1NTMD

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 50
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntmD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntmD01
1GQ1A 4Y5RA 5H2FV 4FA9A 3ORVA 1CRHA 1CSWA 1RZ5A 3PXWA 1AOFA 1I6DA 1M60A 1M70A 3RN1A 1GJQA 4JCGA 1E29A 1IQCA 2C2CA 4UB8V 2BH5X 1A2SA 5B66V 3O1YA 1CC5A 1DVHA 1CYCA 1HJ5A 1N50A 1YFCA 5DFSA 4AX3A 1KB9D 2BLFB 1NU1D 3SLEA 1QN2A 1F1FA 2PACA 5IY51 2N3YA 4AANA 1CRGA 4WQCA 4O1QA 1PPJD 5CIGB 2FYNB 3L4OA 3H1HD 2MTAC 1E2RA 2PCBB 5C9MA 3MK7B 2ZONG 2C1UA 2CE1A 3SWSA 1FOCA 3DR0A 3M97X 1CIEA 2Y0CA 3CU4A 4FAVA 1CRYA 1I55A 3VRDA 4WQDA 4RSZA 1NNOA 2IBZD 1DVVA 1H33B 1C6RA 1SQXD 2BCCD 1HH7A 3CX5D 1DW3A 3GG2A 1CYIA 2Y0EA 2QG4A 3TYIA 5B6QA 2RN0A 3PTZA 5EXQA 1C75A 1NTMD 2D0SA 4PD4D 4AAMA 1HROA 1C6OA 2B12B 4WQ9A 1CEDA 3ZOXA 1K3GA 1KB0A 1HRCA 5CIFB 1OCDA 3SXTA 3ITKA 2GB8B 3WUIA 2OZ1A 1B7VA 1C2NA 1C6SA 1IZL0 4MU8A 4FA5A 2CA3B 3HQ7A 4WQEA 2C1DA 2GC4D 3L74D 3NBSA 4A7PA 2ORLA 1P84D 4J20A 3O20A 1SQQD 5CIBB 5TJHA 1M6ZA 1BL9A 1HCMA 1NTKD 1GU2A 1ZZHA 3H1KD 3HQ8A 4GEDB 3OCDB 3BCCD 3ZIYA 3O0RC 3H1LD 1CCRA 3RN0A 2Q3EA 2YQBA 4U3FD 3FWLA 2YCCA 1N90A 2L91A 1QYZA 4PJ0V 3KHUA 4AALA 3ZBMA 1DIIC 5B5EV 2AXTV 1SQVD 1YEBA 1L9BC 1IRWA 1BGYD 1I6EA 3ZOYA 1MG2D 3WFDC 1K3HA 2V07A 3WC8A 4FB1A 1YCCA 2JWAA 1H33A 2FWLA 1H31B 1GDVA 1ZRTD 3RLMA 2EXVA 3DMIA 1H32A 3A0BV 4O1WA 3L71D 2QJYB 3WU2V 2CE0A 1FI9A 4EDFA 1ETPA 3A0HV 1J3SA 1CTJA 3TF5A 2YK3A 1GIWA 3PHLA 1HZVA 2N3BA 2HV4A 1W2LA 4P4QB 1KV9A 2KNCB 2Y0DA 2B4ZA 1H9YA 1EB7A 3O5CA 2ZBOA 1YNRA 3A9FA 3C2CA 2RMZA 1NIRA 2L4DA 4L3GA 3SJLA 1A8CA 1OAEA 1I5TA 1N15A 3JBTB 5CIHB 3KZIV 4UB6V 1LC1A 3L4MA 1FCDC 3ZCFA 1CNOA 3H1JD 451CA 2BCNB 1CHIA 1NMIA 2V08A 1QL4A 1CO6A 3CWBD 4WQ8A 1IRVA 2N18C 3HQ9A 2AIUA 5KAFV 4EIDA 1DIQC 3DP5A 4EIEA 1C52A 2N9JA 4K3IA 4N0KA 1CYJA 1RZ6A 1YTCA 4FA4A 3MK7C 3L75D 1H31A 1SQBD 1KX7A 5GTIV 1FI7A 2O3JA 5DF5A 3NBTA 1U74B 4YE1A 3HQ6A 3CXHD 2BH4X 5CIDB 1DT1A 3ZOOA 1HZUA 1AOQA 2QJKB 3PRJA 1S6VB 4WQBA 5E79V 1A56A 3NWVA 1I8PA 1I8OA 1FJ0A 1CSUA 5KLIB 3WFBC 2ZZS1 1GKSA 1YEAA 1QKSA 3TDKA 1COTA 1DW1A 2OZ1B 1AKKA 4IL6V 2C1DB 2N18B 2ZOOA 4GYDA 1L0ND 4PWAA 1C2RA 4EICA 2QJPB 1BCCD 1CIHA 1CSVA 1LS9A 2C9XB 5CYTR 1CIGA 3CP5A 5DJQB 3SVWA 4V2KA 3L73D 5KAIV 4FANA 1RAPA 2FRCA 1CORA 2B11B 1CXAA 5KLVD 1NMLA 2DVHA 2CXBA 2LIRA 2JQRA 2C8SA 2I8FA 1PP9D 2XTSB 2N9YB 2LITA 4PW9B 1S5LV 1NTZD 1KYOD 4LJIA 1H9XA 3VMAA 1YIQA 1WVEC 1LFMA 1R0QA 2BGVX 1MG3D 1KX2A 4QAOA 2N9IA 1EZVD 4AAOA 1VYDA 4H0KA 2D0WA 2CA4B 1N9CA 1W5CT 3L72D 2BPBB 3WFEC 4KMGA 1WEJF 1H32B 3WFCC 5DJQC 3RMZA 1HJ4A 1JDLA 2B10B 1CHHA 1QL3A 2AI5A 2B0ZB 2YIUB 1LC2A 2C1VA 3ZOWA 5AURA 1CRIA 3X39A 3GW6A 1KIBA 4XXLA 2GC7D 1L9JC 4H0JA 3CX5W 3TGUD 5TISV 1CIFA 1MZ4A 1AYGA 2DGEA 1HJ3A 2ZXYA 3PH2B 3H1ID 1IO3A 2VHDA 3CXHW 3OA8A 4RJTA 1LMSA 1CSXA 1L0LD 4WQ7A 5CICB 1E8EA 1CTZA 1H1OA 3VNWA 1CTYA 2KS1A 1C7MA 4EIFA 4FA1A 2JTIB 1CRJA 1DW0A 1CXCA 2GIWA 3OA8B 1YICA 5CIEB 1KYOW 1BE3D 1CCHA 4D6TD 3PXTA 3PLNA 1U75B 4Q5PA 5KKZB 3VYMA 2A06D 4L3HA 1F1CA 1FI3A 1I54A 351CA 3PXSA 5GTHV 3CYTI 1SQPD 4NFGB 4DY9A 1CRCA 1DW2A 4XYDB 155CA 3OCDA 1RAQA 2MHMA 5C0ZA 2K9JB 1FHBA 2FYUD 1CHJA 4L1QA 4WQAA 2PCCB 3L70D
chains in the Genus database with same CATH superfamily
1N7LA 4ZKUA 4Y5RA 4K35A 3ORVA 1NWQA 1CSWA 2KB7P 4HJGH 1SQQE 3L74E 2PGDA 1M60A 1QVFO 4IOIH 1GJQA 5H2FE 1S3JA 5CBNA 1DIPA 2VRSA 3CCLP 2OGUA 1HJ5A 1N50A 1GZLA 3RK2D 1NU1D 3SLEA 1Q2NA 4W7ZA 1LT9B 3R4YA 1F1FA 5KAIE 2PACA 1DD3A 1JUNA 5B5EH 4OH8B 2E43A 5C9MA 1KB9I 2L5GB 1LTAC 2E76D 1OMIA 1PGPA 1OWAA 2Y0CA 1CIEA 1Y8AA 4GT1A 2C0XA 3H1JJ 2Q5UA 3VP8A 1NNOA 1SQQG 1PZQA 1GU4A 2OYHB 3AEDC 3M06A 2BCCD 1HH7A 2RN0A 1C6OA 2B12B 1JTHA 2WQYC 2YO2A 2ZXXA 4DCKA 2KIKA 3UIAA 1Q7YQ 5AW7B 3H32A 1ZMEC 3HUSC 3AEEC 2B89A 1RHZB 4EI2A 3GMAA 2R3CA 5AVXB 3L73G 1C2NA 2OZ1A 3B5NB 5DJUB 3MD0A 4FA5A 3H1KG 3HQ7A 4WQEA 2ZYGA 2O1KA 3BRTB 3NBSA 4A7PA 4J20A 1NTKD 1FZEA 1SQVK 3B5NA 3H1KD 3G9RA 4IFMA 5B66E 2YKQA 3BCCD 3ZIYA 2FYUK 1FOSE 4ASWA 1SFCB 3FXEA 2A06E 1IFNA 1N90A 4AALA 1KN7A 2JEEA 2AXTV 5TISH 1SQVD 1MG2D 2IDBA 3USSA 2V07A 4ASVA 1NTZJ 2JWAA 1WT6A 1GDVA 3A0BV 2QJPC 2KSJA 5AW5B 1RF1C 1FI9A 3CCMP 1ETPA 3RL0D 2IX7C 3TGUE 1CTJA 5CMZA 1ZW0A 3PHLA 2OQQA 2O01N 4U3FJ 1H9YA 1Q86Q 3MZWB 3A0BE 3RBXA 1RF1B 2KLUA 2RMZA 1HJ0A 2R5BA 1NTMJ 3CXHH 3A0BH 1OZHA 1T3UA 3PH0A 3V6IA 2KNCA 2WPSA 1L4AD 5GTIE 3JBTB 3WUTA 3SWFA 3MHVA 1T6AA 3G4SP 4IL6X 1LC1A 4N6JA 4K3AA 1MKMA 2BCNB 1NMIA 4WQ8A 1U57A 2E5TA 4GOFA 1DIQC 3DP5A 4RO0A 1JCDA 1JCCA 3TGUG 1MFTA 1RE3C 2N9JA 1CYJA 2NPSD 3HUSA 3IR9A 1YTCA 4H44C 3SWKA 1YYCA 1BSHA 3II6A 3L75D 4LLHA 5KKZC 1T2KD 1H31A 1NOHA 3TNUA 1M57D 3H1LE 1EDKA 3A2AA 1EQ7A 2K3RA 3GHGB 2R44A 3HQ6A 4GODA 1ZV8A 3CXHD 1PP9E 2NZ2A 1Q82Q 3PRJA 2IZ0A 2W6BA 2O01H 1VQ4P 1KB9H 1W5CE 2QE7H 3NWVA 2WSFJ 5KLVJ 1CSUA 2FY8A 1VQNP 1KTMA 1YI2P 1SQPJ 1DW1A 1R5LA 3L75J 3BCCG 5DJTB 1FOSF 1VF5B 5TISE 3AE2C 2QIWA 1P84H 2C1DB 1NJIQ 2ITAA 2ZOOA 4GYDA 3WMM0 2XNDH 1HBWA 3L71E 1LS9A 5CYTR 4C7NB 3CCJP 2KK7A 3S9OA 3A3YB 2KZJA 3SVWA 4V2KA 1YJ9P 5KAIV 2LR2A 3H1IJ 2WZ7A 2CXBA 1OIPA 3CLQA 2I8FA 4PW9B 1NTMG 1S5LV 1ZR4A 2AXTH 2WMMA 3C1LA 2ZXEB 1BCCG 2H7HA 1YHQP 1YIQA 1WVEC 1LFMA 1R0QA 3BCCE 2BGVX 4QAOA 1RE3A 4H0KA 3V4QA 1KILB 1W5CT 2B87B 1Q81Q 3WFEC 1URQC 1KMIZ 1RH5B 3CD6P 3RMZA 1HJ4A 4UB6E 1JDLA 2V7QJ 1JY2O 3U59A 5AW3B 1QL3A 2AI5A 2B0ZB 1KQLA 2C1VA 1GL2B 1K8AQ 1PGQA 3L36A 3G71P 1JM0A 5AW1B 1PPJG 2FXOA 1L9JC 4H0JA 3MUDC 3TGUD 1KILC 2DGEA 2WSSH 1U7MA 3H1ID 4RJTA 4R4MA 1LMSA 1CSXA 2Q9IA 2E5YA 3CXHI 3Q2YA 2E75C 1CTYA 4JYBA 3HD7B 3H32B 3JC22 1C7MA 1USEA 4HYTB 1EDJA 1LTJB 5APSA 1DW0A 1CXCA 3D71A 3OA8B 4H0LB 4JBZA 5APVA 4NPEA 1U75B 1LJ2A 5KKZB 2A06D 1F1CA 2G8YA 1FI3A 1JMBA 351CA 3PXSA 2D2CC 1LTJA 1WRGA 4L76A 1SQPD 1KYOH 4DOJA 4DY9A 4XYDB 3OCDA 3RK3C 2MHMA 1NTZE 3SFEC 2OYHC 2K9JB 4HH2A 4AYCA 4L1QA 2E75B 1W2EA 5K5GB 2YMYA 4WY4C 2GM4A 1CRHA 1N86A 3D6ZA 4Y99B 5APTA 3RN1A 1E29A 1IQCA 1RE4C 2C9LY 3IF4A 2B9BA 1DVHA 1DEEG 5APQA 2WSEJ 4AX3A 1JY2P 2A45H 3KXDA 4I7ZC 1GW3A 5BU5A 3P8MC 2BLFB 1K04A 5KLVK 3H1IG 1LGHB 3KQGA 1FZGA 1VDFA 5CHXA 5IY51 2N3YA 3L70E 1CRGA 3V2RA 2LXCB 3I56P 2HPCA 3L4OA 1NAYA 3N7NA 3H1HD 1SQXE 2WPQA 3NTNA 1K05A 3AEAC 2YMKA 1CI6A 1E5WA 1VQPP 2P7JA 2CE1A 3SWSA 2NPSC 1CRYA 3L72G 5APYA 1N7SD 4CPGA 4RSZA 2IBZD 3CX5D 1S9KE 3GG2A 1NKNA 1CYIA 1CI6B 3S1KA 2QG4A 4EOTA 3PTZA 3CCSP 1AQTA 1NTMD 3CCQP 1WMKA 4WQ9A 4LGDE 3ZOXA 2NPSA 5KAIH 1K3GA 1ZOYC 5KJ7C 1HRCA 2QSIA 3TSIA 3ITKA 5AVZB 1AQ5A 1H0TA 4WWIA 2GB8B 3MIWA 2CA3B 2AEFA 1VQ7P 4I1LA 3NFQA 4Y99C 2K88A 3LW5H 1M6ZA 1BL9A 3H1HE 1HCMA 1L0NG 4JQ0D 2KP8A 2I8DA 3TNUB 2FYUE 2WT7A 4NPDA 1UIXA 2K1AA 3O0RC 2OTKE 3RN0A 1QGKB 4XA4A 2Q3EA 1T8ZA 2YQBA 1HH0A 1JY2N 2N1TC 2W6JH 3AECC 3KHUA 2IYOA 2WT7B 5B5EV 1HWTC 4GKGA 1L9BC 1IRWA 1NU1G 5AVWB 3WFDC 3I55P 3D0WA 2I1JA 1H33A 3HE4A 1L2PA 2EXVA 1H32A 1IFJA 2XU6A 3RK2B 4ZKPA 2ZT9C 1RE4A 3WU2V 1T3JA 3L75G 2CE0A 3VMZA 4EDFA 3H1HG 1BGYJ 3L73J 3TF5A 4R4LA 1HZVA 3H25A 2QRXA 1OW8A 1XTGB 2KOGA 2HV4A 3AEBC 1KV9A 1IO4A 4Z1MH 1EB7A 5B66H 3O5CA 2E76B 2ZBOA 1IZNB 3HE5B 4YXWH 2C0WA 2L4DA 3FGAD 3SJLA 3VMYA 2GUSA 1OAEA 3CCEP 1KV4A 2P1JA 3EWKA 1PL5A 5AVUB 1KQGB 5CIHB 3KZIV 2FYUJ 3PP5A 5GTIH 3P8CE 3L4MA 4H0LC 1J1EB 3H1JD 3CXHE 1CHIA 1QL4A 1CO6A 1L0LG 3TYYA 1IRVA 5KAFV 2UWJE 1SQVG 1VQ5P 3N4XA 3B5ND 1NYHA 1C52A 1HGZA 4K3IA 2BASA 3B5NC 3CCUP 3KZIH 1VQ6P 1IFIA 1VQ9P 3MGNA 5GTIV 2M3EA 2DW3A 2GA1A 2J5UA 1S1CX 2RH0A 3O8ZA 3RBZA 2R5DA 3U1AA 1FS0E 2B88A 1DT1A 4RESB 5CJ0A 1M1KQ 3EFGA 2K9YA 1A56A 4H13C 2SPZA 4WY4D 5KLIB 1HJBA 2ZZS1 1SQPK 1COTA 3H1LG 3V4WA 3S4RA 2Z5HA 2ZVNB 1GL2C 3B71A 1AKKA 3AE7C 5CBOA 2D2CB 2N18B 1FAVA 2E74B 1EZVG 2BCCG 2YXQB 1GTWA 5KLIC 3SFDC 2FYNC 4I6MC 1GD2E 1BCCD 1VQOP 2QM7A 1J1EC 1LWUC 2C9XB 1CIGA 2WSFH 5DJQB 2ZAEB 4WB4A 1JTHB 3RK3E 2YIUC 1RAPA 1K73Q 1RF1A 1CORA 2YKPA 5KLVD 5KLVE 3Q3DA 1Y9BA 2OYOA 2LIRA 3VYIA 2JQRA 3RK3D 2OARA 3OA7A 2LITA 1P84I 4UB8E 1L0NJ 4U3FE 1KYOD 4LJIA 3M9BA 2WPRA 1EDIA 1KX2A 4AAOA 1KILD 1VYDA 2JP3A 5CCGD 1M1JB 1H32B 3WFCC 5DJQC 1EXJA 2P10A 3NMDA 2BCCE 1USDA 1FZCB 4YXDC 1SQBG 3R2PA 1CHHA 3WU2H 2YIUB 3KDPB 3CWBE 3ZOWA 4I2LC 5AW8B 1FDOA 1Y47A 4XXLA 2GC7D 1N2DC 3T97B 1YBKA 3MP7B 3HTKA 1GK4A 1ZP0C 3E1RA 1LT1A 3AEFC 5AVQB 3JCUE 3PH2B 2CPSA 1IO3A 2VHDA 1SQPG 3TK1A 1E8EA 1L4AA 5CICB 1CTZA 2J59M 1SQVJ 2R3SA 4EIFA 1SQBJ 1H0TB 3ABVC 1BDDA 3I5CA 2JTIB 4YTPC 3LW5J 2IPPA 2V7QH 4B86A 4H0LD 1M56D 2HR3A 5KJ7A 1KYOW 1JEKA 1DH3A 3BVHA 1DD4A 3SSUA 1N73C 4Q5PA 3HRNA 4L3HA 3G6EP 5GTHV 2FFDA 1NO4A 2QEXP 4NFGB 2M5AA 4GDOA 1DW2A 1VF5D 155CA 3VP9A 1RAQA 2FYZA 3CWBG 2I1KA 1UIIA 2KZIA 1VPCA 1QEXA 1QLED 3LIDA 4WQAA 4Y28J 3L70D 3P8CD 1CSBA 2O1JA 5H2FV 1KQSO 3PXWA 2J58A 3E7KA 1BCCJ 3AEGC 1I6DA 2W27A 2C2CA 2BH5X 1A2SA 3WUUA 1CC5A 5GTHH 3IN6A 2BEZF 3RGUA 3BRVB 3CC2P 1NTZG 1SFCD 1YITP 2YO3A 1N73A 4AANA 1FE6A 1AVYA 3P32A 4O1QA 1HTLC 1KFMA 3HUSB 2FYNB 2MTAC 1E2RA 2PCBB 2ZONG 2WITA 4L74A 3L71G 2JWDA 3DR0A 3M97X 3L70J 1KZUB 1TU3F 1J1DB 5AVVB 3B4SA 1OFCX 2W8ZA 3B8EB 1HGVA 2P67A 3M91A 2E76C 1SS1A 1DVVA 1H33B 1GL2D 1DW3A 3CX5I 2Y0EA 3TYIA 5B6QA 5EXQA 1C75A 4AUWA 1HROA 1NTME 3HD7C 1H89A 1S72P 1KB0A 4TT3H 5CIFB 1OCDA 3RL0C 1B7VA 1IZL0 4IL6H 5AW6B 2C1DA 3BATA 4PJ0E 2GC4D 3L74J 2H43A 5BVZA 3L74D 2C9NY 3Q1MA 2ORLA 1P84D 1P84E 3O20A 4OGQD 1SQQD 1LTJC 2ZVOB 3M9QA 1FZBA 1ZZHA 3AE6C 2ZYAA 2HODB 3H1HJ 1LTBC 1NGMB 3HQ8A 2V4HA 4GEDB 2QJKC 3OCDB 1BE3J 1FZCA 1A02F 1GU5A 1YTZT 3V2QA 3H1LD 1X9VA 3Q5SA 3OW2O 2P58A 4U3FD 3FWLA 1IK7A 2YCCA 5AW2B 1QYZA 4PJ0V 2A45I 1URQA 4U7JA 1CZQA 4D6TE 4RKUJ 2O01J 2WSCJ 1NVOA 1YEBA 1BGYD 1I6EA 2OTLP 1G1IA 1QX8A 1K3HA 3VMXA 4FB1A 1SFCA 2HLOA 1M8OB 3MUDA 1KILA 2WVRA 3DMIA 2Y9YA 1JB0J 4O1WA 3L71D 2M8RA 5E79H 1LP1A 1S5LH 3SWYA 5CCHA 3A0HV 2N1TD 1SFCC 2YK3A 3L72J 2N1TA 4AQRD 1Q90D 2M3BA 2KNCB 4P4QB 1M7LA 2FFDB 5E79E 1EXIA 1KFNA 2XDJA 1JNMA 1HVVA 3CPWO 1PIXA 3ZDMA 4W7YA 1JY3N 1VQKP 3A9FA 1NIRA 1X8YA 4D6TG 1A8CA 1N7SB 1I5TA 1KILE 1LTTC 1N15A 5H2FH 1NTMK 2XV5A 2P2UA 4UB6V 2YXRB 3FXDA 3L35A 1FCDC 3ZCFA 3L70G 1CNOA 4H44B 1AJYA 3L71J 1VQ8P 3TGUJ 3OAKA 1PFIA 3D6YA 2N18C 3HQ9A 2IFMA 4EIDA 1LTIC 1JOCA 2KXPB 1W2BO 4N78E 2Q1KA 1YIJP 1HUCA 1S5LE 2K9JA 2KSEA 3L72E 1ZLLA 3RK2C 4BRYB 1BE3E 1RF0C 3MK7C 1N7SC 3IFMA 1SQBD 3HTKB 1KX7A 2O3JA 3F89A 2FXMA 1S2EA 4UB8H 3NBTA 3AE5C 1U74B 4YE1A 1NAFA 2BH4X 2FBWC 5CIDB 3CI9A 2IZ1A 1L0LE 3CX5E 3ZOOA 2BEQD 3RL0B 1S6VB 3L74G 1M1JA 1BGYG 2Q6QA 2AXCA 3GHGA 1I8OA 1SQBK 2QVAA 2QM8A 3GLMA 1GKSA 3EQ2A 3TDKA 2AEMA 1OVVA 1L0NE 2OZ1B 2Z5IA 4IL6V 1QL1A 1VL2A 4OGQC 1L4AB 1DX7A 3VOPA 1L0ND 1S9KD 2ZJSE 1C2RA 2HYNA 3H1KJ 1CIHA 1JO5A 2M0BA 1NTKJ 2HODA 5M1BA 3L73D 4HB1A 1GK6A 1LNQA 5CCHC 2YKOA 3JCUH 2B11B 1EC5A 1CXAA 1NMLA 1GMJA 1BGYE 1NH4A 2C8SA 1URQB 1PP9D 2OTJP 2B87A 1VQLP 3H1JE 3A7OA 2POHA 1AFOA 1NTZD 4NPFX 1H8AA 1H9XA 1BSNA 3L75E 3VMAA 1AVOA 1BDCA 2N9IA 2KI7B 2BCCJ 1N9CA 3H1KE 2FXPA 3FX0A 2BPBB 4KMGA 1KC8Q 3EFFK 3V2PA 1LC2A 2PAJA 5GTHE 3QH9A 4MN4C 1FDIA 5AURA 1CRIA 1URQD 3A0HH 3X39A 3HD7A 1KIBA 1PP9J 3CX5W 3CWBJ 1X0TA 1D7MA 2RKLA 1MZ4A 1AYGA 2ZXYA 1A02J 1YJNP 3OA8A 1IK9A 5AW4B 1YJWP 2A06G 2ZT9D 1H1OA 4WY4A 1R8EA 3H1JG 2CK3H 3C8VA 2FKWB 1SQBE 2PRRA 4HKZH 2HFED 5CIEB 1SQVE 2WTYA 3W67A 2KYVA 4UB6H 3OJAB 1CCHA 4D6TD 4WY4B 2K37A 1KD1Q 3PLNA 2OYHA 1MUUA 1I54A 3CYTI 2MKVA 1S5LX 2ZT9B 5C0ZA 1X79B 2AXTE 1FHBA 2FYUD 1PGOA 2E74D 1GQ1A 2WWWA 3M9HA 3RL0g 3D70A 4FA9A 1RZ5A 3O6QA 1AOFA 2E74C 5KAFE 3U1CA 5AVSB 2AEJA 1M70A 1KB9E 2N9BA 3VN0A 4JCGA 4UB8V 1LTSC 4JF7A 5B66V 3O1YA 3CCVP 1CYCA 1KORA 3CL3D 1YFCA 3M0DA 5DFSA 1EZVE 1KB9D 3KZIE 1NHLA 3T97A 2H88C 2WPVB 2JKVA 1QN2A 5AVYB 4WBAA 4WQCA 3M0AA 1SQXK 4KT0J 4EYYQ 1PPJD 1H88A 5CIGB 2OYIB 2YNYA 1KQFB 3P7KA 1RQVA 5KLVG 3MK7B 4DT0A 2C1UA 3HD7D 1FOCA 3L73E 1ZRTE 3CU4A 1Z56A 4FAVA 1I55A 3VRDA 4WQDA 1FJKA 2ZFCA 1QVGO 4IFDK 1YQ4C 3WU2E 1C6RA 1SQXD 1FZCC 1JY3P 2W6AA 4KJMA 2D0SA 4PD4D 4AAMA 2M5AB 1IJDB 1PP9G 1CEDA 1MV8A 1U7JA 4U3FG 5BU8B 5AVRB 2OYIC 2IBZE 3SXTA 3AE9C 1L0LK 1JMMA 2XKMA 3WUIA 2XNXA 5KTBA 1C6SA 1SQXJ 2E75D 4MU8A 1ZR2A 2H8PD 5KJ7D 4OVNF 3Q5PA 2NPSB 1FC2C 2A45G 4OGQB 2E42A 5L8RJ 4KHXA 1E79H 1HF9A 5CIBB 1X22A 5TJHA 2FFDC 1GU2A 1FZAA 3PJSK 5APUA 2QJYC 4PV1C 4D6TJ 4JPZB 1RY3A 1N73B 3AE8C 4C46A 3AE4C 1CCRA 1SQPE 5APXA 2L91A 3L37A 3JSVC 1GDTA 4W80A 1J2JB 4PD4E 3GF7A 3ZBMA 1DIIC 1MZ9A 4N78D 1QL2A 2GUVA 3ZOYA 4L73A 5EFWB 2IBZG 3WC8A 5CCHD 1YCCA 1YQ3C 3MTUE 1RF0A 2W83C 4IL6E 2FWLA 2Y9ZA 1H31B 1ZRTD 1IC2A 2WSEH 4O9BA 1LT9A 3RLMA 1SLQA 2QJYB 4C7RA 1SQQJ 1BCCE 1NU1K 1KYOI 1J3SA 1RQUA 4PV1D 1GIWA 3C9IA 3HE4B 1FBMA 3WUVA 2N3BA 1J1DC 1IFMA 2Y0DA 1W2LA 1M1JC 2B4ZA 4BWNA 2QA4P 1YNRA 3C2CA 1OX3A 3CX5H 2KS1B 4L3GA 4PD4I 3VTPC 2NRGA 1NTZK 4QMAA 3A5TA 1EDLA 1T2KC 1ZN5A 3W68A 3BASA 1L0LJ 1PPJE 5B5EE 4H44D 1N8RQ 1PV3A 4PV1B 3IAOA 1MFZA 2Q3IA 2PP6A 451CA 4DZOA 4XE5B 2V08A 3Q5RA 2KUBA 3CWBD 2AIUA 1G2CA 4H13B 3FWNA 2Z4EA 2KLVA 3CCRP 1EZVI 1SVFA 1VQMP 4EIEA 1FJPA 4IFFA 2H89C 4M3LA 3RK3B 1SQQK 4N0KA 3F5HA 2OYIA 1RZ6A 3QWOC 4FA4A 3CC4P 4BXLA 1PGJA 2IBZI 1FI7A 1KYOE 4N3YB 5DF5A 2JDIH 2XZRA 5CJ4A 1ZXGA 4LC1A 4GOEA 2IFNA 1IFPA 1NTKG 4WVZA 1HZUA 1AOQA 1LWUA 4H13D 2QJKB 4WQBA 4PD4H 5E79V 3V2NA 4JYCA 1I8PA 1FJ0A 2JO1A 3V5BA 3WFBC 3CC7P 2WSCH 1GL2A 3A0HE 1YEAA 1QKSA 2CPBA 1LWUB 1N7SA 1NU1J 5AW0B 1YTZI 5AW9B 4GIFA 2LKMA 4OWFA 1AV1A 3AE1C 1LP1B 1GW4A 3H1LJ 4DJGA 1FDMA 3AE3C 4PWAA 1SQXG 3E1IA 1SP4A 4EICA 3H1IE 2QJPB 2N1TB 1CSVA 1LTGC 1K9MQ 1NTKK 3O6QB 3CP5A 3LIEA 1AA0A 1M90Q 1NTKE 4FANA 2LXBA 2FRCA 1DEBA 2DVHA 2HG5D 3KPEA 4BRYA 4YPCA 2XTSB 2N9YB 4I7ZB 2Q7CA 3L4FA 4EIJA 5CCGC 1OW7A 1JY3O 1OVRA 2HPCB 1MG3D 1EZVD 2D0WA 2CA4B 3L72D 1WEJF 3KYQA 1FU1A 1NKZB 4ZNCA 5C39A 2B10B 2PFXA 3BCCJ 4XFJA 3G3ZA 3K5BA 1LT9C 3GW6A 2R32A 3M0DC 1L4AC 2FYUG 1R5SA 5TISV 1CIFA 4TLFA 1HJ3A 1S4XA 1IFDA 1OXZA 3H6PA 3CXHW 1OVUA 3HE5A 1L0LD 4WQ7A 2MJZA 1XTCC 4L75A 3VNWA 1CW5A 5APWA 2D2CD 2KS1A 2JR8A 4FA1A 5KAFH 3GHGC 1BE3G 3NXSA 1FZFA 1CRJA 4PJ0H 4C7NA 3CMEP 2ZYDA 5CCGA 1OW6A 1NU1E 2GIWA 2IYPA 1YICA 1G1JA 1BE3D 5AVTB 1VF5C 3PXTA 3VYMA 3GF3A 1G2CB 4ZMDA 2W90A 1CRCA 1L0NK 3CMAP 2JJLA 1CHJA 2PCCB 2G3AA
chains in the Genus database with same CATH topology
1GQ1A 4Y5RA 5H2FV 4FA9A 3ORVA 1CRHA 1CSWA 1RZ5A 3PXWA 1AOFA 1I6DA 1M60A 1M70A 3RN1A 1GJQA 4JCGA 1E29A 1IQCA 2C2CA 4UB8V 2BH5X 1A2SA 5B66V 3O1YA 1CC5A 1DVHA 1CYCA 1HJ5A 1N50A 1YFCA 5DFSA 4AX3A 1KB9D 2BLFB 1NU1D 3SLEA 1QN2A 1F1FA 2PACA 5IY51 2N3YA 4AANA 1CRGA 4WQCA 4O1QA 1PPJD 5CIGB 2FYNB 3L4OA 3H1HD 2MTAC 1E2RA 2PCBB 5C9MA 3MK7B 2ZONG 2C1UA 2CE1A 3SWSA 1FOCA 3DR0A 3M97X 1CIEA 2Y0CA 3CU4A 4FAVA 1CRYA 1I55A 3VRDA 4WQDA 4RSZA 1NNOA 2IBZD 1DVVA 1H33B 1C6RA 1SQXD 2BCCD 1HH7A 3CX5D 1DW3A 3GG2A 1CYIA 2Y0EA 2QG4A 3TYIA 5B6QA 2RN0A 3PTZA 5EXQA 1C75A 1NTMD 2D0SA 4PD4D 4AAMA 1HROA 1C6OA 2B12B 4WQ9A 1CEDA 3ZOXA 1K3GA 1KB0A 1HRCA 5CIFB 1OCDA 3SXTA 3ITKA 2GB8B 3WUIA 2OZ1A 1B7VA 1C2NA 1C6SA 1IZL0 4MU8A 4FA5A 2CA3B 3HQ7A 4WQEA 2C1DA 2GC4D 3L74D 3NBSA 4A7PA 2ORLA 1P84D 4J20A 3O20A 1SQQD 5CIBB 5TJHA 1M6ZA 1BL9A 1HCMA 1NTKD 1GU2A 1ZZHA 3H1KD 3HQ8A 4GEDB 3OCDB 3BCCD 3ZIYA 3O0RC 3H1LD 1CCRA 3RN0A 2Q3EA 2YQBA 4U3FD 3FWLA 2YCCA 1N90A 2L91A 1QYZA 4PJ0V 3KHUA 4AALA 3ZBMA 1DIIC 5B5EV 2AXTV 1SQVD 1YEBA 1L9BC 1IRWA 1BGYD 1I6EA 3ZOYA 1MG2D 3WFDC 1K3HA 2V07A 3WC8A 4FB1A 1YCCA 2JWAA 1H33A 2FWLA 1H31B 1GDVA 1ZRTD 3RLMA 2EXVA 3DMIA 1H32A 3A0BV 4O1WA 3L71D 2QJYB 3WU2V 2CE0A 1FI9A 4EDFA 1ETPA 3A0HV 1J3SA 1CTJA 3TF5A 2YK3A 1GIWA 3PHLA 1HZVA 2N3BA 2HV4A 1W2LA 4P4QB 1KV9A 2KNCB 2Y0DA 2B4ZA 1H9YA 1EB7A 3O5CA 2ZBOA 1YNRA 3A9FA 3C2CA 2RMZA 1NIRA 2L4DA 4L3GA 3SJLA 1A8CA 1OAEA 1I5TA 1N15A 3JBTB 5CIHB 3KZIV 4UB6V 1LC1A 3L4MA 1FCDC 3ZCFA 1CNOA 3H1JD 451CA 2BCNB 1CHIA 1NMIA 2V08A 1QL4A 1CO6A 3CWBD 4WQ8A 1IRVA 2N18C 3HQ9A 2AIUA 5KAFV 4EIDA 1DIQC 3DP5A 4EIEA 1C52A 2N9JA 4K3IA 4N0KA 1CYJA 1RZ6A 1YTCA 4FA4A 3MK7C 3L75D 1H31A 1SQBD 1KX7A 5GTIV 1FI7A 2O3JA 5DF5A 3NBTA 1U74B 4YE1A 3HQ6A 3CXHD 2BH4X 5CIDB 1DT1A 3ZOOA 1HZUA 1AOQA 2QJKB 3PRJA 1S6VB 4WQBA 5E79V 1A56A 3NWVA 1I8PA 1I8OA 1FJ0A 1CSUA 5KLIB 3WFBC 2ZZS1 1GKSA 1YEAA 1QKSA 3TDKA 1COTA 1DW1A 2OZ1B 1AKKA 4IL6V 2C1DB 2N18B 2ZOOA 4GYDA 1L0ND 4PWAA 1C2RA 4EICA 2QJPB 1BCCD 1CIHA 1CSVA 1LS9A 2C9XB 5CYTR 1CIGA 3CP5A 5DJQB 3SVWA 4V2KA 3L73D 5KAIV 4FANA 1RAPA 2FRCA 1CORA 2B11B 1CXAA 5KLVD 1NMLA 2DVHA 2CXBA 2LIRA 2JQRA 2C8SA 2I8FA 1PP9D 2XTSB 2N9YB 2LITA 4PW9B 1S5LV 1NTZD 1KYOD 4LJIA 1H9XA 3VMAA 1YIQA 1WVEC 1LFMA 1R0QA 2BGVX 1MG3D 1KX2A 4QAOA 2N9IA 1EZVD 4AAOA 1VYDA 4H0KA 2D0WA 2CA4B 1N9CA 1W5CT 3L72D 2BPBB 3WFEC 4KMGA 1WEJF 1H32B 3WFCC 5DJQC 3RMZA 1HJ4A 1JDLA 2B10B 1CHHA 1QL3A 2AI5A 2B0ZB 2YIUB 1LC2A 2C1VA 3ZOWA 5AURA 1CRIA 3X39A 3GW6A 1KIBA 4XXLA 2GC7D 1L9JC 4H0JA 3CX5W 3TGUD 5TISV 1CIFA 1MZ4A 1AYGA 2DGEA 1HJ3A 2ZXYA 3PH2B 3H1ID 1IO3A 2VHDA 3CXHW 3OA8A 4RJTA 1LMSA 1CSXA 1L0LD 4WQ7A 5CICB 1E8EA 1CTZA 1H1OA 3VNWA 1CTYA 2KS1A 1C7MA 4EIFA 4FA1A 2JTIB 1CRJA 1DW0A 1CXCA 2GIWA 3OA8B 1YICA 5CIEB 1KYOW 1BE3D 1CCHA 4D6TD 3PXTA 3PLNA 1U75B 4Q5PA 5KKZB 3VYMA 2A06D 4L3HA 1F1CA 1FI3A 1I54A 351CA 3PXSA 5GTHV 3CYTI 1SQPD 4NFGB 4DY9A 1CRCA 1DW2A 4XYDB 155CA 3OCDA 1RAQA 2MHMA 5C0ZA 2K9JB 1FHBA 2FYUD 1CHJA 4L1QA 4WQAA 2PCCB 3L70D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQ1 A;  4Y5R A;  5H2F V;  4FA9 A;  3ORV A;  1CRH A;  1CSW A;  1RZ5 A;  3PXW A;  1AOF A;  1I6D A;  1M60 A;  1M70 A;  3RN1 A;  1GJQ A;  4JCG A;  1E29 A;  1IQC A;  2C2C A;  4UB8 V;  2BH5 X;  1A2S A;  5B66 V;  3O1Y A;  1CC5 A;  1DVH A;  1CYC A;  1HJ5 A;  1N50 A;  1YFC A;  5DFS A;  4AX3 A;  1KB9 D;  2BLF B;  1NU1 D;  3SLE A;  1QN2 A;  1F1F A;  2PAC A;  5IY5 1;  2N3Y A;  4AAN A;  1CRG A;  4WQC A;  4O1Q A;  1PPJ D;  5CIG B;  2FYN B;  3L4O A;  3H1H D;  2MTA C;  1E2R A;  2PCB B;  5C9M A;  3MK7 B;  2ZON G;  2C1U A;  2CE1 A;  3SWS A;  1FOC A;  3DR0 A;  3M97 X;  1CIE A;  2Y0C A;  3CU4 A;  4FAV A;  1CRY A;  1I55 A;  3VRD A;  4WQD A;  4RSZ A;  1NNO A;  2IBZ D;  1DVV A;  1H33 B;  1C6R A;  1SQX D;  2BCC D;  1HH7 A;  3CX5 D;  1DW3 A;  3GG2 A;  1CYI A;  2Y0E A;  2QG4 A;  3TYI A;  5B6Q A;  2RN0 A;  3PTZ A;  5EXQ A;  1C75 A;  1NTM D;  2D0S A;  4PD4 D;  4AAM A;  1HRO A;  1C6O A;  2B12 B;  4WQ9 A;  1CED A;  3ZOX A;  1K3G A;  1KB0 A;  1HRC A;  5CIF B;  1OCD A;  3SXT A;  3ITK A;  2GB8 B;  3WUI A;  2OZ1 A;  1B7V A;  1C2N A;  1C6S A;  1IZL 0;  4MU8 A;  4FA5 A;  2CA3 B;  3HQ7 A;  4WQE A;  2C1D A;  2GC4 D;  3L74 D;  3NBS A;  4A7P A;  2ORL A;  1P84 D;  4J20 A;  3O20 A;  1SQQ D;  5CIB B;  5TJH A;  1M6Z A;  1BL9 A;  1HCM A;  1NTK D;  1GU2 A;  1ZZH A;  3H1K D;  3HQ8 A;  4GED B;  3OCD B;  3BCC D;  3ZIY A;  3O0R C;  3H1L D;  1CCR A;  3RN0 A;  2Q3E A;  2YQB A;  4U3F D;  3FWL A;  2YCC A;  1N90 A;  2L91 A;  1QYZ A;  4PJ0 V;  3KHU A;  4AAL A;  3ZBM A;  1DII C;  5B5E V;  2AXT V;  1SQV D;  1YEB A;  1L9B C;  1IRW A;  1BGY D;  1I6E A;  3ZOY A;  1MG2 D;  3WFD C;  1K3H A;  2V07 A;  3WC8 A;  4FB1 A;  1YCC A;  2JWA A;  1H33 A;  2FWL A;  1H31 B;  1GDV A;  1ZRT D;  3RLM A;  2EXV A;  3DMI A;  1H32 A;  3A0B V;  4O1W A;  3L71 D;  2QJY B;  3WU2 V;  2CE0 A;  1FI9 A;  4EDF A;  1ETP A;  3A0H V;  1J3S A;  1CTJ A;  3TF5 A;  2YK3 A;  1GIW A;  3PHL A;  1HZV A;  2N3B A;  2HV4 A;  1W2L A;  4P4Q B;  1KV9 A;  2KNC B;  2Y0D A;  2B4Z A;  1H9Y A;  1EB7 A;  3O5C A;  2ZBO A;  1YNR A;  3A9F A;  3C2C A;  2RMZ A;  1NIR A;  2L4D A;  4L3G A;  3SJL A;  1A8C A;  1OAE A;  1I5T A;  1N15 A;  3JBT B;  5CIH B;  3KZI V;  4UB6 V;  1LC1 A;  3L4M A;  1FCD C;  3ZCF A;  1CNO A;  3H1J D;  451C A;  2BCN B;  1CHI A;  1NMI A;  2V08 A;  1QL4 A;  1CO6 A;  3CWB D;  4WQ8 A;  1IRV A;  2N18 C;  3HQ9 A;  2AIU A;  5KAF V;  4EID A;  1DIQ C;  3DP5 A;  4EIE A;  1C52 A;  2N9J A;  4K3I A;  4N0K A;  1CYJ A;  1RZ6 A;  1YTC A;  4FA4 A;  3MK7 C;  3L75 D;  1H31 A;  1SQB D;  1KX7 A;  5GTI V;  1FI7 A;  2O3J A;  5DF5 A;  3NBT A;  1U74 B;  4YE1 A;  3HQ6 A;  3CXH D;  2BH4 X;  5CID B;  1DT1 A;  3ZOO A;  1HZU A;  1AOQ A;  2QJK B;  3PRJ A;  1S6V B;  4WQB A;  5E79 V;  1A56 A;  3NWV A;  1I8P A;  1I8O A;  1FJ0 A;  1CSU A;  5KLI B;  3WFB C;  2ZZS 1;  1GKS A;  1YEA A;  1QKS A;  3TDK A;  1COT A;  1DW1 A;  2OZ1 B;  1AKK A;  4IL6 V;  2C1D B;  2N18 B;  2ZOO A;  4GYD A;  1L0N D;  4PWA A;  1C2R A;  4EIC A;  2QJP B;  1BCC D;  1CIH A;  1CSV A;  1LS9 A;  2C9X B;  5CYT R;  1CIG A;  3CP5 A;  5DJQ B;  3SVW A;  4V2K A;  3L73 D;  5KAI V;  4FAN A;  1RAP A;  2FRC A;  1COR A;  2B11 B;  1CXA A;  5KLV D;  1NML A;  2DVH A;  2CXB A;  2LIR A;  2JQR A;  2C8S A;  2I8F A;  1PP9 D;  2XTS B;  2N9Y B;  2LIT A;  4PW9 B;  1S5L V;  1NTZ D;  1KYO D;  4LJI A;  1H9X A;  3VMA A;  1YIQ A;  1WVE C;  1LFM A;  1R0Q A;  2BGV X;  1MG3 D;  1KX2 A;  4QAO A;  2N9I A;  1EZV D;  4AAO A;  1VYD A;  4H0K A;  2D0W A;  2CA4 B;  1N9C A;  1W5C T;  3L72 D;  2BPB B;  3WFE C;  4KMG A;  1WEJ F;  1H32 B;  3WFC C;  5DJQ C;  3RMZ A;  1HJ4 A;  1JDL A;  2B10 B;  1CHH A;  1QL3 A;  2AI5 A;  2B0Z B;  2YIU B;  1LC2 A;  2C1V A;  3ZOW A;  5AUR A;  1CRI A;  3X39 A;  3GW6 A;  1KIB A;  4XXL A;  2GC7 D;  1L9J C;  4H0J A;  3CX5 W;  3TGU D;  5TIS V;  1CIF A;  1MZ4 A;  1AYG A;  2DGE A;  1HJ3 A;  2ZXY A;  3PH2 B;  3H1I D;  1IO3 A;  2VHD A;  3CXH W;  3OA8 A;  4RJT A;  1LMS A;  1CSX A;  1L0L D;  4WQ7 A;  5CIC B;  1E8E A;  1CTZ A;  1H1O A;  3VNW A;  1CTY A;  2KS1 A;  1C7M A;  4EIF A;  4FA1 A;  2JTI B;  1CRJ A;  1DW0 A;  1CXC A;  2GIW A;  3OA8 B;  1YIC A;  5CIE B;  1KYO W;  1BE3 D;  1CCH A;  4D6T D;  3PXT A;  3PLN A;  1U75 B;  4Q5P A;  5KKZ B;  3VYM A;  2A06 D;  4L3H A;  1F1C A;  1FI3 A;  1I54 A;  351C A;  3PXS A;  5GTH V;  3CYT I;  1SQP D;  4NFG B;  4DY9 A;  1CRC A;  1DW2 A;  4XYD B;  155C A;  3OCD A;  1RAQ A;  2MHM A;  5C0Z A;  2K9J B;  1FHB A;  2FYU D;  1CHJ A;  4L1Q A;  4WQA A;  2PCC B;  3L70 D; 
#chains in the Genus database with same CATH topology
 1N7L A;  4ZKU A;  4Y5R A;  4K35 A;  3ORV A;  1NWQ A;  1CSW A;  2KB7 P;  4HJG H;  1SQQ E;  3L74 E;  2PGD A;  1M60 A;  1QVF O;  4IOI H;  1GJQ A;  5H2F E;  1S3J A;  5CBN A;  1DIP A;  2VRS A;  3CCL P;  2OGU A;  1HJ5 A;  1N50 A;  1GZL A;  3RK2 D;  1NU1 D;  3SLE A;  1Q2N A;  4W7Z A;  1LT9 B;  3R4Y A;  1F1F A;  5KAI E;  2PAC A;  1DD3 A;  1JUN A;  5B5E H;  4OH8 B;  2E43 A;  5C9M A;  1KB9 I;  2L5G B;  1LTA C;  2E76 D;  1OMI A;  1PGP A;  1OWA A;  2Y0C A;  1CIE A;  1Y8A A;  4GT1 A;  2C0X A;  3H1J J;  2Q5U A;  3VP8 A;  1NNO A;  1SQQ G;  1PZQ A;  1GU4 A;  2OYH B;  3AED C;  3M06 A;  2BCC D;  1HH7 A;  2RN0 A;  1C6O A;  2B12 B;  1JTH A;  2WQY C;  2YO2 A;  2ZXX A;  4DCK A;  2KIK A;  3UIA A;  1Q7Y Q;  5AW7 B;  3H32 A;  1ZME C;  3HUS C;  3AEE C;  2B89 A;  1RHZ B;  4EI2 A;  3GMA A;  2R3C A;  5AVX B;  3L73 G;  1C2N A;  2OZ1 A;  3B5N B;  5DJU B;  3MD0 A;  4FA5 A;  3H1K G;  3HQ7 A;  4WQE A;  2ZYG A;  2O1K A;  3BRT B;  3NBS A;  4A7P A;  4J20 A;  1NTK D;  1FZE A;  1SQV K;  3B5N A;  3H1K D;  3G9R A;  4IFM A;  5B66 E;  2YKQ A;  3BCC D;  3ZIY A;  2FYU K;  1FOS E;  4ASW A;  1SFC B;  3FXE A;  2A06 E;  1IFN A;  1N90 A;  4AAL A;  1KN7 A;  2JEE A;  2AXT V;  5TIS H;  1SQV D;  1MG2 D;  2IDB A;  3USS A;  2V07 A;  4ASV A;  1NTZ J;  2JWA A;  1WT6 A;  1GDV A;  3A0B V;  2QJP C;  2KSJ A;  5AW5 B;  1RF1 C;  1FI9 A;  3CCM P;  1ETP A;  3RL0 D;  2IX7 C;  3TGU E;  1CTJ A;  5CMZ A;  1ZW0 A;  3PHL A;  2OQQ A;  2O01 N;  4U3F J;  1H9Y A;  1Q86 Q;  3MZW B;  3A0B E;  3RBX A;  1RF1 B;  2KLU A;  2RMZ A;  1HJ0 A;  2R5B A;  1NTM J;  3CXH H;  3A0B H;  1OZH A;  1T3U A;  3PH0 A;  3V6I A;  2KNC A;  2WPS A;  1L4A D;  5GTI E;  3JBT B;  3WUT A;  3SWF A;  3MHV A;  1T6A A;  3G4S P;  4IL6 X;  1LC1 A;  4N6J A;  4K3A A;  1MKM A;  2BCN B;  1NMI A;  4WQ8 A;  1U57 A;  2E5T A;  4GOF A;  1DIQ C;  3DP5 A;  4RO0 A;  1JCD A;  1JCC A;  3TGU G;  1MFT A;  1RE3 C;  2N9J A;  1CYJ A;  2NPS D;  3HUS A;  3IR9 A;  1YTC A;  4H44 C;  3SWK A;  1YYC A;  1BSH A;  3II6 A;  3L75 D;  4LLH A;  5KKZ C;  1T2K D;  1H31 A;  1NOH A;  3TNU A;  1M57 D;  3H1L E;  1EDK A;  3A2A A;  1EQ7 A;  2K3R A;  3GHG B;  2R44 A;  3HQ6 A;  4GOD A;  1ZV8 A;  3CXH D;  1PP9 E;  2NZ2 A;  1Q82 Q;  3PRJ A;  2IZ0 A;  2W6B A;  2O01 H;  1VQ4 P;  1KB9 H;  1W5C E;  2QE7 H;  3NWV A;  2WSF J;  5KLV J;  1CSU A;  2FY8 A;  1VQN P;  1KTM A;  1YI2 P;  1SQP J;  1DW1 A;  1R5L A;  3L75 J;  3BCC G;  5DJT B;  1FOS F;  1VF5 B;  5TIS E;  3AE2 C;  2QIW A;  1P84 H;  2C1D B;  1NJI Q;  2ITA A;  2ZOO A;  4GYD A;  3WMM 0;  2XND H;  1HBW A;  3L71 E;  1LS9 A;  5CYT R;  4C7N B;  3CCJ P;  2KK7 A;  3S9O A;  3A3Y B;  2KZJ A;  3SVW A;  4V2K A;  1YJ9 P;  5KAI V;  2LR2 A;  3H1I J;  2WZ7 A;  2CXB A;  1OIP A;  3CLQ A;  2I8F A;  4PW9 B;  1NTM G;  1S5L V;  1ZR4 A;  2AXT H;  2WMM A;  3C1L A;  2ZXE B;  1BCC G;  2H7H A;  1YHQ P;  1YIQ A;  1WVE C;  1LFM A;  1R0Q A;  3BCC E;  2BGV X;  4QAO A;  1RE3 A;  4H0K A;  3V4Q A;  1KIL B;  1W5C T;  2B87 B;  1Q81 Q;  3WFE C;  1URQ C;  1KMI Z;  1RH5 B;  3CD6 P;  3RMZ A;  1HJ4 A;  4UB6 E;  1JDL A;  2V7Q J;  1JY2 O;  3U59 A;  5AW3 B;  1QL3 A;  2AI5 A;  2B0Z B;  1KQL A;  2C1V A;  1GL2 B;  1K8A Q;  1PGQ A;  3L36 A;  3G71 P;  1JM0 A;  5AW1 B;  1PPJ G;  2FXO A;  1L9J C;  4H0J A;  3MUD C;  3TGU D;  1KIL C;  2DGE A;  2WSS H;  1U7M A;  3H1I D;  4RJT A;  4R4M A;  1LMS A;  1CSX A;  2Q9I A;  2E5Y A;  3CXH I;  3Q2Y A;  2E75 C;  1CTY A;  4JYB A;  3HD7 B;  3H32 B;  3JC2 2;  1C7M A;  1USE A;  4HYT B;  1EDJ A;  1LTJ B;  5APS A;  1DW0 A;  1CXC A;  3D71 A;  3OA8 B;  4H0L B;  4JBZ A;  5APV A;  4NPE A;  1U75 B;  1LJ2 A;  5KKZ B;  2A06 D;  1F1C A;  2G8Y A;  1FI3 A;  1JMB A;  351C A;  3PXS A;  2D2C C;  1LTJ A;  1WRG A;  4L76 A;  1SQP D;  1KYO H;  4DOJ A;  4DY9 A;  4XYD B;  3OCD A;  3RK3 C;  2MHM A;  1NTZ E;  3SFE C;  2OYH C;  2K9J B;  4HH2 A;  4AYC A;  4L1Q A;  2E75 B;  1W2E A;  5K5G B;  2YMY A;  4WY4 C;  2GM4 A;  1CRH A;  1N86 A;  3D6Z A;  4Y99 B;  5APT A;  3RN1 A;  1E29 A;  1IQC A;  1RE4 C;  2C9L Y;  3IF4 A;  2B9B A;  1DVH A;  1DEE G;  5APQ A;  2WSE J;  4AX3 A;  1JY2 P;  2A45 H;  3KXD A;  4I7Z C;  1GW3 A;  5BU5 A;  3P8M C;  2BLF B;  1K04 A;  5KLV K;  3H1I G;  1LGH B;  3KQG A;  1FZG A;  1VDF A;  5CHX A;  5IY5 1;  2N3Y A;  3L70 E;  1CRG A;  3V2R A;  2LXC B;  3I56 P;  2HPC A;  3L4O A;  1NAY A;  3N7N A;  3H1H D;  1SQX E;  2WPQ A;  3NTN A;  1K05 A;  3AEA C;  2YMK A;  1CI6 A;  1E5W A;  1VQP P;  2P7J A;  2CE1 A;  3SWS A;  2NPS C;  1CRY A;  3L72 G;  5APY A;  1N7S D;  4CPG A;  4RSZ A;  2IBZ D;  3CX5 D;  1S9K E;  3GG2 A;  1NKN A;  1CYI A;  1CI6 B;  3S1K A;  2QG4 A;  4EOT A;  3PTZ A;  3CCS P;  1AQT A;  1NTM D;  3CCQ P;  1WMK A;  4WQ9 A;  4LGD E;  3ZOX A;  2NPS A;  5KAI H;  1K3G A;  1ZOY C;  5KJ7 C;  1HRC A;  2QSI A;  3TSI A;  3ITK A;  5AVZ B;  1AQ5 A;  1H0T A;  4WWI A;  2GB8 B;  3MIW A;  2CA3 B;  2AEF A;  1VQ7 P;  4I1L A;  3NFQ A;  4Y99 C;  2K88 A;  3LW5 H;  1M6Z A;  1BL9 A;  3H1H E;  1HCM A;  1L0N G;  4JQ0 D;  2KP8 A;  2I8D A;  3TNU B;  2FYU E;  2WT7 A;  4NPD A;  1UIX A;  2K1A A;  3O0R C;  2OTK E;  3RN0 A;  1QGK B;  4XA4 A;  2Q3E A;  1T8Z A;  2YQB A;  1HH0 A;  1JY2 N;  2N1T C;  2W6J H;  3AEC C;  3KHU A;  2IYO A;  2WT7 B;  5B5E V;  1HWT C;  4GKG A;  1L9B C;  1IRW A;  1NU1 G;  5AVW B;  3WFD C;  3I55 P;  3D0W A;  2I1J A;  1H33 A;  3HE4 A;  1L2P A;  2EXV A;  1H32 A;  1IFJ A;  2XU6 A;  3RK2 B;  4ZKP A;  2ZT9 C;  1RE4 A;  3WU2 V;  1T3J A;  3L75 G;  2CE0 A;  3VMZ A;  4EDF A;  3H1H G;  1BGY J;  3L73 J;  3TF5 A;  4R4L A;  1HZV A;  3H25 A;  2QRX A;  1OW8 A;  1XTG B;  2KOG A;  2HV4 A;  3AEB C;  1KV9 A;  1IO4 A;  4Z1M H;  1EB7 A;  5B66 H;  3O5C A;  2E76 B;  2ZBO A;  1IZN B;  3HE5 B;  4YXW H;  2C0W A;  2L4D A;  3FGA D;  3SJL A;  3VMY A;  2GUS A;  1OAE A;  3CCE P;  1KV4 A;  2P1J A;  3EWK A;  1PL5 A;  5AVU B;  1KQG B;  5CIH B;  3KZI V;  2FYU J;  3PP5 A;  5GTI H;  3P8C E;  3L4M A;  4H0L C;  1J1E B;  3H1J D;  3CXH E;  1CHI A;  1QL4 A;  1CO6 A;  1L0L G;  3TYY A;  1IRV A;  5KAF V;  2UWJ E;  1SQV G;  1VQ5 P;  3N4X A;  3B5N D;  1NYH A;  1C52 A;  1HGZ A;  4K3I A;  2BAS A;  3B5N C;  3CCU P;  3KZI H;  1VQ6 P;  1IFI A;  1VQ9 P;  3MGN A;  5GTI V;  2M3E A;  2DW3 A;  2GA1 A;  2J5U A;  1S1C X;  2RH0 A;  3O8Z A;  3RBZ A;  2R5D A;  3U1A A;  1FS0 E;  2B88 A;  1DT1 A;  4RES B;  5CJ0 A;  1M1K Q;  3EFG A;  2K9Y A;  1A56 A;  4H13 C;  2SPZ A;  4WY4 D;  5KLI B;  1HJB A;  2ZZS 1;  1SQP K;  1COT A;  3H1L G;  3V4W A;  3S4R A;  2Z5H A;  2ZVN B;  1GL2 C;  3B71 A;  1AKK A;  3AE7 C;  5CBO A;  2D2C B;  2N18 B;  1FAV A;  2E74 B;  1EZV G;  2BCC G;  2YXQ B;  1GTW A;  5KLI C;  3SFD C;  2FYN C;  4I6M C;  1GD2 E;  1BCC D;  1VQO P;  2QM7 A;  1J1E C;  1LWU C;  2C9X B;  1CIG A;  2WSF H;  5DJQ B;  2ZAE B;  4WB4 A;  1JTH B;  3RK3 E;  2YIU C;  1RAP A;  1K73 Q;  1RF1 A;  1COR A;  2YKP A;  5KLV D;  5KLV E;  3Q3D A;  1Y9B A;  2OYO A;  2LIR A;  3VYI A;  2JQR A;  3RK3 D;  2OAR A;  3OA7 A;  2LIT A;  1P84 I;  4UB8 E;  1L0N J;  4U3F E;  1KYO D;  4LJI A;  3M9B A;  2WPR A;  1EDI A;  1KX2 A;  4AAO A;  1KIL D;  1VYD A;  2JP3 A;  5CCG D;  1M1J B;  1H32 B;  3WFC C;  5DJQ C;  1EXJ A;  2P10 A;  3NMD A;  2BCC E;  1USD A;  1FZC B;  4YXD C;  1SQB G;  3R2P A;  1CHH A;  3WU2 H;  2YIU B;  3KDP B;  3CWB E;  3ZOW A;  4I2L C;  5AW8 B;  1FDO A;  1Y47 A;  4XXL A;  2GC7 D;  1N2D C;  3T97 B;  1YBK A;  3MP7 B;  3HTK A;  1GK4 A;  1ZP0 C;  3E1R A;  1LT1 A;  3AEF C;  5AVQ B;  3JCU E;  3PH2 B;  2CPS A;  1IO3 A;  2VHD A;  1SQP G;  3TK1 A;  1E8E A;  1L4A A;  5CIC B;  1CTZ A;  2J59 M;  1SQV J;  2R3S A;  4EIF A;  1SQB J;  1H0T B;  3ABV C;  1BDD A;  3I5C A;  2JTI B;  4YTP C;  3LW5 J;  2IPP A;  2V7Q H;  4B86 A;  4H0L D;  1M56 D;  2HR3 A;  5KJ7 A;  1KYO W;  1JEK A;  1DH3 A;  3BVH A;  1DD4 A;  3SSU A;  1N73 C;  4Q5P A;  3HRN A;  4L3H A;  3G6E P;  5GTH V;  2FFD A;  1NO4 A;  2QEX P;  4NFG B;  2M5A A;  4GDO A;  1DW2 A;  1VF5 D;  155C A;  3VP9 A;  1RAQ A;  2FYZ A;  3CWB G;  2I1K A;  1UII A;  2KZI A;  1VPC A;  1QEX A;  1QLE D;  3LID A;  4WQA A;  4Y28 J;  3L70 D;  3P8C D;  1CSB A;  2O1J A;  5H2F V;  1KQS O;  3PXW A;  2J58 A;  3E7K A;  1BCC J;  3AEG C;  1I6D A;  2W27 A;  2C2C A;  2BH5 X;  1A2S A;  3WUU A;  1CC5 A;  5GTH H;  3IN6 A;  2BEZ F;  3RGU A;  3BRV B;  3CC2 P;  1NTZ G;  1SFC D;  1YIT P;  2YO3 A;  1N73 A;  4AAN A;  1FE6 A;  1AVY A;  3P32 A;  4O1Q A;  1HTL C;  1KFM A;  3HUS B;  2FYN B;  2MTA C;  1E2R A;  2PCB B;  2ZON G;  2WIT A;  4L74 A;  3L71 G;  2JWD A;  3DR0 A;  3M97 X;  3L70 J;  1KZU B;  1TU3 F;  1J1D B;  5AVV B;  3B4S A;  1OFC X;  2W8Z A;  3B8E B;  1HGV A;  2P67 A;  3M91 A;  2E76 C;  1SS1 A;  1DVV A;  1H33 B;  1GL2 D;  1DW3 A;  3CX5 I;  2Y0E A;  3TYI A;  5B6Q A;  5EXQ A;  1C75 A;  4AUW A;  1HRO A;  1NTM E;  3HD7 C;  1H89 A;  1S72 P;  1KB0 A;  4TT3 H;  5CIF B;  1OCD A;  3RL0 C;  1B7V A;  1IZL 0;  4IL6 H;  5AW6 B;  2C1D A;  3BAT A;  4PJ0 E;  2GC4 D;  3L74 J;  2H43 A;  5BVZ A;  3L74 D;  2C9N Y;  3Q1M A;  2ORL A;  1P84 D;  1P84 E;  3O20 A;  4OGQ D;  1SQQ D;  1LTJ C;  2ZVO B;  3M9Q A;  1FZB A;  1ZZH A;  3AE6 C;  2ZYA A;  2HOD B;  3H1H J;  1LTB C;  1NGM B;  3HQ8 A;  2V4H A;  4GED B;  2QJK C;  3OCD B;  1BE3 J;  1FZC A;  1A02 F;  1GU5 A;  1YTZ T;  3V2Q A;  3H1L D;  1X9V A;  3Q5S A;  3OW2 O;  2P58 A;  4U3F D;  3FWL A;  1IK7 A;  2YCC A;  5AW2 B;  1QYZ A;  4PJ0 V;  2A45 I;  1URQ A;  4U7J A;  1CZQ A;  4D6T E;  4RKU J;  2O01 J;  2WSC J;  1NVO A;  1YEB A;  1BGY D;  1I6E A;  2OTL P;  1G1I A;  1QX8 A;  1K3H A;  3VMX A;  4FB1 A;  1SFC A;  2HLO A;  1M8O B;  3MUD A;  1KIL A;  2WVR A;  3DMI A;  2Y9Y A;  1JB0 J;  4O1W A;  3L71 D;  2M8R A;  5E79 H;  1LP1 A;  1S5L H;  3SWY A;  5CCH A;  3A0H V;  2N1T D;  1SFC C;  2YK3 A;  3L72 J;  2N1T A;  4AQR D;  1Q90 D;  2M3B A;  2KNC B;  4P4Q B;  1M7L A;  2FFD B;  5E79 E;  1EXI A;  1KFN A;  2XDJ A;  1JNM A;  1HVV A;  3CPW O;  1PIX A;  3ZDM A;  4W7Y A;  1JY3 N;  1VQK P;  3A9F A;  1NIR A;  1X8Y A;  4D6T G;  1A8C A;  1N7S B;  1I5T A;  1KIL E;  1LTT C;  1N15 A;  5H2F H;  1NTM K;  2XV5 A;  2P2U A;  4UB6 V;  2YXR B;  3FXD A;  3L35 A;  1FCD C;  3ZCF A;  3L70 G;  1CNO A;  4H44 B;  1AJY A;  3L71 J;  1VQ8 P;  3TGU J;  3OAK A;  1PFI A;  3D6Y A;  2N18 C;  3HQ9 A;  2IFM A;  4EID A;  1LTI C;  1JOC A;  2KXP B;  1W2B O;  4N78 E;  2Q1K A;  1YIJ P;  1HUC A;  1S5L E;  2K9J A;  2KSE A;  3L72 E;  1ZLL A;  3RK2 C;  4BRY B;  1BE3 E;  1RF0 C;  3MK7 C;  1N7S C;  3IFM A;  1SQB D;  3HTK B;  1KX7 A;  2O3J A;  3F89 A;  2FXM A;  1S2E A;  4UB8 H;  3NBT A;  3AE5 C;  1U74 B;  4YE1 A;  1NAF A;  2BH4 X;  2FBW C;  5CID B;  3CI9 A;  2IZ1 A;  1L0L E;  3CX5 E;  3ZOO A;  2BEQ D;  3RL0 B;  1S6V B;  3L74 G;  1M1J A;  1BGY G;  2Q6Q A;  2AXC A;  3GHG A;  1I8O A;  1SQB K;  2QVA A;  2QM8 A;  3GLM A;  1GKS A;  3EQ2 A;  3TDK A;  2AEM A;  1OVV A;  1L0N E;  2OZ1 B;  2Z5I A;  4IL6 V;  1QL1 A;  1VL2 A;  4OGQ C;  1L4A B;  1DX7 A;  3VOP A;  1L0N D;  1S9K D;  2ZJS E;  1C2R A;  2HYN A;  3H1K J;  1CIH A;  1JO5 A;  2M0B A;  1NTK J;  2HOD A;  5M1B A;  3L73 D;  4HB1 A;  1GK6 A;  1LNQ A;  5CCH C;  2YKO A;  3JCU H;  2B11 B;  1EC5 A;  1CXA A;  1NML A;  1GMJ A;  1BGY E;  1NH4 A;  2C8S A;  1URQ B;  1PP9 D;  2OTJ P;  2B87 A;  1VQL P;  3H1J E;  3A7O A;  2POH A;  1AFO A;  1NTZ D;  4NPF X;  1H8A A;  1H9X A;  1BSN A;  3L75 E;  3VMA A;  1AVO A;  1BDC A;  2N9I A;  2KI7 B;  2BCC J;  1N9C A;  3H1K E;  2FXP A;  3FX0 A;  2BPB B;  4KMG A;  1KC8 Q;  3EFF K;  3V2P A;  1LC2 A;  2PAJ A;  5GTH E;  3QH9 A;  4MN4 C;  1FDI A;  5AUR A;  1CRI A;  1URQ D;  3A0H H;  3X39 A;  3HD7 A;  1KIB A;  1PP9 J;  3CX5 W;  3CWB J;  1X0T A;  1D7M A;  2RKL A;  1MZ4 A;  1AYG A;  2ZXY A;  1A02 J;  1YJN P;  3OA8 A;  1IK9 A;  5AW4 B;  1YJW P;  2A06 G;  2ZT9 D;  1H1O A;  4WY4 A;  1R8E A;  3H1J G;  2CK3 H;  3C8V A;  2FKW B;  1SQB E;  2PRR A;  4HKZ H;  2HFE D;  5CIE B;  1SQV E;  2WTY A;  3W67 A;  2KYV A;  4UB6 H;  3OJA B;  1CCH A;  4D6T D;  4WY4 B;  2K37 A;  1KD1 Q;  3PLN A;  2OYH A;  1MUU A;  1I54 A;  3CYT I;  2MKV A;  1S5L X;  2ZT9 B;  5C0Z A;  1X79 B;  2AXT E;  1FHB A;  2FYU D;  1PGO A;  2E74 D;  1GQ1 A;  2WWW A;  3M9H A;  3RL0 g;  3D70 A;  4FA9 A;  1RZ5 A;  3O6Q A;  1AOF A;  2E74 C;  5KAF E;  3U1C A;  5AVS B;  2AEJ A;  1M70 A;  1KB9 E;  2N9B A;  3VN0 A;  4JCG A;  4UB8 V;  1LTS C;  4JF7 A;  5B66 V;  3O1Y A;  3CCV P;  1CYC A;  1KOR A;  3CL3 D;  1YFC A;  3M0D A;  5DFS A;  1EZV E;  1KB9 D;  3KZI E;  1NHL A;  3T97 A;  2H88 C;  2WPV B;  2JKV A;  1QN2 A;  5AVY B;  4WBA A;  4WQC A;  3M0A A;  1SQX K;  4KT0 J;  4EYY Q;  1PPJ D;  1H88 A;  5CIG B;  2OYI B;  2YNY A;  1KQF B;  3P7K A;  1RQV A;  5KLV G;  3MK7 B;  4DT0 A;  2C1U A;  3HD7 D;  1FOC A;  3L73 E;  1ZRT E;  3CU4 A;  1Z56 A;  4FAV A;  1I55 A;  3VRD A;  4WQD A;  1FJK A;  2ZFC A;  1QVG O;  4IFD K;  1YQ4 C;  3WU2 E;  1C6R A;  1SQX D;  1FZC C;  1JY3 P;  2W6A A;  4KJM A;  2D0S A;  4PD4 D;  4AAM A;  2M5A B;  1IJD B;  1PP9 G;  1CED A;  1MV8 A;  1U7J A;  4U3F G;  5BU8 B;  5AVR B;  2OYI C;  2IBZ E;  3SXT A;  3AE9 C;  1L0L K;  1JMM A;  2XKM A;  3WUI A;  2XNX A;  5KTB A;  1C6S A;  1SQX J;  2E75 D;  4MU8 A;  1ZR2 A;  2H8P D;  5KJ7 D;  4OVN F;  3Q5P A;  2NPS B;  1FC2 C;  2A45 G;  4OGQ B;  2E42 A;  5L8R J;  4KHX A;  1E79 H;  1HF9 A;  5CIB B;  1X22 A;  5TJH A;  2FFD C;  1GU2 A;  1FZA A;  3PJS K;  5APU A;  2QJY C;  4PV1 C;  4D6T J;  4JPZ B;  1RY3 A;  1N73 B;  3AE8 C;  4C46 A;  3AE4 C;  1CCR A;  1SQP E;  5APX A;  2L91 A;  3L37 A;  3JSV C;  1GDT A;  4W80 A;  1J2J B;  4PD4 E;  3GF7 A;  3ZBM A;  1DII C;  1MZ9 A;  4N78 D;  1QL2 A;  2GUV A;  3ZOY A;  4L73 A;  5EFW B;  2IBZ G;  3WC8 A;  5CCH D;  1YCC A;  1YQ3 C;  3MTU E;  1RF0 A;  2W83 C;  4IL6 E;  2FWL A;  2Y9Z A;  1H31 B;  1ZRT D;  1IC2 A;  2WSE H;  4O9B A;  1LT9 A;  3RLM A;  1SLQ A;  2QJY B;  4C7R A;  1SQQ J;  1BCC E;  1NU1 K;  1KYO I;  1J3S A;  1RQU A;  4PV1 D;  1GIW A;  3C9I A;  3HE4 B;  1FBM A;  3WUV A;  2N3B A;  1J1D C;  1IFM A;  2Y0D A;  1W2L A;  1M1J C;  2B4Z A;  4BWN A;  2QA4 P;  1YNR A;  3C2C A;  1OX3 A;  3CX5 H;  2KS1 B;  4L3G A;  4PD4 I;  3VTP C;  2NRG A;  1NTZ K;  4QMA A;  3A5T A;  1EDL A;  1T2K C;  1ZN5 A;  3W68 A;  3BAS A;  1L0L J;  1PPJ E;  5B5E E;  4H44 D;  1N8R Q;  1PV3 A;  4PV1 B;  3IAO A;  1MFZ A;  2Q3I A;  2PP6 A;  451C A;  4DZO A;  4XE5 B;  2V08 A;  3Q5R A;  2KUB A;  3CWB D;  2AIU A;  1G2C A;  4H13 B;  3FWN A;  2Z4E A;  2KLV A;  3CCR P;  1EZV I;  1SVF A;  1VQM P;  4EIE A;  1FJP A;  4IFF A;  2H89 C;  4M3L A;  3RK3 B;  1SQQ K;  4N0K A;  3F5H A;  2OYI A;  1RZ6 A;  3QWO C;  4FA4 A;  3CC4 P;  4BXL A;  1PGJ A;  2IBZ I;  1FI7 A;  1KYO E;  4N3Y B;  5DF5 A;  2JDI H;  2XZR A;  5CJ4 A;  1ZXG A;  4LC1 A;  4GOE A;  2IFN A;  1IFP A;  1NTK G;  4WVZ A;  1HZU A;  1AOQ A;  1LWU A;  4H13 D;  2QJK B;  4WQB A;  4PD4 H;  5E79 V;  3V2N A;  4JYC A;  1I8P A;  1FJ0 A;  2JO1 A;  3V5B A;  3WFB C;  3CC7 P;  2WSC H;  1GL2 A;  3A0H E;  1YEA A;  1QKS A;  2CPB A;  1LWU B;  1N7S A;  1NU1 J;  5AW0 B;  1YTZ I;  5AW9 B;  4GIF A;  2LKM A;  4OWF A;  1AV1 A;  3AE1 C;  1LP1 B;  1GW4 A;  3H1L J;  4DJG A;  1FDM A;  3AE3 C;  4PWA A;  1SQX G;  3E1I A;  1SP4 A;  4EIC A;  3H1I E;  2QJP B;  2N1T B;  1CSV A;  1LTG C;  1K9M Q;  1NTK K;  3O6Q B;  3CP5 A;  3LIE A;  1AA0 A;  1M90 Q;  1NTK E;  4FAN A;  2LXB A;  2FRC A;  1DEB A;  2DVH A;  2HG5 D;  3KPE A;  4BRY A;  4YPC A;  2XTS B;  2N9Y B;  4I7Z B;  2Q7C A;  3L4F A;  4EIJ A;  5CCG C;  1OW7 A;  1JY3 O;  1OVR A;  2HPC B;  1MG3 D;  1EZV D;  2D0W A;  2CA4 B;  3L72 D;  1WEJ F;  3KYQ A;  1FU1 A;  1NKZ B;  4ZNC A;  5C39 A;  2B10 B;  2PFX A;  3BCC J;  4XFJ A;  3G3Z A;  3K5B A;  1LT9 C;  3GW6 A;  2R32 A;  3M0D C;  1L4A C;  2FYU G;  1R5S A;  5TIS V;  1CIF A;  4TLF A;  1HJ3 A;  1S4X A;  1IFD A;  1OXZ A;  3H6P A;  3CXH W;  1OVU A;  3HE5 A;  1L0L D;  4WQ7 A;  2MJZ A;  1XTC C;  4L75 A;  3VNW A;  1CW5 A;  5APW A;  2D2C D;  2KS1 A;  2JR8 A;  4FA1 A;  5KAF H;  3GHG C;  1BE3 G;  3NXS A;  1FZF A;  1CRJ A;  4PJ0 H;  4C7N A;  3CME P;  2ZYD A;  5CCG A;  1OW6 A;  1NU1 E;  2GIW A;  2IYP A;  1YIC A;  1G1J A;  1BE3 D;  5AVT B;  1VF5 C;  3PXT A;  3VYM A;  3GF3 A;  1G2C B;  4ZMD A;  2W90 A;  1CRC A;  1L0N K;  3CMA P;  2JJL A;  1CHJ A;  2PCC B;  2G3A A; 
#chains in the Genus database with same CATH homology
 1GQ1 A;  4Y5R A;  5H2F V;  4FA9 A;  3ORV A;  1CRH A;  1CSW A;  1RZ5 A;  3PXW A;  1AOF A;  1I6D A;  1M60 A;  1M70 A;  3RN1 A;  1GJQ A;  4JCG A;  1E29 A;  1IQC A;  2C2C A;  4UB8 V;  2BH5 X;  1A2S A;  5B66 V;  3O1Y A;  1CC5 A;  1DVH A;  1CYC A;  1HJ5 A;  1N50 A;  1YFC A;  5DFS A;  4AX3 A;  1KB9 D;  2BLF B;  1NU1 D;  3SLE A;  1QN2 A;  1F1F A;  2PAC A;  5IY5 1;  2N3Y A;  4AAN A;  1CRG A;  4WQC A;  4O1Q A;  1PPJ D;  5CIG B;  2FYN B;  3L4O A;  3H1H D;  2MTA C;  1E2R A;  2PCB B;  5C9M A;  3MK7 B;  2ZON G;  2C1U A;  2CE1 A;  3SWS A;  1FOC A;  3DR0 A;  3M97 X;  1CIE A;  2Y0C A;  3CU4 A;  4FAV A;  1CRY A;  1I55 A;  3VRD A;  4WQD A;  4RSZ A;  1NNO A;  2IBZ D;  1DVV A;  1H33 B;  1C6R A;  1SQX D;  2BCC D;  1HH7 A;  3CX5 D;  1DW3 A;  3GG2 A;  1CYI A;  2Y0E A;  2QG4 A;  3TYI A;  5B6Q A;  2RN0 A;  3PTZ A;  5EXQ A;  1C75 A;  1NTM D;  2D0S A;  4PD4 D;  4AAM A;  1HRO A;  1C6O A;  2B12 B;  4WQ9 A;  1CED A;  3ZOX A;  1K3G A;  1KB0 A;  1HRC A;  5CIF B;  1OCD A;  3SXT A;  3ITK A;  2GB8 B;  3WUI A;  2OZ1 A;  1B7V A;  1C2N A;  1C6S A;  1IZL 0;  4MU8 A;  4FA5 A;  2CA3 B;  3HQ7 A;  4WQE A;  2C1D A;  2GC4 D;  3L74 D;  3NBS A;  4A7P A;  2ORL A;  1P84 D;  4J20 A;  3O20 A;  1SQQ D;  5CIB B;  5TJH A;  1M6Z A;  1BL9 A;  1HCM A;  1NTK D;  1GU2 A;  1ZZH A;  3H1K D;  3HQ8 A;  4GED B;  3OCD B;  3BCC D;  3ZIY A;  3O0R C;  3H1L D;  1CCR A;  3RN0 A;  2Q3E A;  2YQB A;  4U3F D;  3FWL A;  2YCC A;  1N90 A;  2L91 A;  1QYZ A;  4PJ0 V;  3KHU A;  4AAL A;  3ZBM A;  1DII C;  5B5E V;  2AXT V;  1SQV D;  1YEB A;  1L9B C;  1IRW A;  1BGY D;  1I6E A;  3ZOY A;  1MG2 D;  3WFD C;  1K3H A;  2V07 A;  3WC8 A;  4FB1 A;  1YCC A;  2JWA A;  1H33 A;  2FWL A;  1H31 B;  1GDV A;  1ZRT D;  3RLM A;  2EXV A;  3DMI A;  1H32 A;  3A0B V;  4O1W A;  3L71 D;  2QJY B;  3WU2 V;  2CE0 A;  1FI9 A;  4EDF A;  1ETP A;  3A0H V;  1J3S A;  1CTJ A;  3TF5 A;  2YK3 A;  1GIW A;  3PHL A;  1HZV A;  2N3B A;  2HV4 A;  1W2L A;  4P4Q B;  1KV9 A;  2KNC B;  2Y0D A;  2B4Z A;  1H9Y A;  1EB7 A;  3O5C A;  2ZBO A;  1YNR A;  3A9F A;  3C2C A;  2RMZ A;  1NIR A;  2L4D A;  4L3G A;  3SJL A;  1A8C A;  1OAE A;  1I5T A;  1N15 A;  3JBT B;  5CIH B;  3KZI V;  4UB6 V;  1LC1 A;  3L4M A;  1FCD C;  3ZCF A;  1CNO A;  3H1J D;  451C A;  2BCN B;  1CHI A;  1NMI A;  2V08 A;  1QL4 A;  1CO6 A;  3CWB D;  4WQ8 A;  1IRV A;  2N18 C;  3HQ9 A;  2AIU A;  5KAF V;  4EID A;  1DIQ C;  3DP5 A;  4EIE A;  1C52 A;  2N9J A;  4K3I A;  4N0K A;  1CYJ A;  1RZ6 A;  1YTC A;  4FA4 A;  3MK7 C;  3L75 D;  1H31 A;  1SQB D;  1KX7 A;  5GTI V;  1FI7 A;  2O3J A;  5DF5 A;  3NBT A;  1U74 B;  4YE1 A;  3HQ6 A;  3CXH D;  2BH4 X;  5CID B;  1DT1 A;  3ZOO A;  1HZU A;  1AOQ A;  2QJK B;  3PRJ A;  1S6V B;  4WQB A;  5E79 V;  1A56 A;  3NWV A;  1I8P A;  1I8O A;  1FJ0 A;  1CSU A;  5KLI B;  3WFB C;  2ZZS 1;  1GKS A;  1YEA A;  1QKS A;  3TDK A;  1COT A;  1DW1 A;  2OZ1 B;  1AKK A;  4IL6 V;  2C1D B;  2N18 B;  2ZOO A;  4GYD A;  1L0N D;  4PWA A;  1C2R A;  4EIC A;  2QJP B;  1BCC D;  1CIH A;  1CSV A;  1LS9 A;  2C9X B;  5CYT R;  1CIG A;  3CP5 A;  5DJQ B;  3SVW A;  4V2K A;  3L73 D;  5KAI V;  4FAN A;  1RAP A;  2FRC A;  1COR A;  2B11 B;  1CXA A;  5KLV D;  1NML A;  2DVH A;  2CXB A;  2LIR A;  2JQR A;  2C8S A;  2I8F A;  1PP9 D;  2XTS B;  2N9Y B;  2LIT A;  4PW9 B;  1S5L V;  1NTZ D;  1KYO D;  4LJI A;  1H9X A;  3VMA A;  1YIQ A;  1WVE C;  1LFM A;  1R0Q A;  2BGV X;  1MG3 D;  1KX2 A;  4QAO A;  2N9I A;  1EZV D;  4AAO A;  1VYD A;  4H0K A;  2D0W A;  2CA4 B;  1N9C A;  1W5C T;  3L72 D;  2BPB B;  3WFE C;  4KMG A;  1WEJ F;  1H32 B;  3WFC C;  5DJQ C;  3RMZ A;  1HJ4 A;  1JDL A;  2B10 B;  1CHH A;  1QL3 A;  2AI5 A;  2B0Z B;  2YIU B;  1LC2 A;  2C1V A;  3ZOW A;  5AUR A;  1CRI A;  3X39 A;  3GW6 A;  1KIB A;  4XXL A;  2GC7 D;  1L9J C;  4H0J A;  3CX5 W;  3TGU D;  5TIS V;  1CIF A;  1MZ4 A;  1AYG A;  2DGE A;  1HJ3 A;  2ZXY A;  3PH2 B;  3H1I D;  1IO3 A;  2VHD A;  3CXH W;  3OA8 A;  4RJT A;  1LMS A;  1CSX A;  1L0L D;  4WQ7 A;  5CIC B;  1E8E A;  1CTZ A;  1H1O A;  3VNW A;  1CTY A;  2KS1 A;  1C7M A;  4EIF A;  4FA1 A;  2JTI B;  1CRJ A;  1DW0 A;  1CXC A;  2GIW A;  3OA8 B;  1YIC A;  5CIE B;  1KYO W;  1BE3 D;  1CCH A;  4D6T D;  3PXT A;  3PLN A;  1U75 B;  4Q5P A;  5KKZ B;  3VYM A;  2A06 D;  4L3H A;  1F1C A;  1FI3 A;  1I54 A;  351C A;  3PXS A;  5GTH V;  3CYT I;  1SQP D;  4NFG B;  4DY9 A;  1CRC A;  1DW2 A;  4XYD B;  155C A;  3OCD A;  1RAQ A;  2MHM A;  5C0Z A;  2K9J B;  1FHB A;  2FYU D;  1CHJ A;  4L1Q A;  4WQA A;  2PCC B;  3L70 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...