1NTMD

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 50
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntmD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntmD01
1AOFA 1MG3D 1FJ0A 5KLVD 1SQQD 4LJIA 1YTCA 2C1VA 2MHMA 3VRDA 2C1UA 3HQ8A 4D6TD 3OA8A 3L4OA 2ZBOA 4DY9A 4FA5A 1CRIA 2QG4A 1QYZA 1H32B 1RZ5A 3L73D 3ZOXA 1CHJA 3VMAA 1CTYA 1HCMA 2B11B 3A0HV 3SWSA 1M6ZA 2BGVX 1H9XA 4WQ8A 3RMZA 5KAIV 2FYUD 3OCDB 1FI3A 2RMZA 1A56A 1DVVA 4EDFA 5KLIB 4UB8V 3L72D 1H33A 4AALA 2MTAC 2OZ1A 5CICB 1FI9A 1R0QA 1MG2D 2N9IA 3ORVA 1GU2A 1BGYD 1QL4A 1C2NA 2ZZS1 3WFEC 1ZZHA 1S6VB 2JQRA 2RN0A 1KX2A 1ZRTD 5CIBB 3RN1A 1CSWA 2N9JA 1FHBA 5AURA 5CIEB 3L4MA 3WFCC 2ZXYA 4KMGA 1CCRA 2C9XB 1CSXA 2Y0DA 3X39A 1C6RA 1HJ5A 3WUIA 1W5CT 1LMSA 1EB7A 1H31B 5CIHB 1QN2A 2N3YA 1KV9A 3ZIYA 3WFBC 3CXHW 1DW2A 1CIGA 2JWAA 1YCCA 1KYOW 3C2CA 1I6DA 3CYTI 2GC4D 1WEJF 2N9YB 1IZL0 4GEDB 1S5LV 2N18B 3NBSA 4XXLA 1IQCA 1CRYA 1CCHA 1SQVD 3RN0A 1CXAA 2YK3A 2PCCB 4WQ7A 1CORA 4GYDA 1LC1A 3SXTA 3O20A 5KAFV 4YE1A 1CYJA 1RAQA 5CIDB 1MZ4A 1C6OA 4FANA 1QL3A 2I8FA 1I8OA 1OAEA 2BLFB 1PP9D 1FOCA 1NIRA 1DW3A 5GTIV 1COTA 3O0RC 1C52A 1GJQA 4PD4D 1WVEC 2B0ZB 2BPBB 1CIEA 5EXQA 3HQ7A 1CXCA 4WQDA 1FI7A 3CXHD 2QJPB 1K3HA 1C75A 1KYOD 1IRWA 1RAPA 5C0ZA 1CHIA 1QKSA 1W2LA 3OA8B 5TISV 1YIQA 1YEAA 2GB8B 2PCBB 2CE1A 4Y5RA 2B10B 3A9FA 1OCDA 3MK7C 4IL6V 3PXTA 4RJTA 2BCNB 1DIQC 3ZOWA 5KKZB 3ZCFA 4H0JA 2GIWA 2L4DA 4FA4A 5GTHV 3JBTB 4U3FD 3H1ID 2ZONG 5DJQC 3KZIV 3TDKA 5B66V 4RSZA 3CWBD 1YICA 1L0ND 5CIGB 4WQEA 1BE3D 1CRHA 1DW0A 1F1CA 4WQ9A 5TJHA 1HZVA 1CTJA 2Y0EA 1NTMD 2CE0A 3A0BV 2EXVA 1I5TA 4L1QA 2V08A 1HRCA 1H33B 1CHHA 3SLEA 1LS9A 1CEDA 3PTZA 4PJ0V 3O5CA 5E79V 2OZ1B 3WFDC 3L70D 3H1LD 2YIUB 1CSVA 1C7MA 1C2RA 1CIFA 3L75D 1YNRA 4EIDA 4P4QB 3WU2V 2N3BA 351CA 1HJ3A 3PH2B 1A2SA 1CC5A 1SQBD 5IY51 3CX5W 4J20A 4EICA 2FYNB 1GQ1A 3TGUD 3H1JD 1I55A 1HZUA 1NTKD 1A8CA 3KHUA 1L9JC 1HH7A 2AIUA 1CYIA 4K3IA 1CTZA 3VNWA 2ZOOA 2B12B 1BCCD 2C2CA 4XYDB 2C1DB 4A7PA 1HROA 1SQPD 4AX3A 3PLNA 2KNCB 3HQ6A 2C8SA 3CP5A 2AI5A 1KIBA 1IO3A 155CA 1E29A 2A06D 2KS1A 1K3GA 1M60A 1IRVA 1I8PA 1I6EA 4EIEA 1JDLA 1NTZD 3NWVA 2QJYB 2ORLA 3PXSA 1CRGA 4N0KA 2VHDA 1H9YA 1NU1D 1PPJD 4QAOA 1CRCA 4WQCA 1U74B 2CA4B 1AKKA 2BH5X 3DP5A 4FA1A 1H32A 2Y0CA 3GG2A 2YQBA 4L3HA 1RZ6A 2BCCD 1B7VA 1GDVA 1CYCA 4FAVA 1LC2A 1CNOA 2AXTV 2CA3B 3DR0A 5B5EV 5H2FV 3BCCD 1DVHA 4AAOA 3PXWA 2JTIB 5CYTR 1KX7A 3SJLA 4WQAA 3L71D 4AAMA 3OCDA 1L9BC 1N50A 1GKSA 3PRJA 1M70A 1P84D 2IBZD 3M97X 1FCDC 2N18C 2XTSB 2YCCA 1I54A 3PHLA 3HQ9A 451CA 1AOQA 1N90A 2LIRA 5CIFB 4NFGB 1N15A 4V2KA 1EZVD 1NMIA 2D0SA 1LFMA 4MU8A 3H1KD 4WQBA 3SVWA 1DT1A 1HJ4A 2Q3EA 3TYIA 1ETPA 1J3SA 1KB0A 1H1OA 4PWAA 2LITA 5DF5A 2V07A 3TF5A 2QJKB 3VYMA 1NMLA 2K9JB 1H31A 2FWLA 5DFSA 3NBTA 3MK7B 4L3GA 2FRCA 2B4ZA 2PACA 4PW9B 3DMIA 4FB1A 4Q5PA 1C6SA 2CXBA 1DIIC 5B6QA 4H0KA 5DJQB 2L91A 3GW6A 3ITKA 1BL9A 5C9MA 3CU4A 2DVHA 1E8EA 4UB6V 1U75B 3L74D 1SQXD 1N9CA 2HV4A 1CO6A 3ZBMA 1DW1A 2C1DA 3RLMA 1CSUA 1CRJA 1E2RA 1GIWA 1KB9D 4O1WA 4JCGA 1YFCA 1YEBA 3WC8A 4EIFA 3FWLA 3CX5D 1F1FA 1VYDA 4AANA 2O3JA 1CIHA 1NNOA 3H1HD 1AYGA 2GC7D 4O1QA 3ZOOA 2D0WA 2BH4X 3O1YA 3ZOYA 4FA9A 2DGEA 1L0LD
chains in the Genus database with same CATH superfamily
3L75E 2WSCH 3SWYA 1SQQD 1RE3A 2ITAA 1YTCA 2C1VA 2H89C 2V7QH 4FA5A 1CRIA 2QG4A 3TGUE 2IX7C 3EFGA 3H1JE 1NTKE 3VMAA 5B66H 1LP1B 2BGVX 2R5DA 2H7HA 5KAIV 3GHGB 3GLMA 3L74J 1J1DB 3AE7C 1ZMEC 3AEDC 3EQ2A 3KXDA 1NOHA 4EDFA 1N7SA 5KLIB 1QLED 3JC22 1NTKK 1FI9A 1GU4A 3HE4B 3ORVA 1QL4A 2D2CD 2G8YA 1S6VB 5AW9B 3HD7A 1VF5B 2JQRA 1M90Q 5CIBB 3RN1A 1LNQA 1N2DC 1FOSF 1NTZE 4C46A 1SQBG 5AW3B 4KMGA 2C9LY 1CCRA 2C9XB 2IFMA 4H0LB 1CSXA 2XNXA 1C6RA 3JSVC 1X22A 3M0DA 5APXA 1KV9A 1KQFB 1DW2A 4H44B 1CIGA 1S5LH 2JWAA 1YCCA 1AVOA 3CCMP 3TNUA 5BU5A 3RK3D 4W7ZA 3CYTI 1NTZK 1WEJF 1VQ6P 1BCCG 4XXLA 1IQCA 4AQRD 1CXAA 2PCCB 4HH2A 5AVXB 5KAFV 1KZUB 1IFIA 3L72J 1MZ4A 1LTTC 1H8AA 5KAIE 2I8FA 1YIJP 2BLFB 3CLQA 4GT1A 1KILB 1A02J 1W2EA 3USSA 4YTPC 4H13D 3H1KE 3W67A 2GA1A 1CIEA 2BEZF 1RF1B 1NAYA 2SPZA 1FI7A 3D70A 2P1JA 1NGMB 2N1TB 1C75A 1KYOD 2AEJA 4TT3H 2E75D 2QJKC 3N7NA 1QKSA 5C39A 1RF0C 3OA8B 1SQBJ 3H1IG 1EXJA 2PCBB 2CE1A 4Y5RA 1YITP 3ZOWA 2GIWA 2L4DA 4U7JA 1QEXA 1S2EA 4XE5B 1T2KD 5GTHV 1Y9BA 1OIPA 2W8ZA 2IBZG 2OARA 2ZYGA 2AEFA 5KTBA 3AE2C 2YXRB 1BE3D 4WBAA 1DW0A 4WQ9A 5CMZA 1CZQA 4PJ0H 2Y0EA 4C7RA 1Q90D 3A0BV 1LTAC 2Y9YA 4BRYB 2V08A 2XDJA 1HRCA 1MV8A 1PP9J 1H33B 3PH0A 2FFDC 2KB7P 1CEDA 1KB9E 2KP8A 2NZ2A 2OZ1B 3WFDC 3LIEA 1G2CA 5KAFE 3WU2H 2YIUB 3B4SA 1K9MQ 1C7MA 1C2RA 5L8RJ 3CCEP 1L4AC 1YNRA 4EIDA 4P4QB 3MD0A 3OA7A 1SQVK 2O1KA 1NKZB 1ZR2A 2HPCA 1CC5A 1SQQE 1GQ1A 3P8CD 1VF5D 3Q5RA 1KB9I 1JEKA 1WMKA 1A8CA 1FC2C 3H1IJ 4N78D 2Q3IA 4PV1C 3P7KA 1CYIA 3E1IA 3MGNA 4KT0J 1JUNA 1CTZA 2K9YA 1VQMP 3WMM0 4JBZA 2ZOOA 4PD4H 1LTBC 4XYDB 2OYIA 2A06G 5GTHE 2YO2A 1N73A 4N6JA 1BSHA 3U1AA 1CSBA 3LW5H 1IO3A 3QWOC 3L70J 3MP7B 4C7NA 3H1HG 2WTYA 3HTKA 1K3GA 1M56D 3A0BE 1HUCA 1IRVA 1NVOA 2WSEH 1RE4A 5KLVG 3SWFA 2ORLA 3PXSA 1JMMA 3L35A 3N4XA 2BCCG 1CRGA 2VHDA 3CC7P 1H9YA 1JM0A 1PPJD 3U1CA 3JCUH 2Q6QA 4Y99C 2AXTH 1NWQA 2NPSC 2LXBA 2WPRA 2E5YA 3V2QA 4OGQC 5AW6B 3DP5A 1L2PA 2Y0CA 3GG2A 4GDOA 3OAKA 1CYCA 2CA3B 5B5EV 1NH4A 1RQVA 1DVHA 2ZVNB 1LWUC 4PV1B 1QL2A 1LP1A 2ZYAA 1KD1Q 2Q9IA 3B5NC 2N1TD 1KX7A 3L71D 3GHGA 1L9BC 3GF3A 3S4RA 1M70A 1JY2N 1P84D 2BEQD 1JTHA 2PP6A 5CCHC 3PHLA 1X9VA 451CA 1FZCC 2MKVA 2A45I 5APWA 2YKQA 1N15A 1NMIA 3HD7B 1KFNA 3ZDMA 4EOTA 1IK9A 1VPCA 3V4WA 3H1HJ 3WUTA 2CPSA 3H6PA 4PWAA 5EFWB 4LGDE 1LTJC 1YI2P 1OW7A 5M1BA 4LC1A 2YMKA 1NMLA 2HG5D 5KLVJ 4L74A 2QJPC 5DFSA 1KYOE 3NBTA 2FRCA 3AE4C 1R8EA 2BCCJ 3PJSK 3CD6P 1NU1E 2WSFH 2R3SA 1R5SA 3L37A 2WSCJ 1YQ3C 1LWUB 2GUSA 1SQXG 1SFCC 3F89A 2V7QJ 1GD2E 4UB6V 4DT0A 5B5EE 3L74D 2HV4A 1N9CA 1G1IA 2R44A 4K3AA 3CCSP 1BE3E 1XTCC 1J2JB 1NKNA 1NU1K 1KC8Q 1KYOI 1CSUA 1GK6A 4JCGA 5KJ7C 1H89A 4M3LA 3AE5C 3WC8A 3FWLA 3CX5D 5CJ4A 1GU5A 1RF1A 4WY4C 2BH4X 4FA9A 3O8ZA 4HJGH 2N1TA 1LT1A 1MG3D 4RESB 1KTMA 4LJIA 1CW5A 3OA8A 3L4OA 2ZBOA 1YTZI 3P32A 2FXMA 2HFED 2J58A 1SVFA 3P8CE 4XA4A 4ASVA 4YXWH 1RZ5A 5APTA 3L73D 1AV1A 3M9HA 3M9BA 1OXZA 1L4AD 1YJNP 2FXOA 2D2CB 1L0NG 1HCMA 2K88A 3A0HV 1RQUA 4N78E 1M6ZA 2IDBA 2AXCA 1SQXJ 3MUDC 1NTMG 3M0AA 3K5BA 2JDIH 1FI3A 1DVVA 4BRYA 1K8AQ 4UB8V 2YXQB 3L72D 1H33A 4L73A 1GL2C 1PZQA 3H1LG 4PV1D 4UB6E 2OZ1A 1G2CB 2N9IA 1BGYD 2ZZS1 3WFEC 1LTSC 3L75G 2BASA 1YQ4C 5AW5B 2NRGA 1L0LJ 1FHBA 1FDOA 2B87A 3TGUG 3X39A 2QJYC 2XZRA 2ZYDA 3FWNA 3U59A 2KOGA 3H1JG 3G3ZA 2N9BA 3IFMA 2Q1KA 5AVRB 1M8OB 1WT6A 1PGJA 2Q5UA 1FZEA 1OX3A 2P67A 4H13B 1IZL0 2JWDA 3NBSA 3MTUE 2NPSD 1CRYA 3L71E 3RL0C 1SQVD 5CHXA 2PFXA 4HB1A 1P84E 3O20A 2KXPB 5GTIH 4YE1A 1CYJA 3A0HE 1ZR4A 2WPSA 1NTMJ 4C7NB 4N3YB 2YMYA 1I8OA 1PP9D 1FOCA 3B5ND 1FS0E 3KDPB 1DD3A 3V2RA 1YBKA 4UB8E 1EXIA 3OJAB 2B0ZB 5AVWB 1CXCA 4WQDA 3L75J 1LT9B 1P84I 5CCGD 1RAPA 5C0ZA 2PRRA 2DW3A 1NJIQ 2V4HA 1YEAA 3NTNA 2B88A 2B10B 3A9FA 1OCDA 1GMJA 3MK7C 4IL6V 3H1JJ 1DIQC 1VQPP 3ZCFA 1TU3F 4FA4A 4GOEA 3KYQA 3JBTB 4U3FD 3H1ID 1KQGB 5AW4B 3KZIV 2YO3A 1N8RQ 3TDKA 1VQ9P 3S9OA 3D6ZA 3CWBD 1OVVA 1JTHB 5CIGB 4NPDA 5TJHA 3L74E 1ZW0A 2CE0A 4L1QA 1VQOP 1AVYA 1URQC 1SFCD 3H1KG 3RK2B 5E79V 3L70D 2WT7A 4GKGA 3FX0A 2OYHB 3Q5SA 1CSVA 3CX5E 1JMBA 3AEFC 2IZ1A 5AVQB 1VQKP 3LW5J 2N3BA 351CA 2NPSA 5KJ7D 4IOIH 4J20A 4YXDC 2WSEJ 3H32B 2IYPA 3L36A 5APSA 1LWUA 3C1LA 4XFJA 1Q81Q 3L73E 3B5NA 1SQPG 1S4XA 3CX5I 3NMDA 1HH7A 2O1JA 1EDLA 5BVZA 4IL6E 1M1JC 2C2CA 4A7PA 1HROA 3L4FA 3HUSC 3KZIE 2R3CA 3CXHH 2HYNA 5CCGA 4HKZH 3AEBC 3L72E 3R4YA 1E29A 1GZLA 2B9BA 2A06D 1GW4A 2QM8A 2O01H 1M60A 1BGYE 2CPBA 1JDLA 3H1KJ 1JNMA 4IFFA 1SQQG 5E79E 1GK4A 2ZJSE 1J1EC 1GL2D 1SLQA 4MN4C 1NU1D 3SSUA 1MKMA 1CRCA 2H43A 5H2FH 2P7JA 2ZVOB 2CA4B 3AEEC 2HR3A 4FA1A 1RZ6A 2BCCD 3E7KA 2HODB 4FAVA 1LC2A 1P84H 3DR0A 1QL1A 3BCCD 3QH9A 3I56P 1RHZB 3PXWA 3LIDA 3BRTB 3HRNA 1KORA 4IL6X 1EDIA 4WQAA 1JY3N 4I1LA 1IFJA 2Z5HA 1BCCJ 1X79B 2K3RA 2WSFJ 1SQPJ 1FCDC 2N18C 1SQVE 5K5GB 3AE9C 1FBMA 1SQBK 4WB4A 3A7OA 5KJ7A 4NFGB 1OFCX 1EZVD 1PP9E 4RO0A 4L75A 1U7MA 3TK1A 4MU8A 4WQBA 2YKOA 3A2AA 3SVWA 4DZOA 1LTIC 4QMAA 1DT1A 2Q3EA 1J3SA 1FDIA 3VP8A 1RY3A 2E74C 1VQ7P 2WSSH 2LITA 2B87B 1OMIA 5DF5A 3ABVC 3TF5A 4L76A 2QJKB 3VYMA 1MZ9A 3A5TA 1SQQJ 2FWLA 3RK2D 1A02F 1CI6A 1HTLC 2E43A 2Z5IA 1N7LA 2B4ZA 1HJ0A 4GODA 4PW9B 1JCCA 1RE3C 2KYVA 2CXBA 4H0KA 1PV3A 2ZT9C 2L91A 1BL9A 2E76C 1M1KQ 5C9MA 3CU4A 1T3JA 3MUDA 4U3FE 1E8EA 3H1IE 3NXSA 4NPEA 1QGKB 3V2PA 3CWBE 1SQXD 3D6YA 1OW8A 3CX5H 2FFDB 1CO6A 1DW1A 2C1DA 3CCQP 2KI7B 1HH0A 1QVFO 4O1WA 1N7SC 1YFCA 1YEBA 2J5UA 1USDA 1H88A 3Q5PA 2CK3H 1L4AB 1ZLLA 3L70E 4EYYQ 1LGHB 2GC7D 2D0WA 3O1YA 3ZOYA 2DGEA 1L0LD 1AOFA 1LT9A 1FJ0A 1URQD 2MHMA 1OZHA 4D6TD 1AQTA 2R5BA 4DY9A 4IL6H 2I8DA 2FYUG 3M0DC 3V5BA 5KAIH 3IF4A 3SWKA 2GUVA 1CTYA 3AE3C 1BE3G 3SWSA 1H9XA 2RMZA 2RH0A 1IFDA 2JO1A 3VTPC 1BDCA 4AALA 5E79H 1DEBA 2WT7B 1DH3A 2JEEA 2UWJE 2OYHA 2L5GB 1YTZT 2XV5A 3BASA 1PFIA 2A06E 2FXPA 2RN0A 1KX2A 3SFEC 1CSWA 2N9JA 3RGUA 5AURA 4JQ0D 4Y99B 2NPSB 3RBXA 2ZXYA 4OGQB 3VP9A 2Y0DA 3CCVP 5AW2B 5BU8B 2M5AB 3H32A 4BWNA 4KJMA 2LXCB 5APQA 1H31B 5CIHB 2N3YA 4B86A 3CXHW 4DCKA 4ZMDA 3B5NB 2BCCE 4JPZB 2Z4EA 2KZIA 2GC4D 1KB9H 3BCCE 3WUUA 2W27A 4GEDB 1S5LV 5KAFH 4YPCA 1Y8AA 2FYUJ 2FKWB 1CCHA 2Q7CA 5AVVB 1CORA 4GYDA 1JOCA 3SXTA 1BE3J 5KLVK 2RKLA 1LTGC 2IFNA 1FZCB 3G4SP 1RAQA 3IR9A 1C6OA 1URQA 1Y47A 1OAEA 1NIRA 1S3JA 3P8MC 3O6QB 1COTA 3O0RC 1C52A 1FZGA 1GJQA 4PD4D 1EZVE 1LTJB 2J59M 2KLUA 3VMZA 2BPBB 5EXQA 1PPJG 1K05A 2FBWC 2QJPB 1K3HA 1GW3A 3M9QA 2KK7A 5AVZB 3RK3C 1ZRTE 4W80A 2W6AA 1W2LA 2WPVB 5TISV 1YIQA 5GTHH 2HODA 2GB8B 2O01N 1SFCB 1USEA 3R2PA 3PXTA 4RJTA 2BCNB 3VN0A 1HF9A 2JKVA 3L71G 4EIJA 1EZVI 2ZONG 5DJQC 3A0BH 1M1JA 4WQEA 4OVNF 2JR8A 2QEXP 1CRHA 1F1CA 3E1RA 1HZVA 1SQXE 1CTJA 1X0TA 1S5LE 5AVUB 2OYIC 3SLEA 1S1CX 2E76D 4PJ0V 1SS1A 1VQ5P 2P10A 4WY4B 1N73C 1IK7A 2A45H 1YJWP 2MJZA 4JYBA 1GDTA 1EDJA 2M3BA 1CIFA 1NYHA 1SQXK 5CBNA 1IFPA 3WU2V 1RF0A 1DD4A 1ZP0C 2QVAA 1L0LE 2W6JH 1NHLA 1OWAA 1VL2A 1CI6B 1NTKG 3PH2B 1T2KC 1SQBD 2O01J 3CX5W 1KN7A 1WRGA 4D6TE 1IZNB 2Y9ZA 3A3YB 1HZUA 1FZAA 1KQSO 3KHUA 1L9JC 1KQLA 2H8PD 3VOPA 2AIUA 2KLVA 5TISE 4OGQD 1L0LK 5AW8B 4ZKPA 4WWIA 1L0NJ 3VNWA 4O9BA 3L71J 4GIFA 1BCCD 2C1DB 2FFDA 1GL2B 1SQPD 3PLNA 3GHGC 2KNCB 1DIPA 1J1DC 1JCDA 3CP5A 1FJPA 1NTZG 3V4QA 155CA 5KLIC 1KYOH 4LLHA 3H1LJ 1L4AA 2KZJA 1I8PA 5CCHD 1T8ZA 2H88C 1FZBA 1ZXGA 1E5WA 2QJYB 4PJ0E 1VF5C 4N0KA 4QAOA 3TGUJ 5B5EH 4WQCA 1NTMK 3L73G 1AKKA 4H0LC 4BXLA 1YJ9P 2ZXXA 3WU2E 4CPGA 1B7VA 1VQ4P 1NTKJ 2M0BA 1CNOA 2AXTV 3V2NA 4AAOA 3VMXA 4H44C 1D7MA 3FXDA 3RL0B 5CYTR 1S9KD 1AA0A 4GOFA 4R4MA 3I5CA 4AAMA 1N50A 1GKSA 2IBZD 3KPEA 1KV4A 1AJYA 4DJGA 3L72G 2YCCA 1NAFA 1I54A 4AUWA 1BGYG 1YYCA 1KFMA 1N90A 5CIFB 2D0SA 1H0TA 1NTZJ 1KILC 4PD4E 1ETPA 3VYIA 5CBOA 2V07A 1HGZA 3CMEP 4IFMA 1RF1C 2M5AA 1R5LA 1ZOYC 1H31A 1T6AA 1FE6A 3MK7B 2N1TC 4WY4D 1SP4A 2IPPA 2PACA 3DMIA 4OWFA 3GMAA 1C6SA 1DIIC 5B6QA 1OVUA 2E5TA 1HGVA 4ASWA 3L73J 4UB6H 3V6IA 3GW6A 2OTJP 3KQGA 3ITKA 2KSJA 2XKMA 3IAOA 1SQVG 3W68A 4PD4I 2DVHA 4R4LA 5CCHA 1VQLP 3JCUE 2AXTE 1U75B 3CPWO 1FZCA 3ZBMA 1URQB 1AQ5A 3RLMA 1LJ2A 1PP9G 1CRJA 1E2RA 1GIWA 1JY2P 3H25A 1VQ8P 1FJKA 3O6QA 2QSIA 1LTJA 4AANA 3HE5B 2KS1B 1BGYJ 3H1HD 4O1QA 4HYTB 2K37A 2YIUC 3C8VA 3Q1MA 3T97B 5KLVD 2KIKA 3BVHA 1VQNP 3CCJP 3VRDA 5TISH 2C1UA 3HQ8A 2KUBA 1SQBE 1SFCA 1QYZA 1H32B 3A0HH 1IC2A 4U3FG 4EI2A 2ZXEB 1HWTC 3ZOXA 1CHJA 3CWBG 1M1JB 2B11B 4WQ8A 3RMZA 4UB8H 1YHQP 3MZWB 2FYUD 3OCDB 3HUSB 1SQVJ 1A56A 1BCCE 1Q82Q 2YKPA 1SQPE 1HVVA 1M7LA 3L70G 2MTAC 5CICB 3RL0D 1R0QA 1MG2D 4WY4A 1HJBA 1GU2A 1C2NA 2WMMA 1OW6A 1ZZHA 1Q2NA 1QVGO 1J1EB 2WVRA 1ZRTD 5CIEB 3L4MA 3WFCC 2A45G 1MFTA 1SQPK 2G3AA 2QRXA 1HJ5A 3WUIA 1W5CT 1RH5B 1LMSA 2ZAEB 2K9JA 1EB7A 2B89A 1QN2A 2QA4P 3ZIYA 3WFBC 4Y28J 2ZFCA 1KYOW 3C2CA 1I6DA 3BRVB 5AW1B 5KKZC 2N9YB 2OTLP 3CC4P 2N18B 1K04A 4NPFX 4U3FJ 1S9KE 3WUVA 5AW7B 3RN0A 2YK3A 1GL2A 3G6EP 3CWBJ 4WQ7A 4H0LD 1LC1A 2KNCA 2IBZE 2QIWA 1SQQK 5CIDB 4ZNCA 1IFNA 4FANA 1QL3A 4H44D 2WQYC 1G1JA 1DW3A 3F5HA 5GTIV 3RBZA 5APUA 2E74B 3GF7A 4KHXA 1WVEC 3AEGC 1W5CE 1XTGB 3II6A 3HD7C 1VDFA 3HQ7A 1NU1G 4I6MC 3CXHD 3AE1C 3D0WA 2PAJA 1IRWA 2IBZI 3B8EB 1EDKA 2JJLA 1CHIA 1Q86Q 2FYNC 5DJTB 3BCCG 2FYZA 2ZT9B 3KZIH 3CMAP 1KILD 1X8YA 2E76B 2W90A 5KKZB 4H0JA 1U57A 4I2LC 2FY8A 2LR2A 5B66V 4JYCA 4RSZA 2POHA 1YICA 1L0ND 3RK3E 3CCUP 1DEEG 3BATA 1NTMD 3NFQA 2XU6A 2EXVA 1N7SB 1JY3O 1I5TA 3G9RA 1PGOA 3I55P 1EZVG 1CHHA 3M91A 1LS9A 4JF7A 3PTZA 5DJUB 1H0TB 3O5CA 1ZV8A 3H1LD 3HE4A 1E79H 3CCRP 5CCGC 1FZFA 2IZ0A 4TLFA 3H1HE 1EQ7A 3L75D 1M57D 5GTIE 1IFMA 1K73Q 1PIXA 1HJ3A 4Z1MH 1A2SA 4I7ZC 2OQQA 5KLVE 1NU1J 1W2BO 5IY51 4W7YA 4EICA 2FYNB 2C0WA 3TGUD 2E42A 3H1JD 2IYOA 1UIXA 1I55A 1NTKD 3D71A 3TNUB 2WZ7A 3BCCJ 4K3IA 3AE6C 2D2CC 2B12B 2W83C 2FYUE 1S72P 2WPQA 3TSIA 2PGDA 4AX3A 3HQ6A 2R32A 5APYA 2C8SA 1QX8A 5B66E 2C0XA 1T3UA 2AI5A 1KIBA 1FDMA 1MUUA 3HE5A 2KS1A 2W6BA 1KILA 3EFFK 3CL3D 1FU1A 3M06A 1I6EA 1L0LG 4EIEA 2P58A 1UIIA 1MFZA 1NTZD 2FYUK 1EC5A 3NWVA 2LKMA 2P2UA 3EWKA 3T97A 4AYCA 3CCLP 2QM7A 4D6TG 1AFOA 3Q2YA 4I7ZB 4WVZA 4IFDK 1U74B 2BH5X 5AVSB 1H32A 2E74D 2YQBA 4L3HA 3CC2P 2XNDH 1GDVA 2WWWA 5H2FV 1N86A 2JTIB 1Z56A 5AW0B 3SJLA 2VRSA 2OYOA 3OCDA 3HUSA 3TYYA 3PRJA 4H13C 3M97X 5AVTB 1HBWA 2XTSB 1IO4A 1JY2O 3C9IA 2JP3A 3VMYA 2ZT9D 3B71A 3HQ9A 2WITA 3MIWA 2OGUA 3AE8C 5AVYB 1PGQA 1AOQA 4K35A 2LIRA 2AEMA 2E75C 4V2KA 1LFMA 3H1KD 3Q3DA 2I1JA 1ZN5A 1HJ4A 3TYIA 2QE7H 2M3EA 1KB0A 1RE4C 1H1OA 3RK3B 3MHVA 3AECC 1N7SD 3CI9A 3CXHE 1NO4A 3FGAD 2K9JB 4OH8B 3PP5A 3AEAC 1KMIZ 2HPCB 4L3GA 3FXEA 1LT9C 4D6TJ 1BDDA 5CJ0A 1PPJE 4FB1A 4Q5PA 2M8RA 3UIAA 5DJQB 3HD7D 1PGPA 3L74G 1KILE 3G71P 1GTWA 4RKUJ 1DX7A 2K1AA 4DOJA 1S5LX 1IJDB 1JO5A 1Q7YQ 5H2FE 1L0NE 2OTKE 2YNYA 2I1KA 3CXHI 3OW2O 2OYIB 1OVRA 1JY3P 1U7JA 1BSNA 2HLOA 1NTME 1KB9D 1N73B 2GM4A 3S1KA 1JB0J 2E75B 5APVA 1FOSE 4EIFA 3IN6A 2C9NY 1FAVA 3HTKB 3RL0g 1F1FA 1VYDA 2O3JA 1CIHA 1NNOA 1AYGA 3H1LE 3RK2C 1PL5A 3ZOOA 1L0NK 3SFDC 4ZKUA 2OYHC 2KSEA
chains in the Genus database with same CATH topology
1AOFA 1MG3D 1FJ0A 5KLVD 1SQQD 4LJIA 1YTCA 2C1VA 2MHMA 3VRDA 2C1UA 3HQ8A 4D6TD 3OA8A 3L4OA 2ZBOA 4DY9A 4FA5A 1CRIA 2QG4A 1QYZA 1H32B 1RZ5A 3L73D 3ZOXA 1CHJA 3VMAA 1CTYA 1HCMA 2B11B 3A0HV 3SWSA 1M6ZA 2BGVX 1H9XA 4WQ8A 3RMZA 5KAIV 2FYUD 3OCDB 1FI3A 2RMZA 1A56A 1DVVA 4EDFA 5KLIB 4UB8V 3L72D 1H33A 4AALA 2MTAC 2OZ1A 5CICB 1FI9A 1R0QA 1MG2D 2N9IA 3ORVA 1GU2A 1BGYD 1QL4A 1C2NA 2ZZS1 3WFEC 1ZZHA 1S6VB 2JQRA 2RN0A 1KX2A 1ZRTD 5CIBB 3RN1A 1CSWA 2N9JA 1FHBA 5AURA 5CIEB 3L4MA 3WFCC 2ZXYA 4KMGA 1CCRA 2C9XB 1CSXA 2Y0DA 3X39A 1C6RA 1HJ5A 3WUIA 1W5CT 1LMSA 1EB7A 1H31B 5CIHB 1QN2A 2N3YA 1KV9A 3ZIYA 3WFBC 3CXHW 1DW2A 1CIGA 2JWAA 1YCCA 1KYOW 3C2CA 1I6DA 3CYTI 2GC4D 1WEJF 2N9YB 1IZL0 4GEDB 1S5LV 2N18B 3NBSA 4XXLA 1IQCA 1CRYA 1CCHA 1SQVD 3RN0A 1CXAA 2YK3A 2PCCB 4WQ7A 1CORA 4GYDA 1LC1A 3SXTA 3O20A 5KAFV 4YE1A 1CYJA 1RAQA 5CIDB 1MZ4A 1C6OA 4FANA 1QL3A 2I8FA 1I8OA 1OAEA 2BLFB 1PP9D 1FOCA 1NIRA 1DW3A 5GTIV 1COTA 3O0RC 1C52A 1GJQA 4PD4D 1WVEC 2B0ZB 2BPBB 1CIEA 5EXQA 3HQ7A 1CXCA 4WQDA 1FI7A 3CXHD 2QJPB 1K3HA 1C75A 1KYOD 1IRWA 1RAPA 5C0ZA 1CHIA 1QKSA 1W2LA 3OA8B 5TISV 1YIQA 1YEAA 2GB8B 2PCBB 2CE1A 4Y5RA 2B10B 3A9FA 1OCDA 3MK7C 4IL6V 3PXTA 4RJTA 2BCNB 1DIQC 3ZOWA 5KKZB 3ZCFA 4H0JA 2GIWA 2L4DA 4FA4A 5GTHV 3JBTB 4U3FD 3H1ID 2ZONG 5DJQC 3KZIV 3TDKA 5B66V 4RSZA 3CWBD 1YICA 1L0ND 5CIGB 4WQEA 1BE3D 1CRHA 1DW0A 1F1CA 4WQ9A 5TJHA 1HZVA 1CTJA 2Y0EA 1NTMD 2CE0A 3A0BV 2EXVA 1I5TA 4L1QA 2V08A 1HRCA 1H33B 1CHHA 3SLEA 1LS9A 1CEDA 3PTZA 4PJ0V 3O5CA 5E79V 2OZ1B 3WFDC 3L70D 3H1LD 2YIUB 1CSVA 1C7MA 1C2RA 1CIFA 3L75D 1YNRA 4EIDA 4P4QB 3WU2V 2N3BA 351CA 1HJ3A 3PH2B 1A2SA 1CC5A 1SQBD 5IY51 3CX5W 4J20A 4EICA 2FYNB 1GQ1A 3TGUD 3H1JD 1I55A 1HZUA 1NTKD 1A8CA 3KHUA 1L9JC 1HH7A 2AIUA 1CYIA 4K3IA 1CTZA 3VNWA 2ZOOA 2B12B 1BCCD 2C2CA 4XYDB 2C1DB 4A7PA 1HROA 1SQPD 4AX3A 3PLNA 2KNCB 3HQ6A 2C8SA 3CP5A 2AI5A 1KIBA 1IO3A 155CA 1E29A 2A06D 2KS1A 1K3GA 1M60A 1IRVA 1I8PA 1I6EA 4EIEA 1JDLA 1NTZD 3NWVA 2QJYB 2ORLA 3PXSA 1CRGA 4N0KA 2VHDA 1H9YA 1NU1D 1PPJD 4QAOA 1CRCA 4WQCA 1U74B 2CA4B 1AKKA 2BH5X 3DP5A 4FA1A 1H32A 2Y0CA 3GG2A 2YQBA 4L3HA 1RZ6A 2BCCD 1B7VA 1GDVA 1CYCA 4FAVA 1LC2A 1CNOA 2AXTV 2CA3B 3DR0A 5B5EV 5H2FV 3BCCD 1DVHA 4AAOA 3PXWA 2JTIB 5CYTR 1KX7A 3SJLA 4WQAA 3L71D 4AAMA 3OCDA 1L9BC 1N50A 1GKSA 3PRJA 1M70A 1P84D 2IBZD 3M97X 1FCDC 2N18C 2XTSB 2YCCA 1I54A 3PHLA 3HQ9A 451CA 1AOQA 1N90A 2LIRA 5CIFB 4NFGB 1N15A 4V2KA 1EZVD 1NMIA 2D0SA 1LFMA 4MU8A 3H1KD 4WQBA 3SVWA 1DT1A 1HJ4A 2Q3EA 3TYIA 1ETPA 1J3SA 1KB0A 1H1OA 4PWAA 2LITA 5DF5A 2V07A 3TF5A 2QJKB 3VYMA 1NMLA 2K9JB 1H31A 2FWLA 5DFSA 3NBTA 3MK7B 4L3GA 2FRCA 2B4ZA 2PACA 4PW9B 3DMIA 4FB1A 4Q5PA 1C6SA 2CXBA 1DIIC 5B6QA 4H0KA 5DJQB 2L91A 3GW6A 3ITKA 1BL9A 5C9MA 3CU4A 2DVHA 1E8EA 4UB6V 1U75B 3L74D 1SQXD 1N9CA 2HV4A 1CO6A 3ZBMA 1DW1A 2C1DA 3RLMA 1CSUA 1CRJA 1E2RA 1GIWA 1KB9D 4O1WA 4JCGA 1YFCA 1YEBA 3WC8A 4EIFA 3FWLA 3CX5D 1F1FA 1VYDA 4AANA 2O3JA 1CIHA 1NNOA 3H1HD 1AYGA 2GC7D 4O1QA 3ZOOA 2D0WA 2BH4X 3O1YA 3ZOYA 4FA9A 2DGEA 1L0LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOF A;  1MG3 D;  1FJ0 A;  5KLV D;  1SQQ D;  4LJI A;  1YTC A;  2C1V A;  2MHM A;  3VRD A;  2C1U A;  3HQ8 A;  4D6T D;  3OA8 A;  3L4O A;  2ZBO A;  4DY9 A;  4FA5 A;  1CRI A;  2QG4 A;  1QYZ A;  1H32 B;  1RZ5 A;  3L73 D;  3ZOX A;  1CHJ A;  3VMA A;  1CTY A;  1HCM A;  2B11 B;  3A0H V;  3SWS A;  1M6Z A;  2BGV X;  1H9X A;  4WQ8 A;  3RMZ A;  5KAI V;  2FYU D;  3OCD B;  1FI3 A;  2RMZ A;  1A56 A;  1DVV A;  4EDF A;  5KLI B;  4UB8 V;  3L72 D;  1H33 A;  4AAL A;  2MTA C;  2OZ1 A;  5CIC B;  1FI9 A;  1R0Q A;  1MG2 D;  2N9I A;  3ORV A;  1GU2 A;  1BGY D;  1QL4 A;  1C2N A;  2ZZS 1;  3WFE C;  1ZZH A;  1S6V B;  2JQR A;  2RN0 A;  1KX2 A;  1ZRT D;  5CIB B;  3RN1 A;  1CSW A;  2N9J A;  1FHB A;  5AUR A;  5CIE B;  3L4M A;  3WFC C;  2ZXY A;  4KMG A;  1CCR A;  2C9X B;  1CSX A;  2Y0D A;  3X39 A;  1C6R A;  1HJ5 A;  3WUI A;  1W5C T;  1LMS A;  1EB7 A;  1H31 B;  5CIH B;  1QN2 A;  2N3Y A;  1KV9 A;  3ZIY A;  3WFB C;  3CXH W;  1DW2 A;  1CIG A;  2JWA A;  1YCC A;  1KYO W;  3C2C A;  1I6D A;  3CYT I;  2GC4 D;  1WEJ F;  2N9Y B;  1IZL 0;  4GED B;  1S5L V;  2N18 B;  3NBS A;  4XXL A;  1IQC A;  1CRY A;  1CCH A;  1SQV D;  3RN0 A;  1CXA A;  2YK3 A;  2PCC B;  4WQ7 A;  1COR A;  4GYD A;  1LC1 A;  3SXT A;  3O20 A;  5KAF V;  4YE1 A;  1CYJ A;  1RAQ A;  5CID B;  1MZ4 A;  1C6O A;  4FAN A;  1QL3 A;  2I8F A;  1I8O A;  1OAE A;  2BLF B;  1PP9 D;  1FOC A;  1NIR A;  1DW3 A;  5GTI V;  1COT A;  3O0R C;  1C52 A;  1GJQ A;  4PD4 D;  1WVE C;  2B0Z B;  2BPB B;  1CIE A;  5EXQ A;  3HQ7 A;  1CXC A;  4WQD A;  1FI7 A;  3CXH D;  2QJP B;  1K3H A;  1C75 A;  1KYO D;  1IRW A;  1RAP A;  5C0Z A;  1CHI A;  1QKS A;  1W2L A;  3OA8 B;  5TIS V;  1YIQ A;  1YEA A;  2GB8 B;  2PCB B;  2CE1 A;  4Y5R A;  2B10 B;  3A9F A;  1OCD A;  3MK7 C;  4IL6 V;  3PXT A;  4RJT A;  2BCN B;  1DIQ C;  3ZOW A;  5KKZ B;  3ZCF A;  4H0J A;  2GIW A;  2L4D A;  4FA4 A;  5GTH V;  3JBT B;  4U3F D;  3H1I D;  2ZON G;  5DJQ C;  3KZI V;  3TDK A;  5B66 V;  4RSZ A;  3CWB D;  1YIC A;  1L0N D;  5CIG B;  4WQE A;  1BE3 D;  1CRH A;  1DW0 A;  1F1C A;  4WQ9 A;  5TJH A;  1HZV A;  1CTJ A;  2Y0E A;  1NTM D;  2CE0 A;  3A0B V;  2EXV A;  1I5T A;  4L1Q A;  2V08 A;  1HRC A;  1H33 B;  1CHH A;  3SLE A;  1LS9 A;  1CED A;  3PTZ A;  4PJ0 V;  3O5C A;  5E79 V;  2OZ1 B;  3WFD C;  3L70 D;  3H1L D;  2YIU B;  1CSV A;  1C7M A;  1C2R A;  1CIF A;  3L75 D;  1YNR A;  4EID A;  4P4Q B;  3WU2 V;  2N3B A;  351C A;  1HJ3 A;  3PH2 B;  1A2S A;  1CC5 A;  1SQB D;  5IY5 1;  3CX5 W;  4J20 A;  4EIC A;  2FYN B;  1GQ1 A;  3TGU D;  3H1J D;  1I55 A;  1HZU A;  1NTK D;  1A8C A;  3KHU A;  1L9J C;  1HH7 A;  2AIU A;  1CYI A;  4K3I A;  1CTZ A;  3VNW A;  2ZOO A;  2B12 B;  1BCC D;  2C2C A;  4XYD B;  2C1D B;  4A7P A;  1HRO A;  1SQP D;  4AX3 A;  3PLN A;  2KNC B;  3HQ6 A;  2C8S A;  3CP5 A;  2AI5 A;  1KIB A;  1IO3 A;  155C A;  1E29 A;  2A06 D;  2KS1 A;  1K3G A;  1M60 A;  1IRV A;  1I8P A;  1I6E A;  4EIE A;  1JDL A;  1NTZ D;  3NWV A;  2QJY B;  2ORL A;  3PXS A;  1CRG A;  4N0K A;  2VHD A;  1H9Y A;  1NU1 D;  1PPJ D;  4QAO A;  1CRC A;  4WQC A;  1U74 B;  2CA4 B;  1AKK A;  2BH5 X;  3DP5 A;  4FA1 A;  1H32 A;  2Y0C A;  3GG2 A;  2YQB A;  4L3H A;  1RZ6 A;  2BCC D;  1B7V A;  1GDV A;  1CYC A;  4FAV A;  1LC2 A;  1CNO A;  2AXT V;  2CA3 B;  3DR0 A;  5B5E V;  5H2F V;  3BCC D;  1DVH A;  4AAO A;  3PXW A;  2JTI B;  5CYT R;  1KX7 A;  3SJL A;  4WQA A;  3L71 D;  4AAM A;  3OCD A;  1L9B C;  1N50 A;  1GKS A;  3PRJ A;  1M70 A;  1P84 D;  2IBZ D;  3M97 X;  1FCD C;  2N18 C;  2XTS B;  2YCC A;  1I54 A;  3PHL A;  3HQ9 A;  451C A;  1AOQ A;  1N90 A;  2LIR A;  5CIF B;  4NFG B;  1N15 A;  4V2K A;  1EZV D;  1NMI A;  2D0S A;  1LFM A;  4MU8 A;  3H1K D;  4WQB A;  3SVW A;  1DT1 A;  1HJ4 A;  2Q3E A;  3TYI A;  1ETP A;  1J3S A;  1KB0 A;  1H1O A;  4PWA A;  2LIT A;  5DF5 A;  2V07 A;  3TF5 A;  2QJK B;  3VYM A;  1NML A;  2K9J B;  1H31 A;  2FWL A;  5DFS A;  3NBT A;  3MK7 B;  4L3G A;  2FRC A;  2B4Z A;  2PAC A;  4PW9 B;  3DMI A;  4FB1 A;  4Q5P A;  1C6S A;  2CXB A;  1DII C;  5B6Q A;  4H0K A;  5DJQ B;  2L91 A;  3GW6 A;  3ITK A;  1BL9 A;  5C9M A;  3CU4 A;  2DVH A;  1E8E A;  4UB6 V;  1U75 B;  3L74 D;  1SQX D;  1N9C A;  2HV4 A;  1CO6 A;  3ZBM A;  1DW1 A;  2C1D A;  3RLM A;  1CSU A;  1CRJ A;  1E2R A;  1GIW A;  1KB9 D;  4O1W A;  4JCG A;  1YFC A;  1YEB A;  3WC8 A;  4EIF A;  3FWL A;  3CX5 D;  1F1F A;  1VYD A;  4AAN A;  2O3J A;  1CIH A;  1NNO A;  3H1H D;  1AYG A;  2GC7 D;  4O1Q A;  3ZOO A;  2D0W A;  2BH4 X;  3O1Y A;  3ZOY A;  4FA9 A;  2DGE A;  1L0L D; 
#chains in the Genus database with same CATH topology
 3L75 E;  2WSC H;  3SWY A;  1SQQ D;  1RE3 A;  2ITA A;  1YTC A;  2C1V A;  2H89 C;  2V7Q H;  4FA5 A;  1CRI A;  2QG4 A;  3TGU E;  2IX7 C;  3EFG A;  3H1J E;  1NTK E;  3VMA A;  5B66 H;  1LP1 B;  2BGV X;  2R5D A;  2H7H A;  5KAI V;  3GHG B;  3GLM A;  3L74 J;  1J1D B;  3AE7 C;  1ZME C;  3AED C;  3EQ2 A;  3KXD A;  1NOH A;  4EDF A;  1N7S A;  5KLI B;  1QLE D;  3JC2 2;  1NTK K;  1FI9 A;  1GU4 A;  3HE4 B;  3ORV A;  1QL4 A;  2D2C D;  2G8Y A;  1S6V B;  5AW9 B;  3HD7 A;  1VF5 B;  2JQR A;  1M90 Q;  5CIB B;  3RN1 A;  1LNQ A;  1N2D C;  1FOS F;  1NTZ E;  4C46 A;  1SQB G;  5AW3 B;  4KMG A;  2C9L Y;  1CCR A;  2C9X B;  2IFM A;  4H0L B;  1CSX A;  2XNX A;  1C6R A;  3JSV C;  1X22 A;  3M0D A;  5APX A;  1KV9 A;  1KQF B;  1DW2 A;  4H44 B;  1CIG A;  1S5L H;  2JWA A;  1YCC A;  1AVO A;  3CCM P;  3TNU A;  5BU5 A;  3RK3 D;  4W7Z A;  3CYT I;  1NTZ K;  1WEJ F;  1VQ6 P;  1BCC G;  4XXL A;  1IQC A;  4AQR D;  1CXA A;  2PCC B;  4HH2 A;  5AVX B;  5KAF V;  1KZU B;  1IFI A;  3L72 J;  1MZ4 A;  1LTT C;  1H8A A;  5KAI E;  2I8F A;  1YIJ P;  2BLF B;  3CLQ A;  4GT1 A;  1KIL B;  1A02 J;  1W2E A;  3USS A;  4YTP C;  4H13 D;  3H1K E;  3W67 A;  2GA1 A;  1CIE A;  2BEZ F;  1RF1 B;  1NAY A;  2SPZ A;  1FI7 A;  3D70 A;  2P1J A;  1NGM B;  2N1T B;  1C75 A;  1KYO D;  2AEJ A;  4TT3 H;  2E75 D;  2QJK C;  3N7N A;  1QKS A;  5C39 A;  1RF0 C;  3OA8 B;  1SQB J;  3H1I G;  1EXJ A;  2PCB B;  2CE1 A;  4Y5R A;  1YIT P;  3ZOW A;  2GIW A;  2L4D A;  4U7J A;  1QEX A;  1S2E A;  4XE5 B;  1T2K D;  5GTH V;  1Y9B A;  1OIP A;  2W8Z A;  2IBZ G;  2OAR A;  2ZYG A;  2AEF A;  5KTB A;  3AE2 C;  2YXR B;  1BE3 D;  4WBA A;  1DW0 A;  4WQ9 A;  5CMZ A;  1CZQ A;  4PJ0 H;  2Y0E A;  4C7R A;  1Q90 D;  3A0B V;  1LTA C;  2Y9Y A;  4BRY B;  2V08 A;  2XDJ A;  1HRC A;  1MV8 A;  1PP9 J;  1H33 B;  3PH0 A;  2FFD C;  2KB7 P;  1CED A;  1KB9 E;  2KP8 A;  2NZ2 A;  2OZ1 B;  3WFD C;  3LIE A;  1G2C A;  5KAF E;  3WU2 H;  2YIU B;  3B4S A;  1K9M Q;  1C7M A;  1C2R A;  5L8R J;  3CCE P;  1L4A C;  1YNR A;  4EID A;  4P4Q B;  3MD0 A;  3OA7 A;  1SQV K;  2O1K A;  1NKZ B;  1ZR2 A;  2HPC A;  1CC5 A;  1SQQ E;  1GQ1 A;  3P8C D;  1VF5 D;  3Q5R A;  1KB9 I;  1JEK A;  1WMK A;  1A8C A;  1FC2 C;  3H1I J;  4N78 D;  2Q3I A;  4PV1 C;  3P7K A;  1CYI A;  3E1I A;  3MGN A;  4KT0 J;  1JUN A;  1CTZ A;  2K9Y A;  1VQM P;  3WMM 0;  4JBZ A;  2ZOO A;  4PD4 H;  1LTB C;  4XYD B;  2OYI A;  2A06 G;  5GTH E;  2YO2 A;  1N73 A;  4N6J A;  1BSH A;  3U1A A;  1CSB A;  3LW5 H;  1IO3 A;  3QWO C;  3L70 J;  3MP7 B;  4C7N A;  3H1H G;  2WTY A;  3HTK A;  1K3G A;  1M56 D;  3A0B E;  1HUC A;  1IRV A;  1NVO A;  2WSE H;  1RE4 A;  5KLV G;  3SWF A;  2ORL A;  3PXS A;  1JMM A;  3L35 A;  3N4X A;  2BCC G;  1CRG A;  2VHD A;  3CC7 P;  1H9Y A;  1JM0 A;  1PPJ D;  3U1C A;  3JCU H;  2Q6Q A;  4Y99 C;  2AXT H;  1NWQ A;  2NPS C;  2LXB A;  2WPR A;  2E5Y A;  3V2Q A;  4OGQ C;  5AW6 B;  3DP5 A;  1L2P A;  2Y0C A;  3GG2 A;  4GDO A;  3OAK A;  1CYC A;  2CA3 B;  5B5E V;  1NH4 A;  1RQV A;  1DVH A;  2ZVN B;  1LWU C;  4PV1 B;  1QL2 A;  1LP1 A;  2ZYA A;  1KD1 Q;  2Q9I A;  3B5N C;  2N1T D;  1KX7 A;  3L71 D;  3GHG A;  1L9B C;  3GF3 A;  3S4R A;  1M70 A;  1JY2 N;  1P84 D;  2BEQ D;  1JTH A;  2PP6 A;  5CCH C;  3PHL A;  1X9V A;  451C A;  1FZC C;  2MKV A;  2A45 I;  5APW A;  2YKQ A;  1N15 A;  1NMI A;  3HD7 B;  1KFN A;  3ZDM A;  4EOT A;  1IK9 A;  1VPC A;  3V4W A;  3H1H J;  3WUT A;  2CPS A;  3H6P A;  4PWA A;  5EFW B;  4LGD E;  1LTJ C;  1YI2 P;  1OW7 A;  5M1B A;  4LC1 A;  2YMK A;  1NML A;  2HG5 D;  5KLV J;  4L74 A;  2QJP C;  5DFS A;  1KYO E;  3NBT A;  2FRC A;  3AE4 C;  1R8E A;  2BCC J;  3PJS K;  3CD6 P;  1NU1 E;  2WSF H;  2R3S A;  1R5S A;  3L37 A;  2WSC J;  1YQ3 C;  1LWU B;  2GUS A;  1SQX G;  1SFC C;  3F89 A;  2V7Q J;  1GD2 E;  4UB6 V;  4DT0 A;  5B5E E;  3L74 D;  2HV4 A;  1N9C A;  1G1I A;  2R44 A;  4K3A A;  3CCS P;  1BE3 E;  1XTC C;  1J2J B;  1NKN A;  1NU1 K;  1KC8 Q;  1KYO I;  1CSU A;  1GK6 A;  4JCG A;  5KJ7 C;  1H89 A;  4M3L A;  3AE5 C;  3WC8 A;  3FWL A;  3CX5 D;  5CJ4 A;  1GU5 A;  1RF1 A;  4WY4 C;  2BH4 X;  4FA9 A;  3O8Z A;  4HJG H;  2N1T A;  1LT1 A;  1MG3 D;  4RES B;  1KTM A;  4LJI A;  1CW5 A;  3OA8 A;  3L4O A;  2ZBO A;  1YTZ I;  3P32 A;  2FXM A;  2HFE D;  2J58 A;  1SVF A;  3P8C E;  4XA4 A;  4ASV A;  4YXW H;  1RZ5 A;  5APT A;  3L73 D;  1AV1 A;  3M9H A;  3M9B A;  1OXZ A;  1L4A D;  1YJN P;  2FXO A;  2D2C B;  1L0N G;  1HCM A;  2K88 A;  3A0H V;  1RQU A;  4N78 E;  1M6Z A;  2IDB A;  2AXC A;  1SQX J;  3MUD C;  1NTM G;  3M0A A;  3K5B A;  2JDI H;  1FI3 A;  1DVV A;  4BRY A;  1K8A Q;  4UB8 V;  2YXQ B;  3L72 D;  1H33 A;  4L73 A;  1GL2 C;  1PZQ A;  3H1L G;  4PV1 D;  4UB6 E;  2OZ1 A;  1G2C B;  2N9I A;  1BGY D;  2ZZS 1;  3WFE C;  1LTS C;  3L75 G;  2BAS A;  1YQ4 C;  5AW5 B;  2NRG A;  1L0L J;  1FHB A;  1FDO A;  2B87 A;  3TGU G;  3X39 A;  2QJY C;  2XZR A;  2ZYD A;  3FWN A;  3U59 A;  2KOG A;  3H1J G;  3G3Z A;  2N9B A;  3IFM A;  2Q1K A;  5AVR B;  1M8O B;  1WT6 A;  1PGJ A;  2Q5U A;  1FZE A;  1OX3 A;  2P67 A;  4H13 B;  1IZL 0;  2JWD A;  3NBS A;  3MTU E;  2NPS D;  1CRY A;  3L71 E;  3RL0 C;  1SQV D;  5CHX A;  2PFX A;  4HB1 A;  1P84 E;  3O20 A;  2KXP B;  5GTI H;  4YE1 A;  1CYJ A;  3A0H E;  1ZR4 A;  2WPS A;  1NTM J;  4C7N B;  4N3Y B;  2YMY A;  1I8O A;  1PP9 D;  1FOC A;  3B5N D;  1FS0 E;  3KDP B;  1DD3 A;  3V2R A;  1YBK A;  4UB8 E;  1EXI A;  3OJA B;  2B0Z B;  5AVW B;  1CXC A;  4WQD A;  3L75 J;  1LT9 B;  1P84 I;  5CCG D;  1RAP A;  5C0Z A;  2PRR A;  2DW3 A;  1NJI Q;  2V4H A;  1YEA A;  3NTN A;  2B88 A;  2B10 B;  3A9F A;  1OCD A;  1GMJ A;  3MK7 C;  4IL6 V;  3H1J J;  1DIQ C;  1VQP P;  3ZCF A;  1TU3 F;  4FA4 A;  4GOE A;  3KYQ A;  3JBT B;  4U3F D;  3H1I D;  1KQG B;  5AW4 B;  3KZI V;  2YO3 A;  1N8R Q;  3TDK A;  1VQ9 P;  3S9O A;  3D6Z A;  3CWB D;  1OVV A;  1JTH B;  5CIG B;  4NPD A;  5TJH A;  3L74 E;  1ZW0 A;  2CE0 A;  4L1Q A;  1VQO P;  1AVY A;  1URQ C;  1SFC D;  3H1K G;  3RK2 B;  5E79 V;  3L70 D;  2WT7 A;  4GKG A;  3FX0 A;  2OYH B;  3Q5S A;  1CSV A;  3CX5 E;  1JMB A;  3AEF C;  2IZ1 A;  5AVQ B;  1VQK P;  3LW5 J;  2N3B A;  351C A;  2NPS A;  5KJ7 D;  4IOI H;  4J20 A;  4YXD C;  2WSE J;  3H32 B;  2IYP A;  3L36 A;  5APS A;  1LWU A;  3C1L A;  4XFJ A;  1Q81 Q;  3L73 E;  3B5N A;  1SQP G;  1S4X A;  3CX5 I;  3NMD A;  1HH7 A;  2O1J A;  1EDL A;  5BVZ A;  4IL6 E;  1M1J C;  2C2C A;  4A7P A;  1HRO A;  3L4F A;  3HUS C;  3KZI E;  2R3C A;  3CXH H;  2HYN A;  5CCG A;  4HKZ H;  3AEB C;  3L72 E;  3R4Y A;  1E29 A;  1GZL A;  2B9B A;  2A06 D;  1GW4 A;  2QM8 A;  2O01 H;  1M60 A;  1BGY E;  2CPB A;  1JDL A;  3H1K J;  1JNM A;  4IFF A;  1SQQ G;  5E79 E;  1GK4 A;  2ZJS E;  1J1E C;  1GL2 D;  1SLQ A;  4MN4 C;  1NU1 D;  3SSU A;  1MKM A;  1CRC A;  2H43 A;  5H2F H;  2P7J A;  2ZVO B;  2CA4 B;  3AEE C;  2HR3 A;  4FA1 A;  1RZ6 A;  2BCC D;  3E7K A;  2HOD B;  4FAV A;  1LC2 A;  1P84 H;  3DR0 A;  1QL1 A;  3BCC D;  3QH9 A;  3I56 P;  1RHZ B;  3PXW A;  3LID A;  3BRT B;  3HRN A;  1KOR A;  4IL6 X;  1EDI A;  4WQA A;  1JY3 N;  4I1L A;  1IFJ A;  2Z5H A;  1BCC J;  1X79 B;  2K3R A;  2WSF J;  1SQP J;  1FCD C;  2N18 C;  1SQV E;  5K5G B;  3AE9 C;  1FBM A;  1SQB K;  4WB4 A;  3A7O A;  5KJ7 A;  4NFG B;  1OFC X;  1EZV D;  1PP9 E;  4RO0 A;  4L75 A;  1U7M A;  3TK1 A;  4MU8 A;  4WQB A;  2YKO A;  3A2A A;  3SVW A;  4DZO A;  1LTI C;  4QMA A;  1DT1 A;  2Q3E A;  1J3S A;  1FDI A;  3VP8 A;  1RY3 A;  2E74 C;  1VQ7 P;  2WSS H;  2LIT A;  2B87 B;  1OMI A;  5DF5 A;  3ABV C;  3TF5 A;  4L76 A;  2QJK B;  3VYM A;  1MZ9 A;  3A5T A;  1SQQ J;  2FWL A;  3RK2 D;  1A02 F;  1CI6 A;  1HTL C;  2E43 A;  2Z5I A;  1N7L A;  2B4Z A;  1HJ0 A;  4GOD A;  4PW9 B;  1JCC A;  1RE3 C;  2KYV A;  2CXB A;  4H0K A;  1PV3 A;  2ZT9 C;  2L91 A;  1BL9 A;  2E76 C;  1M1K Q;  5C9M A;  3CU4 A;  1T3J A;  3MUD A;  4U3F E;  1E8E A;  3H1I E;  3NXS A;  4NPE A;  1QGK B;  3V2P A;  3CWB E;  1SQX D;  3D6Y A;  1OW8 A;  3CX5 H;  2FFD B;  1CO6 A;  1DW1 A;  2C1D A;  3CCQ P;  2KI7 B;  1HH0 A;  1QVF O;  4O1W A;  1N7S C;  1YFC A;  1YEB A;  2J5U A;  1USD A;  1H88 A;  3Q5P A;  2CK3 H;  1L4A B;  1ZLL A;  3L70 E;  4EYY Q;  1LGH B;  2GC7 D;  2D0W A;  3O1Y A;  3ZOY A;  2DGE A;  1L0L D;  1AOF A;  1LT9 A;  1FJ0 A;  1URQ D;  2MHM A;  1OZH A;  4D6T D;  1AQT A;  2R5B A;  4DY9 A;  4IL6 H;  2I8D A;  2FYU G;  3M0D C;  3V5B A;  5KAI H;  3IF4 A;  3SWK A;  2GUV A;  1CTY A;  3AE3 C;  1BE3 G;  3SWS A;  1H9X A;  2RMZ A;  2RH0 A;  1IFD A;  2JO1 A;  3VTP C;  1BDC A;  4AAL A;  5E79 H;  1DEB A;  2WT7 B;  1DH3 A;  2JEE A;  2UWJ E;  2OYH A;  2L5G B;  1YTZ T;  2XV5 A;  3BAS A;  1PFI A;  2A06 E;  2FXP A;  2RN0 A;  1KX2 A;  3SFE C;  1CSW A;  2N9J A;  3RGU A;  5AUR A;  4JQ0 D;  4Y99 B;  2NPS B;  3RBX A;  2ZXY A;  4OGQ B;  3VP9 A;  2Y0D A;  3CCV P;  5AW2 B;  5BU8 B;  2M5A B;  3H32 A;  4BWN A;  4KJM A;  2LXC B;  5APQ A;  1H31 B;  5CIH B;  2N3Y A;  4B86 A;  3CXH W;  4DCK A;  4ZMD A;  3B5N B;  2BCC E;  4JPZ B;  2Z4E A;  2KZI A;  2GC4 D;  1KB9 H;  3BCC E;  3WUU A;  2W27 A;  4GED B;  1S5L V;  5KAF H;  4YPC A;  1Y8A A;  2FYU J;  2FKW B;  1CCH A;  2Q7C A;  5AVV B;  1COR A;  4GYD A;  1JOC A;  3SXT A;  1BE3 J;  5KLV K;  2RKL A;  1LTG C;  2IFN A;  1FZC B;  3G4S P;  1RAQ A;  3IR9 A;  1C6O A;  1URQ A;  1Y47 A;  1OAE A;  1NIR A;  1S3J A;  3P8M C;  3O6Q B;  1COT A;  3O0R C;  1C52 A;  1FZG A;  1GJQ A;  4PD4 D;  1EZV E;  1LTJ B;  2J59 M;  2KLU A;  3VMZ A;  2BPB B;  5EXQ A;  1PPJ G;  1K05 A;  2FBW C;  2QJP B;  1K3H A;  1GW3 A;  3M9Q A;  2KK7 A;  5AVZ B;  3RK3 C;  1ZRT E;  4W80 A;  2W6A A;  1W2L A;  2WPV B;  5TIS V;  1YIQ A;  5GTH H;  2HOD A;  2GB8 B;  2O01 N;  1SFC B;  1USE A;  3R2P A;  3PXT A;  4RJT A;  2BCN B;  3VN0 A;  1HF9 A;  2JKV A;  3L71 G;  4EIJ A;  1EZV I;  2ZON G;  5DJQ C;  3A0B H;  1M1J A;  4WQE A;  4OVN F;  2JR8 A;  2QEX P;  1CRH A;  1F1C A;  3E1R A;  1HZV A;  1SQX E;  1CTJ A;  1X0T A;  1S5L E;  5AVU B;  2OYI C;  3SLE A;  1S1C X;  2E76 D;  4PJ0 V;  1SS1 A;  1VQ5 P;  2P10 A;  4WY4 B;  1N73 C;  1IK7 A;  2A45 H;  1YJW P;  2MJZ A;  4JYB A;  1GDT A;  1EDJ A;  2M3B A;  1CIF A;  1NYH A;  1SQX K;  5CBN A;  1IFP A;  3WU2 V;  1RF0 A;  1DD4 A;  1ZP0 C;  2QVA A;  1L0L E;  2W6J H;  1NHL A;  1OWA A;  1VL2 A;  1CI6 B;  1NTK G;  3PH2 B;  1T2K C;  1SQB D;  2O01 J;  3CX5 W;  1KN7 A;  1WRG A;  4D6T E;  1IZN B;  2Y9Z A;  3A3Y B;  1HZU A;  1FZA A;  1KQS O;  3KHU A;  1L9J C;  1KQL A;  2H8P D;  3VOP A;  2AIU A;  2KLV A;  5TIS E;  4OGQ D;  1L0L K;  5AW8 B;  4ZKP A;  4WWI A;  1L0N J;  3VNW A;  4O9B A;  3L71 J;  4GIF A;  1BCC D;  2C1D B;  2FFD A;  1GL2 B;  1SQP D;  3PLN A;  3GHG C;  2KNC B;  1DIP A;  1J1D C;  1JCD A;  3CP5 A;  1FJP A;  1NTZ G;  3V4Q A;  155C A;  5KLI C;  1KYO H;  4LLH A;  3H1L J;  1L4A A;  2KZJ A;  1I8P A;  5CCH D;  1T8Z A;  2H88 C;  1FZB A;  1ZXG A;  1E5W A;  2QJY B;  4PJ0 E;  1VF5 C;  4N0K A;  4QAO A;  3TGU J;  5B5E H;  4WQC A;  1NTM K;  3L73 G;  1AKK A;  4H0L C;  4BXL A;  1YJ9 P;  2ZXX A;  3WU2 E;  4CPG A;  1B7V A;  1VQ4 P;  1NTK J;  2M0B A;  1CNO A;  2AXT V;  3V2N A;  4AAO A;  3VMX A;  4H44 C;  1D7M A;  3FXD A;  3RL0 B;  5CYT R;  1S9K D;  1AA0 A;  4GOF A;  4R4M A;  3I5C A;  4AAM A;  1N50 A;  1GKS A;  2IBZ D;  3KPE A;  1KV4 A;  1AJY A;  4DJG A;  3L72 G;  2YCC A;  1NAF A;  1I54 A;  4AUW A;  1BGY G;  1YYC A;  1KFM A;  1N90 A;  5CIF B;  2D0S A;  1H0T A;  1NTZ J;  1KIL C;  4PD4 E;  1ETP A;  3VYI A;  5CBO A;  2V07 A;  1HGZ A;  3CME P;  4IFM A;  1RF1 C;  2M5A A;  1R5L A;  1ZOY C;  1H31 A;  1T6A A;  1FE6 A;  3MK7 B;  2N1T C;  4WY4 D;  1SP4 A;  2IPP A;  2PAC A;  3DMI A;  4OWF A;  3GMA A;  1C6S A;  1DII C;  5B6Q A;  1OVU A;  2E5T A;  1HGV A;  4ASW A;  3L73 J;  4UB6 H;  3V6I A;  3GW6 A;  2OTJ P;  3KQG A;  3ITK A;  2KSJ A;  2XKM A;  3IAO A;  1SQV G;  3W68 A;  4PD4 I;  2DVH A;  4R4L A;  5CCH A;  1VQL P;  3JCU E;  2AXT E;  1U75 B;  3CPW O;  1FZC A;  3ZBM A;  1URQ B;  1AQ5 A;  3RLM A;  1LJ2 A;  1PP9 G;  1CRJ A;  1E2R A;  1GIW A;  1JY2 P;  3H25 A;  1VQ8 P;  1FJK A;  3O6Q A;  2QSI A;  1LTJ A;  4AAN A;  3HE5 B;  2KS1 B;  1BGY J;  3H1H D;  4O1Q A;  4HYT B;  2K37 A;  2YIU C;  3C8V A;  3Q1M A;  3T97 B;  5KLV D;  2KIK A;  3BVH A;  1VQN P;  3CCJ P;  3VRD A;  5TIS H;  2C1U A;  3HQ8 A;  2KUB A;  1SQB E;  1SFC A;  1QYZ A;  1H32 B;  3A0H H;  1IC2 A;  4U3F G;  4EI2 A;  2ZXE B;  1HWT C;  3ZOX A;  1CHJ A;  3CWB G;  1M1J B;  2B11 B;  4WQ8 A;  3RMZ A;  4UB8 H;  1YHQ P;  3MZW B;  2FYU D;  3OCD B;  3HUS B;  1SQV J;  1A56 A;  1BCC E;  1Q82 Q;  2YKP A;  1SQP E;  1HVV A;  1M7L A;  3L70 G;  2MTA C;  5CIC B;  3RL0 D;  1R0Q A;  1MG2 D;  4WY4 A;  1HJB A;  1GU2 A;  1C2N A;  2WMM A;  1OW6 A;  1ZZH A;  1Q2N A;  1QVG O;  1J1E B;  2WVR A;  1ZRT D;  5CIE B;  3L4M A;  3WFC C;  2A45 G;  1MFT A;  1SQP K;  2G3A A;  2QRX A;  1HJ5 A;  3WUI A;  1W5C T;  1RH5 B;  1LMS A;  2ZAE B;  2K9J A;  1EB7 A;  2B89 A;  1QN2 A;  2QA4 P;  3ZIY A;  3WFB C;  4Y28 J;  2ZFC A;  1KYO W;  3C2C A;  1I6D A;  3BRV B;  5AW1 B;  5KKZ C;  2N9Y B;  2OTL P;  3CC4 P;  2N18 B;  1K04 A;  4NPF X;  4U3F J;  1S9K E;  3WUV A;  5AW7 B;  3RN0 A;  2YK3 A;  1GL2 A;  3G6E P;  3CWB J;  4WQ7 A;  4H0L D;  1LC1 A;  2KNC A;  2IBZ E;  2QIW A;  1SQQ K;  5CID B;  4ZNC A;  1IFN A;  4FAN A;  1QL3 A;  4H44 D;  2WQY C;  1G1J A;  1DW3 A;  3F5H A;  5GTI V;  3RBZ A;  5APU A;  2E74 B;  3GF7 A;  4KHX A;  1WVE C;  3AEG C;  1W5C E;  1XTG B;  3II6 A;  3HD7 C;  1VDF A;  3HQ7 A;  1NU1 G;  4I6M C;  3CXH D;  3AE1 C;  3D0W A;  2PAJ A;  1IRW A;  2IBZ I;  3B8E B;  1EDK A;  2JJL A;  1CHI A;  1Q86 Q;  2FYN C;  5DJT B;  3BCC G;  2FYZ A;  2ZT9 B;  3KZI H;  3CMA P;  1KIL D;  1X8Y A;  2E76 B;  2W90 A;  5KKZ B;  4H0J A;  1U57 A;  4I2L C;  2FY8 A;  2LR2 A;  5B66 V;  4JYC A;  4RSZ A;  2POH A;  1YIC A;  1L0N D;  3RK3 E;  3CCU P;  1DEE G;  3BAT A;  1NTM D;  3NFQ A;  2XU6 A;  2EXV A;  1N7S B;  1JY3 O;  1I5T A;  3G9R A;  1PGO A;  3I55 P;  1EZV G;  1CHH A;  3M91 A;  1LS9 A;  4JF7 A;  3PTZ A;  5DJU B;  1H0T B;  3O5C A;  1ZV8 A;  3H1L D;  3HE4 A;  1E79 H;  3CCR P;  5CCG C;  1FZF A;  2IZ0 A;  4TLF A;  3H1H E;  1EQ7 A;  3L75 D;  1M57 D;  5GTI E;  1IFM A;  1K73 Q;  1PIX A;  1HJ3 A;  4Z1M H;  1A2S A;  4I7Z C;  2OQQ A;  5KLV E;  1NU1 J;  1W2B O;  5IY5 1;  4W7Y A;  4EIC A;  2FYN B;  2C0W A;  3TGU D;  2E42 A;  3H1J D;  2IYO A;  1UIX A;  1I55 A;  1NTK D;  3D71 A;  3TNU B;  2WZ7 A;  3BCC J;  4K3I A;  3AE6 C;  2D2C C;  2B12 B;  2W83 C;  2FYU E;  1S72 P;  2WPQ A;  3TSI A;  2PGD A;  4AX3 A;  3HQ6 A;  2R32 A;  5APY A;  2C8S A;  1QX8 A;  5B66 E;  2C0X A;  1T3U A;  2AI5 A;  1KIB A;  1FDM A;  1MUU A;  3HE5 A;  2KS1 A;  2W6B A;  1KIL A;  3EFF K;  3CL3 D;  1FU1 A;  3M06 A;  1I6E A;  1L0L G;  4EIE A;  2P58 A;  1UII A;  1MFZ A;  1NTZ D;  2FYU K;  1EC5 A;  3NWV A;  2LKM A;  2P2U A;  3EWK A;  3T97 A;  4AYC A;  3CCL P;  2QM7 A;  4D6T G;  1AFO A;  3Q2Y A;  4I7Z B;  4WVZ A;  4IFD K;  1U74 B;  2BH5 X;  5AVS B;  1H32 A;  2E74 D;  2YQB A;  4L3H A;  3CC2 P;  2XND H;  1GDV A;  2WWW A;  5H2F V;  1N86 A;  2JTI B;  1Z56 A;  5AW0 B;  3SJL A;  2VRS A;  2OYO A;  3OCD A;  3HUS A;  3TYY A;  3PRJ A;  4H13 C;  3M97 X;  5AVT B;  1HBW A;  2XTS B;  1IO4 A;  1JY2 O;  3C9I A;  2JP3 A;  3VMY A;  2ZT9 D;  3B71 A;  3HQ9 A;  2WIT A;  3MIW A;  2OGU A;  3AE8 C;  5AVY B;  1PGQ A;  1AOQ A;  4K35 A;  2LIR A;  2AEM A;  2E75 C;  4V2K A;  1LFM A;  3H1K D;  3Q3D A;  2I1J A;  1ZN5 A;  1HJ4 A;  3TYI A;  2QE7 H;  2M3E A;  1KB0 A;  1RE4 C;  1H1O A;  3RK3 B;  3MHV A;  3AEC C;  1N7S D;  3CI9 A;  3CXH E;  1NO4 A;  3FGA D;  2K9J B;  4OH8 B;  3PP5 A;  3AEA C;  1KMI Z;  2HPC B;  4L3G A;  3FXE A;  1LT9 C;  4D6T J;  1BDD A;  5CJ0 A;  1PPJ E;  4FB1 A;  4Q5P A;  2M8R A;  3UIA A;  5DJQ B;  3HD7 D;  1PGP A;  3L74 G;  1KIL E;  3G71 P;  1GTW A;  4RKU J;  1DX7 A;  2K1A A;  4DOJ A;  1S5L X;  1IJD B;  1JO5 A;  1Q7Y Q;  5H2F E;  1L0N E;  2OTK E;  2YNY A;  2I1K A;  3CXH I;  3OW2 O;  2OYI B;  1OVR A;  1JY3 P;  1U7J A;  1BSN A;  2HLO A;  1NTM E;  1KB9 D;  1N73 B;  2GM4 A;  3S1K A;  1JB0 J;  2E75 B;  5APV A;  1FOS E;  4EIF A;  3IN6 A;  2C9N Y;  1FAV A;  3HTK B;  3RL0 g;  1F1F A;  1VYD A;  2O3J A;  1CIH A;  1NNO A;  1AYG A;  3H1L E;  3RK2 C;  1PL5 A;  3ZOO A;  1L0N K;  3SFD C;  4ZKU A;  2OYH C;  2KSE A; 
#chains in the Genus database with same CATH homology
 1AOF A;  1MG3 D;  1FJ0 A;  5KLV D;  1SQQ D;  4LJI A;  1YTC A;  2C1V A;  2MHM A;  3VRD A;  2C1U A;  3HQ8 A;  4D6T D;  3OA8 A;  3L4O A;  2ZBO A;  4DY9 A;  4FA5 A;  1CRI A;  2QG4 A;  1QYZ A;  1H32 B;  1RZ5 A;  3L73 D;  3ZOX A;  1CHJ A;  3VMA A;  1CTY A;  1HCM A;  2B11 B;  3A0H V;  3SWS A;  1M6Z A;  2BGV X;  1H9X A;  4WQ8 A;  3RMZ A;  5KAI V;  2FYU D;  3OCD B;  1FI3 A;  2RMZ A;  1A56 A;  1DVV A;  4EDF A;  5KLI B;  4UB8 V;  3L72 D;  1H33 A;  4AAL A;  2MTA C;  2OZ1 A;  5CIC B;  1FI9 A;  1R0Q A;  1MG2 D;  2N9I A;  3ORV A;  1GU2 A;  1BGY D;  1QL4 A;  1C2N A;  2ZZS 1;  3WFE C;  1ZZH A;  1S6V B;  2JQR A;  2RN0 A;  1KX2 A;  1ZRT D;  5CIB B;  3RN1 A;  1CSW A;  2N9J A;  1FHB A;  5AUR A;  5CIE B;  3L4M A;  3WFC C;  2ZXY A;  4KMG A;  1CCR A;  2C9X B;  1CSX A;  2Y0D A;  3X39 A;  1C6R A;  1HJ5 A;  3WUI A;  1W5C T;  1LMS A;  1EB7 A;  1H31 B;  5CIH B;  1QN2 A;  2N3Y A;  1KV9 A;  3ZIY A;  3WFB C;  3CXH W;  1DW2 A;  1CIG A;  2JWA A;  1YCC A;  1KYO W;  3C2C A;  1I6D A;  3CYT I;  2GC4 D;  1WEJ F;  2N9Y B;  1IZL 0;  4GED B;  1S5L V;  2N18 B;  3NBS A;  4XXL A;  1IQC A;  1CRY A;  1CCH A;  1SQV D;  3RN0 A;  1CXA A;  2YK3 A;  2PCC B;  4WQ7 A;  1COR A;  4GYD A;  1LC1 A;  3SXT A;  3O20 A;  5KAF V;  4YE1 A;  1CYJ A;  1RAQ A;  5CID B;  1MZ4 A;  1C6O A;  4FAN A;  1QL3 A;  2I8F A;  1I8O A;  1OAE A;  2BLF B;  1PP9 D;  1FOC A;  1NIR A;  1DW3 A;  5GTI V;  1COT A;  3O0R C;  1C52 A;  1GJQ A;  4PD4 D;  1WVE C;  2B0Z B;  2BPB B;  1CIE A;  5EXQ A;  3HQ7 A;  1CXC A;  4WQD A;  1FI7 A;  3CXH D;  2QJP B;  1K3H A;  1C75 A;  1KYO D;  1IRW A;  1RAP A;  5C0Z A;  1CHI A;  1QKS A;  1W2L A;  3OA8 B;  5TIS V;  1YIQ A;  1YEA A;  2GB8 B;  2PCB B;  2CE1 A;  4Y5R A;  2B10 B;  3A9F A;  1OCD A;  3MK7 C;  4IL6 V;  3PXT A;  4RJT A;  2BCN B;  1DIQ C;  3ZOW A;  5KKZ B;  3ZCF A;  4H0J A;  2GIW A;  2L4D A;  4FA4 A;  5GTH V;  3JBT B;  4U3F D;  3H1I D;  2ZON G;  5DJQ C;  3KZI V;  3TDK A;  5B66 V;  4RSZ A;  3CWB D;  1YIC A;  1L0N D;  5CIG B;  4WQE A;  1BE3 D;  1CRH A;  1DW0 A;  1F1C A;  4WQ9 A;  5TJH A;  1HZV A;  1CTJ A;  2Y0E A;  1NTM D;  2CE0 A;  3A0B V;  2EXV A;  1I5T A;  4L1Q A;  2V08 A;  1HRC A;  1H33 B;  1CHH A;  3SLE A;  1LS9 A;  1CED A;  3PTZ A;  4PJ0 V;  3O5C A;  5E79 V;  2OZ1 B;  3WFD C;  3L70 D;  3H1L D;  2YIU B;  1CSV A;  1C7M A;  1C2R A;  1CIF A;  3L75 D;  1YNR A;  4EID A;  4P4Q B;  3WU2 V;  2N3B A;  351C A;  1HJ3 A;  3PH2 B;  1A2S A;  1CC5 A;  1SQB D;  5IY5 1;  3CX5 W;  4J20 A;  4EIC A;  2FYN B;  1GQ1 A;  3TGU D;  3H1J D;  1I55 A;  1HZU A;  1NTK D;  1A8C A;  3KHU A;  1L9J C;  1HH7 A;  2AIU A;  1CYI A;  4K3I A;  1CTZ A;  3VNW A;  2ZOO A;  2B12 B;  1BCC D;  2C2C A;  4XYD B;  2C1D B;  4A7P A;  1HRO A;  1SQP D;  4AX3 A;  3PLN A;  2KNC B;  3HQ6 A;  2C8S A;  3CP5 A;  2AI5 A;  1KIB A;  1IO3 A;  155C A;  1E29 A;  2A06 D;  2KS1 A;  1K3G A;  1M60 A;  1IRV A;  1I8P A;  1I6E A;  4EIE A;  1JDL A;  1NTZ D;  3NWV A;  2QJY B;  2ORL A;  3PXS A;  1CRG A;  4N0K A;  2VHD A;  1H9Y A;  1NU1 D;  1PPJ D;  4QAO A;  1CRC A;  4WQC A;  1U74 B;  2CA4 B;  1AKK A;  2BH5 X;  3DP5 A;  4FA1 A;  1H32 A;  2Y0C A;  3GG2 A;  2YQB A;  4L3H A;  1RZ6 A;  2BCC D;  1B7V A;  1GDV A;  1CYC A;  4FAV A;  1LC2 A;  1CNO A;  2AXT V;  2CA3 B;  3DR0 A;  5B5E V;  5H2F V;  3BCC D;  1DVH A;  4AAO A;  3PXW A;  2JTI B;  5CYT R;  1KX7 A;  3SJL A;  4WQA A;  3L71 D;  4AAM A;  3OCD A;  1L9B C;  1N50 A;  1GKS A;  3PRJ A;  1M70 A;  1P84 D;  2IBZ D;  3M97 X;  1FCD C;  2N18 C;  2XTS B;  2YCC A;  1I54 A;  3PHL A;  3HQ9 A;  451C A;  1AOQ A;  1N90 A;  2LIR A;  5CIF B;  4NFG B;  1N15 A;  4V2K A;  1EZV D;  1NMI A;  2D0S A;  1LFM A;  4MU8 A;  3H1K D;  4WQB A;  3SVW A;  1DT1 A;  1HJ4 A;  2Q3E A;  3TYI A;  1ETP A;  1J3S A;  1KB0 A;  1H1O A;  4PWA A;  2LIT A;  5DF5 A;  2V07 A;  3TF5 A;  2QJK B;  3VYM A;  1NML A;  2K9J B;  1H31 A;  2FWL A;  5DFS A;  3NBT A;  3MK7 B;  4L3G A;  2FRC A;  2B4Z A;  2PAC A;  4PW9 B;  3DMI A;  4FB1 A;  4Q5P A;  1C6S A;  2CXB A;  1DII C;  5B6Q A;  4H0K A;  5DJQ B;  2L91 A;  3GW6 A;  3ITK A;  1BL9 A;  5C9M A;  3CU4 A;  2DVH A;  1E8E A;  4UB6 V;  1U75 B;  3L74 D;  1SQX D;  1N9C A;  2HV4 A;  1CO6 A;  3ZBM A;  1DW1 A;  2C1D A;  3RLM A;  1CSU A;  1CRJ A;  1E2R A;  1GIW A;  1KB9 D;  4O1W A;  4JCG A;  1YFC A;  1YEB A;  3WC8 A;  4EIF A;  3FWL A;  3CX5 D;  1F1F A;  1VYD A;  4AAN A;  2O3J A;  1CIH A;  1NNO A;  3H1H D;  1AYG A;  2GC7 D;  4O1Q A;  3ZOO A;  2D0W A;  2BH4 X;  3O1Y A;  3ZOY A;  4FA9 A;  2DGE A;  1L0L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...