2QJYB

Crystal structure of rhodobacter sphaeroides double mutant with stigmatellin and uq2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed Structures of the Cytochrome bc1 from the Photosynthetic Bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 67
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjyB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjyB02
1GJQA 1NTMD 1YIQA 3DMIA 3L4MA 3VRDA 1H32B 1YCCA 1I8OA 5E79V 1SQVD 2N3YA 2N9IA 5CIDB 3O5CA 5CIHB 1LC1A 2ZBOA 1HH7A 1QKSA 3OA8A 1AKKA 1M60A 3L71D 2O3JA 2GC4D 2D0SA 3PRJA 1N50A 2C9XB 2YIUB 4AAMA 3H1LD 3VMAA 1CHHA 1CIGA 4GYDA 1MG3D 1CRIA 2N3BA 5B66V 1WEJF 5DJQB 2JWAA 3KZIV 2B0ZB 1AYGA 1H9XA 1SQBD 2QJYB 4JCGA 1YNRA 2QJPB 4WQ8A 1GDVA 2BH4X 4RJTA 3SVWA 1ETPA 3GG2A 3A0HV 1IQCA 3SLEA 3BCCD 1DW2A 3OA8B 3CXHW 2BCCD 2D0WA 1MG2D 4FAVA 3L74D 4Y5RA 3SWSA 1I5TA 3L75D 4WQDA 2VHDA 5KLIB 3L70D 1CIFA 4Q5PA 1BCCD 4DY9A 2QG4A 1LS9A 5KKZB 2GC7D 1CRCA 3A9FA 1DVHA 5CICB 1YTCA 1CTJA 5GTHV 1KB0A 2RMZA 3CX5D 4FA4A 1LMSA 1NTKD 2L91A 2N9YB 1RZ5A 1JDLA 1CRHA 3NWVA 1CSVA 1CEDA 1HCMA 2PCCB 1N9CA 4O1QA 3KHUA 1AOQA 1N90A 1HROA 1YEAA 1E8EA 2FYNB 1WVEC 3HQ8A 1SQPD 2B12B 3WFBC 1CXAA 4J20A 2K9JB 2FWLA 1KYOW 1H31B 4WQBA 4H0JA 3VNWA 3O0RC 1GKSA 3OCDA 1CCHA 4PD4D 4U3FD 3SXTA 4AANA 3PXWA 1HZUA 1N15A 1CIHA 1CSXA 3ORVA 1DW1A 4MU8A 1VYDA 1QN2A 451CA 2YK3A 3H1ID 1YEBA 2Q3EA 5IY51 1CXCA 1EB7A 1NNOA 2ZONG 4V2KA 2DVHA 4L1QA 1HJ5A 1K3GA 1KB9D 3ZCFA 3HQ6A 2C1VA 1DIQC 1GU2A 2BCNB 1CORA 1RZ6A 1IO3A 1K3HA 4PJ0V 5KAFV 3SJLA 5CIBB 1H9YA 2IBZD 3HQ9A 3WFDC 3OCDB 3CP5A 4UB8V 1AOFA 1B7VA 3GW6A 5DF5A 1GQ1A 1I6EA 1DW3A 3PH2B 1NMLA 1I8PA 4WQEA 1S6VB 3PHLA 4FANA 3L4OA 2YCCA 3TYIA 1BGYD 1FCDC 2AIUA 3RN1A 1NIRA 4AAOA 1CC5A 1ZZHA 1LFMA 5TISV 2EXVA 5DFSA 4XXLA 1COTA 1CRJA 3NBSA 4D6TD 2LITA 1EZVD 2N18B 2XTSB 5KLVD 2N9JA 1F1FA 1FI7A 3O20A 3MK7C 3RN0A 1R0QA 4KMGA 2C1UA 1FJ0A 3CX5W 3X39A 1DVVA 2CA3B 2ZXYA 2A06D 4RSZA 1CCRA 5CIGB 4NFGB 2BPBB 4A7PA 1P84D 1QL3A 1IZL0 2AXTV 4WQAA 1C6SA 1HRCA 1BL9A 1CHJA 1CNOA 1CRYA 1CSUA 1L9JC 1OCDA 2BGVX 1QYZA 3PTZA 1CIEA 5C9MA 1L0LD 3PXSA 2Y0CA 4EIDA 3DP5A 2CE0A 2YQBA 1RAQA 2FRCA 1CYCA 3CWBD 1I55A 2V08A 2MHMA 2ORLA 4H0KA 1CYIA 1L0ND 2Y0EA 1NU1D 1C6OA 3RMZA 2PCBB 1U75B 3ZOYA 4FB1A 3PLNA 3ITKA 5C0ZA 2B11B 3HQ7A 3ZOXA 3RLMA 3ZIYA 2V07A 4N0KA 4WQ9A 1C7MA 1E2RA 5TJHA 4XYDB 1MZ4A 3ZOOA 1H32A 4EIFA 1NMIA 1C2RA 1S5LV 4FA9A 3NBTA 3WFEC 5EXQA 1J3SA 5CIEB 1SQXD 1C2NA 1CO6A 2KNCB 5B5EV 3C2CA 1H1OA 2MTAC 1FOCA 1I54A 1CYJA 4LJIA 155CA 3H1JD 2RN0A 5CIFB 1KV9A 2ZOOA 3A0BV 3DR0A 1C75A 3ZOWA 4EDFA 1YICA 1SQQD 1CHIA 1W5CT 1CTZA 2B10B 1IRWA 1OAEA 4AALA 4O1WA 1F1CA 2FYUD 1GIWA 1L9BC 1RAPA 2C2CA 1CSWA 1I6DA 3H1HD 3CU4A 2AI5A 1DT1A 2CXBA 1C6RA 4UB6V 2Y0DA 1FHBA 3WFCC 1H33A 2CA4B 2HV4A 4EIEA 3VYMA 1CRGA 5H2FV 5CYTR 1KX7A 1KIBA 1A56A 2BH5X 2LIRA 4IL6V 2C1DA 2L4DA 1BE3D 3CYTI 4L3HA 1U74B 1ZRTD 4AX3A 2I8FA 3WC8A 1A8CA 2DGEA 3JBTB 1C52A 1HJ3A 3H1KD 2CE1A 2C8SA 2B4ZA 1DW0A 1A2SA 4EICA 2JTIB 3CXHD 1H33B 3O1YA 1M6ZA 3L73D 1HZVA 1PP9D 1HJ4A 4WQCA 5AURA 5B6QA 2C1DB 2ZZS1 1H31A 1QL4A 1NTZD 1YFCA 3TDKA 1IRVA 4GEDB 1PPJD 4K3IA 1W2LA 4YE1A 5GTIV 4L3GA 1E29A 2OZ1A 4PWAA 1CTYA 5DJQC 4FA1A 1DIIC 2KS1A 4P4QB 3MK7B 3ZBMA 3FWLA 1M70A 1KX2A 3M97X 2JQRA 4PW9B 1FI3A 2GIWA 1FI9A 2QJKB 2PACA 3TGUD 2N18C 3L72D 2BLFB 3TF5A 3PXTA 3WUIA 3WU2V 4WQ7A 351CA 4QAOA 2GB8B 1KYOD 5KAIV 2OZ1B 1LC2A 4FA5A
chains in the Genus database with same CATH superfamily
1YIQA 2KOGA 5KAIH 1LTGC 3DMIA 4U7JA 1NTMJ 1M57D 4PJ0E 1ZW0A 4EOTA 2M3BA 5KAFE 1VQ4P 2N3YA 2N9IA 1CZQA 2LR2A 3OA8A 3P32A 3P8CD 1SS1A 3U1CA 1YJWP 3CLQA 2E5YA 1MG3D 1CRIA 1SFCC 4NPDA 2B0ZB 1T8ZA 1AYGA 2B88A 1H9XA 4WY4D 1BGYJ 2WMMA 1JUNA 3USSA 5AW6B 2BCCG 2BH4X 3AE4C 2J58A 3A0HV 3L75G 3OA8B 1ZRTE 1IJDB 4D6TJ 1URQD 2QA4P 1AQ5A 3SWSA 2H7HA 3H1KE 4YXWH 1J2JB 5KLIB 1SFCA 3CX5I 4Q5PA 5CMZA 1BCCD 2AXTE 3L70J 3A9FA 3CXHE 1H88A 3K5BA 1S3JA 2NZ2A 1OX3A 3AEEC 1L0LG 3L35A 1KFNA 2L91A 2PGDA 2WPSA 1RZ5A 1IZNB 2WZ7A 2AXCA 1PPJE 3CD6P 1CSVA 3I56P 1HCMA 1NU1G 1M1JB 2KIKA 1JMMA 1N90A 3V4WA 1E8EA 3R4YA 2IYOA 4N3YB 2B12B 2ZT9C 3WUVA 1JO5A 1VF5D 3NXSA 1VQ5P 1H31B 4WQBA 3L72E 4U3FD 3SXTA 2C0XA 1NYHA 3PXWA 1S5LE 1CSXA 3ORVA 4MU8A 1VYDA 1QN2A 1KB9I 5B5EE 2I1JA 3H1ID 3Q5PA 1KYOE 1ZLLA 3H1JG 3EWKA 3LIDA 2J59M 1NTME 2IBZI 1IFPA 3H25A 4JF7A 3ZCFA 1NTMK 1GU2A 1IO3A 1K3HA 4NPEA 4IFMA 3HQ9A 5AVXB 1UIIA 2HPCA 1OWAA 5DF5A 1GQ1A 1USDA 1T3UA 1JMBA 1OW8A 1M56D 4WQEA 1S6VB 2ZYGA 3V6IA 3H1HG 4OGQC 2YCCA 1BGYE 2AIUA 3O6QB 1X0TA 2N1TC 2ZT9B 2Q1KA 3NBSA 3M0DC 1EDJA 2C0WA 2YMKA 2N9JA 1FI7A 1R0QA 1LWUC 2E76C 3A7OA 2I8DA 1PGOA 3CC2P 1BE3G 1PGJA 4EI2A 1L4AD 3L70E 2CA3B 3M0AA 4NFGB 2BPBB 4ASVA 2N1TA 1BL9A 1CHJA 1KILD 1A02J 1CNOA 1CRYA 2BGVX 1AFOA 3M0DA 4RESB 3RK2B 5C9MA 1JEKA 1LWUA 2YQBA 4L73A 4H13D 1NAFA 2VRSA 4N78D 3LIEA 5EFWB 3CWBJ 1IFDA 2ORLA 1L0ND 2A45I 2Y0EA 3H32A 3RK3C 1C6OA 2WTYA 3ZOYA 2A45G 2O1JA 2ZYDA 3SSUA 1NTZJ 2YIUC 5AVSB 1RE3C 2B11B 5CJ0A 2QSIA 3TYYA 2XKMA 3RLMA 2Z5HA 3ZIYA 4N0KA 2IFNA 1JTHA 1FAVA 4BRYB 1MZ4A 3TGUG 3NBTA 2M0BA 5CIEB 2QJPC 1CO6A 4BWNA 3HE4A 3JCUH 3WUUA 3AE2C 1CYJA 4LJIA 155CA 3S4RA 1RE3A 5KAIE 4PV1C 1X9VA 4K3AA 3A0BV 3ZOWA 1GL2B 4EDFA 3E7KA 1LTSC 3Q5SA 1QX8A 1SQQJ 2B10B 1OAEA 2D2CD 2I1KA 5KTBA 1JOCA 2WVRA 1SVFA 1LTTC 1RAPA 5CCGD 2C2CA 1CSWA 1I6DA 2FYUJ 1KZUB 4I7ZC 3KXDA 4IL6X 1S72P 5APQA 2MJZA 1OW6A 1EZVE 3L36A 1YITP 2CA4B 2HV4A 4EIEA 3VYMA 5H2FV 3HD7C 1KQLA 2OTKE 1W2BO 1MUUA 1OIPA 2CPSA 3BASA 3MZWB 2BH5X 4LC1A 2C1DA 2L4DA 4JPZB 1SQBJ 2H43A 2QM7A 1ZRTD 3G6EP 1BCCG 2YKOA 3H1KD 2CE1A 4H0LC 2B4ZA 3L73G 1A2SA 4DZOA 1HJBA 3CXHD 3CX5H 1M6ZA 3HD7A 2HFED 3EFGA 5AW0B 3M06A 3CWBE 3CI9A 4WQCA 2K9JA 2WPRA 2C1DB 3RBXA 1DEEG 2R3SA 1IRVA 3WMM0 1X79B 1PPJD 2NPSC 5GTIV 1NVOA 1E29A 1JCDA 2OZ1A 1H8AA 1ZN5A 3R2PA 3AECC 1DIIC 5DJTB 2E74C 2WT7A 3E1RA 1KX2A 2CPBA 1T2KD 1N73C 1FI3A 3AE8C 4U3FG 2O1KA 1SQXE 4JYBA 3IFMA 1SQXK 3L72D 3FX0A 2ITAA 2E43A 1CW5A 3H1IG 2NPSA 2PAJA 3WUIA 3AEAC 3HTKB 3AE6C 4QAOA 4H0LB 1YTZI 2W6AA 4JBZA 1KYOD 2OZ1B 1H0TA 1KB9H 1SQQE 1YI2P 1MFTA 1NTMD 1YIJP 1SQQK 4IFDK 1GTWA 3L4MA 1N73A 3L71G 1I8OA 2WSFJ 3A5TA 1LJ2A 2PFXA 5CIHB 1LC1A 1FDIA 2FYUE 2V4HA 1M60A 2FYUK 5CJ4A 1M1KQ 3PRJA 1N50A 3B71A 1CSBA 5AVRB 1CIGA 4GYDA 5APXA 3NMDA 2N3BA 5B66V 3QWOC 3CCVP 2KI7B 3KZIV 2KLUA 3CCLP 4DT0A 2M5AA 1GZLA 1VPCA 2QJYB 1KORA 1GDVA 5AVUB 2OYHB 1ETPA 3GG2A 1EDLA 1G1IA 3A0HH 1LP1B 1S1CX 1RF1C 2QEXP 1E79H 1I5TA 2BCCJ 3L70D 1P84H 1NAYA 1MKMA 1PV3A 1CIFA 1LTAC 3L74J 5AVVB 3L75J 4DY9A 1LS9A 5KKZB 3NFQA 1VQ9P 2M5AB 1YTCA 3CMEP 5BU5A 2RMZA 4YTPC 4FA4A 1N2DC 2PRRA 1NTKJ 1LGHB 2R32A 1Q2NA 2QVAA 1RF1A 1CEDA 4O9BA 2YXQB 2KSJA 1L0NG 2W27A 1N9CA 1SQPG 3MP7B 2ZT9D 1E5WA 3SFDC 2W6BA 1YYCA 1LT9B 1W5CE 3HQ8A 1JY3O 4PD4I 2KZJA 3CCQP 1S2EA 1CXAA 1WMKA 2R5DA 3VNWA 3O0RC 1GKSA 1CCHA 4AANA 1FOSE 4DOJA 2RKLA 2FXOA 3V2RA 2ZJSE 1FJKA 1BDDA 1DW1A 3JCUE 451CA 1QL1A 2Q3EA 3M9QA 1CXCA 4Y99B 2CK3H 5KJ7C 1DIQC 1BDCA 2E5TA 3RK2D 2BCNB 2KLVA 1CORA 1JY2O 3BATA 3H1JJ 2BEQD 2Q9IA 1H9YA 3V4QA 2P7JA 1AOFA 1GU4A 3PH2B 3Q1MA 2IZ0A 5AVWB 1IC2A 4WWIA 3TYIA 2Z4EA 4EIJA 5KJ7A 1NIRA 4AAOA 4H44C 1CC5A 1LFMA 1NWQA 4OWFA 3H1HJ 1COTA 1CRJA 2POHA 3IF4A 2LITA 1FDOA 1EZVD 2N18B 2O01N 4OVNF 2XDJA 1GK4A 1OXZA 1WT6A 3RN0A 3NTNA 2BCCE 2GUSA 5KLVJ 1DH3A 3GF3A 3L74E 4KMGA 3L75E 1DVVA 5CIGB 3CPWO 1FJPA 3LW5H 1QL3A 1GK6A 1PZQA 1CSUA 3CX5E 1L9JC 3CXHI 1GL2D 1OCDA 3IN6A 1NJIQ 1NTKE 3Q2YA 4GIFA 1NTKK 1LTBC 4EIDA 1VQOP 2CE0A 1RAQA 1SFCB 1CYCA 3CWBD 1PL5A 4XE5B 3G9RA 5AVTB 3F89A 3KDPB 2MKVA 1VL2A 3HUSC 3RL0C 1PGQA 2PCBB 3D71A 1U7MA 4GOFA 4NPFX 3ITKA 3W68A 3VP9A 3HQ7A 1N7SC 2K9YA 1PFIA 3GLMA 3P8MC 2IYPA 1J1DC 4XYDB 1H32A 4EIFA 3WFEC 3L72G 1SQXD 2OARA 3C2CA 3FXDA 1H1OA 2MTAC 1KYOI 1KB9E 5AW3B 1I54A 4HYTB 4W7YA 1KV9A 1S9KE 3CCEP 1N7SA 1NTMG 2IBZE 1SQQD 3A0BH 4M3LA 2W8ZA 1GW4A 2QIWA 1RF0C 2P2UA 1G2CA 1F1CA 2FYUD 2LXCB 2GUVA 2O01J 3SWKA 3CU4A 3H1HE 1DT1A 1T3JA 3JC22 1C6RA 4UB6V 1S4XA 4D6TE 4HB1A 2WSSH 5KLVE 1H33A 1QGKB 5KLVK 2FYNC 4LLHA 2HPCB 3M9BA 1NO4A 2WSCJ 3AE7C 1RQVA 1KIBA 2FXMA 3G3ZA 5H2FH 3A0HE 2LIRA 2KK7A 1RF0A 2A06E 2RH0A 1ZV8A 1R8EA 2HLOA 1P84E 1U74B 2ZAEB 3A3YB 4H0LD 3L70G 3WC8A 1KQSO 5AW1B 1A8CA 2DGEA 3JBTB 3EQ2A 3PP5A 3F5HA 3LW5J 1PP9G 4EICA 3OAKA 1H33B 2YMYA 2C9NY 1BCCJ 1HZVA 1IFNA 3L73J 3C1LA 5AURA 2C9LY 2ZZS1 4OGQB 2OYOA 1JCCA 2OYIC 1YHQP 2N1TB 5AW5B 2HG5D 2H88C 3P7KA 2R5BA 3TDKA 2ZFCA 4C7NA 1S5LX 1VQ7P 2KZIA 2FY8A 4K3IA 3JSVC 2IPPA 1HJ0A 1CTYA 5DJQC 2H89C 4FA1A 5GTIH 3MIWA 2KS1A 2HODA 4P4QB 1LWUB 2E76B 3OW2O 3EFFK 4PW9B 3G4SP 2GIWA 3I55P 4PD4H 1FI9A 2G8YA 1AVOA 3I5CA 1Q86Q 1NKNA 3H32B 1K05A 1EDIA 3TF5A 4U3FJ 1FZCC 3WU2V 4WQ7A 351CA 1R5LA 3L37A 2WSFH 1AA0A 1GJQA 1JTHB 1J1EC 4EYYQ 1YQ3C 2KSEA 4LGDE 3L4FA 1YCCA 4KT0J 1XTGB 5E79V 3HE4B 2ZBOA 1HH7A 1SQVJ 1QKSA 1AKKA 3RK3B 1T6AA 2O3JA 2GC4D 2C9XB 3L71J 2YIUB 4AAMA 1QVFO 1K9MQ 1FZCA 1OVVA 3AE9C 3H1LJ 1WEJF 3TSIA 4ZMDA 3VMZA 5DJQB 1RE4C 5B66H 1GU5A 2M8RA 3G71P 2PP6A 1EZVI 2YO3A 3KZIH 1EZVG 2ZXEB 1A02F 2QJPB 1DIPA 1IQCA 3SLEA 5TISH 5CCHC 1DW2A 3CXHW 2XV5A 3BCCJ 2BCCD 2D0WA 1MG2D 4XFJA 3L74D 2FKWB 4PV1B 5APTA 3L75D 4WQDA 2QG4A 1ZMEC 1RE4A 1DVHA 1L4AC 3CC4P 3L73E 5GTHV 1KB0A 3CX5D 4YXDC 1LMSA 2IDBA 3RK3E 1KQGB 4WVZA 2V7QH 1NTKD 2AEFA 1KILC 5CCHA 1NTZE 2FXPA 1CRHA 3CWBG 3NWVA 1NTZK 4I7ZB 1BSNA 3D6ZA 3KHUA 3MD0A 1AOQA 2KNCA 2HR3A 4H13C 1LTJC 1L4AA 3HD7B 1VQMP 5APUA 2XNDH 2YXRB 1EXIA 2JR8A 1L0NJ 2FFDC 3WFBC 1SQPJ 4J20A 2K9JB 3M9HA 1KILA 1KYOW 4H0JA 2XNXA 3OCDA 1HZUA 1N15A 4AYCA 1Q81Q 1LT1A 1SQXG 1VQ8P 2Z5IA 4Z1MH 1EB7A 3VMYA 3GHGC 2ZONG 4V2KA 1LTJA 2DVHA 2WT7B 4L1QA 4JQ0D 1HJ5A 4DJGA 1KB9D 2HYNA 3HQ6A 2FFDA 3A0BE 3AE5C 3CMAP 1IO4A 1SQVE 1S9KD 3TK1A 4PJ0V 5KAFV 4AQRD 1SQVK 3SJLA 5L8RJ 2IBZD 3L71E 1LNQA 3OCDB 1SFCD 2B87A 3VYIA 2NPSB 1H89A 3H1LE 2QM8A 1FU1A 2FYUG 1NMLA 1H0TB 3C8VA 3MGNA 4TT3H 3PHLA 4FANA 3GHGA 2E74B 1BGYD 5C39A 3RN1A 2D2CC 1HWTC 2Q3IA 2YO2A 1SQBE 1N73B 1VDFA 5TISV 1LTIC 5DFSA 1JB0J 1SQBK 5CCGC 4ZKPA 3OA7A 4D6TD 5H2FE 1Y8AA 5KLVD 3BCCE 3O20A 3MK7C 1FZEA 4C46A 1DX7A 2L5GB 3CCSP 2C1UA 5AW2B 2ZVNB 1FJ0A 3U1AA 2JDIH 1N86A 2A06D 4RSZA 1CCRA 2QJKC 4A7PA 1P84D 5APWA 4C7RA 4IL6H 4ZKUA 2AXTV 4WQAA 1C6SA 1HRCA 5CCGA 1Y9BA 2Q5UA 1QYZA 3PTZA 1OZHA 2Y9ZA 2E75C 3PXSA 1CI6A 3DP5A 5M1BA 1L0LJ 1YQ4C 2P58A 2V7QJ 1Q7YQ 1VQKP 3VN0A 1I55A 2V08A 1AQTA 1KTMA 1JY3N 1CYIA 3CC7P 1U75B 1OW7A 1RQUA 1SQPE 5APYA 5GTIE 4FB1A 2A45H 1NU1J 3T97A 2IZ1A 1SQPK 1FOSF 4BXLA 3ZOXA 1QVGO 2V07A 1GW3A 4WQ9A 4PD4E 4GKGA 1HF9A 1C7MA 1HVVA 1L2PA 1DD4A 3C9IA 5TJHA 3BVHA 1RF1B 4GODA 1NMIA 1X22A 2OGUA 1S5LV 4FA9A 5AW4B 1NKZB 2WPVB 4KHXA 2SPZA 5B5EV 3UIAA 3FWNA 4CPGA 1YJ9P 1XTCC 1FOCA 1JNMA 1QL2A 1JY2N 3L72J 3T97B 2JWDA 2ZOOA 5KLIC 1C75A 2FBWC 1U57A 3AEBC 5AVQB 4DCKA 1CHIA 1W5CT 3Q3DA 1IRWA 4OGQD 2LXBA 5DJUB 2O01H 3CCUP 1FS0E 2N1TD 2QRXA 2G3AA 4AALA 4O1WA 1IFMA 1GIWA 1FZFA 2WWWA 5B66E 3N7NA 1OMIA 1MV8A 3B5NC 2CXBA 2WSCH 3KZIE 2E76D 3A2AA 1M1JC 3B8EB 4R4LA 3WFCC 4UB6H 1CRGA 1NOHA 5TISE 1HGZA 1KX7A 3PJSK 1RHZB 1W2EA 4IL6V 1KQFB 1FC2C 3H6PA 4L74A 1PIXA 3CYTI 3L74G 4IFFA 3H1KG 2UWJE 1BE3J 3BRTB 3KPEA 1HH0A 1HJ3A 2Y9YA 3B5NA 1KN7A 4KJMA 2C8SA 1M1JA 1DW0A 1N8RQ 3MUDC 2JTIB 4RKUJ 1L0LE 1VQPP 3PH0A 1L0LK 3L73D 1NTKG 3IAOA 4WBAA 2JP3A 2WQYC 3O8ZA 1KV4A 3RK3D 1PP9J 4MN4C 1PPJG 1H31A 1QL4A 2H8PD 1NTZD 1NU1E 4H44B 4I1LA 4GEDB 1NU1K 2OTJP 1W2LA 3B5NB 4YE1A 3HRNA 1HBWA 4L3GA 3S9OA 1RY3A 2GM4A 4PWAA 3MUDA 2K3RA 1IK9A 1KD1Q 1SLQA 3ZBMA 3FWLA 1M70A 3M97X 2P10A 2JQRA 3HUSA 5K5GB 2JEEA 2PACA 1N7LA 2P1JA 4PV1D 2BLFB 3CL3D 3TGUJ 4JYCA 1EQ7A 4L75A 1NGMB 1M7LA 3H1JE 3VMXA 3U59A 1Z56A 5KAIV 1LC2A 3WU2H 3O6QA 4I2LC 5APVA 1GMJA 3VRDA 1H32B 2IBZG 2B9BA 1SQVD 3WUTA 2AEMA 5CIDB 3O5CA 3HUSB 3RL0B 1OVRA 1YJNP 5E79H 3RK2C 3L71D 2D0SA 3RGUA 3H1LD 3VMAA 1CHHA 1BGYG 4UB8H 1N7SB 3HD7D 1KC8Q 2DW3A 2JWAA 3KYQA 1J1DB 1M90Q 1QLED 2YKPA 3MTUE 4D6TG 1SQBD 2B89A 5KLVG 5CCHD 4JCGA 1ZXGA 1YNRA 1Q82Q 2P67A 4WQ8A 1SP4A 1DEBA 1G2CB 1G1JA 4RJTA 4WY4C 3SVWA 2M3EA 1BE3E 1QEXA 3BCCD 1AVYA 3D6YA 1FBMA 4FAVA 2A06G 1P84I 3CCMP 4Y5RA 4IL6E 1AJYA 1VQLP 2VHDA 1FZAA 1URQC 1NH4A 2GC7D 1CRCA 1OFCX 2AEJA 5CICB 1CTJA 1PP9E 5AW7B 4OH8B 5BU8B 3VTPC 2YKQA 5GTHH 4WY4A 2NPSD 2N9YB 1GL2C 1JDLA 4BRYA 2E74D 2PCCB 1URQA 2ZYAA 4O1QA 1HROA 1YEAA 2FYNB 1WVEC 1SQPD 3V2NA 1FE6A 3RL0g 1MFZA 3M91A 3AE3C 2OYIA 2WSEH 4WY4B 3TGUE 2FWLA 3VP8A 1GL2A 4PD4D 1VF5C 3AEDC 4C7NB 5APSA 1CIHA 2K88A 3GMAA 2OQQA 5AW9B 2Q7CA 2YK3A 1URQB 3OJAB 1YEBA 2FYZA 4K35A 1VQ6P 5IY51 1NNOA 1USEA 2KS1B 3H1IJ 2HODB 3V2QA 1SQXJ 2K37A 1AV1A 3Q5RA 1K3GA 2KXPB 2C1VA 1R5SA 3S1KA 1ZOYC 1EXJA 3TNUA 2E42A 1RZ6A 2OTLP 2OYIB 5BVZA 3IR9A 4GDOA 5CIBB 3P8CE 3WFDC 1K8AQ 3CP5A 4PJ0H 3N4XA 4UB8V 5KAFH 1B7VA 3GW6A 1FZGA 2J5UA 1I6EA 1DW3A 4YPCA 3CCJP 1I8PA 4HKZH 3L4OA 5AVZB 3AEFC 1FCDC 4Y28J 3ZDMA 4XA4A 1ZZHA 1MZ9A 4UB6E 3E1IA 2EXVA 4XXLA 1IK7A 3TNUB 1BSHA 2XTSB 3D0WA 1GDTA 1OVUA 2XU6A 1K73Q 1JY3P 1VF5B 3V5BA 1F1FA 2BASA 1FZCB 3HE5A 3CX5W 3X39A 4AUWA 1HUCA 2ZXYA 5AVYB 1BCCE 2W90A 2R44A 3SWFA 1J1EB 1IZL0 2E75D 2AXTH 3CXHH 1FDMA 2K1AA 4R4MA 1CIEA 3II6A 1M8OB 1L0LD 4IOIH 2Y0CA 1ZR4A 4I6MC 3W67A 1NHLA 1JY2P 2NRGA 3HE5B 2FRCA 1NTZG 5CHXA 2MHMA 3MHVA 4H0KA 1NU1D 2IFMA 3RMZA 1WRGA 3PLNA 5C0ZA 3HTKA 2ZVOB 2JO1A 4U3FE 1E2RA 1PGPA 2YNYA 2Q6QA 1HGVA 3ZOOA 2WSEJ 1C2RA 2BEZF 2QJYC 5EXQA 1J3SA 3H1IE 5KJ7D 1YBKA 1C2NA 4TLFA 2KNCB 1S5LH 2OYHC 1L4AB 3AE1C 3WU2E 5B5EH 5CBOA 3H1JD 1KYOH 1SQQG 3FXEA 2RN0A 5CIFB 2R3CA 1Q90D 1U7JA 1KILB 1ZR2A 3DR0A 1ZP0C 5AW8B 1YICA 3BRVB 5KKZC 2KYVA 1CTZA 1SQVG 1Y47A 5E79E 1VQNP 1RH5B 1UIXA 4H44D 2ZXXA 4H13B 2OYHA 1LTJB 3H1LG 1L9BC 4UB8E 3B5ND 1KMIZ 3H1HD 1LP1A 2AI5A 2FFDB 2WITA 4B86A 1JM0A 2Y0DA 1FHBA 2QE7H 2W6JH 2XZRA 1SQBG 1K04A 3AEGC 5CYTR 2B87B 2KP8A 1LT9C 2GA1A 1YTZT 1A56A 3BCCG 4L76A 2WPQA 3RBZA 3ABVC 1IFJA 4N6JA 4RO0A 3GHGB 1BE3D 4L3HA 4AX3A 2I8FA 3VOPA 4GOEA 1KILE 3FGAD 1C52A 1X8YA 4HH2A 1FZBA 2LKMA 4QMAA 3KQGA 1TU3F 1IFIA 3H1KJ 4HJGH 5GTHE 3O1YA 4Y99C 1LT9A 2IX7C 2JKVA 1PP9D 3RL0D 1EDKA 1HJ4A 1GD2E 5B6QA 1D7MA 4N78E 3SWYA 1L0NE 2D2CB 3SFEC 1YFCA 4GT1A 1N7SD 3QH9A 1L0NK 5CBNA 1DD3A 1KFMA 1EC5A 2W83C 2KB7P 3CCRP 3B4SA 3MK7B 1CI6B 3GF7A 4W7ZA 2N9BA 2QJKB 1T2KC 3TGUD 2N18C 1HTLC 2KUBA 3D70A 2JJLA 3PXTA 2GB8B 4WB4A 4ASWA 2E75B 4ZNCA 4FA5A 4W80A 3V2PA
chains in the Genus database with same CATH topology
1GJQA 1NTMD 1YIQA 3DMIA 3L4MA 3VRDA 1H32B 1YCCA 1I8OA 5E79V 1SQVD 2N3YA 2N9IA 5CIDB 3O5CA 5CIHB 1LC1A 2ZBOA 1HH7A 1QKSA 3OA8A 1AKKA 1M60A 3L71D 2O3JA 2GC4D 2D0SA 3PRJA 1N50A 2C9XB 2YIUB 4AAMA 3H1LD 3VMAA 1CHHA 1CIGA 4GYDA 1MG3D 1CRIA 2N3BA 5B66V 1WEJF 5DJQB 2JWAA 3KZIV 2B0ZB 1AYGA 1H9XA 1SQBD 2QJYB 4JCGA 1YNRA 2QJPB 4WQ8A 1GDVA 2BH4X 4RJTA 3SVWA 1ETPA 3GG2A 3A0HV 1IQCA 3SLEA 3BCCD 1DW2A 3OA8B 3CXHW 2BCCD 2D0WA 1MG2D 4FAVA 3L74D 4Y5RA 3SWSA 1I5TA 3L75D 4WQDA 2VHDA 5KLIB 3L70D 1CIFA 4Q5PA 1BCCD 4DY9A 2QG4A 1LS9A 5KKZB 2GC7D 1CRCA 3A9FA 1DVHA 5CICB 1YTCA 1CTJA 5GTHV 1KB0A 2RMZA 3CX5D 4FA4A 1LMSA 1NTKD 2L91A 2N9YB 1RZ5A 1JDLA 1CRHA 3NWVA 1CSVA 1CEDA 1HCMA 2PCCB 1N9CA 4O1QA 3KHUA 1AOQA 1N90A 1HROA 1YEAA 1E8EA 2FYNB 1WVEC 3HQ8A 1SQPD 2B12B 3WFBC 1CXAA 4J20A 2K9JB 2FWLA 1KYOW 1H31B 4WQBA 4H0JA 3VNWA 3O0RC 1GKSA 3OCDA 1CCHA 4PD4D 4U3FD 3SXTA 4AANA 3PXWA 1HZUA 1N15A 1CIHA 1CSXA 3ORVA 1DW1A 4MU8A 1VYDA 1QN2A 451CA 2YK3A 3H1ID 1YEBA 2Q3EA 5IY51 1CXCA 1EB7A 1NNOA 2ZONG 4V2KA 2DVHA 4L1QA 1HJ5A 1K3GA 1KB9D 3ZCFA 3HQ6A 2C1VA 1DIQC 1GU2A 2BCNB 1CORA 1RZ6A 1IO3A 1K3HA 4PJ0V 5KAFV 3SJLA 5CIBB 1H9YA 2IBZD 3HQ9A 3WFDC 3OCDB 3CP5A 4UB8V 1AOFA 1B7VA 3GW6A 5DF5A 1GQ1A 1I6EA 1DW3A 3PH2B 1NMLA 1I8PA 4WQEA 1S6VB 3PHLA 4FANA 3L4OA 2YCCA 3TYIA 1BGYD 1FCDC 2AIUA 3RN1A 1NIRA 4AAOA 1CC5A 1ZZHA 1LFMA 5TISV 2EXVA 5DFSA 4XXLA 1COTA 1CRJA 3NBSA 4D6TD 2LITA 1EZVD 2N18B 2XTSB 5KLVD 2N9JA 1F1FA 1FI7A 3O20A 3MK7C 3RN0A 1R0QA 4KMGA 2C1UA 1FJ0A 3CX5W 3X39A 1DVVA 2CA3B 2ZXYA 2A06D 4RSZA 1CCRA 5CIGB 4NFGB 2BPBB 4A7PA 1P84D 1QL3A 1IZL0 2AXTV 4WQAA 1C6SA 1HRCA 1BL9A 1CHJA 1CNOA 1CRYA 1CSUA 1L9JC 1OCDA 2BGVX 1QYZA 3PTZA 1CIEA 5C9MA 1L0LD 3PXSA 2Y0CA 4EIDA 3DP5A 2CE0A 2YQBA 1RAQA 2FRCA 1CYCA 3CWBD 1I55A 2V08A 2MHMA 2ORLA 4H0KA 1CYIA 1L0ND 2Y0EA 1NU1D 1C6OA 3RMZA 2PCBB 1U75B 3ZOYA 4FB1A 3PLNA 3ITKA 5C0ZA 2B11B 3HQ7A 3ZOXA 3RLMA 3ZIYA 2V07A 4N0KA 4WQ9A 1C7MA 1E2RA 5TJHA 4XYDB 1MZ4A 3ZOOA 1H32A 4EIFA 1NMIA 1C2RA 1S5LV 4FA9A 3NBTA 3WFEC 5EXQA 1J3SA 5CIEB 1SQXD 1C2NA 1CO6A 2KNCB 5B5EV 3C2CA 1H1OA 2MTAC 1FOCA 1I54A 1CYJA 4LJIA 155CA 3H1JD 2RN0A 5CIFB 1KV9A 2ZOOA 3A0BV 3DR0A 1C75A 3ZOWA 4EDFA 1YICA 1SQQD 1CHIA 1W5CT 1CTZA 2B10B 1IRWA 1OAEA 4AALA 4O1WA 1F1CA 2FYUD 1GIWA 1L9BC 1RAPA 2C2CA 1CSWA 1I6DA 3H1HD 3CU4A 2AI5A 1DT1A 2CXBA 1C6RA 4UB6V 2Y0DA 1FHBA 3WFCC 1H33A 2CA4B 2HV4A 4EIEA 3VYMA 1CRGA 5H2FV 5CYTR 1KX7A 1KIBA 1A56A 2BH5X 2LIRA 4IL6V 2C1DA 2L4DA 1BE3D 3CYTI 4L3HA 1U74B 1ZRTD 4AX3A 2I8FA 3WC8A 1A8CA 2DGEA 3JBTB 1C52A 1HJ3A 3H1KD 2CE1A 2C8SA 2B4ZA 1DW0A 1A2SA 4EICA 2JTIB 3CXHD 1H33B 3O1YA 1M6ZA 3L73D 1HZVA 1PP9D 1HJ4A 4WQCA 5AURA 5B6QA 2C1DB 2ZZS1 1H31A 1QL4A 1NTZD 1YFCA 3TDKA 1IRVA 4GEDB 1PPJD 4K3IA 1W2LA 4YE1A 5GTIV 4L3GA 1E29A 2OZ1A 4PWAA 1CTYA 5DJQC 4FA1A 1DIIC 2KS1A 4P4QB 3MK7B 3ZBMA 3FWLA 1M70A 1KX2A 3M97X 2JQRA 4PW9B 1FI3A 2GIWA 1FI9A 2QJKB 2PACA 3TGUD 2N18C 3L72D 2BLFB 3TF5A 3PXTA 3WUIA 3WU2V 4WQ7A 351CA 4QAOA 2GB8B 1KYOD 5KAIV 2OZ1B 1LC2A 4FA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJQ A;  1NTM D;  1YIQ A;  3DMI A;  3L4M A;  3VRD A;  1H32 B;  1YCC A;  1I8O A;  5E79 V;  1SQV D;  2N3Y A;  2N9I A;  5CID B;  3O5C A;  5CIH B;  1LC1 A;  2ZBO A;  1HH7 A;  1QKS A;  3OA8 A;  1AKK A;  1M60 A;  3L71 D;  2O3J A;  2GC4 D;  2D0S A;  3PRJ A;  1N50 A;  2C9X B;  2YIU B;  4AAM A;  3H1L D;  3VMA A;  1CHH A;  1CIG A;  4GYD A;  1MG3 D;  1CRI A;  2N3B A;  5B66 V;  1WEJ F;  5DJQ B;  2JWA A;  3KZI V;  2B0Z B;  1AYG A;  1H9X A;  1SQB D;  2QJY B;  4JCG A;  1YNR A;  2QJP B;  4WQ8 A;  1GDV A;  2BH4 X;  4RJT A;  3SVW A;  1ETP A;  3GG2 A;  3A0H V;  1IQC A;  3SLE A;  3BCC D;  1DW2 A;  3OA8 B;  3CXH W;  2BCC D;  2D0W A;  1MG2 D;  4FAV A;  3L74 D;  4Y5R A;  3SWS A;  1I5T A;  3L75 D;  4WQD A;  2VHD A;  5KLI B;  3L70 D;  1CIF A;  4Q5P A;  1BCC D;  4DY9 A;  2QG4 A;  1LS9 A;  5KKZ B;  2GC7 D;  1CRC A;  3A9F A;  1DVH A;  5CIC B;  1YTC A;  1CTJ A;  5GTH V;  1KB0 A;  2RMZ A;  3CX5 D;  4FA4 A;  1LMS A;  1NTK D;  2L91 A;  2N9Y B;  1RZ5 A;  1JDL A;  1CRH A;  3NWV A;  1CSV A;  1CED A;  1HCM A;  2PCC B;  1N9C A;  4O1Q A;  3KHU A;  1AOQ A;  1N90 A;  1HRO A;  1YEA A;  1E8E A;  2FYN B;  1WVE C;  3HQ8 A;  1SQP D;  2B12 B;  3WFB C;  1CXA A;  4J20 A;  2K9J B;  2FWL A;  1KYO W;  1H31 B;  4WQB A;  4H0J A;  3VNW A;  3O0R C;  1GKS A;  3OCD A;  1CCH A;  4PD4 D;  4U3F D;  3SXT A;  4AAN A;  3PXW A;  1HZU A;  1N15 A;  1CIH A;  1CSX A;  3ORV A;  1DW1 A;  4MU8 A;  1VYD A;  1QN2 A;  451C A;  2YK3 A;  3H1I D;  1YEB A;  2Q3E A;  5IY5 1;  1CXC A;  1EB7 A;  1NNO A;  2ZON G;  4V2K A;  2DVH A;  4L1Q A;  1HJ5 A;  1K3G A;  1KB9 D;  3ZCF A;  3HQ6 A;  2C1V A;  1DIQ C;  1GU2 A;  2BCN B;  1COR A;  1RZ6 A;  1IO3 A;  1K3H A;  4PJ0 V;  5KAF V;  3SJL A;  5CIB B;  1H9Y A;  2IBZ D;  3HQ9 A;  3WFD C;  3OCD B;  3CP5 A;  4UB8 V;  1AOF A;  1B7V A;  3GW6 A;  5DF5 A;  1GQ1 A;  1I6E A;  1DW3 A;  3PH2 B;  1NML A;  1I8P A;  4WQE A;  1S6V B;  3PHL A;  4FAN A;  3L4O A;  2YCC A;  3TYI A;  1BGY D;  1FCD C;  2AIU A;  3RN1 A;  1NIR A;  4AAO A;  1CC5 A;  1ZZH A;  1LFM A;  5TIS V;  2EXV A;  5DFS A;  4XXL A;  1COT A;  1CRJ A;  3NBS A;  4D6T D;  2LIT A;  1EZV D;  2N18 B;  2XTS B;  5KLV D;  2N9J A;  1F1F A;  1FI7 A;  3O20 A;  3MK7 C;  3RN0 A;  1R0Q A;  4KMG A;  2C1U A;  1FJ0 A;  3CX5 W;  3X39 A;  1DVV A;  2CA3 B;  2ZXY A;  2A06 D;  4RSZ A;  1CCR A;  5CIG B;  4NFG B;  2BPB B;  4A7P A;  1P84 D;  1QL3 A;  1IZL 0;  2AXT V;  4WQA A;  1C6S A;  1HRC A;  1BL9 A;  1CHJ A;  1CNO A;  1CRY A;  1CSU A;  1L9J C;  1OCD A;  2BGV X;  1QYZ A;  3PTZ A;  1CIE A;  5C9M A;  1L0L D;  3PXS A;  2Y0C A;  4EID A;  3DP5 A;  2CE0 A;  2YQB A;  1RAQ A;  2FRC A;  1CYC A;  3CWB D;  1I55 A;  2V08 A;  2MHM A;  2ORL A;  4H0K A;  1CYI A;  1L0N D;  2Y0E A;  1NU1 D;  1C6O A;  3RMZ A;  2PCB B;  1U75 B;  3ZOY A;  4FB1 A;  3PLN A;  3ITK A;  5C0Z A;  2B11 B;  3HQ7 A;  3ZOX A;  3RLM A;  3ZIY A;  2V07 A;  4N0K A;  4WQ9 A;  1C7M A;  1E2R A;  5TJH A;  4XYD B;  1MZ4 A;  3ZOO A;  1H32 A;  4EIF A;  1NMI A;  1C2R A;  1S5L V;  4FA9 A;  3NBT A;  3WFE C;  5EXQ A;  1J3S A;  5CIE B;  1SQX D;  1C2N A;  1CO6 A;  2KNC B;  5B5E V;  3C2C A;  1H1O A;  2MTA C;  1FOC A;  1I54 A;  1CYJ A;  4LJI A;  155C A;  3H1J D;  2RN0 A;  5CIF B;  1KV9 A;  2ZOO A;  3A0B V;  3DR0 A;  1C75 A;  3ZOW A;  4EDF A;  1YIC A;  1SQQ D;  1CHI A;  1W5C T;  1CTZ A;  2B10 B;  1IRW A;  1OAE A;  4AAL A;  4O1W A;  1F1C A;  2FYU D;  1GIW A;  1L9B C;  1RAP A;  2C2C A;  1CSW A;  1I6D A;  3H1H D;  3CU4 A;  2AI5 A;  1DT1 A;  2CXB A;  1C6R A;  4UB6 V;  2Y0D A;  1FHB A;  3WFC C;  1H33 A;  2CA4 B;  2HV4 A;  4EIE A;  3VYM A;  1CRG A;  5H2F V;  5CYT R;  1KX7 A;  1KIB A;  1A56 A;  2BH5 X;  2LIR A;  4IL6 V;  2C1D A;  2L4D A;  1BE3 D;  3CYT I;  4L3H A;  1U74 B;  1ZRT D;  4AX3 A;  2I8F A;  3WC8 A;  1A8C A;  2DGE A;  3JBT B;  1C52 A;  1HJ3 A;  3H1K D;  2CE1 A;  2C8S A;  2B4Z A;  1DW0 A;  1A2S A;  4EIC A;  2JTI B;  3CXH D;  1H33 B;  3O1Y A;  1M6Z A;  3L73 D;  1HZV A;  1PP9 D;  1HJ4 A;  4WQC A;  5AUR A;  5B6Q A;  2C1D B;  2ZZS 1;  1H31 A;  1QL4 A;  1NTZ D;  1YFC A;  3TDK A;  1IRV A;  4GED B;  1PPJ D;  4K3I A;  1W2L A;  4YE1 A;  5GTI V;  4L3G A;  1E29 A;  2OZ1 A;  4PWA A;  1CTY A;  5DJQ C;  4FA1 A;  1DII C;  2KS1 A;  4P4Q B;  3MK7 B;  3ZBM A;  3FWL A;  1M70 A;  1KX2 A;  3M97 X;  2JQR A;  4PW9 B;  1FI3 A;  2GIW A;  1FI9 A;  2QJK B;  2PAC A;  3TGU D;  2N18 C;  3L72 D;  2BLF B;  3TF5 A;  3PXT A;  3WUI A;  3WU2 V;  4WQ7 A;  351C A;  4QAO A;  2GB8 B;  1KYO D;  5KAI V;  2OZ1 B;  1LC2 A;  4FA5 A; 
#chains in the Genus database with same CATH topology
 1YIQ A;  2KOG A;  5KAI H;  1LTG C;  3DMI A;  4U7J A;  1NTM J;  1M57 D;  4PJ0 E;  1ZW0 A;  4EOT A;  2M3B A;  5KAF E;  1VQ4 P;  2N3Y A;  2N9I A;  1CZQ A;  2LR2 A;  3OA8 A;  3P32 A;  3P8C D;  1SS1 A;  3U1C A;  1YJW P;  3CLQ A;  2E5Y A;  1MG3 D;  1CRI A;  1SFC C;  4NPD A;  2B0Z B;  1T8Z A;  1AYG A;  2B88 A;  1H9X A;  4WY4 D;  1BGY J;  2WMM A;  1JUN A;  3USS A;  5AW6 B;  2BCC G;  2BH4 X;  3AE4 C;  2J58 A;  3A0H V;  3L75 G;  3OA8 B;  1ZRT E;  1IJD B;  4D6T J;  1URQ D;  2QA4 P;  1AQ5 A;  3SWS A;  2H7H A;  3H1K E;  4YXW H;  1J2J B;  5KLI B;  1SFC A;  3CX5 I;  4Q5P A;  5CMZ A;  1BCC D;  2AXT E;  3L70 J;  3A9F A;  3CXH E;  1H88 A;  3K5B A;  1S3J A;  2NZ2 A;  1OX3 A;  3AEE C;  1L0L G;  3L35 A;  1KFN A;  2L91 A;  2PGD A;  2WPS A;  1RZ5 A;  1IZN B;  2WZ7 A;  2AXC A;  1PPJ E;  3CD6 P;  1CSV A;  3I56 P;  1HCM A;  1NU1 G;  1M1J B;  2KIK A;  1JMM A;  1N90 A;  3V4W A;  1E8E A;  3R4Y A;  2IYO A;  4N3Y B;  2B12 B;  2ZT9 C;  3WUV A;  1JO5 A;  1VF5 D;  3NXS A;  1VQ5 P;  1H31 B;  4WQB A;  3L72 E;  4U3F D;  3SXT A;  2C0X A;  1NYH A;  3PXW A;  1S5L E;  1CSX A;  3ORV A;  4MU8 A;  1VYD A;  1QN2 A;  1KB9 I;  5B5E E;  2I1J A;  3H1I D;  3Q5P A;  1KYO E;  1ZLL A;  3H1J G;  3EWK A;  3LID A;  2J59 M;  1NTM E;  2IBZ I;  1IFP A;  3H25 A;  4JF7 A;  3ZCF A;  1NTM K;  1GU2 A;  1IO3 A;  1K3H A;  4NPE A;  4IFM A;  3HQ9 A;  5AVX B;  1UII A;  2HPC A;  1OWA A;  5DF5 A;  1GQ1 A;  1USD A;  1T3U A;  1JMB A;  1OW8 A;  1M56 D;  4WQE A;  1S6V B;  2ZYG A;  3V6I A;  3H1H G;  4OGQ C;  2YCC A;  1BGY E;  2AIU A;  3O6Q B;  1X0T A;  2N1T C;  2ZT9 B;  2Q1K A;  3NBS A;  3M0D C;  1EDJ A;  2C0W A;  2YMK A;  2N9J A;  1FI7 A;  1R0Q A;  1LWU C;  2E76 C;  3A7O A;  2I8D A;  1PGO A;  3CC2 P;  1BE3 G;  1PGJ A;  4EI2 A;  1L4A D;  3L70 E;  2CA3 B;  3M0A A;  4NFG B;  2BPB B;  4ASV A;  2N1T A;  1BL9 A;  1CHJ A;  1KIL D;  1A02 J;  1CNO A;  1CRY A;  2BGV X;  1AFO A;  3M0D A;  4RES B;  3RK2 B;  5C9M A;  1JEK A;  1LWU A;  2YQB A;  4L73 A;  4H13 D;  1NAF A;  2VRS A;  4N78 D;  3LIE A;  5EFW B;  3CWB J;  1IFD A;  2ORL A;  1L0N D;  2A45 I;  2Y0E A;  3H32 A;  3RK3 C;  1C6O A;  2WTY A;  3ZOY A;  2A45 G;  2O1J A;  2ZYD A;  3SSU A;  1NTZ J;  2YIU C;  5AVS B;  1RE3 C;  2B11 B;  5CJ0 A;  2QSI A;  3TYY A;  2XKM A;  3RLM A;  2Z5H A;  3ZIY A;  4N0K A;  2IFN A;  1JTH A;  1FAV A;  4BRY B;  1MZ4 A;  3TGU G;  3NBT A;  2M0B A;  5CIE B;  2QJP C;  1CO6 A;  4BWN A;  3HE4 A;  3JCU H;  3WUU A;  3AE2 C;  1CYJ A;  4LJI A;  155C A;  3S4R A;  1RE3 A;  5KAI E;  4PV1 C;  1X9V A;  4K3A A;  3A0B V;  3ZOW A;  1GL2 B;  4EDF A;  3E7K A;  1LTS C;  3Q5S A;  1QX8 A;  1SQQ J;  2B10 B;  1OAE A;  2D2C D;  2I1K A;  5KTB A;  1JOC A;  2WVR A;  1SVF A;  1LTT C;  1RAP A;  5CCG D;  2C2C A;  1CSW A;  1I6D A;  2FYU J;  1KZU B;  4I7Z C;  3KXD A;  4IL6 X;  1S72 P;  5APQ A;  2MJZ A;  1OW6 A;  1EZV E;  3L36 A;  1YIT P;  2CA4 B;  2HV4 A;  4EIE A;  3VYM A;  5H2F V;  3HD7 C;  1KQL A;  2OTK E;  1W2B O;  1MUU A;  1OIP A;  2CPS A;  3BAS A;  3MZW B;  2BH5 X;  4LC1 A;  2C1D A;  2L4D A;  4JPZ B;  1SQB J;  2H43 A;  2QM7 A;  1ZRT D;  3G6E P;  1BCC G;  2YKO A;  3H1K D;  2CE1 A;  4H0L C;  2B4Z A;  3L73 G;  1A2S A;  4DZO A;  1HJB A;  3CXH D;  3CX5 H;  1M6Z A;  3HD7 A;  2HFE D;  3EFG A;  5AW0 B;  3M06 A;  3CWB E;  3CI9 A;  4WQC A;  2K9J A;  2WPR A;  2C1D B;  3RBX A;  1DEE G;  2R3S A;  1IRV A;  3WMM 0;  1X79 B;  1PPJ D;  2NPS C;  5GTI V;  1NVO A;  1E29 A;  1JCD A;  2OZ1 A;  1H8A A;  1ZN5 A;  3R2P A;  3AEC C;  1DII C;  5DJT B;  2E74 C;  2WT7 A;  3E1R A;  1KX2 A;  2CPB A;  1T2K D;  1N73 C;  1FI3 A;  3AE8 C;  4U3F G;  2O1K A;  1SQX E;  4JYB A;  3IFM A;  1SQX K;  3L72 D;  3FX0 A;  2ITA A;  2E43 A;  1CW5 A;  3H1I G;  2NPS A;  2PAJ A;  3WUI A;  3AEA C;  3HTK B;  3AE6 C;  4QAO A;  4H0L B;  1YTZ I;  2W6A A;  4JBZ A;  1KYO D;  2OZ1 B;  1H0T A;  1KB9 H;  1SQQ E;  1YI2 P;  1MFT A;  1NTM D;  1YIJ P;  1SQQ K;  4IFD K;  1GTW A;  3L4M A;  1N73 A;  3L71 G;  1I8O A;  2WSF J;  3A5T A;  1LJ2 A;  2PFX A;  5CIH B;  1LC1 A;  1FDI A;  2FYU E;  2V4H A;  1M60 A;  2FYU K;  5CJ4 A;  1M1K Q;  3PRJ A;  1N50 A;  3B71 A;  1CSB A;  5AVR B;  1CIG A;  4GYD A;  5APX A;  3NMD A;  2N3B A;  5B66 V;  3QWO C;  3CCV P;  2KI7 B;  3KZI V;  2KLU A;  3CCL P;  4DT0 A;  2M5A A;  1GZL A;  1VPC A;  2QJY B;  1KOR A;  1GDV A;  5AVU B;  2OYH B;  1ETP A;  3GG2 A;  1EDL A;  1G1I A;  3A0H H;  1LP1 B;  1S1C X;  1RF1 C;  2QEX P;  1E79 H;  1I5T A;  2BCC J;  3L70 D;  1P84 H;  1NAY A;  1MKM A;  1PV3 A;  1CIF A;  1LTA C;  3L74 J;  5AVV B;  3L75 J;  4DY9 A;  1LS9 A;  5KKZ B;  3NFQ A;  1VQ9 P;  2M5A B;  1YTC A;  3CME P;  5BU5 A;  2RMZ A;  4YTP C;  4FA4 A;  1N2D C;  2PRR A;  1NTK J;  1LGH B;  2R32 A;  1Q2N A;  2QVA A;  1RF1 A;  1CED A;  4O9B A;  2YXQ B;  2KSJ A;  1L0N G;  2W27 A;  1N9C A;  1SQP G;  3MP7 B;  2ZT9 D;  1E5W A;  3SFD C;  2W6B A;  1YYC A;  1LT9 B;  1W5C E;  3HQ8 A;  1JY3 O;  4PD4 I;  2KZJ A;  3CCQ P;  1S2E A;  1CXA A;  1WMK A;  2R5D A;  3VNW A;  3O0R C;  1GKS A;  1CCH A;  4AAN A;  1FOS E;  4DOJ A;  2RKL A;  2FXO A;  3V2R A;  2ZJS E;  1FJK A;  1BDD A;  1DW1 A;  3JCU E;  451C A;  1QL1 A;  2Q3E A;  3M9Q A;  1CXC A;  4Y99 B;  2CK3 H;  5KJ7 C;  1DIQ C;  1BDC A;  2E5T A;  3RK2 D;  2BCN B;  2KLV A;  1COR A;  1JY2 O;  3BAT A;  3H1J J;  2BEQ D;  2Q9I A;  1H9Y A;  3V4Q A;  2P7J A;  1AOF A;  1GU4 A;  3PH2 B;  3Q1M A;  2IZ0 A;  5AVW B;  1IC2 A;  4WWI A;  3TYI A;  2Z4E A;  4EIJ A;  5KJ7 A;  1NIR A;  4AAO A;  4H44 C;  1CC5 A;  1LFM A;  1NWQ A;  4OWF A;  3H1H J;  1COT A;  1CRJ A;  2POH A;  3IF4 A;  2LIT A;  1FDO A;  1EZV D;  2N18 B;  2O01 N;  4OVN F;  2XDJ A;  1GK4 A;  1OXZ A;  1WT6 A;  3RN0 A;  3NTN A;  2BCC E;  2GUS A;  5KLV J;  1DH3 A;  3GF3 A;  3L74 E;  4KMG A;  3L75 E;  1DVV A;  5CIG B;  3CPW O;  1FJP A;  3LW5 H;  1QL3 A;  1GK6 A;  1PZQ A;  1CSU A;  3CX5 E;  1L9J C;  3CXH I;  1GL2 D;  1OCD A;  3IN6 A;  1NJI Q;  1NTK E;  3Q2Y A;  4GIF A;  1NTK K;  1LTB C;  4EID A;  1VQO P;  2CE0 A;  1RAQ A;  1SFC B;  1CYC A;  3CWB D;  1PL5 A;  4XE5 B;  3G9R A;  5AVT B;  3F89 A;  3KDP B;  2MKV A;  1VL2 A;  3HUS C;  3RL0 C;  1PGQ A;  2PCB B;  3D71 A;  1U7M A;  4GOF A;  4NPF X;  3ITK A;  3W68 A;  3VP9 A;  3HQ7 A;  1N7S C;  2K9Y A;  1PFI A;  3GLM A;  3P8M C;  2IYP A;  1J1D C;  4XYD B;  1H32 A;  4EIF A;  3WFE C;  3L72 G;  1SQX D;  2OAR A;  3C2C A;  3FXD A;  1H1O A;  2MTA C;  1KYO I;  1KB9 E;  5AW3 B;  1I54 A;  4HYT B;  4W7Y A;  1KV9 A;  1S9K E;  3CCE P;  1N7S A;  1NTM G;  2IBZ E;  1SQQ D;  3A0B H;  4M3L A;  2W8Z A;  1GW4 A;  2QIW A;  1RF0 C;  2P2U A;  1G2C A;  1F1C A;  2FYU D;  2LXC B;  2GUV A;  2O01 J;  3SWK A;  3CU4 A;  3H1H E;  1DT1 A;  1T3J A;  3JC2 2;  1C6R A;  4UB6 V;  1S4X A;  4D6T E;  4HB1 A;  2WSS H;  5KLV E;  1H33 A;  1QGK B;  5KLV K;  2FYN C;  4LLH A;  2HPC B;  3M9B A;  1NO4 A;  2WSC J;  3AE7 C;  1RQV A;  1KIB A;  2FXM A;  3G3Z A;  5H2F H;  3A0H E;  2LIR A;  2KK7 A;  1RF0 A;  2A06 E;  2RH0 A;  1ZV8 A;  1R8E A;  2HLO A;  1P84 E;  1U74 B;  2ZAE B;  3A3Y B;  4H0L D;  3L70 G;  3WC8 A;  1KQS O;  5AW1 B;  1A8C A;  2DGE A;  3JBT B;  3EQ2 A;  3PP5 A;  3F5H A;  3LW5 J;  1PP9 G;  4EIC A;  3OAK A;  1H33 B;  2YMY A;  2C9N Y;  1BCC J;  1HZV A;  1IFN A;  3L73 J;  3C1L A;  5AUR A;  2C9L Y;  2ZZS 1;  4OGQ B;  2OYO A;  1JCC A;  2OYI C;  1YHQ P;  2N1T B;  5AW5 B;  2HG5 D;  2H88 C;  3P7K A;  2R5B A;  3TDK A;  2ZFC A;  4C7N A;  1S5L X;  1VQ7 P;  2KZI A;  2FY8 A;  4K3I A;  3JSV C;  2IPP A;  1HJ0 A;  1CTY A;  5DJQ C;  2H89 C;  4FA1 A;  5GTI H;  3MIW A;  2KS1 A;  2HOD A;  4P4Q B;  1LWU B;  2E76 B;  3OW2 O;  3EFF K;  4PW9 B;  3G4S P;  2GIW A;  3I55 P;  4PD4 H;  1FI9 A;  2G8Y A;  1AVO A;  3I5C A;  1Q86 Q;  1NKN A;  3H32 B;  1K05 A;  1EDI A;  3TF5 A;  4U3F J;  1FZC C;  3WU2 V;  4WQ7 A;  351C A;  1R5L A;  3L37 A;  2WSF H;  1AA0 A;  1GJQ A;  1JTH B;  1J1E C;  4EYY Q;  1YQ3 C;  2KSE A;  4LGD E;  3L4F A;  1YCC A;  4KT0 J;  1XTG B;  5E79 V;  3HE4 B;  2ZBO A;  1HH7 A;  1SQV J;  1QKS A;  1AKK A;  3RK3 B;  1T6A A;  2O3J A;  2GC4 D;  2C9X B;  3L71 J;  2YIU B;  4AAM A;  1QVF O;  1K9M Q;  1FZC A;  1OVV A;  3AE9 C;  3H1L J;  1WEJ F;  3TSI A;  4ZMD A;  3VMZ A;  5DJQ B;  1RE4 C;  5B66 H;  1GU5 A;  2M8R A;  3G71 P;  2PP6 A;  1EZV I;  2YO3 A;  3KZI H;  1EZV G;  2ZXE B;  1A02 F;  2QJP B;  1DIP A;  1IQC A;  3SLE A;  5TIS H;  5CCH C;  1DW2 A;  3CXH W;  2XV5 A;  3BCC J;  2BCC D;  2D0W A;  1MG2 D;  4XFJ A;  3L74 D;  2FKW B;  4PV1 B;  5APT A;  3L75 D;  4WQD A;  2QG4 A;  1ZME C;  1RE4 A;  1DVH A;  1L4A C;  3CC4 P;  3L73 E;  5GTH V;  1KB0 A;  3CX5 D;  4YXD C;  1LMS A;  2IDB A;  3RK3 E;  1KQG B;  4WVZ A;  2V7Q H;  1NTK D;  2AEF A;  1KIL C;  5CCH A;  1NTZ E;  2FXP A;  1CRH A;  3CWB G;  3NWV A;  1NTZ K;  4I7Z B;  1BSN A;  3D6Z A;  3KHU A;  3MD0 A;  1AOQ A;  2KNC A;  2HR3 A;  4H13 C;  1LTJ C;  1L4A A;  3HD7 B;  1VQM P;  5APU A;  2XND H;  2YXR B;  1EXI A;  2JR8 A;  1L0N J;  2FFD C;  3WFB C;  1SQP J;  4J20 A;  2K9J B;  3M9H A;  1KIL A;  1KYO W;  4H0J A;  2XNX A;  3OCD A;  1HZU A;  1N15 A;  4AYC A;  1Q81 Q;  1LT1 A;  1SQX G;  1VQ8 P;  2Z5I A;  4Z1M H;  1EB7 A;  3VMY A;  3GHG C;  2ZON G;  4V2K A;  1LTJ A;  2DVH A;  2WT7 B;  4L1Q A;  4JQ0 D;  1HJ5 A;  4DJG A;  1KB9 D;  2HYN A;  3HQ6 A;  2FFD A;  3A0B E;  3AE5 C;  3CMA P;  1IO4 A;  1SQV E;  1S9K D;  3TK1 A;  4PJ0 V;  5KAF V;  4AQR D;  1SQV K;  3SJL A;  5L8R J;  2IBZ D;  3L71 E;  1LNQ A;  3OCD B;  1SFC D;  2B87 A;  3VYI A;  2NPS B;  1H89 A;  3H1L E;  2QM8 A;  1FU1 A;  2FYU G;  1NML A;  1H0T B;  3C8V A;  3MGN A;  4TT3 H;  3PHL A;  4FAN A;  3GHG A;  2E74 B;  1BGY D;  5C39 A;  3RN1 A;  2D2C C;  1HWT C;  2Q3I A;  2YO2 A;  1SQB E;  1N73 B;  1VDF A;  5TIS V;  1LTI C;  5DFS A;  1JB0 J;  1SQB K;  5CCG C;  4ZKP A;  3OA7 A;  4D6T D;  5H2F E;  1Y8A A;  5KLV D;  3BCC E;  3O20 A;  3MK7 C;  1FZE A;  4C46 A;  1DX7 A;  2L5G B;  3CCS P;  2C1U A;  5AW2 B;  2ZVN B;  1FJ0 A;  3U1A A;  2JDI H;  1N86 A;  2A06 D;  4RSZ A;  1CCR A;  2QJK C;  4A7P A;  1P84 D;  5APW A;  4C7R A;  4IL6 H;  4ZKU A;  2AXT V;  4WQA A;  1C6S A;  1HRC A;  5CCG A;  1Y9B A;  2Q5U A;  1QYZ A;  3PTZ A;  1OZH A;  2Y9Z A;  2E75 C;  3PXS A;  1CI6 A;  3DP5 A;  5M1B A;  1L0L J;  1YQ4 C;  2P58 A;  2V7Q J;  1Q7Y Q;  1VQK P;  3VN0 A;  1I55 A;  2V08 A;  1AQT A;  1KTM A;  1JY3 N;  1CYI A;  3CC7 P;  1U75 B;  1OW7 A;  1RQU A;  1SQP E;  5APY A;  5GTI E;  4FB1 A;  2A45 H;  1NU1 J;  3T97 A;  2IZ1 A;  1SQP K;  1FOS F;  4BXL A;  3ZOX A;  1QVG O;  2V07 A;  1GW3 A;  4WQ9 A;  4PD4 E;  4GKG A;  1HF9 A;  1C7M A;  1HVV A;  1L2P A;  1DD4 A;  3C9I A;  5TJH A;  3BVH A;  1RF1 B;  4GOD A;  1NMI A;  1X22 A;  2OGU A;  1S5L V;  4FA9 A;  5AW4 B;  1NKZ B;  2WPV B;  4KHX A;  2SPZ A;  5B5E V;  3UIA A;  3FWN A;  4CPG A;  1YJ9 P;  1XTC C;  1FOC A;  1JNM A;  1QL2 A;  1JY2 N;  3L72 J;  3T97 B;  2JWD A;  2ZOO A;  5KLI C;  1C75 A;  2FBW C;  1U57 A;  3AEB C;  5AVQ B;  4DCK A;  1CHI A;  1W5C T;  3Q3D A;  1IRW A;  4OGQ D;  2LXB A;  5DJU B;  2O01 H;  3CCU P;  1FS0 E;  2N1T D;  2QRX A;  2G3A A;  4AAL A;  4O1W A;  1IFM A;  1GIW A;  1FZF A;  2WWW A;  5B66 E;  3N7N A;  1OMI A;  1MV8 A;  3B5N C;  2CXB A;  2WSC H;  3KZI E;  2E76 D;  3A2A A;  1M1J C;  3B8E B;  4R4L A;  3WFC C;  4UB6 H;  1CRG A;  1NOH A;  5TIS E;  1HGZ A;  1KX7 A;  3PJS K;  1RHZ B;  1W2E A;  4IL6 V;  1KQF B;  1FC2 C;  3H6P A;  4L74 A;  1PIX A;  3CYT I;  3L74 G;  4IFF A;  3H1K G;  2UWJ E;  1BE3 J;  3BRT B;  3KPE A;  1HH0 A;  1HJ3 A;  2Y9Y A;  3B5N A;  1KN7 A;  4KJM A;  2C8S A;  1M1J A;  1DW0 A;  1N8R Q;  3MUD C;  2JTI B;  4RKU J;  1L0L E;  1VQP P;  3PH0 A;  1L0L K;  3L73 D;  1NTK G;  3IAO A;  4WBA A;  2JP3 A;  2WQY C;  3O8Z A;  1KV4 A;  3RK3 D;  1PP9 J;  4MN4 C;  1PPJ G;  1H31 A;  1QL4 A;  2H8P D;  1NTZ D;  1NU1 E;  4H44 B;  4I1L A;  4GED B;  1NU1 K;  2OTJ P;  1W2L A;  3B5N B;  4YE1 A;  3HRN A;  1HBW A;  4L3G A;  3S9O A;  1RY3 A;  2GM4 A;  4PWA A;  3MUD A;  2K3R A;  1IK9 A;  1KD1 Q;  1SLQ A;  3ZBM A;  3FWL A;  1M70 A;  3M97 X;  2P10 A;  2JQR A;  3HUS A;  5K5G B;  2JEE A;  2PAC A;  1N7L A;  2P1J A;  4PV1 D;  2BLF B;  3CL3 D;  3TGU J;  4JYC A;  1EQ7 A;  4L75 A;  1NGM B;  1M7L A;  3H1J E;  3VMX A;  3U59 A;  1Z56 A;  5KAI V;  1LC2 A;  3WU2 H;  3O6Q A;  4I2L C;  5APV A;  1GMJ A;  3VRD A;  1H32 B;  2IBZ G;  2B9B A;  1SQV D;  3WUT A;  2AEM A;  5CID B;  3O5C A;  3HUS B;  3RL0 B;  1OVR A;  1YJN P;  5E79 H;  3RK2 C;  3L71 D;  2D0S A;  3RGU A;  3H1L D;  3VMA A;  1CHH A;  1BGY G;  4UB8 H;  1N7S B;  3HD7 D;  1KC8 Q;  2DW3 A;  2JWA A;  3KYQ A;  1J1D B;  1M90 Q;  1QLE D;  2YKP A;  3MTU E;  4D6T G;  1SQB D;  2B89 A;  5KLV G;  5CCH D;  4JCG A;  1ZXG A;  1YNR A;  1Q82 Q;  2P67 A;  4WQ8 A;  1SP4 A;  1DEB A;  1G2C B;  1G1J A;  4RJT A;  4WY4 C;  3SVW A;  2M3E A;  1BE3 E;  1QEX A;  3BCC D;  1AVY A;  3D6Y A;  1FBM A;  4FAV A;  2A06 G;  1P84 I;  3CCM P;  4Y5R A;  4IL6 E;  1AJY A;  1VQL P;  2VHD A;  1FZA A;  1URQ C;  1NH4 A;  2GC7 D;  1CRC A;  1OFC X;  2AEJ A;  5CIC B;  1CTJ A;  1PP9 E;  5AW7 B;  4OH8 B;  5BU8 B;  3VTP C;  2YKQ A;  5GTH H;  4WY4 A;  2NPS D;  2N9Y B;  1GL2 C;  1JDL A;  4BRY A;  2E74 D;  2PCC B;  1URQ A;  2ZYA A;  4O1Q A;  1HRO A;  1YEA A;  2FYN B;  1WVE C;  1SQP D;  3V2N A;  1FE6 A;  3RL0 g;  1MFZ A;  3M91 A;  3AE3 C;  2OYI A;  2WSE H;  4WY4 B;  3TGU E;  2FWL A;  3VP8 A;  1GL2 A;  4PD4 D;  1VF5 C;  3AED C;  4C7N B;  5APS A;  1CIH A;  2K88 A;  3GMA A;  2OQQ A;  5AW9 B;  2Q7C A;  2YK3 A;  1URQ B;  3OJA B;  1YEB A;  2FYZ A;  4K35 A;  1VQ6 P;  5IY5 1;  1NNO A;  1USE A;  2KS1 B;  3H1I J;  2HOD B;  3V2Q A;  1SQX J;  2K37 A;  1AV1 A;  3Q5R A;  1K3G A;  2KXP B;  2C1V A;  1R5S A;  3S1K A;  1ZOY C;  1EXJ A;  3TNU A;  2E42 A;  1RZ6 A;  2OTL P;  2OYI B;  5BVZ A;  3IR9 A;  4GDO A;  5CIB B;  3P8C E;  3WFD C;  1K8A Q;  3CP5 A;  4PJ0 H;  3N4X A;  4UB8 V;  5KAF H;  1B7V A;  3GW6 A;  1FZG A;  2J5U A;  1I6E A;  1DW3 A;  4YPC A;  3CCJ P;  1I8P A;  4HKZ H;  3L4O A;  5AVZ B;  3AEF C;  1FCD C;  4Y28 J;  3ZDM A;  4XA4 A;  1ZZH A;  1MZ9 A;  4UB6 E;  3E1I A;  2EXV A;  4XXL A;  1IK7 A;  3TNU B;  1BSH A;  2XTS B;  3D0W A;  1GDT A;  1OVU A;  2XU6 A;  1K73 Q;  1JY3 P;  1VF5 B;  3V5B A;  1F1F A;  2BAS A;  1FZC B;  3HE5 A;  3CX5 W;  3X39 A;  4AUW A;  1HUC A;  2ZXY A;  5AVY B;  1BCC E;  2W90 A;  2R44 A;  3SWF A;  1J1E B;  1IZL 0;  2E75 D;  2AXT H;  3CXH H;  1FDM A;  2K1A A;  4R4M A;  1CIE A;  3II6 A;  1M8O B;  1L0L D;  4IOI H;  2Y0C A;  1ZR4 A;  4I6M C;  3W67 A;  1NHL A;  1JY2 P;  2NRG A;  3HE5 B;  2FRC A;  1NTZ G;  5CHX A;  2MHM A;  3MHV A;  4H0K A;  1NU1 D;  2IFM A;  3RMZ A;  1WRG A;  3PLN A;  5C0Z A;  3HTK A;  2ZVO B;  2JO1 A;  4U3F E;  1E2R A;  1PGP A;  2YNY A;  2Q6Q A;  1HGV A;  3ZOO A;  2WSE J;  1C2R A;  2BEZ F;  2QJY C;  5EXQ A;  1J3S A;  3H1I E;  5KJ7 D;  1YBK A;  1C2N A;  4TLF A;  2KNC B;  1S5L H;  2OYH C;  1L4A B;  3AE1 C;  3WU2 E;  5B5E H;  5CBO A;  3H1J D;  1KYO H;  1SQQ G;  3FXE A;  2RN0 A;  5CIF B;  2R3C A;  1Q90 D;  1U7J A;  1KIL B;  1ZR2 A;  3DR0 A;  1ZP0 C;  5AW8 B;  1YIC A;  3BRV B;  5KKZ C;  2KYV A;  1CTZ A;  1SQV G;  1Y47 A;  5E79 E;  1VQN P;  1RH5 B;  1UIX A;  4H44 D;  2ZXX A;  4H13 B;  2OYH A;  1LTJ B;  3H1L G;  1L9B C;  4UB8 E;  3B5N D;  1KMI Z;  3H1H D;  1LP1 A;  2AI5 A;  2FFD B;  2WIT A;  4B86 A;  1JM0 A;  2Y0D A;  1FHB A;  2QE7 H;  2W6J H;  2XZR A;  1SQB G;  1K04 A;  3AEG C;  5CYT R;  2B87 B;  2KP8 A;  1LT9 C;  2GA1 A;  1YTZ T;  1A56 A;  3BCC G;  4L76 A;  2WPQ A;  3RBZ A;  3ABV C;  1IFJ A;  4N6J A;  4RO0 A;  3GHG B;  1BE3 D;  4L3H A;  4AX3 A;  2I8F A;  3VOP A;  4GOE A;  1KIL E;  3FGA D;  1C52 A;  1X8Y A;  4HH2 A;  1FZB A;  2LKM A;  4QMA A;  3KQG A;  1TU3 F;  1IFI A;  3H1K J;  4HJG H;  5GTH E;  3O1Y A;  4Y99 C;  1LT9 A;  2IX7 C;  2JKV A;  1PP9 D;  3RL0 D;  1EDK A;  1HJ4 A;  1GD2 E;  5B6Q A;  1D7M A;  4N78 E;  3SWY A;  1L0N E;  2D2C B;  3SFE C;  1YFC A;  4GT1 A;  1N7S D;  3QH9 A;  1L0N K;  5CBN A;  1DD3 A;  1KFM A;  1EC5 A;  2W83 C;  2KB7 P;  3CCR P;  3B4S A;  3MK7 B;  1CI6 B;  3GF7 A;  4W7Z A;  2N9B A;  2QJK B;  1T2K C;  3TGU D;  2N18 C;  1HTL C;  2KUB A;  3D70 A;  2JJL A;  3PXT A;  2GB8 B;  4WB4 A;  4ASW A;  2E75 B;  4ZNC A;  4FA5 A;  4W80 A;  3V2P A; 
#chains in the Genus database with same CATH homology
 1GJQ A;  1NTM D;  1YIQ A;  3DMI A;  3L4M A;  3VRD A;  1H32 B;  1YCC A;  1I8O A;  5E79 V;  1SQV D;  2N3Y A;  2N9I A;  5CID B;  3O5C A;  5CIH B;  1LC1 A;  2ZBO A;  1HH7 A;  1QKS A;  3OA8 A;  1AKK A;  1M60 A;  3L71 D;  2O3J A;  2GC4 D;  2D0S A;  3PRJ A;  1N50 A;  2C9X B;  2YIU B;  4AAM A;  3H1L D;  3VMA A;  1CHH A;  1CIG A;  4GYD A;  1MG3 D;  1CRI A;  2N3B A;  5B66 V;  1WEJ F;  5DJQ B;  2JWA A;  3KZI V;  2B0Z B;  1AYG A;  1H9X A;  1SQB D;  2QJY B;  4JCG A;  1YNR A;  2QJP B;  4WQ8 A;  1GDV A;  2BH4 X;  4RJT A;  3SVW A;  1ETP A;  3GG2 A;  3A0H V;  1IQC A;  3SLE A;  3BCC D;  1DW2 A;  3OA8 B;  3CXH W;  2BCC D;  2D0W A;  1MG2 D;  4FAV A;  3L74 D;  4Y5R A;  3SWS A;  1I5T A;  3L75 D;  4WQD A;  2VHD A;  5KLI B;  3L70 D;  1CIF A;  4Q5P A;  1BCC D;  4DY9 A;  2QG4 A;  1LS9 A;  5KKZ B;  2GC7 D;  1CRC A;  3A9F A;  1DVH A;  5CIC B;  1YTC A;  1CTJ A;  5GTH V;  1KB0 A;  2RMZ A;  3CX5 D;  4FA4 A;  1LMS A;  1NTK D;  2L91 A;  2N9Y B;  1RZ5 A;  1JDL A;  1CRH A;  3NWV A;  1CSV A;  1CED A;  1HCM A;  2PCC B;  1N9C A;  4O1Q A;  3KHU A;  1AOQ A;  1N90 A;  1HRO A;  1YEA A;  1E8E A;  2FYN B;  1WVE C;  3HQ8 A;  1SQP D;  2B12 B;  3WFB C;  1CXA A;  4J20 A;  2K9J B;  2FWL A;  1KYO W;  1H31 B;  4WQB A;  4H0J A;  3VNW A;  3O0R C;  1GKS A;  3OCD A;  1CCH A;  4PD4 D;  4U3F D;  3SXT A;  4AAN A;  3PXW A;  1HZU A;  1N15 A;  1CIH A;  1CSX A;  3ORV A;  1DW1 A;  4MU8 A;  1VYD A;  1QN2 A;  451C A;  2YK3 A;  3H1I D;  1YEB A;  2Q3E A;  5IY5 1;  1CXC A;  1EB7 A;  1NNO A;  2ZON G;  4V2K A;  2DVH A;  4L1Q A;  1HJ5 A;  1K3G A;  1KB9 D;  3ZCF A;  3HQ6 A;  2C1V A;  1DIQ C;  1GU2 A;  2BCN B;  1COR A;  1RZ6 A;  1IO3 A;  1K3H A;  4PJ0 V;  5KAF V;  3SJL A;  5CIB B;  1H9Y A;  2IBZ D;  3HQ9 A;  3WFD C;  3OCD B;  3CP5 A;  4UB8 V;  1AOF A;  1B7V A;  3GW6 A;  5DF5 A;  1GQ1 A;  1I6E A;  1DW3 A;  3PH2 B;  1NML A;  1I8P A;  4WQE A;  1S6V B;  3PHL A;  4FAN A;  3L4O A;  2YCC A;  3TYI A;  1BGY D;  1FCD C;  2AIU A;  3RN1 A;  1NIR A;  4AAO A;  1CC5 A;  1ZZH A;  1LFM A;  5TIS V;  2EXV A;  5DFS A;  4XXL A;  1COT A;  1CRJ A;  3NBS A;  4D6T D;  2LIT A;  1EZV D;  2N18 B;  2XTS B;  5KLV D;  2N9J A;  1F1F A;  1FI7 A;  3O20 A;  3MK7 C;  3RN0 A;  1R0Q A;  4KMG A;  2C1U A;  1FJ0 A;  3CX5 W;  3X39 A;  1DVV A;  2CA3 B;  2ZXY A;  2A06 D;  4RSZ A;  1CCR A;  5CIG B;  4NFG B;  2BPB B;  4A7P A;  1P84 D;  1QL3 A;  1IZL 0;  2AXT V;  4WQA A;  1C6S A;  1HRC A;  1BL9 A;  1CHJ A;  1CNO A;  1CRY A;  1CSU A;  1L9J C;  1OCD A;  2BGV X;  1QYZ A;  3PTZ A;  1CIE A;  5C9M A;  1L0L D;  3PXS A;  2Y0C A;  4EID A;  3DP5 A;  2CE0 A;  2YQB A;  1RAQ A;  2FRC A;  1CYC A;  3CWB D;  1I55 A;  2V08 A;  2MHM A;  2ORL A;  4H0K A;  1CYI A;  1L0N D;  2Y0E A;  1NU1 D;  1C6O A;  3RMZ A;  2PCB B;  1U75 B;  3ZOY A;  4FB1 A;  3PLN A;  3ITK A;  5C0Z A;  2B11 B;  3HQ7 A;  3ZOX A;  3RLM A;  3ZIY A;  2V07 A;  4N0K A;  4WQ9 A;  1C7M A;  1E2R A;  5TJH A;  4XYD B;  1MZ4 A;  3ZOO A;  1H32 A;  4EIF A;  1NMI A;  1C2R A;  1S5L V;  4FA9 A;  3NBT A;  3WFE C;  5EXQ A;  1J3S A;  5CIE B;  1SQX D;  1C2N A;  1CO6 A;  2KNC B;  5B5E V;  3C2C A;  1H1O A;  2MTA C;  1FOC A;  1I54 A;  1CYJ A;  4LJI A;  155C A;  3H1J D;  2RN0 A;  5CIF B;  1KV9 A;  2ZOO A;  3A0B V;  3DR0 A;  1C75 A;  3ZOW A;  4EDF A;  1YIC A;  1SQQ D;  1CHI A;  1W5C T;  1CTZ A;  2B10 B;  1IRW A;  1OAE A;  4AAL A;  4O1W A;  1F1C A;  2FYU D;  1GIW A;  1L9B C;  1RAP A;  2C2C A;  1CSW A;  1I6D A;  3H1H D;  3CU4 A;  2AI5 A;  1DT1 A;  2CXB A;  1C6R A;  4UB6 V;  2Y0D A;  1FHB A;  3WFC C;  1H33 A;  2CA4 B;  2HV4 A;  4EIE A;  3VYM A;  1CRG A;  5H2F V;  5CYT R;  1KX7 A;  1KIB A;  1A56 A;  2BH5 X;  2LIR A;  4IL6 V;  2C1D A;  2L4D A;  1BE3 D;  3CYT I;  4L3H A;  1U74 B;  1ZRT D;  4AX3 A;  2I8F A;  3WC8 A;  1A8C A;  2DGE A;  3JBT B;  1C52 A;  1HJ3 A;  3H1K D;  2CE1 A;  2C8S A;  2B4Z A;  1DW0 A;  1A2S A;  4EIC A;  2JTI B;  3CXH D;  1H33 B;  3O1Y A;  1M6Z A;  3L73 D;  1HZV A;  1PP9 D;  1HJ4 A;  4WQC A;  5AUR A;  5B6Q A;  2C1D B;  2ZZS 1;  1H31 A;  1QL4 A;  1NTZ D;  1YFC A;  3TDK A;  1IRV A;  4GED B;  1PPJ D;  4K3I A;  1W2L A;  4YE1 A;  5GTI V;  4L3G A;  1E29 A;  2OZ1 A;  4PWA A;  1CTY A;  5DJQ C;  4FA1 A;  1DII C;  2KS1 A;  4P4Q B;  3MK7 B;  3ZBM A;  3FWL A;  1M70 A;  1KX2 A;  3M97 X;  2JQR A;  4PW9 B;  1FI3 A;  2GIW A;  1FI9 A;  2QJK B;  2PAC A;  3TGU D;  2N18 C;  3L72 D;  2BLF B;  3TF5 A;  3PXT A;  3WUI A;  3WU2 V;  4WQ7 A;  351C A;  4QAO A;  2GB8 B;  1KYO D;  5KAI V;  2OZ1 B;  1LC2 A;  4FA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...