1NTMD

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 50
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntmD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntmD01
2GIWA 2ZXYA 155CA 2ZBOA 3H1HD 4WQEA 1OAEA 4WQBA 2FYNB 1CYJA 3PXSA 451CA 1FI9A 2B11B 3H1JD 1IO3A 4P4QB 1DW1A 1CIFA 1OCDA 2C1DA 1C75A 5CIDB 3SLEA 1NTKD 4YE1A 1H32A 3HQ9A 4RSZA 3SXTA 3O0RC 4K3IA 1K3GA 2L91A 3WFEC 1NTMD 3H1LD 1CXAA 1KYOD 4AAMA 2Q3EA 2B10B 1P84D 3O5CA 3HQ8A 1HJ5A 4XYDB 1NNOA 4FANA 1U74B 1KYOW 1CIHA 2JWAA 2BLFB 2OZ1B 1CSWA 4FA1A 1H9XA 1IRWA 2MHMA 5AURA 1GKSA 1CEDA 5KLIB 4NFGB 1CRHA 3ZBMA 2DVHA 2CXBA 3CU4A 5TISV 1NTZD 1CXCA 1YFCA 1NMLA 1KX7A 2YQBA 351CA 1LFMA 1S5LV 1QL4A 2XTSB 2KNCB 1H31B 1CTJA 5C0ZA 5CICB 1I5TA 4DY9A 3GG2A 3ZOOA 1YIQA 4V2KA 2N9YB 1AKKA 1L9JC 3VRDA 3H1ID 4O1QA 3CX5D 1DW0A 3M97X 2FRCA 3C2CA 1QL3A 2Y0CA 1L0ND 3CX5W 4U3FD 1C2RA 2MTAC 3WFBC 3WUIA 1AOFA 2D0WA 1KX2A 1SQXD 1W5CT 4AAOA 2C2CA 3O1YA 3O20A 1J3SA 1W2LA 1MG2D 3VNWA 2A06D 4L3GA 1U75B 1CC5A 5DJQB 2ZZS1 1BE3D 4IL6V 3FWLA 1ETPA 5CIEB 3RLMA 1CYIA 4AX3A 1M70A 1GDVA 1KB0A 1NIRA 5GTHV 3L71D 2N18C 4H0KA 2YCCA 2GB8B 2K9JB 1N9CA 3CP5A 2CE0A 3MK7B 4UB8V 4EIEA 1EB7A 2B12B 1I6DA 3GW6A 4WQCA 1SQVD 1AOQA 4WQDA 1N90A 1YEAA 1R0QA 3CXHD 3RMZA 2V07A 1DT1A 3OCDB 2GC4D 3CXHW 2B0ZB 1LC2A 5KKZB 5DJQC 1L0LD 5B66V 1BL9A 1HROA 1IQCA 3X39A 1HRCA 3VMAA 3WFDC 2EXVA 4PWAA 4EDFA 3L4MA 1HJ4A 1BGYD 1CCHA 4FA9A 2DGEA 2BH4X 3MK7C 2L4DA 2YK3A 1LMSA 1YEBA 1JDLA 1DIQC 2CE1A 1FI3A 3NBSA 2O3JA 1CIEA 3VYMA 2ZOOA 5CIHB 4AALA 1KV9A 1DW2A 1C6SA 2Y0DA 3WU2V 4PD4D 4RJTA 3SVWA 4J20A 4L3HA 3KHUA 1I54A 3DMIA 1I6EA 1IRVA 1NMIA 2N3BA 1CHJA 1NU1D 1PP9D 2OZ1A 3CYTI 1A2SA 4Q5PA 1LS9A 2Y0EA 1RAPA 2CA4B 1A56A 2N18B 4FB1A 4GEDB 3ZCFA 2KS1A 4JCGA 4A7PA 1SQPD 5C9MA 3ZOWA 4FA4A 1GJQA 2GC7D 1C7MA 1KIBA 1MG3D 2VHDA 1CHHA 1H31A 4MU8A 2IBZD 5EXQA 3ORVA 2I8FA 1EZVD 1GU2A 2QJYB 3L4OA 4GYDA 2C1UA 1H1OA 4KMGA 1QYZA 5GTIV 1F1CA 3PH2B 1FOCA 1CORA 3ITKA 1H33B 1DIIC 1DW3A 1C6OA 3PRJA 1LC1A 1I8OA 2QG4A 5TJHA 1S6VB 1CO6A 3L73D 1HZVA 1B7VA 2HV4A 3CWBD 3SWSA 2ZONG 1DVHA 1ZZHA 5DFSA 2JTIB 1CSUA 4EIDA 3L72D 2C1DB 2N9JA 4WQ7A 3L75D 3A0BV 5DF5A 5KAIV 1K3HA 5IY51 3TF5A 1WEJF 2C8SA 1H32B 3JBTB 1BCCD 1C2NA 4LJIA 1SQQD 4XXLA 1YTCA 1FCDC 1FJ0A 4WQ8A 4L1QA 1MZ4A 1AYGA 1QKSA 2V08A 3HQ6A 5CIBB 1YICA 1L9BC 3PXTA 1E29A 2RN0A 4PW9B 1COTA 1F1FA 4FA5A 1HZUA 3OCDA 1CTZA 3L74D 4AANA 1RAQA 3OA8B 1CNOA 1H9YA 1CYCA 2N9IA 1YNRA 1HJ3A 3ZOYA 2QJPB 4EIFA 1ZRTD 2QJKB 2D0SA 1CRIA 1M60A 4D6TD 1N15A 2FWLA 1CCRA 2B4ZA 3RN0A 3RN1A 2CA3B 2BCNB 3NBTA 1PPJD 3NWVA 1CRYA 1N50A 4PJ0V 1CRCA 1HCMA 1CSVA 5E79V 3ZOXA 5KAFV 1YCCA 3OA8A 2BGVX 3TDKA 1DVVA 3HQ7A 3WFCC 1CSXA 1GIWA 4Y5RA 2LITA 2JQRA 2C1VA 4O1WA 1IZL0 1RZ6A 3KZIV 1HH7A 3SJLA 5B5EV 4N0KA 2PACA 3DR0A 4H0JA 1FHBA 3TYIA 5CYTR 2AXTV 4FAVA 5B6QA 5CIGB 1E2RA 3WC8A 3L70D 5H2FV 3PHLA 1I55A 1I8PA 2FYUD 2PCCB 1SQBD 3PXWA 4WQAA 2C9XB 3A0HV 2AI5A 1CRJA 4QAOA 4EICA 5CIFB 1FI7A 3PLNA 2LIRA 3H1KD 2YIUB 3ZIYA 1GQ1A 1WVEC 1QN2A 2BPBB 3BCCD 1KB9D 1CHIA 1CRGA 3DP5A 3TGUD 1C52A 2ORLA 1C6RA 1CTYA 2AIUA 2BCCD 3A9FA 1VYDA 1A8CA 1CIGA 2PCBB 2RMZA 1E8EA 2BH5X 2N3YA 5KLVD 1H33A 3PTZA 1RZ5A 1M6ZA 4UB6V 4WQ9A
chains in the Genus database with same CATH superfamily
5CCHC 1K05A 2ZXYA 3D0WA 1OAEA 2Y9YA 1LJ2A 4L73A 1L0LG 1J1DB 2B11B 3H1JD 3IN6A 1N2DC 3T97A 1YTZT 1NTMJ 3FX0A 1H32A 1R5LA 4RSZA 2XKMA 5KAFE 1BGYE 4K3IA 5CJ0A 2L91A 3H1LD 4PV1B 2B10B 1MFZA 2E74B 1NNOA 1VDFA 1U74B 1KYOW 2JWAA 3M91A 1NTKK 1IFJA 2OZ1B 4I6MC 2AEJA 2JKVA 1GKSA 4HYTB 1NAFA 3KDPB 1W5CE 2QEXP 3D6YA 2V4HA 3P32A 5TISV 3M0DC 1CXCA 2B9BA 3Q1MA 2ZYDA 351CA 2WSCJ 1VQMP 1S5LV 1QLED 1QL4A 2XTSB 2HPCB 2KNCB 3VP8A 1MUUA 1CTJA 3SWYA 3N4XA 1LTGC 2OGUA 1I5TA 4DY9A 1SQPG 3ZOOA 3HRNA 1FZGA 3BRVB 4V2KA 1AKKA 1SQPE 3CI9A 2POHA 3CX5D 5CCGA 2FRCA 1SQXJ 3M06A 1L0ND 4U3FD 2M3EA 3II6A 1C2RA 1X8YA 2KNCA 3EQ2A 2D0WA 2C2CA 2M3BA 1T2KD 3O20A 1SVFA 1J3SA 3D6ZA 3VNWA 4LLHA 4L3GA 3RL0B 5DJQB 3PJSK 1G2CB 4IL6V 1RF0C 3L71J 3FWLA 5CIEB 1UIIA 1VQ4P 2OYIC 3CWBG 1URQB 3CWBE 1GDVA 3AEBC 2K9JB 1N9CA 1N8RQ 4UB8V 1N73A 1JMMA 2C9NY 3HD7D 1N90A 3BATA 1KB9H 1R0QA 4AYCA 1MKMA 2C9LY 3AEGC 2XDJA 4NPFX 1SQQE 1CI6B 2B0ZB 3V6IA 1L0LD 2WSEJ 3HE5B 1HROA 4ZMDA 3X39A 4RESB 4EIJA 3VMAA 1VQ6P 4C7NB 1SQVK 2ZAEB 2E43A 1SP4A 5TISE 3AE7C 2ZVNB 1BGYD 4R4MA 1GL2A 4FA9A 2W8ZA 1ZRTE 2YK3A 1LMSA 2J5UA 2CE1A 3NTNA 1PZQA 1YYCA 2E76C 2O3JA 2Z4EA 1RF1B 1U7MA 4OVNF 4C7NA 5CIHB 1S5LH 2P2UA 4BXLA 1PP9J 1CSBA 1NU1E 1I54A 4AUWA 1OFCX 1MZ9A 3V4QA 3CC7P 1Q86Q 2J58A 1LS9A 2Y0EA 1QEXA 1RF1A 1RAPA 1EDLA 1N7SD 2KS1A 4IL6E 1E5WA 4GOEA 1SQPD 1OX3A 1GJQA 2GC7D 1C7MA 2D2CD 3E1RA 2VHDA 2KSJA 1CHHA 1H31A 3L70E 5EXQA 1IFDA 1SQBE 2NPSD 2H88C 4GYDA 4UB8E 2C1UA 2WSCH 2ZXXA 2KLUA 1SQXG 1FOCA 3L73J 1CORA 1VQPP 2G8YA 3ITKA 1DW3A 3CC2P 3C9IA 3TGUG 1C6OA 1SQVJ 1LC1A 3MHVA 1U57A 3L72J 4WY4B 1M1JC 2BCCE 4XFJA 1RHZB 2K3RA 2WSSH 3CWBD 3SWSA 3A0BH 3FGAD 3L71G 1X9VA 3WMM0 4EIDA 2C1DB 2N9JA 4ASWA 2AEFA 3D70A 1N7LA 1C2NA 4LJIA 1SQQD 4WY4A 1JY2N 1YHQP 1NTKG 2FBWC 4YTPC 1T2KC 1NTKE 3USSA 4IFFA 2V08A 2W90A 3W67A 3G3ZA 1E29A 3CXHH 1XTGB 2RN0A 1COTA 5KLVK 1AVYA 3OCDA 1CTZA 3JSVC 1KYOE 2N1TB 2N9IA 2NZ2A 1P84E 1JNMA 1OZHA 4GDOA 4EIFA 4M3LA 1ZRTD 1OVVA 1S4XA 5AVQB 1M60A 4YPCA 3A3YB 1AFOA 2B4ZA 3AE4C 1NJIQ 1JB0J 5E79H 2CA3B 2WSEH 3HD7C 2VRSA 1KD1Q 1CRYA 1FU1A 3TYYA 1HCMA 1NTZE 1FS0E 1OVUA 2HG5D 3HTKB 5L8RJ 4ASVA 4LC1A 1LTJB 1DVVA 2FKWB 4WBAA 3CPWO 1CSXA 4Y5RA 3AE6C 5B5EH 1Q82Q 1EXJA 2XU6A 3RK2D 1ZV8A 3KZIV 1PGJA 1KN7A 1WT6A 3RK3E 4N0KA 2GA1A 3D71A 4H0JA 3JCUH 2FXPA 3TYIA 1SFCA 4OH8B 3U1CA 5GTHE 2R5BA 4L74A 5B6QA 3Q3DA 1EDJA 3GHGB 3S1KA 3CD6P 3L70D 1KMIZ 1SQBD 2BEZF 2P67A 1OVRA 3JC22 3A0HV 2A06E 2AI5A 3BCCE 1Q7YQ 1BE3G 1LWUC 1JY2O 1SS1A 1T3UA 1BE3E 2LIRA 1AVOA 3ZIYA 1QN2A 1IK9A 1CHIA 1CRGA 5KLVJ 3TGUD 1ZR2A 1IFPA 1C52A 2FYUK 2AIUA 5AVXB 1K73Q 2BCCD 2P7JA 1N7SC 3H1HJ 1L4AD 1SQVG 3L72G 2D2CC 2JR8A 2WT7B 4WQ9A 2GIWA 4OGQD 155CA 4WQBA 4GOFA 1KILA 2MKVA 1KC8Q 2NPSC 1ZP0C 3MUDA 3R2PA 4O9BA 2QE7H 1NTKD 4PD4I 3ABVC 5C39A 1LTAC 2P1JA 1USDA 3SXTA 4WB4A 3AE5C 2OQQA 1QX8A 2KOGA 2C0XA 1JTHB 1KYOD 1PGQA 3VMYA 2Q3EA 3WUUA 1P84D 3O5CA 2OTLP 2E75D 1CIHA 2OARA 3KZIE 2FYNC 3VOPA 1H9XA 1IRWA 5AURA 1IC2A 1BDDA 2HODB 1NO4A 3CU4A 3HUSA 1NTMK 4K3AA 3Q5PA 2IBZI 1NTZD 1AA0A 2E5YA 3SSUA 1H0TB 1YFCA 1AQTA 1YTZI 3V2NA 1KX7A 5KJ7C 1FZBA 3CCQP 5APXA 1LFMA 1FJKA 2LR2A 3AEFC 4KHXA 3H1IJ 1PFIA 2Q5UA 3CX5E 5C0ZA 3KYQA 2OYIB 1YIQA 3RK3D 2HODA 2LXCB 1L9JC 4DOJA 4O1QA 1VQ7P 2Q1KA 3B5ND 4U3FE 1H0TA 1DX7A 1NVOA 4EYYQ 3C2CA 3A0HH 2WTYA 2W83C 1JCCA 2Y0CA 1S72P 1AOFA 1KX2A 4AAOA 1YQ3C 1FE6A 3LW5J 4N78D 4CPGA 2A06D 4YXWH 2H7HA 1BE3D 2YNYA 1FC2C 3RL0g 1OWAA 5APYA 2ZVOB 3I56P 1CYIA 4AX3A 2P58A 1EQ7A 4GT1A 3RK2C 1QL1A 1NIRA 2B87B 2N18C 2GB8B 2Q3IA 4EIEA 1EB7A 1X79B 3L75E 5KLVG 1RQUA 4WQCA 1SQVD 1AOQA 1GK4A 4WQDA 3W68A 3CMEP 1YEAA 1BCCG 2OYHA 1L0LE 2W27A 2E76B 1DT1A 3H1HG 5B66H 2QJYC 1JUNA 1ZOYC 1M56D 1G1IA 2OTKE 2QVAA 1VQNP 3CXHW 1VPCA 1LC2A 1HWTC 1BL9A 5BU5A 3AE8C 3VP9A 1RQVA 3L74G 4HH2A 2W6AA 1HJ4A 2IFMA 2CK3H 1A02F 2DGEA 2PP6A 1OIPA 1W2EA 2JDIH 3CMAP 4D6TG 1YEBA 2E74D 2K1AA 4TLFA 5CMZA 5APWA 1L4AC 1CIEA 3VYMA 2ZOOA 5AW6B 4OGQC 3H32B 1EZVI 1MFTA 2XNXA 5KKZC 1NU1J 5CCGD 3WU2V 1ZR4A 4RJTA 3KHUA 1RE4A 3DMIA 1I6EA 1IRVA 2IFNA 3U1AA 2OZ1A 1OMIA 2O1JA 2XV5A 3AEEC 3AE3C 2RH0A 4FB1A 3IFMA 2KXPB 1M1JB 4A7PA 3SWFA 4B86A 3TNUB 1FZCC 2QA4P 1KIBA 1MG3D 4ZNCA 3PP5A 1JY3N 2HPCA 3GF7A 1VQOP 2FYUG 3OW2O 1VQ9P 4MU8A 3ORVA 2PGDA 3B8EB 4KMGA 1GK6A 2DW3A 2NRGA 1M1JA 2E42A 5AVUB 3L4FA 1KB9E 1NH4A 3FXDA 4H0LD 5TJHA 1S6VB 1FOSE 1B7VA 1GDTA 1KQLA 3RK3C 1FZEA 3B71A 1G2CA 1HUCA 4W80A 3L75D 2Z5HA 3A0BV 5DF5A 3B5NC 1GL2D 1K3HA 5IY51 3LW5H 3TF5A 1WEJF 2C8SA 2Q6QA 1URQA 1BCCD 1MV8A 3HD7B 1YTCA 1FCDC 1FJ0A 2K9JA 4WQ8A 1MZ4A 2KUBA 1AYGA 1QKSA 2ITAA 1JEKA 1YICA 1L9BC 1NTMG 4FA5A 3L74D 4AANA 1S5LE 1NTME 1H9YA 1CI6A 1M7LA 1YNRA 1HJ3A 2WSFJ 3V2QA 1OW7A 3HE5A 3WU2H 4D6TD 2QM8A 2FWLA 1CCRA 4PJ0H 1QVFO 3RN0A 2Q7CA 3RN1A 1JY3O 1OW8A 4EI2A 5BU8B 1CSVA 3I5CA 3OAKA 3Q2YA 5E79V 3ZOXA 1YCCA 1J1DC 3TSIA 2XZRA 1YJWP 3S4RA 1KQSO 3CC4P 4IOIH 3HQ7A 4R4LA 2K9YA 1LWUB 4YXDC 2LITA 1USEA 2JQRA 2C1VA 1Q81Q 1QL2A 1DIPA 3CCEP 1IZL0 3C1LA 4I7ZC 1RZ6A 2QJPC 1HH7A 1LT9B 3SJLA 5B5EV 2WPSA 2PACA 4PD4H 1JY3P 3AEDC 1SLQA 1NKZB 1IFMA 3V2RA 2AXTV 4FAVA 5APSA 1N7SB 2E74C 5CIGB 1E2RA 1M1KQ 2KZJA 5H2FV 3OA7A 4H13D 2D2CB 1HF9A 2IBZG 1R5SA 4GODA 2FYUD 1SQXE 3H1KJ 1LTTC 2YKQA 3A0BE 2C9XB 3BCCJ 1FZFA 1JCDA 5CCGC 1LT9A 2NPSB 4EICA 1FI7A 2YMYA 3TGUE 1KILE 4L76A 1S9KE 1GQ1A 1KB9D 2JJLA 4WY4D 3NXSA 4RO0A 4GKGA 3DP5A 2KB7P 3SFDC 1CTYA 3L71E 3A9FA 1VYDA 1CIGA 1EDIA 1L0NK 2PCBB 2KK7A 4UB6H 1DH3A 1E8EA 4U7JA 1JO5A 1J1EC 3PH0A 2JP3A 3A7OA 3CCVP 2IX7C 2KLVA 3H1JJ 3CXHE 2KZIA 2M0BA 2IDBA 2FYNB 2QRXA 1CYJA 4N3YB 4W7YA 5CJ4A 3PXSA 451CA 2I8DA 1FI9A 4P4QB 1M8OB 3RBZA 2C1DA 2YIUC 1N73C 5CBNA 1FOSF 5CIDB 3SLEA 5APUA 3H1LJ 3GMAA 4YE1A 3HQ9A 5E79E 3O0RC 1K3GA 3RBXA 1FDMA 3WFEC 2FFDB 4H0LC 1NTMD 4TT3H 1RH5B 2O01J 1HJ5A 2SPZA 3AE2C 1FDIA 1LTIC 1IZNB 4FA1A 5B5EE 2QIWA 1GL2C 2A45I 3BASA 5KLIB 4NFGB 1CRHA 2N1TA 1SFCD 5KJ7A 1PPJG 3L37A 3G71P 1ZXGA 2GUVA 3VN0A 3UIAA 3JCUE 5AW4B 2FFDA 2ZYGA 1OW6A 1PP9G 1AJYA 1S1CX 1RE3A 2YXRB 1PP9E 2YQBA 2WSFH 2AXTH 1PGOA 2QSIA 4JYBA 2WQYC 1QGKB 1ZW0A 3U59A 2V7QJ 2M5AB 1IFIA 2RKLA 3GG2A 5H2FH 2N9YB 1T6AA 3HTKA 1K9MQ 3RK2B 1LTJA 1L0NJ 3CCMP 4U3FJ 3O6QB 1DW0A 2LXBA 3M97X 3BRTB 2WPVB 2ZJSE 4JPZB 1HH0A 5CHXA 1EZVG 1QL3A 1K8AQ 3CCRP 4H44D 4N78E 3WFBC 3WUIA 1IK7A 1SQXD 1W5CT 3O1YA 3M0AA 4HJGH 2Z5IA 1PGPA 2ZZS1 3GHGA 3O6QA 2OTJP 3H1KG 1KILD 1JMBA 3AE9C 3RLMA 1S9KD 1VQLP 3L73G 1CW5A 5CCHA 1VF5D 3L73E 4LGDE 2GUSA 3L71D 1SQVE 5AVZB 4C46A 2K88A 3L72E 2R32A 1HTLC 5AW0B 1JY2P 1M90Q 2B12B 1I6DA 3N7NA 1DD3A 3EFFK 1AV1A 3L35A 1DEEG 1L4AB 3CXHD 1L0LJ 1H88A 3RMZA 3WUTA 4H13C 4DJGA 5KKZB 3H1JG 2WVRA 5B66V 1BGYJ 1X22A 3MP7B 3OJAB 1AQ5A 1IQCA 3G9RA 5DJTB 1HRCA 2WT7A 1G1JA 3WFDC 2EXVA 4PWAA 5APTA 3L4MA 1DD4A 4ZKUA 1ZLLA 2BH4X 1LTBC 1X0TA 2HR3A 3MK7C 3H1LG 2L4DA 3FWNA 3M0DA 3CLQA 1FBMA 1SQQK 1FZCB 1KFMA 1FI3A 2CPSA 3WUVA 4AALA 1JTHA 4JF7A 1C6SA 2KIKA 4N6JA 3QH9A 2C0WA 5AW3B 4J20A 4JYCA 1JOCA 1Y8AA 2ZYAA 1RY3A 3A0HE 1PP9D 3CYTI 4DCKA 1SQPJ 4Q5PA 2O01H 5AW9B 2K37A 1Q90D 1KV4A 2CA4B 4GEDB 3ZCFA 1R8EA 2MJZA 4JCGA 1K04A 1S3JA 3RK3B 2GM4A 3A5TA 1NU1K 5GTIH 3P8CE 3K5BA 1RF0A 3B5NB 3V2PA 2I8FA 1L0NG 1EZVD 1GU2A 3L4OA 1D7MA 3IF4A 2OYIA 1H1OA 1VQ5P 1QYZA 3VMXA 1SFCC 3AECC 2JWDA 4GIFA 4XA4A 3VYIA 1H33B 1DIIC 3CWBJ 1OXZA 5AW5B 1IO4A 4WWIA 2ZT9D 2QG4A 3F89A 5B66E 3L73D 5AW7B 5BVZA 2M8RA 1DVHA 5KAIH 2JTIB 1CSUA 5KLVE 2W6BA 3L72D 3T97B 4JBZA 4WQ7A 1KYOI 5AVYB 2IZ1A 1KQFB 1NGMB 1SQQJ 1BCCE 2WITA 1P84I 3CCJP 2P10A 3H1HE 3IAOA 1H32B 3JBTB 4HKZH 4OWFA 4QMAA 4H44C 1KQGB 2B87A 2BEQD 4EOTA 4NPDA 1WMKA 4IFMA 3MIWA 3L74E 1H89A 3PXTA 5CBOA 4PV1D 1KILC 5AVTB 1RAQA 1YJNP 1CNOA 1BGYG 3MUDC 1VF5C 1YQ4C 4D6TE 4I7ZB 1CYCA 1GD2E 2QJPB 1NYHA 4K35A 2D0SA 3MZWB 1CRIA 3AEAC 1N15A 2JEEA 5KAFH 3NBTA 2I1KA 4PJ0V 2IYOA 2PAJA 4L75A 2AXCA 1ZN5A 2R5DA 1GIWA 4O1WA 1T3JA 3H32A 3HUSC 1UIXA 1VQKP 5AW2B 3O8ZA 3H1IG 2QJKC 4KT0J 3DR0A 2UWJE 3H1IE 1HBWA 3L70J 2HFED 2E75C 5CYTR 1DEBA 1SQBJ 1LGHB 2A45G 4Y99C 2FYUE 1J1EB 3A2AA 1NTZK 5APQA 2YKOA 3P8CD 2FXOA 3CCSP 1XTCC 2PCCB 1L2PA 3PXWA 3AE1C 4I1LA 3RL0D 3TNUA 4QAOA 1H8AA 2A45H 3TGUJ 4KJMA 3MTUE 2J59M 3F5HA 1EC5A 2IPPA 2YIUB 2BCCJ 1N73B 1BSHA 1URQD 2BPBB 3H25A 3Q5RA 1A8CA 1KZUB 2RMZA 1S2EA 4H0LB 2KI7B 5KLVD 5M1BA 1YBKA 1RZ5A 1M6ZA 4UB6V 1Y9BA 2FY8A 2I1JA 2ZBOA 3H1HD 4WQEA 3I55P 1NTKJ 1GL2B 1IJDB 1IO3A 1SQQG 1DW1A 3S9OA 1CIFA 1GW4A 1OCDA 5DJUB 1C75A 3WU2E 3CCLP 3KPEA 4PJ0E 1WRGA 2OYHC 4AQRD 4W7ZA 4BRYB 1YIJP 3EFGA 3HD7A 2ZT9C 1CXAA 4AAMA 4ZKPA 3HQ8A 1T8ZA 4XYDB 3CX5I 4DZOA 4I2LC 4FANA 4WVZA 2BLFB 2CPBA 1CSWA 1NTZJ 2MHMA 5TISH 1CEDA 2W6JH 1GU4A 3ZBMA 2DVHA 2CXBA 4BRYA 1GMJA 3C8VA 4PD4E 1M57D 2KS1B 3GF3A 1NU1G 1PIXA 1NMLA 1QVGO 1H31B 2E5TA 3SFEC 4PV1C 2H89C 5CICB 2B89A 1RE4C 2R3CA 3KQGA 1NOHA 3VRDA 3H1ID 3LIEA 1GU5A 3M9HA 3CCUP 4XE5B 2H8PD 1LWUA 4BWNA 1NKNA 2IBZE 3CX5W 4DT0A 3L70G 2MTAC 1LNQA 2N9BA 2KYVA 1BE3J 1SQBG 1NWQA 4IL6H 4H13B 1W2LA 4UB6E 1MG2D 1CZQA 1N86A 1S5LX 1N7SA 1U75B 1YI2P 1CC5A 1ETPA 1JM0A 4C7RA 4Z1MH 1M70A 1EDKA 2YMKA 4UB8H 1KB0A 5GTHV 4H0KA 2BCCG 2YCCA 2WPQA 1A02J 2NPSA 3CP5A 2CE0A 3MK7B 3GW6A 3IR9A 3EWKA 1HGVA 3GLMA 2V07A 1KORA 1LT1A 3OCDB 5AW1B 2GC4D 3RL0C 5DJQC 2PFXA 4IL6X 3VTPC 1E79H 1Z56A 1EXIA 2YKPA 2N1TD 5KJ7D 1NAYA 2WZ7A 4EDFA 5AVRB 3E7KA 1URQC 2Y9ZA 1CCHA 1FDOA 1PL5A 1LP1B 1L0LK 1JDLA 1DIQC 1LTSC 1HJBA 1KTMA 3NBSA 2AXTE 1YITP 1PPJE 2BASA 3H6PA 1KV9A 1J2JB 1KYOH 1DW2A 5H2FE 2Y0DA 4PD4D 1P84H 3SVWA 3ZDMA 4L3HA 1NTZG 2L5GB 3TK1A 2HYNA 1NMIA 1SFCB 1HVVA 2N3BA 1FAVA 1CHJA 2B88A 1LP1A 1NU1D 2IYPA 1A2SA 5AW8B 5K5GB 1W2BO 1TU3F 5APVA 1A56A 2N18B 1KB9I 1VQ8P 2ZFCA 5C9MA 3ZOWA 4FA4A 3MD0A 1EZVE 1RF1C 2AEMA 5CCHD 2IZ0A 3V5BA 3FXEA 2IBZD 1GZLA 2M5AA 2QJYB 5GTIV 3BVHA 4H44B 1F1CA 3PH2B 2HLOA 1SQPK 5GTHH 3H1KE 2A06G 3BCCG 1BSNA 4MN4C 4RKUJ 1Y47A 3PRJA 1I8OA 2WWWA 1CO6A 4JQ0D 3M9BA 1KILB 3L75J 1HZVA 2R3SA 3QWOC 2HV4A 1LT9C 3SWKA 2ZONG 1ZZHA 5DFSA 1VF5B 2O1KA 3HE4B 1BCCJ 3B4SA 5KAIV 4IFDK 2G3AA 5AVVB 4OGQB 2WMMA 3P7KA 1KFNA 3H1JE 3NMDA 4XXLA 2QM7A 4L1QA 3L74J 3HQ6A 3V4WA 5CIBB 1BDCA 1PV3A 3HE4A 4WY4C 1L4AA 3Q5SA 4PW9B 1F1FA 3M9QA 1HZUA 1IFNA 2OYOA 3OA8B 2FXMA 3H1LE 4D6TJ 3HUSB 1YJ9P 3ZOYA 1NHLA 2R44A 2QJKB 3MGNA 2XNDH 5AVSB 2E75B 4Y99B 3NFQA 2BCNB 1PPJD 3NWVA 1N50A 1CRCA 3G4SP 1HJ0A 5KAFV 3VMZA 3R4YA 3OA8A 2H43A 2BGVX 3CL3D 2LKMA 3TDKA 2O01N 3RGUA 1FZCA 3KZIH 2YO2A 3WFCC 2YXQB 5GTIE 1FJPA 1FZAA 2N1TC 1HGZA 1VL2A 2FFDC 2KP8A 1FHBA 1RE3C 2Q9IA 1GW3A 2FYUJ 3G6EP 3LIDA 4U3FG 3WC8A 1L0NE 2ZXEB 1U7JA 3PHLA 1ZMEC 1I55A 2PRRA 1I8PA 5KLIC 3CX5H 2V7QH 4HB1A 1LTJC 1Q2NA 3CXHI 2YO3A 4WQAA 5KAIE 1CRJA 3P8MC 5CIFB 2WPRA 4Y28J 3PLNA 3H1KD 2FYZA 4NPEA 5KTBA 1WVEC 3E1IA 3BCCD 2JO1A 3B5NA 2OYHB 2ORLA 1C6RA 1SQBK 2BH5X 3KXDA 2N3YA 2ZT9B 1GTWA 5EFWB 3GHGC 1H33A 1SQXK 3PTZA 2E76D 5AVWB 3L36A 3L75G 2KSEA
chains in the Genus database with same CATH topology
2GIWA 2ZXYA 155CA 2ZBOA 3H1HD 4WQEA 1OAEA 4WQBA 2FYNB 1CYJA 3PXSA 451CA 1FI9A 2B11B 3H1JD 1IO3A 4P4QB 1DW1A 1CIFA 1OCDA 2C1DA 1C75A 5CIDB 3SLEA 1NTKD 4YE1A 1H32A 3HQ9A 4RSZA 3SXTA 3O0RC 4K3IA 1K3GA 2L91A 3WFEC 1NTMD 3H1LD 1CXAA 1KYOD 4AAMA 2Q3EA 2B10B 1P84D 3O5CA 3HQ8A 1HJ5A 4XYDB 1NNOA 4FANA 1U74B 1KYOW 1CIHA 2JWAA 2BLFB 2OZ1B 1CSWA 4FA1A 1H9XA 1IRWA 2MHMA 5AURA 1GKSA 1CEDA 5KLIB 4NFGB 1CRHA 3ZBMA 2DVHA 2CXBA 3CU4A 5TISV 1NTZD 1CXCA 1YFCA 1NMLA 1KX7A 2YQBA 351CA 1LFMA 1S5LV 1QL4A 2XTSB 2KNCB 1H31B 1CTJA 5C0ZA 5CICB 1I5TA 4DY9A 3GG2A 3ZOOA 1YIQA 4V2KA 2N9YB 1AKKA 1L9JC 3VRDA 3H1ID 4O1QA 3CX5D 1DW0A 3M97X 2FRCA 3C2CA 1QL3A 2Y0CA 1L0ND 3CX5W 4U3FD 1C2RA 2MTAC 3WFBC 3WUIA 1AOFA 2D0WA 1KX2A 1SQXD 1W5CT 4AAOA 2C2CA 3O1YA 3O20A 1J3SA 1W2LA 1MG2D 3VNWA 2A06D 4L3GA 1U75B 1CC5A 5DJQB 2ZZS1 1BE3D 4IL6V 3FWLA 1ETPA 5CIEB 3RLMA 1CYIA 4AX3A 1M70A 1GDVA 1KB0A 1NIRA 5GTHV 3L71D 2N18C 4H0KA 2YCCA 2GB8B 2K9JB 1N9CA 3CP5A 2CE0A 3MK7B 4UB8V 4EIEA 1EB7A 2B12B 1I6DA 3GW6A 4WQCA 1SQVD 1AOQA 4WQDA 1N90A 1YEAA 1R0QA 3CXHD 3RMZA 2V07A 1DT1A 3OCDB 2GC4D 3CXHW 2B0ZB 1LC2A 5KKZB 5DJQC 1L0LD 5B66V 1BL9A 1HROA 1IQCA 3X39A 1HRCA 3VMAA 3WFDC 2EXVA 4PWAA 4EDFA 3L4MA 1HJ4A 1BGYD 1CCHA 4FA9A 2DGEA 2BH4X 3MK7C 2L4DA 2YK3A 1LMSA 1YEBA 1JDLA 1DIQC 2CE1A 1FI3A 3NBSA 2O3JA 1CIEA 3VYMA 2ZOOA 5CIHB 4AALA 1KV9A 1DW2A 1C6SA 2Y0DA 3WU2V 4PD4D 4RJTA 3SVWA 4J20A 4L3HA 3KHUA 1I54A 3DMIA 1I6EA 1IRVA 1NMIA 2N3BA 1CHJA 1NU1D 1PP9D 2OZ1A 3CYTI 1A2SA 4Q5PA 1LS9A 2Y0EA 1RAPA 2CA4B 1A56A 2N18B 4FB1A 4GEDB 3ZCFA 2KS1A 4JCGA 4A7PA 1SQPD 5C9MA 3ZOWA 4FA4A 1GJQA 2GC7D 1C7MA 1KIBA 1MG3D 2VHDA 1CHHA 1H31A 4MU8A 2IBZD 5EXQA 3ORVA 2I8FA 1EZVD 1GU2A 2QJYB 3L4OA 4GYDA 2C1UA 1H1OA 4KMGA 1QYZA 5GTIV 1F1CA 3PH2B 1FOCA 1CORA 3ITKA 1H33B 1DIIC 1DW3A 1C6OA 3PRJA 1LC1A 1I8OA 2QG4A 5TJHA 1S6VB 1CO6A 3L73D 1HZVA 1B7VA 2HV4A 3CWBD 3SWSA 2ZONG 1DVHA 1ZZHA 5DFSA 2JTIB 1CSUA 4EIDA 3L72D 2C1DB 2N9JA 4WQ7A 3L75D 3A0BV 5DF5A 5KAIV 1K3HA 5IY51 3TF5A 1WEJF 2C8SA 1H32B 3JBTB 1BCCD 1C2NA 4LJIA 1SQQD 4XXLA 1YTCA 1FCDC 1FJ0A 4WQ8A 4L1QA 1MZ4A 1AYGA 1QKSA 2V08A 3HQ6A 5CIBB 1YICA 1L9BC 3PXTA 1E29A 2RN0A 4PW9B 1COTA 1F1FA 4FA5A 1HZUA 3OCDA 1CTZA 3L74D 4AANA 1RAQA 3OA8B 1CNOA 1H9YA 1CYCA 2N9IA 1YNRA 1HJ3A 3ZOYA 2QJPB 4EIFA 1ZRTD 2QJKB 2D0SA 1CRIA 1M60A 4D6TD 1N15A 2FWLA 1CCRA 2B4ZA 3RN0A 3RN1A 2CA3B 2BCNB 3NBTA 1PPJD 3NWVA 1CRYA 1N50A 4PJ0V 1CRCA 1HCMA 1CSVA 5E79V 3ZOXA 5KAFV 1YCCA 3OA8A 2BGVX 3TDKA 1DVVA 3HQ7A 3WFCC 1CSXA 1GIWA 4Y5RA 2LITA 2JQRA 2C1VA 4O1WA 1IZL0 1RZ6A 3KZIV 1HH7A 3SJLA 5B5EV 4N0KA 2PACA 3DR0A 4H0JA 1FHBA 3TYIA 5CYTR 2AXTV 4FAVA 5B6QA 5CIGB 1E2RA 3WC8A 3L70D 5H2FV 3PHLA 1I55A 1I8PA 2FYUD 2PCCB 1SQBD 3PXWA 4WQAA 2C9XB 3A0HV 2AI5A 1CRJA 4QAOA 4EICA 5CIFB 1FI7A 3PLNA 2LIRA 3H1KD 2YIUB 3ZIYA 1GQ1A 1WVEC 1QN2A 2BPBB 3BCCD 1KB9D 1CHIA 1CRGA 3DP5A 3TGUD 1C52A 2ORLA 1C6RA 1CTYA 2AIUA 2BCCD 3A9FA 1VYDA 1A8CA 1CIGA 2PCBB 2RMZA 1E8EA 2BH5X 2N3YA 5KLVD 1H33A 3PTZA 1RZ5A 1M6ZA 4UB6V 4WQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GIW A;  2ZXY A;  155C A;  2ZBO A;  3H1H D;  4WQE A;  1OAE A;  4WQB A;  2FYN B;  1CYJ A;  3PXS A;  451C A;  1FI9 A;  2B11 B;  3H1J D;  1IO3 A;  4P4Q B;  1DW1 A;  1CIF A;  1OCD A;  2C1D A;  1C75 A;  5CID B;  3SLE A;  1NTK D;  4YE1 A;  1H32 A;  3HQ9 A;  4RSZ A;  3SXT A;  3O0R C;  4K3I A;  1K3G A;  2L91 A;  3WFE C;  1NTM D;  3H1L D;  1CXA A;  1KYO D;  4AAM A;  2Q3E A;  2B10 B;  1P84 D;  3O5C A;  3HQ8 A;  1HJ5 A;  4XYD B;  1NNO A;  4FAN A;  1U74 B;  1KYO W;  1CIH A;  2JWA A;  2BLF B;  2OZ1 B;  1CSW A;  4FA1 A;  1H9X A;  1IRW A;  2MHM A;  5AUR A;  1GKS A;  1CED A;  5KLI B;  4NFG B;  1CRH A;  3ZBM A;  2DVH A;  2CXB A;  3CU4 A;  5TIS V;  1NTZ D;  1CXC A;  1YFC A;  1NML A;  1KX7 A;  2YQB A;  351C A;  1LFM A;  1S5L V;  1QL4 A;  2XTS B;  2KNC B;  1H31 B;  1CTJ A;  5C0Z A;  5CIC B;  1I5T A;  4DY9 A;  3GG2 A;  3ZOO A;  1YIQ A;  4V2K A;  2N9Y B;  1AKK A;  1L9J C;  3VRD A;  3H1I D;  4O1Q A;  3CX5 D;  1DW0 A;  3M97 X;  2FRC A;  3C2C A;  1QL3 A;  2Y0C A;  1L0N D;  3CX5 W;  4U3F D;  1C2R A;  2MTA C;  3WFB C;  3WUI A;  1AOF A;  2D0W A;  1KX2 A;  1SQX D;  1W5C T;  4AAO A;  2C2C A;  3O1Y A;  3O20 A;  1J3S A;  1W2L A;  1MG2 D;  3VNW A;  2A06 D;  4L3G A;  1U75 B;  1CC5 A;  5DJQ B;  2ZZS 1;  1BE3 D;  4IL6 V;  3FWL A;  1ETP A;  5CIE B;  3RLM A;  1CYI A;  4AX3 A;  1M70 A;  1GDV A;  1KB0 A;  1NIR A;  5GTH V;  3L71 D;  2N18 C;  4H0K A;  2YCC A;  2GB8 B;  2K9J B;  1N9C A;  3CP5 A;  2CE0 A;  3MK7 B;  4UB8 V;  4EIE A;  1EB7 A;  2B12 B;  1I6D A;  3GW6 A;  4WQC A;  1SQV D;  1AOQ A;  4WQD A;  1N90 A;  1YEA A;  1R0Q A;  3CXH D;  3RMZ A;  2V07 A;  1DT1 A;  3OCD B;  2GC4 D;  3CXH W;  2B0Z B;  1LC2 A;  5KKZ B;  5DJQ C;  1L0L D;  5B66 V;  1BL9 A;  1HRO A;  1IQC A;  3X39 A;  1HRC A;  3VMA A;  3WFD C;  2EXV A;  4PWA A;  4EDF A;  3L4M A;  1HJ4 A;  1BGY D;  1CCH A;  4FA9 A;  2DGE A;  2BH4 X;  3MK7 C;  2L4D A;  2YK3 A;  1LMS A;  1YEB A;  1JDL A;  1DIQ C;  2CE1 A;  1FI3 A;  3NBS A;  2O3J A;  1CIE A;  3VYM A;  2ZOO A;  5CIH B;  4AAL A;  1KV9 A;  1DW2 A;  1C6S A;  2Y0D A;  3WU2 V;  4PD4 D;  4RJT A;  3SVW A;  4J20 A;  4L3H A;  3KHU A;  1I54 A;  3DMI A;  1I6E A;  1IRV A;  1NMI A;  2N3B A;  1CHJ A;  1NU1 D;  1PP9 D;  2OZ1 A;  3CYT I;  1A2S A;  4Q5P A;  1LS9 A;  2Y0E A;  1RAP A;  2CA4 B;  1A56 A;  2N18 B;  4FB1 A;  4GED B;  3ZCF A;  2KS1 A;  4JCG A;  4A7P A;  1SQP D;  5C9M A;  3ZOW A;  4FA4 A;  1GJQ A;  2GC7 D;  1C7M A;  1KIB A;  1MG3 D;  2VHD A;  1CHH A;  1H31 A;  4MU8 A;  2IBZ D;  5EXQ A;  3ORV A;  2I8F A;  1EZV D;  1GU2 A;  2QJY B;  3L4O A;  4GYD A;  2C1U A;  1H1O A;  4KMG A;  1QYZ A;  5GTI V;  1F1C A;  3PH2 B;  1FOC A;  1COR A;  3ITK A;  1H33 B;  1DII C;  1DW3 A;  1C6O A;  3PRJ A;  1LC1 A;  1I8O A;  2QG4 A;  5TJH A;  1S6V B;  1CO6 A;  3L73 D;  1HZV A;  1B7V A;  2HV4 A;  3CWB D;  3SWS A;  2ZON G;  1DVH A;  1ZZH A;  5DFS A;  2JTI B;  1CSU A;  4EID A;  3L72 D;  2C1D B;  2N9J A;  4WQ7 A;  3L75 D;  3A0B V;  5DF5 A;  5KAI V;  1K3H A;  5IY5 1;  3TF5 A;  1WEJ F;  2C8S A;  1H32 B;  3JBT B;  1BCC D;  1C2N A;  4LJI A;  1SQQ D;  4XXL A;  1YTC A;  1FCD C;  1FJ0 A;  4WQ8 A;  4L1Q A;  1MZ4 A;  1AYG A;  1QKS A;  2V08 A;  3HQ6 A;  5CIB B;  1YIC A;  1L9B C;  3PXT A;  1E29 A;  2RN0 A;  4PW9 B;  1COT A;  1F1F A;  4FA5 A;  1HZU A;  3OCD A;  1CTZ A;  3L74 D;  4AAN A;  1RAQ A;  3OA8 B;  1CNO A;  1H9Y A;  1CYC A;  2N9I A;  1YNR A;  1HJ3 A;  3ZOY A;  2QJP B;  4EIF A;  1ZRT D;  2QJK B;  2D0S A;  1CRI A;  1M60 A;  4D6T D;  1N15 A;  2FWL A;  1CCR A;  2B4Z A;  3RN0 A;  3RN1 A;  2CA3 B;  2BCN B;  3NBT A;  1PPJ D;  3NWV A;  1CRY A;  1N50 A;  4PJ0 V;  1CRC A;  1HCM A;  1CSV A;  5E79 V;  3ZOX A;  5KAF V;  1YCC A;  3OA8 A;  2BGV X;  3TDK A;  1DVV A;  3HQ7 A;  3WFC C;  1CSX A;  1GIW A;  4Y5R A;  2LIT A;  2JQR A;  2C1V A;  4O1W A;  1IZL 0;  1RZ6 A;  3KZI V;  1HH7 A;  3SJL A;  5B5E V;  4N0K A;  2PAC A;  3DR0 A;  4H0J A;  1FHB A;  3TYI A;  5CYT R;  2AXT V;  4FAV A;  5B6Q A;  5CIG B;  1E2R A;  3WC8 A;  3L70 D;  5H2F V;  3PHL A;  1I55 A;  1I8P A;  2FYU D;  2PCC B;  1SQB D;  3PXW A;  4WQA A;  2C9X B;  3A0H V;  2AI5 A;  1CRJ A;  4QAO A;  4EIC A;  5CIF B;  1FI7 A;  3PLN A;  2LIR A;  3H1K D;  2YIU B;  3ZIY A;  1GQ1 A;  1WVE C;  1QN2 A;  2BPB B;  3BCC D;  1KB9 D;  1CHI A;  1CRG A;  3DP5 A;  3TGU D;  1C52 A;  2ORL A;  1C6R A;  1CTY A;  2AIU A;  2BCC D;  3A9F A;  1VYD A;  1A8C A;  1CIG A;  2PCB B;  2RMZ A;  1E8E A;  2BH5 X;  2N3Y A;  5KLV D;  1H33 A;  3PTZ A;  1RZ5 A;  1M6Z A;  4UB6 V;  4WQ9 A; 
#chains in the Genus database with same CATH topology
 5CCH C;  1K05 A;  2ZXY A;  3D0W A;  1OAE A;  2Y9Y A;  1LJ2 A;  4L73 A;  1L0L G;  1J1D B;  2B11 B;  3H1J D;  3IN6 A;  1N2D C;  3T97 A;  1YTZ T;  1NTM J;  3FX0 A;  1H32 A;  1R5L A;  4RSZ A;  2XKM A;  5KAF E;  1BGY E;  4K3I A;  5CJ0 A;  2L91 A;  3H1L D;  4PV1 B;  2B10 B;  1MFZ A;  2E74 B;  1NNO A;  1VDF A;  1U74 B;  1KYO W;  2JWA A;  3M91 A;  1NTK K;  1IFJ A;  2OZ1 B;  4I6M C;  2AEJ A;  2JKV A;  1GKS A;  4HYT B;  1NAF A;  3KDP B;  1W5C E;  2QEX P;  3D6Y A;  2V4H A;  3P32 A;  5TIS V;  3M0D C;  1CXC A;  2B9B A;  3Q1M A;  2ZYD A;  351C A;  2WSC J;  1VQM P;  1S5L V;  1QLE D;  1QL4 A;  2XTS B;  2HPC B;  2KNC B;  3VP8 A;  1MUU A;  1CTJ A;  3SWY A;  3N4X A;  1LTG C;  2OGU A;  1I5T A;  4DY9 A;  1SQP G;  3ZOO A;  3HRN A;  1FZG A;  3BRV B;  4V2K A;  1AKK A;  1SQP E;  3CI9 A;  2POH A;  3CX5 D;  5CCG A;  2FRC A;  1SQX J;  3M06 A;  1L0N D;  4U3F D;  2M3E A;  3II6 A;  1C2R A;  1X8Y A;  2KNC A;  3EQ2 A;  2D0W A;  2C2C A;  2M3B A;  1T2K D;  3O20 A;  1SVF A;  1J3S A;  3D6Z A;  3VNW A;  4LLH A;  4L3G A;  3RL0 B;  5DJQ B;  3PJS K;  1G2C B;  4IL6 V;  1RF0 C;  3L71 J;  3FWL A;  5CIE B;  1UII A;  1VQ4 P;  2OYI C;  3CWB G;  1URQ B;  3CWB E;  1GDV A;  3AEB C;  2K9J B;  1N9C A;  1N8R Q;  4UB8 V;  1N73 A;  1JMM A;  2C9N Y;  3HD7 D;  1N90 A;  3BAT A;  1KB9 H;  1R0Q A;  4AYC A;  1MKM A;  2C9L Y;  3AEG C;  2XDJ A;  4NPF X;  1SQQ E;  1CI6 B;  2B0Z B;  3V6I A;  1L0L D;  2WSE J;  3HE5 B;  1HRO A;  4ZMD A;  3X39 A;  4RES B;  4EIJ A;  3VMA A;  1VQ6 P;  4C7N B;  1SQV K;  2ZAE B;  2E43 A;  1SP4 A;  5TIS E;  3AE7 C;  2ZVN B;  1BGY D;  4R4M A;  1GL2 A;  4FA9 A;  2W8Z A;  1ZRT E;  2YK3 A;  1LMS A;  2J5U A;  2CE1 A;  3NTN A;  1PZQ A;  1YYC A;  2E76 C;  2O3J A;  2Z4E A;  1RF1 B;  1U7M A;  4OVN F;  4C7N A;  5CIH B;  1S5L H;  2P2U A;  4BXL A;  1PP9 J;  1CSB A;  1NU1 E;  1I54 A;  4AUW A;  1OFC X;  1MZ9 A;  3V4Q A;  3CC7 P;  1Q86 Q;  2J58 A;  1LS9 A;  2Y0E A;  1QEX A;  1RF1 A;  1RAP A;  1EDL A;  1N7S D;  2KS1 A;  4IL6 E;  1E5W A;  4GOE A;  1SQP D;  1OX3 A;  1GJQ A;  2GC7 D;  1C7M A;  2D2C D;  3E1R A;  2VHD A;  2KSJ A;  1CHH A;  1H31 A;  3L70 E;  5EXQ A;  1IFD A;  1SQB E;  2NPS D;  2H88 C;  4GYD A;  4UB8 E;  2C1U A;  2WSC H;  2ZXX A;  2KLU A;  1SQX G;  1FOC A;  3L73 J;  1COR A;  1VQP P;  2G8Y A;  3ITK A;  1DW3 A;  3CC2 P;  3C9I A;  3TGU G;  1C6O A;  1SQV J;  1LC1 A;  3MHV A;  1U57 A;  3L72 J;  4WY4 B;  1M1J C;  2BCC E;  4XFJ A;  1RHZ B;  2K3R A;  2WSS H;  3CWB D;  3SWS A;  3A0B H;  3FGA D;  3L71 G;  1X9V A;  3WMM 0;  4EID A;  2C1D B;  2N9J A;  4ASW A;  2AEF A;  3D70 A;  1N7L A;  1C2N A;  4LJI A;  1SQQ D;  4WY4 A;  1JY2 N;  1YHQ P;  1NTK G;  2FBW C;  4YTP C;  1T2K C;  1NTK E;  3USS A;  4IFF A;  2V08 A;  2W90 A;  3W67 A;  3G3Z A;  1E29 A;  3CXH H;  1XTG B;  2RN0 A;  1COT A;  5KLV K;  1AVY A;  3OCD A;  1CTZ A;  3JSV C;  1KYO E;  2N1T B;  2N9I A;  2NZ2 A;  1P84 E;  1JNM A;  1OZH A;  4GDO A;  4EIF A;  4M3L A;  1ZRT D;  1OVV A;  1S4X A;  5AVQ B;  1M60 A;  4YPC A;  3A3Y B;  1AFO A;  2B4Z A;  3AE4 C;  1NJI Q;  1JB0 J;  5E79 H;  2CA3 B;  2WSE H;  3HD7 C;  2VRS A;  1KD1 Q;  1CRY A;  1FU1 A;  3TYY A;  1HCM A;  1NTZ E;  1FS0 E;  1OVU A;  2HG5 D;  3HTK B;  5L8R J;  4ASV A;  4LC1 A;  1LTJ B;  1DVV A;  2FKW B;  4WBA A;  3CPW O;  1CSX A;  4Y5R A;  3AE6 C;  5B5E H;  1Q82 Q;  1EXJ A;  2XU6 A;  3RK2 D;  1ZV8 A;  3KZI V;  1PGJ A;  1KN7 A;  1WT6 A;  3RK3 E;  4N0K A;  2GA1 A;  3D71 A;  4H0J A;  3JCU H;  2FXP A;  3TYI A;  1SFC A;  4OH8 B;  3U1C A;  5GTH E;  2R5B A;  4L74 A;  5B6Q A;  3Q3D A;  1EDJ A;  3GHG B;  3S1K A;  3CD6 P;  3L70 D;  1KMI Z;  1SQB D;  2BEZ F;  2P67 A;  1OVR A;  3JC2 2;  3A0H V;  2A06 E;  2AI5 A;  3BCC E;  1Q7Y Q;  1BE3 G;  1LWU C;  1JY2 O;  1SS1 A;  1T3U A;  1BE3 E;  2LIR A;  1AVO A;  3ZIY A;  1QN2 A;  1IK9 A;  1CHI A;  1CRG A;  5KLV J;  3TGU D;  1ZR2 A;  1IFP A;  1C52 A;  2FYU K;  2AIU A;  5AVX B;  1K73 Q;  2BCC D;  2P7J A;  1N7S C;  3H1H J;  1L4A D;  1SQV G;  3L72 G;  2D2C C;  2JR8 A;  2WT7 B;  4WQ9 A;  2GIW A;  4OGQ D;  155C A;  4WQB A;  4GOF A;  1KIL A;  2MKV A;  1KC8 Q;  2NPS C;  1ZP0 C;  3MUD A;  3R2P A;  4O9B A;  2QE7 H;  1NTK D;  4PD4 I;  3ABV C;  5C39 A;  1LTA C;  2P1J A;  1USD A;  3SXT A;  4WB4 A;  3AE5 C;  2OQQ A;  1QX8 A;  2KOG A;  2C0X A;  1JTH B;  1KYO D;  1PGQ A;  3VMY A;  2Q3E A;  3WUU A;  1P84 D;  3O5C A;  2OTL P;  2E75 D;  1CIH A;  2OAR A;  3KZI E;  2FYN C;  3VOP A;  1H9X A;  1IRW A;  5AUR A;  1IC2 A;  1BDD A;  2HOD B;  1NO4 A;  3CU4 A;  3HUS A;  1NTM K;  4K3A A;  3Q5P A;  2IBZ I;  1NTZ D;  1AA0 A;  2E5Y A;  3SSU A;  1H0T B;  1YFC A;  1AQT A;  1YTZ I;  3V2N A;  1KX7 A;  5KJ7 C;  1FZB A;  3CCQ P;  5APX A;  1LFM A;  1FJK A;  2LR2 A;  3AEF C;  4KHX A;  3H1I J;  1PFI A;  2Q5U A;  3CX5 E;  5C0Z A;  3KYQ A;  2OYI B;  1YIQ A;  3RK3 D;  2HOD A;  2LXC B;  1L9J C;  4DOJ A;  4O1Q A;  1VQ7 P;  2Q1K A;  3B5N D;  4U3F E;  1H0T A;  1DX7 A;  1NVO A;  4EYY Q;  3C2C A;  3A0H H;  2WTY A;  2W83 C;  1JCC A;  2Y0C A;  1S72 P;  1AOF A;  1KX2 A;  4AAO A;  1YQ3 C;  1FE6 A;  3LW5 J;  4N78 D;  4CPG A;  2A06 D;  4YXW H;  2H7H A;  1BE3 D;  2YNY A;  1FC2 C;  3RL0 g;  1OWA A;  5APY A;  2ZVO B;  3I56 P;  1CYI A;  4AX3 A;  2P58 A;  1EQ7 A;  4GT1 A;  3RK2 C;  1QL1 A;  1NIR A;  2B87 B;  2N18 C;  2GB8 B;  2Q3I A;  4EIE A;  1EB7 A;  1X79 B;  3L75 E;  5KLV G;  1RQU A;  4WQC A;  1SQV D;  1AOQ A;  1GK4 A;  4WQD A;  3W68 A;  3CME P;  1YEA A;  1BCC G;  2OYH A;  1L0L E;  2W27 A;  2E76 B;  1DT1 A;  3H1H G;  5B66 H;  2QJY C;  1JUN A;  1ZOY C;  1M56 D;  1G1I A;  2OTK E;  2QVA A;  1VQN P;  3CXH W;  1VPC A;  1LC2 A;  1HWT C;  1BL9 A;  5BU5 A;  3AE8 C;  3VP9 A;  1RQV A;  3L74 G;  4HH2 A;  2W6A A;  1HJ4 A;  2IFM A;  2CK3 H;  1A02 F;  2DGE A;  2PP6 A;  1OIP A;  1W2E A;  2JDI H;  3CMA P;  4D6T G;  1YEB A;  2E74 D;  2K1A A;  4TLF A;  5CMZ A;  5APW A;  1L4A C;  1CIE A;  3VYM A;  2ZOO A;  5AW6 B;  4OGQ C;  3H32 B;  1EZV I;  1MFT A;  2XNX A;  5KKZ C;  1NU1 J;  5CCG D;  3WU2 V;  1ZR4 A;  4RJT A;  3KHU A;  1RE4 A;  3DMI A;  1I6E A;  1IRV A;  2IFN A;  3U1A A;  2OZ1 A;  1OMI A;  2O1J A;  2XV5 A;  3AEE C;  3AE3 C;  2RH0 A;  4FB1 A;  3IFM A;  2KXP B;  1M1J B;  4A7P A;  3SWF A;  4B86 A;  3TNU B;  1FZC C;  2QA4 P;  1KIB A;  1MG3 D;  4ZNC A;  3PP5 A;  1JY3 N;  2HPC A;  3GF7 A;  1VQO P;  2FYU G;  3OW2 O;  1VQ9 P;  4MU8 A;  3ORV A;  2PGD A;  3B8E B;  4KMG A;  1GK6 A;  2DW3 A;  2NRG A;  1M1J A;  2E42 A;  5AVU B;  3L4F A;  1KB9 E;  1NH4 A;  3FXD A;  4H0L D;  5TJH A;  1S6V B;  1FOS E;  1B7V A;  1GDT A;  1KQL A;  3RK3 C;  1FZE A;  3B71 A;  1G2C A;  1HUC A;  4W80 A;  3L75 D;  2Z5H A;  3A0B V;  5DF5 A;  3B5N C;  1GL2 D;  1K3H A;  5IY5 1;  3LW5 H;  3TF5 A;  1WEJ F;  2C8S A;  2Q6Q A;  1URQ A;  1BCC D;  1MV8 A;  3HD7 B;  1YTC A;  1FCD C;  1FJ0 A;  2K9J A;  4WQ8 A;  1MZ4 A;  2KUB A;  1AYG A;  1QKS A;  2ITA A;  1JEK A;  1YIC A;  1L9B C;  1NTM G;  4FA5 A;  3L74 D;  4AAN A;  1S5L E;  1NTM E;  1H9Y A;  1CI6 A;  1M7L A;  1YNR A;  1HJ3 A;  2WSF J;  3V2Q A;  1OW7 A;  3HE5 A;  3WU2 H;  4D6T D;  2QM8 A;  2FWL A;  1CCR A;  4PJ0 H;  1QVF O;  3RN0 A;  2Q7C A;  3RN1 A;  1JY3 O;  1OW8 A;  4EI2 A;  5BU8 B;  1CSV A;  3I5C A;  3OAK A;  3Q2Y A;  5E79 V;  3ZOX A;  1YCC A;  1J1D C;  3TSI A;  2XZR A;  1YJW P;  3S4R A;  1KQS O;  3CC4 P;  4IOI H;  3HQ7 A;  4R4L A;  2K9Y A;  1LWU B;  4YXD C;  2LIT A;  1USE A;  2JQR A;  2C1V A;  1Q81 Q;  1QL2 A;  1DIP A;  3CCE P;  1IZL 0;  3C1L A;  4I7Z C;  1RZ6 A;  2QJP C;  1HH7 A;  1LT9 B;  3SJL A;  5B5E V;  2WPS A;  2PAC A;  4PD4 H;  1JY3 P;  3AED C;  1SLQ A;  1NKZ B;  1IFM A;  3V2R A;  2AXT V;  4FAV A;  5APS A;  1N7S B;  2E74 C;  5CIG B;  1E2R A;  1M1K Q;  2KZJ A;  5H2F V;  3OA7 A;  4H13 D;  2D2C B;  1HF9 A;  2IBZ G;  1R5S A;  4GOD A;  2FYU D;  1SQX E;  3H1K J;  1LTT C;  2YKQ A;  3A0B E;  2C9X B;  3BCC J;  1FZF A;  1JCD A;  5CCG C;  1LT9 A;  2NPS B;  4EIC A;  1FI7 A;  2YMY A;  3TGU E;  1KIL E;  4L76 A;  1S9K E;  1GQ1 A;  1KB9 D;  2JJL A;  4WY4 D;  3NXS A;  4RO0 A;  4GKG A;  3DP5 A;  2KB7 P;  3SFD C;  1CTY A;  3L71 E;  3A9F A;  1VYD A;  1CIG A;  1EDI A;  1L0N K;  2PCB B;  2KK7 A;  4UB6 H;  1DH3 A;  1E8E A;  4U7J A;  1JO5 A;  1J1E C;  3PH0 A;  2JP3 A;  3A7O A;  3CCV P;  2IX7 C;  2KLV A;  3H1J J;  3CXH E;  2KZI A;  2M0B A;  2IDB A;  2FYN B;  2QRX A;  1CYJ A;  4N3Y B;  4W7Y A;  5CJ4 A;  3PXS A;  451C A;  2I8D A;  1FI9 A;  4P4Q B;  1M8O B;  3RBZ A;  2C1D A;  2YIU C;  1N73 C;  5CBN A;  1FOS F;  5CID B;  3SLE A;  5APU A;  3H1L J;  3GMA A;  4YE1 A;  3HQ9 A;  5E79 E;  3O0R C;  1K3G A;  3RBX A;  1FDM A;  3WFE C;  2FFD B;  4H0L C;  1NTM D;  4TT3 H;  1RH5 B;  2O01 J;  1HJ5 A;  2SPZ A;  3AE2 C;  1FDI A;  1LTI C;  1IZN B;  4FA1 A;  5B5E E;  2QIW A;  1GL2 C;  2A45 I;  3BAS A;  5KLI B;  4NFG B;  1CRH A;  2N1T A;  1SFC D;  5KJ7 A;  1PPJ G;  3L37 A;  3G71 P;  1ZXG A;  2GUV A;  3VN0 A;  3UIA A;  3JCU E;  5AW4 B;  2FFD A;  2ZYG A;  1OW6 A;  1PP9 G;  1AJY A;  1S1C X;  1RE3 A;  2YXR B;  1PP9 E;  2YQB A;  2WSF H;  2AXT H;  1PGO A;  2QSI A;  4JYB A;  2WQY C;  1QGK B;  1ZW0 A;  3U59 A;  2V7Q J;  2M5A B;  1IFI A;  2RKL A;  3GG2 A;  5H2F H;  2N9Y B;  1T6A A;  3HTK A;  1K9M Q;  3RK2 B;  1LTJ A;  1L0N J;  3CCM P;  4U3F J;  3O6Q B;  1DW0 A;  2LXB A;  3M97 X;  3BRT B;  2WPV B;  2ZJS E;  4JPZ B;  1HH0 A;  5CHX A;  1EZV G;  1QL3 A;  1K8A Q;  3CCR P;  4H44 D;  4N78 E;  3WFB C;  3WUI A;  1IK7 A;  1SQX D;  1W5C T;  3O1Y A;  3M0A A;  4HJG H;  2Z5I A;  1PGP A;  2ZZS 1;  3GHG A;  3O6Q A;  2OTJ P;  3H1K G;  1KIL D;  1JMB A;  3AE9 C;  3RLM A;  1S9K D;  1VQL P;  3L73 G;  1CW5 A;  5CCH A;  1VF5 D;  3L73 E;  4LGD E;  2GUS A;  3L71 D;  1SQV E;  5AVZ B;  4C46 A;  2K88 A;  3L72 E;  2R32 A;  1HTL C;  5AW0 B;  1JY2 P;  1M90 Q;  2B12 B;  1I6D A;  3N7N A;  1DD3 A;  3EFF K;  1AV1 A;  3L35 A;  1DEE G;  1L4A B;  3CXH D;  1L0L J;  1H88 A;  3RMZ A;  3WUT A;  4H13 C;  4DJG A;  5KKZ B;  3H1J G;  2WVR A;  5B66 V;  1BGY J;  1X22 A;  3MP7 B;  3OJA B;  1AQ5 A;  1IQC A;  3G9R A;  5DJT B;  1HRC A;  2WT7 A;  1G1J A;  3WFD C;  2EXV A;  4PWA A;  5APT A;  3L4M A;  1DD4 A;  4ZKU A;  1ZLL A;  2BH4 X;  1LTB C;  1X0T A;  2HR3 A;  3MK7 C;  3H1L G;  2L4D A;  3FWN A;  3M0D A;  3CLQ A;  1FBM A;  1SQQ K;  1FZC B;  1KFM A;  1FI3 A;  2CPS A;  3WUV A;  4AAL A;  1JTH A;  4JF7 A;  1C6S A;  2KIK A;  4N6J A;  3QH9 A;  2C0W A;  5AW3 B;  4J20 A;  4JYC A;  1JOC A;  1Y8A A;  2ZYA A;  1RY3 A;  3A0H E;  1PP9 D;  3CYT I;  4DCK A;  1SQP J;  4Q5P A;  2O01 H;  5AW9 B;  2K37 A;  1Q90 D;  1KV4 A;  2CA4 B;  4GED B;  3ZCF A;  1R8E A;  2MJZ A;  4JCG A;  1K04 A;  1S3J A;  3RK3 B;  2GM4 A;  3A5T A;  1NU1 K;  5GTI H;  3P8C E;  3K5B A;  1RF0 A;  3B5N B;  3V2P A;  2I8F A;  1L0N G;  1EZV D;  1GU2 A;  3L4O A;  1D7M A;  3IF4 A;  2OYI A;  1H1O A;  1VQ5 P;  1QYZ A;  3VMX A;  1SFC C;  3AEC C;  2JWD A;  4GIF A;  4XA4 A;  3VYI A;  1H33 B;  1DII C;  3CWB J;  1OXZ A;  5AW5 B;  1IO4 A;  4WWI A;  2ZT9 D;  2QG4 A;  3F89 A;  5B66 E;  3L73 D;  5AW7 B;  5BVZ A;  2M8R A;  1DVH A;  5KAI H;  2JTI B;  1CSU A;  5KLV E;  2W6B A;  3L72 D;  3T97 B;  4JBZ A;  4WQ7 A;  1KYO I;  5AVY B;  2IZ1 A;  1KQF B;  1NGM B;  1SQQ J;  1BCC E;  2WIT A;  1P84 I;  3CCJ P;  2P10 A;  3H1H E;  3IAO A;  1H32 B;  3JBT B;  4HKZ H;  4OWF A;  4QMA A;  4H44 C;  1KQG B;  2B87 A;  2BEQ D;  4EOT A;  4NPD A;  1WMK A;  4IFM A;  3MIW A;  3L74 E;  1H89 A;  3PXT A;  5CBO A;  4PV1 D;  1KIL C;  5AVT B;  1RAQ A;  1YJN P;  1CNO A;  1BGY G;  3MUD C;  1VF5 C;  1YQ4 C;  4D6T E;  4I7Z B;  1CYC A;  1GD2 E;  2QJP B;  1NYH A;  4K35 A;  2D0S A;  3MZW B;  1CRI A;  3AEA C;  1N15 A;  2JEE A;  5KAF H;  3NBT A;  2I1K A;  4PJ0 V;  2IYO A;  2PAJ A;  4L75 A;  2AXC A;  1ZN5 A;  2R5D A;  1GIW A;  4O1W A;  1T3J A;  3H32 A;  3HUS C;  1UIX A;  1VQK P;  5AW2 B;  3O8Z A;  3H1I G;  2QJK C;  4KT0 J;  3DR0 A;  2UWJ E;  3H1I E;  1HBW A;  3L70 J;  2HFE D;  2E75 C;  5CYT R;  1DEB A;  1SQB J;  1LGH B;  2A45 G;  4Y99 C;  2FYU E;  1J1E B;  3A2A A;  1NTZ K;  5APQ A;  2YKO A;  3P8C D;  2FXO A;  3CCS P;  1XTC C;  2PCC B;  1L2P A;  3PXW A;  3AE1 C;  4I1L A;  3RL0 D;  3TNU A;  4QAO A;  1H8A A;  2A45 H;  3TGU J;  4KJM A;  3MTU E;  2J59 M;  3F5H A;  1EC5 A;  2IPP A;  2YIU B;  2BCC J;  1N73 B;  1BSH A;  1URQ D;  2BPB B;  3H25 A;  3Q5R A;  1A8C A;  1KZU B;  2RMZ A;  1S2E A;  4H0L B;  2KI7 B;  5KLV D;  5M1B A;  1YBK A;  1RZ5 A;  1M6Z A;  4UB6 V;  1Y9B A;  2FY8 A;  2I1J A;  2ZBO A;  3H1H D;  4WQE A;  3I55 P;  1NTK J;  1GL2 B;  1IJD B;  1IO3 A;  1SQQ G;  1DW1 A;  3S9O A;  1CIF A;  1GW4 A;  1OCD A;  5DJU B;  1C75 A;  3WU2 E;  3CCL P;  3KPE A;  4PJ0 E;  1WRG A;  2OYH C;  4AQR D;  4W7Z A;  4BRY B;  1YIJ P;  3EFG A;  3HD7 A;  2ZT9 C;  1CXA A;  4AAM A;  4ZKP A;  3HQ8 A;  1T8Z A;  4XYD B;  3CX5 I;  4DZO A;  4I2L C;  4FAN A;  4WVZ A;  2BLF B;  2CPB A;  1CSW A;  1NTZ J;  2MHM A;  5TIS H;  1CED A;  2W6J H;  1GU4 A;  3ZBM A;  2DVH A;  2CXB A;  4BRY A;  1GMJ A;  3C8V A;  4PD4 E;  1M57 D;  2KS1 B;  3GF3 A;  1NU1 G;  1PIX A;  1NML A;  1QVG O;  1H31 B;  2E5T A;  3SFE C;  4PV1 C;  2H89 C;  5CIC B;  2B89 A;  1RE4 C;  2R3C A;  3KQG A;  1NOH A;  3VRD A;  3H1I D;  3LIE A;  1GU5 A;  3M9H A;  3CCU P;  4XE5 B;  2H8P D;  1LWU A;  4BWN A;  1NKN A;  2IBZ E;  3CX5 W;  4DT0 A;  3L70 G;  2MTA C;  1LNQ A;  2N9B A;  2KYV A;  1BE3 J;  1SQB G;  1NWQ A;  4IL6 H;  4H13 B;  1W2L A;  4UB6 E;  1MG2 D;  1CZQ A;  1N86 A;  1S5L X;  1N7S A;  1U75 B;  1YI2 P;  1CC5 A;  1ETP A;  1JM0 A;  4C7R A;  4Z1M H;  1M70 A;  1EDK A;  2YMK A;  4UB8 H;  1KB0 A;  5GTH V;  4H0K A;  2BCC G;  2YCC A;  2WPQ A;  1A02 J;  2NPS A;  3CP5 A;  2CE0 A;  3MK7 B;  3GW6 A;  3IR9 A;  3EWK A;  1HGV A;  3GLM A;  2V07 A;  1KOR A;  1LT1 A;  3OCD B;  5AW1 B;  2GC4 D;  3RL0 C;  5DJQ C;  2PFX A;  4IL6 X;  3VTP C;  1E79 H;  1Z56 A;  1EXI A;  2YKP A;  2N1T D;  5KJ7 D;  1NAY A;  2WZ7 A;  4EDF A;  5AVR B;  3E7K A;  1URQ C;  2Y9Z A;  1CCH A;  1FDO A;  1PL5 A;  1LP1 B;  1L0L K;  1JDL A;  1DIQ C;  1LTS C;  1HJB A;  1KTM A;  3NBS A;  2AXT E;  1YIT P;  1PPJ E;  2BAS A;  3H6P A;  1KV9 A;  1J2J B;  1KYO H;  1DW2 A;  5H2F E;  2Y0D A;  4PD4 D;  1P84 H;  3SVW A;  3ZDM A;  4L3H A;  1NTZ G;  2L5G B;  3TK1 A;  2HYN A;  1NMI A;  1SFC B;  1HVV A;  2N3B A;  1FAV A;  1CHJ A;  2B88 A;  1LP1 A;  1NU1 D;  2IYP A;  1A2S A;  5AW8 B;  5K5G B;  1W2B O;  1TU3 F;  5APV A;  1A56 A;  2N18 B;  1KB9 I;  1VQ8 P;  2ZFC A;  5C9M A;  3ZOW A;  4FA4 A;  3MD0 A;  1EZV E;  1RF1 C;  2AEM A;  5CCH D;  2IZ0 A;  3V5B A;  3FXE A;  2IBZ D;  1GZL A;  2M5A A;  2QJY B;  5GTI V;  3BVH A;  4H44 B;  1F1C A;  3PH2 B;  2HLO A;  1SQP K;  5GTH H;  3H1K E;  2A06 G;  3BCC G;  1BSN A;  4MN4 C;  4RKU J;  1Y47 A;  3PRJ A;  1I8O A;  2WWW A;  1CO6 A;  4JQ0 D;  3M9B A;  1KIL B;  3L75 J;  1HZV A;  2R3S A;  3QWO C;  2HV4 A;  1LT9 C;  3SWK A;  2ZON G;  1ZZH A;  5DFS A;  1VF5 B;  2O1K A;  3HE4 B;  1BCC J;  3B4S A;  5KAI V;  4IFD K;  2G3A A;  5AVV B;  4OGQ B;  2WMM A;  3P7K A;  1KFN A;  3H1J E;  3NMD A;  4XXL A;  2QM7 A;  4L1Q A;  3L74 J;  3HQ6 A;  3V4W A;  5CIB B;  1BDC A;  1PV3 A;  3HE4 A;  4WY4 C;  1L4A A;  3Q5S A;  4PW9 B;  1F1F A;  3M9Q A;  1HZU A;  1IFN A;  2OYO A;  3OA8 B;  2FXM A;  3H1L E;  4D6T J;  3HUS B;  1YJ9 P;  3ZOY A;  1NHL A;  2R44 A;  2QJK B;  3MGN A;  2XND H;  5AVS B;  2E75 B;  4Y99 B;  3NFQ A;  2BCN B;  1PPJ D;  3NWV A;  1N50 A;  1CRC A;  3G4S P;  1HJ0 A;  5KAF V;  3VMZ A;  3R4Y A;  3OA8 A;  2H43 A;  2BGV X;  3CL3 D;  2LKM A;  3TDK A;  2O01 N;  3RGU A;  1FZC A;  3KZI H;  2YO2 A;  3WFC C;  2YXQ B;  5GTI E;  1FJP A;  1FZA A;  2N1T C;  1HGZ A;  1VL2 A;  2FFD C;  2KP8 A;  1FHB A;  1RE3 C;  2Q9I A;  1GW3 A;  2FYU J;  3G6E P;  3LID A;  4U3F G;  3WC8 A;  1L0N E;  2ZXE B;  1U7J A;  3PHL A;  1ZME C;  1I55 A;  2PRR A;  1I8P A;  5KLI C;  3CX5 H;  2V7Q H;  4HB1 A;  1LTJ C;  1Q2N A;  3CXH I;  2YO3 A;  4WQA A;  5KAI E;  1CRJ A;  3P8M C;  5CIF B;  2WPR A;  4Y28 J;  3PLN A;  3H1K D;  2FYZ A;  4NPE A;  5KTB A;  1WVE C;  3E1I A;  3BCC D;  2JO1 A;  3B5N A;  2OYH B;  2ORL A;  1C6R A;  1SQB K;  2BH5 X;  3KXD A;  2N3Y A;  2ZT9 B;  1GTW A;  5EFW B;  3GHG C;  1H33 A;  1SQX K;  3PTZ A;  2E76 D;  5AVW B;  3L36 A;  3L75 G;  2KSE A; 
#chains in the Genus database with same CATH homology
 2GIW A;  2ZXY A;  155C A;  2ZBO A;  3H1H D;  4WQE A;  1OAE A;  4WQB A;  2FYN B;  1CYJ A;  3PXS A;  451C A;  1FI9 A;  2B11 B;  3H1J D;  1IO3 A;  4P4Q B;  1DW1 A;  1CIF A;  1OCD A;  2C1D A;  1C75 A;  5CID B;  3SLE A;  1NTK D;  4YE1 A;  1H32 A;  3HQ9 A;  4RSZ A;  3SXT A;  3O0R C;  4K3I A;  1K3G A;  2L91 A;  3WFE C;  1NTM D;  3H1L D;  1CXA A;  1KYO D;  4AAM A;  2Q3E A;  2B10 B;  1P84 D;  3O5C A;  3HQ8 A;  1HJ5 A;  4XYD B;  1NNO A;  4FAN A;  1U74 B;  1KYO W;  1CIH A;  2JWA A;  2BLF B;  2OZ1 B;  1CSW A;  4FA1 A;  1H9X A;  1IRW A;  2MHM A;  5AUR A;  1GKS A;  1CED A;  5KLI B;  4NFG B;  1CRH A;  3ZBM A;  2DVH A;  2CXB A;  3CU4 A;  5TIS V;  1NTZ D;  1CXC A;  1YFC A;  1NML A;  1KX7 A;  2YQB A;  351C A;  1LFM A;  1S5L V;  1QL4 A;  2XTS B;  2KNC B;  1H31 B;  1CTJ A;  5C0Z A;  5CIC B;  1I5T A;  4DY9 A;  3GG2 A;  3ZOO A;  1YIQ A;  4V2K A;  2N9Y B;  1AKK A;  1L9J C;  3VRD A;  3H1I D;  4O1Q A;  3CX5 D;  1DW0 A;  3M97 X;  2FRC A;  3C2C A;  1QL3 A;  2Y0C A;  1L0N D;  3CX5 W;  4U3F D;  1C2R A;  2MTA C;  3WFB C;  3WUI A;  1AOF A;  2D0W A;  1KX2 A;  1SQX D;  1W5C T;  4AAO A;  2C2C A;  3O1Y A;  3O20 A;  1J3S A;  1W2L A;  1MG2 D;  3VNW A;  2A06 D;  4L3G A;  1U75 B;  1CC5 A;  5DJQ B;  2ZZS 1;  1BE3 D;  4IL6 V;  3FWL A;  1ETP A;  5CIE B;  3RLM A;  1CYI A;  4AX3 A;  1M70 A;  1GDV A;  1KB0 A;  1NIR A;  5GTH V;  3L71 D;  2N18 C;  4H0K A;  2YCC A;  2GB8 B;  2K9J B;  1N9C A;  3CP5 A;  2CE0 A;  3MK7 B;  4UB8 V;  4EIE A;  1EB7 A;  2B12 B;  1I6D A;  3GW6 A;  4WQC A;  1SQV D;  1AOQ A;  4WQD A;  1N90 A;  1YEA A;  1R0Q A;  3CXH D;  3RMZ A;  2V07 A;  1DT1 A;  3OCD B;  2GC4 D;  3CXH W;  2B0Z B;  1LC2 A;  5KKZ B;  5DJQ C;  1L0L D;  5B66 V;  1BL9 A;  1HRO A;  1IQC A;  3X39 A;  1HRC A;  3VMA A;  3WFD C;  2EXV A;  4PWA A;  4EDF A;  3L4M A;  1HJ4 A;  1BGY D;  1CCH A;  4FA9 A;  2DGE A;  2BH4 X;  3MK7 C;  2L4D A;  2YK3 A;  1LMS A;  1YEB A;  1JDL A;  1DIQ C;  2CE1 A;  1FI3 A;  3NBS A;  2O3J A;  1CIE A;  3VYM A;  2ZOO A;  5CIH B;  4AAL A;  1KV9 A;  1DW2 A;  1C6S A;  2Y0D A;  3WU2 V;  4PD4 D;  4RJT A;  3SVW A;  4J20 A;  4L3H A;  3KHU A;  1I54 A;  3DMI A;  1I6E A;  1IRV A;  1NMI A;  2N3B A;  1CHJ A;  1NU1 D;  1PP9 D;  2OZ1 A;  3CYT I;  1A2S A;  4Q5P A;  1LS9 A;  2Y0E A;  1RAP A;  2CA4 B;  1A56 A;  2N18 B;  4FB1 A;  4GED B;  3ZCF A;  2KS1 A;  4JCG A;  4A7P A;  1SQP D;  5C9M A;  3ZOW A;  4FA4 A;  1GJQ A;  2GC7 D;  1C7M A;  1KIB A;  1MG3 D;  2VHD A;  1CHH A;  1H31 A;  4MU8 A;  2IBZ D;  5EXQ A;  3ORV A;  2I8F A;  1EZV D;  1GU2 A;  2QJY B;  3L4O A;  4GYD A;  2C1U A;  1H1O A;  4KMG A;  1QYZ A;  5GTI V;  1F1C A;  3PH2 B;  1FOC A;  1COR A;  3ITK A;  1H33 B;  1DII C;  1DW3 A;  1C6O A;  3PRJ A;  1LC1 A;  1I8O A;  2QG4 A;  5TJH A;  1S6V B;  1CO6 A;  3L73 D;  1HZV A;  1B7V A;  2HV4 A;  3CWB D;  3SWS A;  2ZON G;  1DVH A;  1ZZH A;  5DFS A;  2JTI B;  1CSU A;  4EID A;  3L72 D;  2C1D B;  2N9J A;  4WQ7 A;  3L75 D;  3A0B V;  5DF5 A;  5KAI V;  1K3H A;  5IY5 1;  3TF5 A;  1WEJ F;  2C8S A;  1H32 B;  3JBT B;  1BCC D;  1C2N A;  4LJI A;  1SQQ D;  4XXL A;  1YTC A;  1FCD C;  1FJ0 A;  4WQ8 A;  4L1Q A;  1MZ4 A;  1AYG A;  1QKS A;  2V08 A;  3HQ6 A;  5CIB B;  1YIC A;  1L9B C;  3PXT A;  1E29 A;  2RN0 A;  4PW9 B;  1COT A;  1F1F A;  4FA5 A;  1HZU A;  3OCD A;  1CTZ A;  3L74 D;  4AAN A;  1RAQ A;  3OA8 B;  1CNO A;  1H9Y A;  1CYC A;  2N9I A;  1YNR A;  1HJ3 A;  3ZOY A;  2QJP B;  4EIF A;  1ZRT D;  2QJK B;  2D0S A;  1CRI A;  1M60 A;  4D6T D;  1N15 A;  2FWL A;  1CCR A;  2B4Z A;  3RN0 A;  3RN1 A;  2CA3 B;  2BCN B;  3NBT A;  1PPJ D;  3NWV A;  1CRY A;  1N50 A;  4PJ0 V;  1CRC A;  1HCM A;  1CSV A;  5E79 V;  3ZOX A;  5KAF V;  1YCC A;  3OA8 A;  2BGV X;  3TDK A;  1DVV A;  3HQ7 A;  3WFC C;  1CSX A;  1GIW A;  4Y5R A;  2LIT A;  2JQR A;  2C1V A;  4O1W A;  1IZL 0;  1RZ6 A;  3KZI V;  1HH7 A;  3SJL A;  5B5E V;  4N0K A;  2PAC A;  3DR0 A;  4H0J A;  1FHB A;  3TYI A;  5CYT R;  2AXT V;  4FAV A;  5B6Q A;  5CIG B;  1E2R A;  3WC8 A;  3L70 D;  5H2F V;  3PHL A;  1I55 A;  1I8P A;  2FYU D;  2PCC B;  1SQB D;  3PXW A;  4WQA A;  2C9X B;  3A0H V;  2AI5 A;  1CRJ A;  4QAO A;  4EIC A;  5CIF B;  1FI7 A;  3PLN A;  2LIR A;  3H1K D;  2YIU B;  3ZIY A;  1GQ1 A;  1WVE C;  1QN2 A;  2BPB B;  3BCC D;  1KB9 D;  1CHI A;  1CRG A;  3DP5 A;  3TGU D;  1C52 A;  2ORL A;  1C6R A;  1CTY A;  2AIU A;  2BCC D;  3A9F A;  1VYD A;  1A8C A;  1CIG A;  2PCB B;  2RMZ A;  1E8E A;  2BH5 X;  2N3Y A;  5KLV D;  1H33 A;  3PTZ A;  1RZ5 A;  1M6Z A;  4UB6 V;  4WQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...