW 3WU2V 2KNCB 5KKZB 4N0KA 4QAOA 3ZOYA 2L91A 3A9FA 3PH2B 1W5CT 4LJIA 4H0KA 2B12B 1U75B 2MTAC 3OA8B 3MK7C 1NTMD 1M70A 2BLFB 3O1YA 1CC5A 1QKSA 1YEBA 4WQAA 2BCNB 4EIDA 1I6EA 1YFCA 1H1OA 4AANA 1PP9D 1FOCA 1KYOW 2HV4A 1EB7A 2OZ1B 1CIHA 3L74D 3ZOXA 1WVEC 1HZUA 1RZ5A 2C1DA 1C52A 1LC1A 5KLIB 1HJ4A 2FWLA 3ZOOA 2Y0CA 3PLNA 3PTZA 5DJQC 2C2CA 1CYCA 5KAIV 1PPJD 3OCDA 2YCCA 1KX2A 1C2RA 1LS9A 1KB0A 3TGUD 1YTCA 3H1JD 3SLEA 1OAEA 3NBTA 4WQBA 3NBSA 2D0WA 4FAVA 1GQ1A 4EIEA 4JCGA 4PW9B 1AOFA 1A2SA 5TISV 1CRCA 1FCDC 1F1CA 4YE1A 2LIRA 1CTJA 1I54A 2V07A 1KX7A 1C6OA 1KIBA 1KYOD 4V2KA 3L73D 3WFCC 3O5CA 1GJQA 1IRWA 4O1QA 1MG2D 1LFMA 1H31A 1ZRTD 1QL3A 3C2CA 5CIDB 1LC2A 2N9JA 1DVHA 1CORA 1ZZHA 3RLMA 2GIWA 2PCCB 3WFDC 2C1VA 1M6ZA 1CHIA 4RJTA 2N18B 2B11B 1F1FA 2DVHA 1CRHA 3TYIA 1DIIC 4UB6V 2C1UA 4MU8A 1N9CA 2GC4D 4PD4D 3RN0A 1L0LD 2CA3B 5EXQA 2ZONG 1ETPA 3DR0A 3WFBC 4FA4A 2JTIB 3PRJA 1SQPD 1CYIA 2BH5X 3KZIV 1MZ4A 4WQ7A 1C6RA 3SWSA 2AIUA 1CXAA 1MG3D 5TJHA 5GTIV 3HQ8A 4K3IA 1KB9D 4L1QA 5C0ZA 1COTA 4PWAA 3SJLA 3TDKA 1KV9A 1E8EA 3HQ9A 1BL9A 3ITKA 1IO3A 1CTYA 3H1KD 1I6DA 1CHJA 1HROA 1H32A 1GU2A 1CEDA 2B4ZA 2N18C 3SXTA 2QJYB 1GDVA 1HRCA 3CX5D 4A7PA 1NMIA 1R0QA 451CA 2N9YB 3PXTA 2A06D 1FJ0A 3WFEC 1FI3A 5B6QA 4RSZA 2ORLA 1CRIA 2EXVA 2QJPB 2VHDA 1LMSA 351CA 2N3YA 1N15A 2ZZS1 1CRYA 1M60A 1FHBA 1QN2A 2KS1A 3L70D 2C1DB 1BGYD 4AAMA 1B7VA 3PXWA 4H0JA 2PCBB 1K3GA 1IZL0 1NTKD 3H1HD 4WQ8A 3PHLA 2AXTV 2Y0DA 3CP5A 1AOQA 2RMZA 3DP5A 3OCDB 4Y5RA 2Q3EA 1OCDA 2N3BA 1C2NA 1EZVD 1C6SA 1SQQD 1L9BC 5KLVD 1HZVA 1CHHA 4AALA 2JQRA 4GEDB 2Y0EA 1CSWA 3DMIA 3RN1A 3VMAA 1AYGA 4XYDB 1SQVD 2V08A 1N50A 1C75A 3L72D 2FRCA 1DW0A 3CX5W 155CA 1I55A 1CCHA 1H33A 1YEAA 5CIFB 4WQEA 1N90A 1RAQA 2O3JA 1NTZD 4P4QB 4FB1A 1CIFA 3L71D 5E79V 1NU1D 1L9JC 2C9XB 1BCCD 3PXSA 1H31B 2K9JB 4XXLA 3OA8A 4FA1A 1CYJA 4EIFA 2C8SA 1CCRA 2MHMA 3O0RC 1HCMA 1NIRA 1IQCA 3WUIA 2ZXYA 2CA4B 3CU4A 4J20A 1CO6A 2BH4X 2OZ1A 5H2FV 1CSVA 3X39A 3O20A 3HQ6A 3ZBMA 2QG4A 1I8OA 2XTSB 2CXBA 1HJ5A 5B5EV 1YIQA 4Q5PA 3ZOWA 1A56A 1J3SA 2RN0A 4DY9A 2FYUD 2YQBA 5B66V 5AURA 3ORVA 4PJ0V 1QL4A 1SQXD 1CNOA 1YCCA 1RZ6A 3JBTB 4EDFA 1BE3D 1YICA 1CXCA 1E2RA 1U74B 1DW3A 4AAOA 2B10B 5CIHB 4AX3A 2AI5A 2DGEA 1IRVA 3M97X 1DVVA 5GTHV 1AKKA 2BPBB 1FI9A 1CSXA 1CIGA 4U3FD 4KMGA 2YK3A 2JWAA 5DFSA 3FWLA 1HH7A 2FYNB 5IY51 1DIQC 4GYDA 2D0SA 2GC7D 1CRJA 1WEJF 3A0BV 3CWBD 4FA5A 3L4MA 2B0ZB 2GB8B 3H1LD 4D6TD
chains in the Genus database with same CATH superfamily
3VYMA 3KHUA 3FXEA 2BCCD 5CCHD 3L72E 1FOSE 2WITA 1SQBD 2PAJA 3RMZA 1SQVJ 4IFDK 1W2LA 3WC8A 1FBMA 2D2CD 2CK3H 3GF7A 3BCCD 2N1TD 3RBZA 1FI7A 1VL2A 2JO1A 1L0ND 1P84D 2ZT9D 4I6MC 1NNOA 3VP8A 2Q3IA 3V2PA 5CIBB 2K1AA 1JDLA 1OW8A 2C0XA 1NO4A 3FX0A 3TSIA 4XFJA 3P7KA 3NWVA 3CCRP 1LTJA 2Z5IA 3A2AA 1GL2A 1NTKG 5B66H 3GW6A 1RAPA 2ZOOA 4K3AA 1KB9E 1N7SB 1GIWA 1GKSA 2YIUB 1NVOA 3BATA 2ZJSE 4RKUJ 1N73B 2W8ZA 2W6JH 1FDOA 5CBNA 2WPQA 4DJGA 1NKNA 1LJ2A 2KOGA 5CICB 1URQA 1NMLA 1H9XA 2C9NY 4ASVA 3H1KJ 5CIGB 3A0BH 5C9MA 3VNWA 1H0TB 5AVYB 3AE4C 4U7JA 3RL0g 4W7YA 1T8ZA 3A9FA 1N8RQ 1MZ9A 4H0KA 3B4SA 2MTAC 2W6BA 1GDTA 1A02F 1YEBA 4NPDA 1L0LK 4EIDA 4GKGA 1H1OA 4AANA 1FZGA 2WMMA 1N7SC 1SLQA 3L74D 5APVA 4GODA 3B71A 2PFXA 3V2QA 3F5HA 1S72P 3V2RA 3ZOOA 3PLNA 3EWKA 2V7QJ 1NTMK 2GUVA 2FYUG 3PH0A 4M3LA 2YCCA 1LP1B 1QGKB 1KFNA 5KLVJ 3CCMP 1YQ4C 4C7NA 1LT1A 2FBWC 1S3JA 4IFFA 5AW0B 3RK3B 1BDCA 4UB8H 2H88C 4PW9B 5TISV 2QRXA 5H2FH 1IC2A 2ZVNB 3EFFK 1F1CA 1R5LA 3E7KA 1I54A 5KAFE 1M90Q 1CI6B 2E74C 2M3BA 3H1IE 5APXA 1VQ8P 1RHZB 4V2KA 3O5CA 3MGNA 2BCCG 4OH8B 3WU2E 2E43A 2K9JA 1QL3A 5CIDB 1IZNB 1CORA 1SQBG 1ZZHA 3L4FA 1KILA 2ZXEB 2YO2A 2PCCB 3P32A 1M6ZA 1EZVG 1DEEG 2N18B 3BCCG 1YBKA 2B87B 3ZDMA 1L0NG 5GTHE 4I7ZB 3RK2B 3RN0A 2WPSA 3AE6C 2ZONG 3U1CA 1R5SA 2NPSA 1ZLLA 1SQQK 1SQXJ 3ABVC 3PRJA 2KSJA 1CYIA 2BH5X 2OYOA 2KB7P 1NTZG 1MZ4A 3M0DA 1C6RA 2AIUA 1IK7A 5KAIE 5AVWB 3Q5PA 4K3IA 2OYHB 2JWDA 5CCGC 1YITP 4L1QA 3HE4B 5M1BA 1FS0E 4WBAA 3SJLA 3CWBJ 4PV1D 1J1EC 5AW3B 3H1LJ 1E8EA 4WB4A 1SFCB 3H1JE 2WVRA 2QJKC 1IO3A 1AJYA 3H1KD 3K5BA 3CXHE 1Q82Q 1J1DC 1CHJA 1H32A 3TGUJ 2Q1KA 4ASWA 2N18C 4H13B 2QJYB 4A7PA 2PP6A 1Y8AA 2N9YB 4I7ZC 3RK2C 5AW7B 1JMBA 3P8CD 1CRIA 2EXVA 3L75J 4W80A 3CLQA 3I5CA 1KYOE 2OTKE 2PGDA 1VF5D 5KKZC 2N3YA 3U59A 1FHBA 3S9OA 2PCBB 2OYHC 1H8AA 4WQ8A 5KJ7D 4UB6E 1JY2P 1M8OB 2M5AA 1KFMA 2AXTV 3DP5A 3FGAD 2WPRA 4DZOA 2OGUA 3H32B 5BVZA 4PD4E 1C6SA 5GTIH 1L9BC 5KLIC 3KZIE 5KLVD 1HZVA 1EXIA 1JY3O 1ZOYC 2JQRA 4GEDB 3DMIA 4H13C 4IL6X 5BU5A 3M9BA 2Q5UA 2QJYC 2WT7A 1J2JB 3CX5W 1I55A 2DW3A 1LT9A 1T2KD 5CIFB 3G6EP 3TNUB 1HUCA 1PGPA 3NFQA 2P67A 3MUDC 1RF1A 4WY4B 1NTMJ 1PP9E 3AEGC 1FAVA 2O01N 3RL0B 2XNDH 4XXLA 3CX5H 4EIFA 4ZKUA 1CCRA 2MHMA 1HCMA 1NIRA 2XV5A 2CA4B 3CU4A 1X0TA 3X39A 2YKPA 2B88A 3HQ6A 4D6TD 1SVFA 1Z56A 2BEZF 3PP5A 2MJZA 2R5DA 2CXBA 1HJ5A 4WWIA 4BXLA 3CI9A 4RESB 1NU1K 1Q7YQ 1RF0A 2RN0A 3AEBC 5AURA 4Z1MH 1QL4A 1SQXD 1E79H 2WQYC 2OTJP 1Y47A 2E75B 1K04A 4AX3A 1JY3N 2AI5A 3B5NB 3RGUA 1NTKE 2IFMA 1IRVA 1AKKA 5CJ4A 3T97A 1IFDA 3VP9A 3CC2P 1CIGA 4WY4C 2YK3A 1KV4A 3AE1C 1LWUA 1KQLA 3FWLA 3OW2O 2FYNB 5IY51 1HVVA 1L4AD 3CWBD 1ZRTE 5APUA 3GHGA 2AEFA 3H1LD 1N2DC 3H1KG 5APTA 3G71P 2WWWA 3HE5A 4NFGB 1GMJA 1SQQJ 2OARA 2M8RA 2WSCJ 2BGVX 3M91A 4WQ9A 3HD7C 1PV3A 1MV8A 1AVYA 2IBZD 4DCKA 2Q6QA 2R3CA 3PJSK 4O1WA 5E79E 4WQDA 3L72J 3D71A 2Z4EA 3NTNA 1QYZA 3L71E 3D0WA 1OMIA 3CYTI 3L75D 1K05A 1AV1A 3LIDA 4FA9A 1CRGA 1JO5A 1H9YA 1M1JB 2D2CB 2E75C 3B5NC 3NMDA 5B5EH 5AVXB 2E76D 2N1TB 3ZIYA 3IR9A 2GUSA 2ZT9B 3MP7B 4N78D 2FYNC 2WZ7A 2SPZA 5DF5A 5DJTB 1I5TA 4IL6V 4PJ0E 1JB0J 1PL5A 2FYUE 2FYZA 5DJQB 3EQ2A 3HD7A 3HTKA 1NAYA 1DW2A 4H44D 5KAFV 1BE3E 2IZ1A 3E1RA 4HB1A 1S2EA 3OAKA 2CE1A 1H33B 2I1KA 3CXHW 3WU2V 5CCHC 1NH4A 2KNCB 1VQ6P 4KT0J 4U3FE 1QX8A 4QAOA 3CC4P 2L91A 3PH2B 2N9BA 1RE4C 1G2CA 1PGOA 2QIWA 2B12B 1IFPA 1NTMD 1M70A 2BLFB 3O1YA 2N1TC 1CC5A 4D6TE 1VQ5P 4WQAA 1WT6A 2KIKA 2XU6A 2BCCE 2V7QH 2NZ2A 1FOCA 5BU8B 2ZT9C 2E5TA 1KYOW 1BGYJ 2OZ1B 1Q90D 3ZOXA 1WVEC 2RH0A 1SQBE 1RZ5A 3H1HJ 2C1DA 5AVVB 4LC1A 5CHXA 2AXCA 2KSEA 3SFDC 3OJAB 1EZVE 5AW2B 3PTZA 1H88A 3BCCE 3A0HE 5DJQC 2FY8A 2ZAEB 1S5LE 5KAIV 1HWTC 2C0WA 1VPCA 1L0NE 2QM7A 3NXSA 5DJUB 2KXPB 1YI2P 1P84E 2WSEJ 3SSUA 1SQXG 4L74A 2IYPA 5CJ0A 2FXOA 3QWOC 1KB9I 4BRYB 2A45I 2OYIA 1NTZE 4WQBA 1L2PA 1GQ1A 1AOFA 2YMKA 1A2SA 1CRCA 2ZYGA 4YE1A 2JP3A 1DX7A 3HUSA 1CTJA 2HYNA 1Q86Q 2Y9YA 1NU1J 3CX5I 3H1LG 3L70G 1BCCJ 1KIBA 3F89A 1FZFA 4O1QA 1MG2D 1ZR2A 1OXZA 1H31A 3H1IJ 3W68A 1FZCA 2IX7C 2ZVOB 1FDMA 1DVHA 1EDKA 2B9BA 2IBZG 3RLMA 4EYYQ 4OGQD 3Q3DA 1OX3A 3WFDC 1NTKK 1NJIQ 2C1VA 4Y99B 4RJTA 2B11B 4JQ0D 1F1FA 1GL2D 4UB6V 4KJMA 1N9CA 2GC4D 1M56D 2JKVA 5EXQA 2AEJA 2O01J 1MUUA 3VN0A 3WFBC 2JTIB 2KK7A 3O6QB 1SQPD 3L74E 1QEXA 3KZIV 2FXPA 2W6AA 1A02J 1URQD 3SWSA 2GM4A 4NPEA 1EDJA 1BSHA 3L71G 4CPGA 5AW5B 1FC2C 5TJHA 2KYVA 1KB9D 1COTA 5TISH 3RBXA 2CPBA 3TDKA 2HODB 2B89A 2M0BA 1BL9A 1CTYA 2I8DA 2YIUC 2GA1A 5AW6B 3V6IA 1GU2A 1N73C 5CBOA 4PV1B 2E5YA 1QVFO 3CX5D 2KLUA 1R0QA 2YXQB 4GOEA 2QA4P 451CA 3PXTA 1S9KE 1FJ0A 2FFDB 2P10A 1AFOA 1BE3G 1RQVA 1X9VA 4YPCA 1CRYA 1M57D 2FYUK 1W5CE 1N7LA 1QN2A 1BSNA 1LTGC 2HPCB 1BGYD 4AAMA 4IL6E 4U3FG 3PXWA 1EDLA 2Z5HA 3H1HD 1S5LX 1VF5B 3PHLA 2XDJA 3A5TA 1AOQA 1N7SA 4IOIH 3OCDB 1HTLC 4D6TG 1WMKA 5C39A 2C9LY 2N3BA 1MKMA 2HLOA 2KZIA 5EFWB 3JCUE 1OWAA 2Y0EA 1CSWA 3RN1A 3A7OA 2JEEA 1SQVD 1UIIA 2FRCA 1DW0A 1H0TA 1JY2O 155CA 2FFDC 3L36A 4WQEA 1SQBK 1HGVA 1RAQA 2G8YA 3VTPC 2Q9IA 2W83C 1KILD 5E79V 3CXHI 1NU1D 3RK3C 1BCCD 1L0NK 4FA1A 4GOFA 2LKMA 3H1KE 1PP9J 3O0RC 1JNMA 1RE3C 2J59M 1LNQA 2WT7B 2KP8A 2NPSD 2BH4X 3V4QA 5H2FV 2VRSA 1LT9B 1NTZK 4AUWA 4GDOA 3H25A 3KXDA 2QG4A 1ZR4A 1KYOI 1QLED 3RK3E 3MZWB 3G3ZA 3ZOWA 4NPFX 3C8VA 2AXTH 2E74D 1SQPG 4PJ0V 1LP1A 2Q7CA 1CNOA 1YICA 2W27A 2R5BA 1CSBA 1DW3A 4ZNCA 5CIHB 1VQ7P 3CD6P 2DGEA 3CC7P 3II6A 4PD4I 4KHXA 1FI9A 1OIPA 1CSXA 1NTKJ 4LLHA 2JWAA 2WSCH 1T2KC 1JY2N 5DFSA 4I1LA 1HH7A 1DEBA 1DIQC 1USDA 2GC7D 1CRJA 1WEJF 4FA5A 3L4MA 5KLVE 3L74G 5APSA 4YXDC 3LW5J 3L73J 1HGZA 3JSVC 5CYTR 1CI6A 5CCGA 4H0LD 1I8PA 1YYCA 2I8FA 4I2LC 3P8MC 1FZAA 1L4AB 2QVAA 3A3YB 3SVWA 1RH5B 3CXHD 4L3GA 3V5BA 2ZBOA 1U7MA 1SFCC 5CIEB 1K8AQ 4L3HA 2N9IA 1YJNP 4WQCA 2L4DA 1K9MQ 1L0LJ 4EICA 2B87A 1VQNP 3GHGB 1GZLA 3A0HV 5AW4B 2KS1B 1S5LV 1KB9H 4FANA 3MK7B 1BGYG 1CTZA 2A45H 5APQA 1YQ3C 4XA4A 1OW7A 3AECC 2KUBA 2XKMA 3BRVB 1A8CA 5AVSB 2E76B 3VMYA 3Q2YA 5B66E 3ZCFA 1EXJA 2OYHA 1NGMB 3CCJP 3HE4A 2PACA 1L4AC 1SQXE 3KQGA 2RKLA 1SQVG 1ZP0C 1K73Q 3GG2A 1SFCA 3IAOA 1JOCA 1DW1A 2YO3A 3CPWO 4H44B 1Q81Q 3A0BE 2QE7H 5L8RJ 1JCDA 1CZQA 4LJIA 1D7MA 1DD4A 3CWBE 3OA8B 3MK7C 3I56P 4ZKPA 1M1KQ 3H1LE 1QKSA 3L70E 2BCNB 4HJGH 5AVZB 3QH9A 2HFED 2BEQD 1PP9D 2HV4A 1EB7A 3MUDA 3IF4A 4GT1A 2WSEH 1HZUA 2IBZE 2BCCJ 1IFIA 1C52A 1LC1A 3RL0C 1FJKA 1HJ4A 3OA7A 2J5UA 2Y0CA 1SQBJ 4R4MA 2C2CA 1Y9BA 1PPJD 3L75E 1KD1Q 3BCCJ 3H32A 1VQKP 1C2RA 4JYBA 1LS9A 1KB0A 2P58A 3TK1A 3TGUD 1KN7A 1N86A 1JY3P 5KAFH 4N78E 4FAVA 2IPPA 1XTCC 1NTZJ 1JTHB 3D70A 3WU2H 3TNUA 4UB8E 3JCUH 2V07A 1LTBC 2PRRA 1KX7A 5H2FE 3M06A 1C6OA 1CW5A 1S4XA 3L73D 3WFCC 4WY4A 1GJQA 1KTMA 2KI7B 1ZRTD 3C2CA 4EIJA 2N9JA 3O8ZA 5AVUB 4HH2A 2O01H 5GTHH 4JBZA 1CHIA 2H43A 2DVHA 1CRHA 5KLVG 3TYIA 3HUSB 4JYCA 2WTYA 2OQQA 4OGQB 1L0LD 1ETPA 5KAIH 4FA4A 1LTJB 1GL2B 2G3AA 2KLVA 4AYCA 1FDIA 1EZVI 1X22A 3HD7D 1CXAA 3B5NA 3AEAC 4YTPC 2K9YA 1M1JC 1P84I 2D2CC 3LIEA 3AEEC 3CXHH 4PWAA 1SS1A 1URQB 4GIFA 4WVZA 3GF3A 2H8PD 5AVRB 2QSIA 3HQ9A 4TLFA 1I6DA 3SFEC 1VQ4P 1HROA 1HBWA 4N3YB 1CEDA 2B4ZA 1R8EA 2FKWB 1HRCA 3CCSP 1LTAC 1NMIA 1KYOH 2A06D 3D6YA 5APWA 3L37A 1FI3A 4RSZA 1T3UA 3M9QA 2O1JA 5CCHA 2O1KA 1N15A 2ZZS1 4UB6H 2P1JA 1RE4A 1KORA 1OFCX 1M1JA 1SQXK 1IJDB 4H0JA 1K3GA 2N1TA 4PD4H 1IZL0 2AEMA 3SWKA 2JDIH 4B86A 3CWBG 2Y0DA 1URQC 3CP5A 3KZIH 2RMZA 1PPJG 4Y5RA 2Q3EA 1OCDA 1C2NA 4N6JA 5AVQB 3USSA 1EZVD 1RQUA 2FXMA 1SQQD 4JPZB 3TGUG 4C7NB 4R4LA 1CHHA 1OZHA 4AALA 1SQPE 1GK4A 2M3EA 3VMAA 1NHLA 4XYDB 5GTIE 2V08A 2NRGA 1OVUA 1C75A 3S4RA 3L72D 1CCHA 1H33A 3L75G 2R44A 2KNCA 4BWNA 1NTZD 4LGDE 4P4QB 1MFZA 2J58A 3VMXA 1CIFA 1DH3A 3L73G 2C9XB 3PXSA 2K9JB 1CYJA 2ZYDA 1IQCA 3WUIA 1KILB 1IFJA 4J20A 3CX5E 2WSFH 2OZ1A 4ZMDA 1CSVA 3O20A 3S1KA 1I8OA 1KMIZ 1YHQP 2IZ0A 2V4HA 1YIQA 4Q5PA 1L0LG 1J3SA 3AEFC 1U57A 2NPSB 1VQLP 4DY9A 5B66V 2I1JA 3AE9C 3CCUP 2YXRB 4Y99C 3H1JJ 1RZ6A 1BGYE 1E2RA 1U74B 1ZXGA 3H1HE 2E74B 3LW5H 3M97X 1DVVA 3MIWA 4BRYA 4IFMA 1JEKA 3CMAP 1NTMG 3CL3D 4KMGA 2WPVB 3V4WA 2D0SA 1PGQA 3A0BV 3M0AA 1KILC 3WUVA 1H89A 1H32B 1E29A 3AE8C 5E79H 4EOTA 1SQVE 1G1IA 1VQMP 3Q1MA 3SWFA 3WMM0 4RO0A 2A06G 4H0LB 3I55P 2NPSC 4XE5B 3UIAA 1KILE 1S6VB 1N73A 1NU1E 4PV1C 1BCCE 1C7MA 1S9KD 1VYDA 3G9RA 3M0DC 1VQ9P 1N7SD 4QMAA 1QVGO 2LXBA 1SP4A 3TF5A 1YNRA 3KYQA 1GU4A 1M7LA 2E42A 3O6QA 2M5AB 3VRDA 1J1EB 2IFNA 1DT1A 1PZQA 4PJ0H 3B8EB 5B5EE 1NWQA 2QJKB 4HKZH 1DD3A 1W2EA 1J1DB 3R4YA 5CMZA 1KQFB 2YKOA 1FZBA 2P7JA 4EI2A 3HQ7A 1CSUA 1VQOP 2OTLP 1CIEA 1SQQG 1IFMA 1K3HA 1GW4A 4DOJA 1HF9A 3H1ID 4L75A 2CE0A 1VF5C 2HODA 2XNXA 4UB8V 2HR3A 1AQ5A 3L4OA 2LITA 3WUTA 3L72G 2R3SA 4H0LC 1HJ3A 5KJ7C 4TT3H 1X8YA 1GTWA 5KKZB 3P8CE 1FZEA 1DIPA 4N0KA 1EQ7A 1PIXA 2JR8A 1YJ9P 3ZOYA 1RF1B 4W7ZA 1W5CT 3IN6A 1U75B 2WSFJ 1NAFA 2FFDA 3H6PA 1YJWP 1I6EA 1YFCA 1AVOA 3VOPA 1UIXA 3L70J 1SQPK 1CIHA 3A0HH 1WRGA 3HRNA 3CCLP 4MN4C 1S5LH 2HPCA 2JJLA 5KLIB 2A45G 1P84H 2FWLA 1GD2E 1RE3A 1ZMEC 1CYCA 1NOHA 3OCDA 5AW8B 2H89C 4O9BA 3RK3D 1KX2A 3IFMA 5KJ7A 1LT9C 1YTCA 3H1JD 3SLEA 1OAEA 3NBTA 3T97B 1VQPP 1RF1C 4DT0A 3Q5SA 1GW3A 1OVVA 3NBSA 2D0WA 5CCGD 3FWNA 4EIEA 4JCGA 1LWUB 3E1IA 1FCDC 1RY3A 4L73A 2LIRA 3BASA 3Q5RA 1FE6A 3L71J 3MD0A 2ITAA 3MHVA 1HJBA 3HE5B 1IK9A 1KYOD 1HH0A 1IFNA 4YXWH 1KZUB 1IRWA 3H1HG 2WSSH 1LFMA 3JC22 3BVHA 1LC2A 1TU3F 2ZXXA 2W90A 1RF0C 3RK2D 1QL1A 2GIWA 2Y9ZA 2YKQA 4C7RA 3FXDA 1LTSC 3M9HA 1DIIC 2C1UA 4MU8A 1ZN5A 3AE5C 4Y28J 4PD4D 1OVRA 3MTUE 1KC8Q 2CA3B 3N4XA 2FYUJ 2CPSA 3V2NA 2HG5D 2IBZI 3DR0A 2YMYA 1BE3J 2QM8A 5AW1B 1LWUC 4WQ7A 2IDBA 2XZRA 3C1LA 2POHA 4JF7A 1SQVK 2MKVA 1MG3D 1NKZB 4HYTB 1PGJA 3GHGC 2P2UA 5GTIV 1NU1G 3HQ8A 4U3FJ 3AE2C 1SFCD 1BCCG 3WUUA 1PPJE 1E5WA 5C0ZA 3H1IG 3HD7B 3HTKB 3VMZA 4H13D 1FU1A 2R32A 1KV9A 4D6TJ 3TGUE 1LGHB 3ITKA 2E76C 1AQTA 3SWYA 1ZV8A 3EFGA 5TISE 3TYYA 3SXTA 1YTZI 1GDVA 1G1JA 1L4AA 1EDIA 1G2CB 1XTGB 1YIJP 1KQSO 2QEXP 1T6AA 3WFEC 1JCCA 5B6QA 1JMMA 2H7HA 2ORLA 3CMEP 1L0NJ 1KQGB 4IL6H 2QJPB 2VHDA 3L73E 1LMSA 351CA 3KPEA 3CCEP 1VDFA 4H44C 1M60A 1JUNA 1JM0A 2KS1A 3L70D 5K5GB 2C1DB 1USEA 3GMAA 1ZW0A 3W67A 1B7VA 3N7NA 1NTKD 4OVNF 1PFIA 2LXCB 3C9IA 1NYHA 3D6ZA 4AQRD 2LR2A 1L0LE 2UWJE 1U7JA 3GLMA 2K88A 3L35A 2YNYA 3CCVP 5AVTB 3H1JG 2OYIB 1FOSF 1OW6A 5AW9B 2KZJA 1AA0A 1AYGA 1N50A 1SQPJ 4WY4D 3VYIA 3RL0D 1YEAA 3KDPB 3G4SP 1N90A 2O3JA 1NTME 1MFTA 2QJPC 1LTTC 4FB1A 5KTBA 3L71D 4K35A 1L9JC 5KLVK 1H31B 1FZCB 1EC5A 3OA8A 2BASA 1W2BO 1QL2A 2C8SA 3L74J 1T3JA 2ZXYA 3AEDC 1LTIC 1CO6A 1HJ0A 5APYA 2ZFCA 3U1AA 3ZBMA 2A06E 2XTSB 1GU5A 3BRTB 1FJPA 2L5GB 3AE3C 1BDDA 5B5EV 1A56A 2E75D 2OYIC 3B5ND 2FYUD 1S1CX 2YQBA 1Q2NA 3ORVA 1YCCA 3JBTB 4OWFA 4EDFA 1BE3D 1CXCA 2AXTE 4L76A 4AAOA 2B10B 1YTZT 2IYOA 3HUSC 1X79B 5GTHV 4OGQC 2BPBB 3CCQP 4U3FD 1GK6A 1LTJC 1GL2C 2K37A 1FZCC 2ZYAA 3R2PA 4GYDA 1PP9G 1JTHA 1IO4A 1SQQE 4C46A 2B0ZB 2GB8B 2K3RA 3AE7C
chains in the Genus database with same CATH topology
3VYMA 3KHUA 5CYTR 1H32B 1E29A 4NFGB 1I8PA 2BCCD 2I8FA 2BGVX 4WQ9A 3SVWA 3CXHD 2IBZD 1SQBD 4L3GA 3RMZA 1W2LA 2ZBOA 4O1WA 3WC8A 4WQDA 5CIEB 3BCCD 4L3HA 1S6VB 1QYZA 2N9IA 3CYTI 1FI7A 4WQCA 3L75D 1L0ND 2L4DA 4EICA 1C7MA 1VYDA 1P84D 4FA9A 1CRGA 3A0HV 1NNOA 1H9YA 1S5LV 5CIBB 4FANA 1JDLA 3MK7B 1CTZA 3TF5A 1YNRA 3ZIYA 3NWVA 3GW6A 3VRDA 1DT1A 1RAPA 2ZOOA 1A8CA 1GIWA 2QJKB 5DF5A 1GKSA 2YIUB 3ZCFA 1I5TA 3HQ7A 4IL6V 1CSUA 1CIEA 1K3HA 3H1ID 5DJQB 2CE0A 2PACA 5CICB 1NMLA 1H9XA 1DW2A 5KAFV 4UB8V 5CIGB 3L4OA 2LITA 3VNWA 5C9MA 3GG2A 2CE1A 1H33B 1DW1A 1HJ3A 3CXHW 3WU2V 2KNCB 5KKZB 4N0KA 4QAOA 3ZOYA 2L91A 3A9FA 3PH2B 1W5CT 4LJIA 4H0KA 2B12B 1U75B 2MTAC 3OA8B 3MK7C 1NTMD 1M70A 2BLFB 3O1YA 1CC5A 1QKSA 1YEBA 4WQAA 2BCNB 4EIDA 1I6EA 1YFCA 1H1OA 4AANA 1PP9D 1FOCA 1KYOW 2HV4A 1EB7A 2OZ1B 1CIHA 3L74D 3ZOXA 1WVEC 1HZUA 1RZ5A 2C1DA 1C52A 1LC1A 5KLIB 1HJ4A 2FWLA 3ZOOA 2Y0CA 3PLNA 3PTZA 5DJQC 2C2CA 1CYCA 5KAIV 1PPJD 3OCDA 2YCCA 1KX2A 1C2RA 1LS9A 1KB0A 3TGUD 1YTCA 3H1JD 3SLEA 1OAEA 3NBTA 4WQBA 3NBSA 2D0WA 4FAVA 1GQ1A 4EIEA 4JCGA 4PW9B 1AOFA 1A2SA 5TISV 1CRCA 1FCDC 1F1CA 4YE1A 2LIRA 1CTJA 1I54A 2V07A 1KX7A 1C6OA 1KIBA 1KYOD 4V2KA 3L73D 3WFCC 3O5CA 1GJQA 1IRWA 4O1QA 1MG2D 1LFMA 1H31A 1ZRTD 1QL3A 3C2CA 5CIDB 1LC2A 2N9JA 1DVHA 1CORA 1ZZHA 3RLMA 2GIWA 2PCCB 3WFDC 2C1VA 1M6ZA 1CHIA 4RJTA 2N18B 2B11B 1F1FA 2DVHA 1CRHA 3TYIA 1DIIC 4UB6V 2C1UA 4MU8A 1N9CA 2GC4D 4PD4D 3RN0A 1L0LD 2CA3B 5EXQA 2ZONG 1ETPA 3DR0A 3WFBC 4FA4A 2JTIB 3PRJA 1SQPD 1CYIA 2BH5X 3KZIV 1MZ4A 4WQ7A 1C6RA 3SWSA 2AIUA 1CXAA 1MG3D 5TJHA 5GTIV 3HQ8A 4K3IA 1KB9D 4L1QA 5C0ZA 1COTA 4PWAA 3SJLA 3TDKA 1KV9A 1E8EA 3HQ9A 1BL9A 3ITKA 1IO3A 1CTYA 3H1KD 1I6DA 1CHJA 1HROA 1H32A 1GU2A 1CEDA 2B4ZA 2N18C 3SXTA 2QJYB 1GDVA 1HRCA 3CX5D 4A7PA 1NMIA 1R0QA 451CA 2N9YB 3PXTA 2A06D 1FJ0A 3WFEC 1FI3A 5B6QA 4RSZA 2ORLA 1CRIA 2EXVA 2QJPB 2VHDA 1LMSA 351CA 2N3YA 1N15A 2ZZS1 1CRYA 1M60A 1FHBA 1QN2A 2KS1A 3L70D 2C1DB 1BGYD 4AAMA 1B7VA 3PXWA 4H0JA 2PCBB 1K3GA 1IZL0 1NTKD 3H1HD 4WQ8A 3PHLA 2AXTV 2Y0DA 3CP5A 1AOQA 2RMZA 3DP5A 3OCDB 4Y5RA 2Q3EA 1OCDA 2N3BA 1C2NA 1EZVD 1C6SA 1SQQD 1L9BC 5KLVD 1HZVA 1CHHA 4AALA 2JQRA 4GEDB 2Y0EA 1CSWA 3DMIA 3RN1A 3VMAA 1AYGA 4XYDB 1SQVD 2V08A 1N50A 1C75A 3L72D 2FRCA 1DW0A 3CX5W 155CA 1I55A 1CCHA 1H33A 1YEAA 5CIFB 4WQEA 1N90A 1RAQA 2O3JA 1NTZD 4P4QB 4FB1A 1CIFA 3L71D 5E79V 1NU1D 1L9JC 2C9XB 1BCCD 3PXSA 1H31B 2K9JB 4XXLA 3OA8A 4FA1A 1CYJA 4EIFA 2C8SA 1CCRA 2MHMA 3O0RC 1HCMA 1NIRA 1IQCA 3WUIA 2ZXYA 2CA4B 3CU4A 4J20A 1CO6A 2BH4X 2OZ1A 5H2FV 1CSVA 3X39A 3O20A 3HQ6A 3ZBMA 2QG4A 1I8OA 2XTSB 2CXBA 1HJ5A 5B5EV 1YIQA 4Q5PA 3ZOWA 1A56A 1J3SA 2RN0A 4DY9A 2FYUD 2YQBA 5B66V 5AURA 3ORVA 4PJ0V 1QL4A 1SQXD 1CNOA 1YCCA 1RZ6A 3JBTB 4EDFA 1BE3D 1YICA 1CXCA 1E2RA 1U74B 1DW3A 4AAOA 2B10B 5CIHB 4AX3A 2AI5A 2DGEA 1IRVA 3M97X 1DVVA 5GTHV 1AKKA 2BPBB 1FI9A 1CSXA 1CIGA 4U3FD 4KMGA 2YK3A 2JWAA 5DFSA 3FWLA 1HH7A 2FYNB 5IY51 1DIQC 4GYDA 2D0SA 2GC7D 1CRJA 1WEJF 3A0BV 3CWBD 4FA5A 3L4MA 2B0ZB 2GB8B 3H1LD 4D6TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYM A;  3KHU A;  5CYT R;  1H32 B;  1E29 A;  4NFG B;  1I8P A;  2BCC D;  2I8F A;  2BGV X;  4WQ9 A;  3SVW A;  3CXH D;  2IBZ D;  1SQB D;  4L3G A;  3RMZ A;  1W2L A;  2ZBO A;  4O1W A;  3WC8 A;  4WQD A;  5CIE B;  3BCC D;  4L3H A;  1S6V B;  1QYZ A;  2N9I A;  3CYT I;  1FI7 A;  4WQC A;  3L75 D;  1L0N D;  2L4D A;  4EIC A;  1C7M A;  1VYD A;  1P84 D;  4FA9 A;  1CRG A;  3A0H V;  1NNO A;  1H9Y A;  1S5L V;  5CIB B;  4FAN A;  1JDL A;  3MK7 B;  1CTZ A;  3TF5 A;  1YNR A;  3ZIY A;  3NWV A;  3GW6 A;  3VRD A;  1DT1 A;  1RAP A;  2ZOO A;  1A8C A;  1GIW A;  2QJK B;  5DF5 A;  1GKS A;  2YIU B;  3ZCF A;  1I5T A;  3HQ7 A;  4IL6 V;  1CSU A;  1CIE A;  1K3H A;  3H1I D;  5DJQ B;  2CE0 A;  2PAC A;  5CIC B;  1NML A;  1H9X A;  1DW2 A;  5KAF V;  4UB8 V;  5CIG B;  3L4O A;  2LIT A;  3VNW A;  5C9M A;  3GG2 A;  2CE1 A;  1H33 B;  1DW1 A;  1HJ3 A;  3CXH W;  3WU2 V;  2KNC B;  5KKZ B;  4N0K A;  4QAO A;  3ZOY A;  2L91 A;  3A9F A;  3PH2 B;  1W5C T;  4LJI A;  4H0K A;  2B12 B;  1U75 B;  2MTA C;  3OA8 B;  3MK7 C;  1NTM D;  1M70 A;  2BLF B;  3O1Y A;  1CC5 A;  1QKS A;  1YEB A;  4WQA A;  2BCN B;  4EID A;  1I6E A;  1YFC A;  1H1O A;  4AAN A;  1PP9 D;  1FOC A;  1KYO W;  2HV4 A;  1EB7 A;  2OZ1 B;  1CIH A;  3L74 D;  3ZOX A;  1WVE C;  1HZU A;  1RZ5 A;  2C1D A;  1C52 A;  1LC1 A;  5KLI B;  1HJ4 A;  2FWL A;  3ZOO A;  2Y0C A;  3PLN A;  3PTZ A;  5DJQ C;  2C2C A;  1CYC A;  5KAI V;  1PPJ D;  3OCD A;  2YCC A;  1KX2 A;  1C2R A;  1LS9 A;  1KB0 A;  3TGU D;  1YTC A;  3H1J D;  3SLE A;  1OAE A;  3NBT A;  4WQB A;  3NBS A;  2D0W A;  4FAV A;  1GQ1 A;  4EIE A;  4JCG A;  4PW9 B;  1AOF A;  1A2S A;  5TIS V;  1CRC A;  1FCD C;  1F1C A;  4YE1 A;  2LIR A;  1CTJ A;  1I54 A;  2V07 A;  1KX7 A;  1C6O A;  1KIB A;  1KYO D;  4V2K A;  3L73 D;  3WFC C;  3O5C A;  1GJQ A;  1IRW A;  4O1Q A;  1MG2 D;  1LFM A;  1H31 A;  1ZRT D;  1QL3 A;  3C2C A;  5CID B;  1LC2 A;  2N9J A;  1DVH A;  1COR A;  1ZZH A;  3RLM A;  2GIW A;  2PCC B;  3WFD C;  2C1V A;  1M6Z A;  1CHI A;  4RJT A;  2N18 B;  2B11 B;  1F1F A;  2DVH A;  1CRH A;  3TYI A;  1DII C;  4UB6 V;  2C1U A;  4MU8 A;  1N9C A;  2GC4 D;  4PD4 D;  3RN0 A;  1L0L D;  2CA3 B;  5EXQ A;  2ZON G;  1ETP A;  3DR0 A;  3WFB C;  4FA4 A;  2JTI B;  3PRJ A;  1SQP D;  1CYI A;  2BH5 X;  3KZI V;  1MZ4 A;  4WQ7 A;  1C6R A;  3SWS A;  2AIU A;  1CXA A;  1MG3 D;  5TJH A;  5GTI V;  3HQ8 A;  4K3I A;  1KB9 D;  4L1Q A;  5C0Z A;  1COT A;  4PWA A;  3SJL A;  3TDK A;  1KV9 A;  1E8E A;  3HQ9 A;  1BL9 A;  3ITK A;  1IO3 A;  1CTY A;  3H1K D;  1I6D A;  1CHJ A;  1HRO A;  1H32 A;  1GU2 A;  1CED A;  2B4Z A;  2N18 C;  3SXT A;  2QJY B;  1GDV A;  1HRC A;  3CX5 D;  4A7P A;  1NMI A;  1R0Q A;  451C A;  2N9Y B;  3PXT A;  2A06 D;  1FJ0 A;  3WFE C;  1FI3 A;  5B6Q A;  4RSZ A;  2ORL A;  1CRI A;  2EXV A;  2QJP B;  2VHD A;  1LMS A;  351C A;  2N3Y A;  1N15 A;  2ZZS 1;  1CRY A;  1M60 A;  1FHB A;  1QN2 A;  2KS1 A;  3L70 D;  2C1D B;  1BGY D;  4AAM A;  1B7V A;  3PXW A;  4H0J A;  2PCB B;  1K3G A;  1IZL 0;  1NTK D;  3H1H D;  4WQ8 A;  3PHL A;  2AXT V;  2Y0D A;  3CP5 A;  1AOQ A;  2RMZ A;  3DP5 A;  3OCD B;  4Y5R A;  2Q3E A;  1OCD A;  2N3B A;  1C2N A;  1EZV D;  1C6S A;  1SQQ D;  1L9B C;  5KLV D;  1HZV A;  1CHH A;  4AAL A;  2JQR A;  4GED B;  2Y0E A;  1CSW A;  3DMI A;  3RN1 A;  3VMA A;  1AYG A;  4XYD B;  1SQV D;  2V08 A;  1N50 A;  1C75 A;  3L72 D;  2FRC A;  1DW0 A;  3CX5 W;  155C A;  1I55 A;  1CCH A;  1H33 A;  1YEA A;  5CIF B;  4WQE A;  1N90 A;  1RAQ A;  2O3J A;  1NTZ D;  4P4Q B;  4FB1 A;  1CIF A;  3L71 D;  5E79 V;  1NU1 D;  1L9J C;  2C9X B;  1BCC D;  3PXS A;  1H31 B;  2K9J B;  4XXL A;  3OA8 A;  4FA1 A;  1CYJ A;  4EIF A;  2C8S A;  1CCR A;  2MHM A;  3O0R C;  1HCM A;  1NIR A;  1IQC A;  3WUI A;  2ZXY A;  2CA4 B;  3CU4 A;  4J20 A;  1CO6 A;  2BH4 X;  2OZ1 A;  5H2F V;  1CSV A;  3X39 A;  3O20 A;  3HQ6 A;  3ZBM A;  2QG4 A;  1I8O A;  2XTS B;  2CXB A;  1HJ5 A;  5B5E V;  1YIQ A;  4Q5P A;  3ZOW A;  1A56 A;  1J3S A;  2RN0 A;  4DY9 A;  2FYU D;  2YQB A;  5B66 V;  5AUR A;  3ORV A;  4PJ0 V;  1QL4 A;  1SQX D;  1CNO A;  1YCC A;  1RZ6 A;  3JBT B;  4EDF A;  1BE3 D;  1YIC A;  1CXC A;  1E2R A;  1U74 B;  1DW3 A;  4AAO A;  2B10 B;  5CIH B;  4AX3 A;  2AI5 A;  2DGE A;  1IRV A;  3M97 X;  1DVV A;  5GTH V;  1AKK A;  2BPB B;  1FI9 A;  1CSX A;  1CIG A;  4U3F D;  4KMG A;  2YK3 A;  2JWA A;  5DFS A;  3FWL A;  1HH7 A;  2FYN B;  5IY5 1;  1DIQ C;  4GYD A;  2D0S A;  2GC7 D;  1CRJ A;  1WEJ F;  3A0B V;  3CWB D;  4FA5 A;  3L4M A;  2B0Z B;  2GB8 B;  3H1L D;  4D6T D; 
#chains in the Genus database with same CATH topology
 3VYM A;  3KHU A;  3FXE A;  2BCC D;  5CCH D;  3L72 E;  1FOS E;  2WIT A;  1SQB D;  2PAJ A;  3RMZ A;  1SQV J;  4IFD K;  1W2L A;  3WC8 A;  1FBM A;  2D2C D;  2CK3 H;  3GF7 A;  3BCC D;  2N1T D;  3RBZ A;  1FI7 A;  1VL2 A;  2JO1 A;  1L0N D;  1P84 D;  2ZT9 D;  4I6M C;  1NNO A;  3VP8 A;  2Q3I A;  3V2P A;  5CIB B;  2K1A A;  1JDL A;  1OW8 A;  2C0X A;  1NO4 A;  3FX0 A;  3TSI A;  4XFJ A;  3P7K A;  3NWV A;  3CCR P;  1LTJ A;  2Z5I A;  3A2A A;  1GL2 A;  1NTK G;  5B66 H;  3GW6 A;  1RAP A;  2ZOO A;  4K3A A;  1KB9 E;  1N7S B;  1GIW A;  1GKS A;  2YIU B;  1NVO A;  3BAT A;  2ZJS E;  4RKU J;  1N73 B;  2W8Z A;  2W6J H;  1FDO A;  5CBN A;  2WPQ A;  4DJG A;  1NKN A;  1LJ2 A;  2KOG A;  5CIC B;  1URQ A;  1NML A;  1H9X A;  2C9N Y;  4ASV A;  3H1K J;  5CIG B;  3A0B H;  5C9M A;  3VNW A;  1H0T B;  5AVY B;  3AE4 C;  4U7J A;  3RL0 g;  4W7Y A;  1T8Z A;  3A9F A;  1N8R Q;  1MZ9 A;  4H0K A;  3B4S A;  2MTA C;  2W6B A;  1GDT A;  1A02 F;  1YEB A;  4NPD A;  1L0L K;  4EID A;  4GKG A;  1H1O A;  4AAN A;  1FZG A;  2WMM A;  1N7S C;  1SLQ A;  3L74 D;  5APV A;  4GOD A;  3B71 A;  2PFX A;  3V2Q A;  3F5H A;  1S72 P;  3V2R A;  3ZOO A;  3PLN A;  3EWK A;  2V7Q J;  1NTM K;  2GUV A;  2FYU G;  3PH0 A;  4M3L A;  2YCC A;  1LP1 B;  1QGK B;  1KFN A;  5KLV J;  3CCM P;  1YQ4 C;  4C7N A;  1LT1 A;  2FBW C;  1S3J A;  4IFF A;  5AW0 B;  3RK3 B;  1BDC A;  4UB8 H;  2H88 C;  4PW9 B;  5TIS V;  2QRX A;  5H2F H;  1IC2 A;  2ZVN B;  3EFF K;  1F1C A;  1R5L A;  3E7K A;  1I54 A;  5KAF E;  1M90 Q;  1CI6 B;  2E74 C;  2M3B A;  3H1I E;  5APX A;  1VQ8 P;  1RHZ B;  4V2K A;  3O5C A;  3MGN A;  2BCC G;  4OH8 B;  3WU2 E;  2E43 A;  2K9J A;  1QL3 A;  5CID B;  1IZN B;  1COR A;  1SQB G;  1ZZH A;  3L4F A;  1KIL A;  2ZXE B;  2YO2 A;  2PCC B;  3P32 A;  1M6Z A;  1EZV G;  1DEE G;  2N18 B;  3BCC G;  1YBK A;  2B87 B;  3ZDM A;  1L0N G;  5GTH E;  4I7Z B;  3RK2 B;  3RN0 A;  2WPS A;  3AE6 C;  2ZON G;  3U1C A;  1R5S A;  2NPS A;  1ZLL A;  1SQQ K;  1SQX J;  3ABV C;  3PRJ A;  2KSJ A;  1CYI A;  2BH5 X;  2OYO A;  2KB7 P;  1NTZ G;  1MZ4 A;  3M0D A;  1C6R A;  2AIU A;  1IK7 A;  5KAI E;  5AVW B;  3Q5P A;  4K3I A;  2OYH B;  2JWD A;  5CCG C;  1YIT P;  4L1Q A;  3HE4 B;  5M1B A;  1FS0 E;  4WBA A;  3SJL A;  3CWB J;  4PV1 D;  1J1E C;  5AW3 B;  3H1L J;  1E8E A;  4WB4 A;  1SFC B;  3H1J E;  2WVR A;  2QJK C;  1IO3 A;  1AJY A;  3H1K D;  3K5B A;  3CXH E;  1Q82 Q;  1J1D C;  1CHJ A;  1H32 A;  3TGU J;  2Q1K A;  4ASW A;  2N18 C;  4H13 B;  2QJY B;  4A7P A;  2PP6 A;  1Y8A A;  2N9Y B;  4I7Z C;  3RK2 C;  5AW7 B;  1JMB A;  3P8C D;  1CRI A;  2EXV A;  3L75 J;  4W80 A;  3CLQ A;  3I5C A;  1KYO E;  2OTK E;  2PGD A;  1VF5 D;  5KKZ C;  2N3Y A;  3U59 A;  1FHB A;  3S9O A;  2PCB B;  2OYH C;  1H8A A;  4WQ8 A;  5KJ7 D;  4UB6 E;  1JY2 P;  1M8O B;  2M5A A;  1KFM A;  2AXT V;  3DP5 A;  3FGA D;  2WPR A;  4DZO A;  2OGU A;  3H32 B;  5BVZ A;  4PD4 E;  1C6S A;  5GTI H;  1L9B C;  5KLI C;  3KZI E;  5KLV D;  1HZV A;  1EXI A;  1JY3 O;  1ZOY C;  2JQR A;  4GED B;  3DMI A;  4H13 C;  4IL6 X;  5BU5 A;  3M9B A;  2Q5U A;  2QJY C;  2WT7 A;  1J2J B;  3CX5 W;  1I55 A;  2DW3 A;  1LT9 A;  1T2K D;  5CIF B;  3G6E P;  3TNU B;  1HUC A;  1PGP A;  3NFQ A;  2P67 A;  3MUD C;  1RF1 A;  4WY4 B;  1NTM J;  1PP9 E;  3AEG C;  1FAV A;  2O01 N;  3RL0 B;  2XND H;  4XXL A;  3CX5 H;  4EIF A;  4ZKU A;  1CCR A;  2MHM A;  1HCM A;  1NIR A;  2XV5 A;  2CA4 B;  3CU4 A;  1X0T A;  3X39 A;  2YKP A;  2B88 A;  3HQ6 A;  4D6T D;  1SVF A;  1Z56 A;  2BEZ F;  3PP5 A;  2MJZ A;  2R5D A;  2CXB A;  1HJ5 A;  4WWI A;  4BXL A;  3CI9 A;  4RES B;  1NU1 K;  1Q7Y Q;  1RF0 A;  2RN0 A;  3AEB C;  5AUR A;  4Z1M H;  1QL4 A;  1SQX D;  1E79 H;  2WQY C;  2OTJ P;  1Y47 A;  2E75 B;  1K04 A;  4AX3 A;  1JY3 N;  2AI5 A;  3B5N B;  3RGU A;  1NTK E;  2IFM A;  1IRV A;  1AKK A;  5CJ4 A;  3T97 A;  1IFD A;  3VP9 A;  3CC2 P;  1CIG A;  4WY4 C;  2YK3 A;  1KV4 A;  3AE1 C;  1LWU A;  1KQL A;  3FWL A;  3OW2 O;  2FYN B;  5IY5 1;  1HVV A;  1L4A D;  3CWB D;  1ZRT E;  5APU A;  3GHG A;  2AEF A;  3H1L D;  1N2D C;  3H1K G;  5APT A;  3G71 P;  2WWW A;  3HE5 A;  4NFG B;  1GMJ A;  1SQQ J;  2OAR A;  2M8R A;  2WSC J;  2BGV X;  3M91 A;  4WQ9 A;  3HD7 C;  1PV3 A;  1MV8 A;  1AVY A;  2IBZ D;  4DCK A;  2Q6Q A;  2R3C A;  3PJS K;  4O1W A;  5E79 E;  4WQD A;  3L72 J;  3D71 A;  2Z4E A;  3NTN A;  1QYZ A;  3L71 E;  3D0W A;  1OMI A;  3CYT I;  3L75 D;  1K05 A;  1AV1 A;  3LID A;  4FA9 A;  1CRG A;  1JO5 A;  1H9Y A;  1M1J B;  2D2C B;  2E75 C;  3B5N C;  3NMD A;  5B5E H;  5AVX B;  2E76 D;  2N1T B;  3ZIY A;  3IR9 A;  2GUS A;  2ZT9 B;  3MP7 B;  4N78 D;  2FYN C;  2WZ7 A;  2SPZ A;  5DF5 A;  5DJT B;  1I5T A;  4IL6 V;  4PJ0 E;  1JB0 J;  1PL5 A;  2FYU E;  2FYZ A;  5DJQ B;  3EQ2 A;  3HD7 A;  3HTK A;  1NAY A;  1DW2 A;  4H44 D;  5KAF V;  1BE3 E;  2IZ1 A;  3E1R A;  4HB1 A;  1S2E A;  3OAK A;  2CE1 A;  1H33 B;  2I1K A;  3CXH W;  3WU2 V;  5CCH C;  1NH4 A;  2KNC B;  1VQ6 P;  4KT0 J;  4U3F E;  1QX8 A;  4QAO A;  3CC4 P;  2L91 A;  3PH2 B;  2N9B A;  1RE4 C;  1G2C A;  1PGO A;  2QIW A;  2B12 B;  1IFP A;  1NTM D;  1M70 A;  2BLF B;  3O1Y A;  2N1T C;  1CC5 A;  4D6T E;  1VQ5 P;  4WQA A;  1WT6 A;  2KIK A;  2XU6 A;  2BCC E;  2V7Q H;  2NZ2 A;  1FOC A;  5BU8 B;  2ZT9 C;  2E5T A;  1KYO W;  1BGY J;  2OZ1 B;  1Q90 D;  3ZOX A;  1WVE C;  2RH0 A;  1SQB E;  1RZ5 A;  3H1H J;  2C1D A;  5AVV B;  4LC1 A;  5CHX A;  2AXC A;  2KSE A;  3SFD C;  3OJA B;  1EZV E;  5AW2 B;  3PTZ A;  1H88 A;  3BCC E;  3A0H E;  5DJQ C;  2FY8 A;  2ZAE B;  1S5L E;  5KAI V;  1HWT C;  2C0W A;  1VPC A;  1L0N E;  2QM7 A;  3NXS A;  5DJU B;  2KXP B;  1YI2 P;  1P84 E;  2WSE J;  3SSU A;  1SQX G;  4L74 A;  2IYP A;  5CJ0 A;  2FXO A;  3QWO C;  1KB9 I;  4BRY B;  2A45 I;  2OYI A;  1NTZ E;  4WQB A;  1L2P A;  1GQ1 A;  1AOF A;  2YMK A;  1A2S A;  1CRC A;  2ZYG A;  4YE1 A;  2JP3 A;  1DX7 A;  3HUS A;  1CTJ A;  2HYN A;  1Q86 Q;  2Y9Y A;  1NU1 J;  3CX5 I;  3H1L G;  3L70 G;  1BCC J;  1KIB A;  3F89 A;  1FZF A;  4O1Q A;  1MG2 D;  1ZR2 A;  1OXZ A;  1H31 A;  3H1I J;  3W68 A;  1FZC A;  2IX7 C;  2ZVO B;  1FDM A;  1DVH A;  1EDK A;  2B9B A;  2IBZ G;  3RLM A;  4EYY Q;  4OGQ D;  3Q3D A;  1OX3 A;  3WFD C;  1NTK K;  1NJI Q;  2C1V A;  4Y99 B;  4RJT A;  2B11 B;  4JQ0 D;  1F1F A;  1GL2 D;  4UB6 V;  4KJM A;  1N9C A;  2GC4 D;  1M56 D;  2JKV A;  5EXQ A;  2AEJ A;  2O01 J;  1MUU A;  3VN0 A;  3WFB C;  2JTI B;  2KK7 A;  3O6Q B;  1SQP D;  3L74 E;  1QEX A;  3KZI V;  2FXP A;  2W6A A;  1A02 J;  1URQ D;  3SWS A;  2GM4 A;  4NPE A;  1EDJ A;  1BSH A;  3L71 G;  4CPG A;  5AW5 B;  1FC2 C;  5TJH A;  2KYV A;  1KB9 D;  1COT A;  5TIS H;  3RBX A;  2CPB A;  3TDK A;  2HOD B;  2B89 A;  2M0B A;  1BL9 A;  1CTY A;  2I8D A;  2YIU C;  2GA1 A;  5AW6 B;  3V6I A;  1GU2 A;  1N73 C;  5CBO A;  4PV1 B;  2E5Y A;  1QVF O;  3CX5 D;  2KLU A;  1R0Q A;  2YXQ B;  4GOE A;  2QA4 P;  451C A;  3PXT A;  1S9K E;  1FJ0 A;  2FFD B;  2P10 A;  1AFO A;  1BE3 G;  1RQV A;  1X9V A;  4YPC A;  1CRY A;  1M57 D;  2FYU K;  1W5C E;  1N7L A;  1QN2 A;  1BSN A;  1LTG C;  2HPC B;  1BGY D;  4AAM A;  4IL6 E;  4U3F G;  3PXW A;  1EDL A;  2Z5H A;  3H1H D;  1S5L X;  1VF5 B;  3PHL A;  2XDJ A;  3A5T A;  1AOQ A;  1N7S A;  4IOI H;  3OCD B;  1HTL C;  4D6T G;  1WMK A;  5C39 A;  2C9L Y;  2N3B A;  1MKM A;  2HLO A;  2KZI A;  5EFW B;  3JCU E;  1OWA A;  2Y0E A;  1CSW A;  3RN1 A;  3A7O A;  2JEE A;  1SQV D;  1UII A;  2FRC A;  1DW0 A;  1H0T A;  1JY2 O;  155C A;  2FFD C;  3L36 A;  4WQE A;  1SQB K;  1HGV A;  1RAQ A;  2G8Y A;  3VTP C;  2Q9I A;  2W83 C;  1KIL D;  5E79 V;  3CXH I;  1NU1 D;  3RK3 C;  1BCC D;  1L0N K;  4FA1 A;  4GOF A;  2LKM A;  3H1K E;  1PP9 J;  3O0R C;  1JNM A;  1RE3 C;  2J59 M;  1LNQ A;  2WT7 B;  2KP8 A;  2NPS D;  2BH4 X;  3V4Q A;  5H2F V;  2VRS A;  1LT9 B;  1NTZ K;  4AUW A;  4GDO A;  3H25 A;  3KXD A;  2QG4 A;  1ZR4 A;  1KYO I;  1QLE D;  3RK3 E;  3MZW B;  3G3Z A;  3ZOW A;  4NPF X;  3C8V A;  2AXT H;  2E74 D;  1SQP G;  4PJ0 V;  1LP1 A;  2Q7C A;  1CNO A;  1YIC A;  2W27 A;  2R5B A;  1CSB A;  1DW3 A;  4ZNC A;  5CIH B;  1VQ7 P;  3CD6 P;  2DGE A;  3CC7 P;  3II6 A;  4PD4 I;  4KHX A;  1FI9 A;  1OIP A;  1CSX A;  1NTK J;  4LLH A;  2JWA A;  2WSC H;  1T2K C;  1JY2 N;  5DFS A;  4I1L A;  1HH7 A;  1DEB A;  1DIQ C;  1USD A;  2GC7 D;  1CRJ A;  1WEJ F;  4FA5 A;  3L4M A;  5KLV E;  3L74 G;  5APS A;  4YXD C;  3LW5 J;  3L73 J;  1HGZ A;  3JSV C;  5CYT R;  1CI6 A;  5CCG A;  4H0L D;  1I8P A;  1YYC A;  2I8F A;  4I2L C;  3P8M C;  1FZA A;  1L4A B;  2QVA A;  3A3Y B;  3SVW A;  1RH5 B;  3CXH D;  4L3G A;  3V5B A;  2ZBO A;  1U7M A;  1SFC C;  5CIE B;  1K8A Q;  4L3H A;  2N9I A;  1YJN P;  4WQC A;  2L4D A;  1K9M Q;  1L0L J;  4EIC A;  2B87 A;  1VQN P;  3GHG B;  1GZL A;  3A0H V;  5AW4 B;  2KS1 B;  1S5L V;  1KB9 H;  4FAN A;  3MK7 B;  1BGY G;  1CTZ A;  2A45 H;  5APQ A;  1YQ3 C;  4XA4 A;  1OW7 A;  3AEC C;  2KUB A;  2XKM A;  3BRV B;  1A8C A;  5AVS B;  2E76 B;  3VMY A;  3Q2Y A;  5B66 E;  3ZCF A;  1EXJ A;  2OYH A;  1NGM B;  3CCJ P;  3HE4 A;  2PAC A;  1L4A C;  1SQX E;  3KQG A;  2RKL A;  1SQV G;  1ZP0 C;  1K73 Q;  3GG2 A;  1SFC A;  3IAO A;  1JOC A;  1DW1 A;  2YO3 A;  3CPW O;  4H44 B;  1Q81 Q;  3A0B E;  2QE7 H;  5L8R J;  1JCD A;  1CZQ A;  4LJI A;  1D7M A;  1DD4 A;  3CWB E;  3OA8 B;  3MK7 C;  3I56 P;  4ZKP A;  1M1K Q;  3H1L E;  1QKS A;  3L70 E;  2BCN B;  4HJG H;  5AVZ B;  3QH9 A;  2HFE D;  2BEQ D;  1PP9 D;  2HV4 A;  1EB7 A;  3MUD A;  3IF4 A;  4GT1 A;  2WSE H;  1HZU A;  2IBZ E;  2BCC J;  1IFI A;  1C52 A;  1LC1 A;  3RL0 C;  1FJK A;  1HJ4 A;  3OA7 A;  2J5U A;  2Y0C A;  1SQB J;  4R4M A;  2C2C A;  1Y9B A;  1PPJ D;  3L75 E;  1KD1 Q;  3BCC J;  3H32 A;  1VQK P;  1C2R A;  4JYB A;  1LS9 A;  1KB0 A;  2P58 A;  3TK1 A;  3TGU D;  1KN7 A;  1N86 A;  1JY3 P;  5KAF H;  4N78 E;  4FAV A;  2IPP A;  1XTC C;  1NTZ J;  1JTH B;  3D70 A;  3WU2 H;  3TNU A;  4UB8 E;  3JCU H;  2V07 A;  1LTB C;  2PRR A;  1KX7 A;  5H2F E;  3M06 A;  1C6O A;  1CW5 A;  1S4X A;  3L73 D;  3WFC C;  4WY4 A;  1GJQ A;  1KTM A;  2KI7 B;  1ZRT D;  3C2C A;  4EIJ A;  2N9J A;  3O8Z A;  5AVU B;  4HH2 A;  2O01 H;  5GTH H;  4JBZ A;  1CHI A;  2H43 A;  2DVH A;  1CRH A;  5KLV G;  3TYI A;  3HUS B;  4JYC A;  2WTY A;  2OQQ A;  4OGQ B;  1L0L D;  1ETP A;  5KAI H;  4FA4 A;  1LTJ B;  1GL2 B;  2G3A A;  2KLV A;  4AYC A;  1FDI A;  1EZV I;  1X22 A;  3HD7 D;  1CXA A;  3B5N A;  3AEA C;  4YTP C;  2K9Y A;  1M1J C;  1P84 I;  2D2C C;  3LIE A;  3AEE C;  3CXH H;  4PWA A;  1SS1 A;  1URQ B;  4GIF A;  4WVZ A;  3GF3 A;  2H8P D;  5AVR B;  2QSI A;  3HQ9 A;  4TLF A;  1I6D A;  3SFE C;  1VQ4 P;  1HRO A;  1HBW A;  4N3Y B;  1CED A;  2B4Z A;  1R8E A;  2FKW B;  1HRC A;  3CCS P;  1LTA C;  1NMI A;  1KYO H;  2A06 D;  3D6Y A;  5APW A;  3L37 A;  1FI3 A;  4RSZ A;  1T3U A;  3M9Q A;  2O1J A;  5CCH A;  2O1K A;  1N15 A;  2ZZS 1;  4UB6 H;  2P1J A;  1RE4 A;  1KOR A;  1OFC X;  1M1J A;  1SQX K;  1IJD B;  4H0J A;  1K3G A;  2N1T A;  4PD4 H;  1IZL 0;  2AEM A;  3SWK A;  2JDI H;  4B86 A;  3CWB G;  2Y0D A;  1URQ C;  3CP5 A;  3KZI H;  2RMZ A;  1PPJ G;  4Y5R A;  2Q3E A;  1OCD A;  1C2N A;  4N6J A;  5AVQ B;  3USS A;  1EZV D;  1RQU A;  2FXM A;  1SQQ D;  4JPZ B;  3TGU G;  4C7N B;  4R4L A;  1CHH A;  1OZH A;  4AAL A;  1SQP E;  1GK4 A;  2M3E A;  3VMA A;  1NHL A;  4XYD B;  5GTI E;  2V08 A;  2NRG A;  1OVU A;  1C75 A;  3S4R A;  3L72 D;  1CCH A;  1H33 A;  3L75 G;  2R44 A;  2KNC A;  4BWN A;  1NTZ D;  4LGD E;  4P4Q B;  1MFZ A;  2J58 A;  3VMX A;  1CIF A;  1DH3 A;  3L73 G;  2C9X B;  3PXS A;  2K9J B;  1CYJ A;  2ZYD A;  1IQC A;  3WUI A;  1KIL B;  1IFJ A;  4J20 A;  3CX5 E;  2WSF H;  2OZ1 A;  4ZMD A;  1CSV A;  3O20 A;  3S1K A;  1I8O A;  1KMI Z;  1YHQ P;  2IZ0 A;  2V4H A;  1YIQ A;  4Q5P A;  1L0L G;  1J3S A;  3AEF C;  1U57 A;  2NPS B;  1VQL P;  4DY9 A;  5B66 V;  2I1J A;  3AE9 C;  3CCU P;  2YXR B;  4Y99 C;  3H1J J;  1RZ6 A;  1BGY E;  1E2R A;  1U74 B;  1ZXG A;  3H1H E;  2E74 B;  3LW5 H;  3M97 X;  1DVV A;  3MIW A;  4BRY A;  4IFM A;  1JEK A;  3CMA P;  1NTM G;  3CL3 D;  4KMG A;  2WPV B;  3V4W A;  2D0S A;  1PGQ A;  3A0B V;  3M0A A;  1KIL C;  3WUV A;  1H89 A;  1H32 B;  1E29 A;  3AE8 C;  5E79 H;  4EOT A;  1SQV E;  1G1I A;  1VQM P;  3Q1M A;  3SWF A;  3WMM 0;  4RO0 A;  2A06 G;  4H0L B;  3I55 P;  2NPS C;  4XE5 B;  3UIA A;  1KIL E;  1S6V B;  1N73 A;  1NU1 E;  4PV1 C;  1BCC E;  1C7M A;  1S9K D;  1VYD A;  3G9R A;  3M0D C;  1VQ9 P;  1N7S D;  4QMA A;  1QVG O;  2LXB A;  1SP4 A;  3TF5 A;  1YNR A;  3KYQ A;  1GU4 A;  1M7L A;  2E42 A;  3O6Q A;  2M5A B;  3VRD A;  1J1E B;  2IFN A;  1DT1 A;  1PZQ A;  4PJ0 H;  3B8E B;  5B5E E;  1NWQ A;  2QJK B;  4HKZ H;  1DD3 A;  1W2E A;  1J1D B;  3R4Y A;  5CMZ A;  1KQF B;  2YKO A;  1FZB A;  2P7J A;  4EI2 A;  3HQ7 A;  1CSU A;  1VQO P;  2OTL P;  1CIE A;  1SQQ G;  1IFM A;  1K3H A;  1GW4 A;  4DOJ A;  1HF9 A;  3H1I D;  4L75 A;  2CE0 A;  1VF5 C;  2HOD A;  2XNX A;  4UB8 V;  2HR3 A;  1AQ5 A;  3L4O A;  2LIT A;  3WUT A;  3L72 G;  2R3S A;  4H0L C;  1HJ3 A;  5KJ7 C;  4TT3 H;  1X8Y A;  1GTW A;  5KKZ B;  3P8C E;  1FZE A;  1DIP A;  4N0K A;  1EQ7 A;  1PIX A;  2JR8 A;  1YJ9 P;  3ZOY A;  1RF1 B;  4W7Z A;  1W5C T;  3IN6 A;  1U75 B;  2WSF J;  1NAF A;  2FFD A;  3H6P A;  1YJW P;  1I6E A;  1YFC A;  1AVO A;  3VOP A;  1UIX A;  3L70 J;  1SQP K;  1CIH A;  3A0H H;  1WRG A;  3HRN A;  3CCL P;  4MN4 C;  1S5L H;  2HPC A;  2JJL A;  5KLI B;  2A45 G;  1P84 H;  2FWL A;  1GD2 E;  1RE3 A;  1ZME C;  1CYC A;  1NOH A;  3OCD A;  5AW8 B;  2H89 C;  4O9B A;  3RK3 D;  1KX2 A;  3IFM A;  5KJ7 A;  1LT9 C;  1YTC A;  3H1J D;  3SLE A;  1OAE A;  3NBT A;  3T97 B;  1VQP P;  1RF1 C;  4DT0 A;  3Q5S A;  1GW3 A;  1OVV A;  3NBS A;  2D0W A;  5CCG D;  3FWN A;  4EIE A;  4JCG A;  1LWU B;  3E1I A;  1FCD C;  1RY3 A;  4L73 A;  2LIR A;  3BAS A;  3Q5R A;  1FE6 A;  3L71 J;  3MD0 A;  2ITA A;  3MHV A;  1HJB A;  3HE5 B;  1IK9 A;  1KYO D;  1HH0 A;  1IFN A;  4YXW H;  1KZU B;  1IRW A;  3H1H G;  2WSS H;  1LFM A;  3JC2 2;  3BVH A;  1LC2 A;  1TU3 F;  2ZXX A;  2W90 A;  1RF0 C;  3RK2 D;  1QL1 A;  2GIW A;  2Y9Z A;  2YKQ A;  4C7R A;  3FXD A;  1LTS C;  3M9H A;  1DII C;  2C1U A;  4MU8 A;  1ZN5 A;  3AE5 C;  4Y28 J;  4PD4 D;  1OVR A;  3MTU E;  1KC8 Q;  2CA3 B;  3N4X A;  2FYU J;  2CPS A;  3V2N A;  2HG5 D;  2IBZ I;  3DR0 A;  2YMY A;  1BE3 J;  2QM8 A;  5AW1 B;  1LWU C;  4WQ7 A;  2IDB A;  2XZR A;  3C1L A;  2POH A;  4JF7 A;  1SQV K;  2MKV A;  1MG3 D;  1NKZ B;  4HYT B;  1PGJ A;  3GHG C;  2P2U A;  5GTI V;  1NU1 G;  3HQ8 A;  4U3F J;  3AE2 C;  1SFC D;  1BCC G;  3WUU A;  1PPJ E;  1E5W A;  5C0Z A;  3H1I G;  3HD7 B;  3HTK B;  3VMZ A;  4H13 D;  1FU1 A;  2R32 A;  1KV9 A;  4D6T J;  3TGU E;  1LGH B;  3ITK A;  2E76 C;  1AQT A;  3SWY A;  1ZV8 A;  3EFG A;  5TIS E;  3TYY A;  3SXT A;  1YTZ I;  1GDV A;  1G1J A;  1L4A A;  1EDI A;  1G2C B;  1XTG B;  1YIJ P;  1KQS O;  2QEX P;  1T6A A;  3WFE C;  1JCC A;  5B6Q A;  1JMM A;  2H7H A;  2ORL A;  3CME P;  1L0N J;  1KQG B;  4IL6 H;  2QJP B;  2VHD A;  3L73 E;  1LMS A;  351C A;  3KPE A;  3CCE P;  1VDF A;  4H44 C;  1M60 A;  1JUN A;  1JM0 A;  2KS1 A;  3L70 D;  5K5G B;  2C1D B;  1USE A;  3GMA A;  1ZW0 A;  3W67 A;  1B7V A;  3N7N A;  1NTK D;  4OVN F;  1PFI A;  2LXC B;  3C9I A;  1NYH A;  3D6Z A;  4AQR D;  2LR2 A;  1L0L E;  2UWJ E;  1U7J A;  3GLM A;  2K88 A;  3L35 A;  2YNY A;  3CCV P;  5AVT B;  3H1J G;  2OYI B;  1FOS F;  1OW6 A;  5AW9 B;  2KZJ A;  1AA0 A;  1AYG A;  1N50 A;  1SQP J;  4WY4 D;  3VYI A;  3RL0 D;  1YEA A;  3KDP B;  3G4S P;  1N90 A;  2O3J A;  1NTM E;  1MFT A;  2QJP C;  1LTT C;  4FB1 A;  5KTB A;  3L71 D;  4K35 A;  1L9J C;  5KLV K;  1H31 B;  1FZC B;  1EC5 A;  3OA8 A;  2BAS A;  1W2B O;  1QL2 A;  2C8S A;  3L74 J;  1T3J A;  2ZXY A;  3AED C;  1LTI C;  1CO6 A;  1HJ0 A;  5APY A;  2ZFC A;  3U1A A;  3ZBM A;  2A06 E;  2XTS B;  1GU5 A;  3BRT B;  1FJP A;  2L5G B;  3AE3 C;  1BDD A;  5B5E V;  1A56 A;  2E75 D;  2OYI C;  3B5N D;  2FYU D;  1S1C X;  2YQB A;  1Q2N A;  3ORV A;  1YCC A;  3JBT B;  4OWF A;  4EDF A;  1BE3 D;  1CXC A;  2AXT E;  4L76 A;  4AAO A;  2B10 B;  1YTZ T;  2IYO A;  3HUS C;  1X79 B;  5GTH V;  4OGQ C;  2BPB B;  3CCQ P;  4U3F D;  1GK6 A;  1LTJ C;  1GL2 C;  2K37 A;  1FZC C;  2ZYA A;  3R2P A;  4GYD A;  1PP9 G;  1JTH A;  1IO4 A;  1SQQ E;  4C46 A;  2B0Z B;  2GB8 B;  2K3R A;  3AE7 C; 
#chains in the Genus database with same CATH homology
 3VYM A;  3KHU A;  5CYT R;  1H32 B;  1E29 A;  4NFG B;  1I8P A;  2BCC D;  2I8F A;  2BGV X;  4WQ9 A;  3SVW A;  3CXH D;  2IBZ D;  1SQB D;  4L3G A;  3RMZ A;  1W2L A;  2ZBO A;  4O1W A;  3WC8 A;  4WQD A;  5CIE B;  3BCC D;  4L3H A;  1S6V B;  1QYZ A;  2N9I A;  3CYT I;  1FI7 A;  4WQC A;  3L75 D;  1L0N D;  2L4D A;  4EIC A;  1C7M A;  1VYD A;  1P84 D;  4FA9 A;  1CRG A;  3A0H V;  1NNO A;  1H9Y A;  1S5L V;  5CIB B;  4FAN A;  1JDL A;  3MK7 B;  1CTZ A;  3TF5 A;  1YNR A;  3ZIY A;  3NWV A;  3GW6 A;  3VRD A;  1DT1 A;  1RAP A;  2ZOO A;  1A8C A;  1GIW A;  2QJK B;  5DF5 A;  1GKS A;  2YIU B;  3ZCF A;  1I5T A;  3HQ7 A;  4IL6 V;  1CSU A;  1CIE A;  1K3H A;  3H1I D;  5DJQ B;  2CE0 A;  2PAC A;  5CIC B;  1NML A;  1H9X A;  1DW2 A;  5KAF V;  4UB8 V;  5CIG B;  3L4O A;  2LIT A;  3VNW A;  5C9M A;  3GG2 A;  2CE1 A;  1H33 B;  1DW1 A;  1HJ3 A;  3CXH W;  3WU2 V;  2KNC B;  5KKZ B;  4N0K A;  4QAO A;  3ZOY A;  2L91 A;  3A9F A;  3PH2 B;  1W5C T;  4LJI A;  4H0K A;  2B12 B;  1U75 B;  2MTA C;  3OA8 B;  3MK7 C;  1NTM D;  1M70 A;  2BLF B;  3O1Y A;  1CC5 A;  1QKS A;  1YEB A;  4WQA A;  2BCN B;  4EID A;  1I6E A;  1YFC A;  1H1O A;  4AAN A;  1PP9 D;  1FOC A;  1KYO W;  2HV4 A;  1EB7 A;  2OZ1 B;  1CIH A;  3L74 D;  3ZOX A;  1WVE C;  1HZU A;  1RZ5 A;  2C1D A;  1C52 A;  1LC1 A;  5KLI B;  1HJ4 A;  2FWL A;  3ZOO A;  2Y0C A;  3PLN A;  3PTZ A;  5DJQ C;  2C2C A;  1CYC A;  5KAI V;  1PPJ D;  3OCD A;  2YCC A;  1KX2 A;  1C2R A;  1LS9 A;  1KB0 A;  3TGU D;  1YTC A;  3H1J D;  3SLE A;  1OAE A;  3NBT A;  4WQB A;  3NBS A;  2D0W A;  4FAV A;  1GQ1 A;  4EIE A;  4JCG A;  4PW9 B;  1AOF A;  1A2S A;  5TIS V;  1CRC A;  1FCD C;  1F1C A;  4YE1 A;  2LIR A;  1CTJ A;  1I54 A;  2V07 A;  1KX7 A;  1C6O A;  1KIB A;  1KYO D;  4V2K A;  3L73 D;  3WFC C;  3O5C A;  1GJQ A;  1IRW A;  4O1Q A;  1MG2 D;  1LFM A;  1H31 A;  1ZRT D;  1QL3 A;  3C2C A;  5CID B;  1LC2 A;  2N9J A;  1DVH A;  1COR A;  1ZZH A;  3RLM A;  2GIW A;  2PCC B;  3WFD C;  2C1V A;  1M6Z A;  1CHI A;  4RJT A;  2N18 B;  2B11 B;  1F1F A;  2DVH A;  1CRH A;  3TYI A;  1DII C;  4UB6 V;  2C1U A;  4MU8 A;  1N9C A;  2GC4 D;  4PD4 D;  3RN0 A;  1L0L D;  2CA3 B;  5EXQ A;  2ZON G;  1ETP A;  3DR0 A;  3WFB C;  4FA4 A;  2JTI B;  3PRJ A;  1SQP D;  1CYI A;  2BH5 X;  3KZI V;  1MZ4 A;  4WQ7 A;  1C6R A;  3SWS A;  2AIU A;  1CXA A;  1MG3 D;  5TJH A;  5GTI V;  3HQ8 A;  4K3I A;  1KB9 D;  4L1Q A;  5C0Z A;  1COT A;  4PWA A;  3SJL A;  3TDK A;  1KV9 A;  1E8E A;  3HQ9 A;  1BL9 A;  3ITK A;  1IO3 A;  1CTY A;  3H1K D;  1I6D A;  1CHJ A;  1HRO A;  1H32 A;  1GU2 A;  1CED A;  2B4Z A;  2N18 C;  3SXT A;  2QJY B;  1GDV A;  1HRC A;  3CX5 D;  4A7P A;  1NMI A;  1R0Q A;  451C A;  2N9Y B;  3PXT A;  2A06 D;  1FJ0 A;  3WFE C;  1FI3 A;  5B6Q A;  4RSZ A;  2ORL A;  1CRI A;  2EXV A;  2QJP B;  2VHD A;  1LMS A;  351C A;  2N3Y A;  1N15 A;  2ZZS 1;  1CRY A;  1M60 A;  1FHB A;  1QN2 A;  2KS1 A;  3L70 D;  2C1D B;  1BGY D;  4AAM A;  1B7V A;  3PXW A;  4H0J A;  2PCB B;  1K3G A;  1IZL 0;  1NTK D;  3H1H D;  4WQ8 A;  3PHL A;  2AXT V;  2Y0D A;  3CP5 A;  1AOQ A;  2RMZ A;  3DP5 A;  3OCD B;  4Y5R A;  2Q3E A;  1OCD A;  2N3B A;  1C2N A;  1EZV D;  1C6S A;  1SQQ D;  1L9B C;  5KLV D;  1HZV A;  1CHH A;  4AAL A;  2JQR A;  4GED B;  2Y0E A;  1CSW A;  3DMI A;  3RN1 A;  3VMA A;  1AYG A;  4XYD B;  1SQV D;  2V08 A;  1N50 A;  1C75 A;  3L72 D;  2FRC A;  1DW0 A;  3CX5 W;  155C A;  1I55 A;  1CCH A;  1H33 A;  1YEA A;  5CIF B;  4WQE A;  1N90 A;  1RAQ A;  2O3J A;  1NTZ D;  4P4Q B;  4FB1 A;  1CIF A;  3L71 D;  5E79 V;  1NU1 D;  1L9J C;  2C9X B;  1BCC D;  3PXS A;  1H31 B;  2K9J B;  4XXL A;  3OA8 A;  4FA1 A;  1CYJ A;  4EIF A;  2C8S A;  1CCR A;  2MHM A;  3O0R C;  1HCM A;  1NIR A;  1IQC A;  3WUI A;  2ZXY A;  2CA4 B;  3CU4 A;  4J20 A;  1CO6 A;  2BH4 X;  2OZ1 A;  5H2F V;  1CSV A;  3X39 A;  3O20 A;  3HQ6 A;  3ZBM A;  2QG4 A;  1I8O A;  2XTS B;  2CXB A;  1HJ5 A;  5B5E V;  1YIQ A;  4Q5P A;  3ZOW A;  1A56 A;  1J3S A;  2RN0 A;  4DY9 A;  2FYU D;  2YQB A;  5B66 V;  5AUR A;  3ORV A;  4PJ0 V;  1QL4 A;  1SQX D;  1CNO A;  1YCC A;  1RZ6 A;  3JBT B;  4EDF A;  1BE3 D;  1YIC A;  1CXC A;  1E2R A;  1U74 B;  1DW3 A;  4AAO A;  2B10 B;  5CIH B;  4AX3 A;  2AI5 A;  2DGE A;  1IRV A;  3M97 X;  1DVV A;  5GTH V;  1AKK A;  2BPB B;  1FI9 A;  1CSX A;  1CIG A;  4U3F D;  4KMG A;  2YK3 A;  2JWA A;  5DFS A;  3FWL A;  1HH7 A;  2FYN B;  5IY5 1;  1DIQ C;  4GYD A;  2D0S A;  2GC7 D;  1CRJ A;  1WEJ F;  3A0B V;  3CWB D;  4FA5 A;  3L4M A;  2B0Z B;  2GB8 B;  3H1L D;  4D6T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...