2YIUB

X-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
228
structure length
206
Chain Sequence
DISFSFEGPFGKFDQHQLQRGLQVYTEVCSACHGLRYVPLRTLADEGGPQLPEDQVRAYAANFDITDPETEEDRPRVPTDHFPTVSGEGMGPDLSLMAKARIGGPEYIHAVLTGYDGEEKVLYHNAAFAGNWIQMAAPLSDDQVTYEDGTPATVDQMATDVAAFLMWTAEPKMMDRKQVGFVSVIFLIVLAALLYLTNKKLWQPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of the Dimeric Cytochrome Bc(1) Complex from the Soil Bacterium Paracoccus Denitrificans at 2.7-A Resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME B
total genus 59
structure length 206
sequence length 228
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2yiuB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2yiuB02
5CIFB 1LC1A 1GIWA 2BCNB 3C2CA 3PTZA 1A8CA 1HZUA 1HJ5A 4V2KA 3DMIA 1QKSA 3L74D 3VNWA 3NWVA 3CXHW 4PJ0V 2C1VA 1QL4A 1FCDC 2N9YB 3HQ6A 1J3SA 2N18C 1ZZHA 1GJQA 1YFCA 2CE0A 3A0BV 1IZL0 5B6QA 5GTIV 5CYTR 3KZIV 1AYGA 1I5TA 1CCRA 2YCCA 2B10B 2BCCD 1M60A 3SJLA 4LJIA 3VMAA 2PACA 1IQCA 2ORLA 2KNCB 1NIRA 5AURA 2ZOOA 4WQ9A 2C1DB 2N3YA 1H9XA 4AANA 5KAIV 5C0ZA 2CA4B 4A7PA 1NMLA 1E8EA 1GU2A 1CYJA 3L75D 1LMSA 1EZVD 4EIEA 1N90A 2FYUD 1BL9A 3OCDB 4WQ7A 1I8PA 155CA 1RZ5A 1H33B 1NNOA 1K3GA 2N18B 3WFEC 1GDVA 4AAOA 1AOQA 1DT1A 3RN0A 2QJPB 1DW2A 1CO6A 2QJYB 1YIQA 3HQ8A 1H33A 3PRJA 1CC5A 5B66V 2C2CA 5GTHV 4NFGB 4WQCA 4EDFA 1IO3A 1BGYD 2XTSB 1CYCA 4XYDB 3KHUA 4Y5RA 4RSZA 1CRJA 1OCDA 3X39A 2MHMA 5E79V 5TJHA 1HRCA 4PD4D 3PHLA 1H32A 1QN2A 5CIDB 3FWLA 1L9JC 3JBTB 3ZOWA 3L70D 4DY9A 3DR0A 3WFCC 3H1KD 1CEDA 1R0QA 3O5CA 1N9CA 4AAMA 1S5LV 3CXHD 3OA8B 2A06D 3RMZA 1SQVD 4EIDA 2DVHA 1YICA 2FRCA 5CICB 3PLNA 1K3HA 1MG3D 3CU4A 1H9YA 1DVVA 2KS1A 1I54A 2ZZS1 1SQBD 3WFBC 1FOCA 4L3GA 1MG2D 3PXSA 1CIGA 4AX3A 1E29A 3H1HD 1YEBA 2JWAA 1NU1D 5DFSA 1CSXA 4J20A 2FYNB 3HQ7A 3ZOOA 3TDKA 1CRCA 1EB7A 2B4ZA 2QJKB 1COTA 3GG2A 2GC4D 2JQRA 1GQ1A 2EXVA 4WQEA 1CIFA 1F1CA 2CE1A 1CTYA 4MU8A 3MK7C 4UB6V 3ZBMA 2FWLA 1CIHA 2C8SA 3HQ9A 1CORA 3ORVA 1IRVA 1H31B 2LITA 1IRWA 1OAEA 4YE1A 3L73D 3ZIYA 5DF5A 1CHJA 1HZVA 1A56A 3A0HV 4U3FD 1CNOA 1DVHA 1FI9A 4O1WA 5H2FV 2BPBB 1NTMD 1B7VA 1S6VB 1LS9A 2VHDA 4UB8V 5IY51 3RLMA 4D6TD 5KAFV 1I55A 1I6EA 2K9JB 1KV9A 5KLVD 2BH4X 1BE3D 1C7MA 1CSUA 4KMGA 1DIIC 2AIUA 2CA3B 1SQPD 1VYDA 3L71D 2Y0DA 3O20A 3ITKA 2BH5X 1L0ND 3BCCD 1CXCA 3H1ID 1CRIA 4FAVA 2V07A 3VYMA 5DJQB 3GW6A 3H1JD 2MTAC 1FHBA 5EXQA 2ZBOA 1DIQC 3WFDC 2L91A 1WVEC 3CX5W 3M97X 1ETPA 2RMZA 2O3JA 1C75A 1A2SA 1F1FA 1CSVA 4FA4A 3VRDA 2B12B 3PXTA 2L4DA 2C1DA 2C9XB 4WQ8A 2I8FA 1GKSA 3L4MA 1PPJD 2B0ZB 1JDLA 1YNRA 4FA1A 1BCCD 1KX7A 3WC8A 2DGEA 1WEJF 1LFMA 1C6OA 4GEDB 2Q3EA 5KKZB 1CRGA 1CTZA 1SQXD 1KX2A 4O1QA 3CP5A 4PWAA 1W5CT 2BLFB 5CIBB 1HH7A 1KYOD 1N15A 2OZ1A 1CXAA 3DP5A 451CA 3CYTI 3CWBD 5C9MA 3TF5A 1L9BC 2IBZD 4IL6V 1CIEA 1L0LD 3O0RC 3NBSA 1AOFA 1C2NA 5DJQC 1U75B 1CCHA 1ZRTD 4AALA 3ZCFA 1SQQD 4K3IA 4EIFA 4WQAA 3RN1A 3MK7B 1KB0A 1CSWA 2N9IA 3L4OA 2GIWA 2C1UA 4N0KA 3NBTA 2PCBB 1FJ0A 1RZ6A 1HJ3A 1LC2A 1QL3A 1I8OA 2YK3A 1CHHA 1NTKD 1KB9D 3ZOYA 2GB8B 1PP9D 2D0SA 3CX5D 1CTJA 4XXLA 1KIBA 5CIHB 4EICA 2CXBA 2Y0CA 1YCCA 3WUIA 1DW3A 4FANA 1DW1A 3WU2V 4L1QA 1HROA 1CRYA 3PH2B 1FI3A 3SVWA 1H31A 1C2RA 1P84D 1C6RA 2ZXYA 1FI7A 4FA5A 1C52A 2JTIB 1DW0A 1C6SA 1CRHA 5B5EV 1NTZD 1CYIA 2AI5A 3TYIA 3SWSA 1YEAA 4JCGA 3L72D 4FA9A 2AXTV 5TISV 4RJTA 3SXTA 1YTCA 1H32B 3O1YA 5CIEB 5KLIB 1I6DA 3H1LD 2N9JA 4P4QB 5CIGB 3PXWA 3TGUD 2YQBA 4PW9B 3A9FA 1KYOW 4WQBA 2ZONG 4H0JA 1CHIA 1U74B 4WQDA 1H1OA 2QG4A 3SLEA 1NMIA 351CA 2OZ1B 1M70A 1HCMA 3OA8A 3OCDA 4L3HA 1M6ZA 4H0KA 4FB1A 2HV4A 1AKKA 2N3BA 1N50A 2B11B 2LIRA 1QYZA 2Y0EA 2GC7D 2D0WA 2YIUB 4Q5PA 1RAQA 2RN0A 4QAOA 2PCCB 1RAPA 2BGVX 1HJ4A 4GYDA 1MZ4A 1E2RA 3ZOXA 1W2LA 2V08A
chains in the Genus database with same CATH superfamily
2JR8A 5CIFB 1GIWA 1RF1A 2BCCJ 1HJ5A 1E5WA 5CBNA 4AUWA 1DEEG 5AW4B 4NPEA 2QM7A 3CCRP 1SQQJ 2E75B 5KAIH 3RGUA 2N9YB 3H1LJ 1LTIC 1SQPJ 4XA4A 2QA4P 1BCCJ 1AVYA 3N4XA 3TGUJ 2YXRB 1W2BO 1YFCA 4H13C 1FZCA 3TGUG 3KZIV 1LNQA 2XNXA 2IFMA 2YCCA 2KOGA 2V7QH 3H1LG 2BCCD 2A06G 3A0BH 4M3LA 3I55P 2Y9ZA 3FXDA 1IFMA 1Z56A 3H1KG 2C1DB 3D6YA 1H9XA 2GUVA 1NTZG 3H1HJ 1JY2O 2YMYA 4A7PA 2FYUG 3SFEC 1SQVE 3Q1MA 1L2PA 1NTZJ 1GW4A 3Q5PA 1EZVD 3W67A 1N90A 3PH0A 3HUSA 4OVNF 1SQXE 1BL9A 3OCDB 3KZIE 5M1BA 4IFMA 1H33B 1K3GA 1W2EA 3WFEC 2KZJA 2J5UA 1AOQA 3RN0A 2MKVA 1NKZB 4BRYA 1RE3C 1JNMA 1YIQA 1QVGO 1BGYG 2CPBA 4HKZH 1PFIA 1EDKA 4H44D 3FXEA 1NO4A 4RSZA 3B4SA 2YNYA 3H1LE 3L75G 3L70E 3X39A 2IBZI 3TNUA 1HH0A 3PHLA 5CCGD 4PD4E 3H32A 3JBTB 3ZOWA 3WFCC 1OW8A 2WITA 3U1AA 1R0QA 1EZVE 4C7NA 4H13B 1S5LV 3RMZA 2WPRA 1SQVD 1YICA 2AXTH 1SQXG 3OAKA 1HGZA 3NMDA 1OFCX 3CU4A 1PGPA 2W83C 1N7SC 1SQBD 3WFBC 1FZAA 1HF9A 4L3GA 3S9OA 1KYOH 2L5GB 2OTJP 3CCVP 4HB1A 1NH4A 1QX8A 1N73B 1KORA 5KJ7D 1RF1C 2ZYAA 3CCMP 3KDPB 3H1HD 2JWAA 4L75A 1VF5D 1CSXA 3SWKA 3ZOOA 1KTMA 2ZXEB 4YPCA 2CE1A 3RK3B 1M1JB 2D2CD 1CORA 1GZLA 3M9BA 1J1DC 3B5ND 1A02F 1IRWA 1OAEA 3O6QB 1KB9H 1SQVK 1JUNA 1N7SD 2KS1B 1DVHA 4C7RA 1FI9A 1L0NJ 4O1WA 2G8YA 2YO2A 2BCCG 1KYOE 3L73E 2K1AA 5KAFV 1MZ9A 3RK3D 3MHVA 5KLVD 5AW1B 1Q86Q 1LTAC 1MUUA 1P84I 1C7MA 1CSUA 1G1JA 3L71D 2P1JA 1L0ND 3CCEP 3M91A 2V07A 3VYMA 3LW5J 2WWWA 1GD2E 2C9LY 3H1JD 5B5EE 1ZP0C 1VQ4P 4IL6E 1ETPA 1F1FA 3HE5B 3VRDA 2WT7B 2B12B 3PXTA 2YIUC 2C1DA 2HG5D 1NU1G 2R3CA 2AXCA 5AW7B 2QJYC 4K35A 1GKSA 1DX7A 1URQB 3L70G 3CXHI 3BASA 1HBWA 1LFMA 5KLVK 1C6OA 4GEDB 1QVFO 1OZHA 5KKZB 1X22A 4ZMDA 1NTMJ 1PGJA 1PL5A 1FU1A 1KX2A 3CP5A 2O1KA 1S1CX 1JY2N 1AA0A 3WUTA 1VQKP 3FWNA 3A3YB 2D2CC 3AEEC 3DP5A 3VP9A 2FXMA 1YTZI 3GHGC 4JYCA 5TISE 451CA 1RQUA 3RL0B 3TF5A 4RO0A 1L9BC 1HVVA 4AALA 3RN1A 1KB0A 1CSWA 1X79B 2NZ2A 1QL2A 2P2UA 1ZMEC 2PCBB 3V2PA 1HJ3A 1QL3A 2KP8A 2E5TA 1CHHA 1CZQA 3VMXA 2ZJSE 3AE9C 1RF1B 2D0SA 5BU5A 3CX5D 3KQGA 1FBMA 1KIBA 5CIHB 1IC2A 3H32B 3B5NB 1M57D 2OYIA 4ASVA 1JO5A 1YQ3C 2G3AA 3WU2V 1EZVG 2FXOA 1CRYA 3PH2B 3E1RA 2PAJA 3FGAD 3P32A 1C2RA 4DOJA 1C6RA 4FA5A 1C52A 2V4HA 1DW0A 3A2AA 1C6SA 1JMMA 1T8ZA 1CRHA 1KQGB 4KT0J 3F89A 3AE7C 4OGQD 2AXTV 5APWA 5TISV 4RJTA 2M5AB 3GF3A 3SXTA 3CCLP 1IFDA 2I1JA 5AW9B 5CBOA 1ZR4A 1BGYE 5CIGB 3JCUE 1URQA 3QH9A 4PW9B 2K88A 4XFJA 1S5LH 1L4AD 2WSCH 1KYOW 4H0JA 5AVTB 1NYHA 2KZIA 4WB4A 3E1IA 2A06E 5APTA 3O6QA 1HCMA 3E7KA 3V2QA 2POHA 3A0HE 4H44B 5AVWB 2FYUK 1H0TA 2H88C 1QYZA 1W5CE 4BXLA 3RK2C 2Y0EA 1X9VA 4Q5PA 5GTIH 3L75J 2E76C 3H1KJ 2BGVX 2JJLA 2PGDA 1HJ4A 2JO1A 3EQ2A 4I6MC 2Q9IA 3ZOXA 1GMJA 2O01N 4PV1D 5CCGC 2FFDB 1VF5C 3H1JG 1KILE 3C2CA 1GTWA 3H1JJ 4IOIH 3PTZA 3SFDC 1A8CA 1HZUA 2BEQD 3BCCG 3NTNA 3DMIA 1ZW0A 1QKSA 4MN4C 3M9QA 3NWVA 1JY2P 2KLVA 1NTKJ 1QL4A 4W7ZA 3P8CE 1FCDC 3MTUE 1L0LK 2I1KA 1J3SA 1G2CA 3A7OA 3D0WA 2H8PD 2CE0A 2C0WA 2Q3IA 1IZL0 5KAIE 3CLQA 2E76B 3C9IA 2FYUJ 5GTIE 2B10B 1M60A 5L8RJ 4KJMA 3H1HG 2PACA 2ORLA 2SPZA 2KYVA 5AURA 3Q2YA 1CW5A 2C9NY 3EFFK 2VRSA 4ZKPA 3A0BE 4PJ0H 1OW7A 4I7ZC 3M0DC 3CL3D 5APQA 2Z5IA 1VQMP 3IN6A 1FZFA 2GA1A 4DCKA 4WQ7A 1RZ5A 3ABVC 5APUA 1NNOA 3M0AA 5CCHC 1SFCC 2E43A 1PPJG 2QJPB 1DW2A 1GL2B 3AEAC 3HQ8A 1R5LA 1YHQP 5B66E 2A45G 4N3YB 2C2CA 5GTHV 4WQCA 4IFDK 1VQ8P 1JY3O 2HR3A 1OCDA 2QVAA 2OYIB 1NWQA 2J59M 2Z4EA 3BRVB 4R4LA 2AEFA 3FWLA 1NTMK 3B5NA 3DR0A 2PFXA 3VMZA 4Y28J 3O5CA 4JPZB 1RE4C 1N9CA 2OYHB 3I5CA 2DVHA 3KPEA 1PZQA 4WY4D 2H43A 3MUDA 2QSIA 1H9YA 5B66H 5BVZA 1FDMA 1CIGA 3V6IA 3HE4A 2KLUA 3HD7C 3RBXA 3HRNA 5DFSA 2WZ7A 3VMYA 4J20A 3HQ7A 3BATA 1CRCA 3L74G 1COTA 4N78D 1CIFA 2YXQB 2NRGA 2FWLA 1MFZA 2FBWC 1CI6A 1KFNA 2YKPA 3ORVA 1H31B 1KQSO 4BWNA 2QEXP 3M9HA 4I7ZB 4YE1A 4WY4C 5DF5A 1H8AA 3JC22 1FOSE 3CD6P 4JQ0D 1HZVA 1LT9C 3H1JE 2JP3A 3A0HV 4U3FD 2E74B 1GL2D 1JOCA 1ZLLA 1L4AB 3G4SP 4ZNCA 1S6VB 1LS9A 2KSJA 4UB8V 3RLMA 2ZYGA 1NTKK 2HPCB 2K9JB 1OXZA 1NAYA 4UB8E 4KMGA 1DIIC 3HUSC 2XU6A 4JF7A 1SQPD 3O20A 2BH5X 1XTGB 2KUBA 3BCCD 1CXCA 5CCHA 4FAVA 3IAOA 3VYIA 2W6AA 1FHBA 2PRRA 1M1JA 1DIQC 4L74A 2L91A 1WVEC 3CX5W 3V4QA 3B8EB 1S2EA 4KHXA 1A2SA 4RESB 1CSVA 3G71P 4FA4A 1LP1B 1M90Q 2L4DA 2OTLP 3AE1C 1K8AQ 1SQPK 2C0XA 3N7NA 5APVA 1Q2NA 1ZN5A 5APXA 1T3JA 2DGEA 2WVRA 3G3ZA 3M0DA 3AECC 2M5AA 1PP9G 1CRGA 1KILB 1S9KD 2K37A 3MIWA 4AQRD 1SQXD 4UB6H 5AW8B 1W5CT 4L73A 3K5BA 1RQVA 1SQBE 5AVQB 1RH5B 2OZ1A 3RL0D 5BU8B 1S5LE 1HUCA 2B9BA 2FY8A 2BASA 3CYTI 4IL6V 4Y99C 4D6TJ 3O0RC 3NBSA 1AOFA 3CX5I 5DJQC 1U75B 1RE4A 2B87A 1CCHA 1T6AA 2GM4A 3TGUE 5TISH 1K04A 4EIFA 4WQAA 4EIJA 2V7QJ 2N9IA 1WMKA 3L4OA 3NBTA 1KMIZ 1MV8A 3P7KA 5E79E 1UIXA 2YMKA 1KB9D 2M0BA 3PP5A 2ZVOB 1VDFA 1ZV8A 1PP9D 2ZT9D 4U3FE 3S1KA 4EICA 2CXBA 1YCCA 4YXWH 1BCCG 4WVZA 1SQPG 3HUSB 1VQ6P 4L1QA 5KAFE 1FI3A 3SVWA 1DIPA 1H31A 4GIFA 3R2PA 4W7YA 2Z5HA 4HJGH 3CXHE 2RKLA 4DJGA 1NTZD 1QGKB 3SWSA 4JCGA 3D71A 4C46A 1LT9B 3WMM0 3O1YA 5KLIB 2N9JA 4H44C 2QJKC 3IF4A 3T97A 4H0LB 1LTJA 4WQBA 2HODA 1CI6B 1CHIA 1BE3G 2IBZE 4WQDA 1UIIA 2MJZA 3VTPC 1NMIA 351CA 1M70A 4U7JA 1T2KC 2KXPB 3WU2E 1LP1A 1M6ZA 4H0KA 2CPSA 3BVHA 4FB1A 3L35A 2IX7C 3U59A 2YIUB 1M8OB 1RAQA 2RN0A 5KLVG 2QE7H 3L70J 5AVVB 1NJIQ 1NTMG 1FDIA 2R5BA 1LC1A 2BCNB 2JEEA 2A45H 2P10A 3V2RA 2ZT9C 3MD0A 3CXHW 3LIEA 3G6EP 3CMAP 2OYIC 1S9KE 1YJWP 3IFMA 1OVRA 2N18C 1LWUB 1GJQA 1S4XA 1FZCB 1LTGC 3SWFA 2N1TC 4OWFA 5CYTR 2WPQA 2KB7P 1AYGA 2KK7A 1KD1Q 2IFNA 1GL2C 1HTLC 3RL0g 2WSSH 1IQCA 3VOPA 1AV1A 1NIRA 3AEGC 2ZOOA 3KZIH 2KI7B 5KAIV 3GHGB 2FFDA 2CA4B 1GK6A 1YI2P 1NMLA 3AEDC 1E8EA 1GU2A 1J1DB 1CYJA 3PJSK 1LMSA 1PGQA 3MGNA 2DW3A 1SQVG 3QWOC 1OVUA 2UWJE 2FYUD 4WWIA 1FZCC 1FZGA 2N18B 1LWUC 2LXBA 1SVFA 4HYTB 3LIDA 3L74E 4WBAA 2QJYB 4OGQC 1KILD 3OW2O 4PD4H 1H33A 1LT1A 3PRJA 1N7SB 2IZ0A 1N7SA 3KYQA 3L72J 1G1IA 2XNDH 1RHZB 4NFGB 3KXDA 4EDFA 5KJ7C 1IO3A 2XTSB 4O9BA 1CYCA 3KHUA 4Y5RA 2GUSA 2MHMA 5E79V 1JTHB 4R4MA 1H32A 4EOTA 4Z1MH 3CCUP 1L9JC 1PIXA 4DY9A 3H1KD 2LXCB 1CEDA 1MKMA 2N1TB 3CPWO 4QMAA 1VF5B 1L0LE 1N2DC 1NTKG 1OIPA 1SLQA 3CXHD 4LGDE 2A06D 2BEZF 1SFCD 3I56P 4EIDA 1FZBA 1NU1E 1J2JB 2IYPA 3SSUA 4C7NB 3PLNA 1K3HA 2ZZS1 4RKUJ 1FOCA 1JMBA 2N1TD 2NPSA 1EDIA 5EFWB 1MG2D 3RK2B 3PXSA 4AX3A 1NTME 1LJ2A 2P58A 5APYA 1BSNA 2XDJA 2QIWA 3R4YA 1J1EC 2BCCE 1Q82Q 1KB9E 2AEJA 2B4ZA 2QJKB 2GC4D 5KLIC 5AVZB 1GQ1A 1OW6A 3L71E 1YYCA 3MK7C 5CHXA 2XKMA 1CIHA 2M3EA 2C8SA 3HQ9A 1DD3A 3HTKA 4CPGA 1GW3A 1IRVA 2LITA 1S3JA 3AE6C 3L73D 1JB0J 2E42A 3ZIYA 1JCDA 4XE5B 4D6TE 1VQPP 1K05A 1N7LA 3TK1A 1DD4A 3SWYA 1H0TB 1VQ9P 5H2FV 1N73C 1B7VA 1JY3N 1EXIA 2VHDA 4D6TD 5AW0B 1YJNP 2FKWB 3GF7A 5B5EH 3EWKA 1KV9A 2BH4X 1JEKA 4NPFX 1BE3D 4IL6H 2AIUA 4N6JA 2CA3B 1GK4A 1AQ5A 1KILA 1FS0E 1FAVA 2KSEA 3H1IG 3B5NC 3ITKA 3CMEP 2R32A 1BDCA 1LWUA 3H1ID 1PPJE 2Q5UA 1VQNP 5DJQB 3WUUA 4H13D 2ZBOA 5CMZA 2O1JA 1VQ7P 1YIJP 1BE3J 1C75A 4D6TG 2IYOA 5KJ7A 1Q81Q 2OTKE 1L0NK 4WQ8A 1SQXK 1NOHA 1SQQG 2I8FA 1U57A 3L4MA 1XTCC 1FOSF 1JDLA 1YNRA 1BCCD 1KX7A 3HD7D 1WEJF 1OX3A 1J1EB 2D2CB 2Q3EA 3JSVC 2HFED 1CTZA 2W8ZA 4O1QA 2IPPA 2BLFB 5CIBB 5AVRB 1FZEA 1ZOYC 5KKZC 1QEXA 1H88A 5K5GB 1EDLA 3B71A 4UB6E 2LR2A 2FYNC 4EYYQ 5AW6B 2IBZD 1LTTC 1CIEA 3C8VA 4GODA 2HYNA 3D6ZA 1C2NA 1HJ0A 2J58A 5H2FE 2K3RA 2K9YA 2NPSB 1FDOA 2WSFH 3V4WA 3MK7B 2P7JA 5C39A 1P84H 2C1UA 4H0LD 1BE3E 3EFGA 1NAFA 1NU1J 2Q6QA 1FJ0A 1RZ6A 2YK3A 1NTKD 1VPCA 3T97B 3OJAB 1CTJA 1KZUB 4XXLA 2W27A 2LKMA 1KN7A 1AJYA 1NTZK 1SQBK 1L4AC 1USDA 2Q1KA 3L71G 1USEA 5AW2B 4FANA 2E74C 3MZWB 1DW1A 1RF0C 4GDOA 3A5TA 1NKNA 1BDDA 1FJPA 2ZYDA 1A02J 1P84D 3JCUH 2JTIB 1D7MA 5CCHD 3Q5RA 5KAFH 1PP9J 3CCJP 3L72D 4I1LA 3CXHH 2B89A 1P84E 5AVUB 5CCGA 5CIEB 3A0HH 1RY3A 2H89C 2AEMA 1NU1K 3L73G 3TGUD 4EI2A 4IFFA 3A9FA 3HD7B 1M1JC 1ZR2A 1H1OA 4DT0A 2QG4A 1PGOA 1Q7YQ 4YXDC 2OZ1B 3OA8A 3OCDA 4L3HA 1SQPE 2HLOA 1L0NG 1Y8AA 3H1KE 2LIRA 5AVYB 4JBZA 4BRYB 2Q7CA 4GOEA 2D0WA 3AE2C 1R5SA 1N8RQ 5AVXB 1E79H 2W90A 4QAOA 1RAPA 2PP6A 1N86A 2R3SA 1MZ4A 2ZAEB 3L37A 1PP9E 1W2LA 2V08A 3H1HE 2HPCA 1R8EA 1EDJA 1LTJB 2R44A 1KQLA 4V2KA 3L74D 3VNWA 2WTYA 4PJ0V 3H25A 2C1VA 3WUVA 1WRGA 5CJ4A 3HQ6A 1DH3A 1ZZHA 2E74D 4PJ0E 3A0BV 1SQVJ 5B6QA 5GTIV 1I5TA 3P8CD 1CCRA 2ZT9B 1EZVI 1RE3A 3SJLA 2WPSA 4LJIA 2NPSD 3VMAA 4U3FG 2KNCB 4WQ9A 3W68A 2N3YA 1T3UA 3GLMA 1LGHB 4AANA 1OVVA 5C0ZA 1Q90D 2IDBA 3IR9A 2JDIH 3AEFC 3L73J 3L75D 1NHLA 5APSA 3HTKB 2WPVB 4EIEA 1U7JA 1SFCB 1BGYJ 2P67A 1I8PA 155CA 1SQQE 1JY3P 1ZRTE 1GDVA 4AAOA 1DT1A 3RK3E 4JYBA 1KQFB 1CO6A 3MUDC 3CWBG 2K9JA 1SQBG 4H0LC 3BRTB 1CC5A 5B66V 1GL2A 3L71J 2ZFCA 1CSBA 3BCCE 4NPDA 3HD7A 2FFDC 3CC2P 2M8RA 1QLED 1BGYD 1U7MA 2CK3H 2A45I 4XYDB 3ZDMA 1CRJA 5KLVJ 1FC2C 2E75C 5TJHA 1HRCA 4PV1C 4PD4D 1QN2A 2E5YA 2IBZG 1YITP 5CIDB 1Y9BA 1NGMB 3L70D 1FE6A 1VQOP 2H7HA 2QM8A 2OYHA 3L72E 3LW5H 4AAMA 3OA8B 2R5DA 3MP7B 4W80A 1FJKA 3L75E 1OWAA 2FRCA 5CICB 1MG3D 1DVVA 2KS1A 1I54A 2WT7A 1SS1A 1JM0A 3G9RA 2O01J 2B87B 2XV5A 1E29A 2KIKA 1YEBA 1NU1D 2FYNB 1ZXGA 3TDKA 1EB7A 3GG2A 2JQRA 3CWBJ 3NFQA 2EXVA 4WQEA 1IK9A 1F1CA 1IO4A 1CTYA 4HH2A 4MU8A 4UB6V 3ZBMA 2WMMA 3NXSA 2IZ1A 1YQ4C 1SQQK 4GOFA 5AW5B 2N1TA 1SQBJ 3AE3C 1AQTA 4Y99B 2HODB 4GKGA 2O01H 1CHJA 1T2KD 2JKVA 1A56A 3OA7A 1SFCA 1PV3A 4PD4I 1K73Q 1CNOA 3BCCJ 3H1IJ 2BPBB 1K9MQ 4DZOA 1NTMD 1KILC 5IY51 3D70A 1KYOI 1M7LA 1I55A 1I6EA 3TNUB 3RBZA 2XZRA 2WSEH 3C1LA 1X8YA 1IFJA 2FYZA 3V2NA 1VYDA 3AE5C 2Y0DA 2AXTE 4U3FJ 1G2CB 1CRIA 1KFMA 2YKQA 4N78E 4PV1B 3GW6A 1AFOA 2MTAC 5EXQA 1KC8Q 3WFDC 3CX5H 4TLFA 3RL0C 1M56D 4UB8H 3M97X 4WY4A 4WY4B 2RMZA 1N73A 2O3JA 1HWTC 1KB9I 3L36A 3P8MC 2OQQA 4TT3H 1LT9A 2ZVNB 2WSEJ 5CJ0A 3M06A 1JCCA 3CCSP 2C9XB 1TU3F 1QL1A 4AYCA 3II6A 1L0NE 4OH8B 3VN0A 2W6BA 1BSHA 1PPJD 2B0ZB 5AW3B 4FA1A 2E76D 4ASWA 3L72G 3AEBC 3TSIA 1IFPA 3WC8A 3S4RA 4LC1A 1URQC 2W6JH 1YTZT 1MFTA 4PWAA 1AVOA 2WSCJ 1HH7A 2QRXA 1SP4A 1KYOD 1N15A 2OARA 1KV4A 1CXAA 2I8DA 3FX0A 3VP8A 1L0LJ 3CX5E 4YTPC 5E79H 1IFNA 3CWBD 5C9MA 2JWDA 1HGVA 1L0LD 2OYHC 3HE4B 1L0LG 1NTKE 1ZRTD 3ZCFA 1SQQD 3GMAA 4K3IA 5DJTB 1IZNB 3GHGA 2OGUA 3HE5A 1WT6A 2GIWA 2RH0A 4N0KA 2ITAA 1X0TA 5H2FH 3V5BA 1L4AA 1GDTA 2WQYC 1URQD 1LC2A 1I8OA 1IK7A 3ZOYA 2GB8B 4I2LC 3TYYA 3O8ZA 5DJUB 3CCQP 2B88A 4ZKUA 2Y0CA 1LTBC 1LTJC 3WUIA 1S5LX 2YO3A 1JTHA 1Y47A 4B86A 1DW3A 1VQ5P 1HROA 1VL2A 3AE4C 1OMIA 3CI9A 1M1KQ 2ZXYA 1FI7A 3AE8C 3H6PA 2OYOA 5AVSB 1YJ9P 5B5EV 5GTHE 2NPSC 1CYIA 2AI5A 3TYIA 2Y9YA 1BCCE 1YEAA 1GU4A 4FA9A 4L76A 3RK2D 3RK3C 4OGQB 3CWBE 3L74J 2KNCA 3L4FA 3UIAA 1NVOA 1YTCA 3U1CA 1H32B 1I6DA 3H1LD 3F5HA 1LTSC 1VQLP 1EXJA 4P4QB 3PXWA 2N9BA 2YQBA 1EQ7A 4LLHA 3CC4P 1HJBA 4IL6X 2ZONG 3Q3DA 1U74B 1IJDB 3CC7P 2QJPC 3SLEA 4K3AA 1DEBA 1GU5A 2M3BA 3H1IE 1YBKA 1EC5A 2WSFJ 3Q5SA 2FXPA 2HV4A 1AKKA 2N3BA 1N50A 2B11B 5KLVE 2YKOA 5GTHH 1SQXJ 2GC7D 2FYUE 5KTBA 2PCCB 4GT1A 1S72P 1IFIA 4GYDA 1NTZE 2ZXXA 3WU2H 1H89A 1E2RA 2E75D 3USSA 1RF0A
chains in the Genus database with same CATH topology
5CIFB 1LC1A 1GIWA 2BCNB 3C2CA 3PTZA 1A8CA 1HZUA 1HJ5A 4V2KA 3DMIA 1QKSA 3L74D 3VNWA 3NWVA 3CXHW 4PJ0V 2C1VA 1QL4A 1FCDC 2N9YB 3HQ6A 1J3SA 2N18C 1ZZHA 1GJQA 1YFCA 2CE0A 3A0BV 1IZL0 5B6QA 5GTIV 5CYTR 3KZIV 1AYGA 1I5TA 1CCRA 2YCCA 2B10B 2BCCD 1M60A 3SJLA 4LJIA 3VMAA 2PACA 1IQCA 2ORLA 2KNCB 1NIRA 5AURA 2ZOOA 4WQ9A 2C1DB 2N3YA 1H9XA 4AANA 5KAIV 5C0ZA 2CA4B 4A7PA 1NMLA 1E8EA 1GU2A 1CYJA 3L75D 1LMSA 1EZVD 4EIEA 1N90A 2FYUD 1BL9A 3OCDB 4WQ7A 1I8PA 155CA 1RZ5A 1H33B 1NNOA 1K3GA 2N18B 3WFEC 1GDVA 4AAOA 1AOQA 1DT1A 3RN0A 2QJPB 1DW2A 1CO6A 2QJYB 1YIQA 3HQ8A 1H33A 3PRJA 1CC5A 5B66V 2C2CA 5GTHV 4NFGB 4WQCA 4EDFA 1IO3A 1BGYD 2XTSB 1CYCA 4XYDB 3KHUA 4Y5RA 4RSZA 1CRJA 1OCDA 3X39A 2MHMA 5E79V 5TJHA 1HRCA 4PD4D 3PHLA 1H32A 1QN2A 5CIDB 3FWLA 1L9JC 3JBTB 3ZOWA 3L70D 4DY9A 3DR0A 3WFCC 3H1KD 1CEDA 1R0QA 3O5CA 1N9CA 4AAMA 1S5LV 3CXHD 3OA8B 2A06D 3RMZA 1SQVD 4EIDA 2DVHA 1YICA 2FRCA 5CICB 3PLNA 1K3HA 1MG3D 3CU4A 1H9YA 1DVVA 2KS1A 1I54A 2ZZS1 1SQBD 3WFBC 1FOCA 4L3GA 1MG2D 3PXSA 1CIGA 4AX3A 1E29A 3H1HD 1YEBA 2JWAA 1NU1D 5DFSA 1CSXA 4J20A 2FYNB 3HQ7A 3ZOOA 3TDKA 1CRCA 1EB7A 2B4ZA 2QJKB 1COTA 3GG2A 2GC4D 2JQRA 1GQ1A 2EXVA 4WQEA 1CIFA 1F1CA 2CE1A 1CTYA 4MU8A 3MK7C 4UB6V 3ZBMA 2FWLA 1CIHA 2C8SA 3HQ9A 1CORA 3ORVA 1IRVA 1H31B 2LITA 1IRWA 1OAEA 4YE1A 3L73D 3ZIYA 5DF5A 1CHJA 1HZVA 1A56A 3A0HV 4U3FD 1CNOA 1DVHA 1FI9A 4O1WA 5H2FV 2BPBB 1NTMD 1B7VA 1S6VB 1LS9A 2VHDA 4UB8V 5IY51 3RLMA 4D6TD 5KAFV 1I55A 1I6EA 2K9JB 1KV9A 5KLVD 2BH4X 1BE3D 1C7MA 1CSUA 4KMGA 1DIIC 2AIUA 2CA3B 1SQPD 1VYDA 3L71D 2Y0DA 3O20A 3ITKA 2BH5X 1L0ND 3BCCD 1CXCA 3H1ID 1CRIA 4FAVA 2V07A 3VYMA 5DJQB 3GW6A 3H1JD 2MTAC 1FHBA 5EXQA 2ZBOA 1DIQC 3WFDC 2L91A 1WVEC 3CX5W 3M97X 1ETPA 2RMZA 2O3JA 1C75A 1A2SA 1F1FA 1CSVA 4FA4A 3VRDA 2B12B 3PXTA 2L4DA 2C1DA 2C9XB 4WQ8A 2I8FA 1GKSA 3L4MA 1PPJD 2B0ZB 1JDLA 1YNRA 4FA1A 1BCCD 1KX7A 3WC8A 2DGEA 1WEJF 1LFMA 1C6OA 4GEDB 2Q3EA 5KKZB 1CRGA 1CTZA 1SQXD 1KX2A 4O1QA 3CP5A 4PWAA 1W5CT 2BLFB 5CIBB 1HH7A 1KYOD 1N15A 2OZ1A 1CXAA 3DP5A 451CA 3CYTI 3CWBD 5C9MA 3TF5A 1L9BC 2IBZD 4IL6V 1CIEA 1L0LD 3O0RC 3NBSA 1AOFA 1C2NA 5DJQC 1U75B 1CCHA 1ZRTD 4AALA 3ZCFA 1SQQD 4K3IA 4EIFA 4WQAA 3RN1A 3MK7B 1KB0A 1CSWA 2N9IA 3L4OA 2GIWA 2C1UA 4N0KA 3NBTA 2PCBB 1FJ0A 1RZ6A 1HJ3A 1LC2A 1QL3A 1I8OA 2YK3A 1CHHA 1NTKD 1KB9D 3ZOYA 2GB8B 1PP9D 2D0SA 3CX5D 1CTJA 4XXLA 1KIBA 5CIHB 4EICA 2CXBA 2Y0CA 1YCCA 3WUIA 1DW3A 4FANA 1DW1A 3WU2V 4L1QA 1HROA 1CRYA 3PH2B 1FI3A 3SVWA 1H31A 1C2RA 1P84D 1C6RA 2ZXYA 1FI7A 4FA5A 1C52A 2JTIB 1DW0A 1C6SA 1CRHA 5B5EV 1NTZD 1CYIA 2AI5A 3TYIA 3SWSA 1YEAA 4JCGA 3L72D 4FA9A 2AXTV 5TISV 4RJTA 3SXTA 1YTCA 1H32B 3O1YA 5CIEB 5KLIB 1I6DA 3H1LD 2N9JA 4P4QB 5CIGB 3PXWA 3TGUD 2YQBA 4PW9B 3A9FA 1KYOW 4WQBA 2ZONG 4H0JA 1CHIA 1U74B 4WQDA 1H1OA 2QG4A 3SLEA 1NMIA 351CA 2OZ1B 1M70A 1HCMA 3OA8A 3OCDA 4L3HA 1M6ZA 4H0KA 4FB1A 2HV4A 1AKKA 2N3BA 1N50A 2B11B 2LIRA 1QYZA 2Y0EA 2GC7D 2D0WA 2YIUB 4Q5PA 1RAQA 2RN0A 4QAOA 2PCCB 1RAPA 2BGVX 1HJ4A 4GYDA 1MZ4A 1E2RA 3ZOXA 1W2LA 2V08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CIF B;  1LC1 A;  1GIW A;  2BCN B;  3C2C A;  3PTZ A;  1A8C A;  1HZU A;  1HJ5 A;  4V2K A;  3DMI A;  1QKS A;  3L74 D;  3VNW A;  3NWV A;  3CXH W;  4PJ0 V;  2C1V A;  1QL4 A;  1FCD C;  2N9Y B;  3HQ6 A;  1J3S A;  2N18 C;  1ZZH A;  1GJQ A;  1YFC A;  2CE0 A;  3A0B V;  1IZL 0;  5B6Q A;  5GTI V;  5CYT R;  3KZI V;  1AYG A;  1I5T A;  1CCR A;  2YCC A;  2B10 B;  2BCC D;  1M60 A;  3SJL A;  4LJI A;  3VMA A;  2PAC A;  1IQC A;  2ORL A;  2KNC B;  1NIR A;  5AUR A;  2ZOO A;  4WQ9 A;  2C1D B;  2N3Y A;  1H9X A;  4AAN A;  5KAI V;  5C0Z A;  2CA4 B;  4A7P A;  1NML A;  1E8E A;  1GU2 A;  1CYJ A;  3L75 D;  1LMS A;  1EZV D;  4EIE A;  1N90 A;  2FYU D;  1BL9 A;  3OCD B;  4WQ7 A;  1I8P A;  155C A;  1RZ5 A;  1H33 B;  1NNO A;  1K3G A;  2N18 B;  3WFE C;  1GDV A;  4AAO A;  1AOQ A;  1DT1 A;  3RN0 A;  2QJP B;  1DW2 A;  1CO6 A;  2QJY B;  1YIQ A;  3HQ8 A;  1H33 A;  3PRJ A;  1CC5 A;  5B66 V;  2C2C A;  5GTH V;  4NFG B;  4WQC A;  4EDF A;  1IO3 A;  1BGY D;  2XTS B;  1CYC A;  4XYD B;  3KHU A;  4Y5R A;  4RSZ A;  1CRJ A;  1OCD A;  3X39 A;  2MHM A;  5E79 V;  5TJH A;  1HRC A;  4PD4 D;  3PHL A;  1H32 A;  1QN2 A;  5CID B;  3FWL A;  1L9J C;  3JBT B;  3ZOW A;  3L70 D;  4DY9 A;  3DR0 A;  3WFC C;  3H1K D;  1CED A;  1R0Q A;  3O5C A;  1N9C A;  4AAM A;  1S5L V;  3CXH D;  3OA8 B;  2A06 D;  3RMZ A;  1SQV D;  4EID A;  2DVH A;  1YIC A;  2FRC A;  5CIC B;  3PLN A;  1K3H A;  1MG3 D;  3CU4 A;  1H9Y A;  1DVV A;  2KS1 A;  1I54 A;  2ZZS 1;  1SQB D;  3WFB C;  1FOC A;  4L3G A;  1MG2 D;  3PXS A;  1CIG A;  4AX3 A;  1E29 A;  3H1H D;  1YEB A;  2JWA A;  1NU1 D;  5DFS A;  1CSX A;  4J20 A;  2FYN B;  3HQ7 A;  3ZOO A;  3TDK A;  1CRC A;  1EB7 A;  2B4Z A;  2QJK B;  1COT A;  3GG2 A;  2GC4 D;  2JQR A;  1GQ1 A;  2EXV A;  4WQE A;  1CIF A;  1F1C A;  2CE1 A;  1CTY A;  4MU8 A;  3MK7 C;  4UB6 V;  3ZBM A;  2FWL A;  1CIH A;  2C8S A;  3HQ9 A;  1COR A;  3ORV A;  1IRV A;  1H31 B;  2LIT A;  1IRW A;  1OAE A;  4YE1 A;  3L73 D;  3ZIY A;  5DF5 A;  1CHJ A;  1HZV A;  1A56 A;  3A0H V;  4U3F D;  1CNO A;  1DVH A;  1FI9 A;  4O1W A;  5H2F V;  2BPB B;  1NTM D;  1B7V A;  1S6V B;  1LS9 A;  2VHD A;  4UB8 V;  5IY5 1;  3RLM A;  4D6T D;  5KAF V;  1I55 A;  1I6E A;  2K9J B;  1KV9 A;  5KLV D;  2BH4 X;  1BE3 D;  1C7M A;  1CSU A;  4KMG A;  1DII C;  2AIU A;  2CA3 B;  1SQP D;  1VYD A;  3L71 D;  2Y0D A;  3O20 A;  3ITK A;  2BH5 X;  1L0N D;  3BCC D;  1CXC A;  3H1I D;  1CRI A;  4FAV A;  2V07 A;  3VYM A;  5DJQ B;  3GW6 A;  3H1J D;  2MTA C;  1FHB A;  5EXQ A;  2ZBO A;  1DIQ C;  3WFD C;  2L91 A;  1WVE C;  3CX5 W;  3M97 X;  1ETP A;  2RMZ A;  2O3J A;  1C75 A;  1A2S A;  1F1F A;  1CSV A;  4FA4 A;  3VRD A;  2B12 B;  3PXT A;  2L4D A;  2C1D A;  2C9X B;  4WQ8 A;  2I8F A;  1GKS A;  3L4M A;  1PPJ D;  2B0Z B;  1JDL A;  1YNR A;  4FA1 A;  1BCC D;  1KX7 A;  3WC8 A;  2DGE A;  1WEJ F;  1LFM A;  1C6O A;  4GED B;  2Q3E A;  5KKZ B;  1CRG A;  1CTZ A;  1SQX D;  1KX2 A;  4O1Q A;  3CP5 A;  4PWA A;  1W5C T;  2BLF B;  5CIB B;  1HH7 A;  1KYO D;  1N15 A;  2OZ1 A;  1CXA A;  3DP5 A;  451C A;  3CYT I;  3CWB D;  5C9M A;  3TF5 A;  1L9B C;  2IBZ D;  4IL6 V;  1CIE A;  1L0L D;  3O0R C;  3NBS A;  1AOF A;  1C2N A;  5DJQ C;  1U75 B;  1CCH A;  1ZRT D;  4AAL A;  3ZCF A;  1SQQ D;  4K3I A;  4EIF A;  4WQA A;  3RN1 A;  3MK7 B;  1KB0 A;  1CSW A;  2N9I A;  3L4O A;  2GIW A;  2C1U A;  4N0K A;  3NBT A;  2PCB B;  1FJ0 A;  1RZ6 A;  1HJ3 A;  1LC2 A;  1QL3 A;  1I8O A;  2YK3 A;  1CHH A;  1NTK D;  1KB9 D;  3ZOY A;  2GB8 B;  1PP9 D;  2D0S A;  3CX5 D;  1CTJ A;  4XXL A;  1KIB A;  5CIH B;  4EIC A;  2CXB A;  2Y0C A;  1YCC A;  3WUI A;  1DW3 A;  4FAN A;  1DW1 A;  3WU2 V;  4L1Q A;  1HRO A;  1CRY A;  3PH2 B;  1FI3 A;  3SVW A;  1H31 A;  1C2R A;  1P84 D;  1C6R A;  2ZXY A;  1FI7 A;  4FA5 A;  1C52 A;  2JTI B;  1DW0 A;  1C6S A;  1CRH A;  5B5E V;  1NTZ D;  1CYI A;  2AI5 A;  3TYI A;  3SWS A;  1YEA A;  4JCG A;  3L72 D;  4FA9 A;  2AXT V;  5TIS V;  4RJT A;  3SXT A;  1YTC A;  1H32 B;  3O1Y A;  5CIE B;  5KLI B;  1I6D A;  3H1L D;  2N9J A;  4P4Q B;  5CIG B;  3PXW A;  3TGU D;  2YQB A;  4PW9 B;  3A9F A;  1KYO W;  4WQB A;  2ZON G;  4H0J A;  1CHI A;  1U74 B;  4WQD A;  1H1O A;  2QG4 A;  3SLE A;  1NMI A;  351C A;  2OZ1 B;  1M70 A;  1HCM A;  3OA8 A;  3OCD A;  4L3H A;  1M6Z A;  4H0K A;  4FB1 A;  2HV4 A;  1AKK A;  2N3B A;  1N50 A;  2B11 B;  2LIR A;  1QYZ A;  2Y0E A;  2GC7 D;  2D0W A;  2YIU B;  4Q5P A;  1RAQ A;  2RN0 A;  4QAO A;  2PCC B;  1RAP A;  2BGV X;  1HJ4 A;  4GYD A;  1MZ4 A;  1E2R A;  3ZOX A;  1W2L A;  2V08 A; 
#chains in the Genus database with same CATH topology
 2JR8 A;  5CIF B;  1GIW A;  1RF1 A;  2BCC J;  1HJ5 A;  1E5W A;  5CBN A;  4AUW A;  1DEE G;  5AW4 B;  4NPE A;  2QM7 A;  3CCR P;  1SQQ J;  2E75 B;  5KAI H;  3RGU A;  2N9Y B;  3H1L J;  1LTI C;  1SQP J;  4XA4 A;  2QA4 P;  1BCC J;  1AVY A;  3N4X A;  3TGU J;  2YXR B;  1W2B O;  1YFC A;  4H13 C;  1FZC A;  3TGU G;  3KZI V;  1LNQ A;  2XNX A;  2IFM A;  2YCC A;  2KOG A;  2V7Q H;  3H1L G;  2BCC D;  2A06 G;  3A0B H;  4M3L A;  3I55 P;  2Y9Z A;  3FXD A;  1IFM A;  1Z56 A;  3H1K G;  2C1D B;  3D6Y A;  1H9X A;  2GUV A;  1NTZ G;  3H1H J;  1JY2 O;  2YMY A;  4A7P A;  2FYU G;  3SFE C;  1SQV E;  3Q1M A;  1L2P A;  1NTZ J;  1GW4 A;  3Q5P A;  1EZV D;  3W67 A;  1N90 A;  3PH0 A;  3HUS A;  4OVN F;  1SQX E;  1BL9 A;  3OCD B;  3KZI E;  5M1B A;  4IFM A;  1H33 B;  1K3G A;  1W2E A;  3WFE C;  2KZJ A;  2J5U A;  1AOQ A;  3RN0 A;  2MKV A;  1NKZ B;  4BRY A;  1RE3 C;  1JNM A;  1YIQ A;  1QVG O;  1BGY G;  2CPB A;  4HKZ H;  1PFI A;  1EDK A;  4H44 D;  3FXE A;  1NO4 A;  4RSZ A;  3B4S A;  2YNY A;  3H1L E;  3L75 G;  3L70 E;  3X39 A;  2IBZ I;  3TNU A;  1HH0 A;  3PHL A;  5CCG D;  4PD4 E;  3H32 A;  3JBT B;  3ZOW A;  3WFC C;  1OW8 A;  2WIT A;  3U1A A;  1R0Q A;  1EZV E;  4C7N A;  4H13 B;  1S5L V;  3RMZ A;  2WPR A;  1SQV D;  1YIC A;  2AXT H;  1SQX G;  3OAK A;  1HGZ A;  3NMD A;  1OFC X;  3CU4 A;  1PGP A;  2W83 C;  1N7S C;  1SQB D;  3WFB C;  1FZA A;  1HF9 A;  4L3G A;  3S9O A;  1KYO H;  2L5G B;  2OTJ P;  3CCV P;  4HB1 A;  1NH4 A;  1QX8 A;  1N73 B;  1KOR A;  5KJ7 D;  1RF1 C;  2ZYA A;  3CCM P;  3KDP B;  3H1H D;  2JWA A;  4L75 A;  1VF5 D;  1CSX A;  3SWK A;  3ZOO A;  1KTM A;  2ZXE B;  4YPC A;  2CE1 A;  3RK3 B;  1M1J B;  2D2C D;  1COR A;  1GZL A;  3M9B A;  1J1D C;  3B5N D;  1A02 F;  1IRW A;  1OAE A;  3O6Q B;  1KB9 H;  1SQV K;  1JUN A;  1N7S D;  2KS1 B;  1DVH A;  4C7R A;  1FI9 A;  1L0N J;  4O1W A;  2G8Y A;  2YO2 A;  2BCC G;  1KYO E;  3L73 E;  2K1A A;  5KAF V;  1MZ9 A;  3RK3 D;  3MHV A;  5KLV D;  5AW1 B;  1Q86 Q;  1LTA C;  1MUU A;  1P84 I;  1C7M A;  1CSU A;  1G1J A;  3L71 D;  2P1J A;  1L0N D;  3CCE P;  3M91 A;  2V07 A;  3VYM A;  3LW5 J;  2WWW A;  1GD2 E;  2C9L Y;  3H1J D;  5B5E E;  1ZP0 C;  1VQ4 P;  4IL6 E;  1ETP A;  1F1F A;  3HE5 B;  3VRD A;  2WT7 B;  2B12 B;  3PXT A;  2YIU C;  2C1D A;  2HG5 D;  1NU1 G;  2R3C A;  2AXC A;  5AW7 B;  2QJY C;  4K35 A;  1GKS A;  1DX7 A;  1URQ B;  3L70 G;  3CXH I;  3BAS A;  1HBW A;  1LFM A;  5KLV K;  1C6O A;  4GED B;  1QVF O;  1OZH A;  5KKZ B;  1X22 A;  4ZMD A;  1NTM J;  1PGJ A;  1PL5 A;  1FU1 A;  1KX2 A;  3CP5 A;  2O1K A;  1S1C X;  1JY2 N;  1AA0 A;  3WUT A;  1VQK P;  3FWN A;  3A3Y B;  2D2C C;  3AEE C;  3DP5 A;  3VP9 A;  2FXM A;  1YTZ I;  3GHG C;  4JYC A;  5TIS E;  451C A;  1RQU A;  3RL0 B;  3TF5 A;  4RO0 A;  1L9B C;  1HVV A;  4AAL A;  3RN1 A;  1KB0 A;  1CSW A;  1X79 B;  2NZ2 A;  1QL2 A;  2P2U A;  1ZME C;  2PCB B;  3V2P A;  1HJ3 A;  1QL3 A;  2KP8 A;  2E5T A;  1CHH A;  1CZQ A;  3VMX A;  2ZJS E;  3AE9 C;  1RF1 B;  2D0S A;  5BU5 A;  3CX5 D;  3KQG A;  1FBM A;  1KIB A;  5CIH B;  1IC2 A;  3H32 B;  3B5N B;  1M57 D;  2OYI A;  4ASV A;  1JO5 A;  1YQ3 C;  2G3A A;  3WU2 V;  1EZV G;  2FXO A;  1CRY A;  3PH2 B;  3E1R A;  2PAJ A;  3FGA D;  3P32 A;  1C2R A;  4DOJ A;  1C6R A;  4FA5 A;  1C52 A;  2V4H A;  1DW0 A;  3A2A A;  1C6S A;  1JMM A;  1T8Z A;  1CRH A;  1KQG B;  4KT0 J;  3F89 A;  3AE7 C;  4OGQ D;  2AXT V;  5APW A;  5TIS V;  4RJT A;  2M5A B;  3GF3 A;  3SXT A;  3CCL P;  1IFD A;  2I1J A;  5AW9 B;  5CBO A;  1ZR4 A;  1BGY E;  5CIG B;  3JCU E;  1URQ A;  3QH9 A;  4PW9 B;  2K88 A;  4XFJ A;  1S5L H;  1L4A D;  2WSC H;  1KYO W;  4H0J A;  5AVT B;  1NYH A;  2KZI A;  4WB4 A;  3E1I A;  2A06 E;  5APT A;  3O6Q A;  1HCM A;  3E7K A;  3V2Q A;  2POH A;  3A0H E;  4H44 B;  5AVW B;  2FYU K;  1H0T A;  2H88 C;  1QYZ A;  1W5C E;  4BXL A;  3RK2 C;  2Y0E A;  1X9V A;  4Q5P A;  5GTI H;  3L75 J;  2E76 C;  3H1K J;  2BGV X;  2JJL A;  2PGD A;  1HJ4 A;  2JO1 A;  3EQ2 A;  4I6M C;  2Q9I A;  3ZOX A;  1GMJ A;  2O01 N;  4PV1 D;  5CCG C;  2FFD B;  1VF5 C;  3H1J G;  1KIL E;  3C2C A;  1GTW A;  3H1J J;  4IOI H;  3PTZ A;  3SFD C;  1A8C A;  1HZU A;  2BEQ D;  3BCC G;  3NTN A;  3DMI A;  1ZW0 A;  1QKS A;  4MN4 C;  3M9Q A;  3NWV A;  1JY2 P;  2KLV A;  1NTK J;  1QL4 A;  4W7Z A;  3P8C E;  1FCD C;  3MTU E;  1L0L K;  2I1K A;  1J3S A;  1G2C A;  3A7O A;  3D0W A;  2H8P D;  2CE0 A;  2C0W A;  2Q3I A;  1IZL 0;  5KAI E;  3CLQ A;  2E76 B;  3C9I A;  2FYU J;  5GTI E;  2B10 B;  1M60 A;  5L8R J;  4KJM A;  3H1H G;  2PAC A;  2ORL A;  2SPZ A;  2KYV A;  5AUR A;  3Q2Y A;  1CW5 A;  2C9N Y;  3EFF K;  2VRS A;  4ZKP A;  3A0B E;  4PJ0 H;  1OW7 A;  4I7Z C;  3M0D C;  3CL3 D;  5APQ A;  2Z5I A;  1VQM P;  3IN6 A;  1FZF A;  2GA1 A;  4DCK A;  4WQ7 A;  1RZ5 A;  3ABV C;  5APU A;  1NNO A;  3M0A A;  5CCH C;  1SFC C;  2E43 A;  1PPJ G;  2QJP B;  1DW2 A;  1GL2 B;  3AEA C;  3HQ8 A;  1R5L A;  1YHQ P;  5B66 E;  2A45 G;  4N3Y B;  2C2C A;  5GTH V;  4WQC A;  4IFD K;  1VQ8 P;  1JY3 O;  2HR3 A;  1OCD A;  2QVA A;  2OYI B;  1NWQ A;  2J59 M;  2Z4E A;  3BRV B;  4R4L A;  2AEF A;  3FWL A;  1NTM K;  3B5N A;  3DR0 A;  2PFX A;  3VMZ A;  4Y28 J;  3O5C A;  4JPZ B;  1RE4 C;  1N9C A;  2OYH B;  3I5C A;  2DVH A;  3KPE A;  1PZQ A;  4WY4 D;  2H43 A;  3MUD A;  2QSI A;  1H9Y A;  5B66 H;  5BVZ A;  1FDM A;  1CIG A;  3V6I A;  3HE4 A;  2KLU A;  3HD7 C;  3RBX A;  3HRN A;  5DFS A;  2WZ7 A;  3VMY A;  4J20 A;  3HQ7 A;  3BAT A;  1CRC A;  3L74 G;  1COT A;  4N78 D;  1CIF A;  2YXQ B;  2NRG A;  2FWL A;  1MFZ A;  2FBW C;  1CI6 A;  1KFN A;  2YKP A;  3ORV A;  1H31 B;  1KQS O;  4BWN A;  2QEX P;  3M9H A;  4I7Z B;  4YE1 A;  4WY4 C;  5DF5 A;  1H8A A;  3JC2 2;  1FOS E;  3CD6 P;  4JQ0 D;  1HZV A;  1LT9 C;  3H1J E;  2JP3 A;  3A0H V;  4U3F D;  2E74 B;  1GL2 D;  1JOC A;  1ZLL A;  1L4A B;  3G4S P;  4ZNC A;  1S6V B;  1LS9 A;  2KSJ A;  4UB8 V;  3RLM A;  2ZYG A;  1NTK K;  2HPC B;  2K9J B;  1OXZ A;  1NAY A;  4UB8 E;  4KMG A;  1DII C;  3HUS C;  2XU6 A;  4JF7 A;  1SQP D;  3O20 A;  2BH5 X;  1XTG B;  2KUB A;  3BCC D;  1CXC A;  5CCH A;  4FAV A;  3IAO A;  3VYI A;  2W6A A;  1FHB A;  2PRR A;  1M1J A;  1DIQ C;  4L74 A;  2L91 A;  1WVE C;  3CX5 W;  3V4Q A;  3B8E B;  1S2E A;  4KHX A;  1A2S A;  4RES B;  1CSV A;  3G71 P;  4FA4 A;  1LP1 B;  1M90 Q;  2L4D A;  2OTL P;  3AE1 C;  1K8A Q;  1SQP K;  2C0X A;  3N7N A;  5APV A;  1Q2N A;  1ZN5 A;  5APX A;  1T3J A;  2DGE A;  2WVR A;  3G3Z A;  3M0D A;  3AEC C;  2M5A A;  1PP9 G;  1CRG A;  1KIL B;  1S9K D;  2K37 A;  3MIW A;  4AQR D;  1SQX D;  4UB6 H;  5AW8 B;  1W5C T;  4L73 A;  3K5B A;  1RQV A;  1SQB E;  5AVQ B;  1RH5 B;  2OZ1 A;  3RL0 D;  5BU8 B;  1S5L E;  1HUC A;  2B9B A;  2FY8 A;  2BAS A;  3CYT I;  4IL6 V;  4Y99 C;  4D6T J;  3O0R C;  3NBS A;  1AOF A;  3CX5 I;  5DJQ C;  1U75 B;  1RE4 A;  2B87 A;  1CCH A;  1T6A A;  2GM4 A;  3TGU E;  5TIS H;  1K04 A;  4EIF A;  4WQA A;  4EIJ A;  2V7Q J;  2N9I A;  1WMK A;  3L4O A;  3NBT A;  1KMI Z;  1MV8 A;  3P7K A;  5E79 E;  1UIX A;  2YMK A;  1KB9 D;  2M0B A;  3PP5 A;  2ZVO B;  1VDF A;  1ZV8 A;  1PP9 D;  2ZT9 D;  4U3F E;  3S1K A;  4EIC A;  2CXB A;  1YCC A;  4YXW H;  1BCC G;  4WVZ A;  1SQP G;  3HUS B;  1VQ6 P;  4L1Q A;  5KAF E;  1FI3 A;  3SVW A;  1DIP A;  1H31 A;  4GIF A;  3R2P A;  4W7Y A;  2Z5H A;  4HJG H;  3CXH E;  2RKL A;  4DJG A;  1NTZ D;  1QGK B;  3SWS A;  4JCG A;  3D71 A;  4C46 A;  1LT9 B;  3WMM 0;  3O1Y A;  5KLI B;  2N9J A;  4H44 C;  2QJK C;  3IF4 A;  3T97 A;  4H0L B;  1LTJ A;  4WQB A;  2HOD A;  1CI6 B;  1CHI A;  1BE3 G;  2IBZ E;  4WQD A;  1UII A;  2MJZ A;  3VTP C;  1NMI A;  351C A;  1M70 A;  4U7J A;  1T2K C;  2KXP B;  3WU2 E;  1LP1 A;  1M6Z A;  4H0K A;  2CPS A;  3BVH A;  4FB1 A;  3L35 A;  2IX7 C;  3U59 A;  2YIU B;  1M8O B;  1RAQ A;  2RN0 A;  5KLV G;  2QE7 H;  3L70 J;  5AVV B;  1NJI Q;  1NTM G;  1FDI A;  2R5B A;  1LC1 A;  2BCN B;  2JEE A;  2A45 H;  2P10 A;  3V2R A;  2ZT9 C;  3MD0 A;  3CXH W;  3LIE A;  3G6E P;  3CMA P;  2OYI C;  1S9K E;  1YJW P;  3IFM A;  1OVR A;  2N18 C;  1LWU B;  1GJQ A;  1S4X A;  1FZC B;  1LTG C;  3SWF A;  2N1T C;  4OWF A;  5CYT R;  2WPQ A;  2KB7 P;  1AYG A;  2KK7 A;  1KD1 Q;  2IFN A;  1GL2 C;  1HTL C;  3RL0 g;  2WSS H;  1IQC A;  3VOP A;  1AV1 A;  1NIR A;  3AEG C;  2ZOO A;  3KZI H;  2KI7 B;  5KAI V;  3GHG B;  2FFD A;  2CA4 B;  1GK6 A;  1YI2 P;  1NML A;  3AED C;  1E8E A;  1GU2 A;  1J1D B;  1CYJ A;  3PJS K;  1LMS A;  1PGQ A;  3MGN A;  2DW3 A;  1SQV G;  3QWO C;  1OVU A;  2UWJ E;  2FYU D;  4WWI A;  1FZC C;  1FZG A;  2N18 B;  1LWU C;  2LXB A;  1SVF A;  4HYT B;  3LID A;  3L74 E;  4WBA A;  2QJY B;  4OGQ C;  1KIL D;  3OW2 O;  4PD4 H;  1H33 A;  1LT1 A;  3PRJ A;  1N7S B;  2IZ0 A;  1N7S A;  3KYQ A;  3L72 J;  1G1I A;  2XND H;  1RHZ B;  4NFG B;  3KXD A;  4EDF A;  5KJ7 C;  1IO3 A;  2XTS B;  4O9B A;  1CYC A;  3KHU A;  4Y5R A;  2GUS A;  2MHM A;  5E79 V;  1JTH B;  4R4M A;  1H32 A;  4EOT A;  4Z1M H;  3CCU P;  1L9J C;  1PIX A;  4DY9 A;  3H1K D;  2LXC B;  1CED A;  1MKM A;  2N1T B;  3CPW O;  4QMA A;  1VF5 B;  1L0L E;  1N2D C;  1NTK G;  1OIP A;  1SLQ A;  3CXH D;  4LGD E;  2A06 D;  2BEZ F;  1SFC D;  3I56 P;  4EID A;  1FZB A;  1NU1 E;  1J2J B;  2IYP A;  3SSU A;  4C7N B;  3PLN A;  1K3H A;  2ZZS 1;  4RKU J;  1FOC A;  1JMB A;  2N1T D;  2NPS A;  1EDI A;  5EFW B;  1MG2 D;  3RK2 B;  3PXS A;  4AX3 A;  1NTM E;  1LJ2 A;  2P58 A;  5APY A;  1BSN A;  2XDJ A;  2QIW A;  3R4Y A;  1J1E C;  2BCC E;  1Q82 Q;  1KB9 E;  2AEJ A;  2B4Z A;  2QJK B;  2GC4 D;  5KLI C;  5AVZ B;  1GQ1 A;  1OW6 A;  3L71 E;  1YYC A;  3MK7 C;  5CHX A;  2XKM A;  1CIH A;  2M3E A;  2C8S A;  3HQ9 A;  1DD3 A;  3HTK A;  4CPG A;  1GW3 A;  1IRV A;  2LIT A;  1S3J A;  3AE6 C;  3L73 D;  1JB0 J;  2E42 A;  3ZIY A;  1JCD A;  4XE5 B;  4D6T E;  1VQP P;  1K05 A;  1N7L A;  3TK1 A;  1DD4 A;  3SWY A;  1H0T B;  1VQ9 P;  5H2F V;  1N73 C;  1B7V A;  1JY3 N;  1EXI A;  2VHD A;  4D6T D;  5AW0 B;  1YJN P;  2FKW B;  3GF7 A;  5B5E H;  3EWK A;  1KV9 A;  2BH4 X;  1JEK A;  4NPF X;  1BE3 D;  4IL6 H;  2AIU A;  4N6J A;  2CA3 B;  1GK4 A;  1AQ5 A;  1KIL A;  1FS0 E;  1FAV A;  2KSE A;  3H1I G;  3B5N C;  3ITK A;  3CME P;  2R32 A;  1BDC A;  1LWU A;  3H1I D;  1PPJ E;  2Q5U A;  1VQN P;  5DJQ B;  3WUU A;  4H13 D;  2ZBO A;  5CMZ A;  2O1J A;  1VQ7 P;  1YIJ P;  1BE3 J;  1C75 A;  4D6T G;  2IYO A;  5KJ7 A;  1Q81 Q;  2OTK E;  1L0N K;  4WQ8 A;  1SQX K;  1NOH A;  1SQQ G;  2I8F A;  1U57 A;  3L4M A;  1XTC C;  1FOS F;  1JDL A;  1YNR A;  1BCC D;  1KX7 A;  3HD7 D;  1WEJ F;  1OX3 A;  1J1E B;  2D2C B;  2Q3E A;  3JSV C;  2HFE D;  1CTZ A;  2W8Z A;  4O1Q A;  2IPP A;  2BLF B;  5CIB B;  5AVR B;  1FZE A;  1ZOY C;  5KKZ C;  1QEX A;  1H88 A;  5K5G B;  1EDL A;  3B71 A;  4UB6 E;  2LR2 A;  2FYN C;  4EYY Q;  5AW6 B;  2IBZ D;  1LTT C;  1CIE A;  3C8V A;  4GOD A;  2HYN A;  3D6Z A;  1C2N A;  1HJ0 A;  2J58 A;  5H2F E;  2K3R A;  2K9Y A;  2NPS B;  1FDO A;  2WSF H;  3V4W A;  3MK7 B;  2P7J A;  5C39 A;  1P84 H;  2C1U A;  4H0L D;  1BE3 E;  3EFG A;  1NAF A;  1NU1 J;  2Q6Q A;  1FJ0 A;  1RZ6 A;  2YK3 A;  1NTK D;  1VPC A;  3T97 B;  3OJA B;  1CTJ A;  1KZU B;  4XXL A;  2W27 A;  2LKM A;  1KN7 A;  1AJY A;  1NTZ K;  1SQB K;  1L4A C;  1USD A;  2Q1K A;  3L71 G;  1USE A;  5AW2 B;  4FAN A;  2E74 C;  3MZW B;  1DW1 A;  1RF0 C;  4GDO A;  3A5T A;  1NKN A;  1BDD A;  1FJP A;  2ZYD A;  1A02 J;  1P84 D;  3JCU H;  2JTI B;  1D7M A;  5CCH D;  3Q5R A;  5KAF H;  1PP9 J;  3CCJ P;  3L72 D;  4I1L A;  3CXH H;  2B89 A;  1P84 E;  5AVU B;  5CCG A;  5CIE B;  3A0H H;  1RY3 A;  2H89 C;  2AEM A;  1NU1 K;  3L73 G;  3TGU D;  4EI2 A;  4IFF A;  3A9F A;  3HD7 B;  1M1J C;  1ZR2 A;  1H1O A;  4DT0 A;  2QG4 A;  1PGO A;  1Q7Y Q;  4YXD C;  2OZ1 B;  3OA8 A;  3OCD A;  4L3H A;  1SQP E;  2HLO A;  1L0N G;  1Y8A A;  3H1K E;  2LIR A;  5AVY B;  4JBZ A;  4BRY B;  2Q7C A;  4GOE A;  2D0W A;  3AE2 C;  1R5S A;  1N8R Q;  5AVX B;  1E79 H;  2W90 A;  4QAO A;  1RAP A;  2PP6 A;  1N86 A;  2R3S A;  1MZ4 A;  2ZAE B;  3L37 A;  1PP9 E;  1W2L A;  2V08 A;  3H1H E;  2HPC A;  1R8E A;  1EDJ A;  1LTJ B;  2R44 A;  1KQL A;  4V2K A;  3L74 D;  3VNW A;  2WTY A;  4PJ0 V;  3H25 A;  2C1V A;  3WUV A;  1WRG A;  5CJ4 A;  3HQ6 A;  1DH3 A;  1ZZH A;  2E74 D;  4PJ0 E;  3A0B V;  1SQV J;  5B6Q A;  5GTI V;  1I5T A;  3P8C D;  1CCR A;  2ZT9 B;  1EZV I;  1RE3 A;  3SJL A;  2WPS A;  4LJI A;  2NPS D;  3VMA A;  4U3F G;  2KNC B;  4WQ9 A;  3W68 A;  2N3Y A;  1T3U A;  3GLM A;  1LGH B;  4AAN A;  1OVV A;  5C0Z A;  1Q90 D;  2IDB A;  3IR9 A;  2JDI H;  3AEF C;  3L73 J;  3L75 D;  1NHL A;  5APS A;  3HTK B;  2WPV B;  4EIE A;  1U7J A;  1SFC B;  1BGY J;  2P67 A;  1I8P A;  155C A;  1SQQ E;  1JY3 P;  1ZRT E;  1GDV A;  4AAO A;  1DT1 A;  3RK3 E;  4JYB A;  1KQF B;  1CO6 A;  3MUD C;  3CWB G;  2K9J A;  1SQB G;  4H0L C;  3BRT B;  1CC5 A;  5B66 V;  1GL2 A;  3L71 J;  2ZFC A;  1CSB A;  3BCC E;  4NPD A;  3HD7 A;  2FFD C;  3CC2 P;  2M8R A;  1QLE D;  1BGY D;  1U7M A;  2CK3 H;  2A45 I;  4XYD B;  3ZDM A;  1CRJ A;  5KLV J;  1FC2 C;  2E75 C;  5TJH A;  1HRC A;  4PV1 C;  4PD4 D;  1QN2 A;  2E5Y A;  2IBZ G;  1YIT P;  5CID B;  1Y9B A;  1NGM B;  3L70 D;  1FE6 A;  1VQO P;  2H7H A;  2QM8 A;  2OYH A;  3L72 E;  3LW5 H;  4AAM A;  3OA8 B;  2R5D A;  3MP7 B;  4W80 A;  1FJK A;  3L75 E;  1OWA A;  2FRC A;  5CIC B;  1MG3 D;  1DVV A;  2KS1 A;  1I54 A;  2WT7 A;  1SS1 A;  1JM0 A;  3G9R A;  2O01 J;  2B87 B;  2XV5 A;  1E29 A;  2KIK A;  1YEB A;  1NU1 D;  2FYN B;  1ZXG A;  3TDK A;  1EB7 A;  3GG2 A;  2JQR A;  3CWB J;  3NFQ A;  2EXV A;  4WQE A;  1IK9 A;  1F1C A;  1IO4 A;  1CTY A;  4HH2 A;  4MU8 A;  4UB6 V;  3ZBM A;  2WMM A;  3NXS A;  2IZ1 A;  1YQ4 C;  1SQQ K;  4GOF A;  5AW5 B;  2N1T A;  1SQB J;  3AE3 C;  1AQT A;  4Y99 B;  2HOD B;  4GKG A;  2O01 H;  1CHJ A;  1T2K D;  2JKV A;  1A56 A;  3OA7 A;  1SFC A;  1PV3 A;  4PD4 I;  1K73 Q;  1CNO A;  3BCC J;  3H1I J;  2BPB B;  1K9M Q;  4DZO A;  1NTM D;  1KIL C;  5IY5 1;  3D70 A;  1KYO I;  1M7L A;  1I55 A;  1I6E A;  3TNU B;  3RBZ A;  2XZR A;  2WSE H;  3C1L A;  1X8Y A;  1IFJ A;  2FYZ A;  3V2N A;  1VYD A;  3AE5 C;  2Y0D A;  2AXT E;  4U3F J;  1G2C B;  1CRI A;  1KFM A;  2YKQ A;  4N78 E;  4PV1 B;  3GW6 A;  1AFO A;  2MTA C;  5EXQ A;  1KC8 Q;  3WFD C;  3CX5 H;  4TLF A;  3RL0 C;  1M56 D;  4UB8 H;  3M97 X;  4WY4 A;  4WY4 B;  2RMZ A;  1N73 A;  2O3J A;  1HWT C;  1KB9 I;  3L36 A;  3P8M C;  2OQQ A;  4TT3 H;  1LT9 A;  2ZVN B;  2WSE J;  5CJ0 A;  3M06 A;  1JCC A;  3CCS P;  2C9X B;  1TU3 F;  1QL1 A;  4AYC A;  3II6 A;  1L0N E;  4OH8 B;  3VN0 A;  2W6B A;  1BSH A;  1PPJ D;  2B0Z B;  5AW3 B;  4FA1 A;  2E76 D;  4ASW A;  3L72 G;  3AEB C;  3TSI A;  1IFP A;  3WC8 A;  3S4R A;  4LC1 A;  1URQ C;  2W6J H;  1YTZ T;  1MFT A;  4PWA A;  1AVO A;  2WSC J;  1HH7 A;  2QRX A;  1SP4 A;  1KYO D;  1N15 A;  2OAR A;  1KV4 A;  1CXA A;  2I8D A;  3FX0 A;  3VP8 A;  1L0L J;  3CX5 E;  4YTP C;  5E79 H;  1IFN A;  3CWB D;  5C9M A;  2JWD A;  1HGV A;  1L0L D;  2OYH C;  3HE4 B;  1L0L G;  1NTK E;  1ZRT D;  3ZCF A;  1SQQ D;  3GMA A;  4K3I A;  5DJT B;  1IZN B;  3GHG A;  2OGU A;  3HE5 A;  1WT6 A;  2GIW A;  2RH0 A;  4N0K A;  2ITA A;  1X0T A;  5H2F H;  3V5B A;  1L4A A;  1GDT A;  2WQY C;  1URQ D;  1LC2 A;  1I8O A;  1IK7 A;  3ZOY A;  2GB8 B;  4I2L C;  3TYY A;  3O8Z A;  5DJU B;  3CCQ P;  2B88 A;  4ZKU A;  2Y0C A;  1LTB C;  1LTJ C;  3WUI A;  1S5L X;  2YO3 A;  1JTH A;  1Y47 A;  4B86 A;  1DW3 A;  1VQ5 P;  1HRO A;  1VL2 A;  3AE4 C;  1OMI A;  3CI9 A;  1M1K Q;  2ZXY A;  1FI7 A;  3AE8 C;  3H6P A;  2OYO A;  5AVS B;  1YJ9 P;  5B5E V;  5GTH E;  2NPS C;  1CYI A;  2AI5 A;  3TYI A;  2Y9Y A;  1BCC E;  1YEA A;  1GU4 A;  4FA9 A;  4L76 A;  3RK2 D;  3RK3 C;  4OGQ B;  3CWB E;  3L74 J;  2KNC A;  3L4F A;  3UIA A;  1NVO A;  1YTC A;  3U1C A;  1H32 B;  1I6D A;  3H1L D;  3F5H A;  1LTS C;  1VQL P;  1EXJ A;  4P4Q B;  3PXW A;  2N9B A;  2YQB A;  1EQ7 A;  4LLH A;  3CC4 P;  1HJB A;  4IL6 X;  2ZON G;  3Q3D A;  1U74 B;  1IJD B;  3CC7 P;  2QJP C;  3SLE A;  4K3A A;  1DEB A;  1GU5 A;  2M3B A;  3H1I E;  1YBK A;  1EC5 A;  2WSF J;  3Q5S A;  2FXP A;  2HV4 A;  1AKK A;  2N3B A;  1N50 A;  2B11 B;  5KLV E;  2YKO A;  5GTH H;  1SQX J;  2GC7 D;  2FYU E;  5KTB A;  2PCC B;  4GT1 A;  1S72 P;  1IFI A;  4GYD A;  1NTZ E;  2ZXX A;  3WU2 H;  1H89 A;  1E2R A;  2E75 D;  3USS A;  1RF0 A; 
#chains in the Genus database with same CATH homology
 5CIF B;  1LC1 A;  1GIW A;  2BCN B;  3C2C A;  3PTZ A;  1A8C A;  1HZU A;  1HJ5 A;  4V2K A;  3DMI A;  1QKS A;  3L74 D;  3VNW A;  3NWV A;  3CXH W;  4PJ0 V;  2C1V A;  1QL4 A;  1FCD C;  2N9Y B;  3HQ6 A;  1J3S A;  2N18 C;  1ZZH A;  1GJQ A;  1YFC A;  2CE0 A;  3A0B V;  1IZL 0;  5B6Q A;  5GTI V;  5CYT R;  3KZI V;  1AYG A;  1I5T A;  1CCR A;  2YCC A;  2B10 B;  2BCC D;  1M60 A;  3SJL A;  4LJI A;  3VMA A;  2PAC A;  1IQC A;  2ORL A;  2KNC B;  1NIR A;  5AUR A;  2ZOO A;  4WQ9 A;  2C1D B;  2N3Y A;  1H9X A;  4AAN A;  5KAI V;  5C0Z A;  2CA4 B;  4A7P A;  1NML A;  1E8E A;  1GU2 A;  1CYJ A;  3L75 D;  1LMS A;  1EZV D;  4EIE A;  1N90 A;  2FYU D;  1BL9 A;  3OCD B;  4WQ7 A;  1I8P A;  155C A;  1RZ5 A;  1H33 B;  1NNO A;  1K3G A;  2N18 B;  3WFE C;  1GDV A;  4AAO A;  1AOQ A;  1DT1 A;  3RN0 A;  2QJP B;  1DW2 A;  1CO6 A;  2QJY B;  1YIQ A;  3HQ8 A;  1H33 A;  3PRJ A;  1CC5 A;  5B66 V;  2C2C A;  5GTH V;  4NFG B;  4WQC A;  4EDF A;  1IO3 A;  1BGY D;  2XTS B;  1CYC A;  4XYD B;  3KHU A;  4Y5R A;  4RSZ A;  1CRJ A;  1OCD A;  3X39 A;  2MHM A;  5E79 V;  5TJH A;  1HRC A;  4PD4 D;  3PHL A;  1H32 A;  1QN2 A;  5CID B;  3FWL A;  1L9J C;  3JBT B;  3ZOW A;  3L70 D;  4DY9 A;  3DR0 A;  3WFC C;  3H1K D;  1CED A;  1R0Q A;  3O5C A;  1N9C A;  4AAM A;  1S5L V;  3CXH D;  3OA8 B;  2A06 D;  3RMZ A;  1SQV D;  4EID A;  2DVH A;  1YIC A;  2FRC A;  5CIC B;  3PLN A;  1K3H A;  1MG3 D;  3CU4 A;  1H9Y A;  1DVV A;  2KS1 A;  1I54 A;  2ZZS 1;  1SQB D;  3WFB C;  1FOC A;  4L3G A;  1MG2 D;  3PXS A;  1CIG A;  4AX3 A;  1E29 A;  3H1H D;  1YEB A;  2JWA A;  1NU1 D;  5DFS A;  1CSX A;  4J20 A;  2FYN B;  3HQ7 A;  3ZOO A;  3TDK A;  1CRC A;  1EB7 A;  2B4Z A;  2QJK B;  1COT A;  3GG2 A;  2GC4 D;  2JQR A;  1GQ1 A;  2EXV A;  4WQE A;  1CIF A;  1F1C A;  2CE1 A;  1CTY A;  4MU8 A;  3MK7 C;  4UB6 V;  3ZBM A;  2FWL A;  1CIH A;  2C8S A;  3HQ9 A;  1COR A;  3ORV A;  1IRV A;  1H31 B;  2LIT A;  1IRW A;  1OAE A;  4YE1 A;  3L73 D;  3ZIY A;  5DF5 A;  1CHJ A;  1HZV A;  1A56 A;  3A0H V;  4U3F D;  1CNO A;  1DVH A;  1FI9 A;  4O1W A;  5H2F V;  2BPB B;  1NTM D;  1B7V A;  1S6V B;  1LS9 A;  2VHD A;  4UB8 V;  5IY5 1;  3RLM A;  4D6T D;  5KAF V;  1I55 A;  1I6E A;  2K9J B;  1KV9 A;  5KLV D;  2BH4 X;  1BE3 D;  1C7M A;  1CSU A;  4KMG A;  1DII C;  2AIU A;  2CA3 B;  1SQP D;  1VYD A;  3L71 D;  2Y0D A;  3O20 A;  3ITK A;  2BH5 X;  1L0N D;  3BCC D;  1CXC A;  3H1I D;  1CRI A;  4FAV A;  2V07 A;  3VYM A;  5DJQ B;  3GW6 A;  3H1J D;  2MTA C;  1FHB A;  5EXQ A;  2ZBO A;  1DIQ C;  3WFD C;  2L91 A;  1WVE C;  3CX5 W;  3M97 X;  1ETP A;  2RMZ A;  2O3J A;  1C75 A;  1A2S A;  1F1F A;  1CSV A;  4FA4 A;  3VRD A;  2B12 B;  3PXT A;  2L4D A;  2C1D A;  2C9X B;  4WQ8 A;  2I8F A;  1GKS A;  3L4M A;  1PPJ D;  2B0Z B;  1JDL A;  1YNR A;  4FA1 A;  1BCC D;  1KX7 A;  3WC8 A;  2DGE A;  1WEJ F;  1LFM A;  1C6O A;  4GED B;  2Q3E A;  5KKZ B;  1CRG A;  1CTZ A;  1SQX D;  1KX2 A;  4O1Q A;  3CP5 A;  4PWA A;  1W5C T;  2BLF B;  5CIB B;  1HH7 A;  1KYO D;  1N15 A;  2OZ1 A;  1CXA A;  3DP5 A;  451C A;  3CYT I;  3CWB D;  5C9M A;  3TF5 A;  1L9B C;  2IBZ D;  4IL6 V;  1CIE A;  1L0L D;  3O0R C;  3NBS A;  1AOF A;  1C2N A;  5DJQ C;  1U75 B;  1CCH A;  1ZRT D;  4AAL A;  3ZCF A;  1SQQ D;  4K3I A;  4EIF A;  4WQA A;  3RN1 A;  3MK7 B;  1KB0 A;  1CSW A;  2N9I A;  3L4O A;  2GIW A;  2C1U A;  4N0K A;  3NBT A;  2PCB B;  1FJ0 A;  1RZ6 A;  1HJ3 A;  1LC2 A;  1QL3 A;  1I8O A;  2YK3 A;  1CHH A;  1NTK D;  1KB9 D;  3ZOY A;  2GB8 B;  1PP9 D;  2D0S A;  3CX5 D;  1CTJ A;  4XXL A;  1KIB A;  5CIH B;  4EIC A;  2CXB A;  2Y0C A;  1YCC A;  3WUI A;  1DW3 A;  4FAN A;  1DW1 A;  3WU2 V;  4L1Q A;  1HRO A;  1CRY A;  3PH2 B;  1FI3 A;  3SVW A;  1H31 A;  1C2R A;  1P84 D;  1C6R A;  2ZXY A;  1FI7 A;  4FA5 A;  1C52 A;  2JTI B;  1DW0 A;  1C6S A;  1CRH A;  5B5E V;  1NTZ D;  1CYI A;  2AI5 A;  3TYI A;  3SWS A;  1YEA A;  4JCG A;  3L72 D;  4FA9 A;  2AXT V;  5TIS V;  4RJT A;  3SXT A;  1YTC A;  1H32 B;  3O1Y A;  5CIE B;  5KLI B;  1I6D A;  3H1L D;  2N9J A;  4P4Q B;  5CIG B;  3PXW A;  3TGU D;  2YQB A;  4PW9 B;  3A9F A;  1KYO W;  4WQB A;  2ZON G;  4H0J A;  1CHI A;  1U74 B;  4WQD A;  1H1O A;  2QG4 A;  3SLE A;  1NMI A;  351C A;  2OZ1 B;  1M70 A;  1HCM A;  3OA8 A;  3OCD A;  4L3H A;  1M6Z A;  4H0K A;  4FB1 A;  2HV4 A;  1AKK A;  2N3B A;  1N50 A;  2B11 B;  2LIR A;  1QYZ A;  2Y0E A;  2GC7 D;  2D0W A;  2YIU B;  4Q5P A;  1RAQ A;  2RN0 A;  4QAO A;  2PCC B;  1RAP A;  2BGV X;  1HJ4 A;  4GYD A;  1MZ4 A;  1E2R A;  3ZOX A;  1W2L A;  2V08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...