2YIUB

X-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
228
structure length
206
Chain Sequence
DISFSFEGPFGKFDQHQLQRGLQVYTEVCSACHGLRYVPLRTLADEGGPQLPEDQVRAYAANFDITDPETEEDRPRVPTDHFPTVSGEGMGPDLSLMAKARIGGPEYIHAVLTGYDGEEKVLYHNAAFAGNWIQMAAPLSDDQVTYEDGTPATVDQMATDVAAFLMWTAEPKMMDRKQVGFVSVIFLIVLAALLYLTNKKLWQPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B
publication title X-Ray Structure of the Dimeric Cytochrome Bc(1) Complex from the Soil Bacterium Paracoccus Denitrificans at 2.7-A Resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 59
structure length 206
sequence length 228
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2yiuB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2yiuB02
1DW1A 5DFSA 2C9XB 1U74B 2YIUB 3KZIV 1P84D 4AANA 1H31B 4WQ7A 3HQ6A 1DIIC 5H2FV 1H33A 3O0RC 1NTKD 2YCCA 4XYDB 1M70A 2ORLA 3RN0A 3PXTA 4WQ9A 1CSVA 3OA8B 2N9JA 2GIWA 1CNOA 3O20A 4RJTA 1NMIA 1DVVA 3HQ9A 5CIDB 5B5EV 4EIDA 4KMGA 4PJ0V 1QYZA 1ZRTD 2K9JB 2Y0EA 4UB6V 1C6OA 1KB0A 3L4MA 4JCGA 1HJ4A 3H1KD 5DF5A 3SWSA 2EXVA 2OZ1B 2N3YA 4Q5PA 1AOQA 3DP5A 3NWVA 3GG2A 3HQ7A 1COTA 3TF5A 4WQ8A 5CIHB 2C1UA 4MU8A 1CRIA 1CSUA 2QG4A 1GKSA 1YEAA 3L72D 3RMZA 2D0SA 1CSWA 1LC1A 1SQPD 3TDKA 4L3GA 1CSXA 4XXLA 1ZZHA 5C9MA 3TYIA 1FHBA 5AURA 1CXCA 1W2LA 5CICB 1WVEC 1H32B 4J20A 1KIBA 2LIRA 2C8SA 155CA 2L4DA 1S5LV 4EIEA 1OCDA 3CX5D 1J3SA 4FA9A 3KHUA 1F1FA 2V08A 5GTIV 1IO3A 3CU4A 1LS9A 451CA 3A0BV 2JWAA 3PRJA 1QN2A 1LFMA 3WFEC 4EDFA 1NTMD 4AAOA 3JBTB 4DY9A 2CA4B 4AALA 4O1QA 1YICA 1SQXD 1U75B 1CTJA 5TJHA 3FWLA 4EIFA 5C0ZA 1CIFA 2A06D 1CXAA 1L9JC 1RZ6A 1CEDA 1AOFA 2GC4D 3O5CA 2QJKB 1CRCA 2BCCD 1GQ1A 2JQRA 1H9XA 3ZOXA 5B6QA 4U3FD 1H31A 3SVWA 1CHHA 2N9YB 4WQEA 3VNWA 1CRYA 3OCDB 1EB7A 1FI9A 1CIGA 4PD4D 2V07A 4QAOA 1CC5A 1N90A 2DGEA 1DW3A 3L4OA 2Q3EA 2FRCA 3BCCD 5CIGB 2O3JA 3M97X 2ZXYA 1C6SA 2BCNB 2C2CA 4V2KA 1I8PA 2N3BA 3ITKA 3CX5W 2B11B 4RSZA 1DIQC 1K3GA 1FJ0A 2BH4X 5DJQB 2FYUD 3SJLA 3L74D 4AAMA 1H1OA 1I6DA 1FI7A 1MZ4A 1HROA 1KYOD 3HQ8A 4PW9B 2FWLA 1QL3A 3CXHD 2PACA 1CCHA 1YFCA 4P4QB 1E29A 1YTCA 1N15A 351CA 1GU2A 4L1QA 4WQBA 1AKKA 1BL9A 3MK7C 3PH2B 2PCBB 2I8FA 4H0KA 1N9CA 1SQVD 2Y0DA 2CE1A 2YK3A 3A9FA 4FA4A 3DMIA 1BCCD 1DW2A 2N18C 1MG2D 1CHJA 3WUIA 4NFGB 1C52A 1FCDC 2C1VA 1WEJF 1IZL0 1H9YA 5KAFV 2AIUA 2B0ZB 1EZVD 5KLIB 4LJIA 1N50A 1DW0A 1IQCA 3NBSA 3GW6A 5CIEB 1CYIA 2YQBA 3TGUD 4H0JA 3NBTA 3RN1A 3ZOYA 1LMSA 1I6EA 1LC2A 1SQQD 2GB8B 1MG3D 1HZUA 1BGYD 3L70D 3H1HD 3PXWA 3ORVA 4A7PA 3H1JD 3RLMA 1RZ5A 2N9IA 3L73D 1B7VA 3H1LD 3ZOOA 1NMLA 2RMZA 2Y0CA 1KYOW 4UB8V 1C2RA 1JDLA 3CXHW 4GEDB 1M60A 2ZZS1 5CIBB 1PPJD 2B4ZA 1HRCA 4WQAA 1YEBA 1I5TA 1KB9D 1W5CT 2MHMA 1ETPA 3O1YA 2CE0A 1NIRA 2C1DA 5CIFB 2CXBA 1RAPA 3L75D 5GTHV 3L71D 4FA5A 3OCDA 3WFDC 1L0ND 1CRJA 4FA1A 4WQDA 1VYDA 1FI3A 4O1WA 1QKSA 2LITA 3C2CA 4IL6V 3OA8A 1CIHA 4D6TD 1CIEA 2MTAC 1NU1D 2XTSB 1CTYA 3WU2V 4WQCA 5KLVD 1C7MA 1CYJA 2JTIB 1NTZD 5CYTR 3ZBMA 1H33B 1HZVA 2B10B 1CTZA 2BLFB 1GIWA 4FANA 1K3HA 1BE3D 5TISV 1CYCA 3ZCFA 4AX3A 1DT1A 1CO6A 1YNRA 2OZ1A 5B66V 1F1CA 2VHDA 2AXTV 1IRWA 3WFBC 1DVHA 1HH7A 4FAVA 3CP5A 1IRVA 1R0QA 2GC7D 1RAQA 2ZBOA 3DR0A 2D0WA 1I55A 5KAIV 2BPBB 3PHLA 4FB1A 4GYDA 1H32A 2HV4A 1GDVA 1E2RA 1C6RA 1PP9D 4K3IA 3A0HV 3H1ID 1A2SA 1C2NA 2IBZD 1GJQA 2L91A 1KV9A 3VYMA 1L0LD 4Y5RA 1C75A 5EXQA 1KX2A 4PWAA 3WC8A 1M6ZA 3SLEA 5KKZB 4YE1A 5E79V 2PCCB 1CHIA 5DJQC 1KX7A 1S6VB 3ZOWA 1I54A 4N0KA 2AI5A 3WFCC 2FYNB 3PXSA 2DVHA 3VMAA 1YCCA 1QL4A 1HJ5A 1E8EA 4L3HA 2QJPB 3PLNA 5IY51 2BGVX 2QJYB 2BH5X 1FOCA 2KS1A 2ZONG 1I8OA 3ZIYA 1CRGA 2B12B 1A8CA 1AYGA 3SXTA 1SQBD 1OAEA 3VRDA 2KNCB 3CWBD 1CCRA 2ZOOA 2CA3B 1HJ3A 1NNOA 1L9BC 3MK7B 4EICA 2RN0A 3PTZA 3X39A 1CORA 1CRHA 1YIQA 1HCMA 3CYTI 1A56A 2C1DB 2N18B
chains in the Genus database with same CATH superfamily
1U74B 3A0HE 5APUA 1P84D 1KC8Q 4D6TG 1JTHA 2H8PD 1KMIZ 4GT1A 1NTKD 4XYDB 2ORLA 1JB0J 3TSIA 1SQXJ 2D2CC 3QH9A 1QVGO 1KILA 3O20A 5APVA 1NMIA 1BGYE 4EIDA 1QYZA 1J2JB 2B88A 2SPZA 5GTHH 4BWNA 1KB0A 3CCRP 2G3AA 1N7SB 1YTZT 3H1KD 3VTPC 1YTZI 1LP1B 4Q5PA 1HGVA 1AOQA 1KB9E 2ITAA 3NWVA 2QIWA 3HQ7A 3Q2YA 1PGJA 1PZQA 2QG4A 1KILD 1IJDB 1YEAA 1NO4A 2P1JA 3EWKA 3TDKA 2AEFA 3L37A 1CSXA 2OYHA 4B86A 5C9MA 4I6MC 1VQ8P 1VQNP 1OZHA 3VMXA 5B66H 1HWTC 1NU1K 2WSCH 4J20A 2BASA 3KZIE 5H2FE 2C8SA 3CX5I 1J3SA 1KILC 4FA9A 5TISE 3RBZA 3L70G 4ZKUA 1KV4A 1F1FA 1IO3A 1H0TA 4PJ0E 2PRRA 1EDKA 5KAFH 1LFMA 1DIPA 4UB6E 1NTMD 1NVOA 2Q3IA 3JBTB 4DY9A 3TGUJ 2N1TB 1CTJA 1OMIA 4H13D 3FWLA 2H88C 2HODB 2OYIC 1CIFA 2R44A 3CWBG 1CEDA 1CSBA 3H1HJ 1HTLC 2XKMA 2WMMA 4U3FD 1ZN5A 2OYHC 3SVWA 1X79B 1CHHA 1VQ5P 3L73J 4N78D 1K05A 1M1JB 3OCDB 3O6QB 4UB8H 1KQLA 3EFFK 3JSVC 2DGEA 1DW3A 2JO1A 3MUDC 1OVVA 2FRCA 3GMAA 3BCCD 5CIGB 5KLVG 3VP9A 4L73A 5DJTB 3V4QA 1JY3O 2R3SA 4H13C 3ITKA 2R5BA 3CX5W 3AE4C 4JQ0D 3L73E 5DJQB 2BH4X 3AE2C 2FYUD 1X22A 1FAVA 3SJLA 1P84H 4AAMA 5GTIE 1I6DA 4XFJA 1HH0A 1ZLLA 2O01H 4PD4H 1FI7A 2XNXA 1FS0E 2FWLA 1QL3A 3AE6C 2FFDB 1U57A 3CXHI 1RQUA 4C7RA 4P4QB 1NU1J 1GU2A 4LLHA 4L1QA 3AEGC 1HBWA 2I8FA 1SQVD 5APYA 2CE1A 3MD0A 2H89C 4FA4A 1BCCD 1BE3J 1DW2A 3Q5SA 1MG2D 4GKGA 1FCDC 1KYOH 1GL2D 2I8DA 1NTZK 4DCKA 1L0LG 5AVWB 1RE3C 2ZVNB 4KT0J 1EZVI 1N50A 3T97B 2LKMA 3NBSA 5CIEB 4H0JA 3RN1A 1LT9A 3RBXA 1I6EA 1Q2NA 1SQQD 2HPCA 1BGYD 3WUUA 1BSHA 4ZKPA 3A5TA 2D2CB 3ORVA 2YXQB 2OYOA 2WPVB 2N9IA 1GL2C 3D6YA 1RF1A 3A2AA 3VMYA 3AE9C 3RGUA 2V7QH 2BEQD 1JDLA 3SFEC 3CXHW 4GEDB 2YNYA 5AW5B 1UIIA 1YEBA 3BATA 1I5TA 2KS1B 1KB9D 5E79H 2CE0A 4I2LC 2Z5IA 1FZEA 1SQXG 3EQ2A 3IF4A 3CCLP 3L75D 1PP9E 3L71D 3H1JJ 3L72E 3H1LJ 3H1IE 4WQDA 1EQ7A 2O1JA 1XTGB 2LITA 3V6IA 2XDJA 1G1JA 3TNUB 5KAFE 2FXOA 2ZXXA 1IO4A 2XTSB 3WU2V 1PFIA 3CD6P 1QL2A 2MJZA 4FANA 1JUNA 5BU8B 5TISV 1N7SA 1WRGA 2L5GB 2MKVA 2FXPA 2J59M 1LP1A 3SSUA 1KILB 1RF1C 1MZ9A 1DVHA 4RO0A 3II6A 2GM4A 4UB8E 1VQOP 2IYPA 3D70A 1FJPA 5AW7B 1RAQA 1EDJA 2ZBOA 2QJKC 1I55A 4L75A 3CMAP 5B5EH 4OVNF 4GYDA 1T6AA 2BCCE 2OYIB 1WT6A 1J1DC 2WQYC 3PJSK 1DD3A 1P84E 1BDCA 1FU1A 2JWDA 1GJQA 2L91A 4KJMA 1MKMA 3VYMA 1NTKE 4Y5RA 2OYHB 2W90A 4PWAA 1JY2O 1M6ZA 1S5LX 1GMJA 1W2BO 1LTTC 1IFNA 2PCCB 1CHIA 2WSEJ 2ZAEB 4YPCA 4H44D 3TGUG 5KJ7A 1N73C 4N0KA 1AVOA 4Y99C 2WTYA 3Q1MA 2DVHA 1X8YA 4H13B 1YCCA 1HJ5A 3H1HG 5IY51 2Y9ZA 2N1TA 5CJ4A 1LTSC 3H1KE 3L73G 2KSEA 3OA7A 2P7JA 5APTA 1QX8A 1HUCA 1NJIQ 1SQBD 2YKPA 1OAEA 1SQPK 4NPEA 1S5LH 4H44C 2KNCB 1M1JA 3O6QA 1HJ3A 1SFCD 3CCJP 1LWUC 3PTZA 1GTWA 1W2EA 1CRHA 1EXJA 1T3JA 5KLIC 1Q81Q 1VQ6P 1DW1A 5DFSA 1VQLP 3HE4A 2ZYDA 3O0RC 1FDIA 5CCHD 1NU1G 2YMKA 3RN0A 3LIEA 2R3CA 4WQ9A 3A3YB 4GIFA 2B9BA 1JCDA 5E79E 1JEKA 1SFCC 1AQ5A 1CNOA 3LW5J 1BDDA 4RJTA 3O8ZA 2FFDA 1R5LA 5CIDB 2WSFJ 2K3RA 1CZQA 2Q1KA 3FXDA 4HH2A 1BE3G 3P7KA 1FZFA 1NTME 1SS1A 4U3FJ 2N1TC 1OX3A 3TK1A 1SQXK 3L4MA 4JCGA 2FXMA 2B89A 1FOSE 3AE5C 3KPEA 1GL2B 2P10A 1PPJE 5DF5A 2OZ1B 3R2PA 2N3YA 3LIDA 3V4WA 1W5CE 1QGKB 1COTA 3TF5A 1VPCA 4MU8A 1CRIA 1CSUA 1OVUA 4M3LA 3L72D 1AJYA 2QA4P 2ZYAA 2FYUJ 4XXLA 5AURA 3BCCE 4JBZA 2ZJSE 4CPGA 155CA 3KDPB 2Q7CA 1SQVJ 1RE4A 3SWKA 1SQPJ 3H1JG 3CU4A 451CA 5B5EE 3A0BV 3H1LG 3JCUH 3WFEC 4L76A 2WITA 1RF1B 4AALA 4O1QA 1Q7YQ 2NRGA 4C7NB 3CX5H 2Q5UA 4EIFA 2A06D 1BCCE 1CXAA 3TNUA 2GC4D 2QJKB 1CRCA 1BGYJ 2BCCD 1GQ1A 2JQRA 1H9XA 1VQ7P 5B6QA 1M57D 4IL6X 1VQPP 1H31A 4IFMA 4WVZA 2NZ2A 3VNWA 1CRYA 1FI9A 5AW9B 1CIGA 1KFMA 4PD4D 2KSJA 2ZYGA 1J1DB 2ZFCA 1FOSF 2O3JA 2ZXYA 1E79H 3MHVA 1C6SA 2BCNB 1SQQE 4V2KA 2AXCA 1NTZG 1I8PA 2YXRB 1Q86Q 2RKLA 1S5LE 4LGDE 1RE4C 2KUBA 1FJ0A 3N7NA 1S9KD 1N73B 2WPRA 5APXA 1LTJA 2HG5D 4Y99B 3SFDC 4IL6H 1MZ4A 1HROA 1KYOD 3HQ8A 4PW9B 2PACA 1YFCA 4AQRD 3KXDA 2OYIA 4U7JA 4WQBA 3OW2O 1MUUA 3MK7C 1JY3P 3L75E 5CCGD 3L71E 1S1CX 2XU6A 2YK3A 1NKNA 3KQGA 4H44B 2N18C 1S2EA 1ZXGA 1FZCB 1KQGB 1UIXA 1C52A 2WWWA 4IFFA 2G8YA 1WEJF 1IZL0 2FY8A 1LWUB 1H9YA 1MFZA 3MUDA 3CXHH 2B0ZB 2NPSD 1RY3A 5KLIB 1IFIA 2CPSA 3N4XA 1DW0A 3WUTA 1CYIA 1JM0A 3NBTA 1LMSA 1GU5A 1OW7A 2JR8A 3I5CA 5CCGC 1LC2A 5KAIH 5M1BA 1MG3D 3K5BA 1FC2C 3B4SA 4R4LA 3L70D 2ZXEB 3PXWA 3Q3DA 1LTJC 1SFCB 4GODA 3G4SP 1B7VA 1ZP0C 1SVFA 2KNCA 1NMLA 2NPSC 3VP8A 2E75D 5CMZA 1M56D 5CIBB 1PPJD 4YXDC 1HRCA 1URQA 4WQAA 3P8MC 3FGAD 2GUSA 2IFMA 2R32A 3RK2D 1KN7A 4ZMDA 3AE8C 1DH3A 1RAPA 1YBKA 1HJ0A 1Z56A 4FA5A 5AVYB 1L0ND 3GF7A 1NAYA 1RE3A 4O1WA 1QKSA 2E75C 4U3FG 1KTMA 3JCUE 2M3BA 1CTYA 1RF0C 2PP6A 1PL5A 1URQD 4WQCA 5KLVD 1FBMA 1RH5B 3CI9A 2A45G 3HE4B 2Z5HA 3RK2C 1R5SA 1HZVA 2B10B 1JY3N 2ZT9D 1CTZA 1GIWA 3A7OA 1GL2A 1HF9A 1CO6A 2OZ1A 2H43A 4GDOA 2FYUG 2AXTV 3WFBC 1QVFO 2OTJP 1YI2P 1SQBE 1IRVA 1URQC 2KXPB 5C39A 1Y8AA 3R4YA 2GC7D 3AEBC 2E5TA 2E74D 2D0WA 1L4AA 4AUWA 1KORA 4NPDA 1SQVG 4FB1A 1SQPG 2PGDA 5GTHE 3KYQA 1NH4A 2K88A 2QE7H 3W68A 2PAJA 4K3IA 1NTKK 3MIWA 3A0HV 1VQMP 1C2NA 2IBZD 1OW8A 3G6EP 1NOHA 4IL6E 4RKUJ 1L0LD 1S3JA 2KB7P 1C75A 5EXQA 2WT7A 3M0AA 3SLEA 5L8RJ 4YE1A 1M7LA 2WSCJ 5AVRB 5APQA 3CCUP 2Q9IA 2C9LY 1L4AD 2AI5A 4YXWH 3AE3C 3Q5PA 1CI6A 1PP9J 3VMAA 3L72J 1BGYG 4C7NA 4HYTB 3L74E 3H1IJ 2BGVX 2BH5X 5B66E 2LXCB 5AVQB 5AW8B 5AW6B 1R8EA 1AVYA 1JY2P 1OW6A 1L4AC 4JYCA 1L9BC 5KAIE 3MK7B 4EICA 1AA0A 3X39A 2DW3A 1KQSO 4PV1D 2N18B 4BRYA 2IZ0A 4IOIH 2C9XB 3KZIV 1D7MA 1EZVE 1YJNP 1GW3A 1H31B 4DZOA 3D6ZA 2C9NY 3HQ6A 1DIIC 5H2FV 5AVTB 1OVRA 1N73A 1M70A 3H32A 1CSVA 5BU5A 2GIWA 1NTMK 1DVVA 3HQ9A 4KMGA 4PJ0V 2KZJA 1ZW0A 3B5ND 5CJ0A 2BCCJ 4EIJA 2JP3A 4UB6V 4PV1C 3I56P 1HJ4A 1LTJB 2O01J 1NTKJ 4QMAA 3SWSA 2EXVA 2FYZA 3D71A 2NPSB 1FZCA 4KHXA 1IK9A 3DP5A 2A06E 1LWUA 1N86A 1G2CB 1GU4A 1IFJA 1GKSA 3RMZA 2D0SA 2KP8A 2LXBA 1N2DC 3F89A 1LC1A 4PD4E 4L3GA 2I1KA 3NXSA 1ZZHA 3TYIA 2Q6QA 4L74A 1LNQA 3H1KJ 4Y28J 2I1JA 1WVEC 2E76D 3HE5B 2E75B 2GUVA 1KIBA 1SFCA 2FYUK 1H89A 2L4DA 1LTBC 3E1IA 2OARA 1JY2N 3CX5D 3EFGA 4DT0A 2P58A 1S9KE 2IPPA 3KHUA 3RK2B 2V08A 5GTIV 4JYBA 2OGUA 1LS9A 1KYOE 1OIPA 3U1AA 4ASVA 1QN2A 1IZNB 3CCSP 4EDFA 3H6PA 3L35A 4TT3H 3FWNA 4RESB 5CCHA 1SLQA 1SQVK 2E76C 2OTKE 5AW3B 1VF5D 2E42A 4GOFA 1FZCC 3U59A 2BEZF 1URQB 2KZIA 1L9JC 1RZ6A 1AOFA 3O5CA 2E5YA 3L70J 2ZT9B 3ZOXA 1YYCA 1NTMJ 4WQEA 4QAOA 5KKZC 1N90A 1SQQK 1VF5C 3L4OA 1NHLA 2Q3EA 1YJ9P 1IK7A 1G1IA 1ZR2A 2A45I 1GD2E 5CHXA 1A02F 1Q90D 2CK3H 2J58A 3CCQP 2AEMA 3L70E 2B11B 2E74B 1YHQP 1LJ2A 2K9YA 4NPFX 3M91A 4N3YB 4HB1A 3L74D 1L0NJ 5AW4B 3Q5RA 1EXIA 3BCCJ 4WB4A 3CXHD 2KI7B 5CCHC 4BXLA 1EC5A 1ZR4A 3WU2H 3AE1C 4MN4C 3GHGA 3VMZA 2HLOA 3BRVB 351CA 1K8AQ 2PCBB 4H0KA 3CWBE 2C0XA 2Y0DA 5K5GB 4WY4D 1L0NE 4R4MA 5TISH 1L4AB 1PP9G 2YIUC 4NFGB 1USEA 3L72G 3M9QA 5KAFV 1SP4A 3H1IG 2HFED 1FE6A 3V5BA 1JO5A 1EZVD 5KLVE 4LJIA 3GW6A 3HRNA 2WT7B 2GB8B 3AECC 4WY4C 1BCCJ 1HZUA 3V2NA 1M90Q 2R5DA 4C46A 2M5AA 3H1JD 3RLMA 1H8AA 3RL0g 1CI6B 3H1LD 1YQ3C 2Y0CA 4W7ZA 4UB8V 2W83C 5BVZA 1M60A 3M06A 4PV1B 1JOCA 3CC4P 3GHGC 3M9BA 1Y47A 2MHMA 1ETPA 1KB9I 2E43A 1SQQJ 3G9RA 3V2RA 5AVVB 2WVRA 1MFTA 3U1CA 2FBWC 1IFPA 3WFDC 1PV3A 3S4RA 2UWJE 3WUVA 4FA1A 2YKOA 1VYDA 1FI3A 2IBZE 1X0TA 2BCCG 2FKWB 1L0LE 3B5NB 4O9BA 2W6BA 2C0WA 1AFOA 4D6TD 3M0DC 1CIEA 2MTAC 1NTKG 5CCGA 4BRYB 2WZ7A 1CYJA 2JTIB 1NTZD 3B8EB 3L75J 3L71J 3H32B 3AEDC 1CYCA 4AX3A 1FJKA 1X9VA 1YNRA 2NPSA 3V2PA 1GZLA 2KIKA 1F1CA 4W80A 2W8ZA 1SQBK 3MGNA 5APSA 1OXZA 1G2CA 3H1KG 1M1KQ 1R0QA 4W7YA 2JKVA 3WMM0 1U7MA 1HGZA 1SQXE 2E76B 3DR0A 1USDA 2BPBB 4DJGA 1J1EC 5AVZB 4EYYQ 2KLVA 3HUSA 2HYNA 3HE5A 5AW2B 2WSSH 1C6RA 4YTPC 2YKQA 4TLFA 3VOPA 1Y9BA 3SWYA 2W27A 3G71P 1RF0A 1KV9A 1N8RQ 2QEXP 3WC8A 3WU2E 3OAKA 5KKZB 5E79V 1VF5B 2W6AA 4ZNCA 1KQFB 4HKZH 1S6VB 1I54A 1EDIA 1IC2A 3NTNA 3BVHA 3BRTB 1QL4A 1GDTA 3JC22 2JJLA 3OJAB 4Z1MH 1NTMG 1VL2A 1FOCA 2ZONG 3BASA 1CRGA 5KTBA 4H0LD 1DEEG 1PPJG 2JDIH 1GW4A 3CWBD 1CCRA 2CA3B 2IDBA 3CLQA 1T2KD 2XV5A 3RK3D 1AQTA 3FX0A 1QL1A 3HUSC 1CORA 1DX7A 3A0BH 2ZVOB 1BSNA 1L0NG 2N9BA 1A56A 2C1DB 3VYIA 1NAFA 2YIUB 4AYCA 5CBNA 4H0LC 3BCCG 4AANA 2KK7A 2WPQA 1SQBJ 4WQ7A 1H33A 1JCCA 4JF7A 3CX5E 2YCCA 2PFXA 3AEFC 4N6JA 1LTAC 3TGUE 3B71A 3PXTA 3OA8B 4JPZB 2N9JA 4DOJA 1T2KC 3RK3C 4GOEA 5B5EV 3ABVC 3H1HE 1FDOA 3F5HA 1ZRTD 4WY4B 1IFMA 2K9JB 2Y0EA 3HD7A 1YITP 3IR9A 1C6OA 3CC2P 2M8RA 2QM7A 1U7JA 3I55P 3E1RA 1PIXA 3C8VA 2ZT9C 1TU3F 3GG2A 3H25A 4WQ8A 5CIHB 3GHGB 4EOTA 2C1UA 3P8CD 1BCCG 4LC1A 1CSWA 1SQPD 3RL0D 3HD7D 2B87B 2JEEA 3L74J 5AW1B 1KZUB 1LT1A 2KLUA 1FHBA 1CXCA 3CCVP 1W2LA 5CICB 2IBZG 2E74C 1H32B 2WSEH 5CBOA 1NU1E 2LIRA 4OGQD 1S5LV 1SQQG 4EIEA 1OCDA 4EI2A 1BE3E 3RL0C 3VN0A 3HD7C 1YJWP 2JWAA 3PRJA 3CXHE 2OTLP 2AEJA 3M9HA 3L4FA 3C1LA 4AAOA 2M5AB 3AE7C 3HTKB 5AVSB 1YQ4C 1K73Q 2CA4B 4OGQC 1S72P 1YICA 1SQXD 1U75B 1LTGC 3AEEC 2Z4EA 5TJHA 5C0ZA 3B5NA 3L75G 1FZBA 5AVXB 2QM8A 3L71G 4I7ZC 3V2QA 4I1LA 2IX7C 2W6JH 2K37A 1LTIC 2IFNA 3FXEA 1J1EB 1FDMA 3PP5A 2N9YB 1P84I 4ASWA 3CPWO 1EB7A 5AVUB 2V07A 1CC5A 4PD4I 1H88A 2WPSA 3M97X 3USSA 2FYNC 2C2CA 1YIJP 1A02J 2QVAA 1PGQA 3LW5H 1ZV8A 1EDLA 2N3BA 2M3EA 4HJGH 2WSFH 1AV1A 2QJPC 3NMDA 1E5WA 1LT9C 2QJYC 1NWQA 3H1JE 4RSZA 1DIQC 3PH0A 1JTHB 1K3GA 1OWAA 2RH0A 3S1KA 4WBAA 3H1LE 2LR2A 1H1OA 3A0BE 2KOGA 1KYOI 2OQQA 1CCHA 2A45H 2P2UA 4D6TJ 1E29A 3S9OA 1YTCA 1N15A 3IFMA 1AKKA 1L0NK 2CPBA 1BL9A 2O1KA 3PH2B 1WMKA 3AEAC 1VQKP 1N9CA 1NTZJ 1T3UA 5APWA 3B5NC 3W67A 3A9FA 3DMIA 3WUIA 1IFDA 2C1VA 1KD1Q 5KLVK 4D6TE 1N7SD 2AXTH 2AIUA 3HUSB 2P67A 4WWIA 1NTZE 2HR3A 1IQCA 2YQBA 3TGUD 3ZOYA 4H0LB 1GK6A 1DD4A 3H1HD 1VQ9P 4A7PA 1NKZB 1N7SC 1RZ5A 3L73D 3RK3B 3A0HH 3ZOOA 2V7QJ 2RMZA 1KYOW 1C2RA 2ZZS1 3E7KA 2B4ZA 1RQVA 1S4XA 1SQBG 2HODA 1FZGA 1MV8A 3QWOC 1K04A 1H0TB 1W5CT 1GK4A 1VDFA 2K1AA 1NYHA 3O1YA 2VRSA 1NIRA 2C1DA 5CIFB 2CXBA 1KILE 2J5UA 5GTHV 1JMBA 3OCDA 1L0LK 5KJ7D 2YMYA 1CRJA 3G3ZA 1JMMA 3C2CA 4IL6V 3OA8A 4OH8B 3IAOA 1CIHA 2V4HA 1CW5A 1KB9H 2N1TD 1NU1D 3L36A 4WY4A 2K9JA 1C7MA 3CC7P 5CYTR 5DJUB 3ZBMA 1H33B 3CWBJ 2BLFB 1ZOYC 1K3HA 1BE3D 3ZCFA 5KJ7C 1DT1A 1T8ZA 4XE5B 5B66V 3CCMP 2VHDA 1XTCC 3L74G 3D0WA 1IRWA 1FZAA 1HH7A 1RHZB 4FAVA 3CP5A 3RL0B 4XA4A 3HD7B 2XZRA 1OFCX 3KZIH 2O01N 1Q82Q 1JNMA 5KLVJ 5H2FH 3MTUE 3GF3A 3UIAA 1L2PA 2B87A 2XNDH 1LGHB 3RK3E 5KAIV 4K3AA 1N7LA 4OGQB 3CL3D 3PHLA 3SWFA 5AW0B 3ZDMA 1K9MQ 2IYOA 1ZMEC 4PJ0H 1H32A 1M1JC 2HV4A 1GDVA 1E2RA 1PP9D 4UB6H 4U3FE 4I7ZB 3M0DA 1PGOA 3T97A 3H1ID 1A2SA 4N78E 2YO3A 3P32A 1VQ4P 3C9IA 2IBZI 2KYVA 1KX2A 3NFQA 1EZVG 2M0BA 3IN6A 1PGPA 3MZWB 2H7HA 5DJQC 1KX7A 3ZOWA 2QRXA 1HJBA 3TYYA 3WFCC 2Y9YA 2FYNB 1ZRTE 1NGMB 3HTKA 1HVVA 3PXSA 2QSIA 2YO2A 2FYUE 1E8EA 4L3HA 2QJPB 3PLNA 2FFDC 2QJYB 1LT9B 3MP7B 1L0LJ 2KS1A 2HPCB 1I8OA 4IFDK 3ZIYA 3CCEP 2B12B 2AXTE 1A8CA 1AYGA 1KFNA 4OWFA 3SXTA 2GA1A 3GLMA 3VRDA 3P8CE 2A06G 2ZOOA 2IZ1A 4K35A 1SQVE 1QEXA 2D2CD 2POHA 1DEBA 1NNOA 1SQPE 5EFWB 2RN0A 5GTIH 1YIQA 1M8OB 1QLED 1HCMA 3CYTI 3CMEP 1CHJA
chains in the Genus database with same CATH topology
1DW1A 5DFSA 2C9XB 1U74B 2YIUB 3KZIV 1P84D 4AANA 1H31B 4WQ7A 3HQ6A 1DIIC 5H2FV 1H33A 3O0RC 1NTKD 2YCCA 4XYDB 1M70A 2ORLA 3RN0A 3PXTA 4WQ9A 1CSVA 3OA8B 2N9JA 2GIWA 1CNOA 3O20A 4RJTA 1NMIA 1DVVA 3HQ9A 5CIDB 5B5EV 4EIDA 4KMGA 4PJ0V 1QYZA 1ZRTD 2K9JB 2Y0EA 4UB6V 1C6OA 1KB0A 3L4MA 4JCGA 1HJ4A 3H1KD 5DF5A 3SWSA 2EXVA 2OZ1B 2N3YA 4Q5PA 1AOQA 3DP5A 3NWVA 3GG2A 3HQ7A 1COTA 3TF5A 4WQ8A 5CIHB 2C1UA 4MU8A 1CRIA 1CSUA 2QG4A 1GKSA 1YEAA 3L72D 3RMZA 2D0SA 1CSWA 1LC1A 1SQPD 3TDKA 4L3GA 1CSXA 4XXLA 1ZZHA 5C9MA 3TYIA 1FHBA 5AURA 1CXCA 1W2LA 5CICB 1WVEC 1H32B 4J20A 1KIBA 2LIRA 2C8SA 155CA 2L4DA 1S5LV 4EIEA 1OCDA 3CX5D 1J3SA 4FA9A 3KHUA 1F1FA 2V08A 5GTIV 1IO3A 3CU4A 1LS9A 451CA 3A0BV 2JWAA 3PRJA 1QN2A 1LFMA 3WFEC 4EDFA 1NTMD 4AAOA 3JBTB 4DY9A 2CA4B 4AALA 4O1QA 1YICA 1SQXD 1U75B 1CTJA 5TJHA 3FWLA 4EIFA 5C0ZA 1CIFA 2A06D 1CXAA 1L9JC 1RZ6A 1CEDA 1AOFA 2GC4D 3O5CA 2QJKB 1CRCA 2BCCD 1GQ1A 2JQRA 1H9XA 3ZOXA 5B6QA 4U3FD 1H31A 3SVWA 1CHHA 2N9YB 4WQEA 3VNWA 1CRYA 3OCDB 1EB7A 1FI9A 1CIGA 4PD4D 2V07A 4QAOA 1CC5A 1N90A 2DGEA 1DW3A 3L4OA 2Q3EA 2FRCA 3BCCD 5CIGB 2O3JA 3M97X 2ZXYA 1C6SA 2BCNB 2C2CA 4V2KA 1I8PA 2N3BA 3ITKA 3CX5W 2B11B 4RSZA 1DIQC 1K3GA 1FJ0A 2BH4X 5DJQB 2FYUD 3SJLA 3L74D 4AAMA 1H1OA 1I6DA 1FI7A 1MZ4A 1HROA 1KYOD 3HQ8A 4PW9B 2FWLA 1QL3A 3CXHD 2PACA 1CCHA 1YFCA 4P4QB 1E29A 1YTCA 1N15A 351CA 1GU2A 4L1QA 4WQBA 1AKKA 1BL9A 3MK7C 3PH2B 2PCBB 2I8FA 4H0KA 1N9CA 1SQVD 2Y0DA 2CE1A 2YK3A 3A9FA 4FA4A 3DMIA 1BCCD 1DW2A 2N18C 1MG2D 1CHJA 3WUIA 4NFGB 1C52A 1FCDC 2C1VA 1WEJF 1IZL0 1H9YA 5KAFV 2AIUA 2B0ZB 1EZVD 5KLIB 4LJIA 1N50A 1DW0A 1IQCA 3NBSA 3GW6A 5CIEB 1CYIA 2YQBA 3TGUD 4H0JA 3NBTA 3RN1A 3ZOYA 1LMSA 1I6EA 1LC2A 1SQQD 2GB8B 1MG3D 1HZUA 1BGYD 3L70D 3H1HD 3PXWA 3ORVA 4A7PA 3H1JD 3RLMA 1RZ5A 2N9IA 3L73D 1B7VA 3H1LD 3ZOOA 1NMLA 2RMZA 2Y0CA 1KYOW 4UB8V 1C2RA 1JDLA 3CXHW 4GEDB 1M60A 2ZZS1 5CIBB 1PPJD 2B4ZA 1HRCA 4WQAA 1YEBA 1I5TA 1KB9D 1W5CT 2MHMA 1ETPA 3O1YA 2CE0A 1NIRA 2C1DA 5CIFB 2CXBA 1RAPA 3L75D 5GTHV 3L71D 4FA5A 3OCDA 3WFDC 1L0ND 1CRJA 4FA1A 4WQDA 1VYDA 1FI3A 4O1WA 1QKSA 2LITA 3C2CA 4IL6V 3OA8A 1CIHA 4D6TD 1CIEA 2MTAC 1NU1D 2XTSB 1CTYA 3WU2V 4WQCA 5KLVD 1C7MA 1CYJA 2JTIB 1NTZD 5CYTR 3ZBMA 1H33B 1HZVA 2B10B 1CTZA 2BLFB 1GIWA 4FANA 1K3HA 1BE3D 5TISV 1CYCA 3ZCFA 4AX3A 1DT1A 1CO6A 1YNRA 2OZ1A 5B66V 1F1CA 2VHDA 2AXTV 1IRWA 3WFBC 1DVHA 1HH7A 4FAVA 3CP5A 1IRVA 1R0QA 2GC7D 1RAQA 2ZBOA 3DR0A 2D0WA 1I55A 5KAIV 2BPBB 3PHLA 4FB1A 4GYDA 1H32A 2HV4A 1GDVA 1E2RA 1C6RA 1PP9D 4K3IA 3A0HV 3H1ID 1A2SA 1C2NA 2IBZD 1GJQA 2L91A 1KV9A 3VYMA 1L0LD 4Y5RA 1C75A 5EXQA 1KX2A 4PWAA 3WC8A 1M6ZA 3SLEA 5KKZB 4YE1A 5E79V 2PCCB 1CHIA 5DJQC 1KX7A 1S6VB 3ZOWA 1I54A 4N0KA 2AI5A 3WFCC 2FYNB 3PXSA 2DVHA 3VMAA 1YCCA 1QL4A 1HJ5A 1E8EA 4L3HA 2QJPB 3PLNA 5IY51 2BGVX 2QJYB 2BH5X 1FOCA 2KS1A 2ZONG 1I8OA 3ZIYA 1CRGA 2B12B 1A8CA 1AYGA 3SXTA 1SQBD 1OAEA 3VRDA 2KNCB 3CWBD 1CCRA 2ZOOA 2CA3B 1HJ3A 1NNOA 1L9BC 3MK7B 4EICA 2RN0A 3PTZA 3X39A 1CORA 1CRHA 1YIQA 1HCMA 3CYTI 1A56A 2C1DB 2N18B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DW1 A;  5DFS A;  2C9X B;  1U74 B;  2YIU B;  3KZI V;  1P84 D;  4AAN A;  1H31 B;  4WQ7 A;  3HQ6 A;  1DII C;  5H2F V;  1H33 A;  3O0R C;  1NTK D;  2YCC A;  4XYD B;  1M70 A;  2ORL A;  3RN0 A;  3PXT A;  4WQ9 A;  1CSV A;  3OA8 B;  2N9J A;  2GIW A;  1CNO A;  3O20 A;  4RJT A;  1NMI A;  1DVV A;  3HQ9 A;  5CID B;  5B5E V;  4EID A;  4KMG A;  4PJ0 V;  1QYZ A;  1ZRT D;  2K9J B;  2Y0E A;  4UB6 V;  1C6O A;  1KB0 A;  3L4M A;  4JCG A;  1HJ4 A;  3H1K D;  5DF5 A;  3SWS A;  2EXV A;  2OZ1 B;  2N3Y A;  4Q5P A;  1AOQ A;  3DP5 A;  3NWV A;  3GG2 A;  3HQ7 A;  1COT A;  3TF5 A;  4WQ8 A;  5CIH B;  2C1U A;  4MU8 A;  1CRI A;  1CSU A;  2QG4 A;  1GKS A;  1YEA A;  3L72 D;  3RMZ A;  2D0S A;  1CSW A;  1LC1 A;  1SQP D;  3TDK A;  4L3G A;  1CSX A;  4XXL A;  1ZZH A;  5C9M A;  3TYI A;  1FHB A;  5AUR A;  1CXC A;  1W2L A;  5CIC B;  1WVE C;  1H32 B;  4J20 A;  1KIB A;  2LIR A;  2C8S A;  155C A;  2L4D A;  1S5L V;  4EIE A;  1OCD A;  3CX5 D;  1J3S A;  4FA9 A;  3KHU A;  1F1F A;  2V08 A;  5GTI V;  1IO3 A;  3CU4 A;  1LS9 A;  451C A;  3A0B V;  2JWA A;  3PRJ A;  1QN2 A;  1LFM A;  3WFE C;  4EDF A;  1NTM D;  4AAO A;  3JBT B;  4DY9 A;  2CA4 B;  4AAL A;  4O1Q A;  1YIC A;  1SQX D;  1U75 B;  1CTJ A;  5TJH A;  3FWL A;  4EIF A;  5C0Z A;  1CIF A;  2A06 D;  1CXA A;  1L9J C;  1RZ6 A;  1CED A;  1AOF A;  2GC4 D;  3O5C A;  2QJK B;  1CRC A;  2BCC D;  1GQ1 A;  2JQR A;  1H9X A;  3ZOX A;  5B6Q A;  4U3F D;  1H31 A;  3SVW A;  1CHH A;  2N9Y B;  4WQE A;  3VNW A;  1CRY A;  3OCD B;  1EB7 A;  1FI9 A;  1CIG A;  4PD4 D;  2V07 A;  4QAO A;  1CC5 A;  1N90 A;  2DGE A;  1DW3 A;  3L4O A;  2Q3E A;  2FRC A;  3BCC D;  5CIG B;  2O3J A;  3M97 X;  2ZXY A;  1C6S A;  2BCN B;  2C2C A;  4V2K A;  1I8P A;  2N3B A;  3ITK A;  3CX5 W;  2B11 B;  4RSZ A;  1DIQ C;  1K3G A;  1FJ0 A;  2BH4 X;  5DJQ B;  2FYU D;  3SJL A;  3L74 D;  4AAM A;  1H1O A;  1I6D A;  1FI7 A;  1MZ4 A;  1HRO A;  1KYO D;  3HQ8 A;  4PW9 B;  2FWL A;  1QL3 A;  3CXH D;  2PAC A;  1CCH A;  1YFC A;  4P4Q B;  1E29 A;  1YTC A;  1N15 A;  351C A;  1GU2 A;  4L1Q A;  4WQB A;  1AKK A;  1BL9 A;  3MK7 C;  3PH2 B;  2PCB B;  2I8F A;  4H0K A;  1N9C A;  1SQV D;  2Y0D A;  2CE1 A;  2YK3 A;  3A9F A;  4FA4 A;  3DMI A;  1BCC D;  1DW2 A;  2N18 C;  1MG2 D;  1CHJ A;  3WUI A;  4NFG B;  1C52 A;  1FCD C;  2C1V A;  1WEJ F;  1IZL 0;  1H9Y A;  5KAF V;  2AIU A;  2B0Z B;  1EZV D;  5KLI B;  4LJI A;  1N50 A;  1DW0 A;  1IQC A;  3NBS A;  3GW6 A;  5CIE B;  1CYI A;  2YQB A;  3TGU D;  4H0J A;  3NBT A;  3RN1 A;  3ZOY A;  1LMS A;  1I6E A;  1LC2 A;  1SQQ D;  2GB8 B;  1MG3 D;  1HZU A;  1BGY D;  3L70 D;  3H1H D;  3PXW A;  3ORV A;  4A7P A;  3H1J D;  3RLM A;  1RZ5 A;  2N9I A;  3L73 D;  1B7V A;  3H1L D;  3ZOO A;  1NML A;  2RMZ A;  2Y0C A;  1KYO W;  4UB8 V;  1C2R A;  1JDL A;  3CXH W;  4GED B;  1M60 A;  2ZZS 1;  5CIB B;  1PPJ D;  2B4Z A;  1HRC A;  4WQA A;  1YEB A;  1I5T A;  1KB9 D;  1W5C T;  2MHM A;  1ETP A;  3O1Y A;  2CE0 A;  1NIR A;  2C1D A;  5CIF B;  2CXB A;  1RAP A;  3L75 D;  5GTH V;  3L71 D;  4FA5 A;  3OCD A;  3WFD C;  1L0N D;  1CRJ A;  4FA1 A;  4WQD A;  1VYD A;  1FI3 A;  4O1W A;  1QKS A;  2LIT A;  3C2C A;  4IL6 V;  3OA8 A;  1CIH A;  4D6T D;  1CIE A;  2MTA C;  1NU1 D;  2XTS B;  1CTY A;  3WU2 V;  4WQC A;  5KLV D;  1C7M A;  1CYJ A;  2JTI B;  1NTZ D;  5CYT R;  3ZBM A;  1H33 B;  1HZV A;  2B10 B;  1CTZ A;  2BLF B;  1GIW A;  4FAN A;  1K3H A;  1BE3 D;  5TIS V;  1CYC A;  3ZCF A;  4AX3 A;  1DT1 A;  1CO6 A;  1YNR A;  2OZ1 A;  5B66 V;  1F1C A;  2VHD A;  2AXT V;  1IRW A;  3WFB C;  1DVH A;  1HH7 A;  4FAV A;  3CP5 A;  1IRV A;  1R0Q A;  2GC7 D;  1RAQ A;  2ZBO A;  3DR0 A;  2D0W A;  1I55 A;  5KAI V;  2BPB B;  3PHL A;  4FB1 A;  4GYD A;  1H32 A;  2HV4 A;  1GDV A;  1E2R A;  1C6R A;  1PP9 D;  4K3I A;  3A0H V;  3H1I D;  1A2S A;  1C2N A;  2IBZ D;  1GJQ A;  2L91 A;  1KV9 A;  3VYM A;  1L0L D;  4Y5R A;  1C75 A;  5EXQ A;  1KX2 A;  4PWA A;  3WC8 A;  1M6Z A;  3SLE A;  5KKZ B;  4YE1 A;  5E79 V;  2PCC B;  1CHI A;  5DJQ C;  1KX7 A;  1S6V B;  3ZOW A;  1I54 A;  4N0K A;  2AI5 A;  3WFC C;  2FYN B;  3PXS A;  2DVH A;  3VMA A;  1YCC A;  1QL4 A;  1HJ5 A;  1E8E A;  4L3H A;  2QJP B;  3PLN A;  5IY5 1;  2BGV X;  2QJY B;  2BH5 X;  1FOC A;  2KS1 A;  2ZON G;  1I8O A;  3ZIY A;  1CRG A;  2B12 B;  1A8C A;  1AYG A;  3SXT A;  1SQB D;  1OAE A;  3VRD A;  2KNC B;  3CWB D;  1CCR A;  2ZOO A;  2CA3 B;  1HJ3 A;  1NNO A;  1L9B C;  3MK7 B;  4EIC A;  2RN0 A;  3PTZ A;  3X39 A;  1COR A;  1CRH A;  1YIQ A;  1HCM A;  3CYT I;  1A56 A;  2C1D B;  2N18 B; 
#chains in the Genus database with same CATH topology
 1U74 B;  3A0H E;  5APU A;  1P84 D;  1KC8 Q;  4D6T G;  1JTH A;  2H8P D;  1KMI Z;  4GT1 A;  1NTK D;  4XYD B;  2ORL A;  1JB0 J;  3TSI A;  1SQX J;  2D2C C;  3QH9 A;  1QVG O;  1KIL A;  3O20 A;  5APV A;  1NMI A;  1BGY E;  4EID A;  1QYZ A;  1J2J B;  2B88 A;  2SPZ A;  5GTH H;  4BWN A;  1KB0 A;  3CCR P;  2G3A A;  1N7S B;  1YTZ T;  3H1K D;  3VTP C;  1YTZ I;  1LP1 B;  4Q5P A;  1HGV A;  1AOQ A;  1KB9 E;  2ITA A;  3NWV A;  2QIW A;  3HQ7 A;  3Q2Y A;  1PGJ A;  1PZQ A;  2QG4 A;  1KIL D;  1IJD B;  1YEA A;  1NO4 A;  2P1J A;  3EWK A;  3TDK A;  2AEF A;  3L37 A;  1CSX A;  2OYH A;  4B86 A;  5C9M A;  4I6M C;  1VQ8 P;  1VQN P;  1OZH A;  3VMX A;  5B66 H;  1HWT C;  1NU1 K;  2WSC H;  4J20 A;  2BAS A;  3KZI E;  5H2F E;  2C8S A;  3CX5 I;  1J3S A;  1KIL C;  4FA9 A;  5TIS E;  3RBZ A;  3L70 G;  4ZKU A;  1KV4 A;  1F1F A;  1IO3 A;  1H0T A;  4PJ0 E;  2PRR A;  1EDK A;  5KAF H;  1LFM A;  1DIP A;  4UB6 E;  1NTM D;  1NVO A;  2Q3I A;  3JBT B;  4DY9 A;  3TGU J;  2N1T B;  1CTJ A;  1OMI A;  4H13 D;  3FWL A;  2H88 C;  2HOD B;  2OYI C;  1CIF A;  2R44 A;  3CWB G;  1CED A;  1CSB A;  3H1H J;  1HTL C;  2XKM A;  2WMM A;  4U3F D;  1ZN5 A;  2OYH C;  3SVW A;  1X79 B;  1CHH A;  1VQ5 P;  3L73 J;  4N78 D;  1K05 A;  1M1J B;  3OCD B;  3O6Q B;  4UB8 H;  1KQL A;  3EFF K;  3JSV C;  2DGE A;  1DW3 A;  2JO1 A;  3MUD C;  1OVV A;  2FRC A;  3GMA A;  3BCC D;  5CIG B;  5KLV G;  3VP9 A;  4L73 A;  5DJT B;  3V4Q A;  1JY3 O;  2R3S A;  4H13 C;  3ITK A;  2R5B A;  3CX5 W;  3AE4 C;  4JQ0 D;  3L73 E;  5DJQ B;  2BH4 X;  3AE2 C;  2FYU D;  1X22 A;  1FAV A;  3SJL A;  1P84 H;  4AAM A;  5GTI E;  1I6D A;  4XFJ A;  1HH0 A;  1ZLL A;  2O01 H;  4PD4 H;  1FI7 A;  2XNX A;  1FS0 E;  2FWL A;  1QL3 A;  3AE6 C;  2FFD B;  1U57 A;  3CXH I;  1RQU A;  4C7R A;  4P4Q B;  1NU1 J;  1GU2 A;  4LLH A;  4L1Q A;  3AEG C;  1HBW A;  2I8F A;  1SQV D;  5APY A;  2CE1 A;  3MD0 A;  2H89 C;  4FA4 A;  1BCC D;  1BE3 J;  1DW2 A;  3Q5S A;  1MG2 D;  4GKG A;  1FCD C;  1KYO H;  1GL2 D;  2I8D A;  1NTZ K;  4DCK A;  1L0L G;  5AVW B;  1RE3 C;  2ZVN B;  4KT0 J;  1EZV I;  1N50 A;  3T97 B;  2LKM A;  3NBS A;  5CIE B;  4H0J A;  3RN1 A;  1LT9 A;  3RBX A;  1I6E A;  1Q2N A;  1SQQ D;  2HPC A;  1BGY D;  3WUU A;  1BSH A;  4ZKP A;  3A5T A;  2D2C B;  3ORV A;  2YXQ B;  2OYO A;  2WPV B;  2N9I A;  1GL2 C;  3D6Y A;  1RF1 A;  3A2A A;  3VMY A;  3AE9 C;  3RGU A;  2V7Q H;  2BEQ D;  1JDL A;  3SFE C;  3CXH W;  4GED B;  2YNY A;  5AW5 B;  1UII A;  1YEB A;  3BAT A;  1I5T A;  2KS1 B;  1KB9 D;  5E79 H;  2CE0 A;  4I2L C;  2Z5I A;  1FZE A;  1SQX G;  3EQ2 A;  3IF4 A;  3CCL P;  3L75 D;  1PP9 E;  3L71 D;  3H1J J;  3L72 E;  3H1L J;  3H1I E;  4WQD A;  1EQ7 A;  2O1J A;  1XTG B;  2LIT A;  3V6I A;  2XDJ A;  1G1J A;  3TNU B;  5KAF E;  2FXO A;  2ZXX A;  1IO4 A;  2XTS B;  3WU2 V;  1PFI A;  3CD6 P;  1QL2 A;  2MJZ A;  4FAN A;  1JUN A;  5BU8 B;  5TIS V;  1N7S A;  1WRG A;  2L5G B;  2MKV A;  2FXP A;  2J59 M;  1LP1 A;  3SSU A;  1KIL B;  1RF1 C;  1MZ9 A;  1DVH A;  4RO0 A;  3II6 A;  2GM4 A;  4UB8 E;  1VQO P;  2IYP A;  3D70 A;  1FJP A;  5AW7 B;  1RAQ A;  1EDJ A;  2ZBO A;  2QJK C;  1I55 A;  4L75 A;  3CMA P;  5B5E H;  4OVN F;  4GYD A;  1T6A A;  2BCC E;  2OYI B;  1WT6 A;  1J1D C;  2WQY C;  3PJS K;  1DD3 A;  1P84 E;  1BDC A;  1FU1 A;  2JWD A;  1GJQ A;  2L91 A;  4KJM A;  1MKM A;  3VYM A;  1NTK E;  4Y5R A;  2OYH B;  2W90 A;  4PWA A;  1JY2 O;  1M6Z A;  1S5L X;  1GMJ A;  1W2B O;  1LTT C;  1IFN A;  2PCC B;  1CHI A;  2WSE J;  2ZAE B;  4YPC A;  4H44 D;  3TGU G;  5KJ7 A;  1N73 C;  4N0K A;  1AVO A;  4Y99 C;  2WTY A;  3Q1M A;  2DVH A;  1X8Y A;  4H13 B;  1YCC A;  1HJ5 A;  3H1H G;  5IY5 1;  2Y9Z A;  2N1T A;  5CJ4 A;  1LTS C;  3H1K E;  3L73 G;  2KSE A;  3OA7 A;  2P7J A;  5APT A;  1QX8 A;  1HUC A;  1NJI Q;  1SQB D;  2YKP A;  1OAE A;  1SQP K;  4NPE A;  1S5L H;  4H44 C;  2KNC B;  1M1J A;  3O6Q A;  1HJ3 A;  1SFC D;  3CCJ P;  1LWU C;  3PTZ A;  1GTW A;  1W2E A;  1CRH A;  1EXJ A;  1T3J A;  5KLI C;  1Q81 Q;  1VQ6 P;  1DW1 A;  5DFS A;  1VQL P;  3HE4 A;  2ZYD A;  3O0R C;  1FDI A;  5CCH D;  1NU1 G;  2YMK A;  3RN0 A;  3LIE A;  2R3C A;  4WQ9 A;  3A3Y B;  4GIF A;  2B9B A;  1JCD A;  5E79 E;  1JEK A;  1SFC C;  1AQ5 A;  1CNO A;  3LW5 J;  1BDD A;  4RJT A;  3O8Z A;  2FFD A;  1R5L A;  5CID B;  2WSF J;  2K3R A;  1CZQ A;  2Q1K A;  3FXD A;  4HH2 A;  1BE3 G;  3P7K A;  1FZF A;  1NTM E;  1SS1 A;  4U3F J;  2N1T C;  1OX3 A;  3TK1 A;  1SQX K;  3L4M A;  4JCG A;  2FXM A;  2B89 A;  1FOS E;  3AE5 C;  3KPE A;  1GL2 B;  2P10 A;  1PPJ E;  5DF5 A;  2OZ1 B;  3R2P A;  2N3Y A;  3LID A;  3V4W A;  1W5C E;  1QGK B;  1COT A;  3TF5 A;  1VPC A;  4MU8 A;  1CRI A;  1CSU A;  1OVU A;  4M3L A;  3L72 D;  1AJY A;  2QA4 P;  2ZYA A;  2FYU J;  4XXL A;  5AUR A;  3BCC E;  4JBZ A;  2ZJS E;  4CPG A;  155C A;  3KDP B;  2Q7C A;  1SQV J;  1RE4 A;  3SWK A;  1SQP J;  3H1J G;  3CU4 A;  451C A;  5B5E E;  3A0B V;  3H1L G;  3JCU H;  3WFE C;  4L76 A;  2WIT A;  1RF1 B;  4AAL A;  4O1Q A;  1Q7Y Q;  2NRG A;  4C7N B;  3CX5 H;  2Q5U A;  4EIF A;  2A06 D;  1BCC E;  1CXA A;  3TNU A;  2GC4 D;  2QJK B;  1CRC A;  1BGY J;  2BCC D;  1GQ1 A;  2JQR A;  1H9X A;  1VQ7 P;  5B6Q A;  1M57 D;  4IL6 X;  1VQP P;  1H31 A;  4IFM A;  4WVZ A;  2NZ2 A;  3VNW A;  1CRY A;  1FI9 A;  5AW9 B;  1CIG A;  1KFM A;  4PD4 D;  2KSJ A;  2ZYG A;  1J1D B;  2ZFC A;  1FOS F;  2O3J A;  2ZXY A;  1E79 H;  3MHV A;  1C6S A;  2BCN B;  1SQQ E;  4V2K A;  2AXC A;  1NTZ G;  1I8P A;  2YXR B;  1Q86 Q;  2RKL A;  1S5L E;  4LGD E;  1RE4 C;  2KUB A;  1FJ0 A;  3N7N A;  1S9K D;  1N73 B;  2WPR A;  5APX A;  1LTJ A;  2HG5 D;  4Y99 B;  3SFD C;  4IL6 H;  1MZ4 A;  1HRO A;  1KYO D;  3HQ8 A;  4PW9 B;  2PAC A;  1YFC A;  4AQR D;  3KXD A;  2OYI A;  4U7J A;  4WQB A;  3OW2 O;  1MUU A;  3MK7 C;  1JY3 P;  3L75 E;  5CCG D;  3L71 E;  1S1C X;  2XU6 A;  2YK3 A;  1NKN A;  3KQG A;  4H44 B;  2N18 C;  1S2E A;  1ZXG A;  1FZC B;  1KQG B;  1UIX A;  1C52 A;  2WWW A;  4IFF A;  2G8Y A;  1WEJ F;  1IZL 0;  2FY8 A;  1LWU B;  1H9Y A;  1MFZ A;  3MUD A;  3CXH H;  2B0Z B;  2NPS D;  1RY3 A;  5KLI B;  1IFI A;  2CPS A;  3N4X A;  1DW0 A;  3WUT A;  1CYI A;  1JM0 A;  3NBT A;  1LMS A;  1GU5 A;  1OW7 A;  2JR8 A;  3I5C A;  5CCG C;  1LC2 A;  5KAI H;  5M1B A;  1MG3 D;  3K5B A;  1FC2 C;  3B4S A;  4R4L A;  3L70 D;  2ZXE B;  3PXW A;  3Q3D A;  1LTJ C;  1SFC B;  4GOD A;  3G4S P;  1B7V A;  1ZP0 C;  1SVF A;  2KNC A;  1NML A;  2NPS C;  3VP8 A;  2E75 D;  5CMZ A;  1M56 D;  5CIB B;  1PPJ D;  4YXD C;  1HRC A;  1URQ A;  4WQA A;  3P8M C;  3FGA D;  2GUS A;  2IFM A;  2R32 A;  3RK2 D;  1KN7 A;  4ZMD A;  3AE8 C;  1DH3 A;  1RAP A;  1YBK A;  1HJ0 A;  1Z56 A;  4FA5 A;  5AVY B;  1L0N D;  3GF7 A;  1NAY A;  1RE3 A;  4O1W A;  1QKS A;  2E75 C;  4U3F G;  1KTM A;  3JCU E;  2M3B A;  1CTY A;  1RF0 C;  2PP6 A;  1PL5 A;  1URQ D;  4WQC A;  5KLV D;  1FBM A;  1RH5 B;  3CI9 A;  2A45 G;  3HE4 B;  2Z5H A;  3RK2 C;  1R5S A;  1HZV A;  2B10 B;  1JY3 N;  2ZT9 D;  1CTZ A;  1GIW A;  3A7O A;  1GL2 A;  1HF9 A;  1CO6 A;  2OZ1 A;  2H43 A;  4GDO A;  2FYU G;  2AXT V;  3WFB C;  1QVF O;  2OTJ P;  1YI2 P;  1SQB E;  1IRV A;  1URQ C;  2KXP B;  5C39 A;  1Y8A A;  3R4Y A;  2GC7 D;  3AEB C;  2E5T A;  2E74 D;  2D0W A;  1L4A A;  4AUW A;  1KOR A;  4NPD A;  1SQV G;  4FB1 A;  1SQP G;  2PGD A;  5GTH E;  3KYQ A;  1NH4 A;  2K88 A;  2QE7 H;  3W68 A;  2PAJ A;  4K3I A;  1NTK K;  3MIW A;  3A0H V;  1VQM P;  1C2N A;  2IBZ D;  1OW8 A;  3G6E P;  1NOH A;  4IL6 E;  4RKU J;  1L0L D;  1S3J A;  2KB7 P;  1C75 A;  5EXQ A;  2WT7 A;  3M0A A;  3SLE A;  5L8R J;  4YE1 A;  1M7L A;  2WSC J;  5AVR B;  5APQ A;  3CCU P;  2Q9I A;  2C9L Y;  1L4A D;  2AI5 A;  4YXW H;  3AE3 C;  3Q5P A;  1CI6 A;  1PP9 J;  3VMA A;  3L72 J;  1BGY G;  4C7N A;  4HYT B;  3L74 E;  3H1I J;  2BGV X;  2BH5 X;  5B66 E;  2LXC B;  5AVQ B;  5AW8 B;  5AW6 B;  1R8E A;  1AVY A;  1JY2 P;  1OW6 A;  1L4A C;  4JYC A;  1L9B C;  5KAI E;  3MK7 B;  4EIC A;  1AA0 A;  3X39 A;  2DW3 A;  1KQS O;  4PV1 D;  2N18 B;  4BRY A;  2IZ0 A;  4IOI H;  2C9X B;  3KZI V;  1D7M A;  1EZV E;  1YJN P;  1GW3 A;  1H31 B;  4DZO A;  3D6Z A;  2C9N Y;  3HQ6 A;  1DII C;  5H2F V;  5AVT B;  1OVR A;  1N73 A;  1M70 A;  3H32 A;  1CSV A;  5BU5 A;  2GIW A;  1NTM K;  1DVV A;  3HQ9 A;  4KMG A;  4PJ0 V;  2KZJ A;  1ZW0 A;  3B5N D;  5CJ0 A;  2BCC J;  4EIJ A;  2JP3 A;  4UB6 V;  4PV1 C;  3I56 P;  1HJ4 A;  1LTJ B;  2O01 J;  1NTK J;  4QMA A;  3SWS A;  2EXV A;  2FYZ A;  3D71 A;  2NPS B;  1FZC A;  4KHX A;  1IK9 A;  3DP5 A;  2A06 E;  1LWU A;  1N86 A;  1G2C B;  1GU4 A;  1IFJ A;  1GKS A;  3RMZ A;  2D0S A;  2KP8 A;  2LXB A;  1N2D C;  3F89 A;  1LC1 A;  4PD4 E;  4L3G A;  2I1K A;  3NXS A;  1ZZH A;  3TYI A;  2Q6Q A;  4L74 A;  1LNQ A;  3H1K J;  4Y28 J;  2I1J A;  1WVE C;  2E76 D;  3HE5 B;  2E75 B;  2GUV A;  1KIB A;  1SFC A;  2FYU K;  1H89 A;  2L4D A;  1LTB C;  3E1I A;  2OAR A;  1JY2 N;  3CX5 D;  3EFG A;  4DT0 A;  2P58 A;  1S9K E;  2IPP A;  3KHU A;  3RK2 B;  2V08 A;  5GTI V;  4JYB A;  2OGU A;  1LS9 A;  1KYO E;  1OIP A;  3U1A A;  4ASV A;  1QN2 A;  1IZN B;  3CCS P;  4EDF A;  3H6P A;  3L35 A;  4TT3 H;  3FWN A;  4RES B;  5CCH A;  1SLQ A;  1SQV K;  2E76 C;  2OTK E;  5AW3 B;  1VF5 D;  2E42 A;  4GOF A;  1FZC C;  3U59 A;  2BEZ F;  1URQ B;  2KZI A;  1L9J C;  1RZ6 A;  1AOF A;  3O5C A;  2E5Y A;  3L70 J;  2ZT9 B;  3ZOX A;  1YYC A;  1NTM J;  4WQE A;  4QAO A;  5KKZ C;  1N90 A;  1SQQ K;  1VF5 C;  3L4O A;  1NHL A;  2Q3E A;  1YJ9 P;  1IK7 A;  1G1I A;  1ZR2 A;  2A45 I;  1GD2 E;  5CHX A;  1A02 F;  1Q90 D;  2CK3 H;  2J58 A;  3CCQ P;  2AEM A;  3L70 E;  2B11 B;  2E74 B;  1YHQ P;  1LJ2 A;  2K9Y A;  4NPF X;  3M91 A;  4N3Y B;  4HB1 A;  3L74 D;  1L0N J;  5AW4 B;  3Q5R A;  1EXI A;  3BCC J;  4WB4 A;  3CXH D;  2KI7 B;  5CCH C;  4BXL A;  1EC5 A;  1ZR4 A;  3WU2 H;  3AE1 C;  4MN4 C;  3GHG A;  3VMZ A;  2HLO A;  3BRV B;  351C A;  1K8A Q;  2PCB B;  4H0K A;  3CWB E;  2C0X A;  2Y0D A;  5K5G B;  4WY4 D;  1L0N E;  4R4M A;  5TIS H;  1L4A B;  1PP9 G;  2YIU C;  4NFG B;  1USE A;  3L72 G;  3M9Q A;  5KAF V;  1SP4 A;  3H1I G;  2HFE D;  1FE6 A;  3V5B A;  1JO5 A;  1EZV D;  5KLV E;  4LJI A;  3GW6 A;  3HRN A;  2WT7 B;  2GB8 B;  3AEC C;  4WY4 C;  1BCC J;  1HZU A;  3V2N A;  1M90 Q;  2R5D A;  4C46 A;  2M5A A;  3H1J D;  3RLM A;  1H8A A;  3RL0 g;  1CI6 B;  3H1L D;  1YQ3 C;  2Y0C A;  4W7Z A;  4UB8 V;  2W83 C;  5BVZ A;  1M60 A;  3M06 A;  4PV1 B;  1JOC A;  3CC4 P;  3GHG C;  3M9B A;  1Y47 A;  2MHM A;  1ETP A;  1KB9 I;  2E43 A;  1SQQ J;  3G9R A;  3V2R A;  5AVV B;  2WVR A;  1MFT A;  3U1C A;  2FBW C;  1IFP A;  3WFD C;  1PV3 A;  3S4R A;  2UWJ E;  3WUV A;  4FA1 A;  2YKO A;  1VYD A;  1FI3 A;  2IBZ E;  1X0T A;  2BCC G;  2FKW B;  1L0L E;  3B5N B;  4O9B A;  2W6B A;  2C0W A;  1AFO A;  4D6T D;  3M0D C;  1CIE A;  2MTA C;  1NTK G;  5CCG A;  4BRY B;  2WZ7 A;  1CYJ A;  2JTI B;  1NTZ D;  3B8E B;  3L75 J;  3L71 J;  3H32 B;  3AED C;  1CYC A;  4AX3 A;  1FJK A;  1X9V A;  1YNR A;  2NPS A;  3V2P A;  1GZL A;  2KIK A;  1F1C A;  4W80 A;  2W8Z A;  1SQB K;  3MGN A;  5APS A;  1OXZ A;  1G2C A;  3H1K G;  1M1K Q;  1R0Q A;  4W7Y A;  2JKV A;  3WMM 0;  1U7M A;  1HGZ A;  1SQX E;  2E76 B;  3DR0 A;  1USD A;  2BPB B;  4DJG A;  1J1E C;  5AVZ B;  4EYY Q;  2KLV A;  3HUS A;  2HYN A;  3HE5 A;  5AW2 B;  2WSS H;  1C6R A;  4YTP C;  2YKQ A;  4TLF A;  3VOP A;  1Y9B A;  3SWY A;  2W27 A;  3G71 P;  1RF0 A;  1KV9 A;  1N8R Q;  2QEX P;  3WC8 A;  3WU2 E;  3OAK A;  5KKZ B;  5E79 V;  1VF5 B;  2W6A A;  4ZNC A;  1KQF B;  4HKZ H;  1S6V B;  1I54 A;  1EDI A;  1IC2 A;  3NTN A;  3BVH A;  3BRT B;  1QL4 A;  1GDT A;  3JC2 2;  2JJL A;  3OJA B;  4Z1M H;  1NTM G;  1VL2 A;  1FOC A;  2ZON G;  3BAS A;  1CRG A;  5KTB A;  4H0L D;  1DEE G;  1PPJ G;  2JDI H;  1GW4 A;  3CWB D;  1CCR A;  2CA3 B;  2IDB A;  3CLQ A;  1T2K D;  2XV5 A;  3RK3 D;  1AQT A;  3FX0 A;  1QL1 A;  3HUS C;  1COR A;  1DX7 A;  3A0B H;  2ZVO B;  1BSN A;  1L0N G;  2N9B A;  1A56 A;  2C1D B;  3VYI A;  1NAF A;  2YIU B;  4AYC A;  5CBN A;  4H0L C;  3BCC G;  4AAN A;  2KK7 A;  2WPQ A;  1SQB J;  4WQ7 A;  1H33 A;  1JCC A;  4JF7 A;  3CX5 E;  2YCC A;  2PFX A;  3AEF C;  4N6J A;  1LTA C;  3TGU E;  3B71 A;  3PXT A;  3OA8 B;  4JPZ B;  2N9J A;  4DOJ A;  1T2K C;  3RK3 C;  4GOE A;  5B5E V;  3ABV C;  3H1H E;  1FDO A;  3F5H A;  1ZRT D;  4WY4 B;  1IFM A;  2K9J B;  2Y0E A;  3HD7 A;  1YIT P;  3IR9 A;  1C6O A;  3CC2 P;  2M8R A;  2QM7 A;  1U7J A;  3I55 P;  3E1R A;  1PIX A;  3C8V A;  2ZT9 C;  1TU3 F;  3GG2 A;  3H25 A;  4WQ8 A;  5CIH B;  3GHG B;  4EOT A;  2C1U A;  3P8C D;  1BCC G;  4LC1 A;  1CSW A;  1SQP D;  3RL0 D;  3HD7 D;  2B87 B;  2JEE A;  3L74 J;  5AW1 B;  1KZU B;  1LT1 A;  2KLU A;  1FHB A;  1CXC A;  3CCV P;  1W2L A;  5CIC B;  2IBZ G;  2E74 C;  1H32 B;  2WSE H;  5CBO A;  1NU1 E;  2LIR A;  4OGQ D;  1S5L V;  1SQQ G;  4EIE A;  1OCD A;  4EI2 A;  1BE3 E;  3RL0 C;  3VN0 A;  3HD7 C;  1YJW P;  2JWA A;  3PRJ A;  3CXH E;  2OTL P;  2AEJ A;  3M9H A;  3L4F A;  3C1L A;  4AAO A;  2M5A B;  3AE7 C;  3HTK B;  5AVS B;  1YQ4 C;  1K73 Q;  2CA4 B;  4OGQ C;  1S72 P;  1YIC A;  1SQX D;  1U75 B;  1LTG C;  3AEE C;  2Z4E A;  5TJH A;  5C0Z A;  3B5N A;  3L75 G;  1FZB A;  5AVX B;  2QM8 A;  3L71 G;  4I7Z C;  3V2Q A;  4I1L A;  2IX7 C;  2W6J H;  2K37 A;  1LTI C;  2IFN A;  3FXE A;  1J1E B;  1FDM A;  3PP5 A;  2N9Y B;  1P84 I;  4ASW A;  3CPW O;  1EB7 A;  5AVU B;  2V07 A;  1CC5 A;  4PD4 I;  1H88 A;  2WPS A;  3M97 X;  3USS A;  2FYN C;  2C2C A;  1YIJ P;  1A02 J;  2QVA A;  1PGQ A;  3LW5 H;  1ZV8 A;  1EDL A;  2N3B A;  2M3E A;  4HJG H;  2WSF H;  1AV1 A;  2QJP C;  3NMD A;  1E5W A;  1LT9 C;  2QJY C;  1NWQ A;  3H1J E;  4RSZ A;  1DIQ C;  3PH0 A;  1JTH B;  1K3G A;  1OWA A;  2RH0 A;  3S1K A;  4WBA A;  3H1L E;  2LR2 A;  1H1O A;  3A0B E;  2KOG A;  1KYO I;  2OQQ A;  1CCH A;  2A45 H;  2P2U A;  4D6T J;  1E29 A;  3S9O A;  1YTC A;  1N15 A;  3IFM A;  1AKK A;  1L0N K;  2CPB A;  1BL9 A;  2O1K A;  3PH2 B;  1WMK A;  3AEA C;  1VQK P;  1N9C A;  1NTZ J;  1T3U A;  5APW A;  3B5N C;  3W67 A;  3A9F A;  3DMI A;  3WUI A;  1IFD A;  2C1V A;  1KD1 Q;  5KLV K;  4D6T E;  1N7S D;  2AXT H;  2AIU A;  3HUS B;  2P67 A;  4WWI A;  1NTZ E;  2HR3 A;  1IQC A;  2YQB A;  3TGU D;  3ZOY A;  4H0L B;  1GK6 A;  1DD4 A;  3H1H D;  1VQ9 P;  4A7P A;  1NKZ B;  1N7S C;  1RZ5 A;  3L73 D;  3RK3 B;  3A0H H;  3ZOO A;  2V7Q J;  2RMZ A;  1KYO W;  1C2R A;  2ZZS 1;  3E7K A;  2B4Z A;  1RQV A;  1S4X A;  1SQB G;  2HOD A;  1FZG A;  1MV8 A;  3QWO C;  1K04 A;  1H0T B;  1W5C T;  1GK4 A;  1VDF A;  2K1A A;  1NYH A;  3O1Y A;  2VRS A;  1NIR A;  2C1D A;  5CIF B;  2CXB A;  1KIL E;  2J5U A;  5GTH V;  1JMB A;  3OCD A;  1L0L K;  5KJ7 D;  2YMY A;  1CRJ A;  3G3Z A;  1JMM A;  3C2C A;  4IL6 V;  3OA8 A;  4OH8 B;  3IAO A;  1CIH A;  2V4H A;  1CW5 A;  1KB9 H;  2N1T D;  1NU1 D;  3L36 A;  4WY4 A;  2K9J A;  1C7M A;  3CC7 P;  5CYT R;  5DJU B;  3ZBM A;  1H33 B;  3CWB J;  2BLF B;  1ZOY C;  1K3H A;  1BE3 D;  3ZCF A;  5KJ7 C;  1DT1 A;  1T8Z A;  4XE5 B;  5B66 V;  3CCM P;  2VHD A;  1XTC C;  3L74 G;  3D0W A;  1IRW A;  1FZA A;  1HH7 A;  1RHZ B;  4FAV A;  3CP5 A;  3RL0 B;  4XA4 A;  3HD7 B;  2XZR A;  1OFC X;  3KZI H;  2O01 N;  1Q82 Q;  1JNM A;  5KLV J;  5H2F H;  3MTU E;  3GF3 A;  3UIA A;  1L2P A;  2B87 A;  2XND H;  1LGH B;  3RK3 E;  5KAI V;  4K3A A;  1N7L A;  4OGQ B;  3CL3 D;  3PHL A;  3SWF A;  5AW0 B;  3ZDM A;  1K9M Q;  2IYO A;  1ZME C;  4PJ0 H;  1H32 A;  1M1J C;  2HV4 A;  1GDV A;  1E2R A;  1PP9 D;  4UB6 H;  4U3F E;  4I7Z B;  3M0D A;  1PGO A;  3T97 A;  3H1I D;  1A2S A;  4N78 E;  2YO3 A;  3P32 A;  1VQ4 P;  3C9I A;  2IBZ I;  2KYV A;  1KX2 A;  3NFQ A;  1EZV G;  2M0B A;  3IN6 A;  1PGP A;  3MZW B;  2H7H A;  5DJQ C;  1KX7 A;  3ZOW A;  2QRX A;  1HJB A;  3TYY A;  3WFC C;  2Y9Y A;  2FYN B;  1ZRT E;  1NGM B;  3HTK A;  1HVV A;  3PXS A;  2QSI A;  2YO2 A;  2FYU E;  1E8E A;  4L3H A;  2QJP B;  3PLN A;  2FFD C;  2QJY B;  1LT9 B;  3MP7 B;  1L0L J;  2KS1 A;  2HPC B;  1I8O A;  4IFD K;  3ZIY A;  3CCE P;  2B12 B;  2AXT E;  1A8C A;  1AYG A;  1KFN A;  4OWF A;  3SXT A;  2GA1 A;  3GLM A;  3VRD A;  3P8C E;  2A06 G;  2ZOO A;  2IZ1 A;  4K35 A;  1SQV E;  1QEX A;  2D2C D;  2POH A;  1DEB A;  1NNO A;  1SQP E;  5EFW B;  2RN0 A;  5GTI H;  1YIQ A;  1M8O B;  1QLE D;  1HCM A;  3CYT I;  3CME P;  1CHJ A; 
#chains in the Genus database with same CATH homology
 1DW1 A;  5DFS A;  2C9X B;  1U74 B;  2YIU B;  3KZI V;  1P84 D;  4AAN A;  1H31 B;  4WQ7 A;  3HQ6 A;  1DII C;  5H2F V;  1H33 A;  3O0R C;  1NTK D;  2YCC A;  4XYD B;  1M70 A;  2ORL A;  3RN0 A;  3PXT A;  4WQ9 A;  1CSV A;  3OA8 B;  2N9J A;  2GIW A;  1CNO A;  3O20 A;  4RJT A;  1NMI A;  1DVV A;  3HQ9 A;  5CID B;  5B5E V;  4EID A;  4KMG A;  4PJ0 V;  1QYZ A;  1ZRT D;  2K9J B;  2Y0E A;  4UB6 V;  1C6O A;  1KB0 A;  3L4M A;  4JCG A;  1HJ4 A;  3H1K D;  5DF5 A;  3SWS A;  2EXV A;  2OZ1 B;  2N3Y A;  4Q5P A;  1AOQ A;  3DP5 A;  3NWV A;  3GG2 A;  3HQ7 A;  1COT A;  3TF5 A;  4WQ8 A;  5CIH B;  2C1U A;  4MU8 A;  1CRI A;  1CSU A;  2QG4 A;  1GKS A;  1YEA A;  3L72 D;  3RMZ A;  2D0S A;  1CSW A;  1LC1 A;  1SQP D;  3TDK A;  4L3G A;  1CSX A;  4XXL A;  1ZZH A;  5C9M A;  3TYI A;  1FHB A;  5AUR A;  1CXC A;  1W2L A;  5CIC B;  1WVE C;  1H32 B;  4J20 A;  1KIB A;  2LIR A;  2C8S A;  155C A;  2L4D A;  1S5L V;  4EIE A;  1OCD A;  3CX5 D;  1J3S A;  4FA9 A;  3KHU A;  1F1F A;  2V08 A;  5GTI V;  1IO3 A;  3CU4 A;  1LS9 A;  451C A;  3A0B V;  2JWA A;  3PRJ A;  1QN2 A;  1LFM A;  3WFE C;  4EDF A;  1NTM D;  4AAO A;  3JBT B;  4DY9 A;  2CA4 B;  4AAL A;  4O1Q A;  1YIC A;  1SQX D;  1U75 B;  1CTJ A;  5TJH A;  3FWL A;  4EIF A;  5C0Z A;  1CIF A;  2A06 D;  1CXA A;  1L9J C;  1RZ6 A;  1CED A;  1AOF A;  2GC4 D;  3O5C A;  2QJK B;  1CRC A;  2BCC D;  1GQ1 A;  2JQR A;  1H9X A;  3ZOX A;  5B6Q A;  4U3F D;  1H31 A;  3SVW A;  1CHH A;  2N9Y B;  4WQE A;  3VNW A;  1CRY A;  3OCD B;  1EB7 A;  1FI9 A;  1CIG A;  4PD4 D;  2V07 A;  4QAO A;  1CC5 A;  1N90 A;  2DGE A;  1DW3 A;  3L4O A;  2Q3E A;  2FRC A;  3BCC D;  5CIG B;  2O3J A;  3M97 X;  2ZXY A;  1C6S A;  2BCN B;  2C2C A;  4V2K A;  1I8P A;  2N3B A;  3ITK A;  3CX5 W;  2B11 B;  4RSZ A;  1DIQ C;  1K3G A;  1FJ0 A;  2BH4 X;  5DJQ B;  2FYU D;  3SJL A;  3L74 D;  4AAM A;  1H1O A;  1I6D A;  1FI7 A;  1MZ4 A;  1HRO A;  1KYO D;  3HQ8 A;  4PW9 B;  2FWL A;  1QL3 A;  3CXH D;  2PAC A;  1CCH A;  1YFC A;  4P4Q B;  1E29 A;  1YTC A;  1N15 A;  351C A;  1GU2 A;  4L1Q A;  4WQB A;  1AKK A;  1BL9 A;  3MK7 C;  3PH2 B;  2PCB B;  2I8F A;  4H0K A;  1N9C A;  1SQV D;  2Y0D A;  2CE1 A;  2YK3 A;  3A9F A;  4FA4 A;  3DMI A;  1BCC D;  1DW2 A;  2N18 C;  1MG2 D;  1CHJ A;  3WUI A;  4NFG B;  1C52 A;  1FCD C;  2C1V A;  1WEJ F;  1IZL 0;  1H9Y A;  5KAF V;  2AIU A;  2B0Z B;  1EZV D;  5KLI B;  4LJI A;  1N50 A;  1DW0 A;  1IQC A;  3NBS A;  3GW6 A;  5CIE B;  1CYI A;  2YQB A;  3TGU D;  4H0J A;  3NBT A;  3RN1 A;  3ZOY A;  1LMS A;  1I6E A;  1LC2 A;  1SQQ D;  2GB8 B;  1MG3 D;  1HZU A;  1BGY D;  3L70 D;  3H1H D;  3PXW A;  3ORV A;  4A7P A;  3H1J D;  3RLM A;  1RZ5 A;  2N9I A;  3L73 D;  1B7V A;  3H1L D;  3ZOO A;  1NML A;  2RMZ A;  2Y0C A;  1KYO W;  4UB8 V;  1C2R A;  1JDL A;  3CXH W;  4GED B;  1M60 A;  2ZZS 1;  5CIB B;  1PPJ D;  2B4Z A;  1HRC A;  4WQA A;  1YEB A;  1I5T A;  1KB9 D;  1W5C T;  2MHM A;  1ETP A;  3O1Y A;  2CE0 A;  1NIR A;  2C1D A;  5CIF B;  2CXB A;  1RAP A;  3L75 D;  5GTH V;  3L71 D;  4FA5 A;  3OCD A;  3WFD C;  1L0N D;  1CRJ A;  4FA1 A;  4WQD A;  1VYD A;  1FI3 A;  4O1W A;  1QKS A;  2LIT A;  3C2C A;  4IL6 V;  3OA8 A;  1CIH A;  4D6T D;  1CIE A;  2MTA C;  1NU1 D;  2XTS B;  1CTY A;  3WU2 V;  4WQC A;  5KLV D;  1C7M A;  1CYJ A;  2JTI B;  1NTZ D;  5CYT R;  3ZBM A;  1H33 B;  1HZV A;  2B10 B;  1CTZ A;  2BLF B;  1GIW A;  4FAN A;  1K3H A;  1BE3 D;  5TIS V;  1CYC A;  3ZCF A;  4AX3 A;  1DT1 A;  1CO6 A;  1YNR A;  2OZ1 A;  5B66 V;  1F1C A;  2VHD A;  2AXT V;  1IRW A;  3WFB C;  1DVH A;  1HH7 A;  4FAV A;  3CP5 A;  1IRV A;  1R0Q A;  2GC7 D;  1RAQ A;  2ZBO A;  3DR0 A;  2D0W A;  1I55 A;  5KAI V;  2BPB B;  3PHL A;  4FB1 A;  4GYD A;  1H32 A;  2HV4 A;  1GDV A;  1E2R A;  1C6R A;  1PP9 D;  4K3I A;  3A0H V;  3H1I D;  1A2S A;  1C2N A;  2IBZ D;  1GJQ A;  2L91 A;  1KV9 A;  3VYM A;  1L0L D;  4Y5R A;  1C75 A;  5EXQ A;  1KX2 A;  4PWA A;  3WC8 A;  1M6Z A;  3SLE A;  5KKZ B;  4YE1 A;  5E79 V;  2PCC B;  1CHI A;  5DJQ C;  1KX7 A;  1S6V B;  3ZOW A;  1I54 A;  4N0K A;  2AI5 A;  3WFC C;  2FYN B;  3PXS A;  2DVH A;  3VMA A;  1YCC A;  1QL4 A;  1HJ5 A;  1E8E A;  4L3H A;  2QJP B;  3PLN A;  5IY5 1;  2BGV X;  2QJY B;  2BH5 X;  1FOC A;  2KS1 A;  2ZON G;  1I8O A;  3ZIY A;  1CRG A;  2B12 B;  1A8C A;  1AYG A;  3SXT A;  1SQB D;  1OAE A;  3VRD A;  2KNC B;  3CWB D;  1CCR A;  2ZOO A;  2CA3 B;  1HJ3 A;  1NNO A;  1L9B C;  3MK7 B;  4EIC A;  2RN0 A;  3PTZ A;  3X39 A;  1COR A;  1CRH A;  1YIQ A;  1HCM A;  3CYT I;  1A56 A;  2C1D B;  2N18 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...