1NTMD

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 50
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntmD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntmD01
1BGYD 1MZ4A 2Y0CA 4AAMA 1CIHA 1H31B 1CRIA 2QJYB 1GJQA 1DVVA 2C9XB 1NTMD 1A56A 2PCBB 1HJ5A 3ZOOA 2C2CA 1CHIA 1YICA 2YQBA 4AAOA 4K3IA 5AURA 4FA9A 1FHBA 1DIQC 1GDVA 2QJKB 2A06D 4H0JA 5DJQB 4FB1A 1I8PA 2AI5A 3WFEC 2K9JB 4WQ8A 1E8EA 1E2RA 1P84D 1CHHA 1KV9A 1QN2A 1BCCD 4FA4A 1PP9D 1CC5A 1OCDA 5TISV 3MK7C 1M6ZA 3ITKA 1CRJA 3SWSA 2B11B 1C75A 1M60A 2C1VA 1WVEC 4XYDB 1AOFA 1IRWA 1CTYA 3TYIA 1EB7A 2YCCA 1E29A 3L73D 2C1DB 3WFDC 2XTSB 1CSVA 1C7MA 1F1FA 1FCDC 1H33A 5CIFB 1HRCA 351CA 1SQPD 4UB8V 4D6TD 1BE3D 4LJIA 3FWLA 1J3SA 1HH7A 1KIBA 1LS9A 1SQQD 4Q5PA 1SQBD 1B7VA 3OCDA 1FOCA 3O0RC 4EICA 3L72D 3O5CA 1CXAA 1C2RA 1DW0A 3A9FA 5IY51 1L9BC 1FI7A 3RMZA 3ZOXA 3OCDB 1NTZD 2N9YB 1MG3D 3L74D 4N0KA 5C9MA 1S6VB 2MTAC 4DY9A 4EDFA 1GIWA 1PPJD 1CTZA 3DP5A 2DGEA 1C6RA 1I8OA 1L0ND 1YFCA 3BCCD 2BCCD 1IO3A 3CX5W 1U74B 2C8SA 2EXVA 5C0ZA 1M70A 1QL3A 1N50A 3H1JD 2LITA 1A8CA 2I8FA 3MK7B 2N3BA 1N90A 1NTKD 1CRYA 1ZRTD 1RZ5A 1CO6A 3H1HD 2V07A 1ETPA 2ZOOA 4O1QA 5KLIB 2PACA 2CA4B 5GTHV 1NMIA 1CRCA 3VNWA 2V08A 2BH4X 3CU4A 3RLMA 5KKZB 3VMAA 3NWVA 2D0WA 1CIFA 2KS1A 1NNOA 3PRJA 1I5TA 3CXHD 2Q3EA 2B0ZB 4L3HA 1KX2A 1AKKA 3ZBMA 1CNOA 4WQBA 2N9JA 2GB8B 1YCCA 3L4MA 1SQVD 2AXTV 2LIRA 2YK3A 4KMGA 1CSWA 1H32A 4WQ7A 2B10B 5B6QA 3CX5D 3ZIYA 1KX7A 4U3FD 2YIUB 5GTIV 1C52A 1CHJA 2DVHA 4P4QB 2CE0A 1C6SA 4J20A 2ORLA 1H32B 3NBTA 3H1ID 1CRGA 1CSXA 4RSZA 1C2NA 1H9XA 5CIBB 4FAVA 3PTZA 4H0KA 1LFMA 1ZZHA 4EIFA 4IL6V 3CWBD 1RAPA 1H1OA 3CP5A 1RZ6A 1U75B 451CA 2OZ1A 1K3GA 1NIRA 3SJLA 2N3YA 1A2SA 3ZOWA 1H33B 5DFSA 4L3GA 2FYUD 2OZ1B 2HV4A 1HZUA 5TJHA 2FRCA 2QG4A 3CXHW 1HJ4A 1FJ0A 4PJ0V 3GG2A 3PLNA 2PCCB 1YEAA 2C1UA 5CIEB 3X39A 1DVHA 1IQCA 4FA1A 1GKSA 1CYJA 1C6OA 1GQ1A 1R0QA 3CYTI 5E79V 2JWAA 3VRDA 1CYIA 2VHDA 2B4ZA 3WUIA 2ZXYA 1LMSA 1CIEA 4A7PA 1I6EA 2RMZA 1HCMA 3SXTA 1DIIC 3DMIA 3HQ9A 3JBTB 2Y0DA 4NFGB 5CYTR 1CIGA 3VYMA 2N9IA 4Y5RA 3PH2B 1DW2A 4YE1A 2GC4D 4WQEA 2KNCB 1S5LV 3KZIV 1NU1D 1KYOW 1IZL0 1CRHA 2MHMA 1FI9A 4WQDA 5B66V 3PXTA 4AX3A 3H1KD 3L70D 3PXSA 1QYZA 1F1CA 3RN1A 2N18C 2BCNB 2FWLA 1DT1A 1K3HA 4AALA 4EIDA 3OA8A 1CSUA 1KB0A 1NMLA 4FANA 1KB9D 4QAOA 5DF5A 1LC2A 2CE1A 2D0SA 1YEBA 1QKSA 3O20A 2O3JA 3RN0A 3OA8B 1AOQA 5CIGB 1L0LD 3A0HV 3WFCC 2ZBOA 4EIEA 3WC8A 1I55A 3ZOYA 1MG2D 3KHUA 2CXBA 4PW9B 3A0BV 1HROA 3HQ7A 2C1DA 4PD4D 1DW1A 2IBZD 1I6DA 1L9JC 2B12B 3TDKA 3SLEA 3C2CA 1CCHA 1FI3A 3ORVA 2L4DA 3L71D 2BH5X 1KYOD 5B5EV 2BGVX 3SVWA 5CICB 1W2LA 1BL9A 1CORA 1I54A 2JQRA 1YTCA 2GIWA 1JDLA 5EXQA 3L4OA 5KAIV 3ZCFA 1SQXD 4RJTA 3HQ6A 155CA 1RAQA 2Y0EA 3DR0A 4JCGA 2QJPB 5KLVD 2GC7D 2ZONG 3H1LD 5DJQC 1VYDA 1AYGA 2N18B 3PHLA 3HQ8A 2ZZS1 4WQCA 4UB6V 4PWAA 2BPBB 1EZVD 2RN0A 2BLFB 3GW6A 4MU8A 1CTJA 1QL4A 3L75D 1YIQA 3TGUD 2JTIB 4O1WA 1CCRA 4V2KA 1W5CT 1HZVA 1OAEA 4L1QA 3NBSA 3M97X 1COTA 1HJ3A 4AANA 3O1YA 4GYDA 2L91A 3WU2V 1H9YA 1WEJF 5CIDB 1YNRA 4FA5A 5H2FV 3PXWA 1CEDA 3TF5A 1IRVA 1DW3A 5KAFV 2FYNB 1LC1A 1CXCA 4WQAA 3WFBC 5CIHB 1H31A 4WQ9A 4GEDB 4XXLA 1N15A 1GU2A 2CA3B 2AIUA 1CYCA 1N9CA
chains in the Genus database with same CATH superfamily
2XU6A 3M9HA 2Y0CA 1FU1A 1CRIA 3VOPA 2QJYB 1VQNP 4UB8E 3H1KJ 3L70J 1DVVA 3H25A 3CCUP 1NTMD 1PV3A 3KXDA 4AAOA 3Q1MA 3VMYA 2QJKB 4H0JA 5DJQB 2JWDA 2NPSD 2AI5A 4WQ8A 1E8EA 3FWNA 1NTZG 4IOIH 4LLHA 1J1DC 4FA4A 2YO3A 3I5CA 4UB6H 4Y99C 3MK7C 3ITKA 1FDOA 3SWSA 2B11B 1WRGA 1C75A 1PPJG 1LTBC 4XYDB 4H0LB 1KMIZ 2ZT9B 4W7YA 5E79E 1L0NG 2YCCA 3CCJP 1NKZB 3FXDA 1CSVA 4DZOA 1IFJA 3GF7A 1NU1K 1F1FA 1H33A 1NTKG 1YJWP 2WTYA 1BE3D 2PFXA 4OWFA 1T2KC 2E74C 1B7VA 1JCCA 4IFFA 1GTWA 1IJDB 4JYCA 3KQGA 1JY3P 3O5CA 2OYHA 1GK4A 1C2RA 1DW0A 2FYZA 3A9FA 5IY51 2K3RA 1USDA 3FGAD 3CLQA 3L35A 5KLVJ 2W6BA 3RK2B 1S6VB 3VTPC 2OYHB 1FZCA 4EDFA 2YXRB 2UWJE 1SLQA 3DP5A 1N8RQ 1LTIC 3TNUA 2DGEA 1C6RA 1YFCA 1BCCG 1SQVG 3RL0C 1FZCB 3CMAP 3AEFC 4OVNF 2W6AA 1E5WA 1YJ9P 2ZXXA 1ZRTD 3A0HE 1CO6A 3OAKA 1L0LE 1ETPA 2KXPB 1VL2A 2CA4B 2JJLA 3CWBG 1CRCA 3VNWA 3LIEA 3CU4A 2R3SA 5KKZB 5BVZA 1QL1A 1HVVA 1N73A 2Z4EA 3H6PA 2R44A 3BRTB 4DOJA 2IX7C 2FFDA 1I5TA 1KQSO 1VQ7P 1BGYJ 2B87A 3M9QA 4WQBA 2FFDB 3IAOA 3VP8A 5M1BA 5BU8B 3L4MA 3EFGA 4PJ0E 4BXLA 3G71P 1QLED 2LIRA 3BRVB 2B87B 4KMGA 1H32A 4U3FD 5GTIV 1JEKA 1CHJA 2DVHA 3W68A 1X0TA 1NO4A 3QWOC 2WSCH 2V4HA 3VMXA 1H32B 1PP9J 1CSXA 3V2RA 4RSZA 1RF0C 1NHLA 3P8CE 4H44B 1RAPA 3CP5A 4XFJA 1RZ6A 1XTGB 1DD4A 2JDIH 1VF5B 1VQMP 1NIRA 3SJLA 3H1HG 1RE4C 2N1TC 1S2EA 2KOGA 1KFNA 5DFSA 2KZIA 5TJHA 4U7JA 2QG4A 1SS1A 1HJ4A 3WU2E 1SQPJ 2RKLA 5H2FE 5CCHD 1OWAA 4JF7A 1SQQJ 1IQCA 1SQBJ 1GKSA 1C6OA 1GQ1A 1R0QA 3L72J 3CYTI 4K35A 1GDTA 1YHQP 3VRDA 5AVUB 1CYIA 1KILE 1RHZB 4NPEA 4TLFA 2B4ZA 2A45I 4H13D 2AXTH 3IF4A 3MHVA 1LMSA 4M3LA 4A7PA 2RMZA 2WVRA 3RK3C 3SXTA 3BCCJ 2BCCJ 3HQ9A 3JBTB 1VQPP 1NYHA 3H1IG 4Y5RA 3CCRP 3B5NA 3D71A 2WSSH 1DEBA 3PH2B 3H1JJ 4WY4A 3MTUE 1DW2A 1ZMEC 1BSNA 5DJTB 2B88A 2A45G 3KZIV 2M3BA 3B5NB 1IZL0 5APXA 2MHMA 4WY4B 5KLVK 3PXTA 5KJ7A 1JB0J 1N7SA 4U3FE 2A45H 2XKMA 3L71G 3H1KD 3L70D 3PXSA 1IFNA 4I6MC 3RN1A 5EFWB 3L73E 3LW5H 3TK1A 4AALA 2WZ7A 1CSUA 3SSUA 2ZAEB 1N7SB 1WMKA 4JBZA 1KB9D 3B71A 3S9OA 3HD7C 2PGDA 2GA1A 3O20A 3RN0A 3AE7C 3H1LG 3V2QA 5CIGB 1LNQA 2BEQD 3FX0A 1Q86Q 1BDDA 1MG2D 3KHUA 1X22A 2CXBA 1OW6A 1PGQA 1GU4A 3L75G 1GL2C 4PD4D 1G1IA 1NTZE 1TU3F 1J2JB 1H89A 2B12B 3C2CA 3MUDA 1PPJE 2E76C 2QE7H 3CC4P 1KYOD 1QVFO 2BGVX 2KSJA 1MZ9A 3JSVC 2D2CD 1I54A 1DD3A 1JDLA 3L37A 3L4OA 2W90A 4RJTA 1ZLLA 1VQ4P 1HGZA 2Y0EA 2Q5UA 4C46A 2FYUJ 3DR0A 3CC2P 1NTKE 1YTZI 2ZFCA 5KLVD 2Y9YA 4KHXA 1NJIQ 3GMAA 2KSEA 4WQCA 1NTMG 2R32A 5C39A 2WSEH 2OQQA 2MJZA 2KP8A 1YIQA 4O1WA 1J1EC 2GUSA 1K05A 3RBXA 1OAEA 4L1QA 4H44C 4DT0A 3O1YA 4GYDA 2L91A 2P7JA 1QVGO 3S1KA 4JYBA 1SQPK 1KB9E 1WEJF 1YNRA 4H0LD 3PXWA 3TSIA 2ZT9D 2XNXA 1SQQK 5AVRB 5GTIE 1DW3A 5KAFV 1SQBK 2FYNB 1SP4A 1RE3A 4JQ0D 1CXCA 4WQAA 5CCGA 3WFBC 4WQ9A 2HODA 1SFCA 3SFEC 1N9CA 2NPSC 3CCLP 1HUCA 1CI6A 2OTLP 1BGYD 3GHGA 4L76A 1FDIA 1MZ4A 4I7ZC 1BE3G 1SFCB 3CWBE 1GJQA 2K9JA 2Q9IA 1OVUA 1CI6B 2PCBB 3GHGB 1HJ5A 3ZOOA 1VQ8P 4IFDK 2YQBA 2A06D 2QRXA 3WFEC 2K9JB 1PL5A 3AE8C 1KYOE 1BSHA 4XA4A 1E2RA 1ZOYC 3KDPB 1KV9A 5AVYB 1PP9D 3RK2D 2QA4P 1M6ZA 1CRJA 4WBAA 4ZKUA 2C1VA 2P1JA 1JMBA 1CTYA 3Q5PA 1EB7A 1BDCA 1E29A 2IFNA 4YPCA 2C1DB 3IFMA 3WFDC 5L8RJ 1IFMA 1C7MA 1HTLC 4QMAA 3OJAB 5H2FH 1FCDC 5CIFB 3C9IA 1X79B 4AQRD 3CCEP 1HRCA 2HLOA 4C7NB 1SQPD 4LJIA 3MIWA 2C9NY 3FWLA 1J3SA 1H0TA 1KIBA 2IYOA 1SQQD 2G8YA 1SQBD 3OCDA 4EICA 2YKQA 2M8RA 3L72D 2G3AA 2L5GB 2H89C 1H0TB 1SQXJ 4I1LA 1L9BC 1FI7A 3KPEA 3OCDB 2N9YB 3L74D 1S3JA 4DY9A 3B8EB 3RK3E 1GIWA 3P8MC 1CTZA 4RESB 1FZGA 1YYCA 4L74A 1I8OA 3BCCD 3UIAA 2BCCD 1U74B 1FAVA 2C8SA 2EXVA 2HFED 2OTJP 2ZJSE 3H1JD 1A8CA 3TGUJ 4U3FG 1N90A 1MFZA 1CRYA 2FYUK 3AE3C 5KLIB 1HJ0A 2K37A 3A7OA 3MD0A 2PACA 5GTHV 5AVTB 1NMIA 2BH4X 4LGDE 1URQA 1VF5D 3C1LA 1UIIA 3T97A 3CXHD 2B0ZB 1ZR2A 1URQB 1KX2A 1AKKA 2WSFJ 2HG5D 1FE6A 3T97B 3ZBMA 1PGPA 2KI7B 3L71E 2GB8B 1ZV8A 1JY2N 2O1KA 1JY2O 5AW5B 5B6QA 3CX5D 2XDJA 1LWUC 1KV4A 2ITAA 2CE0A 1C6SA 1R5LA 1BCCJ 3H1LE 1PIXA 1SQVJ 1H9XA 5AW0B 5CIBB 4FAVA 3MZWB 4H0KA 1ZZHA 4EIFA 4N78E 1U75B 4PV1D 5CCHC 451CA 2OZ1A 1K3GA 3L74E 1EZVE 5AW7B 2FBWC 2PP6A 3L75E 3V5BA 3P7KA 1H33B 1GU5A 1LT9A 1KB9I 2FYUD 1QL2A 2OZ1B 2HV4A 2FRCA 1MFTA 2PRRA 3B5ND 3EQ2A 4D6TJ 1N2DC 1ZXGA 4WY4D 1RF1A 2Q1KA 2C1UA 1LT9B 3X39A 4H13C 5B66H 1FS0E 3H1KG 3N4XA 1RF1B 1Y9BA 5KJ7D 1N7SD 4HYTB 2JP3A 3U1AA 1LTJC 3WUIA 1KB9H 1D7MA 3TNUB 1CIEA 5AVZB 1KYOI 5GTIH 1NTME 2KNCA 1JM0A 1Q90D 1JO5A 2HYNA 3F89A 2H8PD 2W8ZA 1PGOA 2NZ2A 3E1RA 2KK7A 3HUSC 2KNCB 1SQXK 1S5LV 1HGVA 1GW3A 4Z1MH 1NU1D 1KYOW 1CRHA 3H1HJ 4PD4H 4WQDA 5B66V 2V7QJ 3AEBC 1NAFA 2XNDH 3HE5A 1R5SA 2N18C 1N73B 3V6IA 2FWLA 3M06A 5AW1B 1KYOH 4EIDA 4OGQB 3N7NA 4FANA 4QAOA 3HE5B 3M0DC 3USSA 1G2CA 2D0SA 5KLVG 2BASA 3AEEC 2DW3A 1BE3E 3RGUA 1L0NK 3WFCC 1M1JA 1Y47A 5CBNA 1G2CB 5AW9B 1RQUA 3WC8A 3A0BV 1M1JB 3HQ7A 1SVFA 2D2CC 2IBZD 1LTTC 1M1KQ 4W7ZA 1I6DA 2IZ1A 1RH5B 3H1IJ 5AW2B 3CD6P 1M56D 3TDKA 3SLEA 4I2LC 1ZN5A 1CCHA 2L4DA 1OFCX 4GODA 2BH5X 1M7LA 4HH2A 4KT0J 3VN0A 1VQ5P 5CICB 1W2LA 2QJYC 1XTCC 3S4RA 1PZQA 3KZIH 2GIWA 5EXQA 5KAIV 1SQXD 3K5BA 155CA 2AEJA 2M5AA 1L4AA 2LXCB 2OYIA 2QJPB 2NRGA 1ZRTE 1AV1A 2WITA 2QJKC 2ZONG 5DJQC 2QM8A 5GTHE 3Q2YA 2XZRA 1BGYG 1AQTA 5CCGD 2M5AB 1SQVK 1E79H 1SFCD 1Q82Q 1L4AB 2OYIB 2ZZS1 2E75B 1EQ7A 1JOCA 1AVOA 2BPBB 4H0LC 2RN0A 2BLFB 1NU1E 2ZT9C 4MU8A 1QL4A 1LTAC 3TGUD 4PV1B 4XE5B 5APTA 2A06G 1CCRA 2R5BA 2WPRA 2R5DA 1W5CT 1HZVA 5AW3B 3M97X 1PP9G 1HJ3A 4AANA 2YKPA 1AVYA 3PH0A 1OIPA 2E43A 1H9YA 4YXDC 2GM4A 2AEFA 3TF5A 2B9BA 4R4LA 1LP1A 4B86A 1H31A 4GEDB 3PJSK 1YI2P 1CYCA 1EZVI 1LP1B 2OGUA 1SQPG 1H31B 1CZQA 3MGNA 3RK2C 2OYHC 1DEEG 1SQQG 4WB4A 1SQBG 1A56A 2P2UA 2C9LY 2C2CA 1CHIA 5APWA 3AECC 5AURA 1FHBA 3WUTA 4FB1A 3AE9C 2Q7CA 1EDIA 1FZCC 1PGJA 1USEA 1P84D 3G6EP 1BCCD 3U59A 3L74G 1EZVG 1CC5A 1OCDA 1L0LJ 1M60A 3AEGC 2O1JA 3AE6C 1AOFA 3BCCG 1KILA 5CJ0A 3SFDC 3H1JG 5KKZC 1VQ9P 1JNMA 1K73Q 1KILB 1OVRA 3CC7P 4UB8V 4D6TD 5KAFH 1FBMA 1W2BO 1Q81Q 1N73C 2FFDC 3NFQA 4ZMDA 1NVOA 3JCUE 2KUBA 3CX5I 2P10A 1VDFA 2WPSA 1IO4A 5B66E 5C9MA 1IFPA 1URQD 2MTAC 3G9RA 1A02F 3CXHH 1GZLA 2KB7P 4GIFA 1GD2E 1MKMA 4L73A 3H1KE 3L70E 1KQGB 2C0WA 3CX5W 4IFMA 1AQ5A 1N50A 3E7KA 1T8ZA 3D6ZA 1VF5C 1NH4A 3MK7B 1LGHB 1M8OB 3Q5SA 4EOTA 1N7LA 1EC5A 3CX5H 3H1HD 4O1QA 2V08A 4IL6H 1GK6A 2XV5A 3VP9A 3D70A 2ZVOB 1ZW0A 2HODB 1S72P 3NWVA 2KS1A 1NNOA 3RL0g 4PD4E 3G3ZA 2Q3EA 3SWYA 3RBZA 4DCKA 2FYUG 2E74B 1KC8Q 3D0WA 1H88A 2I1JA 3CL3D 2KS1B 4LC1A 2N9JA 2AXCA 4HJGH 2LKMA 3HTKA 2MKVA 4DJGA 3AE1C 5CBOA 2WWWA 2YK3A 1CSWA 5BU5A 4PV1C 4WQ7A 2B10B 2FKWB 5DJUB 1X9VA 2O01J 3HTKB 2YIUB 3Q3DA 2H43A 1RY3A 5KLVE 4J20A 2ORLA 3E1IA 2I8DA 2BEZF 3H1ID 1CRGA 4EIJA 1GW4A 1S4XA 3RL0B 4IL6V 3AE5C 4ZKPA 2M0BA 4U3FJ 3B5NC 4WY4C 1FJPA 1U7JA 1JY2P 3L73J 2OTKE 3AE4C 4GT1A 3V4QA 4R4MA 4CPGA 5GTHH 1HZUA 2FY8A 3M91A 5KJ7C 3Q5RA 1N7SC 2B89A 3L4FA 1NU1G 4PJ0V 3PLNA 2PCCB 2P67A 3KZIE 1DVHA 4JPZB 4FA1A 1L0LK 5CJ4A 1JCDA 1T3UA 5APQA 4OGQD 1G1JA 5APVA 1FZAA 1UIXA 1VQLP 1NTZJ 2IBZI 2VHDA 2WQYC 4HB1A 1BGYE 3OA7A 2ZYAA 3IR9A 1IFDA 1I6EA 4L75A 2OARA 1L0NJ 1RF0A 2HR3A 2FXOA 1CIGA 2N9IA 3CI9A 4EYYQ 2A06E 2IFMA 2GC4D 2YXQB 1S5LX 2HPCA 4WQEA 3MUDC 2IBZG 1RE4A 2N1TA 3CCVP 1NTKJ 2J58A 4GDOA 1PP9E 1LT1A 4Y28J 2IDBA 2POHA 3HRNA 2IZ0A 2HPCB 4GKGA 2N1TB 1QYZA 1F1CA 5B5EH 1FDMA 3OW2O 1K3HA 1W2EA 2W6JH 1QGKB 2H88C 1NMLA 1SQXG 2CE1A 2K88A 1YEBA 1QKSA 1SQPE 1AOQA 2ZVNB 1L0LD 3JC22 5KTBA 1SQQE 1L4AD 1YQ4C 1SQBE 2QSIA 1YQ3C 3AEAC 2E75D 3ZOYA 3L72E 4AUWA 1GMJA 4PW9B 1S1CX 3CPWO 1JMMA 3TGUG 2W27A 3F5HA 2FYNC 3M0AA 1L9JC 3RK3B 2Z5HA 1KN7A 1FI3A 3SWFA 3R2PA 3CWBJ 5B5EV 1RE3C 1WT6A 3BCCE 3QH9A 2BCCE 3SVWA 5CCGC 3JCUH 1SFCC 1S5LH 2CK3H 1BL9A 3LIDA 2JQRA 3H1JE 3ZCFA 1M90Q 3HQ6A 1RAQA 3GHGC 3L70G 5KAFE 1P84I 1VYDA 3HD7A 3GLMA 3P8CD 4PD4I 2WSFH 4UB6V 4PWAA 1N86A 3HD7B 1PFIA 2YIUC 2WSCJ 4HKZH 3CXHE 2JTIB 1K04A 1IK7A 1M57D 1YTZT 1T6AA 4GOFA 1GL2A 1QEXA 1YIJP 1OMIA 4RKUJ 3A5TA 2Z5IA 1P84H 5TISH 3A0BH 5CIDB 1YJNP 4FA5A 1IRVA 1GL2B 1OVVA 1FZBA 1FOSF 3CX5E 2H7HA 3AEDC 1EXJA 4XXLA 2W83C 5CHXA 2E76B 3CCQP 3W67A 1KILD 1Z56A 3V4WA 4IL6E 1DH3A 1VQOP 1NTZK 4AAMA 4D6TG 1CIHA 2WPVB 5KAIH 3B4SA 2AEMA 2C9XB 1OZHA 3G4SP 1YICA 4K3IA 4FA9A 1NKNA 1DIQC 1GDVA 2YKOA 1I8PA 2FYUE 3WUUA 3P32A 1CHHA 1QN2A 2JR8A 5AVQB 3WMM0 4N3YB 5TISV 1NTKK 2KYVA 1JUNA 1WVEC 1FC2C 2J5UA 1HWTC 1HBWA 1IRWA 1JY3N 3TYIA 5KLIC 1J1EB 3EFFK 2KLUA 3L73D 4MN4C 1JY3O 1Y8AA 2XTSB 2PAJA 1KORA 3FXEA 351CA 2WMMA 1DIPA 1CSBA 1EXIA 1URQC 3L71J 3LW5J 1HH7A 2NPSA 1LS9A 4Q5PA 5AW4B 4N6JA 1FOCA 3O0RC 2M3EA 2V7QH 2YMKA 3V2PA 1KZUB 1CXAA 3EWKA 2NPSB 2YO2A 1KD1Q 3RMZA 3ZOXA 1JTHA 1AA0A 4I7ZB 1NTZD 2I1KA 1MG3D 4N0KA 1T2KD 2E74D 3H1LJ 3MP7B 3O8ZA 4WWIA 1PPJD 1JTHB 4AYCA 1L0ND 1S9KD 1IO3A 3L74J 5C0ZA 4NPFX 1M70A 1QL3A 1FZEA 4W80A 1R8EA 3L75J 2LITA 2E5YA 2QVAA 1IK9A 2I8FA 2N3BA 2E5TA 1NTKD 5APYA 3ZDMA 1RZ5A 2V07A 1OXZA 2ZOOA 1T3JA 3RL0D 1OW8A 2IYPA 1W5CE 1OW7A 3RLMA 2KZJA 1LT9C 1U57A 3VMAA 2E42A 5AVVB 4UB8H 2D0WA 1CIFA 4OH8B 3PRJA 2IBZE 3CCMP 1RF1C 3VMZA 4L3HA 4EI2A 1DX7A 3L72G 4BRYA 4BWNA 5B5EE 2VRSA 1CNOA 1NAYA 2WSEJ 1KTMA 1YCCA 5CMZA 5AW8B 2JO1A 1EDJA 1NTMJ 1SQVD 1IZNB 2AXTV 1LTSC 4BRYB 3A3YB 1Q7YQ 1SQXE 3ZIYA 1KX7A 1MUUA 1C52A 5E79H 3R4YA 2QIWA 2GUVA 4P4QB 2BCCG 1K8AQ 3HE4A 3NBTA 3SWKA 3NTNA 1C2NA 2R3CA 1NGMB 4IL6X 3PTZA 1LFMA 3NXSA 3CWBD 3CXHI 1H1OA 4UB6E 1LTGC 5APUA 2ZXEB 3HE4B 4KJMA 2LXBA 2N3YA 1A2SA 4O9BA 3TGUE 4C7RA 1KQFB 3ZOWA 5AVXB 2CPBA 4L3GA 1X8YA 3NMDA 1L0NE 4OGQC 1YBKA 1S9KE 3CXHW 3WUVA 1HJBA 2ZYDA 3M9BA 1FJ0A 1BE3J 1S5LE 3GG2A 3D6YA 5CIEB 1YEAA 2P58A 1LJ2A 3GF3A 3BATA 2N1TD 3C8VA 2SPZA 1CYJA 5E79V 2JWAA 3V2NA 1AFOA 1M1JC 1LWUA 1J1DB 2ZXYA 1VQ6P 2ZYGA 1A02J 3PP5A 1L0LG 4Y99B 1K9MQ 5APSA 1HCMA 3A0HH 1EDKA 1DIIC 3DMIA 1LWUB 2Y0DA 4NFGB 5CYTR 3VYMA 4ASWA 2WT7A 1VQKP 2K1AA 5CCHA 1ZP0C 2C0XA 4YE1A 3TYYA 5TISE 1P84E 3A0BE 3II6A 1BCCE 1OX3A 1SQVE 1VPCA 4WVZA 1HH0A 2QM7A 2WT7B 1FI9A 3RK3D 2QJPC 4AX3A 1HF9A 4ASVA 2YMYA 2BCNB 2Y9ZA 1L4AC 1DT1A 2OYIC 3OA8A 1NU1J 4YXWH 2E75C 1KB0A 3L36A 1FZFA 4PJ0H 5DF5A 1MV8A 1LC2A 5KAIE 2O3JA 4H13B 3OA8B 4D6TE 3U1CA 3CCSP 1LTJA 2LR2A 1ZR4A 3A0HV 2ZBOA 2IPPA 3AE2C 4EIEA 1L2PA 2Q3IA 2K9YA 1I55A 1LTJB 1KFMA 3HD7D 3VYIA 2N9BA 5AVWB 1HROA 2JEEA 2KIKA 2C1DA 1DW1A 3CMEP 4K3AA 2J59M 3O6QA 3HUSA 2KLVA 1U7MA 3BASA 3ORVA 4C7NA 3L71D 4NPDA 2QEXP 3BVHA 3I56P 1IFIA 1Q2NA 3WU2H 3O6QB 1GL2D 1CORA 3HUSB 2WPQA 1YTCA 1NTMK 4RO0A 1H8AA 3H32A 3KYQA 4JCGA 4TT3H 2E76D 2GC7D 1FOSE 3H1LD 2O01N 3I55P 1AYGA 3H1HE 3M0DA 2FXMA 1IC2A 3H32B 2N18B 2CPSA 1RQVA 3PHLA 3HQ8A 4N78D 4YTPC 1EZVD 5AW6B 4GOEA 3GW6A 1CTJA 3L75D 1EDLA 3IN6A 4V2KA 1KQLA 1QX8A 3NBSA 2O01H 1COTA 2RH0A 1KILC 1NWQA 3WU2V 2AXTE 2Q6QA 1NOHA 5H2FV 1AJYA 3A2AA 1CEDA 2YNYA 5K5GB 5AVSB 1CW5A 2D2CB 1YITP 2OYOA 4ZNCA 1LC1A 3L73G 5CIHB 1N15A 1GU2A 2CA3B 2FXPA 1FJKA 2JKVA 2AIUA 4H44D 3ABVC 3H1IE
chains in the Genus database with same CATH topology
1BGYD 1MZ4A 2Y0CA 4AAMA 1CIHA 1H31B 1CRIA 2QJYB 1GJQA 1DVVA 2C9XB 1NTMD 1A56A 2PCBB 1HJ5A 3ZOOA 2C2CA 1CHIA 1YICA 2YQBA 4AAOA 4K3IA 5AURA 4FA9A 1FHBA 1DIQC 1GDVA 2QJKB 2A06D 4H0JA 5DJQB 4FB1A 1I8PA 2AI5A 3WFEC 2K9JB 4WQ8A 1E8EA 1E2RA 1P84D 1CHHA 1KV9A 1QN2A 1BCCD 4FA4A 1PP9D 1CC5A 1OCDA 5TISV 3MK7C 1M6ZA 3ITKA 1CRJA 3SWSA 2B11B 1C75A 1M60A 2C1VA 1WVEC 4XYDB 1AOFA 1IRWA 1CTYA 3TYIA 1EB7A 2YCCA 1E29A 3L73D 2C1DB 3WFDC 2XTSB 1CSVA 1C7MA 1F1FA 1FCDC 1H33A 5CIFB 1HRCA 351CA 1SQPD 4UB8V 4D6TD 1BE3D 4LJIA 3FWLA 1J3SA 1HH7A 1KIBA 1LS9A 1SQQD 4Q5PA 1SQBD 1B7VA 3OCDA 1FOCA 3O0RC 4EICA 3L72D 3O5CA 1CXAA 1C2RA 1DW0A 3A9FA 5IY51 1L9BC 1FI7A 3RMZA 3ZOXA 3OCDB 1NTZD 2N9YB 1MG3D 3L74D 4N0KA 5C9MA 1S6VB 2MTAC 4DY9A 4EDFA 1GIWA 1PPJD 1CTZA 3DP5A 2DGEA 1C6RA 1I8OA 1L0ND 1YFCA 3BCCD 2BCCD 1IO3A 3CX5W 1U74B 2C8SA 2EXVA 5C0ZA 1M70A 1QL3A 1N50A 3H1JD 2LITA 1A8CA 2I8FA 3MK7B 2N3BA 1N90A 1NTKD 1CRYA 1ZRTD 1RZ5A 1CO6A 3H1HD 2V07A 1ETPA 2ZOOA 4O1QA 5KLIB 2PACA 2CA4B 5GTHV 1NMIA 1CRCA 3VNWA 2V08A 2BH4X 3CU4A 3RLMA 5KKZB 3VMAA 3NWVA 2D0WA 1CIFA 2KS1A 1NNOA 3PRJA 1I5TA 3CXHD 2Q3EA 2B0ZB 4L3HA 1KX2A 1AKKA 3ZBMA 1CNOA 4WQBA 2N9JA 2GB8B 1YCCA 3L4MA 1SQVD 2AXTV 2LIRA 2YK3A 4KMGA 1CSWA 1H32A 4WQ7A 2B10B 5B6QA 3CX5D 3ZIYA 1KX7A 4U3FD 2YIUB 5GTIV 1C52A 1CHJA 2DVHA 4P4QB 2CE0A 1C6SA 4J20A 2ORLA 1H32B 3NBTA 3H1ID 1CRGA 1CSXA 4RSZA 1C2NA 1H9XA 5CIBB 4FAVA 3PTZA 4H0KA 1LFMA 1ZZHA 4EIFA 4IL6V 3CWBD 1RAPA 1H1OA 3CP5A 1RZ6A 1U75B 451CA 2OZ1A 1K3GA 1NIRA 3SJLA 2N3YA 1A2SA 3ZOWA 1H33B 5DFSA 4L3GA 2FYUD 2OZ1B 2HV4A 1HZUA 5TJHA 2FRCA 2QG4A 3CXHW 1HJ4A 1FJ0A 4PJ0V 3GG2A 3PLNA 2PCCB 1YEAA 2C1UA 5CIEB 3X39A 1DVHA 1IQCA 4FA1A 1GKSA 1CYJA 1C6OA 1GQ1A 1R0QA 3CYTI 5E79V 2JWAA 3VRDA 1CYIA 2VHDA 2B4ZA 3WUIA 2ZXYA 1LMSA 1CIEA 4A7PA 1I6EA 2RMZA 1HCMA 3SXTA 1DIIC 3DMIA 3HQ9A 3JBTB 2Y0DA 4NFGB 5CYTR 1CIGA 3VYMA 2N9IA 4Y5RA 3PH2B 1DW2A 4YE1A 2GC4D 4WQEA 2KNCB 1S5LV 3KZIV 1NU1D 1KYOW 1IZL0 1CRHA 2MHMA 1FI9A 4WQDA 5B66V 3PXTA 4AX3A 3H1KD 3L70D 3PXSA 1QYZA 1F1CA 3RN1A 2N18C 2BCNB 2FWLA 1DT1A 1K3HA 4AALA 4EIDA 3OA8A 1CSUA 1KB0A 1NMLA 4FANA 1KB9D 4QAOA 5DF5A 1LC2A 2CE1A 2D0SA 1YEBA 1QKSA 3O20A 2O3JA 3RN0A 3OA8B 1AOQA 5CIGB 1L0LD 3A0HV 3WFCC 2ZBOA 4EIEA 3WC8A 1I55A 3ZOYA 1MG2D 3KHUA 2CXBA 4PW9B 3A0BV 1HROA 3HQ7A 2C1DA 4PD4D 1DW1A 2IBZD 1I6DA 1L9JC 2B12B 3TDKA 3SLEA 3C2CA 1CCHA 1FI3A 3ORVA 2L4DA 3L71D 2BH5X 1KYOD 5B5EV 2BGVX 3SVWA 5CICB 1W2LA 1BL9A 1CORA 1I54A 2JQRA 1YTCA 2GIWA 1JDLA 5EXQA 3L4OA 5KAIV 3ZCFA 1SQXD 4RJTA 3HQ6A 155CA 1RAQA 2Y0EA 3DR0A 4JCGA 2QJPB 5KLVD 2GC7D 2ZONG 3H1LD 5DJQC 1VYDA 1AYGA 2N18B 3PHLA 3HQ8A 2ZZS1 4WQCA 4UB6V 4PWAA 2BPBB 1EZVD 2RN0A 2BLFB 3GW6A 4MU8A 1CTJA 1QL4A 3L75D 1YIQA 3TGUD 2JTIB 4O1WA 1CCRA 4V2KA 1W5CT 1HZVA 1OAEA 4L1QA 3NBSA 3M97X 1COTA 1HJ3A 4AANA 3O1YA 4GYDA 2L91A 3WU2V 1H9YA 1WEJF 5CIDB 1YNRA 4FA5A 5H2FV 3PXWA 1CEDA 3TF5A 1IRVA 1DW3A 5KAFV 2FYNB 1LC1A 1CXCA 4WQAA 3WFBC 5CIHB 1H31A 4WQ9A 4GEDB 4XXLA 1N15A 1GU2A 2CA3B 2AIUA 1CYCA 1N9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY D;  1MZ4 A;  2Y0C A;  4AAM A;  1CIH A;  1H31 B;  1CRI A;  2QJY B;  1GJQ A;  1DVV A;  2C9X B;  1NTM D;  1A56 A;  2PCB B;  1HJ5 A;  3ZOO A;  2C2C A;  1CHI A;  1YIC A;  2YQB A;  4AAO A;  4K3I A;  5AUR A;  4FA9 A;  1FHB A;  1DIQ C;  1GDV A;  2QJK B;  2A06 D;  4H0J A;  5DJQ B;  4FB1 A;  1I8P A;  2AI5 A;  3WFE C;  2K9J B;  4WQ8 A;  1E8E A;  1E2R A;  1P84 D;  1CHH A;  1KV9 A;  1QN2 A;  1BCC D;  4FA4 A;  1PP9 D;  1CC5 A;  1OCD A;  5TIS V;  3MK7 C;  1M6Z A;  3ITK A;  1CRJ A;  3SWS A;  2B11 B;  1C75 A;  1M60 A;  2C1V A;  1WVE C;  4XYD B;  1AOF A;  1IRW A;  1CTY A;  3TYI A;  1EB7 A;  2YCC A;  1E29 A;  3L73 D;  2C1D B;  3WFD C;  2XTS B;  1CSV A;  1C7M A;  1F1F A;  1FCD C;  1H33 A;  5CIF B;  1HRC A;  351C A;  1SQP D;  4UB8 V;  4D6T D;  1BE3 D;  4LJI A;  3FWL A;  1J3S A;  1HH7 A;  1KIB A;  1LS9 A;  1SQQ D;  4Q5P A;  1SQB D;  1B7V A;  3OCD A;  1FOC A;  3O0R C;  4EIC A;  3L72 D;  3O5C A;  1CXA A;  1C2R A;  1DW0 A;  3A9F A;  5IY5 1;  1L9B C;  1FI7 A;  3RMZ A;  3ZOX A;  3OCD B;  1NTZ D;  2N9Y B;  1MG3 D;  3L74 D;  4N0K A;  5C9M A;  1S6V B;  2MTA C;  4DY9 A;  4EDF A;  1GIW A;  1PPJ D;  1CTZ A;  3DP5 A;  2DGE A;  1C6R A;  1I8O A;  1L0N D;  1YFC A;  3BCC D;  2BCC D;  1IO3 A;  3CX5 W;  1U74 B;  2C8S A;  2EXV A;  5C0Z A;  1M70 A;  1QL3 A;  1N50 A;  3H1J D;  2LIT A;  1A8C A;  2I8F A;  3MK7 B;  2N3B A;  1N90 A;  1NTK D;  1CRY A;  1ZRT D;  1RZ5 A;  1CO6 A;  3H1H D;  2V07 A;  1ETP A;  2ZOO A;  4O1Q A;  5KLI B;  2PAC A;  2CA4 B;  5GTH V;  1NMI A;  1CRC A;  3VNW A;  2V08 A;  2BH4 X;  3CU4 A;  3RLM A;  5KKZ B;  3VMA A;  3NWV A;  2D0W A;  1CIF A;  2KS1 A;  1NNO A;  3PRJ A;  1I5T A;  3CXH D;  2Q3E A;  2B0Z B;  4L3H A;  1KX2 A;  1AKK A;  3ZBM A;  1CNO A;  4WQB A;  2N9J A;  2GB8 B;  1YCC A;  3L4M A;  1SQV D;  2AXT V;  2LIR A;  2YK3 A;  4KMG A;  1CSW A;  1H32 A;  4WQ7 A;  2B10 B;  5B6Q A;  3CX5 D;  3ZIY A;  1KX7 A;  4U3F D;  2YIU B;  5GTI V;  1C52 A;  1CHJ A;  2DVH A;  4P4Q B;  2CE0 A;  1C6S A;  4J20 A;  2ORL A;  1H32 B;  3NBT A;  3H1I D;  1CRG A;  1CSX A;  4RSZ A;  1C2N A;  1H9X A;  5CIB B;  4FAV A;  3PTZ A;  4H0K A;  1LFM A;  1ZZH A;  4EIF A;  4IL6 V;  3CWB D;  1RAP A;  1H1O A;  3CP5 A;  1RZ6 A;  1U75 B;  451C A;  2OZ1 A;  1K3G A;  1NIR A;  3SJL A;  2N3Y A;  1A2S A;  3ZOW A;  1H33 B;  5DFS A;  4L3G A;  2FYU D;  2OZ1 B;  2HV4 A;  1HZU A;  5TJH A;  2FRC A;  2QG4 A;  3CXH W;  1HJ4 A;  1FJ0 A;  4PJ0 V;  3GG2 A;  3PLN A;  2PCC B;  1YEA A;  2C1U A;  5CIE B;  3X39 A;  1DVH A;  1IQC A;  4FA1 A;  1GKS A;  1CYJ A;  1C6O A;  1GQ1 A;  1R0Q A;  3CYT I;  5E79 V;  2JWA A;  3VRD A;  1CYI A;  2VHD A;  2B4Z A;  3WUI A;  2ZXY A;  1LMS A;  1CIE A;  4A7P A;  1I6E A;  2RMZ A;  1HCM A;  3SXT A;  1DII C;  3DMI A;  3HQ9 A;  3JBT B;  2Y0D A;  4NFG B;  5CYT R;  1CIG A;  3VYM A;  2N9I A;  4Y5R A;  3PH2 B;  1DW2 A;  4YE1 A;  2GC4 D;  4WQE A;  2KNC B;  1S5L V;  3KZI V;  1NU1 D;  1KYO W;  1IZL 0;  1CRH A;  2MHM A;  1FI9 A;  4WQD A;  5B66 V;  3PXT A;  4AX3 A;  3H1K D;  3L70 D;  3PXS A;  1QYZ A;  1F1C A;  3RN1 A;  2N18 C;  2BCN B;  2FWL A;  1DT1 A;  1K3H A;  4AAL A;  4EID A;  3OA8 A;  1CSU A;  1KB0 A;  1NML A;  4FAN A;  1KB9 D;  4QAO A;  5DF5 A;  1LC2 A;  2CE1 A;  2D0S A;  1YEB A;  1QKS A;  3O20 A;  2O3J A;  3RN0 A;  3OA8 B;  1AOQ A;  5CIG B;  1L0L D;  3A0H V;  3WFC C;  2ZBO A;  4EIE A;  3WC8 A;  1I55 A;  3ZOY A;  1MG2 D;  3KHU A;  2CXB A;  4PW9 B;  3A0B V;  1HRO A;  3HQ7 A;  2C1D A;  4PD4 D;  1DW1 A;  2IBZ D;  1I6D A;  1L9J C;  2B12 B;  3TDK A;  3SLE A;  3C2C A;  1CCH A;  1FI3 A;  3ORV A;  2L4D A;  3L71 D;  2BH5 X;  1KYO D;  5B5E V;  2BGV X;  3SVW A;  5CIC B;  1W2L A;  1BL9 A;  1COR A;  1I54 A;  2JQR A;  1YTC A;  2GIW A;  1JDL A;  5EXQ A;  3L4O A;  5KAI V;  3ZCF A;  1SQX D;  4RJT A;  3HQ6 A;  155C A;  1RAQ A;  2Y0E A;  3DR0 A;  4JCG A;  2QJP B;  5KLV D;  2GC7 D;  2ZON G;  3H1L D;  5DJQ C;  1VYD A;  1AYG A;  2N18 B;  3PHL A;  3HQ8 A;  2ZZS 1;  4WQC A;  4UB6 V;  4PWA A;  2BPB B;  1EZV D;  2RN0 A;  2BLF B;  3GW6 A;  4MU8 A;  1CTJ A;  1QL4 A;  3L75 D;  1YIQ A;  3TGU D;  2JTI B;  4O1W A;  1CCR A;  4V2K A;  1W5C T;  1HZV A;  1OAE A;  4L1Q A;  3NBS A;  3M97 X;  1COT A;  1HJ3 A;  4AAN A;  3O1Y A;  4GYD A;  2L91 A;  3WU2 V;  1H9Y A;  1WEJ F;  5CID B;  1YNR A;  4FA5 A;  5H2F V;  3PXW A;  1CED A;  3TF5 A;  1IRV A;  1DW3 A;  5KAF V;  2FYN B;  1LC1 A;  1CXC A;  4WQA A;  3WFB C;  5CIH B;  1H31 A;  4WQ9 A;  4GED B;  4XXL A;  1N15 A;  1GU2 A;  2CA3 B;  2AIU A;  1CYC A;  1N9C A; 
#chains in the Genus database with same CATH topology
 2XU6 A;  3M9H A;  2Y0C A;  1FU1 A;  1CRI A;  3VOP A;  2QJY B;  1VQN P;  4UB8 E;  3H1K J;  3L70 J;  1DVV A;  3H25 A;  3CCU P;  1NTM D;  1PV3 A;  3KXD A;  4AAO A;  3Q1M A;  3VMY A;  2QJK B;  4H0J A;  5DJQ B;  2JWD A;  2NPS D;  2AI5 A;  4WQ8 A;  1E8E A;  3FWN A;  1NTZ G;  4IOI H;  4LLH A;  1J1D C;  4FA4 A;  2YO3 A;  3I5C A;  4UB6 H;  4Y99 C;  3MK7 C;  3ITK A;  1FDO A;  3SWS A;  2B11 B;  1WRG A;  1C75 A;  1PPJ G;  1LTB C;  4XYD B;  4H0L B;  1KMI Z;  2ZT9 B;  4W7Y A;  5E79 E;  1L0N G;  2YCC A;  3CCJ P;  1NKZ B;  3FXD A;  1CSV A;  4DZO A;  1IFJ A;  3GF7 A;  1NU1 K;  1F1F A;  1H33 A;  1NTK G;  1YJW P;  2WTY A;  1BE3 D;  2PFX A;  4OWF A;  1T2K C;  2E74 C;  1B7V A;  1JCC A;  4IFF A;  1GTW A;  1IJD B;  4JYC A;  3KQG A;  1JY3 P;  3O5C A;  2OYH A;  1GK4 A;  1C2R A;  1DW0 A;  2FYZ A;  3A9F A;  5IY5 1;  2K3R A;  1USD A;  3FGA D;  3CLQ A;  3L35 A;  5KLV J;  2W6B A;  3RK2 B;  1S6V B;  3VTP C;  2OYH B;  1FZC A;  4EDF A;  2YXR B;  2UWJ E;  1SLQ A;  3DP5 A;  1N8R Q;  1LTI C;  3TNU A;  2DGE A;  1C6R A;  1YFC A;  1BCC G;  1SQV G;  3RL0 C;  1FZC B;  3CMA P;  3AEF C;  4OVN F;  2W6A A;  1E5W A;  1YJ9 P;  2ZXX A;  1ZRT D;  3A0H E;  1CO6 A;  3OAK A;  1L0L E;  1ETP A;  2KXP B;  1VL2 A;  2CA4 B;  2JJL A;  3CWB G;  1CRC A;  3VNW A;  3LIE A;  3CU4 A;  2R3S A;  5KKZ B;  5BVZ A;  1QL1 A;  1HVV A;  1N73 A;  2Z4E A;  3H6P A;  2R44 A;  3BRT B;  4DOJ A;  2IX7 C;  2FFD A;  1I5T A;  1KQS O;  1VQ7 P;  1BGY J;  2B87 A;  3M9Q A;  4WQB A;  2FFD B;  3IAO A;  3VP8 A;  5M1B A;  5BU8 B;  3L4M A;  3EFG A;  4PJ0 E;  4BXL A;  3G71 P;  1QLE D;  2LIR A;  3BRV B;  2B87 B;  4KMG A;  1H32 A;  4U3F D;  5GTI V;  1JEK A;  1CHJ A;  2DVH A;  3W68 A;  1X0T A;  1NO4 A;  3QWO C;  2WSC H;  2V4H A;  3VMX A;  1H32 B;  1PP9 J;  1CSX A;  3V2R A;  4RSZ A;  1RF0 C;  1NHL A;  3P8C E;  4H44 B;  1RAP A;  3CP5 A;  4XFJ A;  1RZ6 A;  1XTG B;  1DD4 A;  2JDI H;  1VF5 B;  1VQM P;  1NIR A;  3SJL A;  3H1H G;  1RE4 C;  2N1T C;  1S2E A;  2KOG A;  1KFN A;  5DFS A;  2KZI A;  5TJH A;  4U7J A;  2QG4 A;  1SS1 A;  1HJ4 A;  3WU2 E;  1SQP J;  2RKL A;  5H2F E;  5CCH D;  1OWA A;  4JF7 A;  1SQQ J;  1IQC A;  1SQB J;  1GKS A;  1C6O A;  1GQ1 A;  1R0Q A;  3L72 J;  3CYT I;  4K35 A;  1GDT A;  1YHQ P;  3VRD A;  5AVU B;  1CYI A;  1KIL E;  1RHZ B;  4NPE A;  4TLF A;  2B4Z A;  2A45 I;  4H13 D;  2AXT H;  3IF4 A;  3MHV A;  1LMS A;  4M3L A;  4A7P A;  2RMZ A;  2WVR A;  3RK3 C;  3SXT A;  3BCC J;  2BCC J;  3HQ9 A;  3JBT B;  1VQP P;  1NYH A;  3H1I G;  4Y5R A;  3CCR P;  3B5N A;  3D71 A;  2WSS H;  1DEB A;  3PH2 B;  3H1J J;  4WY4 A;  3MTU E;  1DW2 A;  1ZME C;  1BSN A;  5DJT B;  2B88 A;  2A45 G;  3KZI V;  2M3B A;  3B5N B;  1IZL 0;  5APX A;  2MHM A;  4WY4 B;  5KLV K;  3PXT A;  5KJ7 A;  1JB0 J;  1N7S A;  4U3F E;  2A45 H;  2XKM A;  3L71 G;  3H1K D;  3L70 D;  3PXS A;  1IFN A;  4I6M C;  3RN1 A;  5EFW B;  3L73 E;  3LW5 H;  3TK1 A;  4AAL A;  2WZ7 A;  1CSU A;  3SSU A;  2ZAE B;  1N7S B;  1WMK A;  4JBZ A;  1KB9 D;  3B71 A;  3S9O A;  3HD7 C;  2PGD A;  2GA1 A;  3O20 A;  3RN0 A;  3AE7 C;  3H1L G;  3V2Q A;  5CIG B;  1LNQ A;  2BEQ D;  3FX0 A;  1Q86 Q;  1BDD A;  1MG2 D;  3KHU A;  1X22 A;  2CXB A;  1OW6 A;  1PGQ A;  1GU4 A;  3L75 G;  1GL2 C;  4PD4 D;  1G1I A;  1NTZ E;  1TU3 F;  1J2J B;  1H89 A;  2B12 B;  3C2C A;  3MUD A;  1PPJ E;  2E76 C;  2QE7 H;  3CC4 P;  1KYO D;  1QVF O;  2BGV X;  2KSJ A;  1MZ9 A;  3JSV C;  2D2C D;  1I54 A;  1DD3 A;  1JDL A;  3L37 A;  3L4O A;  2W90 A;  4RJT A;  1ZLL A;  1VQ4 P;  1HGZ A;  2Y0E A;  2Q5U A;  4C46 A;  2FYU J;  3DR0 A;  3CC2 P;  1NTK E;  1YTZ I;  2ZFC A;  5KLV D;  2Y9Y A;  4KHX A;  1NJI Q;  3GMA A;  2KSE A;  4WQC A;  1NTM G;  2R32 A;  5C39 A;  2WSE H;  2OQQ A;  2MJZ A;  2KP8 A;  1YIQ A;  4O1W A;  1J1E C;  2GUS A;  1K05 A;  3RBX A;  1OAE A;  4L1Q A;  4H44 C;  4DT0 A;  3O1Y A;  4GYD A;  2L91 A;  2P7J A;  1QVG O;  3S1K A;  4JYB A;  1SQP K;  1KB9 E;  1WEJ F;  1YNR A;  4H0L D;  3PXW A;  3TSI A;  2ZT9 D;  2XNX A;  1SQQ K;  5AVR B;  5GTI E;  1DW3 A;  5KAF V;  1SQB K;  2FYN B;  1SP4 A;  1RE3 A;  4JQ0 D;  1CXC A;  4WQA A;  5CCG A;  3WFB C;  4WQ9 A;  2HOD A;  1SFC A;  3SFE C;  1N9C A;  2NPS C;  3CCL P;  1HUC A;  1CI6 A;  2OTL P;  1BGY D;  3GHG A;  4L76 A;  1FDI A;  1MZ4 A;  4I7Z C;  1BE3 G;  1SFC B;  3CWB E;  1GJQ A;  2K9J A;  2Q9I A;  1OVU A;  1CI6 B;  2PCB B;  3GHG B;  1HJ5 A;  3ZOO A;  1VQ8 P;  4IFD K;  2YQB A;  2A06 D;  2QRX A;  3WFE C;  2K9J B;  1PL5 A;  3AE8 C;  1KYO E;  1BSH A;  4XA4 A;  1E2R A;  1ZOY C;  3KDP B;  1KV9 A;  5AVY B;  1PP9 D;  3RK2 D;  2QA4 P;  1M6Z A;  1CRJ A;  4WBA A;  4ZKU A;  2C1V A;  2P1J A;  1JMB A;  1CTY A;  3Q5P A;  1EB7 A;  1BDC A;  1E29 A;  2IFN A;  4YPC A;  2C1D B;  3IFM A;  3WFD C;  5L8R J;  1IFM A;  1C7M A;  1HTL C;  4QMA A;  3OJA B;  5H2F H;  1FCD C;  5CIF B;  3C9I A;  1X79 B;  4AQR D;  3CCE P;  1HRC A;  2HLO A;  4C7N B;  1SQP D;  4LJI A;  3MIW A;  2C9N Y;  3FWL A;  1J3S A;  1H0T A;  1KIB A;  2IYO A;  1SQQ D;  2G8Y A;  1SQB D;  3OCD A;  4EIC A;  2YKQ A;  2M8R A;  3L72 D;  2G3A A;  2L5G B;  2H89 C;  1H0T B;  1SQX J;  4I1L A;  1L9B C;  1FI7 A;  3KPE A;  3OCD B;  2N9Y B;  3L74 D;  1S3J A;  4DY9 A;  3B8E B;  3RK3 E;  1GIW A;  3P8M C;  1CTZ A;  4RES B;  1FZG A;  1YYC A;  4L74 A;  1I8O A;  3BCC D;  3UIA A;  2BCC D;  1U74 B;  1FAV A;  2C8S A;  2EXV A;  2HFE D;  2OTJ P;  2ZJS E;  3H1J D;  1A8C A;  3TGU J;  4U3F G;  1N90 A;  1MFZ A;  1CRY A;  2FYU K;  3AE3 C;  5KLI B;  1HJ0 A;  2K37 A;  3A7O A;  3MD0 A;  2PAC A;  5GTH V;  5AVT B;  1NMI A;  2BH4 X;  4LGD E;  1URQ A;  1VF5 D;  3C1L A;  1UII A;  3T97 A;  3CXH D;  2B0Z B;  1ZR2 A;  1URQ B;  1KX2 A;  1AKK A;  2WSF J;  2HG5 D;  1FE6 A;  3T97 B;  3ZBM A;  1PGP A;  2KI7 B;  3L71 E;  2GB8 B;  1ZV8 A;  1JY2 N;  2O1K A;  1JY2 O;  5AW5 B;  5B6Q A;  3CX5 D;  2XDJ A;  1LWU C;  1KV4 A;  2ITA A;  2CE0 A;  1C6S A;  1R5L A;  1BCC J;  3H1L E;  1PIX A;  1SQV J;  1H9X A;  5AW0 B;  5CIB B;  4FAV A;  3MZW B;  4H0K A;  1ZZH A;  4EIF A;  4N78 E;  1U75 B;  4PV1 D;  5CCH C;  451C A;  2OZ1 A;  1K3G A;  3L74 E;  1EZV E;  5AW7 B;  2FBW C;  2PP6 A;  3L75 E;  3V5B A;  3P7K A;  1H33 B;  1GU5 A;  1LT9 A;  1KB9 I;  2FYU D;  1QL2 A;  2OZ1 B;  2HV4 A;  2FRC A;  1MFT A;  2PRR A;  3B5N D;  3EQ2 A;  4D6T J;  1N2D C;  1ZXG A;  4WY4 D;  1RF1 A;  2Q1K A;  2C1U A;  1LT9 B;  3X39 A;  4H13 C;  5B66 H;  1FS0 E;  3H1K G;  3N4X A;  1RF1 B;  1Y9B A;  5KJ7 D;  1N7S D;  4HYT B;  2JP3 A;  3U1A A;  1LTJ C;  3WUI A;  1KB9 H;  1D7M A;  3TNU B;  1CIE A;  5AVZ B;  1KYO I;  5GTI H;  1NTM E;  2KNC A;  1JM0 A;  1Q90 D;  1JO5 A;  2HYN A;  3F89 A;  2H8P D;  2W8Z A;  1PGO A;  2NZ2 A;  3E1R A;  2KK7 A;  3HUS C;  2KNC B;  1SQX K;  1S5L V;  1HGV A;  1GW3 A;  4Z1M H;  1NU1 D;  1KYO W;  1CRH A;  3H1H J;  4PD4 H;  4WQD A;  5B66 V;  2V7Q J;  3AEB C;  1NAF A;  2XND H;  3HE5 A;  1R5S A;  2N18 C;  1N73 B;  3V6I A;  2FWL A;  3M06 A;  5AW1 B;  1KYO H;  4EID A;  4OGQ B;  3N7N A;  4FAN A;  4QAO A;  3HE5 B;  3M0D C;  3USS A;  1G2C A;  2D0S A;  5KLV G;  2BAS A;  3AEE C;  2DW3 A;  1BE3 E;  3RGU A;  1L0N K;  3WFC C;  1M1J A;  1Y47 A;  5CBN A;  1G2C B;  5AW9 B;  1RQU A;  3WC8 A;  3A0B V;  1M1J B;  3HQ7 A;  1SVF A;  2D2C C;  2IBZ D;  1LTT C;  1M1K Q;  4W7Z A;  1I6D A;  2IZ1 A;  1RH5 B;  3H1I J;  5AW2 B;  3CD6 P;  1M56 D;  3TDK A;  3SLE A;  4I2L C;  1ZN5 A;  1CCH A;  2L4D A;  1OFC X;  4GOD A;  2BH5 X;  1M7L A;  4HH2 A;  4KT0 J;  3VN0 A;  1VQ5 P;  5CIC B;  1W2L A;  2QJY C;  1XTC C;  3S4R A;  1PZQ A;  3KZI H;  2GIW A;  5EXQ A;  5KAI V;  1SQX D;  3K5B A;  155C A;  2AEJ A;  2M5A A;  1L4A A;  2LXC B;  2OYI A;  2QJP B;  2NRG A;  1ZRT E;  1AV1 A;  2WIT A;  2QJK C;  2ZON G;  5DJQ C;  2QM8 A;  5GTH E;  3Q2Y A;  2XZR A;  1BGY G;  1AQT A;  5CCG D;  2M5A B;  1SQV K;  1E79 H;  1SFC D;  1Q82 Q;  1L4A B;  2OYI B;  2ZZS 1;  2E75 B;  1EQ7 A;  1JOC A;  1AVO A;  2BPB B;  4H0L C;  2RN0 A;  2BLF B;  1NU1 E;  2ZT9 C;  4MU8 A;  1QL4 A;  1LTA C;  3TGU D;  4PV1 B;  4XE5 B;  5APT A;  2A06 G;  1CCR A;  2R5B A;  2WPR A;  2R5D A;  1W5C T;  1HZV A;  5AW3 B;  3M97 X;  1PP9 G;  1HJ3 A;  4AAN A;  2YKP A;  1AVY A;  3PH0 A;  1OIP A;  2E43 A;  1H9Y A;  4YXD C;  2GM4 A;  2AEF A;  3TF5 A;  2B9B A;  4R4L A;  1LP1 A;  4B86 A;  1H31 A;  4GED B;  3PJS K;  1YI2 P;  1CYC A;  1EZV I;  1LP1 B;  2OGU A;  1SQP G;  1H31 B;  1CZQ A;  3MGN A;  3RK2 C;  2OYH C;  1DEE G;  1SQQ G;  4WB4 A;  1SQB G;  1A56 A;  2P2U A;  2C9L Y;  2C2C A;  1CHI A;  5APW A;  3AEC C;  5AUR A;  1FHB A;  3WUT A;  4FB1 A;  3AE9 C;  2Q7C A;  1EDI A;  1FZC C;  1PGJ A;  1USE A;  1P84 D;  3G6E P;  1BCC D;  3U59 A;  3L74 G;  1EZV G;  1CC5 A;  1OCD A;  1L0L J;  1M60 A;  3AEG C;  2O1J A;  3AE6 C;  1AOF A;  3BCC G;  1KIL A;  5CJ0 A;  3SFD C;  3H1J G;  5KKZ C;  1VQ9 P;  1JNM A;  1K73 Q;  1KIL B;  1OVR A;  3CC7 P;  4UB8 V;  4D6T D;  5KAF H;  1FBM A;  1W2B O;  1Q81 Q;  1N73 C;  2FFD C;  3NFQ A;  4ZMD A;  1NVO A;  3JCU E;  2KUB A;  3CX5 I;  2P10 A;  1VDF A;  2WPS A;  1IO4 A;  5B66 E;  5C9M A;  1IFP A;  1URQ D;  2MTA C;  3G9R A;  1A02 F;  3CXH H;  1GZL A;  2KB7 P;  4GIF A;  1GD2 E;  1MKM A;  4L73 A;  3H1K E;  3L70 E;  1KQG B;  2C0W A;  3CX5 W;  4IFM A;  1AQ5 A;  1N50 A;  3E7K A;  1T8Z A;  3D6Z A;  1VF5 C;  1NH4 A;  3MK7 B;  1LGH B;  1M8O B;  3Q5S A;  4EOT A;  1N7L A;  1EC5 A;  3CX5 H;  3H1H D;  4O1Q A;  2V08 A;  4IL6 H;  1GK6 A;  2XV5 A;  3VP9 A;  3D70 A;  2ZVO B;  1ZW0 A;  2HOD B;  1S72 P;  3NWV A;  2KS1 A;  1NNO A;  3RL0 g;  4PD4 E;  3G3Z A;  2Q3E A;  3SWY A;  3RBZ A;  4DCK A;  2FYU G;  2E74 B;  1KC8 Q;  3D0W A;  1H88 A;  2I1J A;  3CL3 D;  2KS1 B;  4LC1 A;  2N9J A;  2AXC A;  4HJG H;  2LKM A;  3HTK A;  2MKV A;  4DJG A;  3AE1 C;  5CBO A;  2WWW A;  2YK3 A;  1CSW A;  5BU5 A;  4PV1 C;  4WQ7 A;  2B10 B;  2FKW B;  5DJU B;  1X9V A;  2O01 J;  3HTK B;  2YIU B;  3Q3D A;  2H43 A;  1RY3 A;  5KLV E;  4J20 A;  2ORL A;  3E1I A;  2I8D A;  2BEZ F;  3H1I D;  1CRG A;  4EIJ A;  1GW4 A;  1S4X A;  3RL0 B;  4IL6 V;  3AE5 C;  4ZKP A;  2M0B A;  4U3F J;  3B5N C;  4WY4 C;  1FJP A;  1U7J A;  1JY2 P;  3L73 J;  2OTK E;  3AE4 C;  4GT1 A;  3V4Q A;  4R4M A;  4CPG A;  5GTH H;  1HZU A;  2FY8 A;  3M91 A;  5KJ7 C;  3Q5R A;  1N7S C;  2B89 A;  3L4F A;  1NU1 G;  4PJ0 V;  3PLN A;  2PCC B;  2P67 A;  3KZI E;  1DVH A;  4JPZ B;  4FA1 A;  1L0L K;  5CJ4 A;  1JCD A;  1T3U A;  5APQ A;  4OGQ D;  1G1J A;  5APV A;  1FZA A;  1UIX A;  1VQL P;  1NTZ J;  2IBZ I;  2VHD A;  2WQY C;  4HB1 A;  1BGY E;  3OA7 A;  2ZYA A;  3IR9 A;  1IFD A;  1I6E A;  4L75 A;  2OAR A;  1L0N J;  1RF0 A;  2HR3 A;  2FXO A;  1CIG A;  2N9I A;  3CI9 A;  4EYY Q;  2A06 E;  2IFM A;  2GC4 D;  2YXQ B;  1S5L X;  2HPC A;  4WQE A;  3MUD C;  2IBZ G;  1RE4 A;  2N1T A;  3CCV P;  1NTK J;  2J58 A;  4GDO A;  1PP9 E;  1LT1 A;  4Y28 J;  2IDB A;  2POH A;  3HRN A;  2IZ0 A;  2HPC B;  4GKG A;  2N1T B;  1QYZ A;  1F1C A;  5B5E H;  1FDM A;  3OW2 O;  1K3H A;  1W2E A;  2W6J H;  1QGK B;  2H88 C;  1NML A;  1SQX G;  2CE1 A;  2K88 A;  1YEB A;  1QKS A;  1SQP E;  1AOQ A;  2ZVN B;  1L0L D;  3JC2 2;  5KTB A;  1SQQ E;  1L4A D;  1YQ4 C;  1SQB E;  2QSI A;  1YQ3 C;  3AEA C;  2E75 D;  3ZOY A;  3L72 E;  4AUW A;  1GMJ A;  4PW9 B;  1S1C X;  3CPW O;  1JMM A;  3TGU G;  2W27 A;  3F5H A;  2FYN C;  3M0A A;  1L9J C;  3RK3 B;  2Z5H A;  1KN7 A;  1FI3 A;  3SWF A;  3R2P A;  3CWB J;  5B5E V;  1RE3 C;  1WT6 A;  3BCC E;  3QH9 A;  2BCC E;  3SVW A;  5CCG C;  3JCU H;  1SFC C;  1S5L H;  2CK3 H;  1BL9 A;  3LID A;  2JQR A;  3H1J E;  3ZCF A;  1M90 Q;  3HQ6 A;  1RAQ A;  3GHG C;  3L70 G;  5KAF E;  1P84 I;  1VYD A;  3HD7 A;  3GLM A;  3P8C D;  4PD4 I;  2WSF H;  4UB6 V;  4PWA A;  1N86 A;  3HD7 B;  1PFI A;  2YIU C;  2WSC J;  4HKZ H;  3CXH E;  2JTI B;  1K04 A;  1IK7 A;  1M57 D;  1YTZ T;  1T6A A;  4GOF A;  1GL2 A;  1QEX A;  1YIJ P;  1OMI A;  4RKU J;  3A5T A;  2Z5I A;  1P84 H;  5TIS H;  3A0B H;  5CID B;  1YJN P;  4FA5 A;  1IRV A;  1GL2 B;  1OVV A;  1FZB A;  1FOS F;  3CX5 E;  2H7H A;  3AED C;  1EXJ A;  4XXL A;  2W83 C;  5CHX A;  2E76 B;  3CCQ P;  3W67 A;  1KIL D;  1Z56 A;  3V4W A;  4IL6 E;  1DH3 A;  1VQO P;  1NTZ K;  4AAM A;  4D6T G;  1CIH A;  2WPV B;  5KAI H;  3B4S A;  2AEM A;  2C9X B;  1OZH A;  3G4S P;  1YIC A;  4K3I A;  4FA9 A;  1NKN A;  1DIQ C;  1GDV A;  2YKO A;  1I8P A;  2FYU E;  3WUU A;  3P32 A;  1CHH A;  1QN2 A;  2JR8 A;  5AVQ B;  3WMM 0;  4N3Y B;  5TIS V;  1NTK K;  2KYV A;  1JUN A;  1WVE C;  1FC2 C;  2J5U A;  1HWT C;  1HBW A;  1IRW A;  1JY3 N;  3TYI A;  5KLI C;  1J1E B;  3EFF K;  2KLU A;  3L73 D;  4MN4 C;  1JY3 O;  1Y8A A;  2XTS B;  2PAJ A;  1KOR A;  3FXE A;  351C A;  2WMM A;  1DIP A;  1CSB A;  1EXI A;  1URQ C;  3L71 J;  3LW5 J;  1HH7 A;  2NPS A;  1LS9 A;  4Q5P A;  5AW4 B;  4N6J A;  1FOC A;  3O0R C;  2M3E A;  2V7Q H;  2YMK A;  3V2P A;  1KZU B;  1CXA A;  3EWK A;  2NPS B;  2YO2 A;  1KD1 Q;  3RMZ A;  3ZOX A;  1JTH A;  1AA0 A;  4I7Z B;  1NTZ D;  2I1K A;  1MG3 D;  4N0K A;  1T2K D;  2E74 D;  3H1L J;  3MP7 B;  3O8Z A;  4WWI A;  1PPJ D;  1JTH B;  4AYC A;  1L0N D;  1S9K D;  1IO3 A;  3L74 J;  5C0Z A;  4NPF X;  1M70 A;  1QL3 A;  1FZE A;  4W80 A;  1R8E A;  3L75 J;  2LIT A;  2E5Y A;  2QVA A;  1IK9 A;  2I8F A;  2N3B A;  2E5T A;  1NTK D;  5APY A;  3ZDM A;  1RZ5 A;  2V07 A;  1OXZ A;  2ZOO A;  1T3J A;  3RL0 D;  1OW8 A;  2IYP A;  1W5C E;  1OW7 A;  3RLM A;  2KZJ A;  1LT9 C;  1U57 A;  3VMA A;  2E42 A;  5AVV B;  4UB8 H;  2D0W A;  1CIF A;  4OH8 B;  3PRJ A;  2IBZ E;  3CCM P;  1RF1 C;  3VMZ A;  4L3H A;  4EI2 A;  1DX7 A;  3L72 G;  4BRY A;  4BWN A;  5B5E E;  2VRS A;  1CNO A;  1NAY A;  2WSE J;  1KTM A;  1YCC A;  5CMZ A;  5AW8 B;  2JO1 A;  1EDJ A;  1NTM J;  1SQV D;  1IZN B;  2AXT V;  1LTS C;  4BRY B;  3A3Y B;  1Q7Y Q;  1SQX E;  3ZIY A;  1KX7 A;  1MUU A;  1C52 A;  5E79 H;  3R4Y A;  2QIW A;  2GUV A;  4P4Q B;  2BCC G;  1K8A Q;  3HE4 A;  3NBT A;  3SWK A;  3NTN A;  1C2N A;  2R3C A;  1NGM B;  4IL6 X;  3PTZ A;  1LFM A;  3NXS A;  3CWB D;  3CXH I;  1H1O A;  4UB6 E;  1LTG C;  5APU A;  2ZXE B;  3HE4 B;  4KJM A;  2LXB A;  2N3Y A;  1A2S A;  4O9B A;  3TGU E;  4C7R A;  1KQF B;  3ZOW A;  5AVX B;  2CPB A;  4L3G A;  1X8Y A;  3NMD A;  1L0N E;  4OGQ C;  1YBK A;  1S9K E;  3CXH W;  3WUV A;  1HJB A;  2ZYD A;  3M9B A;  1FJ0 A;  1BE3 J;  1S5L E;  3GG2 A;  3D6Y A;  5CIE B;  1YEA A;  2P58 A;  1LJ2 A;  3GF3 A;  3BAT A;  2N1T D;  3C8V A;  2SPZ A;  1CYJ A;  5E79 V;  2JWA A;  3V2N A;  1AFO A;  1M1J C;  1LWU A;  1J1D B;  2ZXY A;  1VQ6 P;  2ZYG A;  1A02 J;  3PP5 A;  1L0L G;  4Y99 B;  1K9M Q;  5APS A;  1HCM A;  3A0H H;  1EDK A;  1DII C;  3DMI A;  1LWU B;  2Y0D A;  4NFG B;  5CYT R;  3VYM A;  4ASW A;  2WT7 A;  1VQK P;  2K1A A;  5CCH A;  1ZP0 C;  2C0X A;  4YE1 A;  3TYY A;  5TIS E;  1P84 E;  3A0B E;  3II6 A;  1BCC E;  1OX3 A;  1SQV E;  1VPC A;  4WVZ A;  1HH0 A;  2QM7 A;  2WT7 B;  1FI9 A;  3RK3 D;  2QJP C;  4AX3 A;  1HF9 A;  4ASV A;  2YMY A;  2BCN B;  2Y9Z A;  1L4A C;  1DT1 A;  2OYI C;  3OA8 A;  1NU1 J;  4YXW H;  2E75 C;  1KB0 A;  3L36 A;  1FZF A;  4PJ0 H;  5DF5 A;  1MV8 A;  1LC2 A;  5KAI E;  2O3J A;  4H13 B;  3OA8 B;  4D6T E;  3U1C A;  3CCS P;  1LTJ A;  2LR2 A;  1ZR4 A;  3A0H V;  2ZBO A;  2IPP A;  3AE2 C;  4EIE A;  1L2P A;  2Q3I A;  2K9Y A;  1I55 A;  1LTJ B;  1KFM A;  3HD7 D;  3VYI A;  2N9B A;  5AVW B;  1HRO A;  2JEE A;  2KIK A;  2C1D A;  1DW1 A;  3CME P;  4K3A A;  2J59 M;  3O6Q A;  3HUS A;  2KLV A;  1U7M A;  3BAS A;  3ORV A;  4C7N A;  3L71 D;  4NPD A;  2QEX P;  3BVH A;  3I56 P;  1IFI A;  1Q2N A;  3WU2 H;  3O6Q B;  1GL2 D;  1COR A;  3HUS B;  2WPQ A;  1YTC A;  1NTM K;  4RO0 A;  1H8A A;  3H32 A;  3KYQ A;  4JCG A;  4TT3 H;  2E76 D;  2GC7 D;  1FOS E;  3H1L D;  2O01 N;  3I55 P;  1AYG A;  3H1H E;  3M0D A;  2FXM A;  1IC2 A;  3H32 B;  2N18 B;  2CPS A;  1RQV A;  3PHL A;  3HQ8 A;  4N78 D;  4YTP C;  1EZV D;  5AW6 B;  4GOE A;  3GW6 A;  1CTJ A;  3L75 D;  1EDL A;  3IN6 A;  4V2K A;  1KQL A;  1QX8 A;  3NBS A;  2O01 H;  1COT A;  2RH0 A;  1KIL C;  1NWQ A;  3WU2 V;  2AXT E;  2Q6Q A;  1NOH A;  5H2F V;  1AJY A;  3A2A A;  1CED A;  2YNY A;  5K5G B;  5AVS B;  1CW5 A;  2D2C B;  1YIT P;  2OYO A;  4ZNC A;  1LC1 A;  3L73 G;  5CIH B;  1N15 A;  1GU2 A;  2CA3 B;  2FXP A;  1FJK A;  2JKV A;  2AIU A;  4H44 D;  3ABV C;  3H1I E; 
#chains in the Genus database with same CATH homology
 1BGY D;  1MZ4 A;  2Y0C A;  4AAM A;  1CIH A;  1H31 B;  1CRI A;  2QJY B;  1GJQ A;  1DVV A;  2C9X B;  1NTM D;  1A56 A;  2PCB B;  1HJ5 A;  3ZOO A;  2C2C A;  1CHI A;  1YIC A;  2YQB A;  4AAO A;  4K3I A;  5AUR A;  4FA9 A;  1FHB A;  1DIQ C;  1GDV A;  2QJK B;  2A06 D;  4H0J A;  5DJQ B;  4FB1 A;  1I8P A;  2AI5 A;  3WFE C;  2K9J B;  4WQ8 A;  1E8E A;  1E2R A;  1P84 D;  1CHH A;  1KV9 A;  1QN2 A;  1BCC D;  4FA4 A;  1PP9 D;  1CC5 A;  1OCD A;  5TIS V;  3MK7 C;  1M6Z A;  3ITK A;  1CRJ A;  3SWS A;  2B11 B;  1C75 A;  1M60 A;  2C1V A;  1WVE C;  4XYD B;  1AOF A;  1IRW A;  1CTY A;  3TYI A;  1EB7 A;  2YCC A;  1E29 A;  3L73 D;  2C1D B;  3WFD C;  2XTS B;  1CSV A;  1C7M A;  1F1F A;  1FCD C;  1H33 A;  5CIF B;  1HRC A;  351C A;  1SQP D;  4UB8 V;  4D6T D;  1BE3 D;  4LJI A;  3FWL A;  1J3S A;  1HH7 A;  1KIB A;  1LS9 A;  1SQQ D;  4Q5P A;  1SQB D;  1B7V A;  3OCD A;  1FOC A;  3O0R C;  4EIC A;  3L72 D;  3O5C A;  1CXA A;  1C2R A;  1DW0 A;  3A9F A;  5IY5 1;  1L9B C;  1FI7 A;  3RMZ A;  3ZOX A;  3OCD B;  1NTZ D;  2N9Y B;  1MG3 D;  3L74 D;  4N0K A;  5C9M A;  1S6V B;  2MTA C;  4DY9 A;  4EDF A;  1GIW A;  1PPJ D;  1CTZ A;  3DP5 A;  2DGE A;  1C6R A;  1I8O A;  1L0N D;  1YFC A;  3BCC D;  2BCC D;  1IO3 A;  3CX5 W;  1U74 B;  2C8S A;  2EXV A;  5C0Z A;  1M70 A;  1QL3 A;  1N50 A;  3H1J D;  2LIT A;  1A8C A;  2I8F A;  3MK7 B;  2N3B A;  1N90 A;  1NTK D;  1CRY A;  1ZRT D;  1RZ5 A;  1CO6 A;  3H1H D;  2V07 A;  1ETP A;  2ZOO A;  4O1Q A;  5KLI B;  2PAC A;  2CA4 B;  5GTH V;  1NMI A;  1CRC A;  3VNW A;  2V08 A;  2BH4 X;  3CU4 A;  3RLM A;  5KKZ B;  3VMA A;  3NWV A;  2D0W A;  1CIF A;  2KS1 A;  1NNO A;  3PRJ A;  1I5T A;  3CXH D;  2Q3E A;  2B0Z B;  4L3H A;  1KX2 A;  1AKK A;  3ZBM A;  1CNO A;  4WQB A;  2N9J A;  2GB8 B;  1YCC A;  3L4M A;  1SQV D;  2AXT V;  2LIR A;  2YK3 A;  4KMG A;  1CSW A;  1H32 A;  4WQ7 A;  2B10 B;  5B6Q A;  3CX5 D;  3ZIY A;  1KX7 A;  4U3F D;  2YIU B;  5GTI V;  1C52 A;  1CHJ A;  2DVH A;  4P4Q B;  2CE0 A;  1C6S A;  4J20 A;  2ORL A;  1H32 B;  3NBT A;  3H1I D;  1CRG A;  1CSX A;  4RSZ A;  1C2N A;  1H9X A;  5CIB B;  4FAV A;  3PTZ A;  4H0K A;  1LFM A;  1ZZH A;  4EIF A;  4IL6 V;  3CWB D;  1RAP A;  1H1O A;  3CP5 A;  1RZ6 A;  1U75 B;  451C A;  2OZ1 A;  1K3G A;  1NIR A;  3SJL A;  2N3Y A;  1A2S A;  3ZOW A;  1H33 B;  5DFS A;  4L3G A;  2FYU D;  2OZ1 B;  2HV4 A;  1HZU A;  5TJH A;  2FRC A;  2QG4 A;  3CXH W;  1HJ4 A;  1FJ0 A;  4PJ0 V;  3GG2 A;  3PLN A;  2PCC B;  1YEA A;  2C1U A;  5CIE B;  3X39 A;  1DVH A;  1IQC A;  4FA1 A;  1GKS A;  1CYJ A;  1C6O A;  1GQ1 A;  1R0Q A;  3CYT I;  5E79 V;  2JWA A;  3VRD A;  1CYI A;  2VHD A;  2B4Z A;  3WUI A;  2ZXY A;  1LMS A;  1CIE A;  4A7P A;  1I6E A;  2RMZ A;  1HCM A;  3SXT A;  1DII C;  3DMI A;  3HQ9 A;  3JBT B;  2Y0D A;  4NFG B;  5CYT R;  1CIG A;  3VYM A;  2N9I A;  4Y5R A;  3PH2 B;  1DW2 A;  4YE1 A;  2GC4 D;  4WQE A;  2KNC B;  1S5L V;  3KZI V;  1NU1 D;  1KYO W;  1IZL 0;  1CRH A;  2MHM A;  1FI9 A;  4WQD A;  5B66 V;  3PXT A;  4AX3 A;  3H1K D;  3L70 D;  3PXS A;  1QYZ A;  1F1C A;  3RN1 A;  2N18 C;  2BCN B;  2FWL A;  1DT1 A;  1K3H A;  4AAL A;  4EID A;  3OA8 A;  1CSU A;  1KB0 A;  1NML A;  4FAN A;  1KB9 D;  4QAO A;  5DF5 A;  1LC2 A;  2CE1 A;  2D0S A;  1YEB A;  1QKS A;  3O20 A;  2O3J A;  3RN0 A;  3OA8 B;  1AOQ A;  5CIG B;  1L0L D;  3A0H V;  3WFC C;  2ZBO A;  4EIE A;  3WC8 A;  1I55 A;  3ZOY A;  1MG2 D;  3KHU A;  2CXB A;  4PW9 B;  3A0B V;  1HRO A;  3HQ7 A;  2C1D A;  4PD4 D;  1DW1 A;  2IBZ D;  1I6D A;  1L9J C;  2B12 B;  3TDK A;  3SLE A;  3C2C A;  1CCH A;  1FI3 A;  3ORV A;  2L4D A;  3L71 D;  2BH5 X;  1KYO D;  5B5E V;  2BGV X;  3SVW A;  5CIC B;  1W2L A;  1BL9 A;  1COR A;  1I54 A;  2JQR A;  1YTC A;  2GIW A;  1JDL A;  5EXQ A;  3L4O A;  5KAI V;  3ZCF A;  1SQX D;  4RJT A;  3HQ6 A;  155C A;  1RAQ A;  2Y0E A;  3DR0 A;  4JCG A;  2QJP B;  5KLV D;  2GC7 D;  2ZON G;  3H1L D;  5DJQ C;  1VYD A;  1AYG A;  2N18 B;  3PHL A;  3HQ8 A;  2ZZS 1;  4WQC A;  4UB6 V;  4PWA A;  2BPB B;  1EZV D;  2RN0 A;  2BLF B;  3GW6 A;  4MU8 A;  1CTJ A;  1QL4 A;  3L75 D;  1YIQ A;  3TGU D;  2JTI B;  4O1W A;  1CCR A;  4V2K A;  1W5C T;  1HZV A;  1OAE A;  4L1Q A;  3NBS A;  3M97 X;  1COT A;  1HJ3 A;  4AAN A;  3O1Y A;  4GYD A;  2L91 A;  3WU2 V;  1H9Y A;  1WEJ F;  5CID B;  1YNR A;  4FA5 A;  5H2F V;  3PXW A;  1CED A;  3TF5 A;  1IRV A;  1DW3 A;  5KAF V;  2FYN B;  1LC1 A;  1CXC A;  4WQA A;  3WFB C;  5CIH B;  1H31 A;  4WQ9 A;  4GED B;  4XXL A;  1N15 A;  1GU2 A;  2CA3 B;  2AIU A;  1CYC A;  1N9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...