2QJYB

Crystal structure of rhodobacter sphaeroides double mutant with stigmatellin and uq2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
b'AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed Structures of the Cytochrome bc1 from the Photosynthetic Bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 67
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjyB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjyB02
2QJYB 2D0WA 1SQQD 2B11B 4UB6V 1QKSA 2HV4A 1M70A 2L4DA 1LC1A 3PTZA 2O3JA 1NTZD 2JTIB 1CIGA 4GEDB 2N3YA 1QL4A 3O20A 3CXHD 1SQPD 2L91A 2BCNB 1H32B 3PH2B 2CA3B 1CHHA 2VHDA 3OCDB 3PXSA 1M60A 3OA8A 3H1ID 3HQ6A 4EICA 3ZOWA 4WQAA 2FYUD 4FA4A 1C7MA 1I54A 5AURA 5TISV 1DW3A 3O1YA 2B10B 2N9YB 1S6VB 4WQ8A 2QJPB 1C6SA 1RAQA 4WQ9A 1GIWA 2GC4D 3ORVA 5KAIV 1J3SA 1KB9D 3DR0A 3WU2V 4AAOA 1HROA 1C6RA 3CYTI 5GTIV 2V07A 1CRCA 1FI7A 1A56A 1S5LV 2KNCB 2BGVX 1IRWA 4WQCA 3A9FA 2OZ1B 1H9YA 1CSVA 2LIRA 1CNOA 3A0HV 1W5CT 4FA1A 1LMSA 1LFMA 2FYNB 3PXTA 3VRDA 3RMZA 1A2SA 4L3HA 1LS9A 1IRVA 2GB8B 1YEAA 1CRIA 1AOFA 2RN0A 4J20A 2AIUA 5CIEB 4WQ7A 5H2FV 4LJIA 1ETPA 1DT1A 1C75A 2JWAA 2YCCA 1K3HA 1C52A 1YTCA 4EDFA 1A8CA 1YEBA 5TJHA 1MG2D 1H1OA 5KLIB 2PACA 2K9JB 2C1DA 5CIGB 1YIQA 3OA8B 3KHUA 1L9BC 1BGYD 2ZBOA 2A06D 1CXCA 4AANA 4V2KA 5DFSA 2CXBA 1E2RA 1CORA 1CRHA 4FB1A 1CYJA 3HQ7A 1CTZA 3GG2A 1HJ5A 4XXLA 1N15A 2N18C 4Y5RA 1LC2A 1F1CA 2BH4X 1I6DA 1L0LD 3RLMA 1CRYA 2IBZD 2N9JA 1HJ3A 1N50A 3MK7B 3WFEC 1JDLA 4L3GA 4KMGA 1NIRA 4EIFA 5CIBB 4NFGB 1NMLA 2ZONG 2BCCD 3H1JD 1CSUA 1SQBD 1E8EA 3ZBMA 1CHJA 3ZOYA 3SWSA 2YK3A 5DF5A 3VYMA 5C9MA 2N9IA 5CIHB 1PPJD 1N90A 2PCCB 2C1VA 1B7VA 4H0JA 1CC5A 4PW9B 4K3IA 1C6OA 1I8OA 5C0ZA 1KV9A 2ZZS1 1FI9A 3L75D 1KYOW 2C2CA 4L1QA 5CIDB 3WFBC 1ZRTD 1I5TA 1WVEC 3L4MA 3ZOXA 3JBTB 2Y0CA 1YICA 1VYDA 2BLFB 2RMZA 351CA 1ZZHA 1CIHA 1OAEA 1M6ZA 1RZ6A 2C8SA 5CIFB 3PRJA 1P84D 4PJ0V 2MTAC 1YCCA 1KIBA 3NBTA 1CTJA 1C2NA 4A7PA 1CCRA 4IL6V 2DGEA 3TGUD 4WQEA 2C1DB 3FWLA 3PLNA 1KYOD 4FANA 1NNOA 1H31A 4QAOA 2ORLA 5B66V 3VNWA 1CRJA 1OCDA 4UB8V 1H33A 2Q3EA 1NTMD 4O1QA 1QN2A 1CHIA 1GQ1A 5KLVD 1CSWA 2D0SA 5CICB 1NU1D 5DJQC 2AI5A 3VMAA 1YNRA 3NWVA 3TF5A 2EXVA 1I6EA 3WUIA 2BH5X 2XTSB 1HJ4A 1C2RA 2B12B 2MHMA 1EZVD 2FRCA 1L9JC 3SJLA 2C9XB 1DIIC 3M97X 3X39A 3C2CA 3KZIV 1CXAA 2PCBB 1DVVA 1HZVA 4FA5A 2Y0EA 4AAMA 2V08A 5IY51 4FA9A 1HZUA 2B0ZB 4WQBA 1FJ0A 1CO6A 1DW1A 1BL9A 3HQ8A 3PXWA 1IQCA 2B4ZA 2LITA 2GIWA 1U74B 4U3FD 1KX2A 3L4OA 3L71D 3O5CA 2YIUB 2CE1A 3CX5W 4RJTA 3H1LD 3PHLA 3SVWA 3A0BV 4GYDA 3L70D 4H0KA 1HH7A 3L73D 1CCHA 1QL3A 1GDVA 3SLEA 1H31B 1HRCA 2N3BA 4AX3A 3ITKA 1HCMA 5KAFV 1YFCA 1CTYA 3WFCC 1K3GA 3TDKA 1H33B 1CYIA 2BPBB 1FI3A 4EIEA 3MK7C 2I8FA 2ZOOA 1MZ4A 1AKKA 3CX5D 2QG4A 1CSXA 3CU4A 4YE1A 3ZCFA 1I8PA 1DW0A 3RN1A 1QYZA 2GC7D 1AOQA 4MU8A 4PWAA 1BCCD 1SQXD 1NMIA 2DVHA 1IO3A 1CRGA 1DW2A 2FWLA 2KS1A 3ZOOA 1PP9D 3BCCD 5B6QA 2QJKB 4O1WA 451CA 2Y0DA 1FHBA 1NTKD 4WQDA 1CYCA 2C1UA 4D6TD 1R0QA 4RSZA 5CYTR 3WFDC 1CIEA 5DJQB 1FCDC 1BE3D 3TYIA 1F1FA 4XYDB 3DMIA 5KKZB 1H32A 3H1KD 3SXTA 1RAPA 3OCDA 4N0KA 1DVHA 3RN0A 5B5EV 3O0RC 5GTHV 2JQRA 1U75B 1AYGA 1L0ND 155CA 1CEDA 1EB7A 1GJQA 1KX7A 1KB0A 3CP5A 3ZIYA 1H9XA 2ZXYA 4EIDA 1CIFA 1WEJF 1W2LA 2N18B 1COTA 2YQBA 2CA4B 1N9CA 3DP5A 3GW6A 4Q5PA 1RZ5A 3H1HD 5E79V 1I55A 4JCGA 4DY9A 2CE0A 5EXQA 3L74D 3HQ9A 2OZ1A 1GKSA 4P4QB 1GU2A 1MG3D 3NBSA 1FOCA 3CXHW 4PD4D 1E29A 4AALA 2AXTV 3CWBD 1DIQC 4FAVA 3L72D 1IZL0 3WC8A 1SQVD
chains in the Genus database with same CATH superfamily
2KS1B 1WRGA 4I7ZC 5EFWB 2QM7A 2A45H 2NPSA 1J1EC 3GMAA 2L4DA 4I1LA 2IFMA 5H2FE 2FY8A 2JTIB 3E7KA 2A06G 2M5AA 2ZVOB 1OFCX 3CPWO 3B71A 1OVRA 1VF5D 3RL0D 3CXHD 2L91A 2BCNB 3PH2B 1KQLA 1W2EA 3QWOC 3M9HA 4H13D 1L0LG 2WSSH 3V4WA 4EICA 4WQAA 2FYUD 1KORA 4FA4A 2AXTE 3H1JG 1NTKJ 1FC2C 4WY4A 2N1TA 2MKVA 4UB6E 3L35A 3HUSC 5KAIV 1KB9D 1NU1J 2D2CC 1X22A 3H1IG 4OVNF 2P10A 3A2AA 2V07A 1HH0A 1A56A 1A02F 1IK9A 3ZDMA 1SQXK 1G2CB 3A5TA 4HKZH 2LIRA 4RESB 4GDOA 1W5CT 1LFMA 3MGNA 3PXTA 3M06A 4L3HA 1SQXE 5TISE 1GU5A 2YXRB 4IOIH 3W67A 1KILB 4J20A 2KI7B 4H44D 4WQ7A 2N9BA 2W90A 1ETPA 2ZYAA 2JWAA 3RK3E 1BDCA 3D0WA 3WU2E 2O01J 1YTCA 2J59M 4EDFA 4PJ0E 2YMKA 2Q9IA 3HTKB 5TJHA 2B87A 3HD7A 4IFFA 5KLVG 2L5GB 1DD4A 1D7MA 1YIQA 4DJGA 2HR3A 3RL0g 2A06D 1ZLLA 1CXCA 3D6YA 2WPSA 2CXBA 4H0LC 1CYJA 2HLOA 3GG2A 4Y5RA 1LC2A 1AQTA 1NKNA 5AW4B 1HBWA 5APWA 1GW3A 1L0LD 4OGQC 3RLMA 1CRYA 2WQYC 3CCQP 1M7LA 2G3AA 3WFEC 2IFNA 3JCUH 1JDLA 1KMIZ 4EIFA 1M8OB 3H1JD 1NO4A 1CSUA 3H1IJ 1IFIA 3ZBMA 1CHJA 2YK3A 5DF5A 3VYMA 4N6JA 1IO4A 5AVQB 3BRTB 2ZXXA 1SQVK 5CIHB 3E1IA 4I2LC 3CCRP 2PCCB 4H0JA 1VQ8P 2ZJSE 2QJYC 3K5BA 1N73B 1I8OA 1XTGB 3L71E 2OTLP 1FI9A 1YJNP 3KPEA 2P58A 5CIDB 3L36A 1ZRTD 1SQVE 2E43A 1CI6B 1GL2B 1JCCA 1AVYA 3ZOXA 2C0WA 1YICA 2RMZA 2BLFB 2IYOA 1NGMB 3UIAA 1Y8AA 1OAEA 3VP9A 2C8SA 5CIFB 1P84D 1YCCA 3AEGC 3I5CA 4A7PA 3Q5SA 3N4XA 1MZ9A 2C1DB 2KLUA 2HODA 2JP3A 2WPVB 1CZQA 4FANA 3MUDA 1LTJA 2W8ZA 2Q3EA 1NTMD 1QN2A 1N86A 1URQB 1SQXG 1GQ1A 2KP8A 5KLVD 5AVXB 5CICB 1N7SA 3HRNA 1MKMA 1LNQA 3BRVB 1AQ5A 1YNRA 3NWVA 4JYCA 2XZRA 1VQ4P 5AW9B 3II6A 3WUIA 1SLQA 2FKWB 2XTSB 1FAVA 3SJLA 2C9XB 3X39A 3HE5A 1PGQA 1NHLA 1H0TB 3VTPC 1ZV8A 1OMIA 2PCBB 4MN4C 3G71P 1HGVA 2O01N 2QSIA 4FA5A 4AAMA 1YTZT 1FZFA 2WTYA 2JEEA 3CC2P 3PP5A 3WUUA 1G1IA 5B66E 3TNUB 3F5HA 1SFCD 4BXLA 4UB8E 4WQBA 2LXCB 3AE8C 1JY3P 1LP1B 4XA4A 5BU5A 2YIUB 3CX5W 2WT7B 2Q3IA 5APXA 4C46A 4GYDA 4H0KA 3H1HG 2P67A 3KZIE 3H32A 1GDVA 3B8EB 3L74E 1S5LH 4AX3A 3ITKA 3JC22 2YXQB 2AEFA 1HCMA 5KAFV 4WWIA 1CTYA 3S9OA 2SPZA 1FI3A 3L72G 1VQOP 1SQBK 2WPQA 3SWYA 1SQVG 1MUUA 1FZBA 5E79E 4I6MC 5GTHH 3AECC 3Q5RA 3RN1A 2IBZE 1S3JA 2I8DA 3TGUJ 1AOQA 1M90Q 3CD6P 4MU8A 1NKZB 1JY2O 4N3YB 1SQXD 1NMIA 1SQBE 1IO3A 2FWLA 2KOGA 4K35A 5B6QA 1LTTC 1PPJE 2WZ7A 3M0AA 2H8PD 4RSZA 5CYTR 2QJPC 1FZCC 5DJQB 1NOHA 3KYQA 5APUA 1NAYA 1FCDC 1F1FA 2UWJE 1H32A 3SXTA 2LXBA 2BEQD 1Y9BA 2O1KA 4N0KA 1IJDB 3W68A 2KUBA 1EDLA 1USDA 2M3BA 1KILD 1KQGB 3V4QA 1KB9E 4PV1C 3GLMA 1U75B 1AYGA 1RH5B 1DD3A 1CEDA 2IYPA 3P8MC 2FYNC 2YKPA 1L4AB 3C1LA 3CP5A 1E5WA 3B5NC 1KYOE 1WEJF 2IZ1A 1W2LA 2M5AB 3CX5H 2HYNA 5KAIE 2NPSC 4EYYQ 5CCHD 1COTA 3MZWB 4JYBA 2CA4B 3L71J 1N9CA 2OYIB 3DP5A 3H1HD 1FS0E 4JCGA 3HQ9A 1RE3A 4TT3H 5AVRB 2OZ1A 4R4LA 1GKSA 4P4QB 2XNXA 5AW5B 2H7HA 3NBSA 3R2PA 1OW8A 1GD2E 3L72D 3V2QA 1SQVD 4PD4I 5CCGA 2N1TB 1VQKP 2B11B 2HV4A 1M70A 2M0BA 2PFXA 2R3SA 2PAJA 3NFQA 1CIGA 2M8RA 3FGAD 2CA3B 1CHHA 2VHDA 1PGJA 3PXSA 2K9JA 1T2KC 2IBZG 4WB4A 3OA8A 3CL3D 3BCCJ 1M56D 3VMXA 1GL2D 3SFEC 3G4SP 1C7MA 2BCCG 1SQBG 4D6TJ 4DZOA 4IFDK 1RF1B 3L70E 4WQ8A 1PPJG 2BEZF 1BE3J 3AE6C 3ORVA 1JY3N 3DR0A 4IL6X 1C6RA 2G8YA 5AVZB 2H43A 1CRCA 1FI7A 2O01H 1S5LV 1KB9I 1GTWA 3A9FA 1K05A 1ZRTE 2PP6A 2I1KA 1URQD 1CNOA 2GM4A 1LMSA 3RMZA 1S72P 1QL2A 1BCCE 3AE3C 3HE4B 1P84E 1HVVA 1AOFA 2RN0A 1S9KD 3V2PA 1PP9E 4LC1A 4EI2A 1W2BO 1X79B 3L74J 1DT1A 1C75A 2YCCA 1C52A 1IC2A 2PGDA 5GTIE 1FOSF 1VQ9P 1NTME 1MG2D 3RBZA 5KLIB 1L0NK 4GKGA 1JMMA 1VQPP 3H1KE 1BGYD 2Q1KA 4I7ZB 3Q2YA 4AANA 1BDDA 3OJAB 2OYHA 1CORA 1DEBA 4FB1A 4C7NA 3PJSK 3B5NA 3RK2B 3AEBC 1XTCC 1L0NE 1YQ4C 1OW6A 3Q3DA 1F1CA 2BH4X 1I6DA 2WPRA 5AVVB 3GHGC 1GK6A 5APYA 2IBZD 2N9JA 3MK7B 2KIKA 1KQFB 2K37A 4NFGB 1NMLA 2BCCD 3S4RA 1HJBA 1SQBD 2YO2A 5C9MA 2FYUJ 3M0DC 3AE9C 1JTHA 2QIWA 1ZR2A 3NXSA 3VYIA 1PPJD 2XDJA 1N90A 3A7OA 3C8VA 3Q5PA 1SQQK 3SFDC 5AW2B 1KV9A 1GW4A 1PV3A 2ZZS1 1JO5A 1NTZK 4CPGA 3H1LG 4JQ0D 3CWBE 4L1QA 1SP4A 3HUSB 2K9YA 3MUDC 2D2CB 1LTJC 1SQPK 3L70G 3VMYA 3WMM0 1SQQE 1GMJA 5BVZA 2JWDA 1KQSO 1ZZHA 3O6QB 1N7SC 1DX7A 1NTZE 2MTAC 3NBTA 1C2NA 5APSA 2YMYA 1CCRA 1SQPE 3V2RA 1P84I 4WQEA 1KYOD 3MP7B 2HPCB 1NNOA 1J2JB 2QA4P 1H31A 2C9LY 2I1JA 2Q5UA 3VNWA 1BCCG 4XFJA 1EDIA 1CHIA 2D0SA 2FXPA 1NU1D 1PP9G 2YKQA 2AI5A 1S2EA 1LTGC 1L4AD 3FXDA 1EXIA 3RK3C 4NPFX 4UB6H 1C2RA 2B12B 2MHMA 2FRCA 1BSHA 2KSJA 1NTMG 3M97X 2YO3A 3JCUE 3LW5J 5KAFH 3H1KG 2M3EA 1HZVA 3G9RA 1A02J 1JY2P 3CLQA 1L0LJ 5AVWB 4FA9A 1KILE 4XE5B 1FDMA 2FFDA 4OGQB 1L0NG 1CO6A 3H1JJ 1BL9A 5BU8B 2W27A 1AA0A 2LITA 5DJUB 1EDJA 3JSVC 1JOCA 1GZLA 1Q2NA 4RJTA 3H1LD 1FDIA 1W5CE 2ITAA 5CCHC 1OW7A 2FBWC 1Q81Q 3L70D 2ZT9C 3U59A 5AW3B 3H1HE 3L73D 4N78D 4M3LA 1FJKA 2KK7A 5CMZA 1QX8A 2R5BA 3VP8A 2Z5HA 1YFCA 2B88A 3TYYA 2J58A 1H33B 4YTPC 2BPBB 3CWBG 1QVGO 3L72E 3GHGA 2ZOOA 3A0HH 1MZ4A 2E74C 1AKKA 1N8RQ 4DCKA 3FX0A 1KZUB 1SQQG 1KTMA 3CU4A 1FU1A 1QYZA 3M0DA 4EIJA 5AW7B 4PWAA 1BCCD 1NTZG 3P32A 2P1JA 2DVHA 2KS1A 3VN0A 1SQPG 1JCDA 1PP9D 1EC5A 1SVFA 1YQ3C 2QJKB 1NTMJ 4Y99C 1LTIC 1NAFA 451CA 1AVOA 4BRYB 3EFGA 5KLVJ 1FHBA 4WQDA 2C1UA 1RE4A 2RKLA 3OA7A 1RQUA 3T97B 1N2DC 4HJGH 3LIEA 3L75E 4R4MA 5CBNA 3TYIA 3DMIA 3H1KD 4K3AA 4LGDE 1Y47A 1RAPA 1RE3C 1NJIQ 1H89A 3IF4A 1LT9B 4BWNA 1RF0A 1L0ND 4TLFA 1GJQA 2K88A 1KB0A 3ZIYA 4GIFA 5CCGC 1H9XA 2Z4EA 3KDPB 2IDBA 5L8RJ 2K1AA 5KJ7D 2N18B 3P8CE 1M1JC 1S5LE 1I55A 2CE0A 1G2CA 1S9KE 3RK2D 4IFMA 2OQQA 3CXHW 1VQLP 3CCUP 4AALA 2AXTV 3CWBD 1DIQC 5GTHE 3CCLP 2ZAEB 2ZYGA 3RGUA 2D0WA 3I56P 1SQQD 1PGPA 4UB6V 1QKSA 4GODA 1KILA 1LTBC 3C9IA 1YJ9P 1LC1A 3PTZA 2O3JA 1NTZD 4IL6H 2NZ2A 1BGYE 3CMEP 1KFMA 2N3YA 4WBAA 1Q82Q 1SQPD 1T3UA 2XV5A 2YIUC 3HTKA 4AUWA 1SQXJ 5B66H 3OCDB 4UB8H 1M60A 5CCHA 3HQ6A 1OWAA 4U3FE 3ZOWA 2D2CD 2BCCE 5TISV 1VF5C 1JY2N 3RL0C 5AVSB 3V2NA 2B10B 1MV8A 2WWWA 3AE4C 1S6VB 5K5GB 2QJPB 1FZCB 1J1DB 2E76B 1C6SA 1RAQA 4WQ9A 2K3RA 4H13C 2WSFJ 1J3SA 3WU2V 4AAOA 2BASA 4NPEA 1HROA 1TU3F 2GUSA 3ABVC 1KV4A 4RO0A 2WMMA 3L75G 1OVUA 2KNCB 1VL2A 2BGVX 1IRWA 2CPBA 4PD4H 3BATA 1GDTA 1YYCA 2KZIA 4PV1B 1FOSE 1R5SA 5CHXA 3A0HV 5M1BA 1N73A 2FYNB 1PGOA 3VRDA 1NTKK 1VQ5P 1LS9A 1IRVA 4NPDA 2GB8B 3USSA 1NWQA 3B5NB 1CRIA 3GF3A 4DT0A 2VRSA 2OYHC 2NPSB 1CI6A 1GL2A 2AIUA 2Q6QA 5CIEB 3H1HJ 1NU1K 1H88A 3A0BH 3CXHH 3E1RA 5AW6B 3A3YB 3CCSP 2JDIH 2IPPA 2WSEJ 1FBMA 1DEEG 1YEBA 2Z5IA 2KZJA 3L72J 1SQVJ 4C7RA 4OGQD 5CBOA 2C1DA 4H44C 1NU1E 2W6AA 1AV1A 2NRGA 1KC8Q 1L9BC 4DOJA 1BSNA 3F89A 4GOFA 4WY4B 1CRHA 1OXZA 1N7LA 3G6EP 1LWUC 1HJ5A 1URQA 4Z1MH 1N15A 1KB9H 4AQRD 4L3GA 1NIRA 1BGYG 1M1JA 2ZONG 2POHA 2IBZI 1E8EA 3O8ZA 3ZOYA 1YJWP 2N9IA 5AVUB 5KTBA 1T3JA 1H0TA 3AE5C 3MTUE 2QE7H 2KB7P 4K3IA 4U3FG 5C0ZA 1WT6A 2E75B 1L2PA 1HWTC 3L75D 1LTSC 3H1LE 3OW2O 1PFIA 3BVHA 3TNUA 3WFBC 5B5EH 1I5TA 1WVEC 3L4MA 3WUVA 4Y28J 3L73E 2Y0CA 4N78E 1LP1A 3EQ2A 351CA 2DW3A 1EXJA 1M6ZA 3AE1C 2WT7A 2B87B 3HD7B 4IL6V 1Z56A 4B86A 3PLNA 3LW5H 2GA1A 1VQ7P 2C9NY 3P8CD 1RF1C 4QAOA 2ORLA 5B66V 1KYOI 1WMKA 1OCDA 4UB8V 4O1QA 1ZP0C 2FFDC 1CW5A 3AEFC 2EXVA 5KKZC 4YXDC 3AEEC 2JR8A 1EZVD 1LGHB 1BGYJ 1YBKA 3C2CA 3KZIV 1SS1A 1JUNA 1AFOA 1CXAA 1NU1G 1YIJP 1DVVA 2E5YA 4L73A 2V08A 1M57D 1JMBA 5IY51 4HH2A 1J1EB 1IFDA 1K8AQ 1JB0J 2B0ZB 2WSCJ 5AVTB 2OTJP 2BCCJ 1DW1A 1SQBJ 1YITP 3HQ8A 1RY3A 3PXWA 2KYVA 2B4ZA 1P84H 1VPCA 2GIWA 1HUCA 4U3FD 1KX2A 3O5CA 1YHQP 2CE1A 2OTKE 1U57A 3SVWA 3A0BV 1SFCC 1QVFO 1K9MQ 3PH0A 2HODB 1L4AA 1QL3A 5GTIH 3U1AA 3SLEA 3RK2C 5CJ4A 1HRCA 3MIWA 1LWUA 1LTJB 3WFCC 4GT1A 1K3GA 4EIEA 3MK7C 4L74A 1JNMA 1RE4C 2OYIA 3BASA 3CX5D 1N7SB 2QG4A 1CSXA 1FZEA 5APTA 4YE1A 3ZCFA 1FDOA 2CPSA 3L73G 3D70A 2YNYA 2GC7D 2E76D 3R4YA 1YI2P 5H2FH 3HE5B 3ZOOA 1RF0C 1R8EA 4O1WA 3D6ZA 1FJPA 1NTKD 3NMDA 2MJZA 3WFDC 4PV1D 5KAFE 2RH0A 2HFED 5DJTB 2A45I 2WVRA 3RK3B 1UIIA 2AXTH 3Q1MA 2OYOA 3B5ND 1DVHA 1QL1A 5B5EV 3O0RC 2NPSD 3M9QA 2JQRA 2A45G 3IFMA 1CSBA 155CA 1EB7A 1S4XA 2W6BA 3H32B 1RF1A 3RBXA 4H0LB 3TGUE 4L75A 3SSUA 4EIDA 1KILC 2R44A 4Q5PA 1RZ5A 2B89A 3H1LJ 4DY9A 5EXQA 4WY4D 1ZW0A 5TISH 3L70J 1MG3D 2N1TD 1FOCA 3NTNA 5AW0B 3L73J 1E29A 3A0HE 2ZT9B 1IZL0 3KXDA 3HE4A 2J5UA 2QJYB 2P7JA 1QEXA 3WU2H 1PL5A 4PJ0H 1T2KD 2ZYDA 3FXEA 2E74B 2WSFH 4GEDB 2YKOA 4GOEA 1ZN5A 1QL4A 3O20A 2QM8A 3VOPA 1BCCJ 2ZFCA 2E75D 1H32B 3H25A 5KJ7A 1S1CX 1Q7YQ 1KD1Q 2E42A 3H1ID 1Q90D 1PP9J 4HB1A 4W7YA 3VMZA 1SFCA 4L76A 2KLVA 3I55P 4Y99B 1I54A 5AURA 5APQA 1DW3A 1N73C 1QLED 3O1YA 1MFTA 2N9YB 1ZOYC 2FYZA 1GIWA 3HD7D 2GC4D 3H1KJ 1RHZB 1R5LA 1GL2C 3CYTI 3AEAC 3S1KA 5GTIV 4KJMA 2IZ0A 2WSEH 4WQCA 3L37A 2OZ1B 1H9YA 1L0NJ 1CSVA 3FWNA 3U1CA 4FA1A 1GK4A 2QEXP 2QJKC 3IN6A 1A2SA 1H8AA 3SWKA 1YEAA 2HG5D 4ASWA 3HUSA 1LT1A 1MFZA 1DIPA 3IR9A 3BCCE 2W6JH 3TGUG 1FZAA 3D71A 4KHXA 1K04A 1NYHA 1URQC 1LTAC 5H2FV 4LJIA 2B9BA 2W83C 1K73Q 1U7MA 1M1JB 2R5DA 3O6QA 4EOTA 1K3HA 4D6TE 3TSIA 1A8CA 2FXOA 1H1OA 3CWBJ 1BE3E 4IL6E 4ASVA 2PACA 2JO1A 2K9JB 1LT9C 5CIGB 3AEDC 3OA8B 3CMAP 3KHUA 2ZBOA 1SQQJ 2HPCA 3MHVA 4V2KA 5DFSA 1E2RA 1HJ0A 1NTZJ 2GUVA 1EZVE 3HQ7A 1CTZA 3AE2C 4XXLA 2WITA 2Y9YA 2N18C 1X0TA 1HGZA 1SQPJ 1HJ3A 1N50A 1T6AA 1KN7A 5CJ0A 4ZKUA 4KMGA 5CIBB 2LKMA 3SWSA 4QMAA 4OWFA 3H6PA 2C1VA 3AE7C 1B7VA 1CC5A 4PW9B 1C6OA 1VF5B 1HTLC 2XNDH 3RL0B 1N7SD 2R32A 1IZNB 3L71G 2V4HA 1ZMEC 4PD4E 1VQ6P 2Q7CA 3OAKA 2CK3H 1KYOW 2C2CA 1HF9A 4ZKPA 4H13B 1EQ7A 1UIXA 1AJYA 3JBTB 3EWKA 1X8YA 1VYDA 2PRRA 1LJ2A 1CIHA 2KXPB 3KZIH 1RZ6A 3PRJA 4PJ0V 2FYUK 1KIBA 1CTJA 3A0BE 3CXHE 2DGEA 1PIXA 3TGUD 3FWLA 4RKUJ 3CX5E 4KT0J 2H89C 3TK1A 3RK3D 5E79H 3LIDA 1IFNA 2QVAA 1VQNP 2QRXA 2OYHB 2FYUE 1CRJA 1J1DC 2E76C 4C7NB 1H33A 3CC7P 1CSWA 2WSCH 3V5BA 3G3ZA 2FXMA 2V7QH 5DJQC 3P7KA 3BCCG 1PZQA 3VMAA 3WUTA 3TF5A 1GU4A 1I6EA 5AW8B 1NTKE 2BH5X 4D6TG 4H0LD 1HJ4A 3CCJP 4H44B 1L9JC 1JTHB 1E79H 1DH3A 2KSEA 1DIIC 1T8ZA 1BE3G 1EZVI 4BRYA 1LWUB 2Y0EA 1L4AC 3T97A 1HZUA 1Q86Q 1EZVG 1FJ0A 2ZT9D 4WVZA 1IQCA 4JF7A 1U74B 3SWFA 2OYIC 3L4OA 3L71D 1QGKB 4W80A 5B5EE 3PHLA 1KYOH 1VQMP 1IK7A 1LT9A 1X9VA 5C39A 1G1JA 4JBZA 2OGUA 1IFMA 2E74D 2OARA 5KAIH 1YTZI 3L75J 4JPZB 2C0XA 1HH7A 1IFJA 2ZXEB 1CCHA 4WY4C 1FZGA 3CCMP 3L74G 5AVYB 2E5TA 2JJLA 1H31B 2N3BA 1L0LK 2N1TC 3IAOA 2A06E 4YXWH 3TDKA 1CYIA 2AXCA 1OIPA 5AW1B 1ZR4A 1NVOA 4YPCA 2I8FA 3CCEP 2XU6A 3CI9A 2O1JA 4OH8B 1M1KQ 1I8PA 1DW0A 3B4SA 1OVVA 3CXHI 1L0LE 3CX5I 1IFPA 3V6IA 1VDFA 3H1JE 2JKVA 1CRGA 1U7JA 1DW2A 2E75C 3KQGA 3BCCD 1KFNA 2Y0DA 1JY3O 1S5LX 4U7JA 1CYCA 4D6TD 3H1IE 1R0QA 2P2UA 2FYUG 2FFDB 1CIEA 4ZNCA 1BE3D 4XYDB 5KKZB 5APVA 5CCGD 3OCDA 3GF7A 3HD7C 2R3CA 4ZMDA 3RN0A 1NTKG 5GTHV 3M91A 2AEMA 3M9BA 4O9BA 1NTMK 2LR2A 4LLHA 4W7ZA 1KX7A 5KLVK 2H88C 3CC4P 1FZCA 2ZXYA 2IX7C 1USEA 1ZXGA 1FE6A 1JEKA 3L4FA 1CIFA 1EDKA 4U3FJ 2YQBA 3GHGB 2AEJA 4HYTB 3GW6A 3QH9A 3CCVP 2V7QJ 5E79V 2KNCA 3EFFK 5KLVE 3L74D 1OZHA 4AYCA 2Y9ZA 1GU2A 2XKMA 1SFCB 3N7NA 3MD0A 1JM0A 4PD4D 5KLIC 1RQVA 1NH4A 5KJ7C 2ZVNB 4FAVA 3WC8A 1OX3A
chains in the Genus database with same CATH topology
2QJYB 2D0WA 1SQQD 2B11B 4UB6V 1QKSA 2HV4A 1M70A 2L4DA 1LC1A 3PTZA 2O3JA 1NTZD 2JTIB 1CIGA 4GEDB 2N3YA 1QL4A 3O20A 3CXHD 1SQPD 2L91A 2BCNB 1H32B 3PH2B 2CA3B 1CHHA 2VHDA 3OCDB 3PXSA 1M60A 3OA8A 3H1ID 3HQ6A 4EICA 3ZOWA 4WQAA 2FYUD 4FA4A 1C7MA 1I54A 5AURA 5TISV 1DW3A 3O1YA 2B10B 2N9YB 1S6VB 4WQ8A 2QJPB 1C6SA 1RAQA 4WQ9A 1GIWA 2GC4D 3ORVA 5KAIV 1J3SA 1KB9D 3DR0A 3WU2V 4AAOA 1HROA 1C6RA 3CYTI 5GTIV 2V07A 1CRCA 1FI7A 1A56A 1S5LV 2KNCB 2BGVX 1IRWA 4WQCA 3A9FA 2OZ1B 1H9YA 1CSVA 2LIRA 1CNOA 3A0HV 1W5CT 4FA1A 1LMSA 1LFMA 2FYNB 3PXTA 3VRDA 3RMZA 1A2SA 4L3HA 1LS9A 1IRVA 2GB8B 1YEAA 1CRIA 1AOFA 2RN0A 4J20A 2AIUA 5CIEB 4WQ7A 5H2FV 4LJIA 1ETPA 1DT1A 1C75A 2JWAA 2YCCA 1K3HA 1C52A 1YTCA 4EDFA 1A8CA 1YEBA 5TJHA 1MG2D 1H1OA 5KLIB 2PACA 2K9JB 2C1DA 5CIGB 1YIQA 3OA8B 3KHUA 1L9BC 1BGYD 2ZBOA 2A06D 1CXCA 4AANA 4V2KA 5DFSA 2CXBA 1E2RA 1CORA 1CRHA 4FB1A 1CYJA 3HQ7A 1CTZA 3GG2A 1HJ5A 4XXLA 1N15A 2N18C 4Y5RA 1LC2A 1F1CA 2BH4X 1I6DA 1L0LD 3RLMA 1CRYA 2IBZD 2N9JA 1HJ3A 1N50A 3MK7B 3WFEC 1JDLA 4L3GA 4KMGA 1NIRA 4EIFA 5CIBB 4NFGB 1NMLA 2ZONG 2BCCD 3H1JD 1CSUA 1SQBD 1E8EA 3ZBMA 1CHJA 3ZOYA 3SWSA 2YK3A 5DF5A 3VYMA 5C9MA 2N9IA 5CIHB 1PPJD 1N90A 2PCCB 2C1VA 1B7VA 4H0JA 1CC5A 4PW9B 4K3IA 1C6OA 1I8OA 5C0ZA 1KV9A 2ZZS1 1FI9A 3L75D 1KYOW 2C2CA 4L1QA 5CIDB 3WFBC 1ZRTD 1I5TA 1WVEC 3L4MA 3ZOXA 3JBTB 2Y0CA 1YICA 1VYDA 2BLFB 2RMZA 351CA 1ZZHA 1CIHA 1OAEA 1M6ZA 1RZ6A 2C8SA 5CIFB 3PRJA 1P84D 4PJ0V 2MTAC 1YCCA 1KIBA 3NBTA 1CTJA 1C2NA 4A7PA 1CCRA 4IL6V 2DGEA 3TGUD 4WQEA 2C1DB 3FWLA 3PLNA 1KYOD 4FANA 1NNOA 1H31A 4QAOA 2ORLA 5B66V 3VNWA 1CRJA 1OCDA 4UB8V 1H33A 2Q3EA 1NTMD 4O1QA 1QN2A 1CHIA 1GQ1A 5KLVD 1CSWA 2D0SA 5CICB 1NU1D 5DJQC 2AI5A 3VMAA 1YNRA 3NWVA 3TF5A 2EXVA 1I6EA 3WUIA 2BH5X 2XTSB 1HJ4A 1C2RA 2B12B 2MHMA 1EZVD 2FRCA 1L9JC 3SJLA 2C9XB 1DIIC 3M97X 3X39A 3C2CA 3KZIV 1CXAA 2PCBB 1DVVA 1HZVA 4FA5A 2Y0EA 4AAMA 2V08A 5IY51 4FA9A 1HZUA 2B0ZB 4WQBA 1FJ0A 1CO6A 1DW1A 1BL9A 3HQ8A 3PXWA 1IQCA 2B4ZA 2LITA 2GIWA 1U74B 4U3FD 1KX2A 3L4OA 3L71D 3O5CA 2YIUB 2CE1A 3CX5W 4RJTA 3H1LD 3PHLA 3SVWA 3A0BV 4GYDA 3L70D 4H0KA 1HH7A 3L73D 1CCHA 1QL3A 1GDVA 3SLEA 1H31B 1HRCA 2N3BA 4AX3A 3ITKA 1HCMA 5KAFV 1YFCA 1CTYA 3WFCC 1K3GA 3TDKA 1H33B 1CYIA 2BPBB 1FI3A 4EIEA 3MK7C 2I8FA 2ZOOA 1MZ4A 1AKKA 3CX5D 2QG4A 1CSXA 3CU4A 4YE1A 3ZCFA 1I8PA 1DW0A 3RN1A 1QYZA 2GC7D 1AOQA 4MU8A 4PWAA 1BCCD 1SQXD 1NMIA 2DVHA 1IO3A 1CRGA 1DW2A 2FWLA 2KS1A 3ZOOA 1PP9D 3BCCD 5B6QA 2QJKB 4O1WA 451CA 2Y0DA 1FHBA 1NTKD 4WQDA 1CYCA 2C1UA 4D6TD 1R0QA 4RSZA 5CYTR 3WFDC 1CIEA 5DJQB 1FCDC 1BE3D 3TYIA 1F1FA 4XYDB 3DMIA 5KKZB 1H32A 3H1KD 3SXTA 1RAPA 3OCDA 4N0KA 1DVHA 3RN0A 5B5EV 3O0RC 5GTHV 2JQRA 1U75B 1AYGA 1L0ND 155CA 1CEDA 1EB7A 1GJQA 1KX7A 1KB0A 3CP5A 3ZIYA 1H9XA 2ZXYA 4EIDA 1CIFA 1WEJF 1W2LA 2N18B 1COTA 2YQBA 2CA4B 1N9CA 3DP5A 3GW6A 4Q5PA 1RZ5A 3H1HD 5E79V 1I55A 4JCGA 4DY9A 2CE0A 5EXQA 3L74D 3HQ9A 2OZ1A 1GKSA 4P4QB 1GU2A 1MG3D 3NBSA 1FOCA 3CXHW 4PD4D 1E29A 4AALA 2AXTV 3CWBD 1DIQC 4FAVA 3L72D 1IZL0 3WC8A 1SQVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJY B;  2D0W A;  1SQQ D;  2B11 B;  4UB6 V;  1QKS A;  2HV4 A;  1M70 A;  2L4D A;  1LC1 A;  3PTZ A;  2O3J A;  1NTZ D;  2JTI B;  1CIG A;  4GED B;  2N3Y A;  1QL4 A;  3O20 A;  3CXH D;  1SQP D;  2L91 A;  2BCN B;  1H32 B;  3PH2 B;  2CA3 B;  1CHH A;  2VHD A;  3OCD B;  3PXS A;  1M60 A;  3OA8 A;  3H1I D;  3HQ6 A;  4EIC A;  3ZOW A;  4WQA A;  2FYU D;  4FA4 A;  1C7M A;  1I54 A;  5AUR A;  5TIS V;  1DW3 A;  3O1Y A;  2B10 B;  2N9Y B;  1S6V B;  4WQ8 A;  2QJP B;  1C6S A;  1RAQ A;  4WQ9 A;  1GIW A;  2GC4 D;  3ORV A;  5KAI V;  1J3S A;  1KB9 D;  3DR0 A;  3WU2 V;  4AAO A;  1HRO A;  1C6R A;  3CYT I;  5GTI V;  2V07 A;  1CRC A;  1FI7 A;  1A56 A;  1S5L V;  2KNC B;  2BGV X;  1IRW A;  4WQC A;  3A9F A;  2OZ1 B;  1H9Y A;  1CSV A;  2LIR A;  1CNO A;  3A0H V;  1W5C T;  4FA1 A;  1LMS A;  1LFM A;  2FYN B;  3PXT A;  3VRD A;  3RMZ A;  1A2S A;  4L3H A;  1LS9 A;  1IRV A;  2GB8 B;  1YEA A;  1CRI A;  1AOF A;  2RN0 A;  4J20 A;  2AIU A;  5CIE B;  4WQ7 A;  5H2F V;  4LJI A;  1ETP A;  1DT1 A;  1C75 A;  2JWA A;  2YCC A;  1K3H A;  1C52 A;  1YTC A;  4EDF A;  1A8C A;  1YEB A;  5TJH A;  1MG2 D;  1H1O A;  5KLI B;  2PAC A;  2K9J B;  2C1D A;  5CIG B;  1YIQ A;  3OA8 B;  3KHU A;  1L9B C;  1BGY D;  2ZBO A;  2A06 D;  1CXC A;  4AAN A;  4V2K A;  5DFS A;  2CXB A;  1E2R A;  1COR A;  1CRH A;  4FB1 A;  1CYJ A;  3HQ7 A;  1CTZ A;  3GG2 A;  1HJ5 A;  4XXL A;  1N15 A;  2N18 C;  4Y5R A;  1LC2 A;  1F1C A;  2BH4 X;  1I6D A;  1L0L D;  3RLM A;  1CRY A;  2IBZ D;  2N9J A;  1HJ3 A;  1N50 A;  3MK7 B;  3WFE C;  1JDL A;  4L3G A;  4KMG A;  1NIR A;  4EIF A;  5CIB B;  4NFG B;  1NML A;  2ZON G;  2BCC D;  3H1J D;  1CSU A;  1SQB D;  1E8E A;  3ZBM A;  1CHJ A;  3ZOY A;  3SWS A;  2YK3 A;  5DF5 A;  3VYM A;  5C9M A;  2N9I A;  5CIH B;  1PPJ D;  1N90 A;  2PCC B;  2C1V A;  1B7V A;  4H0J A;  1CC5 A;  4PW9 B;  4K3I A;  1C6O A;  1I8O A;  5C0Z A;  1KV9 A;  2ZZS 1;  1FI9 A;  3L75 D;  1KYO W;  2C2C A;  4L1Q A;  5CID B;  3WFB C;  1ZRT D;  1I5T A;  1WVE C;  3L4M A;  3ZOX A;  3JBT B;  2Y0C A;  1YIC A;  1VYD A;  2BLF B;  2RMZ A;  351C A;  1ZZH A;  1CIH A;  1OAE A;  1M6Z A;  1RZ6 A;  2C8S A;  5CIF B;  3PRJ A;  1P84 D;  4PJ0 V;  2MTA C;  1YCC A;  1KIB A;  3NBT A;  1CTJ A;  1C2N A;  4A7P A;  1CCR A;  4IL6 V;  2DGE A;  3TGU D;  4WQE A;  2C1D B;  3FWL A;  3PLN A;  1KYO D;  4FAN A;  1NNO A;  1H31 A;  4QAO A;  2ORL A;  5B66 V;  3VNW A;  1CRJ A;  1OCD A;  4UB8 V;  1H33 A;  2Q3E A;  1NTM D;  4O1Q A;  1QN2 A;  1CHI A;  1GQ1 A;  5KLV D;  1CSW A;  2D0S A;  5CIC B;  1NU1 D;  5DJQ C;  2AI5 A;  3VMA A;  1YNR A;  3NWV A;  3TF5 A;  2EXV A;  1I6E A;  3WUI A;  2BH5 X;  2XTS B;  1HJ4 A;  1C2R A;  2B12 B;  2MHM A;  1EZV D;  2FRC A;  1L9J C;  3SJL A;  2C9X B;  1DII C;  3M97 X;  3X39 A;  3C2C A;  3KZI V;  1CXA A;  2PCB B;  1DVV A;  1HZV A;  4FA5 A;  2Y0E A;  4AAM A;  2V08 A;  5IY5 1;  4FA9 A;  1HZU A;  2B0Z B;  4WQB A;  1FJ0 A;  1CO6 A;  1DW1 A;  1BL9 A;  3HQ8 A;  3PXW A;  1IQC A;  2B4Z A;  2LIT A;  2GIW A;  1U74 B;  4U3F D;  1KX2 A;  3L4O A;  3L71 D;  3O5C A;  2YIU B;  2CE1 A;  3CX5 W;  4RJT A;  3H1L D;  3PHL A;  3SVW A;  3A0B V;  4GYD A;  3L70 D;  4H0K A;  1HH7 A;  3L73 D;  1CCH A;  1QL3 A;  1GDV A;  3SLE A;  1H31 B;  1HRC A;  2N3B A;  4AX3 A;  3ITK A;  1HCM A;  5KAF V;  1YFC A;  1CTY A;  3WFC C;  1K3G A;  3TDK A;  1H33 B;  1CYI A;  2BPB B;  1FI3 A;  4EIE A;  3MK7 C;  2I8F A;  2ZOO A;  1MZ4 A;  1AKK A;  3CX5 D;  2QG4 A;  1CSX A;  3CU4 A;  4YE1 A;  3ZCF A;  1I8P A;  1DW0 A;  3RN1 A;  1QYZ A;  2GC7 D;  1AOQ A;  4MU8 A;  4PWA A;  1BCC D;  1SQX D;  1NMI A;  2DVH A;  1IO3 A;  1CRG A;  1DW2 A;  2FWL A;  2KS1 A;  3ZOO A;  1PP9 D;  3BCC D;  5B6Q A;  2QJK B;  4O1W A;  451C A;  2Y0D A;  1FHB A;  1NTK D;  4WQD A;  1CYC A;  2C1U A;  4D6T D;  1R0Q A;  4RSZ A;  5CYT R;  3WFD C;  1CIE A;  5DJQ B;  1FCD C;  1BE3 D;  3TYI A;  1F1F A;  4XYD B;  3DMI A;  5KKZ B;  1H32 A;  3H1K D;  3SXT A;  1RAP A;  3OCD A;  4N0K A;  1DVH A;  3RN0 A;  5B5E V;  3O0R C;  5GTH V;  2JQR A;  1U75 B;  1AYG A;  1L0N D;  155C A;  1CED A;  1EB7 A;  1GJQ A;  1KX7 A;  1KB0 A;  3CP5 A;  3ZIY A;  1H9X A;  2ZXY A;  4EID A;  1CIF A;  1WEJ F;  1W2L A;  2N18 B;  1COT A;  2YQB A;  2CA4 B;  1N9C A;  3DP5 A;  3GW6 A;  4Q5P A;  1RZ5 A;  3H1H D;  5E79 V;  1I55 A;  4JCG A;  4DY9 A;  2CE0 A;  5EXQ A;  3L74 D;  3HQ9 A;  2OZ1 A;  1GKS A;  4P4Q B;  1GU2 A;  1MG3 D;  3NBS A;  1FOC A;  3CXH W;  4PD4 D;  1E29 A;  4AAL A;  2AXT V;  3CWB D;  1DIQ C;  4FAV A;  3L72 D;  1IZL 0;  3WC8 A;  1SQV D; 
#chains in the Genus database with same CATH topology
 2KS1 B;  1WRG A;  4I7Z C;  5EFW B;  2QM7 A;  2A45 H;  2NPS A;  1J1E C;  3GMA A;  2L4D A;  4I1L A;  2IFM A;  5H2F E;  2FY8 A;  2JTI B;  3E7K A;  2A06 G;  2M5A A;  2ZVO B;  1OFC X;  3CPW O;  3B71 A;  1OVR A;  1VF5 D;  3RL0 D;  3CXH D;  2L91 A;  2BCN B;  3PH2 B;  1KQL A;  1W2E A;  3QWO C;  3M9H A;  4H13 D;  1L0L G;  2WSS H;  3V4W A;  4EIC A;  4WQA A;  2FYU D;  1KOR A;  4FA4 A;  2AXT E;  3H1J G;  1NTK J;  1FC2 C;  4WY4 A;  2N1T A;  2MKV A;  4UB6 E;  3L35 A;  3HUS C;  5KAI V;  1KB9 D;  1NU1 J;  2D2C C;  1X22 A;  3H1I G;  4OVN F;  2P10 A;  3A2A A;  2V07 A;  1HH0 A;  1A56 A;  1A02 F;  1IK9 A;  3ZDM A;  1SQX K;  1G2C B;  3A5T A;  4HKZ H;  2LIR A;  4RES B;  4GDO A;  1W5C T;  1LFM A;  3MGN A;  3PXT A;  3M06 A;  4L3H A;  1SQX E;  5TIS E;  1GU5 A;  2YXR B;  4IOI H;  3W67 A;  1KIL B;  4J20 A;  2KI7 B;  4H44 D;  4WQ7 A;  2N9B A;  2W90 A;  1ETP A;  2ZYA A;  2JWA A;  3RK3 E;  1BDC A;  3D0W A;  3WU2 E;  2O01 J;  1YTC A;  2J59 M;  4EDF A;  4PJ0 E;  2YMK A;  2Q9I A;  3HTK B;  5TJH A;  2B87 A;  3HD7 A;  4IFF A;  5KLV G;  2L5G B;  1DD4 A;  1D7M A;  1YIQ A;  4DJG A;  2HR3 A;  3RL0 g;  2A06 D;  1ZLL A;  1CXC A;  3D6Y A;  2WPS A;  2CXB A;  4H0L C;  1CYJ A;  2HLO A;  3GG2 A;  4Y5R A;  1LC2 A;  1AQT A;  1NKN A;  5AW4 B;  1HBW A;  5APW A;  1GW3 A;  1L0L D;  4OGQ C;  3RLM A;  1CRY A;  2WQY C;  3CCQ P;  1M7L A;  2G3A A;  3WFE C;  2IFN A;  3JCU H;  1JDL A;  1KMI Z;  4EIF A;  1M8O B;  3H1J D;  1NO4 A;  1CSU A;  3H1I J;  1IFI A;  3ZBM A;  1CHJ A;  2YK3 A;  5DF5 A;  3VYM A;  4N6J A;  1IO4 A;  5AVQ B;  3BRT B;  2ZXX A;  1SQV K;  5CIH B;  3E1I A;  4I2L C;  3CCR P;  2PCC B;  4H0J A;  1VQ8 P;  2ZJS E;  2QJY C;  3K5B A;  1N73 B;  1I8O A;  1XTG B;  3L71 E;  2OTL P;  1FI9 A;  1YJN P;  3KPE A;  2P58 A;  5CID B;  3L36 A;  1ZRT D;  1SQV E;  2E43 A;  1CI6 B;  1GL2 B;  1JCC A;  1AVY A;  3ZOX A;  2C0W A;  1YIC A;  2RMZ A;  2BLF B;  2IYO A;  1NGM B;  3UIA A;  1Y8A A;  1OAE A;  3VP9 A;  2C8S A;  5CIF B;  1P84 D;  1YCC A;  3AEG C;  3I5C A;  4A7P A;  3Q5S A;  3N4X A;  1MZ9 A;  2C1D B;  2KLU A;  2HOD A;  2JP3 A;  2WPV B;  1CZQ A;  4FAN A;  3MUD A;  1LTJ A;  2W8Z A;  2Q3E A;  1NTM D;  1QN2 A;  1N86 A;  1URQ B;  1SQX G;  1GQ1 A;  2KP8 A;  5KLV D;  5AVX B;  5CIC B;  1N7S A;  3HRN A;  1MKM A;  1LNQ A;  3BRV B;  1AQ5 A;  1YNR A;  3NWV A;  4JYC A;  2XZR A;  1VQ4 P;  5AW9 B;  3II6 A;  3WUI A;  1SLQ A;  2FKW B;  2XTS B;  1FAV A;  3SJL A;  2C9X B;  3X39 A;  3HE5 A;  1PGQ A;  1NHL A;  1H0T B;  3VTP C;  1ZV8 A;  1OMI A;  2PCB B;  4MN4 C;  3G71 P;  1HGV A;  2O01 N;  2QSI A;  4FA5 A;  4AAM A;  1YTZ T;  1FZF A;  2WTY A;  2JEE A;  3CC2 P;  3PP5 A;  3WUU A;  1G1I A;  5B66 E;  3TNU B;  3F5H A;  1SFC D;  4BXL A;  4UB8 E;  4WQB A;  2LXC B;  3AE8 C;  1JY3 P;  1LP1 B;  4XA4 A;  5BU5 A;  2YIU B;  3CX5 W;  2WT7 B;  2Q3I A;  5APX A;  4C46 A;  4GYD A;  4H0K A;  3H1H G;  2P67 A;  3KZI E;  3H32 A;  1GDV A;  3B8E B;  3L74 E;  1S5L H;  4AX3 A;  3ITK A;  3JC2 2;  2YXQ B;  2AEF A;  1HCM A;  5KAF V;  4WWI A;  1CTY A;  3S9O A;  2SPZ A;  1FI3 A;  3L72 G;  1VQO P;  1SQB K;  2WPQ A;  3SWY A;  1SQV G;  1MUU A;  1FZB A;  5E79 E;  4I6M C;  5GTH H;  3AEC C;  3Q5R A;  3RN1 A;  2IBZ E;  1S3J A;  2I8D A;  3TGU J;  1AOQ A;  1M90 Q;  3CD6 P;  4MU8 A;  1NKZ B;  1JY2 O;  4N3Y B;  1SQX D;  1NMI A;  1SQB E;  1IO3 A;  2FWL A;  2KOG A;  4K35 A;  5B6Q A;  1LTT C;  1PPJ E;  2WZ7 A;  3M0A A;  2H8P D;  4RSZ A;  5CYT R;  2QJP C;  1FZC C;  5DJQ B;  1NOH A;  3KYQ A;  5APU A;  1NAY A;  1FCD C;  1F1F A;  2UWJ E;  1H32 A;  3SXT A;  2LXB A;  2BEQ D;  1Y9B A;  2O1K A;  4N0K A;  1IJD B;  3W68 A;  2KUB A;  1EDL A;  1USD A;  2M3B A;  1KIL D;  1KQG B;  3V4Q A;  1KB9 E;  4PV1 C;  3GLM A;  1U75 B;  1AYG A;  1RH5 B;  1DD3 A;  1CED A;  2IYP A;  3P8M C;  2FYN C;  2YKP A;  1L4A B;  3C1L A;  3CP5 A;  1E5W A;  3B5N C;  1KYO E;  1WEJ F;  2IZ1 A;  1W2L A;  2M5A B;  3CX5 H;  2HYN A;  5KAI E;  2NPS C;  4EYY Q;  5CCH D;  1COT A;  3MZW B;  4JYB A;  2CA4 B;  3L71 J;  1N9C A;  2OYI B;  3DP5 A;  3H1H D;  1FS0 E;  4JCG A;  3HQ9 A;  1RE3 A;  4TT3 H;  5AVR B;  2OZ1 A;  4R4L A;  1GKS A;  4P4Q B;  2XNX A;  5AW5 B;  2H7H A;  3NBS A;  3R2P A;  1OW8 A;  1GD2 E;  3L72 D;  3V2Q A;  1SQV D;  4PD4 I;  5CCG A;  2N1T B;  1VQK P;  2B11 B;  2HV4 A;  1M70 A;  2M0B A;  2PFX A;  2R3S A;  2PAJ A;  3NFQ A;  1CIG A;  2M8R A;  3FGA D;  2CA3 B;  1CHH A;  2VHD A;  1PGJ A;  3PXS A;  2K9J A;  1T2K C;  2IBZ G;  4WB4 A;  3OA8 A;  3CL3 D;  3BCC J;  1M56 D;  3VMX A;  1GL2 D;  3SFE C;  3G4S P;  1C7M A;  2BCC G;  1SQB G;  4D6T J;  4DZO A;  4IFD K;  1RF1 B;  3L70 E;  4WQ8 A;  1PPJ G;  2BEZ F;  1BE3 J;  3AE6 C;  3ORV A;  1JY3 N;  3DR0 A;  4IL6 X;  1C6R A;  2G8Y A;  5AVZ B;  2H43 A;  1CRC A;  1FI7 A;  2O01 H;  1S5L V;  1KB9 I;  1GTW A;  3A9F A;  1K05 A;  1ZRT E;  2PP6 A;  2I1K A;  1URQ D;  1CNO A;  2GM4 A;  1LMS A;  3RMZ A;  1S72 P;  1QL2 A;  1BCC E;  3AE3 C;  3HE4 B;  1P84 E;  1HVV A;  1AOF A;  2RN0 A;  1S9K D;  3V2P A;  1PP9 E;  4LC1 A;  4EI2 A;  1W2B O;  1X79 B;  3L74 J;  1DT1 A;  1C75 A;  2YCC A;  1C52 A;  1IC2 A;  2PGD A;  5GTI E;  1FOS F;  1VQ9 P;  1NTM E;  1MG2 D;  3RBZ A;  5KLI B;  1L0N K;  4GKG A;  1JMM A;  1VQP P;  3H1K E;  1BGY D;  2Q1K A;  4I7Z B;  3Q2Y A;  4AAN A;  1BDD A;  3OJA B;  2OYH A;  1COR A;  1DEB A;  4FB1 A;  4C7N A;  3PJS K;  3B5N A;  3RK2 B;  3AEB C;  1XTC C;  1L0N E;  1YQ4 C;  1OW6 A;  3Q3D A;  1F1C A;  2BH4 X;  1I6D A;  2WPR A;  5AVV B;  3GHG C;  1GK6 A;  5APY A;  2IBZ D;  2N9J A;  3MK7 B;  2KIK A;  1KQF B;  2K37 A;  4NFG B;  1NML A;  2BCC D;  3S4R A;  1HJB A;  1SQB D;  2YO2 A;  5C9M A;  2FYU J;  3M0D C;  3AE9 C;  1JTH A;  2QIW A;  1ZR2 A;  3NXS A;  3VYI A;  1PPJ D;  2XDJ A;  1N90 A;  3A7O A;  3C8V A;  3Q5P A;  1SQQ K;  3SFD C;  5AW2 B;  1KV9 A;  1GW4 A;  1PV3 A;  2ZZS 1;  1JO5 A;  1NTZ K;  4CPG A;  3H1L G;  4JQ0 D;  3CWB E;  4L1Q A;  1SP4 A;  3HUS B;  2K9Y A;  3MUD C;  2D2C B;  1LTJ C;  1SQP K;  3L70 G;  3VMY A;  3WMM 0;  1SQQ E;  1GMJ A;  5BVZ A;  2JWD A;  1KQS O;  1ZZH A;  3O6Q B;  1N7S C;  1DX7 A;  1NTZ E;  2MTA C;  3NBT A;  1C2N A;  5APS A;  2YMY A;  1CCR A;  1SQP E;  3V2R A;  1P84 I;  4WQE A;  1KYO D;  3MP7 B;  2HPC B;  1NNO A;  1J2J B;  2QA4 P;  1H31 A;  2C9L Y;  2I1J A;  2Q5U A;  3VNW A;  1BCC G;  4XFJ A;  1EDI A;  1CHI A;  2D0S A;  2FXP A;  1NU1 D;  1PP9 G;  2YKQ A;  2AI5 A;  1S2E A;  1LTG C;  1L4A D;  3FXD A;  1EXI A;  3RK3 C;  4NPF X;  4UB6 H;  1C2R A;  2B12 B;  2MHM A;  2FRC A;  1BSH A;  2KSJ A;  1NTM G;  3M97 X;  2YO3 A;  3JCU E;  3LW5 J;  5KAF H;  3H1K G;  2M3E A;  1HZV A;  3G9R A;  1A02 J;  1JY2 P;  3CLQ A;  1L0L J;  5AVW B;  4FA9 A;  1KIL E;  4XE5 B;  1FDM A;  2FFD A;  4OGQ B;  1L0N G;  1CO6 A;  3H1J J;  1BL9 A;  5BU8 B;  2W27 A;  1AA0 A;  2LIT A;  5DJU B;  1EDJ A;  3JSV C;  1JOC A;  1GZL A;  1Q2N A;  4RJT A;  3H1L D;  1FDI A;  1W5C E;  2ITA A;  5CCH C;  1OW7 A;  2FBW C;  1Q81 Q;  3L70 D;  2ZT9 C;  3U59 A;  5AW3 B;  3H1H E;  3L73 D;  4N78 D;  4M3L A;  1FJK A;  2KK7 A;  5CMZ A;  1QX8 A;  2R5B A;  3VP8 A;  2Z5H A;  1YFC A;  2B88 A;  3TYY A;  2J58 A;  1H33 B;  4YTP C;  2BPB B;  3CWB G;  1QVG O;  3L72 E;  3GHG A;  2ZOO A;  3A0H H;  1MZ4 A;  2E74 C;  1AKK A;  1N8R Q;  4DCK A;  3FX0 A;  1KZU B;  1SQQ G;  1KTM A;  3CU4 A;  1FU1 A;  1QYZ A;  3M0D A;  4EIJ A;  5AW7 B;  4PWA A;  1BCC D;  1NTZ G;  3P32 A;  2P1J A;  2DVH A;  2KS1 A;  3VN0 A;  1SQP G;  1JCD A;  1PP9 D;  1EC5 A;  1SVF A;  1YQ3 C;  2QJK B;  1NTM J;  4Y99 C;  1LTI C;  1NAF A;  451C A;  1AVO A;  4BRY B;  3EFG A;  5KLV J;  1FHB A;  4WQD A;  2C1U A;  1RE4 A;  2RKL A;  3OA7 A;  1RQU A;  3T97 B;  1N2D C;  4HJG H;  3LIE A;  3L75 E;  4R4M A;  5CBN A;  3TYI A;  3DMI A;  3H1K D;  4K3A A;  4LGD E;  1Y47 A;  1RAP A;  1RE3 C;  1NJI Q;  1H89 A;  3IF4 A;  1LT9 B;  4BWN A;  1RF0 A;  1L0N D;  4TLF A;  1GJQ A;  2K88 A;  1KB0 A;  3ZIY A;  4GIF A;  5CCG C;  1H9X A;  2Z4E A;  3KDP B;  2IDB A;  5L8R J;  2K1A A;  5KJ7 D;  2N18 B;  3P8C E;  1M1J C;  1S5L E;  1I55 A;  2CE0 A;  1G2C A;  1S9K E;  3RK2 D;  4IFM A;  2OQQ A;  3CXH W;  1VQL P;  3CCU P;  4AAL A;  2AXT V;  3CWB D;  1DIQ C;  5GTH E;  3CCL P;  2ZAE B;  2ZYG A;  3RGU A;  2D0W A;  3I56 P;  1SQQ D;  1PGP A;  4UB6 V;  1QKS A;  4GOD A;  1KIL A;  1LTB C;  3C9I A;  1YJ9 P;  1LC1 A;  3PTZ A;  2O3J A;  1NTZ D;  4IL6 H;  2NZ2 A;  1BGY E;  3CME P;  1KFM A;  2N3Y A;  4WBA A;  1Q82 Q;  1SQP D;  1T3U A;  2XV5 A;  2YIU C;  3HTK A;  4AUW A;  1SQX J;  5B66 H;  3OCD B;  4UB8 H;  1M60 A;  5CCH A;  3HQ6 A;  1OWA A;  4U3F E;  3ZOW A;  2D2C D;  2BCC E;  5TIS V;  1VF5 C;  1JY2 N;  3RL0 C;  5AVS B;  3V2N A;  2B10 B;  1MV8 A;  2WWW A;  3AE4 C;  1S6V B;  5K5G B;  2QJP B;  1FZC B;  1J1D B;  2E76 B;  1C6S A;  1RAQ A;  4WQ9 A;  2K3R A;  4H13 C;  2WSF J;  1J3S A;  3WU2 V;  4AAO A;  2BAS A;  4NPE A;  1HRO A;  1TU3 F;  2GUS A;  3ABV C;  1KV4 A;  4RO0 A;  2WMM A;  3L75 G;  1OVU A;  2KNC B;  1VL2 A;  2BGV X;  1IRW A;  2CPB A;  4PD4 H;  3BAT A;  1GDT A;  1YYC A;  2KZI A;  4PV1 B;  1FOS E;  1R5S A;  5CHX A;  3A0H V;  5M1B A;  1N73 A;  2FYN B;  1PGO A;  3VRD A;  1NTK K;  1VQ5 P;  1LS9 A;  1IRV A;  4NPD A;  2GB8 B;  3USS A;  1NWQ A;  3B5N B;  1CRI A;  3GF3 A;  4DT0 A;  2VRS A;  2OYH C;  2NPS B;  1CI6 A;  1GL2 A;  2AIU A;  2Q6Q A;  5CIE B;  3H1H J;  1NU1 K;  1H88 A;  3A0B H;  3CXH H;  3E1R A;  5AW6 B;  3A3Y B;  3CCS P;  2JDI H;  2IPP A;  2WSE J;  1FBM A;  1DEE G;  1YEB A;  2Z5I A;  2KZJ A;  3L72 J;  1SQV J;  4C7R A;  4OGQ D;  5CBO A;  2C1D A;  4H44 C;  1NU1 E;  2W6A A;  1AV1 A;  2NRG A;  1KC8 Q;  1L9B C;  4DOJ A;  1BSN A;  3F89 A;  4GOF A;  4WY4 B;  1CRH A;  1OXZ A;  1N7L A;  3G6E P;  1LWU C;  1HJ5 A;  1URQ A;  4Z1M H;  1N15 A;  1KB9 H;  4AQR D;  4L3G A;  1NIR A;  1BGY G;  1M1J A;  2ZON G;  2POH A;  2IBZ I;  1E8E A;  3O8Z A;  3ZOY A;  1YJW P;  2N9I A;  5AVU B;  5KTB A;  1T3J A;  1H0T A;  3AE5 C;  3MTU E;  2QE7 H;  2KB7 P;  4K3I A;  4U3F G;  5C0Z A;  1WT6 A;  2E75 B;  1L2P A;  1HWT C;  3L75 D;  1LTS C;  3H1L E;  3OW2 O;  1PFI A;  3BVH A;  3TNU A;  3WFB C;  5B5E H;  1I5T A;  1WVE C;  3L4M A;  3WUV A;  4Y28 J;  3L73 E;  2Y0C A;  4N78 E;  1LP1 A;  3EQ2 A;  351C A;  2DW3 A;  1EXJ A;  1M6Z A;  3AE1 C;  2WT7 A;  2B87 B;  3HD7 B;  4IL6 V;  1Z56 A;  4B86 A;  3PLN A;  3LW5 H;  2GA1 A;  1VQ7 P;  2C9N Y;  3P8C D;  1RF1 C;  4QAO A;  2ORL A;  5B66 V;  1KYO I;  1WMK A;  1OCD A;  4UB8 V;  4O1Q A;  1ZP0 C;  2FFD C;  1CW5 A;  3AEF C;  2EXV A;  5KKZ C;  4YXD C;  3AEE C;  2JR8 A;  1EZV D;  1LGH B;  1BGY J;  1YBK A;  3C2C A;  3KZI V;  1SS1 A;  1JUN A;  1AFO A;  1CXA A;  1NU1 G;  1YIJ P;  1DVV A;  2E5Y A;  4L73 A;  2V08 A;  1M57 D;  1JMB A;  5IY5 1;  4HH2 A;  1J1E B;  1IFD A;  1K8A Q;  1JB0 J;  2B0Z B;  2WSC J;  5AVT B;  2OTJ P;  2BCC J;  1DW1 A;  1SQB J;  1YIT P;  3HQ8 A;  1RY3 A;  3PXW A;  2KYV A;  2B4Z A;  1P84 H;  1VPC A;  2GIW A;  1HUC A;  4U3F D;  1KX2 A;  3O5C A;  1YHQ P;  2CE1 A;  2OTK E;  1U57 A;  3SVW A;  3A0B V;  1SFC C;  1QVF O;  1K9M Q;  3PH0 A;  2HOD B;  1L4A A;  1QL3 A;  5GTI H;  3U1A A;  3SLE A;  3RK2 C;  5CJ4 A;  1HRC A;  3MIW A;  1LWU A;  1LTJ B;  3WFC C;  4GT1 A;  1K3G A;  4EIE A;  3MK7 C;  4L74 A;  1JNM A;  1RE4 C;  2OYI A;  3BAS A;  3CX5 D;  1N7S B;  2QG4 A;  1CSX A;  1FZE A;  5APT A;  4YE1 A;  3ZCF A;  1FDO A;  2CPS A;  3L73 G;  3D70 A;  2YNY A;  2GC7 D;  2E76 D;  3R4Y A;  1YI2 P;  5H2F H;  3HE5 B;  3ZOO A;  1RF0 C;  1R8E A;  4O1W A;  3D6Z A;  1FJP A;  1NTK D;  3NMD A;  2MJZ A;  3WFD C;  4PV1 D;  5KAF E;  2RH0 A;  2HFE D;  5DJT B;  2A45 I;  2WVR A;  3RK3 B;  1UII A;  2AXT H;  3Q1M A;  2OYO A;  3B5N D;  1DVH A;  1QL1 A;  5B5E V;  3O0R C;  2NPS D;  3M9Q A;  2JQR A;  2A45 G;  3IFM A;  1CSB A;  155C A;  1EB7 A;  1S4X A;  2W6B A;  3H32 B;  1RF1 A;  3RBX A;  4H0L B;  3TGU E;  4L75 A;  3SSU A;  4EID A;  1KIL C;  2R44 A;  4Q5P A;  1RZ5 A;  2B89 A;  3H1L J;  4DY9 A;  5EXQ A;  4WY4 D;  1ZW0 A;  5TIS H;  3L70 J;  1MG3 D;  2N1T D;  1FOC A;  3NTN A;  5AW0 B;  3L73 J;  1E29 A;  3A0H E;  2ZT9 B;  1IZL 0;  3KXD A;  3HE4 A;  2J5U A;  2QJY B;  2P7J A;  1QEX A;  3WU2 H;  1PL5 A;  4PJ0 H;  1T2K D;  2ZYD A;  3FXE A;  2E74 B;  2WSF H;  4GED B;  2YKO A;  4GOE A;  1ZN5 A;  1QL4 A;  3O20 A;  2QM8 A;  3VOP A;  1BCC J;  2ZFC A;  2E75 D;  1H32 B;  3H25 A;  5KJ7 A;  1S1C X;  1Q7Y Q;  1KD1 Q;  2E42 A;  3H1I D;  1Q90 D;  1PP9 J;  4HB1 A;  4W7Y A;  3VMZ A;  1SFC A;  4L76 A;  2KLV A;  3I55 P;  4Y99 B;  1I54 A;  5AUR A;  5APQ A;  1DW3 A;  1N73 C;  1QLE D;  3O1Y A;  1MFT A;  2N9Y B;  1ZOY C;  2FYZ A;  1GIW A;  3HD7 D;  2GC4 D;  3H1K J;  1RHZ B;  1R5L A;  1GL2 C;  3CYT I;  3AEA C;  3S1K A;  5GTI V;  4KJM A;  2IZ0 A;  2WSE H;  4WQC A;  3L37 A;  2OZ1 B;  1H9Y A;  1L0N J;  1CSV A;  3FWN A;  3U1C A;  4FA1 A;  1GK4 A;  2QEX P;  2QJK C;  3IN6 A;  1A2S A;  1H8A A;  3SWK A;  1YEA A;  2HG5 D;  4ASW A;  3HUS A;  1LT1 A;  1MFZ A;  1DIP A;  3IR9 A;  3BCC E;  2W6J H;  3TGU G;  1FZA A;  3D71 A;  4KHX A;  1K04 A;  1NYH A;  1URQ C;  1LTA C;  5H2F V;  4LJI A;  2B9B A;  2W83 C;  1K73 Q;  1U7M A;  1M1J B;  2R5D A;  3O6Q A;  4EOT A;  1K3H A;  4D6T E;  3TSI A;  1A8C A;  2FXO A;  1H1O A;  3CWB J;  1BE3 E;  4IL6 E;  4ASV A;  2PAC A;  2JO1 A;  2K9J B;  1LT9 C;  5CIG B;  3AED C;  3OA8 B;  3CMA P;  3KHU A;  2ZBO A;  1SQQ J;  2HPC A;  3MHV A;  4V2K A;  5DFS A;  1E2R A;  1HJ0 A;  1NTZ J;  2GUV A;  1EZV E;  3HQ7 A;  1CTZ A;  3AE2 C;  4XXL A;  2WIT A;  2Y9Y A;  2N18 C;  1X0T A;  1HGZ A;  1SQP J;  1HJ3 A;  1N50 A;  1T6A A;  1KN7 A;  5CJ0 A;  4ZKU A;  4KMG A;  5CIB B;  2LKM A;  3SWS A;  4QMA A;  4OWF A;  3H6P A;  2C1V A;  3AE7 C;  1B7V A;  1CC5 A;  4PW9 B;  1C6O A;  1VF5 B;  1HTL C;  2XND H;  3RL0 B;  1N7S D;  2R32 A;  1IZN B;  3L71 G;  2V4H A;  1ZME C;  4PD4 E;  1VQ6 P;  2Q7C A;  3OAK A;  2CK3 H;  1KYO W;  2C2C A;  1HF9 A;  4ZKP A;  4H13 B;  1EQ7 A;  1UIX A;  1AJY A;  3JBT B;  3EWK A;  1X8Y A;  1VYD A;  2PRR A;  1LJ2 A;  1CIH A;  2KXP B;  3KZI H;  1RZ6 A;  3PRJ A;  4PJ0 V;  2FYU K;  1KIB A;  1CTJ A;  3A0B E;  3CXH E;  2DGE A;  1PIX A;  3TGU D;  3FWL A;  4RKU J;  3CX5 E;  4KT0 J;  2H89 C;  3TK1 A;  3RK3 D;  5E79 H;  3LID A;  1IFN A;  2QVA A;  1VQN P;  2QRX A;  2OYH B;  2FYU E;  1CRJ A;  1J1D C;  2E76 C;  4C7N B;  1H33 A;  3CC7 P;  1CSW A;  2WSC H;  3V5B A;  3G3Z A;  2FXM A;  2V7Q H;  5DJQ C;  3P7K A;  3BCC G;  1PZQ A;  3VMA A;  3WUT A;  3TF5 A;  1GU4 A;  1I6E A;  5AW8 B;  1NTK E;  2BH5 X;  4D6T G;  4H0L D;  1HJ4 A;  3CCJ P;  4H44 B;  1L9J C;  1JTH B;  1E79 H;  1DH3 A;  2KSE A;  1DII C;  1T8Z A;  1BE3 G;  1EZV I;  4BRY A;  1LWU B;  2Y0E A;  1L4A C;  3T97 A;  1HZU A;  1Q86 Q;  1EZV G;  1FJ0 A;  2ZT9 D;  4WVZ A;  1IQC A;  4JF7 A;  1U74 B;  3SWF A;  2OYI C;  3L4O A;  3L71 D;  1QGK B;  4W80 A;  5B5E E;  3PHL A;  1KYO H;  1VQM P;  1IK7 A;  1LT9 A;  1X9V A;  5C39 A;  1G1J A;  4JBZ A;  2OGU A;  1IFM A;  2E74 D;  2OAR A;  5KAI H;  1YTZ I;  3L75 J;  4JPZ B;  2C0X A;  1HH7 A;  1IFJ A;  2ZXE B;  1CCH A;  4WY4 C;  1FZG A;  3CCM P;  3L74 G;  5AVY B;  2E5T A;  2JJL A;  1H31 B;  2N3B A;  1L0L K;  2N1T C;  3IAO A;  2A06 E;  4YXW H;  3TDK A;  1CYI A;  2AXC A;  1OIP A;  5AW1 B;  1ZR4 A;  1NVO A;  4YPC A;  2I8F A;  3CCE P;  2XU6 A;  3CI9 A;  2O1J A;  4OH8 B;  1M1K Q;  1I8P A;  1DW0 A;  3B4S A;  1OVV A;  3CXH I;  1L0L E;  3CX5 I;  1IFP A;  3V6I A;  1VDF A;  3H1J E;  2JKV A;  1CRG A;  1U7J A;  1DW2 A;  2E75 C;  3KQG A;  3BCC D;  1KFN A;  2Y0D A;  1JY3 O;  1S5L X;  4U7J A;  1CYC A;  4D6T D;  3H1I E;  1R0Q A;  2P2U A;  2FYU G;  2FFD B;  1CIE A;  4ZNC A;  1BE3 D;  4XYD B;  5KKZ B;  5APV A;  5CCG D;  3OCD A;  3GF7 A;  3HD7 C;  2R3C A;  4ZMD A;  3RN0 A;  1NTK G;  5GTH V;  3M91 A;  2AEM A;  3M9B A;  4O9B A;  1NTM K;  2LR2 A;  4LLH A;  4W7Z A;  1KX7 A;  5KLV K;  2H88 C;  3CC4 P;  1FZC A;  2ZXY A;  2IX7 C;  1USE A;  1ZXG A;  1FE6 A;  1JEK A;  3L4F A;  1CIF A;  1EDK A;  4U3F J;  2YQB A;  3GHG B;  2AEJ A;  4HYT B;  3GW6 A;  3QH9 A;  3CCV P;  2V7Q J;  5E79 V;  2KNC A;  3EFF K;  5KLV E;  3L74 D;  1OZH A;  4AYC A;  2Y9Z A;  1GU2 A;  2XKM A;  1SFC B;  3N7N A;  3MD0 A;  1JM0 A;  4PD4 D;  5KLI C;  1RQV A;  1NH4 A;  5KJ7 C;  2ZVN B;  4FAV A;  3WC8 A;  1OX3 A; 
#chains in the Genus database with same CATH homology
 2QJY B;  2D0W A;  1SQQ D;  2B11 B;  4UB6 V;  1QKS A;  2HV4 A;  1M70 A;  2L4D A;  1LC1 A;  3PTZ A;  2O3J A;  1NTZ D;  2JTI B;  1CIG A;  4GED B;  2N3Y A;  1QL4 A;  3O20 A;  3CXH D;  1SQP D;  2L91 A;  2BCN B;  1H32 B;  3PH2 B;  2CA3 B;  1CHH A;  2VHD A;  3OCD B;  3PXS A;  1M60 A;  3OA8 A;  3H1I D;  3HQ6 A;  4EIC A;  3ZOW A;  4WQA A;  2FYU D;  4FA4 A;  1C7M A;  1I54 A;  5AUR A;  5TIS V;  1DW3 A;  3O1Y A;  2B10 B;  2N9Y B;  1S6V B;  4WQ8 A;  2QJP B;  1C6S A;  1RAQ A;  4WQ9 A;  1GIW A;  2GC4 D;  3ORV A;  5KAI V;  1J3S A;  1KB9 D;  3DR0 A;  3WU2 V;  4AAO A;  1HRO A;  1C6R A;  3CYT I;  5GTI V;  2V07 A;  1CRC A;  1FI7 A;  1A56 A;  1S5L V;  2KNC B;  2BGV X;  1IRW A;  4WQC A;  3A9F A;  2OZ1 B;  1H9Y A;  1CSV A;  2LIR A;  1CNO A;  3A0H V;  1W5C T;  4FA1 A;  1LMS A;  1LFM A;  2FYN B;  3PXT A;  3VRD A;  3RMZ A;  1A2S A;  4L3H A;  1LS9 A;  1IRV A;  2GB8 B;  1YEA A;  1CRI A;  1AOF A;  2RN0 A;  4J20 A;  2AIU A;  5CIE B;  4WQ7 A;  5H2F V;  4LJI A;  1ETP A;  1DT1 A;  1C75 A;  2JWA A;  2YCC A;  1K3H A;  1C52 A;  1YTC A;  4EDF A;  1A8C A;  1YEB A;  5TJH A;  1MG2 D;  1H1O A;  5KLI B;  2PAC A;  2K9J B;  2C1D A;  5CIG B;  1YIQ A;  3OA8 B;  3KHU A;  1L9B C;  1BGY D;  2ZBO A;  2A06 D;  1CXC A;  4AAN A;  4V2K A;  5DFS A;  2CXB A;  1E2R A;  1COR A;  1CRH A;  4FB1 A;  1CYJ A;  3HQ7 A;  1CTZ A;  3GG2 A;  1HJ5 A;  4XXL A;  1N15 A;  2N18 C;  4Y5R A;  1LC2 A;  1F1C A;  2BH4 X;  1I6D A;  1L0L D;  3RLM A;  1CRY A;  2IBZ D;  2N9J A;  1HJ3 A;  1N50 A;  3MK7 B;  3WFE C;  1JDL A;  4L3G A;  4KMG A;  1NIR A;  4EIF A;  5CIB B;  4NFG B;  1NML A;  2ZON G;  2BCC D;  3H1J D;  1CSU A;  1SQB D;  1E8E A;  3ZBM A;  1CHJ A;  3ZOY A;  3SWS A;  2YK3 A;  5DF5 A;  3VYM A;  5C9M A;  2N9I A;  5CIH B;  1PPJ D;  1N90 A;  2PCC B;  2C1V A;  1B7V A;  4H0J A;  1CC5 A;  4PW9 B;  4K3I A;  1C6O A;  1I8O A;  5C0Z A;  1KV9 A;  2ZZS 1;  1FI9 A;  3L75 D;  1KYO W;  2C2C A;  4L1Q A;  5CID B;  3WFB C;  1ZRT D;  1I5T A;  1WVE C;  3L4M A;  3ZOX A;  3JBT B;  2Y0C A;  1YIC A;  1VYD A;  2BLF B;  2RMZ A;  351C A;  1ZZH A;  1CIH A;  1OAE A;  1M6Z A;  1RZ6 A;  2C8S A;  5CIF B;  3PRJ A;  1P84 D;  4PJ0 V;  2MTA C;  1YCC A;  1KIB A;  3NBT A;  1CTJ A;  1C2N A;  4A7P A;  1CCR A;  4IL6 V;  2DGE A;  3TGU D;  4WQE A;  2C1D B;  3FWL A;  3PLN A;  1KYO D;  4FAN A;  1NNO A;  1H31 A;  4QAO A;  2ORL A;  5B66 V;  3VNW A;  1CRJ A;  1OCD A;  4UB8 V;  1H33 A;  2Q3E A;  1NTM D;  4O1Q A;  1QN2 A;  1CHI A;  1GQ1 A;  5KLV D;  1CSW A;  2D0S A;  5CIC B;  1NU1 D;  5DJQ C;  2AI5 A;  3VMA A;  1YNR A;  3NWV A;  3TF5 A;  2EXV A;  1I6E A;  3WUI A;  2BH5 X;  2XTS B;  1HJ4 A;  1C2R A;  2B12 B;  2MHM A;  1EZV D;  2FRC A;  1L9J C;  3SJL A;  2C9X B;  1DII C;  3M97 X;  3X39 A;  3C2C A;  3KZI V;  1CXA A;  2PCB B;  1DVV A;  1HZV A;  4FA5 A;  2Y0E A;  4AAM A;  2V08 A;  5IY5 1;  4FA9 A;  1HZU A;  2B0Z B;  4WQB A;  1FJ0 A;  1CO6 A;  1DW1 A;  1BL9 A;  3HQ8 A;  3PXW A;  1IQC A;  2B4Z A;  2LIT A;  2GIW A;  1U74 B;  4U3F D;  1KX2 A;  3L4O A;  3L71 D;  3O5C A;  2YIU B;  2CE1 A;  3CX5 W;  4RJT A;  3H1L D;  3PHL A;  3SVW A;  3A0B V;  4GYD A;  3L70 D;  4H0K A;  1HH7 A;  3L73 D;  1CCH A;  1QL3 A;  1GDV A;  3SLE A;  1H31 B;  1HRC A;  2N3B A;  4AX3 A;  3ITK A;  1HCM A;  5KAF V;  1YFC A;  1CTY A;  3WFC C;  1K3G A;  3TDK A;  1H33 B;  1CYI A;  2BPB B;  1FI3 A;  4EIE A;  3MK7 C;  2I8F A;  2ZOO A;  1MZ4 A;  1AKK A;  3CX5 D;  2QG4 A;  1CSX A;  3CU4 A;  4YE1 A;  3ZCF A;  1I8P A;  1DW0 A;  3RN1 A;  1QYZ A;  2GC7 D;  1AOQ A;  4MU8 A;  4PWA A;  1BCC D;  1SQX D;  1NMI A;  2DVH A;  1IO3 A;  1CRG A;  1DW2 A;  2FWL A;  2KS1 A;  3ZOO A;  1PP9 D;  3BCC D;  5B6Q A;  2QJK B;  4O1W A;  451C A;  2Y0D A;  1FHB A;  1NTK D;  4WQD A;  1CYC A;  2C1U A;  4D6T D;  1R0Q A;  4RSZ A;  5CYT R;  3WFD C;  1CIE A;  5DJQ B;  1FCD C;  1BE3 D;  3TYI A;  1F1F A;  4XYD B;  3DMI A;  5KKZ B;  1H32 A;  3H1K D;  3SXT A;  1RAP A;  3OCD A;  4N0K A;  1DVH A;  3RN0 A;  5B5E V;  3O0R C;  5GTH V;  2JQR A;  1U75 B;  1AYG A;  1L0N D;  155C A;  1CED A;  1EB7 A;  1GJQ A;  1KX7 A;  1KB0 A;  3CP5 A;  3ZIY A;  1H9X A;  2ZXY A;  4EID A;  1CIF A;  1WEJ F;  1W2L A;  2N18 B;  1COT A;  2YQB A;  2CA4 B;  1N9C A;  3DP5 A;  3GW6 A;  4Q5P A;  1RZ5 A;  3H1H D;  5E79 V;  1I55 A;  4JCG A;  4DY9 A;  2CE0 A;  5EXQ A;  3L74 D;  3HQ9 A;  2OZ1 A;  1GKS A;  4P4Q B;  1GU2 A;  1MG3 D;  3NBS A;  1FOC A;  3CXH W;  4PD4 D;  1E29 A;  4AAL A;  2AXT V;  3CWB D;  1DIQ C;  4FAV A;  3L72 D;  1IZL 0;  3WC8 A;  1SQV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...