2YIUB

X-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
228
structure length
206
Chain Sequence
DISFSFEGPFGKFDQHQLQRGLQVYTEVCSACHGLRYVPLRTLADEGGPQLPEDQVRAYAANFDITDPETEEDRPRVPTDHFPTVSGEGMGPDLSLMAKARIGGPEYIHAVLTGYDGEEKVLYHNAAFAGNWIQMAAPLSDDQVTYEDGTPATVDQMATDVAAFLMWTAEPKMMDRKQVGFVSVIFLIVLAALLYLTNKKLWQPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME B
publication title X-Ray Structure of the Dimeric Cytochrome Bc(1) Complex from the Soil Bacterium Paracoccus Denitrificans at 2.7-A Resolution.
pubmed doi rcsb
total genus 59
structure length 206
sequence length 228
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2yiuB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2yiuB02
1RAPA 1S5LV 2FYNB 3CU4A 1C7MA 1I8OA 1CHHA 3ZOXA 1EB7A 3A0BV 2EXVA 3VYMA 2Y0EA 1CRGA 2QJPB 2BPBB 1U74B 1N9CA 1W5CT 1COTA 4NFGB 3WFEC 3HQ6A 3HQ7A 1HROA 3X39A 3SVWA 1CYCA 1KX7A 3H1HD 4AX3A 1CTZA 1IO3A 4O1QA 1CYIA 3OA8B 2AXTV 1P84D 1QKSA 1DW0A 5KKZB 4FA1A 2LITA 2N3BA 3OCDA 2CE0A 451CA 5DJQB 1IZL0 1KX2A 2GC4D 1I5TA 1GKSA 5DFSA 3PHLA 1CSUA 3NWVA 3L70D 2PCCB 4DY9A 1YEBA 3DMIA 1DW1A 1IQCA 1M6ZA 3ZOOA 3HQ8A 1CSXA 4WQAA 2I8FA 2QG4A 5TJHA 4L3HA 1CYJA 4UB8V 2Y0DA 2C8SA 4MU8A 4EIEA 2N9YB 2C9XB 3GG2A 1A56A 3CX5W 2BH5X 3TYIA 2CA4B 1QN2A 1CHJA 3O20A 3RLMA 1YCCA 1A2SA 3WFDC 5C0ZA 4GYDA 4Y5RA 4FA4A 1AKKA 4IL6V 4H0JA 2V08A 4EDFA 1BL9A 5B6QA 2O3JA 1YEAA 2ORLA 1EZVD 1NNOA 4XYDB 3CXHD 1RAQA 5TISV 1HH7A 1DVHA 2YQBA 1N15A 5CICB 1H33B 1JDLA 1BCCD 1L9JC 2BH4X 351CA 1M60A 3OA8A 4EIFA 1C2RA 1KYOD 1CC5A 1H31B 4O1WA 5B5EV 1SQVD 2YCCA 3PXWA 2CXBA 5H2FV 5B66V 1HZUA 1GJQA 4N0KA 3NBSA 1U75B 2JTIB 1NTZD 1SQQD 3ZCFA 1CCHA 2B10B 4AANA 3L73D 3BCCD 3O5CA 1K3GA 1I54A 4WQEA 3H1ID 3L75D 1CNOA 4P4QB 4XXLA 2AIUA 4LJIA 1WVEC 3WFCC 2C1DA 1IRWA 5KAIV 1DW2A 2L91A 1OAEA 4H0KA 1CRHA 2XTSB 3VMAA 5CYTR 3O1YA 1AOFA 1KV9A 2N18B 1A8CA 1FJ0A 1CIEA 1MG3D 2MTAC 1QYZA 1H33A 3PTZA 1DVVA 2C2CA 1BGYD 1CCRA 4J20A 1FI9A 3PXTA 2MHMA 3L71D 1KB9D 1FOCA 2B0ZB 3CWBD 1FI7A 1S6VB 3DR0A 4K3IA 1H31A 3VRDA 1HZVA 3WU2V 3JBTB 1C52A 2CE1A 4QAOA 3A0HV 2GIWA 5AURA 2B11B 1GQ1A 1SQXD 3ZIYA 1I6DA 1SQPD 3HQ9A 4WQBA 5CIBB 4WQCA 4GEDB 3TF5A 3MK7B 2BCCD 5E79V 3NBTA 4V2KA 1FI3A 3FWLA 3SLEA 1CSWA 2BLFB 1C2NA 3CXHW 2A06D 2GC7D 1RZ5A 1ZZHA 1FHBA 1IRVA 1L9BC 1H9XA 2Q3EA 2L4DA 1CRIA 3PLNA 1CRJA 1HJ4A 1KYOW 1KB0A 2Y0CA 3RN1A 4D6TD 5CIEB 1YFCA 1DW3A 2N18C 2IBZD 1ETPA 2JQRA 1WEJF 4PD4D 1NIRA 2B4ZA 2ZONG 1CTYA 1SQBD 3CYTI 2K9JB 2JWAA 1QL4A 4FAVA 1CRYA 4WQ7A 5DJQC 2OZ1B 1B7VA 1LMSA 2D0WA 3L72D 1CEDA 1YIQA 2HV4A 3DP5A 1J3SA 2N9JA 2YK3A 3ITKA 2ZOOA 1QL3A 1NTKD 3CP5A 1H1OA 3TDKA 1MG2D 4WQ8A 5CIFB 1I8PA 3L4MA 3TGUD 2FWLA 1H9YA 2VHDA 4UB6V 4Q5PA 3PH2B 1YNRA 2ZXYA 3A9FA 3PRJA 1CORA 1F1FA 1W2LA 2RN0A 3H1JD 3ZBMA 1GU2A 4YE1A 1F1CA 1I55A 1AOQA 1I6EA 1CO6A 155CA 1K3HA 3GW6A 1H32B 2DGEA 2CA3B 2LIRA 1LC2A 3WC8A 1KIBA 1VYDA 4RSZA 1C6OA 1PP9D 1BE3D 1M70A 2KS1A 3ZOWA 1GIWA 2BCNB 5CIGB 5CIDB 1CXAA 2C1UA 1HJ5A 1RZ6A 1DIIC 2ZBOA 3KZIV 1CIHA 3L74D 4EICA 2DVHA 5CIHB 3SJLA 2GB8B 1OCDA 2OZ1A 3ORVA 1HRCA 4AAOA 4U3FD 3L4OA 2BGVX 3H1KD 3KHUA 2B12B 1CSVA 1YTCA 1FCDC 1E2RA 1N90A 2N3YA 1CTJA 4WQ9A 4FA9A 3RMZA 5KLVD 1DT1A 1MZ4A 2V07A 3O0RC 4JCGA 1R0QA 5KAFV 4PWAA 4AAMA 4KMGA 1YICA 4RJTA 1NMLA 2YIUB 5GTHV 1C6SA 1AYGA 4FA5A 2C1DB 1C75A 1C6RA 3RN0A 2KNCB 2QJYB 4FANA 1CXCA 1HJ3A 2QJKB 3WUIA 3CX5D 1LFMA 1H32A 2AI5A 3VNWA 4A7PA 5DF5A 4FB1A 2PACA 1CIGA 3OCDB 2RMZA 1ZRTD 5EXQA 1NU1D 4L3GA 3SXTA 2FRCA 4PW9B 1CHIA 4AALA 1LC1A 2FYUD 3ZOYA 1L0ND 1E29A 4L1QA 1L0LD 3WFBC 2ZZS1 5IY51 1GDVA 3PXSA 3C2CA 2N9IA 1E8EA 2D0SA 4WQDA 1LS9A 3SWSA 5KLIB 4EIDA 3M97X 1DIQC 1PPJD 3MK7C 1CRCA 2PCBB 3H1LD 5GTIV 1NTMD 5C9MA 4PJ0V 1NMIA 2C1VA 1CIFA 1N50A 1HCMA
chains in the Genus database with same CATH superfamily
1S2EA 1OVVA 3CU4A 4Y99B 5KLVG 2R5DA 1M1JC 2WSCH 3ZOXA 2FFDC 5CBOA 2Y0EA 2QJPB 2KNCA 1ZP0C 1N9CA 1W5CT 1FC2C 1COTA 4MN4C 1IFJA 1R5SA 1KX7A 5AVXB 2P2UA 4QMAA 2WSCJ 4AX3A 1IO3A 3H32B 1M90Q 4YTPC 1QKSA 3WUUA 3F89A 5KKZB 5GTHE 3EQ2A 3VN0A 1KX2A 1GDTA 2K88A 2N9BA 1I5TA 1AA0A 4GKGA 4DCKA 1GKSA 2V4HA 2FXOA 1L4AA 3PHLA 2LXBA 3NWVA 1SFCC 5TJHA 2FKWB 5KLIC 1CYJA 2Y0DA 4EIEA 2Z5IA 2C9XB 3L73E 1A56A 3TYIA 1CSBA 1QN2A 1HJ0A 2KSEA 1A2SA 1NOHA 5CCGC 4JBZA 5C0ZA 4GYDA 1YJNP 2FYNC 4WY4C 1NTMK 1S5LX 4JQ0D 3GMAA 1EZVD 3KQGA 4W80A 3CXHD 2LR2A 1IZNB 2YQBA 4R4LA 2H88C 2YMYA 3GHGC 4PJ0E 3FXEA 1Q86Q 3CCMP 3L73J 1BCCD 1L9JC 4UB6H 3AEGC 3OA8A 1KFMA 1KYOD 4O1WA 3LIEA 4C7NA 2YCCA 3AEFC 3PXWA 1BDCA 2CXBA 5GTIH 4N0KA 1OW8A 1BGYE 2JTIB 4DZOA 1KB9E 1CCHA 3CWBE 4K3AA 3RK2C 3BCCD 1QL1A 3TNUB 3M0AA 3H1ID 1KILC 5CMZA 1E5WA 4LGDE 4JF7A 4H0LD 3SFEC 2BCCE 2HR3A 2R32A 2WSSH 1BSHA 2XTSB 1BGYJ 5CYTR 4WWIA 5AVYB 2A06E 2QJKC 2KK7A 1OWAA 3CWBJ 3TK1A 1RE3C 4PV1B 1VQ7P 1JB0J 2KLVA 3W67A 1FZAA 1GL2D 3AE7C 2MTAC 3QWOC 3MGNA 3PTZA 1G2CA 1PGQA 1CCRA 1LTJB 3L71D 2ZYGA 2BCCJ 3G4SP 3DR0A 3IF4A 1NKZB 4K3IA 1H31A 5CCHC 3D71A 1RF1C 3VRDA 5KJ7A 3SWKA 2WTYA 2M0BA 4YPCA 1L0NK 1JCCA 1I6DA 1SQPD 4WQCA 1D7MA 1URQC 1W2BO 2E74B 2Q1KA 2P58A 2WPQA 2ZFCA 3SLEA 5BVZA 2BLFB 1DD3A 1KILD 1ZN5A 1NKNA 1RE4A 1VQ9P 1FBMA 3L73G 3N7NA 3H6PA 3H1JE 1K04A 2WT7B 3RK3B 1KB0A 2Y0CA 3UIAA 3I55P 1JEKA 2N18C 1WEJF 1NIRA 3OAKA 1SQBD 3CYTI 1YQ3C 2K9JB 3L4FA 2BEZF 3G9RA 5BU8B 3AEAC 1BE3E 2OZ1B 3GF3A 2AEJA 1YIQA 2YK3A 3B5ND 2ZOOA 1LTGC 1OVUA 1T2KC 1EDKA 1S5LH 1JCDA 5CCHD 2OYHA 4R4MA 1K8AQ 2VHDA 4B86A 3CWBG 4U3FE 1YNRA 3A9FA 1PV3A 3PRJA 3H1KE 4IFFA 2E76B 2M3EA 1SQPK 1BE3J 5AVTB 1GU2A 3HUSA 3CI9A 4CPGA 3JCUH 2OYOA 1CO6A 1H32B 1PIXA 2CA3B 2LIRA 1LC2A 1HH0A 2M5AB 1J1EC 1CW5A 1S9KE 1KIBA 2A06G 2ZXEB 3H25A 1SQXJ 3OJAB 4U3FJ 3C8VA 2PFXA 3H1KJ 1M70A 1OW6A 5CIDB 4XE5B 1L2PA 2KSJA 3S4RA 2ZBOA 3CLQA 4XFJA 1T8ZA 1FZCB 4EICA 2A45H 1LTIC 3ORVA 1NU1E 1SQBK 3KHUA 2ITAA 1YTCA 1NGMB 1FCDC 1QVFO 4PD4H 3BASA 1L0NE 4WQ9A 4FA9A 1L0LE 2Q5UA 1DT1A 2R3CA 2V07A 2M3BA 3CPWO 2GUSA 4H44D 2HG5D 2O1KA 2V7QH 1YICA 2YIUB 1PFIA 1IFPA 4HYTB 2KNCB 1NU1J 2V7QJ 1N7LA 4FANA 2ZT9C 1YBKA 1KQSO 1YTZI 2AI5A 1JY2P 2WPRA 1L0LJ 3H1JG 1ZXGA 2KZIA 1GL2A 4AQRD 1MUUA 3HD7D 1IFNA 2AEMA 2WMMA 5CJ0A 5DJUB 2FYUD 3ZOYA 2W6BA 1PL5A 1P84E 1BE3G 2Y9ZA 1AJYA 2WZ7A 3C2CA 4ZMDA 1K73Q 3A0BE 1PZQA 2A45I 2QEXP 3CCSP 1PPJD 3MK7C 1CRCA 2O01H 4DT0A 1P84H 3L70E 5C9MA 1JTHB 4PD4I 2XKMA 1JY2N 3H1KG 1CIFA 1N50A 3CC4P 3S9OA 3RBXA 3R4YA 4C46A 3CCEP 2FXPA 3VYMA 1VQLP 3HQ7A 1HJBA 2ZT9D 3SVWA 3H1HD 3CL3D 1KTMA 1S4XA 3L70J 5KLVJ 3OA8B 2NPSC 4FA1A 4C7NB 3AEBC 3OCDA 3WUTA 1LNQA 1VF5B 1DX7A 5DJQB 1IZL0 3RK3E 1X22A 5AVQB 4OGQB 2K1AA 3CX5H 3B5NA 1EZVG 2L5GB 4JPZB 3A2AA 1QEXA 4N78E 4IL6E 1RF1A 1QVGO 4DY9A 2M8RA 1N73C 1OIPA 3F5HA 1NU1G 2I8DA 3RL0C 3VYIA 1IQCA 1M6ZA 3HQ8A 4H13D 4NPDA 2FYUK 2XNDH 4UB8V 3M91A 1L0NG 2C8SA 1NTZE 1SQQE 3AE6C 3GG2A 3CX5W 2GA1A 4TT3H 5C39A 1YIJP 1CHJA 3L75E 3RLMA 3KDPB 5BU5A 5B5EE 1ZOYC 4FA4A 4BRYB 2W90A 2V08A 1HVVA 4Y99C 3V5BA 3KYQA 4GDOA 2ORLA 2M5AA 4ZKPA 4XYDB 2RH0A 1HH7A 2QJPC 2UWJE 3GF7A 3VP9A 4I6MC 1EXIA 3HRNA 3IAOA 1NTZJ 1SQQJ 1AVOA 1XTGB 4Y28J 4EIFA 3L75J 1C2RA 1YITP 1H31B 1FZCA 1SQVD 1SP4A 5KKZC 2NPSD 1JY2O 3L36A 3CCVP 5H2FV 5B66V 2KB7P 2MJZA 1SLQA 3NBSA 4M3LA 2H7HA 4JYBA 3AECC 3CX5I 1KN7A 5APVA 5KTBA 2P7JA 4IFDK 3Q5PA 3BVHA 5AVWB 1YTZT 2D2CB 4LJIA 1WVEC 3OW2O 2B88A 3L70G 1IFMA 2RKLA 5KAIV 4H0KA 1X79B 1YHQP 2GM4A 5AW3B 3VMAA 1SQPG 3MHVA 1KV9A 1RHZB 4OWFA 2K9YA 1CIEA 4I7ZB 1HF9A 1MG3D 4UB8E 3V2PA 2QRXA 3HD7A 1QYZA 1H33A 3A5TA 2JEEA 2C2CA 4J20A 2OYIC 1IJDB 2B0ZB 1GW4A 2IBZE 1FI7A 3JSVC 3VMYA 1Y8AA 2IYPA 2OYHB 5GTHH 1C52A 1HWTC 4QAOA 2GIWA 1JO5A 3T97A 2WITA 1IC2A 2B11B 2QM7A 1SQXD 1T6AA 5APWA 3HE5B 3ZIYA 1SQVK 4WQBA 3IN6A 1UIXA 5AW6B 2OTKE 1WT6A 4GEDB 3TF5A 1AFOA 3CCQP 1GK4A 3P7KA 5APXA 3NBTA 1R5LA 1X9VA 1FI3A 1JTHA 2QSIA 3TGUE 4L76A 3HUSB 3Q2YA 2GC7D 1NTZG 1SQQG 2YNYA 1ZZHA 3MIWA 5H2FE 2I1JA 5B66E 2L4DA 3L75G 3A7OA 3PLNA 3P8CE 2FY8A 4D6TD 3G6EP 2E5TA 4PV1C 1FZFA 5APUA 2Q7CA 3B8EB 1QX8A 4PD4D 3TGUJ 4KT0J 3W68A 3MP7B 1CRYA 5KAIE 4K35A 3WMM0 2IYOA 4PJ0H 3L72D 1CEDA 1NAYA 1LTJC 2N9JA 3ITKA 1LTBC 1NTKD 3CP5A 1ZV8A 3TDKA 3IR9A 1SFCD 3CD6P 4L75A 3L4MA 2FWLA 1H9YA 2C0XA 5KAIH 4H0LB 4Q5PA 4KJMA 1KB9H 4GODA 3MUDC 1T3JA 2YXRB 3ZBMA 1VQ6P 4YE1A 3KZIE 5CCGD 3MD0A 1AOQA 1I6EA 4BRYA 4DOJA 1NO4A 1LWUC 1JM0A 155CA 3GW6A 1GW3A 4WY4D 2DGEA 2B87B 1LP1A 1GL2B 4YXWH 5AW2B 3CC2P 1PP9D 1Q81Q 3RK3C 3CMAP 2KS1A 3O8ZA 5CIGB 4DJGA 2HFED 2C1UA 5KAFE 1HJ5A 1VQMP 1FAVA 2BASA 2QVAA 3AEDC 3V2QA 3L74D 4IFMA 2DVHA 5CIHB 2C9LY 2GB8B 2LXCB 1WRGA 2H89C 2IBZG 3L4OA 2BGVX 1DIPA 1E2RA 4KHXA 4ZKUA 2YKOA 3RK2D 3RMZA 5KLVD 2XNXA 3O0RC 4WB4A 4ASWA 1KILB 1NTKK 1U57A 1N86A 2KI7B 1VQ8P 1FJPA 4RJTA 1LT9C 2C1DB 1C75A 3TGUG 1VQPP 3C9IA 1KB9I 3H1LE 1NTME 1M8OB 1OW7A 1IK9A 2QJYB 1CXCA 1HJ3A 2QJKB 1PPJG 3CX5D 2C0WA 2Q6QA 2N1TC 4A7PA 4FB1A 3AE1C 5AW4B 2PACA 1Q90D 1J1DB 3OCDB 2RMZA 1ZRTD 4RESB 3SFDC 3M0DC 4L3GA 1GU5A 3B5NB 4AALA 1LC1A 1NTMJ 3H1JJ 3M9HA 3MTUE 1K05A 1WMKA 1RF1B 3AE9C 2N9IA 2IPPA 1E8EA 3LIDA 1KZUB 2IFMA 2LKMA 3HE5A 3TSIA 5AW0B 2W8ZA 1LTSC 1DIQC 2WSFH 1CZQA 1LTAC 1URQD 1LTTC 1NMIA 2WSFJ 1RAPA 1N7SC 2GUVA 1FZBA 5AVUB 1M1JA 2FFDA 1EB7A 3A0BV 2EXVA 1W5CE 1CRGA 2Z4EA 2BPBB 3CCUP 4HH2A 3WFEC 3HQ6A 1HROA 1FS0E 3V2NA 5L8RJ 1CTZA 2JKVA 4IL6X 1VQ5P 2N1TD 1EZVE 1EXJA 1OXZA 3CXHE 1DW0A 4W7ZA 2PP6A 5CJ4A 1BSNA 3SWYA 1FZGA 1X0TA 3FX0A 2OYIA 1VQNP 1AV1A 2AEFA 1T2KD 1KORA 1L4AC 5DFSA 2DW3A 1KYOE 1NHLA 1SFCA 3U1CA 4XA4A 1YEBA 3DMIA 4H44B 1DW1A 1CSXA 2I8FA 5AVVB 5TISE 4L3HA 2N9YB 3BCCE 3H1IE 1YYCA 1KFNA 1YCCA 1NWQA 5APQA 5CCGA 3WFDC 3KPEA 1HGVA 4JYCA 2AXCA 3I56P 1AKKA 4IL6V 4H0JA 4WY4A 1L0NJ 4HB1A 5B6QA 1N7SD 2B87A 1YEAA 3H1LG 1NTMG 2CPBA 1J1EB 3HD7B 1N15A 5EFWB 1LT1A 3EFGA 1H33B 3GHGA 4LLHA 4EYYQ 1JDLA 1DH3A 1VQOP 3BCCJ 3KXDA 351CA 2OQQA 1M60A 3H1IJ 1CC5A 5B5EV 2IX7C 2OTJP 4W7YA 2HYNA 3T97B 1VF5C 2YO3A 1IK7A 1HZUA 3Q1MA 4OGQC 1VL2A 2P1JA 1IFIA 3L73D 4GOFA 3O5CA 1K3GA 1L4AD 1RQUA 3E1IA 1R8EA 1CNOA 4P4QB 4XXLA 2Q9IA 1KILA 1GK6A 2AIUA 3A0BH 1SQPE 3WFCC 2C1DA 1IRWA 2VRSA 1RF0C 1CRHA 4N6JA 3E7KA 1YQ4C 1H0TB 1JMMA 1AOFA 2ZT9B 3M9QA 1EDIA 3WU2E 3O6QA 1RE3A 3GLMA 1LWUA 5APSA 1HTLC 2J59M 3IFMA 3MZWB 4NPFX 1SQPJ 1FOSE 1H8AA 5E79E 1A02F 1DVVA 1KV4A 5AW7B 1BGYD 5CHXA 1KB9D 1X8YA 2E75C 3CWBD 5CCHA 1SQBE 5KJ7C 3JBTB 5AW5B 2CE1A 4Z1MH 1A02J 4H13B 1BCCG 2W6AA 1GQ1A 5CIBB 3NFQA 1URQA 1M7LA 3MK7B 1PGOA 2BCCD 4IL6H 3VP8A 4O9BA 4V2KA 3FWLA 1FZEA 1C2NA 1P84I 1OFCX 2D2CC 2A06D 1RE4C 1FHBA 3BCCG 1LT9A 1IRVA 1L9BC 3RGUA 1H9XA 3H1IG 1LP1B 1HJ4A 1NH4A 2YKQA 2OARA 2H43A 1G1IA 1EC5A 5B5EH 4HKZH 2HODB 2KS1B 2OGUA 1FJKA 1YI2P 2J5UA 1ETPA 2B4ZA 2ZONG 1CTYA 1M1KQ 2NPSB 2PGDA 1QL4A 1RQVA 2WWWA 2CK3H 2JR8A 2FXMA 4WQ7A 1B7VA 3K5BA 2HV4A 3VMZA 1JNMA 1QL3A 2E75D 2W6JH 1H1OA 1K9MQ 3C1LA 2XV5A 1DEEG 2ZVOB 1MG2D 2OYHC 4WQ8A 1PP9G 5CIFB 3D6YA 3RL0D 2K37A 1HUCA 1OVRA 2JDIH 4UB6V 3L71G 1KQFB 2ZXYA 1S1CX 1RY3A 2IFNA 1CORA 2RN0A 3L74G 1AQTA 1G1JA 3H1JD 2Z5HA 1F1CA 1I55A 1K3HA 1N7SA 2I1KA 3WC8A 1H88A 1USEA 2R44A 2ZAEB 1MFZA 1VYDA 4RSZA 1C6OA 1BE3D 2KZJA 2R5BA 1HBWA 3PP5A 3KZIV 1Q7YQ 4UB8H 1CIHA 1MV8A 1NYHA 1XTCC 3SJLA 1OCDA 2KP8A 1HRCA 4AAOA 4U3FD 3H1KD 2B12B 1SQBG 2WVRA 3L37A 2FYUE 3FXDA 1MZ4A 3U1AA 3S1KA 4I2LC 1LGHB 4JCGA 5KAFV 4H0LC 3LW5H 1PPJE 1AYGA 1USDA 4FA5A 2YXQB 1M1JB 2B9BA 1S9KD 2FFDB 1H0TA 1FE6A 4U7JA 3LW5J 3WUIA 2FYUJ 2ZYDA 3VNWA 4UB6E 2G3AA 5H2FH 5B66H 5DF5A 3V4WA 1CIGA 1GL2C 2E42A 3G3ZA 5EXQA 1NU1D 5GTIE 4PW9B 3H1HE 2OYIB 1FDMA 1CHIA 1JY3P 4GIFA 1L0ND 1E29A 2H8PD 1SFCB 1L0LD 2FBWC 3WFBC 2HPCA 1GDVA 3PXSA 4WQDA 1T3UA 3HE4B 3SWSA 3B71A 2HLOA 5KLIB 1U7JA 4ZNCA 2E74C 3A3YB 2O01N 5DJTB 1SQXK 2PCBB 1QL2A 3L35A 1EQ7A 2IBZI 4ASVA 5AW9B 3R2PA 3H1HJ 1HCMA 2W27A 2XZRA 1S5LV 2FYNB 4WY4B 1KQGB 3FWNA 1C7MA 3G71P 1I8OA 1CHHA 3D70A 1RF0A 4EIJA 1U74B 1N8RQ 2ZJSE 3KZIH 1JY3N 3P32A 4NFGB 2QJYC 3X39A 2HODA 3GHGB 4EOTA 1CYCA 4PV1D 4O1QA 1CYIA 2AXTV 1P84D 1GZLA 2NPSA 1J1DC 2LITA 2N3BA 3QH9A 2CE0A 451CA 4BXLA 4NPEA 3WUVA 1GMJA 3B5NC 2GC4D 5KAFH 1NJIQ 4RO0A 5AW8B 3V6IA 3V2RA 3RK2B 1CSUA 3L70D 1KMIZ 1NU1K 2PCCB 1SQVE 1N73A 1S72P 1VQ4P 1Z56A 4IOIH 2SPZA 2IZ1A 3ZOOA 1ZW0A 2P67A 4WQAA 2QG4A 2FYUG 1L0LK 4MU8A 2E74D 2K3RA 2BH5X 2E76C 2QIWA 2CA4B 4OVNF 1U7MA 3O20A 3CCRP 3CMEP 2WPVB 3M06A 3HTKA 1UIIA 3NMDA 4I1LA 4Y5RA 3O6QB 3E1RA 1LWUB 3P8MC 4EDFA 1BL9A 2O3JA 1SQVJ 1NNOA 4WBAA 3USSA 1RAQA 5TISV 1DVHA 3CC7P 2O1JA 5CICB 2KLUA 3RK3D 5AVZB 3NTNA 1EDLA 2BH4X 3H1LJ 3M9BA 3H32A 3I5CA 1JMBA 1FZCC 1S5LE 4N78D 3Q3DA 4AYCA 1W2EA 3H1HG 3PJSK 5APTA 1GJQA 3AE2C 1U75B 1NTZD 1SQQD 1PGJA 3ZCFA 3SSUA 1GTWA 2B10B 4AANA 1URQB 1I54A 4WQEA 3II6A 3L75D 1JY3O 4H44C 3SWFA 2JP3A 2AXTE 1BGYG 1E79H 4WVZA 1SQXE 1SS1A 3JCUE 5KLVK 2YIUC 3U59A 1LT9B 3ABVC 2NRGA 2JJLA 1DW2A 2L91A 1OAEA 1OZHA 1AVYA 2E76D 2WQYC 3FGAD 1Q82Q 2Q3IA 2AXTH 3O1YA 4RKUJ 1LJ2A 1KQLA 3N4XA 1PGPA 2BCCG 2N18B 2N1TB 1A8CA 1FJ0A 2CPSA 1FDIA 1SVFA 3AE5C 2QE7H 1TU3F 3VOPA 3HD7C 2YO2A 2J58A 4D6TE 5M1BA 1FI9A 3PXTA 2MHMA 1BCCE 1FOCA 1YJWP 1S6VB 1HGZA 3BATA 2OTLP 4PD4E 1GD2E 1HZVA 3BRTB 3CXHH 3WU2V 1YJ9P 1M57D 3A0HV 3RL0g 5AURA 3HE4A 1CI6B 3L72E 2QA4P 3HQ9A 5AW1B 1SQVG 1NTKE 1KYOH 1AQ5A 5E79V 3TNUA 2KXPB 1DD4A 2PAJA 4D6TJ 1CSWA 1NTZK 1SQQK 1BCCJ 3CXHW 2JO1A 1RZ5A 5TISH 2PRRA 3AE8C 3D6ZA 1N7SB 2KYVA 3EWKA 3Q5SA 1IFDA 2Q3EA 1CRIA 4LC1A 1CRJA 4L74A 1KYOW 3L72J 3D0WA 3RN1A 5CIEB 1ZR4A 1NTKJ 3NXSA 2XDJA 4EI2A 5APYA 1YFCA 1DW3A 2QM8A 2IBZD 2JQRA 1Q2NA 2P10A 5AVSB 3BRVB 2JWAA 4FAVA 1PP9E 2ZVNB 5DJQC 1VDFA 1LMSA 2D0WA 4BWNA 3L71E 1LTJA 3DP5A 1J3SA 2POHA 2C9NY 2WSEH 4N3YB 1L4AB 3CCLP 1MKMA 5AVRB 1KD1Q 1I8PA 3L74E 1EZVI 3TGUD 4H13C 2E43A 5K5GB 3CXHI 2NZ2A 1RH5B 2KIKA 2WSEJ 3PH2B 1S3JA 1IO4A 4OH8B 1NAFA 1EDJA 1F1FA 1W2LA 3MUDA 3ZDMA 1PP9J 5KLVE 1SQXG 3P8CD 1H89A 4U3FG 1KYOI 1KILE 3L71J 1ZLLA 1OX3A 1JUNA 2O01J 3A0HE 3TYYA 4AUWA 3VMXA 3L74J 1Y47A 1KC8Q 2Y9YA 3CCJP 2W83C 2WPSA 2WT7A 1MFTA 3ZOWA 1VPCA 3WU2H 1GIWA 2BCNB 3CX5E 4TLFA 3A0HH 2KUBA 1CXAA 1MZ9A 1RZ6A 2IZ0A 1DIIC 4YXDC 2KOGA 2ZYAA 2A45G 3VTPC 3PH0A 2K9JA 2HPCB 1BDDA 4D6TG 2R3SA 1FOSF 1NVOA 1ZRTE 1VF5D 2OZ1A 1JOCA 5E79H 1DEBA 2JWDA 2B89A 4OGQD 1ZR2A 1N2DC 1CSVA 2MKVA 3AE4C 1N90A 2YKPA 2XU6A 2N3YA 1CTJA 1GU4A 4GT1A 3L72G 3OA7A 1R0QA 4PWAA 4AAMA 4KMGA 2E5YA 1NTKG 3Q5RA 1NMLA 5CBNA 1SQBJ 5GTHV 1C6SA 1L0LG 3JC22 1C6RA 3RN0A 4HJGH 4L73A 3AE3C 1LFMA 1H32A 1FDOA 2N1TA 2G8YA 1OMIA 4I7ZC 2ZXXA 3V4QA 3M0DA 1QLED 1G2CB 3SXTA 2FRCA 1VQKP 2E75B 3B4SA 4L1QA 5KJ7D 1M56D 2ZZS1 5IY51 1J2JB 1FU1A 3AEEC 1N73B 3RL0B 2D0SA 1LS9A 2FYZA 1CI6A 1Y9BA 4EIDA 1QGKB 3M97X 2BEQD 3EFFK 3RBZA 2YMKA 3H1LD 5GTIV 1NTMD 4PJ0V 4GOEA 4C7RA 1ZMEC 2C1VA 2IDBA 3HUSC 3HTKB 2D2CD
chains in the Genus database with same CATH topology
1RAPA 1S5LV 2FYNB 3CU4A 1C7MA 1I8OA 1CHHA 3ZOXA 1EB7A 3A0BV 2EXVA 3VYMA 2Y0EA 1CRGA 2QJPB 2BPBB 1U74B 1N9CA 1W5CT 1COTA 4NFGB 3WFEC 3HQ6A 3HQ7A 1HROA 3X39A 3SVWA 1CYCA 1KX7A 3H1HD 4AX3A 1CTZA 1IO3A 4O1QA 1CYIA 3OA8B 2AXTV 1P84D 1QKSA 1DW0A 5KKZB 4FA1A 2LITA 2N3BA 3OCDA 2CE0A 451CA 5DJQB 1IZL0 1KX2A 2GC4D 1I5TA 1GKSA 5DFSA 3PHLA 1CSUA 3NWVA 3L70D 2PCCB 4DY9A 1YEBA 3DMIA 1DW1A 1IQCA 1M6ZA 3ZOOA 3HQ8A 1CSXA 4WQAA 2I8FA 2QG4A 5TJHA 4L3HA 1CYJA 4UB8V 2Y0DA 2C8SA 4MU8A 4EIEA 2N9YB 2C9XB 3GG2A 1A56A 3CX5W 2BH5X 3TYIA 2CA4B 1QN2A 1CHJA 3O20A 3RLMA 1YCCA 1A2SA 3WFDC 5C0ZA 4GYDA 4Y5RA 4FA4A 1AKKA 4IL6V 4H0JA 2V08A 4EDFA 1BL9A 5B6QA 2O3JA 1YEAA 2ORLA 1EZVD 1NNOA 4XYDB 3CXHD 1RAQA 5TISV 1HH7A 1DVHA 2YQBA 1N15A 5CICB 1H33B 1JDLA 1BCCD 1L9JC 2BH4X 351CA 1M60A 3OA8A 4EIFA 1C2RA 1KYOD 1CC5A 1H31B 4O1WA 5B5EV 1SQVD 2YCCA 3PXWA 2CXBA 5H2FV 5B66V 1HZUA 1GJQA 4N0KA 3NBSA 1U75B 2JTIB 1NTZD 1SQQD 3ZCFA 1CCHA 2B10B 4AANA 3L73D 3BCCD 3O5CA 1K3GA 1I54A 4WQEA 3H1ID 3L75D 1CNOA 4P4QB 4XXLA 2AIUA 4LJIA 1WVEC 3WFCC 2C1DA 1IRWA 5KAIV 1DW2A 2L91A 1OAEA 4H0KA 1CRHA 2XTSB 3VMAA 5CYTR 3O1YA 1AOFA 1KV9A 2N18B 1A8CA 1FJ0A 1CIEA 1MG3D 2MTAC 1QYZA 1H33A 3PTZA 1DVVA 2C2CA 1BGYD 1CCRA 4J20A 1FI9A 3PXTA 2MHMA 3L71D 1KB9D 1FOCA 2B0ZB 3CWBD 1FI7A 1S6VB 3DR0A 4K3IA 1H31A 3VRDA 1HZVA 3WU2V 3JBTB 1C52A 2CE1A 4QAOA 3A0HV 2GIWA 5AURA 2B11B 1GQ1A 1SQXD 3ZIYA 1I6DA 1SQPD 3HQ9A 4WQBA 5CIBB 4WQCA 4GEDB 3TF5A 3MK7B 2BCCD 5E79V 3NBTA 4V2KA 1FI3A 3FWLA 3SLEA 1CSWA 2BLFB 1C2NA 3CXHW 2A06D 2GC7D 1RZ5A 1ZZHA 1FHBA 1IRVA 1L9BC 1H9XA 2Q3EA 2L4DA 1CRIA 3PLNA 1CRJA 1HJ4A 1KYOW 1KB0A 2Y0CA 3RN1A 4D6TD 5CIEB 1YFCA 1DW3A 2N18C 2IBZD 1ETPA 2JQRA 1WEJF 4PD4D 1NIRA 2B4ZA 2ZONG 1CTYA 1SQBD 3CYTI 2K9JB 2JWAA 1QL4A 4FAVA 1CRYA 4WQ7A 5DJQC 2OZ1B 1B7VA 1LMSA 2D0WA 3L72D 1CEDA 1YIQA 2HV4A 3DP5A 1J3SA 2N9JA 2YK3A 3ITKA 2ZOOA 1QL3A 1NTKD 3CP5A 1H1OA 3TDKA 1MG2D 4WQ8A 5CIFB 1I8PA 3L4MA 3TGUD 2FWLA 1H9YA 2VHDA 4UB6V 4Q5PA 3PH2B 1YNRA 2ZXYA 3A9FA 3PRJA 1CORA 1F1FA 1W2LA 2RN0A 3H1JD 3ZBMA 1GU2A 4YE1A 1F1CA 1I55A 1AOQA 1I6EA 1CO6A 155CA 1K3HA 3GW6A 1H32B 2DGEA 2CA3B 2LIRA 1LC2A 3WC8A 1KIBA 1VYDA 4RSZA 1C6OA 1PP9D 1BE3D 1M70A 2KS1A 3ZOWA 1GIWA 2BCNB 5CIGB 5CIDB 1CXAA 2C1UA 1HJ5A 1RZ6A 1DIIC 2ZBOA 3KZIV 1CIHA 3L74D 4EICA 2DVHA 5CIHB 3SJLA 2GB8B 1OCDA 2OZ1A 3ORVA 1HRCA 4AAOA 4U3FD 3L4OA 2BGVX 3H1KD 3KHUA 2B12B 1CSVA 1YTCA 1FCDC 1E2RA 1N90A 2N3YA 1CTJA 4WQ9A 4FA9A 3RMZA 5KLVD 1DT1A 1MZ4A 2V07A 3O0RC 4JCGA 1R0QA 5KAFV 4PWAA 4AAMA 4KMGA 1YICA 4RJTA 1NMLA 2YIUB 5GTHV 1C6SA 1AYGA 4FA5A 2C1DB 1C75A 1C6RA 3RN0A 2KNCB 2QJYB 4FANA 1CXCA 1HJ3A 2QJKB 3WUIA 3CX5D 1LFMA 1H32A 2AI5A 3VNWA 4A7PA 5DF5A 4FB1A 2PACA 1CIGA 3OCDB 2RMZA 1ZRTD 5EXQA 1NU1D 4L3GA 3SXTA 2FRCA 4PW9B 1CHIA 4AALA 1LC1A 2FYUD 3ZOYA 1L0ND 1E29A 4L1QA 1L0LD 3WFBC 2ZZS1 5IY51 1GDVA 3PXSA 3C2CA 2N9IA 1E8EA 2D0SA 4WQDA 1LS9A 3SWSA 5KLIB 4EIDA 3M97X 1DIQC 1PPJD 3MK7C 1CRCA 2PCBB 3H1LD 5GTIV 1NTMD 5C9MA 4PJ0V 1NMIA 2C1VA 1CIFA 1N50A 1HCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RAP A;  1S5L V;  2FYN B;  3CU4 A;  1C7M A;  1I8O A;  1CHH A;  3ZOX A;  1EB7 A;  3A0B V;  2EXV A;  3VYM A;  2Y0E A;  1CRG A;  2QJP B;  2BPB B;  1U74 B;  1N9C A;  1W5C T;  1COT A;  4NFG B;  3WFE C;  3HQ6 A;  3HQ7 A;  1HRO A;  3X39 A;  3SVW A;  1CYC A;  1KX7 A;  3H1H D;  4AX3 A;  1CTZ A;  1IO3 A;  4O1Q A;  1CYI A;  3OA8 B;  2AXT V;  1P84 D;  1QKS A;  1DW0 A;  5KKZ B;  4FA1 A;  2LIT A;  2N3B A;  3OCD A;  2CE0 A;  451C A;  5DJQ B;  1IZL 0;  1KX2 A;  2GC4 D;  1I5T A;  1GKS A;  5DFS A;  3PHL A;  1CSU A;  3NWV A;  3L70 D;  2PCC B;  4DY9 A;  1YEB A;  3DMI A;  1DW1 A;  1IQC A;  1M6Z A;  3ZOO A;  3HQ8 A;  1CSX A;  4WQA A;  2I8F A;  2QG4 A;  5TJH A;  4L3H A;  1CYJ A;  4UB8 V;  2Y0D A;  2C8S A;  4MU8 A;  4EIE A;  2N9Y B;  2C9X B;  3GG2 A;  1A56 A;  3CX5 W;  2BH5 X;  3TYI A;  2CA4 B;  1QN2 A;  1CHJ A;  3O20 A;  3RLM A;  1YCC A;  1A2S A;  3WFD C;  5C0Z A;  4GYD A;  4Y5R A;  4FA4 A;  1AKK A;  4IL6 V;  4H0J A;  2V08 A;  4EDF A;  1BL9 A;  5B6Q A;  2O3J A;  1YEA A;  2ORL A;  1EZV D;  1NNO A;  4XYD B;  3CXH D;  1RAQ A;  5TIS V;  1HH7 A;  1DVH A;  2YQB A;  1N15 A;  5CIC B;  1H33 B;  1JDL A;  1BCC D;  1L9J C;  2BH4 X;  351C A;  1M60 A;  3OA8 A;  4EIF A;  1C2R A;  1KYO D;  1CC5 A;  1H31 B;  4O1W A;  5B5E V;  1SQV D;  2YCC A;  3PXW A;  2CXB A;  5H2F V;  5B66 V;  1HZU A;  1GJQ A;  4N0K A;  3NBS A;  1U75 B;  2JTI B;  1NTZ D;  1SQQ D;  3ZCF A;  1CCH A;  2B10 B;  4AAN A;  3L73 D;  3BCC D;  3O5C A;  1K3G A;  1I54 A;  4WQE A;  3H1I D;  3L75 D;  1CNO A;  4P4Q B;  4XXL A;  2AIU A;  4LJI A;  1WVE C;  3WFC C;  2C1D A;  1IRW A;  5KAI V;  1DW2 A;  2L91 A;  1OAE A;  4H0K A;  1CRH A;  2XTS B;  3VMA A;  5CYT R;  3O1Y A;  1AOF A;  1KV9 A;  2N18 B;  1A8C A;  1FJ0 A;  1CIE A;  1MG3 D;  2MTA C;  1QYZ A;  1H33 A;  3PTZ A;  1DVV A;  2C2C A;  1BGY D;  1CCR A;  4J20 A;  1FI9 A;  3PXT A;  2MHM A;  3L71 D;  1KB9 D;  1FOC A;  2B0Z B;  3CWB D;  1FI7 A;  1S6V B;  3DR0 A;  4K3I A;  1H31 A;  3VRD A;  1HZV A;  3WU2 V;  3JBT B;  1C52 A;  2CE1 A;  4QAO A;  3A0H V;  2GIW A;  5AUR A;  2B11 B;  1GQ1 A;  1SQX D;  3ZIY A;  1I6D A;  1SQP D;  3HQ9 A;  4WQB A;  5CIB B;  4WQC A;  4GED B;  3TF5 A;  3MK7 B;  2BCC D;  5E79 V;  3NBT A;  4V2K A;  1FI3 A;  3FWL A;  3SLE A;  1CSW A;  2BLF B;  1C2N A;  3CXH W;  2A06 D;  2GC7 D;  1RZ5 A;  1ZZH A;  1FHB A;  1IRV A;  1L9B C;  1H9X A;  2Q3E A;  2L4D A;  1CRI A;  3PLN A;  1CRJ A;  1HJ4 A;  1KYO W;  1KB0 A;  2Y0C A;  3RN1 A;  4D6T D;  5CIE B;  1YFC A;  1DW3 A;  2N18 C;  2IBZ D;  1ETP A;  2JQR A;  1WEJ F;  4PD4 D;  1NIR A;  2B4Z A;  2ZON G;  1CTY A;  1SQB D;  3CYT I;  2K9J B;  2JWA A;  1QL4 A;  4FAV A;  1CRY A;  4WQ7 A;  5DJQ C;  2OZ1 B;  1B7V A;  1LMS A;  2D0W A;  3L72 D;  1CED A;  1YIQ A;  2HV4 A;  3DP5 A;  1J3S A;  2N9J A;  2YK3 A;  3ITK A;  2ZOO A;  1QL3 A;  1NTK D;  3CP5 A;  1H1O A;  3TDK A;  1MG2 D;  4WQ8 A;  5CIF B;  1I8P A;  3L4M A;  3TGU D;  2FWL A;  1H9Y A;  2VHD A;  4UB6 V;  4Q5P A;  3PH2 B;  1YNR A;  2ZXY A;  3A9F A;  3PRJ A;  1COR A;  1F1F A;  1W2L A;  2RN0 A;  3H1J D;  3ZBM A;  1GU2 A;  4YE1 A;  1F1C A;  1I55 A;  1AOQ A;  1I6E A;  1CO6 A;  155C A;  1K3H A;  3GW6 A;  1H32 B;  2DGE A;  2CA3 B;  2LIR A;  1LC2 A;  3WC8 A;  1KIB A;  1VYD A;  4RSZ A;  1C6O A;  1PP9 D;  1BE3 D;  1M70 A;  2KS1 A;  3ZOW A;  1GIW A;  2BCN B;  5CIG B;  5CID B;  1CXA A;  2C1U A;  1HJ5 A;  1RZ6 A;  1DII C;  2ZBO A;  3KZI V;  1CIH A;  3L74 D;  4EIC A;  2DVH A;  5CIH B;  3SJL A;  2GB8 B;  1OCD A;  2OZ1 A;  3ORV A;  1HRC A;  4AAO A;  4U3F D;  3L4O A;  2BGV X;  3H1K D;  3KHU A;  2B12 B;  1CSV A;  1YTC A;  1FCD C;  1E2R A;  1N90 A;  2N3Y A;  1CTJ A;  4WQ9 A;  4FA9 A;  3RMZ A;  5KLV D;  1DT1 A;  1MZ4 A;  2V07 A;  3O0R C;  4JCG A;  1R0Q A;  5KAF V;  4PWA A;  4AAM A;  4KMG A;  1YIC A;  4RJT A;  1NML A;  2YIU B;  5GTH V;  1C6S A;  1AYG A;  4FA5 A;  2C1D B;  1C75 A;  1C6R A;  3RN0 A;  2KNC B;  2QJY B;  4FAN A;  1CXC A;  1HJ3 A;  2QJK B;  3WUI A;  3CX5 D;  1LFM A;  1H32 A;  2AI5 A;  3VNW A;  4A7P A;  5DF5 A;  4FB1 A;  2PAC A;  1CIG A;  3OCD B;  2RMZ A;  1ZRT D;  5EXQ A;  1NU1 D;  4L3G A;  3SXT A;  2FRC A;  4PW9 B;  1CHI A;  4AAL A;  1LC1 A;  2FYU D;  3ZOY A;  1L0N D;  1E29 A;  4L1Q A;  1L0L D;  3WFB C;  2ZZS 1;  5IY5 1;  1GDV A;  3PXS A;  3C2C A;  2N9I A;  1E8E A;  2D0S A;  4WQD A;  1LS9 A;  3SWS A;  5KLI B;  4EID A;  3M97 X;  1DIQ C;  1PPJ D;  3MK7 C;  1CRC A;  2PCB B;  3H1L D;  5GTI V;  1NTM D;  5C9M A;  4PJ0 V;  1NMI A;  2C1V A;  1CIF A;  1N50 A;  1HCM A; 
#chains in the Genus database with same CATH topology
 1S2E A;  1OVV A;  3CU4 A;  4Y99 B;  5KLV G;  2R5D A;  1M1J C;  2WSC H;  3ZOX A;  2FFD C;  5CBO A;  2Y0E A;  2QJP B;  2KNC A;  1ZP0 C;  1N9C A;  1W5C T;  1FC2 C;  1COT A;  4MN4 C;  1IFJ A;  1R5S A;  1KX7 A;  5AVX B;  2P2U A;  4QMA A;  2WSC J;  4AX3 A;  1IO3 A;  3H32 B;  1M90 Q;  4YTP C;  1QKS A;  3WUU A;  3F89 A;  5KKZ B;  5GTH E;  3EQ2 A;  3VN0 A;  1KX2 A;  1GDT A;  2K88 A;  2N9B A;  1I5T A;  1AA0 A;  4GKG A;  4DCK A;  1GKS A;  2V4H A;  2FXO A;  1L4A A;  3PHL A;  2LXB A;  3NWV A;  1SFC C;  5TJH A;  2FKW B;  5KLI C;  1CYJ A;  2Y0D A;  4EIE A;  2Z5I A;  2C9X B;  3L73 E;  1A56 A;  3TYI A;  1CSB A;  1QN2 A;  1HJ0 A;  2KSE A;  1A2S A;  1NOH A;  5CCG C;  4JBZ A;  5C0Z A;  4GYD A;  1YJN P;  2FYN C;  4WY4 C;  1NTM K;  1S5L X;  4JQ0 D;  3GMA A;  1EZV D;  3KQG A;  4W80 A;  3CXH D;  2LR2 A;  1IZN B;  2YQB A;  4R4L A;  2H88 C;  2YMY A;  3GHG C;  4PJ0 E;  3FXE A;  1Q86 Q;  3CCM P;  3L73 J;  1BCC D;  1L9J C;  4UB6 H;  3AEG C;  3OA8 A;  1KFM A;  1KYO D;  4O1W A;  3LIE A;  4C7N A;  2YCC A;  3AEF C;  3PXW A;  1BDC A;  2CXB A;  5GTI H;  4N0K A;  1OW8 A;  1BGY E;  2JTI B;  4DZO A;  1KB9 E;  1CCH A;  3CWB E;  4K3A A;  3RK2 C;  3BCC D;  1QL1 A;  3TNU B;  3M0A A;  3H1I D;  1KIL C;  5CMZ A;  1E5W A;  4LGD E;  4JF7 A;  4H0L D;  3SFE C;  2BCC E;  2HR3 A;  2R32 A;  2WSS H;  1BSH A;  2XTS B;  1BGY J;  5CYT R;  4WWI A;  5AVY B;  2A06 E;  2QJK C;  2KK7 A;  1OWA A;  3CWB J;  3TK1 A;  1RE3 C;  4PV1 B;  1VQ7 P;  1JB0 J;  2KLV A;  3W67 A;  1FZA A;  1GL2 D;  3AE7 C;  2MTA C;  3QWO C;  3MGN A;  3PTZ A;  1G2C A;  1PGQ A;  1CCR A;  1LTJ B;  3L71 D;  2ZYG A;  2BCC J;  3G4S P;  3DR0 A;  3IF4 A;  1NKZ B;  4K3I A;  1H31 A;  5CCH C;  3D71 A;  1RF1 C;  3VRD A;  5KJ7 A;  3SWK A;  2WTY A;  2M0B A;  4YPC A;  1L0N K;  1JCC A;  1I6D A;  1SQP D;  4WQC A;  1D7M A;  1URQ C;  1W2B O;  2E74 B;  2Q1K A;  2P58 A;  2WPQ A;  2ZFC A;  3SLE A;  5BVZ A;  2BLF B;  1DD3 A;  1KIL D;  1ZN5 A;  1NKN A;  1RE4 A;  1VQ9 P;  1FBM A;  3L73 G;  3N7N A;  3H6P A;  3H1J E;  1K04 A;  2WT7 B;  3RK3 B;  1KB0 A;  2Y0C A;  3UIA A;  3I55 P;  1JEK A;  2N18 C;  1WEJ F;  1NIR A;  3OAK A;  1SQB D;  3CYT I;  1YQ3 C;  2K9J B;  3L4F A;  2BEZ F;  3G9R A;  5BU8 B;  3AEA C;  1BE3 E;  2OZ1 B;  3GF3 A;  2AEJ A;  1YIQ A;  2YK3 A;  3B5N D;  2ZOO A;  1LTG C;  1OVU A;  1T2K C;  1EDK A;  1S5L H;  1JCD A;  5CCH D;  2OYH A;  4R4M A;  1K8A Q;  2VHD A;  4B86 A;  3CWB G;  4U3F E;  1YNR A;  3A9F A;  1PV3 A;  3PRJ A;  3H1K E;  4IFF A;  2E76 B;  2M3E A;  1SQP K;  1BE3 J;  5AVT B;  1GU2 A;  3HUS A;  3CI9 A;  4CPG A;  3JCU H;  2OYO A;  1CO6 A;  1H32 B;  1PIX A;  2CA3 B;  2LIR A;  1LC2 A;  1HH0 A;  2M5A B;  1J1E C;  1CW5 A;  1S9K E;  1KIB A;  2A06 G;  2ZXE B;  3H25 A;  1SQX J;  3OJA B;  4U3F J;  3C8V A;  2PFX A;  3H1K J;  1M70 A;  1OW6 A;  5CID B;  4XE5 B;  1L2P A;  2KSJ A;  3S4R A;  2ZBO A;  3CLQ A;  4XFJ A;  1T8Z A;  1FZC B;  4EIC A;  2A45 H;  1LTI C;  3ORV A;  1NU1 E;  1SQB K;  3KHU A;  2ITA A;  1YTC A;  1NGM B;  1FCD C;  1QVF O;  4PD4 H;  3BAS A;  1L0N E;  4WQ9 A;  4FA9 A;  1L0L E;  2Q5U A;  1DT1 A;  2R3C A;  2V07 A;  2M3B A;  3CPW O;  2GUS A;  4H44 D;  2HG5 D;  2O1K A;  2V7Q H;  1YIC A;  2YIU B;  1PFI A;  1IFP A;  4HYT B;  2KNC B;  1NU1 J;  2V7Q J;  1N7L A;  4FAN A;  2ZT9 C;  1YBK A;  1KQS O;  1YTZ I;  2AI5 A;  1JY2 P;  2WPR A;  1L0L J;  3H1J G;  1ZXG A;  2KZI A;  1GL2 A;  4AQR D;  1MUU A;  3HD7 D;  1IFN A;  2AEM A;  2WMM A;  5CJ0 A;  5DJU B;  2FYU D;  3ZOY A;  2W6B A;  1PL5 A;  1P84 E;  1BE3 G;  2Y9Z A;  1AJY A;  2WZ7 A;  3C2C A;  4ZMD A;  1K73 Q;  3A0B E;  1PZQ A;  2A45 I;  2QEX P;  3CCS P;  1PPJ D;  3MK7 C;  1CRC A;  2O01 H;  4DT0 A;  1P84 H;  3L70 E;  5C9M A;  1JTH B;  4PD4 I;  2XKM A;  1JY2 N;  3H1K G;  1CIF A;  1N50 A;  3CC4 P;  3S9O A;  3RBX A;  3R4Y A;  4C46 A;  3CCE P;  2FXP A;  3VYM A;  1VQL P;  3HQ7 A;  1HJB A;  2ZT9 D;  3SVW A;  3H1H D;  3CL3 D;  1KTM A;  1S4X A;  3L70 J;  5KLV J;  3OA8 B;  2NPS C;  4FA1 A;  4C7N B;  3AEB C;  3OCD A;  3WUT A;  1LNQ A;  1VF5 B;  1DX7 A;  5DJQ B;  1IZL 0;  3RK3 E;  1X22 A;  5AVQ B;  4OGQ B;  2K1A A;  3CX5 H;  3B5N A;  1EZV G;  2L5G B;  4JPZ B;  3A2A A;  1QEX A;  4N78 E;  4IL6 E;  1RF1 A;  1QVG O;  4DY9 A;  2M8R A;  1N73 C;  1OIP A;  3F5H A;  1NU1 G;  2I8D A;  3RL0 C;  3VYI A;  1IQC A;  1M6Z A;  3HQ8 A;  4H13 D;  4NPD A;  2FYU K;  2XND H;  4UB8 V;  3M91 A;  1L0N G;  2C8S A;  1NTZ E;  1SQQ E;  3AE6 C;  3GG2 A;  3CX5 W;  2GA1 A;  4TT3 H;  5C39 A;  1YIJ P;  1CHJ A;  3L75 E;  3RLM A;  3KDP B;  5BU5 A;  5B5E E;  1ZOY C;  4FA4 A;  4BRY B;  2W90 A;  2V08 A;  1HVV A;  4Y99 C;  3V5B A;  3KYQ A;  4GDO A;  2ORL A;  2M5A A;  4ZKP A;  4XYD B;  2RH0 A;  1HH7 A;  2QJP C;  2UWJ E;  3GF7 A;  3VP9 A;  4I6M C;  1EXI A;  3HRN A;  3IAO A;  1NTZ J;  1SQQ J;  1AVO A;  1XTG B;  4Y28 J;  4EIF A;  3L75 J;  1C2R A;  1YIT P;  1H31 B;  1FZC A;  1SQV D;  1SP4 A;  5KKZ C;  2NPS D;  1JY2 O;  3L36 A;  3CCV P;  5H2F V;  5B66 V;  2KB7 P;  2MJZ A;  1SLQ A;  3NBS A;  4M3L A;  2H7H A;  4JYB A;  3AEC C;  3CX5 I;  1KN7 A;  5APV A;  5KTB A;  2P7J A;  4IFD K;  3Q5P A;  3BVH A;  5AVW B;  1YTZ T;  2D2C B;  4LJI A;  1WVE C;  3OW2 O;  2B88 A;  3L70 G;  1IFM A;  2RKL A;  5KAI V;  4H0K A;  1X79 B;  1YHQ P;  2GM4 A;  5AW3 B;  3VMA A;  1SQP G;  3MHV A;  1KV9 A;  1RHZ B;  4OWF A;  2K9Y A;  1CIE A;  4I7Z B;  1HF9 A;  1MG3 D;  4UB8 E;  3V2P A;  2QRX A;  3HD7 A;  1QYZ A;  1H33 A;  3A5T A;  2JEE A;  2C2C A;  4J20 A;  2OYI C;  1IJD B;  2B0Z B;  1GW4 A;  2IBZ E;  1FI7 A;  3JSV C;  3VMY A;  1Y8A A;  2IYP A;  2OYH B;  5GTH H;  1C52 A;  1HWT C;  4QAO A;  2GIW A;  1JO5 A;  3T97 A;  2WIT A;  1IC2 A;  2B11 B;  2QM7 A;  1SQX D;  1T6A A;  5APW A;  3HE5 B;  3ZIY A;  1SQV K;  4WQB A;  3IN6 A;  1UIX A;  5AW6 B;  2OTK E;  1WT6 A;  4GED B;  3TF5 A;  1AFO A;  3CCQ P;  1GK4 A;  3P7K A;  5APX A;  3NBT A;  1R5L A;  1X9V A;  1FI3 A;  1JTH A;  2QSI A;  3TGU E;  4L76 A;  3HUS B;  3Q2Y A;  2GC7 D;  1NTZ G;  1SQQ G;  2YNY A;  1ZZH A;  3MIW A;  5H2F E;  2I1J A;  5B66 E;  2L4D A;  3L75 G;  3A7O A;  3PLN A;  3P8C E;  2FY8 A;  4D6T D;  3G6E P;  2E5T A;  4PV1 C;  1FZF A;  5APU A;  2Q7C A;  3B8E B;  1QX8 A;  4PD4 D;  3TGU J;  4KT0 J;  3W68 A;  3MP7 B;  1CRY A;  5KAI E;  4K35 A;  3WMM 0;  2IYO A;  4PJ0 H;  3L72 D;  1CED A;  1NAY A;  1LTJ C;  2N9J A;  3ITK A;  1LTB C;  1NTK D;  3CP5 A;  1ZV8 A;  3TDK A;  3IR9 A;  1SFC D;  3CD6 P;  4L75 A;  3L4M A;  2FWL A;  1H9Y A;  2C0X A;  5KAI H;  4H0L B;  4Q5P A;  4KJM A;  1KB9 H;  4GOD A;  3MUD C;  1T3J A;  2YXR B;  3ZBM A;  1VQ6 P;  4YE1 A;  3KZI E;  5CCG D;  3MD0 A;  1AOQ A;  1I6E A;  4BRY A;  4DOJ A;  1NO4 A;  1LWU C;  1JM0 A;  155C A;  3GW6 A;  1GW3 A;  4WY4 D;  2DGE A;  2B87 B;  1LP1 A;  1GL2 B;  4YXW H;  5AW2 B;  3CC2 P;  1PP9 D;  1Q81 Q;  3RK3 C;  3CMA P;  2KS1 A;  3O8Z A;  5CIG B;  4DJG A;  2HFE D;  2C1U A;  5KAF E;  1HJ5 A;  1VQM P;  1FAV A;  2BAS A;  2QVA A;  3AED C;  3V2Q A;  3L74 D;  4IFM A;  2DVH A;  5CIH B;  2C9L Y;  2GB8 B;  2LXC B;  1WRG A;  2H89 C;  2IBZ G;  3L4O A;  2BGV X;  1DIP A;  1E2R A;  4KHX A;  4ZKU A;  2YKO A;  3RK2 D;  3RMZ A;  5KLV D;  2XNX A;  3O0R C;  4WB4 A;  4ASW A;  1KIL B;  1NTK K;  1U57 A;  1N86 A;  2KI7 B;  1VQ8 P;  1FJP A;  4RJT A;  1LT9 C;  2C1D B;  1C75 A;  3TGU G;  1VQP P;  3C9I A;  1KB9 I;  3H1L E;  1NTM E;  1M8O B;  1OW7 A;  1IK9 A;  2QJY B;  1CXC A;  1HJ3 A;  2QJK B;  1PPJ G;  3CX5 D;  2C0W A;  2Q6Q A;  2N1T C;  4A7P A;  4FB1 A;  3AE1 C;  5AW4 B;  2PAC A;  1Q90 D;  1J1D B;  3OCD B;  2RMZ A;  1ZRT D;  4RES B;  3SFD C;  3M0D C;  4L3G A;  1GU5 A;  3B5N B;  4AAL A;  1LC1 A;  1NTM J;  3H1J J;  3M9H A;  3MTU E;  1K05 A;  1WMK A;  1RF1 B;  3AE9 C;  2N9I A;  2IPP A;  1E8E A;  3LID A;  1KZU B;  2IFM A;  2LKM A;  3HE5 A;  3TSI A;  5AW0 B;  2W8Z A;  1LTS C;  1DIQ C;  2WSF H;  1CZQ A;  1LTA C;  1URQ D;  1LTT C;  1NMI A;  2WSF J;  1RAP A;  1N7S C;  2GUV A;  1FZB A;  5AVU B;  1M1J A;  2FFD A;  1EB7 A;  3A0B V;  2EXV A;  1W5C E;  1CRG A;  2Z4E A;  2BPB B;  3CCU P;  4HH2 A;  3WFE C;  3HQ6 A;  1HRO A;  1FS0 E;  3V2N A;  5L8R J;  1CTZ A;  2JKV A;  4IL6 X;  1VQ5 P;  2N1T D;  1EZV E;  1EXJ A;  1OXZ A;  3CXH E;  1DW0 A;  4W7Z A;  2PP6 A;  5CJ4 A;  1BSN A;  3SWY A;  1FZG A;  1X0T A;  3FX0 A;  2OYI A;  1VQN P;  1AV1 A;  2AEF A;  1T2K D;  1KOR A;  1L4A C;  5DFS A;  2DW3 A;  1KYO E;  1NHL A;  1SFC A;  3U1C A;  4XA4 A;  1YEB A;  3DMI A;  4H44 B;  1DW1 A;  1CSX A;  2I8F A;  5AVV B;  5TIS E;  4L3H A;  2N9Y B;  3BCC E;  3H1I E;  1YYC A;  1KFN A;  1YCC A;  1NWQ A;  5APQ A;  5CCG A;  3WFD C;  3KPE A;  1HGV A;  4JYC A;  2AXC A;  3I56 P;  1AKK A;  4IL6 V;  4H0J A;  4WY4 A;  1L0N J;  4HB1 A;  5B6Q A;  1N7S D;  2B87 A;  1YEA A;  3H1L G;  1NTM G;  2CPB A;  1J1E B;  3HD7 B;  1N15 A;  5EFW B;  1LT1 A;  3EFG A;  1H33 B;  3GHG A;  4LLH A;  4EYY Q;  1JDL A;  1DH3 A;  1VQO P;  3BCC J;  3KXD A;  351C A;  2OQQ A;  1M60 A;  3H1I J;  1CC5 A;  5B5E V;  2IX7 C;  2OTJ P;  4W7Y A;  2HYN A;  3T97 B;  1VF5 C;  2YO3 A;  1IK7 A;  1HZU A;  3Q1M A;  4OGQ C;  1VL2 A;  2P1J A;  1IFI A;  3L73 D;  4GOF A;  3O5C A;  1K3G A;  1L4A D;  1RQU A;  3E1I A;  1R8E A;  1CNO A;  4P4Q B;  4XXL A;  2Q9I A;  1KIL A;  1GK6 A;  2AIU A;  3A0B H;  1SQP E;  3WFC C;  2C1D A;  1IRW A;  2VRS A;  1RF0 C;  1CRH A;  4N6J A;  3E7K A;  1YQ4 C;  1H0T B;  1JMM A;  1AOF A;  2ZT9 B;  3M9Q A;  1EDI A;  3WU2 E;  3O6Q A;  1RE3 A;  3GLM A;  1LWU A;  5APS A;  1HTL C;  2J59 M;  3IFM A;  3MZW B;  4NPF X;  1SQP J;  1FOS E;  1H8A A;  5E79 E;  1A02 F;  1DVV A;  1KV4 A;  5AW7 B;  1BGY D;  5CHX A;  1KB9 D;  1X8Y A;  2E75 C;  3CWB D;  5CCH A;  1SQB E;  5KJ7 C;  3JBT B;  5AW5 B;  2CE1 A;  4Z1M H;  1A02 J;  4H13 B;  1BCC G;  2W6A A;  1GQ1 A;  5CIB B;  3NFQ A;  1URQ A;  1M7L A;  3MK7 B;  1PGO A;  2BCC D;  4IL6 H;  3VP8 A;  4O9B A;  4V2K A;  3FWL A;  1FZE A;  1C2N A;  1P84 I;  1OFC X;  2D2C C;  2A06 D;  1RE4 C;  1FHB A;  3BCC G;  1LT9 A;  1IRV A;  1L9B C;  3RGU A;  1H9X A;  3H1I G;  1LP1 B;  1HJ4 A;  1NH4 A;  2YKQ A;  2OAR A;  2H43 A;  1G1I A;  1EC5 A;  5B5E H;  4HKZ H;  2HOD B;  2KS1 B;  2OGU A;  1FJK A;  1YI2 P;  2J5U A;  1ETP A;  2B4Z A;  2ZON G;  1CTY A;  1M1K Q;  2NPS B;  2PGD A;  1QL4 A;  1RQV A;  2WWW A;  2CK3 H;  2JR8 A;  2FXM A;  4WQ7 A;  1B7V A;  3K5B A;  2HV4 A;  3VMZ A;  1JNM A;  1QL3 A;  2E75 D;  2W6J H;  1H1O A;  1K9M Q;  3C1L A;  2XV5 A;  1DEE G;  2ZVO B;  1MG2 D;  2OYH C;  4WQ8 A;  1PP9 G;  5CIF B;  3D6Y A;  3RL0 D;  2K37 A;  1HUC A;  1OVR A;  2JDI H;  4UB6 V;  3L71 G;  1KQF B;  2ZXY A;  1S1C X;  1RY3 A;  2IFN A;  1COR A;  2RN0 A;  3L74 G;  1AQT A;  1G1J A;  3H1J D;  2Z5H A;  1F1C A;  1I55 A;  1K3H A;  1N7S A;  2I1K A;  3WC8 A;  1H88 A;  1USE A;  2R44 A;  2ZAE B;  1MFZ A;  1VYD A;  4RSZ A;  1C6O A;  1BE3 D;  2KZJ A;  2R5B A;  1HBW A;  3PP5 A;  3KZI V;  1Q7Y Q;  4UB8 H;  1CIH A;  1MV8 A;  1NYH A;  1XTC C;  3SJL A;  1OCD A;  2KP8 A;  1HRC A;  4AAO A;  4U3F D;  3H1K D;  2B12 B;  1SQB G;  2WVR A;  3L37 A;  2FYU E;  3FXD A;  1MZ4 A;  3U1A A;  3S1K A;  4I2L C;  1LGH B;  4JCG A;  5KAF V;  4H0L C;  3LW5 H;  1PPJ E;  1AYG A;  1USD A;  4FA5 A;  2YXQ B;  1M1J B;  2B9B A;  1S9K D;  2FFD B;  1H0T A;  1FE6 A;  4U7J A;  3LW5 J;  3WUI A;  2FYU J;  2ZYD A;  3VNW A;  4UB6 E;  2G3A A;  5H2F H;  5B66 H;  5DF5 A;  3V4W A;  1CIG A;  1GL2 C;  2E42 A;  3G3Z A;  5EXQ A;  1NU1 D;  5GTI E;  4PW9 B;  3H1H E;  2OYI B;  1FDM A;  1CHI A;  1JY3 P;  4GIF A;  1L0N D;  1E29 A;  2H8P D;  1SFC B;  1L0L D;  2FBW C;  3WFB C;  2HPC A;  1GDV A;  3PXS A;  4WQD A;  1T3U A;  3HE4 B;  3SWS A;  3B71 A;  2HLO A;  5KLI B;  1U7J A;  4ZNC A;  2E74 C;  3A3Y B;  2O01 N;  5DJT B;  1SQX K;  2PCB B;  1QL2 A;  3L35 A;  1EQ7 A;  2IBZ I;  4ASV A;  5AW9 B;  3R2P A;  3H1H J;  1HCM A;  2W27 A;  2XZR A;  1S5L V;  2FYN B;  4WY4 B;  1KQG B;  3FWN A;  1C7M A;  3G71 P;  1I8O A;  1CHH A;  3D70 A;  1RF0 A;  4EIJ A;  1U74 B;  1N8R Q;  2ZJS E;  3KZI H;  1JY3 N;  3P32 A;  4NFG B;  2QJY C;  3X39 A;  2HOD A;  3GHG B;  4EOT A;  1CYC A;  4PV1 D;  4O1Q A;  1CYI A;  2AXT V;  1P84 D;  1GZL A;  2NPS A;  1J1D C;  2LIT A;  2N3B A;  3QH9 A;  2CE0 A;  451C A;  4BXL A;  4NPE A;  3WUV A;  1GMJ A;  3B5N C;  2GC4 D;  5KAF H;  1NJI Q;  4RO0 A;  5AW8 B;  3V6I A;  3V2R A;  3RK2 B;  1CSU A;  3L70 D;  1KMI Z;  1NU1 K;  2PCC B;  1SQV E;  1N73 A;  1S72 P;  1VQ4 P;  1Z56 A;  4IOI H;  2SPZ A;  2IZ1 A;  3ZOO A;  1ZW0 A;  2P67 A;  4WQA A;  2QG4 A;  2FYU G;  1L0L K;  4MU8 A;  2E74 D;  2K3R A;  2BH5 X;  2E76 C;  2QIW A;  2CA4 B;  4OVN F;  1U7M A;  3O20 A;  3CCR P;  3CME P;  2WPV B;  3M06 A;  3HTK A;  1UII A;  3NMD A;  4I1L A;  4Y5R A;  3O6Q B;  3E1R A;  1LWU B;  3P8M C;  4EDF A;  1BL9 A;  2O3J A;  1SQV J;  1NNO A;  4WBA A;  3USS A;  1RAQ A;  5TIS V;  1DVH A;  3CC7 P;  2O1J A;  5CIC B;  2KLU A;  3RK3 D;  5AVZ B;  3NTN A;  1EDL A;  2BH4 X;  3H1L J;  3M9B A;  3H32 A;  3I5C A;  1JMB A;  1FZC C;  1S5L E;  4N78 D;  3Q3D A;  4AYC A;  1W2E A;  3H1H G;  3PJS K;  5APT A;  1GJQ A;  3AE2 C;  1U75 B;  1NTZ D;  1SQQ D;  1PGJ A;  3ZCF A;  3SSU A;  1GTW A;  2B10 B;  4AAN A;  1URQ B;  1I54 A;  4WQE A;  3II6 A;  3L75 D;  1JY3 O;  4H44 C;  3SWF A;  2JP3 A;  2AXT E;  1BGY G;  1E79 H;  4WVZ A;  1SQX E;  1SS1 A;  3JCU E;  5KLV K;  2YIU C;  3U59 A;  1LT9 B;  3ABV C;  2NRG A;  2JJL A;  1DW2 A;  2L91 A;  1OAE A;  1OZH A;  1AVY A;  2E76 D;  2WQY C;  3FGA D;  1Q82 Q;  2Q3I A;  2AXT H;  3O1Y A;  4RKU J;  1LJ2 A;  1KQL A;  3N4X A;  1PGP A;  2BCC G;  2N18 B;  2N1T B;  1A8C A;  1FJ0 A;  2CPS A;  1FDI A;  1SVF A;  3AE5 C;  2QE7 H;  1TU3 F;  3VOP A;  3HD7 C;  2YO2 A;  2J58 A;  4D6T E;  5M1B A;  1FI9 A;  3PXT A;  2MHM A;  1BCC E;  1FOC A;  1YJW P;  1S6V B;  1HGZ A;  3BAT A;  2OTL P;  4PD4 E;  1GD2 E;  1HZV A;  3BRT B;  3CXH H;  3WU2 V;  1YJ9 P;  1M57 D;  3A0H V;  3RL0 g;  5AUR A;  3HE4 A;  1CI6 B;  3L72 E;  2QA4 P;  3HQ9 A;  5AW1 B;  1SQV G;  1NTK E;  1KYO H;  1AQ5 A;  5E79 V;  3TNU A;  2KXP B;  1DD4 A;  2PAJ A;  4D6T J;  1CSW A;  1NTZ K;  1SQQ K;  1BCC J;  3CXH W;  2JO1 A;  1RZ5 A;  5TIS H;  2PRR A;  3AE8 C;  3D6Z A;  1N7S B;  2KYV A;  3EWK A;  3Q5S A;  1IFD A;  2Q3E A;  1CRI A;  4LC1 A;  1CRJ A;  4L74 A;  1KYO W;  3L72 J;  3D0W A;  3RN1 A;  5CIE B;  1ZR4 A;  1NTK J;  3NXS A;  2XDJ A;  4EI2 A;  5APY A;  1YFC A;  1DW3 A;  2QM8 A;  2IBZ D;  2JQR A;  1Q2N A;  2P10 A;  5AVS B;  3BRV B;  2JWA A;  4FAV A;  1PP9 E;  2ZVN B;  5DJQ C;  1VDF A;  1LMS A;  2D0W A;  4BWN A;  3L71 E;  1LTJ A;  3DP5 A;  1J3S A;  2POH A;  2C9N Y;  2WSE H;  4N3Y B;  1L4A B;  3CCL P;  1MKM A;  5AVR B;  1KD1 Q;  1I8P A;  3L74 E;  1EZV I;  3TGU D;  4H13 C;  2E43 A;  5K5G B;  3CXH I;  2NZ2 A;  1RH5 B;  2KIK A;  2WSE J;  3PH2 B;  1S3J A;  1IO4 A;  4OH8 B;  1NAF A;  1EDJ A;  1F1F A;  1W2L A;  3MUD A;  3ZDM A;  1PP9 J;  5KLV E;  1SQX G;  3P8C D;  1H89 A;  4U3F G;  1KYO I;  1KIL E;  3L71 J;  1ZLL A;  1OX3 A;  1JUN A;  2O01 J;  3A0H E;  3TYY A;  4AUW A;  3VMX A;  3L74 J;  1Y47 A;  1KC8 Q;  2Y9Y A;  3CCJ P;  2W83 C;  2WPS A;  2WT7 A;  1MFT A;  3ZOW A;  1VPC A;  3WU2 H;  1GIW A;  2BCN B;  3CX5 E;  4TLF A;  3A0H H;  2KUB A;  1CXA A;  1MZ9 A;  1RZ6 A;  2IZ0 A;  1DII C;  4YXD C;  2KOG A;  2ZYA A;  2A45 G;  3VTP C;  3PH0 A;  2K9J A;  2HPC B;  1BDD A;  4D6T G;  2R3S A;  1FOS F;  1NVO A;  1ZRT E;  1VF5 D;  2OZ1 A;  1JOC A;  5E79 H;  1DEB A;  2JWD A;  2B89 A;  4OGQ D;  1ZR2 A;  1N2D C;  1CSV A;  2MKV A;  3AE4 C;  1N90 A;  2YKP A;  2XU6 A;  2N3Y A;  1CTJ A;  1GU4 A;  4GT1 A;  3L72 G;  3OA7 A;  1R0Q A;  4PWA A;  4AAM A;  4KMG A;  2E5Y A;  1NTK G;  3Q5R A;  1NML A;  5CBN A;  1SQB J;  5GTH V;  1C6S A;  1L0L G;  3JC2 2;  1C6R A;  3RN0 A;  4HJG H;  4L73 A;  3AE3 C;  1LFM A;  1H32 A;  1FDO A;  2N1T A;  2G8Y A;  1OMI A;  4I7Z C;  2ZXX A;  3V4Q A;  3M0D A;  1QLE D;  1G2C B;  3SXT A;  2FRC A;  1VQK P;  2E75 B;  3B4S A;  4L1Q A;  5KJ7 D;  1M56 D;  2ZZS 1;  5IY5 1;  1J2J B;  1FU1 A;  3AEE C;  1N73 B;  3RL0 B;  2D0S A;  1LS9 A;  2FYZ A;  1CI6 A;  1Y9B A;  4EID A;  1QGK B;  3M97 X;  2BEQ D;  3EFF K;  3RBZ A;  2YMK A;  3H1L D;  5GTI V;  1NTM D;  4PJ0 V;  4GOE A;  4C7R A;  1ZME C;  2C1V A;  2IDB A;  3HUS C;  3HTK B;  2D2C D; 
#chains in the Genus database with same CATH homology
 1RAP A;  1S5L V;  2FYN B;  3CU4 A;  1C7M A;  1I8O A;  1CHH A;  3ZOX A;  1EB7 A;  3A0B V;  2EXV A;  3VYM A;  2Y0E A;  1CRG A;  2QJP B;  2BPB B;  1U74 B;  1N9C A;  1W5C T;  1COT A;  4NFG B;  3WFE C;  3HQ6 A;  3HQ7 A;  1HRO A;  3X39 A;  3SVW A;  1CYC A;  1KX7 A;  3H1H D;  4AX3 A;  1CTZ A;  1IO3 A;  4O1Q A;  1CYI A;  3OA8 B;  2AXT V;  1P84 D;  1QKS A;  1DW0 A;  5KKZ B;  4FA1 A;  2LIT A;  2N3B A;  3OCD A;  2CE0 A;  451C A;  5DJQ B;  1IZL 0;  1KX2 A;  2GC4 D;  1I5T A;  1GKS A;  5DFS A;  3PHL A;  1CSU A;  3NWV A;  3L70 D;  2PCC B;  4DY9 A;  1YEB A;  3DMI A;  1DW1 A;  1IQC A;  1M6Z A;  3ZOO A;  3HQ8 A;  1CSX A;  4WQA A;  2I8F A;  2QG4 A;  5TJH A;  4L3H A;  1CYJ A;  4UB8 V;  2Y0D A;  2C8S A;  4MU8 A;  4EIE A;  2N9Y B;  2C9X B;  3GG2 A;  1A56 A;  3CX5 W;  2BH5 X;  3TYI A;  2CA4 B;  1QN2 A;  1CHJ A;  3O20 A;  3RLM A;  1YCC A;  1A2S A;  3WFD C;  5C0Z A;  4GYD A;  4Y5R A;  4FA4 A;  1AKK A;  4IL6 V;  4H0J A;  2V08 A;  4EDF A;  1BL9 A;  5B6Q A;  2O3J A;  1YEA A;  2ORL A;  1EZV D;  1NNO A;  4XYD B;  3CXH D;  1RAQ A;  5TIS V;  1HH7 A;  1DVH A;  2YQB A;  1N15 A;  5CIC B;  1H33 B;  1JDL A;  1BCC D;  1L9J C;  2BH4 X;  351C A;  1M60 A;  3OA8 A;  4EIF A;  1C2R A;  1KYO D;  1CC5 A;  1H31 B;  4O1W A;  5B5E V;  1SQV D;  2YCC A;  3PXW A;  2CXB A;  5H2F V;  5B66 V;  1HZU A;  1GJQ A;  4N0K A;  3NBS A;  1U75 B;  2JTI B;  1NTZ D;  1SQQ D;  3ZCF A;  1CCH A;  2B10 B;  4AAN A;  3L73 D;  3BCC D;  3O5C A;  1K3G A;  1I54 A;  4WQE A;  3H1I D;  3L75 D;  1CNO A;  4P4Q B;  4XXL A;  2AIU A;  4LJI A;  1WVE C;  3WFC C;  2C1D A;  1IRW A;  5KAI V;  1DW2 A;  2L91 A;  1OAE A;  4H0K A;  1CRH A;  2XTS B;  3VMA A;  5CYT R;  3O1Y A;  1AOF A;  1KV9 A;  2N18 B;  1A8C A;  1FJ0 A;  1CIE A;  1MG3 D;  2MTA C;  1QYZ A;  1H33 A;  3PTZ A;  1DVV A;  2C2C A;  1BGY D;  1CCR A;  4J20 A;  1FI9 A;  3PXT A;  2MHM A;  3L71 D;  1KB9 D;  1FOC A;  2B0Z B;  3CWB D;  1FI7 A;  1S6V B;  3DR0 A;  4K3I A;  1H31 A;  3VRD A;  1HZV A;  3WU2 V;  3JBT B;  1C52 A;  2CE1 A;  4QAO A;  3A0H V;  2GIW A;  5AUR A;  2B11 B;  1GQ1 A;  1SQX D;  3ZIY A;  1I6D A;  1SQP D;  3HQ9 A;  4WQB A;  5CIB B;  4WQC A;  4GED B;  3TF5 A;  3MK7 B;  2BCC D;  5E79 V;  3NBT A;  4V2K A;  1FI3 A;  3FWL A;  3SLE A;  1CSW A;  2BLF B;  1C2N A;  3CXH W;  2A06 D;  2GC7 D;  1RZ5 A;  1ZZH A;  1FHB A;  1IRV A;  1L9B C;  1H9X A;  2Q3E A;  2L4D A;  1CRI A;  3PLN A;  1CRJ A;  1HJ4 A;  1KYO W;  1KB0 A;  2Y0C A;  3RN1 A;  4D6T D;  5CIE B;  1YFC A;  1DW3 A;  2N18 C;  2IBZ D;  1ETP A;  2JQR A;  1WEJ F;  4PD4 D;  1NIR A;  2B4Z A;  2ZON G;  1CTY A;  1SQB D;  3CYT I;  2K9J B;  2JWA A;  1QL4 A;  4FAV A;  1CRY A;  4WQ7 A;  5DJQ C;  2OZ1 B;  1B7V A;  1LMS A;  2D0W A;  3L72 D;  1CED A;  1YIQ A;  2HV4 A;  3DP5 A;  1J3S A;  2N9J A;  2YK3 A;  3ITK A;  2ZOO A;  1QL3 A;  1NTK D;  3CP5 A;  1H1O A;  3TDK A;  1MG2 D;  4WQ8 A;  5CIF B;  1I8P A;  3L4M A;  3TGU D;  2FWL A;  1H9Y A;  2VHD A;  4UB6 V;  4Q5P A;  3PH2 B;  1YNR A;  2ZXY A;  3A9F A;  3PRJ A;  1COR A;  1F1F A;  1W2L A;  2RN0 A;  3H1J D;  3ZBM A;  1GU2 A;  4YE1 A;  1F1C A;  1I55 A;  1AOQ A;  1I6E A;  1CO6 A;  155C A;  1K3H A;  3GW6 A;  1H32 B;  2DGE A;  2CA3 B;  2LIR A;  1LC2 A;  3WC8 A;  1KIB A;  1VYD A;  4RSZ A;  1C6O A;  1PP9 D;  1BE3 D;  1M70 A;  2KS1 A;  3ZOW A;  1GIW A;  2BCN B;  5CIG B;  5CID B;  1CXA A;  2C1U A;  1HJ5 A;  1RZ6 A;  1DII C;  2ZBO A;  3KZI V;  1CIH A;  3L74 D;  4EIC A;  2DVH A;  5CIH B;  3SJL A;  2GB8 B;  1OCD A;  2OZ1 A;  3ORV A;  1HRC A;  4AAO A;  4U3F D;  3L4O A;  2BGV X;  3H1K D;  3KHU A;  2B12 B;  1CSV A;  1YTC A;  1FCD C;  1E2R A;  1N90 A;  2N3Y A;  1CTJ A;  4WQ9 A;  4FA9 A;  3RMZ A;  5KLV D;  1DT1 A;  1MZ4 A;  2V07 A;  3O0R C;  4JCG A;  1R0Q A;  5KAF V;  4PWA A;  4AAM A;  4KMG A;  1YIC A;  4RJT A;  1NML A;  2YIU B;  5GTH V;  1C6S A;  1AYG A;  4FA5 A;  2C1D B;  1C75 A;  1C6R A;  3RN0 A;  2KNC B;  2QJY B;  4FAN A;  1CXC A;  1HJ3 A;  2QJK B;  3WUI A;  3CX5 D;  1LFM A;  1H32 A;  2AI5 A;  3VNW A;  4A7P A;  5DF5 A;  4FB1 A;  2PAC A;  1CIG A;  3OCD B;  2RMZ A;  1ZRT D;  5EXQ A;  1NU1 D;  4L3G A;  3SXT A;  2FRC A;  4PW9 B;  1CHI A;  4AAL A;  1LC1 A;  2FYU D;  3ZOY A;  1L0N D;  1E29 A;  4L1Q A;  1L0L D;  3WFB C;  2ZZS 1;  5IY5 1;  1GDV A;  3PXS A;  3C2C A;  2N9I A;  1E8E A;  2D0S A;  4WQD A;  1LS9 A;  3SWS A;  5KLI B;  4EID A;  3M97 X;  1DIQ C;  1PPJ D;  3MK7 C;  1CRC A;  2PCB B;  3H1L D;  5GTI V;  1NTM D;  5C9M A;  4PJ0 V;  1NMI A;  2C1V A;  1CIF A;  1N50 A;  1HCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...