2YIUB

X-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
228
structure length
206
Chain Sequence
DISFSFEGPFGKFDQHQLQRGLQVYTEVCSACHGLRYVPLRTLADEGGPQLPEDQVRAYAANFDITDPETEEDRPRVPTDHFPTVSGEGMGPDLSLMAKARIGGPEYIHAVLTGYDGEEKVLYHNAAFAGNWIQMAAPLSDDQVTYEDGTPATVDQMATDVAAFLMWTAEPKMMDRKQVGFVSVIFLIVLAALLYLTNKKLWQPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B
publication title X-Ray Structure of the Dimeric Cytochrome Bc(1) Complex from the Soil Bacterium Paracoccus Denitrificans at 2.7-A Resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 59
structure length 206
sequence length 228
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2yiuB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2yiuB02
1VYDA 4XYDB 3VYMA 3RMZA 5KLIB 2FWLA 1CRIA 1AYGA 1RZ5A 3H1JD 1R0QA 1NTZD 1IRWA 2XTSB 5CYTR 1KX7A 1GQ1A 1ETPA 3ZOOA 3HQ7A 1NMLA 2DVHA 1CHJA 4KMGA 155CA 1U74B 4A7PA 3ZOWA 1H33B 1H31A 4J20A 1CCRA 4EICA 1CSVA 1DW0A 2N3BA 5KLVD 1CRYA 1P84D 2HV4A 4UB6V 2FYUD 2JWAA 3A9FA 3PHLA 3TYIA 3OA8A 2BCCD 1FCDC 2B4ZA 2YIUB 1KX2A 3PXSA 1GJQA 2CA3B 2GC4D 2BH4X 4D6TD 5C0ZA 1NIRA 1FI7A 3HQ9A 2ZBOA 4WQEA 2B0ZB 1CRCA 3CX5D 3WFDC 1H32A 3NWVA 1CO6A 1I8OA 3CU4A 1GIWA 1CORA 4FAVA 4RJTA 1CYJA 3VNWA 1L0LD 5B66V 1FJ0A 1H31B 4PWAA 2BGVX 2ZZS1 3MK7C 2A06D 1N9CA 2Q3EA 3OCDA 2C1VA 3OA8B 1AOFA 3L71D 4FA5A 4JCGA 3RN1A 1DW2A 3HQ8A 3WFEC 4H0KA 3PXTA 1YFCA 5CIBB 1CIFA 1WEJF 4QAOA 5IY51 4EIFA 5GTIV 3MK7B 4O1WA 1F1CA 1EB7A 1YEBA 3HQ6A 1YIQA 1NTMD 2JTIB 4V2KA 1KYOD 3FWLA 1AOQA 1E8EA 1DIIC 1FI3A 1IQCA 2MTAC 3L4MA 2Y0EA 1C75A 2YQBA 4LJIA 1H9YA 4L3HA 4WQCA 1CYIA 1DW1A 1H33A 2QJKB 1I55A 4FA1A 1C6RA 5KKZB 4NFGB 2JQRA 2KNCB 1KB0A 4DY9A 2I8FA 1SQVD 2QJYB 1CEDA 1BL9A 1BGYD 1YNRA 4FA4A 1S6VB 1B7VA 2CXBA 3PLNA 1KB9D 3VRDA 1M6ZA 3ZIYA 4H0JA 1NU1D 3TF5A 1I8PA 2OZ1B 5H2FV 2N18C 1QYZA 3O1YA 1YCCA 3WU2V 3TGUD 4Y5RA 2B12B 1DT1A 2AXTV 2GC7D 5CIEB 1SQQD 3KZIV 1LMSA 1CTYA 2VHDA 1GKSA 4MU8A 1I6EA 3L72D 4AAOA 2ZOOA 1JDLA 1CRJA 2CE0A 5TJHA 2D0WA 5KAFV 1CIHA 4WQ8A 3CXHD 3WC8A 1QL3A 2RN0A 1ZZHA 1CRHA 1IZL0 5DF5A 2YCCA 3M97X 1C52A 3H1HD 1DW3A 5CIGB 1E2RA 1MG3D 4AAMA 1GU2A 2EXVA 3BCCD 1K3HA 4AALA 1YICA 1KV9A 1CIGA 2C8SA 1MZ4A 1DIQC 3O0RC 2C1DA 2QJPB 1F1FA 2BH5X 2Y0CA 2CE1A 1S5LV 2C9XB 3ZOXA 4EIDA 2N9JA 2LIRA 3NBTA 4PJ0V 1C6SA 1HJ4A 4WQ7A 3PRJA 1EZVD 2PCCB 3O20A 4RSZA 1NMIA 1I6DA 3CXHW 2B11B 4UB8V 3CX5W 1I54A 1FHBA 1HZVA 1LS9A 3DR0A 5B6QA 5EXQA 5CIHB 3VMAA 1YEAA 2YK3A 2PACA 1LC1A 2OZ1A 2C1DB 3L4OA 1HH7A 2CA4B 3ZCFA 1IRVA 3ORVA 1SQBD 2Y0DA 1FOCA 5CIDB 1M60A 4AANA 1FI9A 1NNOA 3SJLA 3GW6A 1W5CT 1W2LA 1ZRTD 1MG2D 5CIFB 1A56A 1RAQA 1CXCA 1BCCD 3C2CA 4EDFA 1SQPD 1OCDA 2C1UA 1CC5A 4FANA 1HROA 1LC2A 4L1QA 1RZ6A 2AIUA 5DJQC 1HRCA 2ORLA 1OAEA 4P4QB 3SLEA 2FRCA 3KHUA 1KYOW 2IBZD 3CP5A 3ITKA 1C7MA 5GTHV 1L0ND 2GB8B 3PH2B 1CNOA 3RLMA 4WQBA 1N90A 1CSUA 1WVEC 4U3FD 1CRGA 1J3SA 3PTZA 3L70D 4AX3A 2N18B 1PPJD 1CSWA 1QKSA 2RMZA 3L74D 2N9IA 351CA 2D0SA 5DJQB 1C2NA 1C6OA 1LFMA 4N0KA 1L9BC 4GYDA 4PW9B 3A0HV 1K3GA 2V07A 2ZONG 3H1ID 3TDKA 1AKKA 3L75D 3WFCC 1A8CA 2BPBB 1IO3A 1QN2A 2V08A 5DFSA 4FB1A 2L91A 3PXWA 3ZOYA 4PD4D 3SXTA 3A0BV 5KAIV 3CWBD 2BCNB 2L4DA 2PCBB 5AURA 5E79V 4IL6V 1RAPA 1CXAA 1HJ5A 1H9XA 3ZBMA 1CHHA 1KIBA 1GDVA 2LITA 3DMIA 2MHMA 5TISV 1COTA 2KS1A 1NTKD 2ZXYA 4WQ9A 4L3GA 1H1OA 1DVHA 3GG2A 2BLFB 1N15A 1HJ3A 3X39A 2AI5A 1U75B 2FYNB 1H32B 3CYTI 4YE1A 1SQXD 3WFBC 4WQAA 1E29A 1M70A 2K9JB 1BE3D 2N9YB 3NBSA 4Q5PA 2QG4A 3L73D 1CTZA 1L9JC 1CSXA 1QL4A 2GIWA 4FA9A 1CHIA 5B5EV 4WQDA 1PP9D 2C2CA 2DGEA 3OCDB 1CTJA 451CA 1CIEA 3SVWA 4O1QA 1HCMA 3H1KD 1I5TA 3SWSA 1CYCA 1YTCA 4GEDB 4EIEA 2O3JA 2N3YA 4XXLA 4K3IA 1C2RA 2B10B 1CCHA 3O5CA 3WUIA 1HZUA 3DP5A 1A2SA 3JBTB 1DVVA 1N50A 5CICB 5C9MA 3H1LD 3RN0A
chains in the Genus database with same CATH superfamily
1NTME 5M1BA 4C46A 3H6PA 1EC5A 3VYMA 1VQ9P 4RESB 1IFMA 3L37A 2ZYAA 2FWLA 1ZV8A 1RZ5A 4DJGA 3H1JD 5KAIE 1N7SA 5KLVK 2XTSB 3ZOOA 3HQ7A 1S5LE 1CHJA 155CA 3VTPC 5TISE 4PJ0E 1KYOI 5APXA 3U59A 1H33B 3KQGA 3TSIA 4J20A 2N3BA 5KLVD 2KI7B 4UB8E 3AE1C 1X79B 2HV4A 4UB6V 2JWAA 3PHLA 1KFMA 1LTSC 2BCCD 3FXEA 3PXSA 1L0LK 5C0ZA 2ZBOA 4H13D 1RF1C 1VQ5P 1N7SB 3CX5D 2R44A 4L75A 2IBZG 2M3EA 1M1JA 1TU3F 2K9JA 3GMAA 2ZT9B 1GL2C 3NMDA 1L0LD 3L35A 1FJ0A 1G2CA 4H0LB 3MUDC 2Q3EA 3OCDA 1PGJA 2N1TA 2ZVOB 2H43A 1PPJG 3E1RA 1HWTC 2LXBA 2HODA 4JCGA 3L75G 1FAVA 4ASWA 2H88C 4EIFA 5IY51 3H1HE 4O1WA 2E74D 2C9NY 1F1CA 1EB7A 1N8RQ 5C39A 2KNCA 1YIQA 2JTIB 2ITAA 1Q7YQ 3CX5I 1E8EA 1DIIC 1LTTC 3II6A 3WUTA 2OYOA 1SQVK 3AEFC 2D2CD 3VMXA 1BSNA 1C75A 4LJIA 1WMKA 1H9YA 4L3HA 1CYIA 1URQC 3V4QA 1DW1A 3VP9A 5BVZA 2QJKB 1I55A 2FYUJ 2WPSA 4JF7A 2E76C 1EZVE 2KNCB 4DY9A 2M8RA 1SQVD 3B71A 3KZIH 1YTZT 2KUBA 1R5SA 4BWNA 3HE4A 1BE3G 3M9BA 3VRDA 1NKZB 1LTJC 4H0JA 2CK3H 3TF5A 1I8PA 2KB7P 3O1YA 1YCCA 2YO2A 3FWNA 1RE3A 3E7KA 1H88A 5AVXB 1SQBE 2AXTV 1KTMA 3MGNA 1E5WA 3IF4A 1LMSA 1CTYA 4MU8A 3V4WA 4HH2A 1KV4A 1WRGA 1JMMA 1JDLA 2I1JA 1KN7A 3D6ZA 4TLFA 1AQ5A 1ZZHA 3HTKA 1CRHA 2C0XA 5B5EE 2QJPC 2YCCA 3M97X 5KAIH 1C52A 1VL2A 1IK7A 1NTMJ 2FY8A 5AVTB 3Q1MA 1S5LH 3Q3DA 1MG3D 4WY4B 1NTZG 1L0NE 2W6AA 1GU2A 2EXVA 1SQQE 5TISH 3HUSA 4AALA 4PJ0H 1YICA 1KV9A 2B88A 2W27A 4EI2A 2C8SA 4JYBA 1MZ4A 1DIQC 4UB8H 3CLQA 3L70E 2IBZI 3CMEP 3G71P 1Z56A 2ZAEB 1OIPA 1C6SA 3BRVB 1HJ4A 2B11B 3BCCE 3DR0A 1S72P 1K73Q 1SVFA 3EFFK 1SFCC 1YHQP 2OZ1A 3T97B 1PGPA 2W8ZA 2OTKE 3CPWO 2OYIC 1M60A 1CZQA 2O1KA 3M06A 5KAFE 2HR3A 3M0AA 3I5CA 1RAQA 1BCCD 1UIIA 3RBXA 4BRYB 4GDOA 2C1UA 4FANA 1J1EC 1U7MA 2WPVB 2WSFH 1LNQA 5AW4B 3H1HJ 2GUSA 2WMMA 1HJ0A 4P4QB 2V7QJ 3CP5A 3VP8A 2KXPB 2GB8B 1OVUA 3RLMA 1DH3A 2IDBA 3MD0A 2DW3A 3H32B 1ZRTE 2BEQD 1WVEC 3A7OA 2HLOA 1J3SA 1N7SC 1VQ8P 5BU5A 4O9BA 2N18B 1K9MQ 5DJQB 1FOSF 3AE5C 4N0KA 2ZXXA 2ZT9C 2ZONG 3H1ID 1AKKA 1YQ4C 3P7KA 1A8CA 3MUDA 4TT3H 1G1JA 1R5LA 3TGUG 1GMJA 1RF0A 2J58A 2ZVNB 1NTKK 3HD7D 4U3FE 3RL0B 2FYNC 1SQQG 1SQBJ 5KAIV 3S1KA 1M1JC 3P8MC 3BVHA 1GDTA 1CXAA 1N73A 1HJ5A 3P8CD 4PV1B 5TISV 1KB9H 1GDVA 2LITA 1SQXK 3D71A 5B5EH 1M90Q 1NTKD 3I55P 2BCCE 1Q86Q 1T3UA 2BLFB 1N15A 2QIWA 2NPSD 3CCQP 3CYTI 3B5ND 2AXTE 1SQXD 3Q5RA 1E29A 3BCCG 4Q5PA 2A45G 2QG4A 5AW6B 3L73D 1L0NJ 2KSEA 1L0LE 1SQQJ 4WQDA 1PP9D 3OA7A 3QH9A 3U1AA 4IFDK 3WUVA 3H1KD 3QWOC 3IN6A 1I5TA 3L70J 1CYCA 4EIEA 2O3JA 5KLIC 5CCGD 2N3YA 2KYVA 3A0HE 1RQVA 1HZUA 3VMZA 2A45H 1LT1A 1OWAA 2RH0A 3H1LD 4NPEA 1JTHB 4IFFA 1VYDA 4EYYQ 5CHXA 1KD1Q 2R32A 3V2NA 4UB6H 1CRIA 2H8PD 2N9BA 1GTWA 2YIUC 1PFIA 1OFCX 1PZQA 5KAFH 2IFNA 1VF5C 4KMGA 1GZLA 4H44B 3CCRP 2NZ2A 1U74B 1RE3C 1H31A 1ZW0A 4EICA 1LWUB 5AVQB 1CSVA 1GU5A 1CRYA 2P10A 1P84D 3PJSK 1SQVE 3TYIA 3OA8A 4OGQB 2R5BA 2GC4D 4D6TD 1GL2D 1H0TA 1NIRA 1KILA 1FI7A 3HQ9A 4ASVA 2W6BA 1CRCA 1CSBA 1H32A 1FZFA 1CO6A 3CU4A 2M3BA 4I7ZC 4RJTA 2WITA 1VDFA 3AE2C 1H31B 2ZZS1 3VOPA 1N9CA 1KB9I 4U3FG 2WPQA 1OMIA 3HUSC 3OA8B 4MN4C 2K37A 2KK7A 3IR9A 1J1DB 3WFEC 1YTZI 4H13B 3WUUA 2Z5IA 5CIBB 3LIDA 3MK7B 3U1CA 4M3LA 4WVZA 1BDDA 3BASA 5KKZC 4GODA 3CXHI 2A06E 1KYOD 3FWLA 5AVWB 3RL0g 3H1JJ 3CC7P 1LP1A 1FI3A 4U3FJ 1NWQA 1QLED 1JY3P 1LTBC 2E76D 3IAOA 2MTAC 3L4MA 3SWKA 1XTGB 1VQMP 3AE7C 2IFMA 2MKVA 2A45I 4WQCA 5KLVJ 1H33A 1X22A 3A3YB 1CI6B 1NU1K 2AXTH 2M5AB 2BCCJ 2JQRA 4GKGA 4RKUJ 3TNUB 1AV1A 2W6JH 5AW3B 2Y9ZA 3EFGA 4PD4H 1PGQA 1KQLA 1BGYD 4FA4A 2Y9YA 2HPCB 2CXBA 1LP1B 4KJMA 1K04A 3M91A 1NU1D 4DT0A 2WSEH 5H2FV 2N18C 5B66E 1QYZA 2IYPA 1L0LJ 4GOFA 2B12B 3D0WA 3CMAP 1EDKA 2VHDA 2WSEJ 2FFDB 1GKSA 1YJ9P 4AAOA 1KFNA 1NVOA 2XKMA 4HKZH 2CE0A 4JYCA 1HUCA 5CJ4A 1S5LX 5KAFV 1IZNB 4WQ8A 1USDA 1KZUB 4C7NA 3CCLP 5AVYB 1IZL0 2E42A 2YMKA 1DW3A 5CIGB 4PV1C 4EOTA 5AVUB 4XA4A 4AAMA 1K3HA 2QM8A 3USSA 1CIGA 2AXCA 2P67A 1DD3A 3FGAD 3L72E 3O0RC 3RK2D 1IO4A 1RF0C 4N78D 1CW5A 2KLVA 2WWWA 1DD4A 4C7NB 3RBZA 1DEBA 1OW6A 2FYUG 1W2BO 3ZOXA 2J5UA 1Y47A 2QA4P 3NBTA 1SQVJ 1N73C 2IZ1A 2PCCB 1SFCD 3O20A 2XV5A 4RSZA 1JCDA 1ZLLA 1VQ7P 2G3AA 1HZVA 1MFZA 1W2EA 2FBWC 5EXQA 1JEKA 1LC1A 2OTLP 2C9LY 1HH7A 2A06G 3ZCFA 1T2KC 1IRVA 2Y0DA 2HYNA 4L76A 3GW6A 1H8AA 2KS1B 4PD4I 5CIFB 2MJZA 1FE6A 3NTNA 2WTYA 1HROA 1S4XA 3O8ZA 1SQXE 1NTMG 5EFWB 5KJ7A 1HRCA 1Y8AA 3OJAB 3L73E 2FRCA 2IBZD 1GW3A 1N7SD 4WY4A 1JY2N 3M9HA 1FZCB 2P1JA 4OGQC 1OVRA 1CSUA 3V5BA 5AVVB 1ZOYC 1N2DC 4AX3A 4DZOA 1SQPE 1PPJD 1QGKB 1QKSA 2N9IA 1UIXA 3F5HA 2JWDA 3MTUE 5APWA 1C2NA 1L4AA 1C6OA 1L9BC 4GYDA 3A0HV 3LIEA 1K3GA 2QSIA 3TDKA 3H1LE 3L75D 3MP7B 1JNMA 1X8YA 3WFCC 3W67A 5CJ0A 1JY3N 2E75C 2K88A 2BPBB 2OARA 4C7RA 3Q2YA 2IX7C 1RQUA 2Q6QA 3VN0A 2YKQA 3V6IA 5DFSA 1LT9B 1FJPA 1KILC 4FB1A 4BXLA 1S9KE 3T97A 3AEGC 2L4DA 3L74E 2PFXA 4YTPC 4IL6V 1L4AB 4N3YB 2N1TD 3L72G 1RH5B 1CHHA 2MHMA 1COTA 1QEXA 2ZXYA 3CCSP 5APQA 1BCCJ 2VRSA 4D6TE 3SWFA 1YIJP 1S3JA 2LKMA 1HJ3A 5H2FE 2AI5A 4BRYA 2XU6A 3H1HG 3S9OA 5AW1B 2JR8A 2ZFCA 1OZHA 1BE3D 3GHGB 3NBSA 1JUNA 3CWBE 3GF3A 1DEEG 1IFJA 2QM7A 1CHIA 1FZGA 1VQ4P 2C2CA 3L72J 2E5YA 3M0DA 4K35A 3N4XA 3RK3D 1HCMA 2B87B 3SWSA 3H32A 1YTCA 3MHVA 4KHXA 4JQ0D 3AE6C 4U7JA 1FZBA 2V7QH 4K3AA 3O5CA 5CBOA 3CC4P 1EZVG 1NTZK 3H1IJ 1N50A 2NPSB 4KT0J 3B5NB 1IFDA 4XFJA 1PL5A 1VF5D 2B9BA 1D7MA 1MZ9A 1R0QA 1NTZD 1YQ3C 1IRWA 1KX7A 5CYTR 1SQBG 4DCKA 5E79E 1VQOP 1VQNP 1NMLA 2DVHA 2FXPA 1NAYA 2H7HA 2R5DA 4A7PA 3ZOWA 4CPGA 3L4FA 5CCHA 1IFIA 1R8EA 1GU4A 2WPRA 1N86A 1SQPG 3ZDMA 4H0LC 1FDMA 1LGHB 1QL1A 1GJQA 2BH4X 1SQXJ 4HB1A 3H1JE 1NU1E 1GIWA 4FAVA 3L73J 1L0NG 1CYJA 4I1LA 3VNWA 1GW4A 3HE5B 5B66V 1HVVA 1NH4A 4PWAA 4LLHA 5KLVE 3H1KJ 3L70G 1X9VA 4Y99B 2C1VA 1RF1B 3L74G 1AOFA 1NHLA 1Y9BA 4L73A 2R3SA 1SQPJ 1FZAA 3G6EP 3L71D 4WWIA 3RN1A 3CX5E 3HQ8A 1GL2B 1QL2A 3H1LJ 1WEJF 4NPFX 2WSSH 1YEBA 3M9QA 2C0WA 1JTHA 2QJKC 4V2KA 4OVNF 3LW5J 3CC2P 1AOQA 2OTJP 2GUVA 2Q7CA 3CWBG 1NYHA 1IQCA 3JCUE 3L74J 4N78E 1LTAC 2Y0EA 4ZNCA 1ZR2A 2H89C 2JEEA 5H2FH 3A2AA 1OXZA 3AE3C 1KQFB 3V2RA 1LWUA 1SS1A 2SPZA 1KB0A 4W7ZA 4D6TJ 1BL9A 1S6VB 1SQQK 2ZJSE 1KB9D 1M6ZA 3ZIYA 2JP3A 1RY3A 4IL6E 1EZVI 3CWBJ 1WT6A 3TGUD 4Y5RA 3CCMP 4I6MC 2YNYA 5KJ7C 1DT1A 1M56D 1G1IA 2E76B 2GC7D 1SQQD 5AVZB 3TK1A 1EDLA 1KMIZ 1RHZB 3C8VA 4WY4C 1I6EA 4R4LA 1CRJA 1HF9A 2D0WA 1LT9C 3CXHD 5GTIE 5BU8B 5DF5A 2POHA 1L4AC 5E79H 1MUUA 2IBZE 3H1JG 3BCCD 1YJWP 1NAFA 1JY2P 2K3RA 2QJPB 5KLVG 1J2JB 2AEJA 2CE1A 3O6QB 1ZR4A 3GHGC 4EIDA 2BCCG 1EXJA 2GA1A 2LIRA 1Q90D 2OQQA 1CI6A 3L75E 4WQ7A 4OWFA 1BGYJ 2M5AA 2O01N 3TNUA 1I6DA 4ZMDA 1HBWA 4YPCA 1FZEA 3KDPB 1T2KD 3CX5W 2HFED 1I54A 1FHBA 2WVRA 3WU2E 2HPCA 1NU1J 2PAJA 1URQD 3VMAA 1YEAA 1QX8A 3SFEC 1L0LG 2AEFA 3RK2B 3NXSA 3ORVA 5APYA 3W68A 1FOCA 5CIDB 3D6YA 3B5NC 3CX5H 2WZ7A 3SJLA 1U57A 1JOCA 2FFDA 4GIFA 1W5CT 1W2LA 1ZRTD 1MG2D 2E74B 1A56A 3M0DC 2HG5D 1CXCA 4EDFA 1SFCB 3FXDA 3EQ2A 1OCDA 4YXWH 1CC5A 1LJ2A 4YXDC 2LXCB 4L1QA 3CD6P 2AIUA 3G3ZA 5DJQC 4OGQD 2OYIB 2ORLA 4IOIH 5AW0B 3Q5PA 3JCUH 3KHUA 3A0HH 1C7MA 5GTHV 1QVGO 2D2CB 3Q5SA 2OYHA 1CNOA 1VPCA 5AW8B 4WQBA 2KP8A 2PGDA 1N90A 3RK3E 2P7JA 1J1EB 2Q3IA 4U3FD 1CRGA 3AEEC 1BCCE 1ZN5A 3VMYA 351CA 2D0SA 1L2PA 3RL0C 2E75D 1SQVG 1E79H 2G8YA 5CCHC 2Q5UA 1KILD 2XNDH 4IL6H 4XE5B 1AVYA 2KLUA 4WB4A 2KOGA 2BEZF 1FC2C 2Q1KA 2OYHB 4Y99C 1W5CE 3JSVC 1IO3A 1QN2A 1M7LA 3I56P 1NTZE 4AYCA 1H89A 3IFMA 1N7LA 2KIKA 3ZOYA 4PD4D 3SXTA 3A0BV 3E1IA 2FYZA 2WQYC 2BCNB 2PCBB 5AURA 5E79V 2KSJA 5GTIH 1AJYA 1DX7A 3ZBMA 5AVRB 1YJNP 3H1IE 2KZIA 2KS1A 4WQ9A 4L3GA 1HH0A 1H1OA 2YXRB 2JKVA 1DVHA 5AW2B 3AECC 1U75B 4AUWA 2FXMA 2FYNB 1S1CX 2XDJA 4YE1A 1KQSO 2JDIH 1M1JB 1M70A 2K9JB 1ZXGA 1LTIC 4DOJA 5AW7B 2N9YB 2O1JA 4IFMA 5KTBA 1CTZA 1QL4A 1CSXA 2GIWA 4JBZA 2OGUA 1G2CB 3P8CE 1YI2P 3OCDB 1CTJA 1ZP0C 1LTGC 2N1TB 1FZCA 3SVWA 1NTKE 2YKOA 1FDIA 2IZ0A 2ZYDA 1U7JA 4XXLA 4K3IA 1C2RA 1FS0E 1Q81Q 2HODB 1CCHA 3L71E 1RE4A 4HYTB 3DP5A 2CPBA 1VQPP 3WU2H 2QEXP 5DJTB 3L75J 4H44C 5CICB 3C9IA 3OAKA 4XYDB 1LWUC 1PP9E 2E5TA 1EQ7A 3OW2O 3RMZA 5KLIB 2V4HA 1AYGA 3GF7A 1LT9A 2ZT9D 3H1KE 1GQ1A 2GM4A 1ETPA 2FYUK 1JM0A 1NGMB 5APSA 3RK3B 4H0LD 2Q9IA 4NPDA 2QRXA 1KC8Q 1JCCA 1CCRA 1DW0A 3H25A 1BCCG 3A5TA 3N7NA 1GK4A 2FYUD 5B66H 5APUA 3A9FA 1FCDC 2K9YA 1DIPA 2B4ZA 2NRGA 2YIUB 1KX2A 2CA3B 1X0TA 2IYOA 3HE4B 4WQEA 2B0ZB 3WFDC 2PRRA 2KZJA 2RKLA 1KB9E 1VF5B 3NWVA 1I8OA 1BE3J 3KPEA 1CORA 1HJBA 1PGOA 3TGUE 5L8RJ 1J1DC 3MIWA 3GHGA 4H13C 3HD7A 2BGVX 3MK7C 1NKNA 2A06D 5K5GB 1EDIA 1HGVA 4EIJA 1P84E 1IFNA 3V2QA 1FDOA 3P32A 2B87A 2XNXA 3S4RA 3TYYA 1NTMK 1OVVA 3L36A 4I7ZB 3CXHE 4FA5A 3AE8C 1DW2A 3H1IG 3HTKB 4H0KA 3PXTA 1YFCA 3AEDC 3RK2C 2W83C 5GTHE 1CIFA 4QAOA 5GTIV 3FX0A 2NPSA 4Z1MH 3B5NA 3HD7B 3AE4C 3HQ6A 2E43A 1NTMD 3CL3D 3HUSB 3KXDA 1NO4A 1AVOA 4W7YA 2BASA 3B4SA 1NTZJ 2JO1A 3CCEP 2E74C 1JB0J 3AEAC 3F89A 1IK9A 3CCJP 2IPPA 2YQBA 1FJKA 5CCGA 1JO5A 2FKWB 1NTKG 4UB6E 1ZMEC 3HRNA 4FA1A 1C6RA 5KKZB 3RGUA 4NFGB 2D2CC 1A02J 1FBMA 2B89A 3L71G 4ZKPA 1JY2O 3GLMA 2I8FA 4LC1A 2QJYB 1CEDA 1T3JA 2QE7H 2FFDC 1YNRA 1MKMA 1SQXG 1KYOE 1B7VA 5KJ7D 3PLNA 3A0BE 3R4YA 3L73G 2K1AA 2OZ1B 1VQ6P 1PP9G 3WU2V 1YBKA 4WY4D 1VQKP 3AEBC 1QVFO 2I1KA 1K05A 1EDJA 4AQRD 2WSFJ 3HE5A 2L5GB 1IJDB 5CIEB 3H1KG 3KZIV 3MZWB 1NTKJ 1Q2NA 3L72D 1JY3O 2ZOOA 2OYHC 5AVSB 1RF1A 1BGYE 1OW7A 5DJUB 3L71J 1L4AD 5TJHA 1CIHA 3WC8A 1YYCA 2ZYGA 1QL3A 2RN0A 3H1LG 1GL2A 1NOHA 2YKPA 1M8OB 2M0BA 1PV3A 3H1HD 1PP9J 1E2RA 2UWJE 3R2PA 2R3CA 1BSHA 3KYQA 2P2UA 1FU1A 1HTLC 4B86A 1T8ZA 3CCVP 1NJIQ 2FXOA 2C1DA 3AE9C 1F1FA 2BH5X 2O01H 5CMZA 2Y0CA 1HGZA 1S5LV 2C9XB 1YITP 3LW5H 2N9JA 5APVA 4PJ0V 4D6TG 1T6AA 2P58A 1KILE 2O01J 2J59M 3PRJA 1EZVD 1NMIA 5APTA 3CXHW 1SQBK 2N1TC 4UB8V 3SWYA 1LS9A 5B6QA 1AFOA 2I8DA 4RO0A 5CIHB 2YK3A 3NFQA 3TGUJ 2PACA 1OX3A 1AA0A 1GK6A 1P84H 2C1DB 4PD4E 3L4OA 2PP6A 1URQA 2CA4B 2QVAA 1SQBD 5AW5B 1SQPK 1N73B 3B8EB 3CXHH 4ZKUA 4AANA 1FI9A 1IC2A 1NNOA 4HJGH 3EWKA 5GTHH 1S2EA 1FZCC 1USEA 3SFDC 3C2CA 1L0NK 1LTJA 1SQPD 5AW9B 1LC2A 2YXQB 1KORA 3RK3C 1RZ6A 2Z4EA 1RE4C 1URQB 1OAEA 4W80A 3SLEA 3VYIA 1Q82Q 1KYOW 3BCCJ 3ITKA 1L0ND 3UIAA 3PH2B 4GT1A 3RL0D 1IFPA 3BATA 2WSCH 4IL6X 5CCHD 3PTZA 1S9KD 3L70D 1LTJB 4PV1D 1CSWA 2RMZA 3L74D 3PP5A 1KYOH 2CPSA 1LFMA 2LR2A 4PW9B 3O6QA 2V07A 3A0BH 2WSCJ 1BGYG 1M57D 2AEMA 3PH0A 1FOSE 4LGDE 4GOEA 1EXIA 1SLQA 4JPZB 1AQTA 2ZXEB 4I2LC 1NU1G 5CBNA 2V08A 4OH8B 1MFTA 3SSUA 1VQLP 2L91A 3PXWA 1MV8A 3CWBD 1PPJE 1RAPA 1XTCC 2YMYA 1H9XA 1A02F 1K8AQ 1SP4A 3HD7C 2WT7A 1KIBA 3DMIA 1KQGB 2E75B 1JMBA 1M1KQ 2FYUE 4N6JA 1H0TB 1KILB 3V2PA 2Z5HA 3GG2A 3X39A 1SFCA 3K5BA 1H32B 2JJLA 4QMAA 3WFBC 4WQAA 1P84I 3WMM0 3C1LA 3KZIE 2OYIA 5B5EV 1L9JC 4FA9A 1PIXA 2NPSC 3ABVC 3BRTB 3CCUP 2DGEA 1OW8A 2WT7B 451CA 1CIEA 2QJYC 4O1QA 3G9RA 3CI9A 3JC22 4GEDB 4H44D 4WBAA 1GD2E 2B10B 3D70A 2W90A 3WUIA 2YO3A 1A2SA 3JBTB 4L74A 1DVVA 5CCGC 3G4SP 1BDCA 4R4MA 1BE3E 2XZRA 4Y28J 5C9MA 3RN0A
chains in the Genus database with same CATH topology
1VYDA 4XYDB 3VYMA 3RMZA 5KLIB 2FWLA 1CRIA 1AYGA 1RZ5A 3H1JD 1R0QA 1NTZD 1IRWA 2XTSB 5CYTR 1KX7A 1GQ1A 1ETPA 3ZOOA 3HQ7A 1NMLA 2DVHA 1CHJA 4KMGA 155CA 1U74B 4A7PA 3ZOWA 1H33B 1H31A 4J20A 1CCRA 4EICA 1CSVA 1DW0A 2N3BA 5KLVD 1CRYA 1P84D 2HV4A 4UB6V 2FYUD 2JWAA 3A9FA 3PHLA 3TYIA 3OA8A 2BCCD 1FCDC 2B4ZA 2YIUB 1KX2A 3PXSA 1GJQA 2CA3B 2GC4D 2BH4X 4D6TD 5C0ZA 1NIRA 1FI7A 3HQ9A 2ZBOA 4WQEA 2B0ZB 1CRCA 3CX5D 3WFDC 1H32A 3NWVA 1CO6A 1I8OA 3CU4A 1GIWA 1CORA 4FAVA 4RJTA 1CYJA 3VNWA 1L0LD 5B66V 1FJ0A 1H31B 4PWAA 2BGVX 2ZZS1 3MK7C 2A06D 1N9CA 2Q3EA 3OCDA 2C1VA 3OA8B 1AOFA 3L71D 4FA5A 4JCGA 3RN1A 1DW2A 3HQ8A 3WFEC 4H0KA 3PXTA 1YFCA 5CIBB 1CIFA 1WEJF 4QAOA 5IY51 4EIFA 5GTIV 3MK7B 4O1WA 1F1CA 1EB7A 1YEBA 3HQ6A 1YIQA 1NTMD 2JTIB 4V2KA 1KYOD 3FWLA 1AOQA 1E8EA 1DIIC 1FI3A 1IQCA 2MTAC 3L4MA 2Y0EA 1C75A 2YQBA 4LJIA 1H9YA 4L3HA 4WQCA 1CYIA 1DW1A 1H33A 2QJKB 1I55A 4FA1A 1C6RA 5KKZB 4NFGB 2JQRA 2KNCB 1KB0A 4DY9A 2I8FA 1SQVD 2QJYB 1CEDA 1BL9A 1BGYD 1YNRA 4FA4A 1S6VB 1B7VA 2CXBA 3PLNA 1KB9D 3VRDA 1M6ZA 3ZIYA 4H0JA 1NU1D 3TF5A 1I8PA 2OZ1B 5H2FV 2N18C 1QYZA 3O1YA 1YCCA 3WU2V 3TGUD 4Y5RA 2B12B 1DT1A 2AXTV 2GC7D 5CIEB 1SQQD 3KZIV 1LMSA 1CTYA 2VHDA 1GKSA 4MU8A 1I6EA 3L72D 4AAOA 2ZOOA 1JDLA 1CRJA 2CE0A 5TJHA 2D0WA 5KAFV 1CIHA 4WQ8A 3CXHD 3WC8A 1QL3A 2RN0A 1ZZHA 1CRHA 1IZL0 5DF5A 2YCCA 3M97X 1C52A 3H1HD 1DW3A 5CIGB 1E2RA 1MG3D 4AAMA 1GU2A 2EXVA 3BCCD 1K3HA 4AALA 1YICA 1KV9A 1CIGA 2C8SA 1MZ4A 1DIQC 3O0RC 2C1DA 2QJPB 1F1FA 2BH5X 2Y0CA 2CE1A 1S5LV 2C9XB 3ZOXA 4EIDA 2N9JA 2LIRA 3NBTA 4PJ0V 1C6SA 1HJ4A 4WQ7A 3PRJA 1EZVD 2PCCB 3O20A 4RSZA 1NMIA 1I6DA 3CXHW 2B11B 4UB8V 3CX5W 1I54A 1FHBA 1HZVA 1LS9A 3DR0A 5B6QA 5EXQA 5CIHB 3VMAA 1YEAA 2YK3A 2PACA 1LC1A 2OZ1A 2C1DB 3L4OA 1HH7A 2CA4B 3ZCFA 1IRVA 3ORVA 1SQBD 2Y0DA 1FOCA 5CIDB 1M60A 4AANA 1FI9A 1NNOA 3SJLA 3GW6A 1W5CT 1W2LA 1ZRTD 1MG2D 5CIFB 1A56A 1RAQA 1CXCA 1BCCD 3C2CA 4EDFA 1SQPD 1OCDA 2C1UA 1CC5A 4FANA 1HROA 1LC2A 4L1QA 1RZ6A 2AIUA 5DJQC 1HRCA 2ORLA 1OAEA 4P4QB 3SLEA 2FRCA 3KHUA 1KYOW 2IBZD 3CP5A 3ITKA 1C7MA 5GTHV 1L0ND 2GB8B 3PH2B 1CNOA 3RLMA 4WQBA 1N90A 1CSUA 1WVEC 4U3FD 1CRGA 1J3SA 3PTZA 3L70D 4AX3A 2N18B 1PPJD 1CSWA 1QKSA 2RMZA 3L74D 2N9IA 351CA 2D0SA 5DJQB 1C2NA 1C6OA 1LFMA 4N0KA 1L9BC 4GYDA 4PW9B 3A0HV 1K3GA 2V07A 2ZONG 3H1ID 3TDKA 1AKKA 3L75D 3WFCC 1A8CA 2BPBB 1IO3A 1QN2A 2V08A 5DFSA 4FB1A 2L91A 3PXWA 3ZOYA 4PD4D 3SXTA 3A0BV 5KAIV 3CWBD 2BCNB 2L4DA 2PCBB 5AURA 5E79V 4IL6V 1RAPA 1CXAA 1HJ5A 1H9XA 3ZBMA 1CHHA 1KIBA 1GDVA 2LITA 3DMIA 2MHMA 5TISV 1COTA 2KS1A 1NTKD 2ZXYA 4WQ9A 4L3GA 1H1OA 1DVHA 3GG2A 2BLFB 1N15A 1HJ3A 3X39A 2AI5A 1U75B 2FYNB 1H32B 3CYTI 4YE1A 1SQXD 3WFBC 4WQAA 1E29A 1M70A 2K9JB 1BE3D 2N9YB 3NBSA 4Q5PA 2QG4A 3L73D 1CTZA 1L9JC 1CSXA 1QL4A 2GIWA 4FA9A 1CHIA 5B5EV 4WQDA 1PP9D 2C2CA 2DGEA 3OCDB 1CTJA 451CA 1CIEA 3SVWA 4O1QA 1HCMA 3H1KD 1I5TA 3SWSA 1CYCA 1YTCA 4GEDB 4EIEA 2O3JA 2N3YA 4XXLA 4K3IA 1C2RA 2B10B 1CCHA 3O5CA 3WUIA 1HZUA 3DP5A 1A2SA 3JBTB 1DVVA 1N50A 5CICB 5C9MA 3H1LD 3RN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYD A;  4XYD B;  3VYM A;  3RMZ A;  5KLI B;  2FWL A;  1CRI A;  1AYG A;  1RZ5 A;  3H1J D;  1R0Q A;  1NTZ D;  1IRW A;  2XTS B;  5CYT R;  1KX7 A;  1GQ1 A;  1ETP A;  3ZOO A;  3HQ7 A;  1NML A;  2DVH A;  1CHJ A;  4KMG A;  155C A;  1U74 B;  4A7P A;  3ZOW A;  1H33 B;  1H31 A;  4J20 A;  1CCR A;  4EIC A;  1CSV A;  1DW0 A;  2N3B A;  5KLV D;  1CRY A;  1P84 D;  2HV4 A;  4UB6 V;  2FYU D;  2JWA A;  3A9F A;  3PHL A;  3TYI A;  3OA8 A;  2BCC D;  1FCD C;  2B4Z A;  2YIU B;  1KX2 A;  3PXS A;  1GJQ A;  2CA3 B;  2GC4 D;  2BH4 X;  4D6T D;  5C0Z A;  1NIR A;  1FI7 A;  3HQ9 A;  2ZBO A;  4WQE A;  2B0Z B;  1CRC A;  3CX5 D;  3WFD C;  1H32 A;  3NWV A;  1CO6 A;  1I8O A;  3CU4 A;  1GIW A;  1COR A;  4FAV A;  4RJT A;  1CYJ A;  3VNW A;  1L0L D;  5B66 V;  1FJ0 A;  1H31 B;  4PWA A;  2BGV X;  2ZZS 1;  3MK7 C;  2A06 D;  1N9C A;  2Q3E A;  3OCD A;  2C1V A;  3OA8 B;  1AOF A;  3L71 D;  4FA5 A;  4JCG A;  3RN1 A;  1DW2 A;  3HQ8 A;  3WFE C;  4H0K A;  3PXT A;  1YFC A;  5CIB B;  1CIF A;  1WEJ F;  4QAO A;  5IY5 1;  4EIF A;  5GTI V;  3MK7 B;  4O1W A;  1F1C A;  1EB7 A;  1YEB A;  3HQ6 A;  1YIQ A;  1NTM D;  2JTI B;  4V2K A;  1KYO D;  3FWL A;  1AOQ A;  1E8E A;  1DII C;  1FI3 A;  1IQC A;  2MTA C;  3L4M A;  2Y0E A;  1C75 A;  2YQB A;  4LJI A;  1H9Y A;  4L3H A;  4WQC A;  1CYI A;  1DW1 A;  1H33 A;  2QJK B;  1I55 A;  4FA1 A;  1C6R A;  5KKZ B;  4NFG B;  2JQR A;  2KNC B;  1KB0 A;  4DY9 A;  2I8F A;  1SQV D;  2QJY B;  1CED A;  1BL9 A;  1BGY D;  1YNR A;  4FA4 A;  1S6V B;  1B7V A;  2CXB A;  3PLN A;  1KB9 D;  3VRD A;  1M6Z A;  3ZIY A;  4H0J A;  1NU1 D;  3TF5 A;  1I8P A;  2OZ1 B;  5H2F V;  2N18 C;  1QYZ A;  3O1Y A;  1YCC A;  3WU2 V;  3TGU D;  4Y5R A;  2B12 B;  1DT1 A;  2AXT V;  2GC7 D;  5CIE B;  1SQQ D;  3KZI V;  1LMS A;  1CTY A;  2VHD A;  1GKS A;  4MU8 A;  1I6E A;  3L72 D;  4AAO A;  2ZOO A;  1JDL A;  1CRJ A;  2CE0 A;  5TJH A;  2D0W A;  5KAF V;  1CIH A;  4WQ8 A;  3CXH D;  3WC8 A;  1QL3 A;  2RN0 A;  1ZZH A;  1CRH A;  1IZL 0;  5DF5 A;  2YCC A;  3M97 X;  1C52 A;  3H1H D;  1DW3 A;  5CIG B;  1E2R A;  1MG3 D;  4AAM A;  1GU2 A;  2EXV A;  3BCC D;  1K3H A;  4AAL A;  1YIC A;  1KV9 A;  1CIG A;  2C8S A;  1MZ4 A;  1DIQ C;  3O0R C;  2C1D A;  2QJP B;  1F1F A;  2BH5 X;  2Y0C A;  2CE1 A;  1S5L V;  2C9X B;  3ZOX A;  4EID A;  2N9J A;  2LIR A;  3NBT A;  4PJ0 V;  1C6S A;  1HJ4 A;  4WQ7 A;  3PRJ A;  1EZV D;  2PCC B;  3O20 A;  4RSZ A;  1NMI A;  1I6D A;  3CXH W;  2B11 B;  4UB8 V;  3CX5 W;  1I54 A;  1FHB A;  1HZV A;  1LS9 A;  3DR0 A;  5B6Q A;  5EXQ A;  5CIH B;  3VMA A;  1YEA A;  2YK3 A;  2PAC A;  1LC1 A;  2OZ1 A;  2C1D B;  3L4O A;  1HH7 A;  2CA4 B;  3ZCF A;  1IRV A;  3ORV A;  1SQB D;  2Y0D A;  1FOC A;  5CID B;  1M60 A;  4AAN A;  1FI9 A;  1NNO A;  3SJL A;  3GW6 A;  1W5C T;  1W2L A;  1ZRT D;  1MG2 D;  5CIF B;  1A56 A;  1RAQ A;  1CXC A;  1BCC D;  3C2C A;  4EDF A;  1SQP D;  1OCD A;  2C1U A;  1CC5 A;  4FAN A;  1HRO A;  1LC2 A;  4L1Q A;  1RZ6 A;  2AIU A;  5DJQ C;  1HRC A;  2ORL A;  1OAE A;  4P4Q B;  3SLE A;  2FRC A;  3KHU A;  1KYO W;  2IBZ D;  3CP5 A;  3ITK A;  1C7M A;  5GTH V;  1L0N D;  2GB8 B;  3PH2 B;  1CNO A;  3RLM A;  4WQB A;  1N90 A;  1CSU A;  1WVE C;  4U3F D;  1CRG A;  1J3S A;  3PTZ A;  3L70 D;  4AX3 A;  2N18 B;  1PPJ D;  1CSW A;  1QKS A;  2RMZ A;  3L74 D;  2N9I A;  351C A;  2D0S A;  5DJQ B;  1C2N A;  1C6O A;  1LFM A;  4N0K A;  1L9B C;  4GYD A;  4PW9 B;  3A0H V;  1K3G A;  2V07 A;  2ZON G;  3H1I D;  3TDK A;  1AKK A;  3L75 D;  3WFC C;  1A8C A;  2BPB B;  1IO3 A;  1QN2 A;  2V08 A;  5DFS A;  4FB1 A;  2L91 A;  3PXW A;  3ZOY A;  4PD4 D;  3SXT A;  3A0B V;  5KAI V;  3CWB D;  2BCN B;  2L4D A;  2PCB B;  5AUR A;  5E79 V;  4IL6 V;  1RAP A;  1CXA A;  1HJ5 A;  1H9X A;  3ZBM A;  1CHH A;  1KIB A;  1GDV A;  2LIT A;  3DMI A;  2MHM A;  5TIS V;  1COT A;  2KS1 A;  1NTK D;  2ZXY A;  4WQ9 A;  4L3G A;  1H1O A;  1DVH A;  3GG2 A;  2BLF B;  1N15 A;  1HJ3 A;  3X39 A;  2AI5 A;  1U75 B;  2FYN B;  1H32 B;  3CYT I;  4YE1 A;  1SQX D;  3WFB C;  4WQA A;  1E29 A;  1M70 A;  2K9J B;  1BE3 D;  2N9Y B;  3NBS A;  4Q5P A;  2QG4 A;  3L73 D;  1CTZ A;  1L9J C;  1CSX A;  1QL4 A;  2GIW A;  4FA9 A;  1CHI A;  5B5E V;  4WQD A;  1PP9 D;  2C2C A;  2DGE A;  3OCD B;  1CTJ A;  451C A;  1CIE A;  3SVW A;  4O1Q A;  1HCM A;  3H1K D;  1I5T A;  3SWS A;  1CYC A;  1YTC A;  4GED B;  4EIE A;  2O3J A;  2N3Y A;  4XXL A;  4K3I A;  1C2R A;  2B10 B;  1CCH A;  3O5C A;  3WUI A;  1HZU A;  3DP5 A;  1A2S A;  3JBT B;  1DVV A;  1N50 A;  5CIC B;  5C9M A;  3H1L D;  3RN0 A; 
#chains in the Genus database with same CATH topology
 1NTM E;  5M1B A;  4C46 A;  3H6P A;  1EC5 A;  3VYM A;  1VQ9 P;  4RES B;  1IFM A;  3L37 A;  2ZYA A;  2FWL A;  1ZV8 A;  1RZ5 A;  4DJG A;  3H1J D;  5KAI E;  1N7S A;  5KLV K;  2XTS B;  3ZOO A;  3HQ7 A;  1S5L E;  1CHJ A;  155C A;  3VTP C;  5TIS E;  4PJ0 E;  1KYO I;  5APX A;  3U59 A;  1H33 B;  3KQG A;  3TSI A;  4J20 A;  2N3B A;  5KLV D;  2KI7 B;  4UB8 E;  3AE1 C;  1X79 B;  2HV4 A;  4UB6 V;  2JWA A;  3PHL A;  1KFM A;  1LTS C;  2BCC D;  3FXE A;  3PXS A;  1L0L K;  5C0Z A;  2ZBO A;  4H13 D;  1RF1 C;  1VQ5 P;  1N7S B;  3CX5 D;  2R44 A;  4L75 A;  2IBZ G;  2M3E A;  1M1J A;  1TU3 F;  2K9J A;  3GMA A;  2ZT9 B;  1GL2 C;  3NMD A;  1L0L D;  3L35 A;  1FJ0 A;  1G2C A;  4H0L B;  3MUD C;  2Q3E A;  3OCD A;  1PGJ A;  2N1T A;  2ZVO B;  2H43 A;  1PPJ G;  3E1R A;  1HWT C;  2LXB A;  2HOD A;  4JCG A;  3L75 G;  1FAV A;  4ASW A;  2H88 C;  4EIF A;  5IY5 1;  3H1H E;  4O1W A;  2E74 D;  2C9N Y;  1F1C A;  1EB7 A;  1N8R Q;  5C39 A;  2KNC A;  1YIQ A;  2JTI B;  2ITA A;  1Q7Y Q;  3CX5 I;  1E8E A;  1DII C;  1LTT C;  3II6 A;  3WUT A;  2OYO A;  1SQV K;  3AEF C;  2D2C D;  3VMX A;  1BSN A;  1C75 A;  4LJI A;  1WMK A;  1H9Y A;  4L3H A;  1CYI A;  1URQ C;  3V4Q A;  1DW1 A;  3VP9 A;  5BVZ A;  2QJK B;  1I55 A;  2FYU J;  2WPS A;  4JF7 A;  2E76 C;  1EZV E;  2KNC B;  4DY9 A;  2M8R A;  1SQV D;  3B71 A;  3KZI H;  1YTZ T;  2KUB A;  1R5S A;  4BWN A;  3HE4 A;  1BE3 G;  3M9B A;  3VRD A;  1NKZ B;  1LTJ C;  4H0J A;  2CK3 H;  3TF5 A;  1I8P A;  2KB7 P;  3O1Y A;  1YCC A;  2YO2 A;  3FWN A;  1RE3 A;  3E7K A;  1H88 A;  5AVX B;  1SQB E;  2AXT V;  1KTM A;  3MGN A;  1E5W A;  3IF4 A;  1LMS A;  1CTY A;  4MU8 A;  3V4W A;  4HH2 A;  1KV4 A;  1WRG A;  1JMM A;  1JDL A;  2I1J A;  1KN7 A;  3D6Z A;  4TLF A;  1AQ5 A;  1ZZH A;  3HTK A;  1CRH A;  2C0X A;  5B5E E;  2QJP C;  2YCC A;  3M97 X;  5KAI H;  1C52 A;  1VL2 A;  1IK7 A;  1NTM J;  2FY8 A;  5AVT B;  3Q1M A;  1S5L H;  3Q3D A;  1MG3 D;  4WY4 B;  1NTZ G;  1L0N E;  2W6A A;  1GU2 A;  2EXV A;  1SQQ E;  5TIS H;  3HUS A;  4AAL A;  4PJ0 H;  1YIC A;  1KV9 A;  2B88 A;  2W27 A;  4EI2 A;  2C8S A;  4JYB A;  1MZ4 A;  1DIQ C;  4UB8 H;  3CLQ A;  3L70 E;  2IBZ I;  3CME P;  3G71 P;  1Z56 A;  2ZAE B;  1OIP A;  1C6S A;  3BRV B;  1HJ4 A;  2B11 B;  3BCC E;  3DR0 A;  1S72 P;  1K73 Q;  1SVF A;  3EFF K;  1SFC C;  1YHQ P;  2OZ1 A;  3T97 B;  1PGP A;  2W8Z A;  2OTK E;  3CPW O;  2OYI C;  1M60 A;  1CZQ A;  2O1K A;  3M06 A;  5KAF E;  2HR3 A;  3M0A A;  3I5C A;  1RAQ A;  1BCC D;  1UII A;  3RBX A;  4BRY B;  4GDO A;  2C1U A;  4FAN A;  1J1E C;  1U7M A;  2WPV B;  2WSF H;  1LNQ A;  5AW4 B;  3H1H J;  2GUS A;  2WMM A;  1HJ0 A;  4P4Q B;  2V7Q J;  3CP5 A;  3VP8 A;  2KXP B;  2GB8 B;  1OVU A;  3RLM A;  1DH3 A;  2IDB A;  3MD0 A;  2DW3 A;  3H32 B;  1ZRT E;  2BEQ D;  1WVE C;  3A7O A;  2HLO A;  1J3S A;  1N7S C;  1VQ8 P;  5BU5 A;  4O9B A;  2N18 B;  1K9M Q;  5DJQ B;  1FOS F;  3AE5 C;  4N0K A;  2ZXX A;  2ZT9 C;  2ZON G;  3H1I D;  1AKK A;  1YQ4 C;  3P7K A;  1A8C A;  3MUD A;  4TT3 H;  1G1J A;  1R5L A;  3TGU G;  1GMJ A;  1RF0 A;  2J58 A;  2ZVN B;  1NTK K;  3HD7 D;  4U3F E;  3RL0 B;  2FYN C;  1SQQ G;  1SQB J;  5KAI V;  3S1K A;  1M1J C;  3P8M C;  3BVH A;  1GDT A;  1CXA A;  1N73 A;  1HJ5 A;  3P8C D;  4PV1 B;  5TIS V;  1KB9 H;  1GDV A;  2LIT A;  1SQX K;  3D71 A;  5B5E H;  1M90 Q;  1NTK D;  3I55 P;  2BCC E;  1Q86 Q;  1T3U A;  2BLF B;  1N15 A;  2QIW A;  2NPS D;  3CCQ P;  3CYT I;  3B5N D;  2AXT E;  1SQX D;  3Q5R A;  1E29 A;  3BCC G;  4Q5P A;  2A45 G;  2QG4 A;  5AW6 B;  3L73 D;  1L0N J;  2KSE A;  1L0L E;  1SQQ J;  4WQD A;  1PP9 D;  3OA7 A;  3QH9 A;  3U1A A;  4IFD K;  3WUV A;  3H1K D;  3QWO C;  3IN6 A;  1I5T A;  3L70 J;  1CYC A;  4EIE A;  2O3J A;  5KLI C;  5CCG D;  2N3Y A;  2KYV A;  3A0H E;  1RQV A;  1HZU A;  3VMZ A;  2A45 H;  1LT1 A;  1OWA A;  2RH0 A;  3H1L D;  4NPE A;  1JTH B;  4IFF A;  1VYD A;  4EYY Q;  5CHX A;  1KD1 Q;  2R32 A;  3V2N A;  4UB6 H;  1CRI A;  2H8P D;  2N9B A;  1GTW A;  2YIU C;  1PFI A;  1OFC X;  1PZQ A;  5KAF H;  2IFN A;  1VF5 C;  4KMG A;  1GZL A;  4H44 B;  3CCR P;  2NZ2 A;  1U74 B;  1RE3 C;  1H31 A;  1ZW0 A;  4EIC A;  1LWU B;  5AVQ B;  1CSV A;  1GU5 A;  1CRY A;  2P10 A;  1P84 D;  3PJS K;  1SQV E;  3TYI A;  3OA8 A;  4OGQ B;  2R5B A;  2GC4 D;  4D6T D;  1GL2 D;  1H0T A;  1NIR A;  1KIL A;  1FI7 A;  3HQ9 A;  4ASV A;  2W6B A;  1CRC A;  1CSB A;  1H32 A;  1FZF A;  1CO6 A;  3CU4 A;  2M3B A;  4I7Z C;  4RJT A;  2WIT A;  1VDF A;  3AE2 C;  1H31 B;  2ZZS 1;  3VOP A;  1N9C A;  1KB9 I;  4U3F G;  2WPQ A;  1OMI A;  3HUS C;  3OA8 B;  4MN4 C;  2K37 A;  2KK7 A;  3IR9 A;  1J1D B;  3WFE C;  1YTZ I;  4H13 B;  3WUU A;  2Z5I A;  5CIB B;  3LID A;  3MK7 B;  3U1C A;  4M3L A;  4WVZ A;  1BDD A;  3BAS A;  5KKZ C;  4GOD A;  3CXH I;  2A06 E;  1KYO D;  3FWL A;  5AVW B;  3RL0 g;  3H1J J;  3CC7 P;  1LP1 A;  1FI3 A;  4U3F J;  1NWQ A;  1QLE D;  1JY3 P;  1LTB C;  2E76 D;  3IAO A;  2MTA C;  3L4M A;  3SWK A;  1XTG B;  1VQM P;  3AE7 C;  2IFM A;  2MKV A;  2A45 I;  4WQC A;  5KLV J;  1H33 A;  1X22 A;  3A3Y B;  1CI6 B;  1NU1 K;  2AXT H;  2M5A B;  2BCC J;  2JQR A;  4GKG A;  4RKU J;  3TNU B;  1AV1 A;  2W6J H;  5AW3 B;  2Y9Z A;  3EFG A;  4PD4 H;  1PGQ A;  1KQL A;  1BGY D;  4FA4 A;  2Y9Y A;  2HPC B;  2CXB A;  1LP1 B;  4KJM A;  1K04 A;  3M91 A;  1NU1 D;  4DT0 A;  2WSE H;  5H2F V;  2N18 C;  5B66 E;  1QYZ A;  2IYP A;  1L0L J;  4GOF A;  2B12 B;  3D0W A;  3CMA P;  1EDK A;  2VHD A;  2WSE J;  2FFD B;  1GKS A;  1YJ9 P;  4AAO A;  1KFN A;  1NVO A;  2XKM A;  4HKZ H;  2CE0 A;  4JYC A;  1HUC A;  5CJ4 A;  1S5L X;  5KAF V;  1IZN B;  4WQ8 A;  1USD A;  1KZU B;  4C7N A;  3CCL P;  5AVY B;  1IZL 0;  2E42 A;  2YMK A;  1DW3 A;  5CIG B;  4PV1 C;  4EOT A;  5AVU B;  4XA4 A;  4AAM A;  1K3H A;  2QM8 A;  3USS A;  1CIG A;  2AXC A;  2P67 A;  1DD3 A;  3FGA D;  3L72 E;  3O0R C;  3RK2 D;  1IO4 A;  1RF0 C;  4N78 D;  1CW5 A;  2KLV A;  2WWW A;  1DD4 A;  4C7N B;  3RBZ A;  1DEB A;  1OW6 A;  2FYU G;  1W2B O;  3ZOX A;  2J5U A;  1Y47 A;  2QA4 P;  3NBT A;  1SQV J;  1N73 C;  2IZ1 A;  2PCC B;  1SFC D;  3O20 A;  2XV5 A;  4RSZ A;  1JCD A;  1ZLL A;  1VQ7 P;  2G3A A;  1HZV A;  1MFZ A;  1W2E A;  2FBW C;  5EXQ A;  1JEK A;  1LC1 A;  2OTL P;  2C9L Y;  1HH7 A;  2A06 G;  3ZCF A;  1T2K C;  1IRV A;  2Y0D A;  2HYN A;  4L76 A;  3GW6 A;  1H8A A;  2KS1 B;  4PD4 I;  5CIF B;  2MJZ A;  1FE6 A;  3NTN A;  2WTY A;  1HRO A;  1S4X A;  3O8Z A;  1SQX E;  1NTM G;  5EFW B;  5KJ7 A;  1HRC A;  1Y8A A;  3OJA B;  3L73 E;  2FRC A;  2IBZ D;  1GW3 A;  1N7S D;  4WY4 A;  1JY2 N;  3M9H A;  1FZC B;  2P1J A;  4OGQ C;  1OVR A;  1CSU A;  3V5B A;  5AVV B;  1ZOY C;  1N2D C;  4AX3 A;  4DZO A;  1SQP E;  1PPJ D;  1QGK B;  1QKS A;  2N9I A;  1UIX A;  3F5H A;  2JWD A;  3MTU E;  5APW A;  1C2N A;  1L4A A;  1C6O A;  1L9B C;  4GYD A;  3A0H V;  3LIE A;  1K3G A;  2QSI A;  3TDK A;  3H1L E;  3L75 D;  3MP7 B;  1JNM A;  1X8Y A;  3WFC C;  3W67 A;  5CJ0 A;  1JY3 N;  2E75 C;  2K88 A;  2BPB B;  2OAR A;  4C7R A;  3Q2Y A;  2IX7 C;  1RQU A;  2Q6Q A;  3VN0 A;  2YKQ A;  3V6I A;  5DFS A;  1LT9 B;  1FJP A;  1KIL C;  4FB1 A;  4BXL A;  1S9K E;  3T97 A;  3AEG C;  2L4D A;  3L74 E;  2PFX A;  4YTP C;  4IL6 V;  1L4A B;  4N3Y B;  2N1T D;  3L72 G;  1RH5 B;  1CHH A;  2MHM A;  1COT A;  1QEX A;  2ZXY A;  3CCS P;  5APQ A;  1BCC J;  2VRS A;  4D6T E;  3SWF A;  1YIJ P;  1S3J A;  2LKM A;  1HJ3 A;  5H2F E;  2AI5 A;  4BRY A;  2XU6 A;  3H1H G;  3S9O A;  5AW1 B;  2JR8 A;  2ZFC A;  1OZH A;  1BE3 D;  3GHG B;  3NBS A;  1JUN A;  3CWB E;  3GF3 A;  1DEE G;  1IFJ A;  2QM7 A;  1CHI A;  1FZG A;  1VQ4 P;  2C2C A;  3L72 J;  2E5Y A;  3M0D A;  4K35 A;  3N4X A;  3RK3 D;  1HCM A;  2B87 B;  3SWS A;  3H32 A;  1YTC A;  3MHV A;  4KHX A;  4JQ0 D;  3AE6 C;  4U7J A;  1FZB A;  2V7Q H;  4K3A A;  3O5C A;  5CBO A;  3CC4 P;  1EZV G;  1NTZ K;  3H1I J;  1N50 A;  2NPS B;  4KT0 J;  3B5N B;  1IFD A;  4XFJ A;  1PL5 A;  1VF5 D;  2B9B A;  1D7M A;  1MZ9 A;  1R0Q A;  1NTZ D;  1YQ3 C;  1IRW A;  1KX7 A;  5CYT R;  1SQB G;  4DCK A;  5E79 E;  1VQO P;  1VQN P;  1NML A;  2DVH A;  2FXP A;  1NAY A;  2H7H A;  2R5D A;  4A7P A;  3ZOW A;  4CPG A;  3L4F A;  5CCH A;  1IFI A;  1R8E A;  1GU4 A;  2WPR A;  1N86 A;  1SQP G;  3ZDM A;  4H0L C;  1FDM A;  1LGH B;  1QL1 A;  1GJQ A;  2BH4 X;  1SQX J;  4HB1 A;  3H1J E;  1NU1 E;  1GIW A;  4FAV A;  3L73 J;  1L0N G;  1CYJ A;  4I1L A;  3VNW A;  1GW4 A;  3HE5 B;  5B66 V;  1HVV A;  1NH4 A;  4PWA A;  4LLH A;  5KLV E;  3H1K J;  3L70 G;  1X9V A;  4Y99 B;  2C1V A;  1RF1 B;  3L74 G;  1AOF A;  1NHL A;  1Y9B A;  4L73 A;  2R3S A;  1SQP J;  1FZA A;  3G6E P;  3L71 D;  4WWI A;  3RN1 A;  3CX5 E;  3HQ8 A;  1GL2 B;  1QL2 A;  3H1L J;  1WEJ F;  4NPF X;  2WSS H;  1YEB A;  3M9Q A;  2C0W A;  1JTH A;  2QJK C;  4V2K A;  4OVN F;  3LW5 J;  3CC2 P;  1AOQ A;  2OTJ P;  2GUV A;  2Q7C A;  3CWB G;  1NYH A;  1IQC A;  3JCU E;  3L74 J;  4N78 E;  1LTA C;  2Y0E A;  4ZNC A;  1ZR2 A;  2H89 C;  2JEE A;  5H2F H;  3A2A A;  1OXZ A;  3AE3 C;  1KQF B;  3V2R A;  1LWU A;  1SS1 A;  2SPZ A;  1KB0 A;  4W7Z A;  4D6T J;  1BL9 A;  1S6V B;  1SQQ K;  2ZJS E;  1KB9 D;  1M6Z A;  3ZIY A;  2JP3 A;  1RY3 A;  4IL6 E;  1EZV I;  3CWB J;  1WT6 A;  3TGU D;  4Y5R A;  3CCM P;  4I6M C;  2YNY A;  5KJ7 C;  1DT1 A;  1M56 D;  1G1I A;  2E76 B;  2GC7 D;  1SQQ D;  5AVZ B;  3TK1 A;  1EDL A;  1KMI Z;  1RHZ B;  3C8V A;  4WY4 C;  1I6E A;  4R4L A;  1CRJ A;  1HF9 A;  2D0W A;  1LT9 C;  3CXH D;  5GTI E;  5BU8 B;  5DF5 A;  2POH A;  1L4A C;  5E79 H;  1MUU A;  2IBZ E;  3H1J G;  3BCC D;  1YJW P;  1NAF A;  1JY2 P;  2K3R A;  2QJP B;  5KLV G;  1J2J B;  2AEJ A;  2CE1 A;  3O6Q B;  1ZR4 A;  3GHG C;  4EID A;  2BCC G;  1EXJ A;  2GA1 A;  2LIR A;  1Q90 D;  2OQQ A;  1CI6 A;  3L75 E;  4WQ7 A;  4OWF A;  1BGY J;  2M5A A;  2O01 N;  3TNU A;  1I6D A;  4ZMD A;  1HBW A;  4YPC A;  1FZE A;  3KDP B;  1T2K D;  3CX5 W;  2HFE D;  1I54 A;  1FHB A;  2WVR A;  3WU2 E;  2HPC A;  1NU1 J;  2PAJ A;  1URQ D;  3VMA A;  1YEA A;  1QX8 A;  3SFE C;  1L0L G;  2AEF A;  3RK2 B;  3NXS A;  3ORV A;  5APY A;  3W68 A;  1FOC A;  5CID B;  3D6Y A;  3B5N C;  3CX5 H;  2WZ7 A;  3SJL A;  1U57 A;  1JOC A;  2FFD A;  4GIF A;  1W5C T;  1W2L A;  1ZRT D;  1MG2 D;  2E74 B;  1A56 A;  3M0D C;  2HG5 D;  1CXC A;  4EDF A;  1SFC B;  3FXD A;  3EQ2 A;  1OCD A;  4YXW H;  1CC5 A;  1LJ2 A;  4YXD C;  2LXC B;  4L1Q A;  3CD6 P;  2AIU A;  3G3Z A;  5DJQ C;  4OGQ D;  2OYI B;  2ORL A;  4IOI H;  5AW0 B;  3Q5P A;  3JCU H;  3KHU A;  3A0H H;  1C7M A;  5GTH V;  1QVG O;  2D2C B;  3Q5S A;  2OYH A;  1CNO A;  1VPC A;  5AW8 B;  4WQB A;  2KP8 A;  2PGD A;  1N90 A;  3RK3 E;  2P7J A;  1J1E B;  2Q3I A;  4U3F D;  1CRG A;  3AEE C;  1BCC E;  1ZN5 A;  3VMY A;  351C A;  2D0S A;  1L2P A;  3RL0 C;  2E75 D;  1SQV G;  1E79 H;  2G8Y A;  5CCH C;  2Q5U A;  1KIL D;  2XND H;  4IL6 H;  4XE5 B;  1AVY A;  2KLU A;  4WB4 A;  2KOG A;  2BEZ F;  1FC2 C;  2Q1K A;  2OYH B;  4Y99 C;  1W5C E;  3JSV C;  1IO3 A;  1QN2 A;  1M7L A;  3I56 P;  1NTZ E;  4AYC A;  1H89 A;  3IFM A;  1N7L A;  2KIK A;  3ZOY A;  4PD4 D;  3SXT A;  3A0B V;  3E1I A;  2FYZ A;  2WQY C;  2BCN B;  2PCB B;  5AUR A;  5E79 V;  2KSJ A;  5GTI H;  1AJY A;  1DX7 A;  3ZBM A;  5AVR B;  1YJN P;  3H1I E;  2KZI A;  2KS1 A;  4WQ9 A;  4L3G A;  1HH0 A;  1H1O A;  2YXR B;  2JKV A;  1DVH A;  5AW2 B;  3AEC C;  1U75 B;  4AUW A;  2FXM A;  2FYN B;  1S1C X;  2XDJ A;  4YE1 A;  1KQS O;  2JDI H;  1M1J B;  1M70 A;  2K9J B;  1ZXG A;  1LTI C;  4DOJ A;  5AW7 B;  2N9Y B;  2O1J A;  4IFM A;  5KTB A;  1CTZ A;  1QL4 A;  1CSX A;  2GIW A;  4JBZ A;  2OGU A;  1G2C B;  3P8C E;  1YI2 P;  3OCD B;  1CTJ A;  1ZP0 C;  1LTG C;  2N1T B;  1FZC A;  3SVW A;  1NTK E;  2YKO A;  1FDI A;  2IZ0 A;  2ZYD A;  1U7J A;  4XXL A;  4K3I A;  1C2R A;  1FS0 E;  1Q81 Q;  2HOD B;  1CCH A;  3L71 E;  1RE4 A;  4HYT B;  3DP5 A;  2CPB A;  1VQP P;  3WU2 H;  2QEX P;  5DJT B;  3L75 J;  4H44 C;  5CIC B;  3C9I A;  3OAK A;  4XYD B;  1LWU C;  1PP9 E;  2E5T A;  1EQ7 A;  3OW2 O;  3RMZ A;  5KLI B;  2V4H A;  1AYG A;  3GF7 A;  1LT9 A;  2ZT9 D;  3H1K E;  1GQ1 A;  2GM4 A;  1ETP A;  2FYU K;  1JM0 A;  1NGM B;  5APS A;  3RK3 B;  4H0L D;  2Q9I A;  4NPD A;  2QRX A;  1KC8 Q;  1JCC A;  1CCR A;  1DW0 A;  3H25 A;  1BCC G;  3A5T A;  3N7N A;  1GK4 A;  2FYU D;  5B66 H;  5APU A;  3A9F A;  1FCD C;  2K9Y A;  1DIP A;  2B4Z A;  2NRG A;  2YIU B;  1KX2 A;  2CA3 B;  1X0T A;  2IYO A;  3HE4 B;  4WQE A;  2B0Z B;  3WFD C;  2PRR A;  2KZJ A;  2RKL A;  1KB9 E;  1VF5 B;  3NWV A;  1I8O A;  1BE3 J;  3KPE A;  1COR A;  1HJB A;  1PGO A;  3TGU E;  5L8R J;  1J1D C;  3MIW A;  3GHG A;  4H13 C;  3HD7 A;  2BGV X;  3MK7 C;  1NKN A;  2A06 D;  5K5G B;  1EDI A;  1HGV A;  4EIJ A;  1P84 E;  1IFN A;  3V2Q A;  1FDO A;  3P32 A;  2B87 A;  2XNX A;  3S4R A;  3TYY A;  1NTM K;  1OVV A;  3L36 A;  4I7Z B;  3CXH E;  4FA5 A;  3AE8 C;  1DW2 A;  3H1I G;  3HTK B;  4H0K A;  3PXT A;  1YFC A;  3AED C;  3RK2 C;  2W83 C;  5GTH E;  1CIF A;  4QAO A;  5GTI V;  3FX0 A;  2NPS A;  4Z1M H;  3B5N A;  3HD7 B;  3AE4 C;  3HQ6 A;  2E43 A;  1NTM D;  3CL3 D;  3HUS B;  3KXD A;  1NO4 A;  1AVO A;  4W7Y A;  2BAS A;  3B4S A;  1NTZ J;  2JO1 A;  3CCE P;  2E74 C;  1JB0 J;  3AEA C;  3F89 A;  1IK9 A;  3CCJ P;  2IPP A;  2YQB A;  1FJK A;  5CCG A;  1JO5 A;  2FKW B;  1NTK G;  4UB6 E;  1ZME C;  3HRN A;  4FA1 A;  1C6R A;  5KKZ B;  3RGU A;  4NFG B;  2D2C C;  1A02 J;  1FBM A;  2B89 A;  3L71 G;  4ZKP A;  1JY2 O;  3GLM A;  2I8F A;  4LC1 A;  2QJY B;  1CED A;  1T3J A;  2QE7 H;  2FFD C;  1YNR A;  1MKM A;  1SQX G;  1KYO E;  1B7V A;  5KJ7 D;  3PLN A;  3A0B E;  3R4Y A;  3L73 G;  2K1A A;  2OZ1 B;  1VQ6 P;  1PP9 G;  3WU2 V;  1YBK A;  4WY4 D;  1VQK P;  3AEB C;  1QVF O;  2I1K A;  1K05 A;  1EDJ A;  4AQR D;  2WSF J;  3HE5 A;  2L5G B;  1IJD B;  5CIE B;  3H1K G;  3KZI V;  3MZW B;  1NTK J;  1Q2N A;  3L72 D;  1JY3 O;  2ZOO A;  2OYH C;  5AVS B;  1RF1 A;  1BGY E;  1OW7 A;  5DJU B;  3L71 J;  1L4A D;  5TJH A;  1CIH A;  3WC8 A;  1YYC A;  2ZYG A;  1QL3 A;  2RN0 A;  3H1L G;  1GL2 A;  1NOH A;  2YKP A;  1M8O B;  2M0B A;  1PV3 A;  3H1H D;  1PP9 J;  1E2R A;  2UWJ E;  3R2P A;  2R3C A;  1BSH A;  3KYQ A;  2P2U A;  1FU1 A;  1HTL C;  4B86 A;  1T8Z A;  3CCV P;  1NJI Q;  2FXO A;  2C1D A;  3AE9 C;  1F1F A;  2BH5 X;  2O01 H;  5CMZ A;  2Y0C A;  1HGZ A;  1S5L V;  2C9X B;  1YIT P;  3LW5 H;  2N9J A;  5APV A;  4PJ0 V;  4D6T G;  1T6A A;  2P58 A;  1KIL E;  2O01 J;  2J59 M;  3PRJ A;  1EZV D;  1NMI A;  5APT A;  3CXH W;  1SQB K;  2N1T C;  4UB8 V;  3SWY A;  1LS9 A;  5B6Q A;  1AFO A;  2I8D A;  4RO0 A;  5CIH B;  2YK3 A;  3NFQ A;  3TGU J;  2PAC A;  1OX3 A;  1AA0 A;  1GK6 A;  1P84 H;  2C1D B;  4PD4 E;  3L4O A;  2PP6 A;  1URQ A;  2CA4 B;  2QVA A;  1SQB D;  5AW5 B;  1SQP K;  1N73 B;  3B8E B;  3CXH H;  4ZKU A;  4AAN A;  1FI9 A;  1IC2 A;  1NNO A;  4HJG H;  3EWK A;  5GTH H;  1S2E A;  1FZC C;  1USE A;  3SFD C;  3C2C A;  1L0N K;  1LTJ A;  1SQP D;  5AW9 B;  1LC2 A;  2YXQ B;  1KOR A;  3RK3 C;  1RZ6 A;  2Z4E A;  1RE4 C;  1URQ B;  1OAE A;  4W80 A;  3SLE A;  3VYI A;  1Q82 Q;  1KYO W;  3BCC J;  3ITK A;  1L0N D;  3UIA A;  3PH2 B;  4GT1 A;  3RL0 D;  1IFP A;  3BAT A;  2WSC H;  4IL6 X;  5CCH D;  3PTZ A;  1S9K D;  3L70 D;  1LTJ B;  4PV1 D;  1CSW A;  2RMZ A;  3L74 D;  3PP5 A;  1KYO H;  2CPS A;  1LFM A;  2LR2 A;  4PW9 B;  3O6Q A;  2V07 A;  3A0B H;  2WSC J;  1BGY G;  1M57 D;  2AEM A;  3PH0 A;  1FOS E;  4LGD E;  4GOE A;  1EXI A;  1SLQ A;  4JPZ B;  1AQT A;  2ZXE B;  4I2L C;  1NU1 G;  5CBN A;  2V08 A;  4OH8 B;  1MFT A;  3SSU A;  1VQL P;  2L91 A;  3PXW A;  1MV8 A;  3CWB D;  1PPJ E;  1RAP A;  1XTC C;  2YMY A;  1H9X A;  1A02 F;  1K8A Q;  1SP4 A;  3HD7 C;  2WT7 A;  1KIB A;  3DMI A;  1KQG B;  2E75 B;  1JMB A;  1M1K Q;  2FYU E;  4N6J A;  1H0T B;  1KIL B;  3V2P A;  2Z5H A;  3GG2 A;  3X39 A;  1SFC A;  3K5B A;  1H32 B;  2JJL A;  4QMA A;  3WFB C;  4WQA A;  1P84 I;  3WMM 0;  3C1L A;  3KZI E;  2OYI A;  5B5E V;  1L9J C;  4FA9 A;  1PIX A;  2NPS C;  3ABV C;  3BRT B;  3CCU P;  2DGE A;  1OW8 A;  2WT7 B;  451C A;  1CIE A;  2QJY C;  4O1Q A;  3G9R A;  3CI9 A;  3JC2 2;  4GED B;  4H44 D;  4WBA A;  1GD2 E;  2B10 B;  3D70 A;  2W90 A;  3WUI A;  2YO3 A;  1A2S A;  3JBT B;  4L74 A;  1DVV A;  5CCG C;  3G4S P;  1BDC A;  4R4M A;  1BE3 E;  2XZR A;  4Y28 J;  5C9M A;  3RN0 A; 
#chains in the Genus database with same CATH homology
 1VYD A;  4XYD B;  3VYM A;  3RMZ A;  5KLI B;  2FWL A;  1CRI A;  1AYG A;  1RZ5 A;  3H1J D;  1R0Q A;  1NTZ D;  1IRW A;  2XTS B;  5CYT R;  1KX7 A;  1GQ1 A;  1ETP A;  3ZOO A;  3HQ7 A;  1NML A;  2DVH A;  1CHJ A;  4KMG A;  155C A;  1U74 B;  4A7P A;  3ZOW A;  1H33 B;  1H31 A;  4J20 A;  1CCR A;  4EIC A;  1CSV A;  1DW0 A;  2N3B A;  5KLV D;  1CRY A;  1P84 D;  2HV4 A;  4UB6 V;  2FYU D;  2JWA A;  3A9F A;  3PHL A;  3TYI A;  3OA8 A;  2BCC D;  1FCD C;  2B4Z A;  2YIU B;  1KX2 A;  3PXS A;  1GJQ A;  2CA3 B;  2GC4 D;  2BH4 X;  4D6T D;  5C0Z A;  1NIR A;  1FI7 A;  3HQ9 A;  2ZBO A;  4WQE A;  2B0Z B;  1CRC A;  3CX5 D;  3WFD C;  1H32 A;  3NWV A;  1CO6 A;  1I8O A;  3CU4 A;  1GIW A;  1COR A;  4FAV A;  4RJT A;  1CYJ A;  3VNW A;  1L0L D;  5B66 V;  1FJ0 A;  1H31 B;  4PWA A;  2BGV X;  2ZZS 1;  3MK7 C;  2A06 D;  1N9C A;  2Q3E A;  3OCD A;  2C1V A;  3OA8 B;  1AOF A;  3L71 D;  4FA5 A;  4JCG A;  3RN1 A;  1DW2 A;  3HQ8 A;  3WFE C;  4H0K A;  3PXT A;  1YFC A;  5CIB B;  1CIF A;  1WEJ F;  4QAO A;  5IY5 1;  4EIF A;  5GTI V;  3MK7 B;  4O1W A;  1F1C A;  1EB7 A;  1YEB A;  3HQ6 A;  1YIQ A;  1NTM D;  2JTI B;  4V2K A;  1KYO D;  3FWL A;  1AOQ A;  1E8E A;  1DII C;  1FI3 A;  1IQC A;  2MTA C;  3L4M A;  2Y0E A;  1C75 A;  2YQB A;  4LJI A;  1H9Y A;  4L3H A;  4WQC A;  1CYI A;  1DW1 A;  1H33 A;  2QJK B;  1I55 A;  4FA1 A;  1C6R A;  5KKZ B;  4NFG B;  2JQR A;  2KNC B;  1KB0 A;  4DY9 A;  2I8F A;  1SQV D;  2QJY B;  1CED A;  1BL9 A;  1BGY D;  1YNR A;  4FA4 A;  1S6V B;  1B7V A;  2CXB A;  3PLN A;  1KB9 D;  3VRD A;  1M6Z A;  3ZIY A;  4H0J A;  1NU1 D;  3TF5 A;  1I8P A;  2OZ1 B;  5H2F V;  2N18 C;  1QYZ A;  3O1Y A;  1YCC A;  3WU2 V;  3TGU D;  4Y5R A;  2B12 B;  1DT1 A;  2AXT V;  2GC7 D;  5CIE B;  1SQQ D;  3KZI V;  1LMS A;  1CTY A;  2VHD A;  1GKS A;  4MU8 A;  1I6E A;  3L72 D;  4AAO A;  2ZOO A;  1JDL A;  1CRJ A;  2CE0 A;  5TJH A;  2D0W A;  5KAF V;  1CIH A;  4WQ8 A;  3CXH D;  3WC8 A;  1QL3 A;  2RN0 A;  1ZZH A;  1CRH A;  1IZL 0;  5DF5 A;  2YCC A;  3M97 X;  1C52 A;  3H1H D;  1DW3 A;  5CIG B;  1E2R A;  1MG3 D;  4AAM A;  1GU2 A;  2EXV A;  3BCC D;  1K3H A;  4AAL A;  1YIC A;  1KV9 A;  1CIG A;  2C8S A;  1MZ4 A;  1DIQ C;  3O0R C;  2C1D A;  2QJP B;  1F1F A;  2BH5 X;  2Y0C A;  2CE1 A;  1S5L V;  2C9X B;  3ZOX A;  4EID A;  2N9J A;  2LIR A;  3NBT A;  4PJ0 V;  1C6S A;  1HJ4 A;  4WQ7 A;  3PRJ A;  1EZV D;  2PCC B;  3O20 A;  4RSZ A;  1NMI A;  1I6D A;  3CXH W;  2B11 B;  4UB8 V;  3CX5 W;  1I54 A;  1FHB A;  1HZV A;  1LS9 A;  3DR0 A;  5B6Q A;  5EXQ A;  5CIH B;  3VMA A;  1YEA A;  2YK3 A;  2PAC A;  1LC1 A;  2OZ1 A;  2C1D B;  3L4O A;  1HH7 A;  2CA4 B;  3ZCF A;  1IRV A;  3ORV A;  1SQB D;  2Y0D A;  1FOC A;  5CID B;  1M60 A;  4AAN A;  1FI9 A;  1NNO A;  3SJL A;  3GW6 A;  1W5C T;  1W2L A;  1ZRT D;  1MG2 D;  5CIF B;  1A56 A;  1RAQ A;  1CXC A;  1BCC D;  3C2C A;  4EDF A;  1SQP D;  1OCD A;  2C1U A;  1CC5 A;  4FAN A;  1HRO A;  1LC2 A;  4L1Q A;  1RZ6 A;  2AIU A;  5DJQ C;  1HRC A;  2ORL A;  1OAE A;  4P4Q B;  3SLE A;  2FRC A;  3KHU A;  1KYO W;  2IBZ D;  3CP5 A;  3ITK A;  1C7M A;  5GTH V;  1L0N D;  2GB8 B;  3PH2 B;  1CNO A;  3RLM A;  4WQB A;  1N90 A;  1CSU A;  1WVE C;  4U3F D;  1CRG A;  1J3S A;  3PTZ A;  3L70 D;  4AX3 A;  2N18 B;  1PPJ D;  1CSW A;  1QKS A;  2RMZ A;  3L74 D;  2N9I A;  351C A;  2D0S A;  5DJQ B;  1C2N A;  1C6O A;  1LFM A;  4N0K A;  1L9B C;  4GYD A;  4PW9 B;  3A0H V;  1K3G A;  2V07 A;  2ZON G;  3H1I D;  3TDK A;  1AKK A;  3L75 D;  3WFC C;  1A8C A;  2BPB B;  1IO3 A;  1QN2 A;  2V08 A;  5DFS A;  4FB1 A;  2L91 A;  3PXW A;  3ZOY A;  4PD4 D;  3SXT A;  3A0B V;  5KAI V;  3CWB D;  2BCN B;  2L4D A;  2PCB B;  5AUR A;  5E79 V;  4IL6 V;  1RAP A;  1CXA A;  1HJ5 A;  1H9X A;  3ZBM A;  1CHH A;  1KIB A;  1GDV A;  2LIT A;  3DMI A;  2MHM A;  5TIS V;  1COT A;  2KS1 A;  1NTK D;  2ZXY A;  4WQ9 A;  4L3G A;  1H1O A;  1DVH A;  3GG2 A;  2BLF B;  1N15 A;  1HJ3 A;  3X39 A;  2AI5 A;  1U75 B;  2FYN B;  1H32 B;  3CYT I;  4YE1 A;  1SQX D;  3WFB C;  4WQA A;  1E29 A;  1M70 A;  2K9J B;  1BE3 D;  2N9Y B;  3NBS A;  4Q5P A;  2QG4 A;  3L73 D;  1CTZ A;  1L9J C;  1CSX A;  1QL4 A;  2GIW A;  4FA9 A;  1CHI A;  5B5E V;  4WQD A;  1PP9 D;  2C2C A;  2DGE A;  3OCD B;  1CTJ A;  451C A;  1CIE A;  3SVW A;  4O1Q A;  1HCM A;  3H1K D;  1I5T A;  3SWS A;  1CYC A;  1YTC A;  4GED B;  4EIE A;  2O3J A;  2N3Y A;  4XXL A;  4K3I A;  1C2R A;  2B10 B;  1CCH A;  3O5C A;  3WUI A;  1HZU A;  3DP5 A;  1A2S A;  3JBT B;  1DVV A;  1N50 A;  5CIC B;  5C9M A;  3H1L D;  3RN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...