2QJYB

Crystal structure of rhodobacter sphaeroides double mutant with stigmatellin and uq2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b
publication title Inhibitor-complexed Structures of the Cytochrome bc1 from the Photosynthetic Bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 67
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjyB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjyB02
3TYIA 4L1QA 1L0ND 1HZVA 1CIGA 5CIEB 1EB7A 2IBZD 3C2CA 5C9MA 4WQ8A 4O1QA 3CP5A 2GC4D 3VNWA 2B10B 2B4ZA 1I8PA 2C1DB 3ZOOA 1CIEA 3RMZA 2V08A 2Y0EA 5TISV 1MG3D 3KHUA 1QN2A 1MG2D 3ZOXA 1M6ZA 3WFEC 3ZCFA 1RAPA 3PXTA 3OA8B 2FWLA 1CSVA 4EICA 1YCCA 1FOCA 1ETPA 1DVVA 1H33B 4J20A 5EXQA 2BH4X 4FB1A 5CICB 4FA5A 2ZOOA 2LIRA 1FI7A 2Q3EA 1LFMA 3ZOYA 1KIBA 2OZ1A 1U75B 1CO6A 1C75A 4EIDA 1BGYD 1OCDA 1IO3A 2AIUA 2N18B 3NBSA 4PJ0V 3MK7C 1SQBD 4N0KA 3L73D 3M97X 1DVHA 3SVWA 3H1HD 1IQCA 1QL4A 3CYTI 3H1JD 5CIHB 3RN1A 1N15A 4Y5RA 1I8OA 4WQ9A 1CSUA 1S5LV 4AAOA 1YICA 3HQ8A 1H1OA 5DFSA 1CYJA 5KKZB 2GIWA 2YCCA 1H9XA 1NIRA 1L0LD 2CA4B 3X39A 1RAQA 1LC2A 4DY9A 1FJ0A 1F1CA 4Q5PA 1E2RA 4JCGA 1P84D 1K3HA 1KB9D 5KAFV 5DF5A 4P4QB 3WFBC 1CXAA 3ITKA 3SLEA 4AALA 3VYMA 2PCBB 1C6RA 1YNRA 3PXSA 4A7PA 3RN0A 1KB0A 1SQVD 5KLIB 1IRWA 1C6SA 1BCCD 3CXHW 2ZZS1 3L4MA 3O5CA 2BH5X 2V07A 1YIQA 1GQ1A 4FAVA 1GIWA 1BE3D 1HJ4A 2D0WA 2EXVA 4WQCA 1YFCA 5E79V 3CWBD 2AI5A 1EZVD 4EDFA 1VYDA 1KX2A 1NMLA 3NBTA 2N3BA 2FYUD 1NTZD 3WU2V 1L9BC 3RLMA 1C52A 4K3IA 2DVHA 3L71D 5AURA 3ORVA 4RSZA 5CIGB 1CNOA 3WC8A 5C0ZA 1CCRA 3JBTB 4NFGB 4FA1A 1CHIA 1AKKA 3L4OA 1GU2A 3SXTA 1HZUA 1DT1A 1W5CT 1PPJD 1SQQD 1DW0A 2CE0A 2OZ1B 1CTZA 2CE1A 1H32A 3CXHD 4WQDA 2N9JA 1J3SA 3GW6A 1SQXD 2C1UA 4KMGA 1I6EA 4WQEA 3MK7B 3BCCD 2LITA 3TDKA 451CA 1DW3A 1CIFA 2O3JA 1CIHA 4MU8A 1S6VB 4FANA 3ZBMA 4EIFA 3KZIV 3NWVA 1N9CA 2ORLA 3O0RC 3WFCC 3SJLA 1AOQA 3L72D 5GTHV 1YEAA 1CYCA 4XYDB 3A9FA 2HV4A 1FCDC 1NTMD 1I54A 1WEJF 1FI9A 2BGVX 4WQAA 2B0ZB 3PXWA 2L4DA 1NU1D 1CYIA 1C7MA 1GDVA 1QKSA 3VRDA 1HRCA 5DJQC 1FI3A 4PWAA 1LC1A 2FYNB 3CX5W 1CRIA 1HCMA 3O20A 1CORA 1CRYA 1DIQC 4PD4D 3O1YA 1AYGA 1QL3A 4U3FD 5KLVD 5IY51 1DIIC 2KNCB 2VHDA 2QJYB 4GYDA 1M60A 3GG2A 3TF5A 3PRJA 1H31A 2A06D 1HJ5A 1KX7A 1WVEC 1A56A 2JTIB 3CU4A 2B12B 3H1KD 3WUIA 155CA 1KYOW 1DW2A 2ZBOA 5CIDB 4AAMA 5B6QA 4UB6V 3FWLA 1K3GA 1C6OA 1NNOA 1YEBA 2C9XB 1RZ5A 4IL6V 2PCCB 1HJ3A 3DP5A 1NMIA 4QAOA 3L70D 3A0HV 2KS1A 2MTAC 3CX5D 3L75D 4FA9A 4WQBA 3PTZA 1CTYA 3HQ7A 2D0SA 4UB8V 1B7VA 5CYTR 1GKSA 4V2KA 2BCCD 2BPBB 3SWSA 2L91A 4LJIA 1LS9A 2MHMA 1IRVA 1F1FA 4FA4A 2JQRA 1H32B 1L9JC 5CIFB 1R0QA 3OCDB 1CTJA 3ZOWA 1FHBA 3A0BV 1C2NA 2XTSB 1BL9A 3TGUD 4AANA 4D6TD 2RMZA 3OCDA 1KYOD 2N9YB 1NTKD 1CHJA 1CXCA 1CRCA 1LMSA 2BCNB 3DMIA 1DW1A 2C1DA 2Y0CA 1I5TA 4L3GA 2K9JB 2ZXYA 1ZRTD 2C1VA 3HQ6A 4O1WA 4EIEA 1CRHA 1CC5A 1HH7A 1PP9D 2YIUB 1RZ6A 3H1ID 2YQBA 4XXLA 1GJQA 3PLNA 3OA8A 1CSWA 4YE1A 1C2RA 4L3HA 2BLFB 2GB8B 2YK3A 1H33A 5DJQB 1CSXA 3PHLA 4PW9B 4H0KA 1CEDA 2N18C 1E29A 5TJHA 1U74B 2C8SA 4AX3A 1QYZA 4WQ7A 4RJTA 2DGEA 1E8EA 1A2SA 1W2LA 5H2FV 2JWAA 1H31B 5B66V 1CRGA 1OAEA 3DR0A 2CA3B 2RN0A 1JDLA 1IZL0 1M70A 1HROA 2FRCA 1AOFA 3ZIYA 5CIBB 351CA 4GEDB 3WFDC 1N90A 2B11B 2Y0DA 2AXTV 2QJPB 4H0JA 3L74D 2QG4A 2N9IA 1KV9A 2C2CA 2ZONG 2QJKB 1YTCA 1COTA 2N3YA 2CXBA 5KAIV 5B5EV 1CRJA 1N50A 1SQPD 2PACA 1CHHA 3VMAA 1A8CA 1H9YA 2GC7D 5GTIV 1ZZHA 1I6DA 3H1LD 1I55A 1CCHA 3HQ9A 3PH2B 1MZ4A 2I8FA
chains in the Genus database with same CATH superfamily
1L0ND 3PJSK 1IK9A 1HZVA 4LLHA 3CMAP 3VN0A 1FZCC 4GODA 4IFDK 2FYZA 3GF3A 1LT9B 3CP5A 2A06E 3VNWA 1KN7A 2B10B 4DT0A 3H1KE 3PH0A 2V08A 2AXCA 1MUUA 4UB6H 1S2EA 3P8MC 1PPJG 1N2DC 1QN2A 2J5UA 1MG2D 1M6ZA 3WFEC 1NAFA 2WITA 2FWLA 1K9MQ 1YTZI 2FFDB 1RE3C 3B5NA 1X9VA 1ETPA 2BCCE 1SFCC 3NMDA 1E79H 2P10A 2WSEJ 2LKMA 1P84H 4PJ0E 2WSEH 4YXWH 1C75A 2KUBA 4TLFA 1OCDA 3H1JG 1IO3A 1KB9I 2FBWC 1MFZA 4HH2A 3NBSA 4PJ0V 3C8VA 1SQBD 1SQVJ 1NTMG 1NTKE 1S5LE 1QL4A 3CYTI 3KYQA 3RN1A 3EQ2A 3G3ZA 1OFCX 1BE3J 2P67A 3CCJP 3HTKB 1S5LV 4AAOA 4WB4A 3HQ8A 2HODA 1FZFA 4N78E 2FYUJ 2YCCA 1NTZJ 3RL0g 4U3FG 5KLVG 1EZVI 1L0LD 1NH4A 3X39A 3AE4C 1H0TB 1RAQA 1LC2A 1E2RA 4JCGA 1IFPA 3CC2P 3V2PA 1KB9D 4L73A 1FZBA 5AVXB 2OYHC 3ITKA 2W27A 4AALA 2IFNA 1MFTA 3Q3DA 3RN0A 3CXHH 4HJGH 3NXSA 4R4LA 3CXHW 2A45H 3L4MA 2YXQB 1GD2E 2QEXP 1GIWA 1HJ4A 4NPEA 5H2FH 3WU2E 3CWBD 1EZVD 1VF5B 1DH3A 3WU2V 1L9BC 4WY4A 5CHXA 1XTCC 2QSIA 1MV8A 1QL2A 2M5AA 3VTPC 1SQPE 3TGUG 1ZLLA 1N8RQ 2C9NY 5CCHD 3GMAA 3H1LE 2H8PD 5GTIH 5CCGA 1DT1A 1LT1A 3Q2YA 1SQQD 1DW0A 2OZ1B 4I7ZB 2Y9YA 1J3SA 1SQXD 2E75C 4KMGA 3L4FA 1G1JA 1JY3P 5KJ7A 4PD4I 1EQ7A 4BRYB 1SVFA 2RKLA 2D2CB 1DW3A 4WBAA 3R4YA 1M1JA 2E76B 3RBZA 1CIHA 1SP4A 1N73A 1EXJA 1S6VB 4FANA 2K9YA 4EIFA 4BRYA 3H1KJ 1N9CA 3IF4A 2YIUC 2E5YA 3H6PA 3O8ZA 1NAYA 1OZHA 4R4MA 3EWKA 2BGVX 5AW6B 5AVRB 3PXWA 2L4DA 1GDVA 3VRDA 3FXDA 1FI3A 2JEEA 5K5GB 1KILE 2H89C 2BCCJ 1DIQC 4PD4D 1AYGA 1QL3A 3MZWB 1NHLA 2KSEA 1DIIC 1RQVA 2SPZA 2I1KA 4PJ0H 1NYHA 3H1HE 3V4QA 4GYDA 2JO1A 2XNDH 3M91A 1NVOA 3AEAC 1AA0A 3GG2A 1NTKJ 3P8CE 2WT7B 3CPWO 1HJ5A 1S5LH 1N7SB 3WUIA 5B6QA 3SSUA 1K3GA 1C6OA 1NNOA 2C9XB 4WVZA 2WT7A 2PCCB 1HJ3A 1L4AB 5EFWB 1NMIA 1K73Q 3L70D 3RK3B 2ZFCA 5APQA 1L0NG 1KTMA 3L75D 3OW2O 4FA9A 3TNUA 3TYYA 4K3AA 5AW8B 2QA4P 2BPBB 3SWSA 3JCUE 4OH8B 3RBXA 2MHMA 4H44D 1H32B 5CIFB 5AVZB 3ZOWA 2KP8A 3VMYA 3GHGA 1NKZB 1URQA 3HE5A 5TISE 1S5LX 1LT9C 1NJIQ 2RMZA 1IC2A 2JWDA 2C1DA 1I5TA 4XFJA 3BASA 3HQ6A 1JB0J 4GT1A 3M0DA 1HH7A 1LP1A 3BRTB 5CJ0A 1YYCA 2JP3A 2CPSA 2Q1KA 1PP9D 3WU2H 1HJBA 3WUUA 2GUVA 3CCQP 1HGZA 3PLNA 1SQBG 2FFDC 2N9BA 2YK3A 1N7LA 4DZOA 1H33A 5DJQB 2XZRA 1SQPJ 3BRVB 1S4XA 2FXPA 2K37A 1PPJE 4PW9B 3H1LJ 1L2PA 4IFMA 4H0KA 1U7MA 2QVAA 3E1RA 5AVUB 2OYOA 1EDJA 3VP8A 1VQ6P 1HJ0A 2C8SA 2GM4A 2M3EA 1FU1A 4AX3A 1HBWA 1QYZA 1L0LG 1IO4A 1A2SA 5AVSB 3G4SP 1YJNP 1OAEA 3H1JE 1VQ8P 4H0LB 3RL0B 2FRCA 3W68A 2PP6A 1NTME 3WFDC 1N90A 2Y0DA 4C46A 1EC5A 2KS1B 3AEFC 1KV9A 2YKPA 1RF1B 1KYOI 1COTA 3OA7A 5KAIV 2FKWB 1DD4A 1NU1K 1GTWA 2WQYC 4W80A 2ZVNB 3HD7B 4U3FE 5KLVE 1USDA 1EZVG 3PH2B 2Q7CA 4L1QA 2O01N 1AQ5A 1S9KE 1G1IA 1CIGA 3C2CA 1QLED 3H1HJ 4DCKA 2B4ZA 5M1BA 1HF9A 2NPSB 1I8PA 1GU4A 2E43A 1VF5C 2HYNA 1OW6A 1LNQA 2XU6A 2NPSA 2Y0EA 3MIWA 1RF0A 5CMZA 3ZOXA 1WT6A 1SQXG 3PXTA 1KD1Q 2ZYAA 1SQPK 4EICA 1YCCA 1FOCA 1PV3A 1Q7YQ 4GDOA 1KC8Q 3MHVA 1DIPA 5CICB 3U1AA 4YTPC 3Q5RA 4I7ZC 2KLUA 1OVVA 1U75B 1CO6A 4EIDA 1BGYD 1QX8A 2AIUA 3JCUH 1VQ5P 1JY3N 1Q81Q 5CBNA 3TGUE 4EIJA 1WMKA 4N0KA 4ASWA 1JTHA 3HUSA 3L73D 3M97X 2D2CC 1T2KC 3SVWA 2E76C 2N1TB 5CIHB 1YIJP 3A7OA 4TT3H 1JY2N 1I8OA 1ZRTE 2C0WA 1YICA 1LTGC 1ZP0C 1RY3A 4C7NB 4KJMA 2IDBA 1TU3F 2E75D 4KT0J 4Z1MH 3IFMA 2ZAEB 5AW3B 1EDKA 1FJ0A 5CJ4A 4Q5PA 5KAFE 1T8ZA 2J59M 5KAFV 5APYA 4P4QB 3WFBC 1CXAA 3M0AA 4RO0A 3SLEA 2AEJA 3I56P 3VYMA 4ASVA 1C6RA 3PXSA 2ZXXA 1FC2C 3CC4P 1R8EA 2KNCA 5KLIB 1BCCD 4I1LA 2BH5X 5C39A 1YIQA 4ZKPA 3L75G 1QL1A 2EXVA 4WQCA 1YFCA 3S1KA 1N7SC 3FWNA 1EDLA 4UB8E 2WPQA 1NMLA 3NBTA 4ZKUA 3H1JJ 1FDOA 5AW7B 1L4AC 3RLMA 4HYTB 3RK3C 1DX7A 2GA1A 1CZQA 3L74E 1NTMJ 3VP9A 4K3IA 2DVHA 3L71D 4RSZA 3WC8A 5KAIH 3S9OA 2ZT9B 3B5NB 5C0ZA 3AEBC 1Q86Q 4FA1A 3W67A 1VQ9P 4W7ZA 1GU2A 3SXTA 3BCCG 1CTZA 2CE1A 3CI9A 4U3FJ 1L0NE 5KLVJ 1IFNA 1VQMP 2KK7A 5AW2B 1X79B 2C1UA 2KZJA 1I6EA 3A3YB 3MK7B 2YKQA 2Q6QA 3AE1C 2P7JA 2RH0A 3M9QA 3TDKA 3M0DC 4MU8A 1HTLC 4JF7A 1KFNA 3ZBMA 2C0XA 2E74B 3K5BA 2HODB 2O1KA 2LR2A 4JPZB 2HR3A 1AOQA 3L72D 2HV4A 1I54A 3B71A 1WEJF 1USEA 3II6A 1NU1D 4GOEA 1MKMA 1FZEA 3MP7B 5DJQC 2POHA 1LC1A 2FYNB 1HCMA 3O20A 3I55P 3CX5I 1CRYA 3O1YA 5AVVB 5IY51 1M8OB 3G6EP 1SQBE 2I8DA 2VHDA 1S72P 2FY8A 1JEKA 1W2EA 3TGUJ 1M60A 1PL5A 2AXTE 4K35A 4NPFX 4H0LC 1WVEC 4IL6E 3RL0C 1A56A 2JTIB 155CA 1KYOW 2ZBOA 5CCHA 5CIDB 4AAMA 1E5WA 2IYPA 3KDPB 1JCCA 3FWLA 1Y8AA 3V4WA 4IL6V 1YEBA 4WY4B 1L0LE 2E74D 1KQLA 1M1KQ 1W5CE 1EDIA 1U7JA 2GUSA 1RF1C 2MTAC 3CX5D 1AFOA 2WSSH 2V7QJ 1FBMA 2M5AB 1KILA 1LWUA 3Q1MA 1YQ3C 2B88A 1KB9E 2D0SA 2V7QH 3C9IA 1B7VA 2MKVA 1J1EB 2CPBA 3HD7C 1GKSA 4V2KA 5KLVK 4HKZH 1IJDB 2L91A 1LTTC 5KAFH 3G9RA 1OVUA 4GOFA 1DEBA 2O01J 2JR8A 3V2RA 1R0QA 4I6MC 2O01H 1BL9A 1SQVK 4D6TD 1JMBA 3VOPA 2NPSC 1M1JB 1YJ9P 1N73B 3CWBE 1EZVE 4N3YB 1LMSA 2G3AA 1ZN5A 2PGDA 1DW1A 4W7YA 2C1VA 1OMIA 1CRHA 2WPVB 1KFMA 1Z56A 1Q82Q 4WWIA 1FDMA 1JY2P 1WRGA 1ZOYC 3CL3D 2R44A 2FYUK 4KHXA 1NTZK 1K8AQ 3A2AA 3H1ID 2YQBA 1BGYG 3L74J 3OA8A 3L35A 1CSBA 1JCDA 1NKNA 3WUTA 4PV1B 3L73G 1AVOA 2GB8B 1VF5D 1CW5A 3MUDC 1AJYA 3RK2B 1SQQE 1H8AA 1SQXE 2Z5IA 3CCVP 1L0NJ 5AVTB 4XA4A 2VRSA 3WMM0 2N1TC 5APWA 4WQ7A 1D7MA 1PGJA 2R3SA 2DGEA 1W2LA 3P7KA 1CRGA 2QM7A 2YKOA 1GL2A 3L74G 2CA3B 2IBZI 3OJAB 1M70A 1AOFA 2C9LY 1ZW0A 4GEDB 3L37A 3D0WA 2B11B 5B5EE 2QJPB 2D2CD 3KPEA 1T2KD 2NZ2A 2QJKB 2E76D 1YTCA 2HLOA 2N3YA 1BCCG 1RE4A 5L8RJ 3TNUB 5B5EV 4JQ0D 3N7NA 1N50A 1RHZB 1K05A 1CHHA 4PD4E 3VMAA 3Q5SA 1A8CA 2GC7D 1FJKA 1ZZHA 1I55A 3SFDC 3HQ9A 4PV1D 2I8FA 1KZUB 5KLIC 3MD0A 3HE4A 1SQBJ 3GHGB 3SFEC 5CIEB 1EB7A 2IBZD 1FZCA 1URQB 3HE5B 1KORA 4WQ8A 3L71G 4O1QA 1QEXA 1JMMA 2WSCJ 1IFDA 2C1DB 3O6QA 3JC22 4EI2A 1CIEA 3RMZA 1YJWP 1ZMEC 4JBZA 1LP1B 3CCMP 4OGQB 1VQOP 2WSFJ 3L70E 4IL6H 5TISV 1JUNA 1N86A 2W8ZA 1H89A 3L75E 2IYOA 1L0LJ 3ZCFA 1GK4A 2ZT9C 3B5NC 2WPSA 1RE3A 3TK1A 1N7SD 1H33B 5EXQA 1SFCA 4FB1A 1FDIA 1LFMA 1KB9H 1L0NK 1L4AD 1KIBA 1KQGB 1LGHB 3RK3D 1P84I 2W6JH 3L72G 2N18B 2KB7P 3MK7C 5AW0B 3SWYA 1PGOA 3H1JD 2Q9IA 1VQLP 2OTJP 1NU1G 4Y5RA 1OW7A 3BCCE 2E74C 1NTKK 4IL6X 1H1OA 3BATA 3CCEP 5KKZB 1PP9E 1FJPA 1H9XA 3USSA 1ZR2A 2E42A 4DY9A 5APSA 2FYNC 4AQRD 4DJGA 1P84D 1K3HA 3CCLP 5DF5A 2OYIB 1W2BO 1HH0A 2ZVOB 4H13C 3VMZA 2IFMA 1U57A 5AW9B 3RGUA 4CPGA 1QGKB 1SQXJ 1SQVD 2OYIA 1IRWA 1C6SA 3AE6C 3M9BA 2ZZS1 1CI6A 5E79E 5APXA 3CWBG 3O5CA 3E7KA 5BVZA 3CXHI 1T6AA 2HPCA 2A45I 1BE3D 5E79V 4EOTA 4N6JA 4EDFA 1VYDA 3T97A 1KILC 4WY4C 2FYUD 1NTZD 4O9BA 1L0LK 2QM8A 3SWFA 2OGUA 1C52A 1X8YA 3ORVA 5CIGB 1R5SA 1CNOA 2H43A 3B4SA 2W6AA 1IZNB 5B5EH 1SQQG 1YTZT 4D6TG 1J1EC 1VQPP 4NFGB 1FZAA 4H0LD 3RL0D 2YO3A 2MJZA 1YHQP 3L4OA 5CCGC 3CCSP 3CMEP 1W5CT 3CXHD 2Z4EA 1R5LA 2N9JA 2R5DA 2YMKA 1YBKA 2WMMA 4PD4H 3GW6A 3NFQA 2O1JA 4WQEA 5KJ7C 1FE6A 4BXLA 1M56D 2LITA 1JTHB 3HUSB 3H1IG 2PAJA 3H32A 1M1JC 3AE2C 1N73C 2R32A 2O3JA 5AVYB 3AE9C 3HD7D 5GTHE 1PGPA 2K9JA 1KYOE 1PFIA 1G2CB 3NWVA 5DJTB 2ORLA 3WFCC 2WVRA 3IN6A 1NGMB 5GTHV 2OQQA 1YEAA 1LJ2A 5TISH 1LTJB 3L70J 2K88A 1G2CA 3IR9A 2B0ZB 3L75J 1IFJA 5BU8B 2NPSD 4PV1C 2KI7B 3LIDA 1HRCA 1LTJA 4PWAA 2QIWA 4HB1A 3RK2C 1DD3A 2YO2A 4B86A 1BGYE 2XV5A 1OIPA 1YI2P 3AECC 2KNCB 1RH5B 2P58A 3L73E 3LIEA 2QJYB 3F5HA 1GL2C 3C1LA 1QVFO 2YXRB 4YPCA 4EYYQ 1H31A 4Y28J 2A06D 4LC1A 1KX7A 3L70G 1GMJA 3CU4A 2KYVA 3BCCJ 3H1KD 1DW2A 1NO4A 3OAKA 3A0HE 1PIXA 2QJPC 4L74A 3A0HV 2QJKC 2N1TD 1JY3O 2IZ0A 3D6ZA 4WQBA 1GDTA 1YQ4C 3ZDMA 2IBZG 4UB8V 4BWNA 1JY2O 2BCCD 1SLQA 1BDCA 4GIFA 1IRVA 2B87A 1GK6A 1HWTC 2IZ1A 1FOSE 1F1FA 4FA4A 3A0BE 2JQRA 3CLQA 2BEZF 2K1AA 1LTSC 3OCDB 1PZQA 1BCCE 1BSHA 3GHGC 3A0BV 1C2NA 1URQC 4AANA 1LT9A 3OCDA 2N9YB 1NTKD 2WPRA 2KLVA 4C7RA 5E79H 1CXCA 1PP9G 3DMIA 2BCNB 2Y0CA 1KQSO 2ZXYA 1VQNP 3LW5J 4O1WA 4EIEA 2QRXA 3V5BA 4OGQC 2B89A 3LW5H 4N78D 1RZ6A 3L71E 1FZGA 1GW4A 1BDDA 1A02J 4XXLA 2XKMA 4L75A 2FFDA 4YE1A 4JYCA 4IOIH 5AW4B 1T3UA 1FS0E 3E1IA 3A5TA 3GLMA 2N18C 4M3LA 5BU5A 1KQFB 2KOGA 3M06A 2ZT9D 3B5ND 3NTNA 5B66E 1VDFA 2ITAA 2KIKA 4H13B 2JWAA 3WUVA 3HTKA 4MN4C 4L76A 5B66V 1X22A 2B9BA 3DR0A 1OVRA 5KKZC 1IFIA 1JDLA 3L72E 1HROA 2BASA 2YNYA 3KXDA 5APUA 3ZIYA 1AV1A 5CIBB 1OWAA 3VMXA 5GTHH 3CCUP 1YITP 1KYOH 3V2QA 3AE5C 1GZLA 2AXTV 4H0JA 2QG4A 1OW8A 1OX3A 3CC7P 1H0TA 1NU1E 3AEGC 1NTMK 1SQVG 1KILB 1LWUB 1CRJA 1SQPD 2Q3IA 2JJLA 3KQGA 2OYIC 1BE3G 1H9YA 3GF7A 3SWKA 3H1LD 3JSVC 5APTA 2LXBA 5CBOA 5AVQB 3TYIA 1BGYJ 2FYUG 1NTZG 2M3BA 2Q5UA 3PP5A 1J2JB 2W90A 1JNMA 5C9MA 3L73J 2GC4D 5AW5B 3G71P 4QMAA 3AEEC 1JM0A 2HG5D 2QE7H 3ZOOA 4Y99B 2PRRA 4H13D 2IX7C 2R3CA 1JOCA 1RF0C 1MG3D 1OXZA 3KHUA 3CX5E 3EFFK 3A0HH 2A45G 1RAPA 3OA8B 1CSVA 2OTKE 2ZXEB 4UB8H 3FX0A 1DVVA 4J20A 1ZV8A 2BH4X 4FA5A 2ZOOA 2LIRA 1FI7A 1KILD 4WY4D 2K3RA 2Q3EA 3ZOYA 2OZ1A 4GKGA 5AW1B 1XTGB 3CD6P 2FXMA 2OTLP 4D6TE 3HUSC 1BCCJ 3A0BH 4RESB 2H88C 1DVHA 3H1HD 1IQCA 1FAVA 1VL2A 1HGVA 1N15A 3H25A 4WQ9A 3P8CD 1CSUA 5CCGD 3AE8C 5DFSA 1GL2B 4XE5B 1CYJA 3EFGA 2ZYDA 2GIWA 2H7HA 1NIRA 1LTJC 3H1IE 3BVHA 4H44B 5KJ7D 2CA4B 3L71J 1PGQA 1H88A 1F1CA 3U1CA 1NOHA 4LGDE 2YMYA 1LTAC 4ZMDA 1J1DB 2A06G 3H1KG 2PCBB 1YNRA 4A7PA 1KB0A 1GU5A 3HE4B 2QJYC 1S3JA 4OVNF 1FZCB 3HRNA 2V07A 1GQ1A 4FAVA 4AYCA 1DEEG 2D0WA 4NPDA 3RK2D 1GW3A 2Y9ZA 3N4XA 2AI5A 5B66H 1N7SA 3O6QB 2ZJSE 1K04A 1VQKP 1KX2A 2BCCG 2N3BA 3L72J 1L4AA 2WZ7A 3Q5PA 4IFFA 1GL2D 2AXTH 5AURA 3FGAD 3UIAA 2WSCH 1M90Q 1LTBC 1NU1J 2W6BA 1CCRA 3JBTB 2WSFH 3S4RA 2FXOA 1NTKG 1SFCB 1CHIA 1AKKA 1RQUA 1HZUA 1Q90D 2Z5HA 1PPJD 1I6DA 2CE0A 4WQDA 1EXIA 1H32A 2XDJA 4AUWA 3VYIA 2W83C 3V2NA 2IBZE 3IAOA 2AEMA 3M9HA 3BCCD 451CA 1CIFA 3KZIE 1VQ7P 4ZNCA 3FXEA 3KZIV 3O0RC 2XNXA 3SJLA 1CYCA 4XYDB 3A9FA 1Y47A 2JDIH 1FCDC 1NTMD 1URQD 3CWBJ 1FI9A 3D71A 4WQAA 1CYIA 2HFED 1C7MA 4YXDC 1QKSA 1M57D 3CX5H 3TSIA 1SS1A 3CX5W 1CRIA 2R5BA 3P32A 1CORA 4OGQD 3ABVC 3R2PA 1QVGO 2OYHB 3RK3E 5KTBA 4U3FD 5KLVD 1Q2NA 1SFCD 3CCRP 2DW3A 2IPPA 5AVWB 2OYHA 1ZR4A 1CI6B 1S9KD 1SQBK 1SQQJ 4D6TJ 2HPCB 3AE7C 1NWQA 3TF5A 3PRJA 1A02F 4DOJA 4UB6E 1LTIC 5KAIE 5CCHC 2B12B 1SQPG 1IK7A 3T97B 4UB6V 1BSNA 3H1LG 1RZ5A 3DP5A 2M0BA 2E5TA 3B8EB 4QAOA 2KS1A 2LXCB 2ZYGA 3H1IJ 1RF1A 1LWUC 3PTZA 1CTYA 1P84E 3HQ7A 1S1CX 5CYTR 3HD7A 4LJIA 2KZIA 4RKUJ 5APVA 1AQTA 1LS9A 1ZXGA 1KV4A 1HUCA 4OWFA 1KMIZ 2P1JA 1L9JC 1M7LA 1SQVE 1CTJA 4U7JA 4JYBA 1FHBA 2E75B 1HVVA 2XTSB 2KSJA 3TGUD 2L5GB 1BE3E 3H32B 2PFXA 1KYOD 3AEDC 5DJUB 1CHJA 3U59A 1Y9BA 1CRCA 4Y99C 4L3GA 2K9JB 1ZRTD 2FYUE 2M8RA 1NTZE 2OARA 1CC5A 3AE3C 3D6YA 2CK3H 1JO5A 2YIUB 2NRGA 2JKVA 1GJQA 1CSWA 2WWWA 2V4HA 3QH9A 1C2RA 4L3HA 2BLFB 3H1HG 1VQ4P 2I1JA 3D70A 2KXPB 1CSXA 3PHLA 3QWOC 3V6IA 3MUDA 3CXHE 3MTUE 1X0TA 1CEDA 1E29A 1SQQK 1U74B 5TJHA 5H2FE 3MGNA 1IFMA 1SQXK 2AEFA 1AVYA 1UIIA 2N1TA 4I2LC 3I5CA 4RJTA 1E8EA 5H2FV 1H31B 2WTYA 3KZIH 2RN0A 1IZL0 4C7NA 351CA 4H44C 2J58A 3L74D 2N9IA 2C2CA 2ZONG 1T3JA 1RE4C 1FOSF 2P2UA 2CXBA 3L36A 1PP9J 5GTIE 3F89A 1VPCA 1J1DC 2PACA 2BEQD 2G8YA 5GTIV 1CCHA 1UIXA 2UWJE 2B87B 1MZ9A 1MZ4A
chains in the Genus database with same CATH topology
3TYIA 4L1QA 1L0ND 1HZVA 1CIGA 5CIEB 1EB7A 2IBZD 3C2CA 5C9MA 4WQ8A 4O1QA 3CP5A 2GC4D 3VNWA 2B10B 2B4ZA 1I8PA 2C1DB 3ZOOA 1CIEA 3RMZA 2V08A 2Y0EA 5TISV 1MG3D 3KHUA 1QN2A 1MG2D 3ZOXA 1M6ZA 3WFEC 3ZCFA 1RAPA 3PXTA 3OA8B 2FWLA 1CSVA 4EICA 1YCCA 1FOCA 1ETPA 1DVVA 1H33B 4J20A 5EXQA 2BH4X 4FB1A 5CICB 4FA5A 2ZOOA 2LIRA 1FI7A 2Q3EA 1LFMA 3ZOYA 1KIBA 2OZ1A 1U75B 1CO6A 1C75A 4EIDA 1BGYD 1OCDA 1IO3A 2AIUA 2N18B 3NBSA 4PJ0V 3MK7C 1SQBD 4N0KA 3L73D 3M97X 1DVHA 3SVWA 3H1HD 1IQCA 1QL4A 3CYTI 3H1JD 5CIHB 3RN1A 1N15A 4Y5RA 1I8OA 4WQ9A 1CSUA 1S5LV 4AAOA 1YICA 3HQ8A 1H1OA 5DFSA 1CYJA 5KKZB 2GIWA 2YCCA 1H9XA 1NIRA 1L0LD 2CA4B 3X39A 1RAQA 1LC2A 4DY9A 1FJ0A 1F1CA 4Q5PA 1E2RA 4JCGA 1P84D 1K3HA 1KB9D 5KAFV 5DF5A 4P4QB 3WFBC 1CXAA 3ITKA 3SLEA 4AALA 3VYMA 2PCBB 1C6RA 1YNRA 3PXSA 4A7PA 3RN0A 1KB0A 1SQVD 5KLIB 1IRWA 1C6SA 1BCCD 3CXHW 2ZZS1 3L4MA 3O5CA 2BH5X 2V07A 1YIQA 1GQ1A 4FAVA 1GIWA 1BE3D 1HJ4A 2D0WA 2EXVA 4WQCA 1YFCA 5E79V 3CWBD 2AI5A 1EZVD 4EDFA 1VYDA 1KX2A 1NMLA 3NBTA 2N3BA 2FYUD 1NTZD 3WU2V 1L9BC 3RLMA 1C52A 4K3IA 2DVHA 3L71D 5AURA 3ORVA 4RSZA 5CIGB 1CNOA 3WC8A 5C0ZA 1CCRA 3JBTB 4NFGB 4FA1A 1CHIA 1AKKA 3L4OA 1GU2A 3SXTA 1HZUA 1DT1A 1W5CT 1PPJD 1SQQD 1DW0A 2CE0A 2OZ1B 1CTZA 2CE1A 1H32A 3CXHD 4WQDA 2N9JA 1J3SA 3GW6A 1SQXD 2C1UA 4KMGA 1I6EA 4WQEA 3MK7B 3BCCD 2LITA 3TDKA 451CA 1DW3A 1CIFA 2O3JA 1CIHA 4MU8A 1S6VB 4FANA 3ZBMA 4EIFA 3KZIV 3NWVA 1N9CA 2ORLA 3O0RC 3WFCC 3SJLA 1AOQA 3L72D 5GTHV 1YEAA 1CYCA 4XYDB 3A9FA 2HV4A 1FCDC 1NTMD 1I54A 1WEJF 1FI9A 2BGVX 4WQAA 2B0ZB 3PXWA 2L4DA 1NU1D 1CYIA 1C7MA 1GDVA 1QKSA 3VRDA 1HRCA 5DJQC 1FI3A 4PWAA 1LC1A 2FYNB 3CX5W 1CRIA 1HCMA 3O20A 1CORA 1CRYA 1DIQC 4PD4D 3O1YA 1AYGA 1QL3A 4U3FD 5KLVD 5IY51 1DIIC 2KNCB 2VHDA 2QJYB 4GYDA 1M60A 3GG2A 3TF5A 3PRJA 1H31A 2A06D 1HJ5A 1KX7A 1WVEC 1A56A 2JTIB 3CU4A 2B12B 3H1KD 3WUIA 155CA 1KYOW 1DW2A 2ZBOA 5CIDB 4AAMA 5B6QA 4UB6V 3FWLA 1K3GA 1C6OA 1NNOA 1YEBA 2C9XB 1RZ5A 4IL6V 2PCCB 1HJ3A 3DP5A 1NMIA 4QAOA 3L70D 3A0HV 2KS1A 2MTAC 3CX5D 3L75D 4FA9A 4WQBA 3PTZA 1CTYA 3HQ7A 2D0SA 4UB8V 1B7VA 5CYTR 1GKSA 4V2KA 2BCCD 2BPBB 3SWSA 2L91A 4LJIA 1LS9A 2MHMA 1IRVA 1F1FA 4FA4A 2JQRA 1H32B 1L9JC 5CIFB 1R0QA 3OCDB 1CTJA 3ZOWA 1FHBA 3A0BV 1C2NA 2XTSB 1BL9A 3TGUD 4AANA 4D6TD 2RMZA 3OCDA 1KYOD 2N9YB 1NTKD 1CHJA 1CXCA 1CRCA 1LMSA 2BCNB 3DMIA 1DW1A 2C1DA 2Y0CA 1I5TA 4L3GA 2K9JB 2ZXYA 1ZRTD 2C1VA 3HQ6A 4O1WA 4EIEA 1CRHA 1CC5A 1HH7A 1PP9D 2YIUB 1RZ6A 3H1ID 2YQBA 4XXLA 1GJQA 3PLNA 3OA8A 1CSWA 4YE1A 1C2RA 4L3HA 2BLFB 2GB8B 2YK3A 1H33A 5DJQB 1CSXA 3PHLA 4PW9B 4H0KA 1CEDA 2N18C 1E29A 5TJHA 1U74B 2C8SA 4AX3A 1QYZA 4WQ7A 4RJTA 2DGEA 1E8EA 1A2SA 1W2LA 5H2FV 2JWAA 1H31B 5B66V 1CRGA 1OAEA 3DR0A 2CA3B 2RN0A 1JDLA 1IZL0 1M70A 1HROA 2FRCA 1AOFA 3ZIYA 5CIBB 351CA 4GEDB 3WFDC 1N90A 2B11B 2Y0DA 2AXTV 2QJPB 4H0JA 3L74D 2QG4A 2N9IA 1KV9A 2C2CA 2ZONG 2QJKB 1YTCA 1COTA 2N3YA 2CXBA 5KAIV 5B5EV 1CRJA 1N50A 1SQPD 2PACA 1CHHA 3VMAA 1A8CA 1H9YA 2GC7D 5GTIV 1ZZHA 1I6DA 3H1LD 1I55A 1CCHA 3HQ9A 3PH2B 1MZ4A 2I8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TYI A;  4L1Q A;  1L0N D;  1HZV A;  1CIG A;  5CIE B;  1EB7 A;  2IBZ D;  3C2C A;  5C9M A;  4WQ8 A;  4O1Q A;  3CP5 A;  2GC4 D;  3VNW A;  2B10 B;  2B4Z A;  1I8P A;  2C1D B;  3ZOO A;  1CIE A;  3RMZ A;  2V08 A;  2Y0E A;  5TIS V;  1MG3 D;  3KHU A;  1QN2 A;  1MG2 D;  3ZOX A;  1M6Z A;  3WFE C;  3ZCF A;  1RAP A;  3PXT A;  3OA8 B;  2FWL A;  1CSV A;  4EIC A;  1YCC A;  1FOC A;  1ETP A;  1DVV A;  1H33 B;  4J20 A;  5EXQ A;  2BH4 X;  4FB1 A;  5CIC B;  4FA5 A;  2ZOO A;  2LIR A;  1FI7 A;  2Q3E A;  1LFM A;  3ZOY A;  1KIB A;  2OZ1 A;  1U75 B;  1CO6 A;  1C75 A;  4EID A;  1BGY D;  1OCD A;  1IO3 A;  2AIU A;  2N18 B;  3NBS A;  4PJ0 V;  3MK7 C;  1SQB D;  4N0K A;  3L73 D;  3M97 X;  1DVH A;  3SVW A;  3H1H D;  1IQC A;  1QL4 A;  3CYT I;  3H1J D;  5CIH B;  3RN1 A;  1N15 A;  4Y5R A;  1I8O A;  4WQ9 A;  1CSU A;  1S5L V;  4AAO A;  1YIC A;  3HQ8 A;  1H1O A;  5DFS A;  1CYJ A;  5KKZ B;  2GIW A;  2YCC A;  1H9X A;  1NIR A;  1L0L D;  2CA4 B;  3X39 A;  1RAQ A;  1LC2 A;  4DY9 A;  1FJ0 A;  1F1C A;  4Q5P A;  1E2R A;  4JCG A;  1P84 D;  1K3H A;  1KB9 D;  5KAF V;  5DF5 A;  4P4Q B;  3WFB C;  1CXA A;  3ITK A;  3SLE A;  4AAL A;  3VYM A;  2PCB B;  1C6R A;  1YNR A;  3PXS A;  4A7P A;  3RN0 A;  1KB0 A;  1SQV D;  5KLI B;  1IRW A;  1C6S A;  1BCC D;  3CXH W;  2ZZS 1;  3L4M A;  3O5C A;  2BH5 X;  2V07 A;  1YIQ A;  1GQ1 A;  4FAV A;  1GIW A;  1BE3 D;  1HJ4 A;  2D0W A;  2EXV A;  4WQC A;  1YFC A;  5E79 V;  3CWB D;  2AI5 A;  1EZV D;  4EDF A;  1VYD A;  1KX2 A;  1NML A;  3NBT A;  2N3B A;  2FYU D;  1NTZ D;  3WU2 V;  1L9B C;  3RLM A;  1C52 A;  4K3I A;  2DVH A;  3L71 D;  5AUR A;  3ORV A;  4RSZ A;  5CIG B;  1CNO A;  3WC8 A;  5C0Z A;  1CCR A;  3JBT B;  4NFG B;  4FA1 A;  1CHI A;  1AKK A;  3L4O A;  1GU2 A;  3SXT A;  1HZU A;  1DT1 A;  1W5C T;  1PPJ D;  1SQQ D;  1DW0 A;  2CE0 A;  2OZ1 B;  1CTZ A;  2CE1 A;  1H32 A;  3CXH D;  4WQD A;  2N9J A;  1J3S A;  3GW6 A;  1SQX D;  2C1U A;  4KMG A;  1I6E A;  4WQE A;  3MK7 B;  3BCC D;  2LIT A;  3TDK A;  451C A;  1DW3 A;  1CIF A;  2O3J A;  1CIH A;  4MU8 A;  1S6V B;  4FAN A;  3ZBM A;  4EIF A;  3KZI V;  3NWV A;  1N9C A;  2ORL A;  3O0R C;  3WFC C;  3SJL A;  1AOQ A;  3L72 D;  5GTH V;  1YEA A;  1CYC A;  4XYD B;  3A9F A;  2HV4 A;  1FCD C;  1NTM D;  1I54 A;  1WEJ F;  1FI9 A;  2BGV X;  4WQA A;  2B0Z B;  3PXW A;  2L4D A;  1NU1 D;  1CYI A;  1C7M A;  1GDV A;  1QKS A;  3VRD A;  1HRC A;  5DJQ C;  1FI3 A;  4PWA A;  1LC1 A;  2FYN B;  3CX5 W;  1CRI A;  1HCM A;  3O20 A;  1COR A;  1CRY A;  1DIQ C;  4PD4 D;  3O1Y A;  1AYG A;  1QL3 A;  4U3F D;  5KLV D;  5IY5 1;  1DII C;  2KNC B;  2VHD A;  2QJY B;  4GYD A;  1M60 A;  3GG2 A;  3TF5 A;  3PRJ A;  1H31 A;  2A06 D;  1HJ5 A;  1KX7 A;  1WVE C;  1A56 A;  2JTI B;  3CU4 A;  2B12 B;  3H1K D;  3WUI A;  155C A;  1KYO W;  1DW2 A;  2ZBO A;  5CID B;  4AAM A;  5B6Q A;  4UB6 V;  3FWL A;  1K3G A;  1C6O A;  1NNO A;  1YEB A;  2C9X B;  1RZ5 A;  4IL6 V;  2PCC B;  1HJ3 A;  3DP5 A;  1NMI A;  4QAO A;  3L70 D;  3A0H V;  2KS1 A;  2MTA C;  3CX5 D;  3L75 D;  4FA9 A;  4WQB A;  3PTZ A;  1CTY A;  3HQ7 A;  2D0S A;  4UB8 V;  1B7V A;  5CYT R;  1GKS A;  4V2K A;  2BCC D;  2BPB B;  3SWS A;  2L91 A;  4LJI A;  1LS9 A;  2MHM A;  1IRV A;  1F1F A;  4FA4 A;  2JQR A;  1H32 B;  1L9J C;  5CIF B;  1R0Q A;  3OCD B;  1CTJ A;  3ZOW A;  1FHB A;  3A0B V;  1C2N A;  2XTS B;  1BL9 A;  3TGU D;  4AAN A;  4D6T D;  2RMZ A;  3OCD A;  1KYO D;  2N9Y B;  1NTK D;  1CHJ A;  1CXC A;  1CRC A;  1LMS A;  2BCN B;  3DMI A;  1DW1 A;  2C1D A;  2Y0C A;  1I5T A;  4L3G A;  2K9J B;  2ZXY A;  1ZRT D;  2C1V A;  3HQ6 A;  4O1W A;  4EIE A;  1CRH A;  1CC5 A;  1HH7 A;  1PP9 D;  2YIU B;  1RZ6 A;  3H1I D;  2YQB A;  4XXL A;  1GJQ A;  3PLN A;  3OA8 A;  1CSW A;  4YE1 A;  1C2R A;  4L3H A;  2BLF B;  2GB8 B;  2YK3 A;  1H33 A;  5DJQ B;  1CSX A;  3PHL A;  4PW9 B;  4H0K A;  1CED A;  2N18 C;  1E29 A;  5TJH A;  1U74 B;  2C8S A;  4AX3 A;  1QYZ A;  4WQ7 A;  4RJT A;  2DGE A;  1E8E A;  1A2S A;  1W2L A;  5H2F V;  2JWA A;  1H31 B;  5B66 V;  1CRG A;  1OAE A;  3DR0 A;  2CA3 B;  2RN0 A;  1JDL A;  1IZL 0;  1M70 A;  1HRO A;  2FRC A;  1AOF A;  3ZIY A;  5CIB B;  351C A;  4GED B;  3WFD C;  1N90 A;  2B11 B;  2Y0D A;  2AXT V;  2QJP B;  4H0J A;  3L74 D;  2QG4 A;  2N9I A;  1KV9 A;  2C2C A;  2ZON G;  2QJK B;  1YTC A;  1COT A;  2N3Y A;  2CXB A;  5KAI V;  5B5E V;  1CRJ A;  1N50 A;  1SQP D;  2PAC A;  1CHH A;  3VMA A;  1A8C A;  1H9Y A;  2GC7 D;  5GTI V;  1ZZH A;  1I6D A;  3H1L D;  1I55 A;  1CCH A;  3HQ9 A;  3PH2 B;  1MZ4 A;  2I8F A; 
#chains in the Genus database with same CATH topology
 1L0N D;  3PJS K;  1IK9 A;  1HZV A;  4LLH A;  3CMA P;  3VN0 A;  1FZC C;  4GOD A;  4IFD K;  2FYZ A;  3GF3 A;  1LT9 B;  3CP5 A;  2A06 E;  3VNW A;  1KN7 A;  2B10 B;  4DT0 A;  3H1K E;  3PH0 A;  2V08 A;  2AXC A;  1MUU A;  4UB6 H;  1S2E A;  3P8M C;  1PPJ G;  1N2D C;  1QN2 A;  2J5U A;  1MG2 D;  1M6Z A;  3WFE C;  1NAF A;  2WIT A;  2FWL A;  1K9M Q;  1YTZ I;  2FFD B;  1RE3 C;  3B5N A;  1X9V A;  1ETP A;  2BCC E;  1SFC C;  3NMD A;  1E79 H;  2P10 A;  2WSE J;  2LKM A;  1P84 H;  4PJ0 E;  2WSE H;  4YXW H;  1C75 A;  2KUB A;  4TLF A;  1OCD A;  3H1J G;  1IO3 A;  1KB9 I;  2FBW C;  1MFZ A;  4HH2 A;  3NBS A;  4PJ0 V;  3C8V A;  1SQB D;  1SQV J;  1NTM G;  1NTK E;  1S5L E;  1QL4 A;  3CYT I;  3KYQ A;  3RN1 A;  3EQ2 A;  3G3Z A;  1OFC X;  1BE3 J;  2P67 A;  3CCJ P;  3HTK B;  1S5L V;  4AAO A;  4WB4 A;  3HQ8 A;  2HOD A;  1FZF A;  4N78 E;  2FYU J;  2YCC A;  1NTZ J;  3RL0 g;  4U3F G;  5KLV G;  1EZV I;  1L0L D;  1NH4 A;  3X39 A;  3AE4 C;  1H0T B;  1RAQ A;  1LC2 A;  1E2R A;  4JCG A;  1IFP A;  3CC2 P;  3V2P A;  1KB9 D;  4L73 A;  1FZB A;  5AVX B;  2OYH C;  3ITK A;  2W27 A;  4AAL A;  2IFN A;  1MFT A;  3Q3D A;  3RN0 A;  3CXH H;  4HJG H;  3NXS A;  4R4L A;  3CXH W;  2A45 H;  3L4M A;  2YXQ B;  1GD2 E;  2QEX P;  1GIW A;  1HJ4 A;  4NPE A;  5H2F H;  3WU2 E;  3CWB D;  1EZV D;  1VF5 B;  1DH3 A;  3WU2 V;  1L9B C;  4WY4 A;  5CHX A;  1XTC C;  2QSI A;  1MV8 A;  1QL2 A;  2M5A A;  3VTP C;  1SQP E;  3TGU G;  1ZLL A;  1N8R Q;  2C9N Y;  5CCH D;  3GMA A;  3H1L E;  2H8P D;  5GTI H;  5CCG A;  1DT1 A;  1LT1 A;  3Q2Y A;  1SQQ D;  1DW0 A;  2OZ1 B;  4I7Z B;  2Y9Y A;  1J3S A;  1SQX D;  2E75 C;  4KMG A;  3L4F A;  1G1J A;  1JY3 P;  5KJ7 A;  4PD4 I;  1EQ7 A;  4BRY B;  1SVF A;  2RKL A;  2D2C B;  1DW3 A;  4WBA A;  3R4Y A;  1M1J A;  2E76 B;  3RBZ A;  1CIH A;  1SP4 A;  1N73 A;  1EXJ A;  1S6V B;  4FAN A;  2K9Y A;  4EIF A;  4BRY A;  3H1K J;  1N9C A;  3IF4 A;  2YIU C;  2E5Y A;  3H6P A;  3O8Z A;  1NAY A;  1OZH A;  4R4M A;  3EWK A;  2BGV X;  5AW6 B;  5AVR B;  3PXW A;  2L4D A;  1GDV A;  3VRD A;  3FXD A;  1FI3 A;  2JEE A;  5K5G B;  1KIL E;  2H89 C;  2BCC J;  1DIQ C;  4PD4 D;  1AYG A;  1QL3 A;  3MZW B;  1NHL A;  2KSE A;  1DII C;  1RQV A;  2SPZ A;  2I1K A;  4PJ0 H;  1NYH A;  3H1H E;  3V4Q A;  4GYD A;  2JO1 A;  2XND H;  3M91 A;  1NVO A;  3AEA C;  1AA0 A;  3GG2 A;  1NTK J;  3P8C E;  2WT7 B;  3CPW O;  1HJ5 A;  1S5L H;  1N7S B;  3WUI A;  5B6Q A;  3SSU A;  1K3G A;  1C6O A;  1NNO A;  2C9X B;  4WVZ A;  2WT7 A;  2PCC B;  1HJ3 A;  1L4A B;  5EFW B;  1NMI A;  1K73 Q;  3L70 D;  3RK3 B;  2ZFC A;  5APQ A;  1L0N G;  1KTM A;  3L75 D;  3OW2 O;  4FA9 A;  3TNU A;  3TYY A;  4K3A A;  5AW8 B;  2QA4 P;  2BPB B;  3SWS A;  3JCU E;  4OH8 B;  3RBX A;  2MHM A;  4H44 D;  1H32 B;  5CIF B;  5AVZ B;  3ZOW A;  2KP8 A;  3VMY A;  3GHG A;  1NKZ B;  1URQ A;  3HE5 A;  5TIS E;  1S5L X;  1LT9 C;  1NJI Q;  2RMZ A;  1IC2 A;  2JWD A;  2C1D A;  1I5T A;  4XFJ A;  3BAS A;  3HQ6 A;  1JB0 J;  4GT1 A;  3M0D A;  1HH7 A;  1LP1 A;  3BRT B;  5CJ0 A;  1YYC A;  2JP3 A;  2CPS A;  2Q1K A;  1PP9 D;  3WU2 H;  1HJB A;  3WUU A;  2GUV A;  3CCQ P;  1HGZ A;  3PLN A;  1SQB G;  2FFD C;  2N9B A;  2YK3 A;  1N7L A;  4DZO A;  1H33 A;  5DJQ B;  2XZR A;  1SQP J;  3BRV B;  1S4X A;  2FXP A;  2K37 A;  1PPJ E;  4PW9 B;  3H1L J;  1L2P A;  4IFM A;  4H0K A;  1U7M A;  2QVA A;  3E1R A;  5AVU B;  2OYO A;  1EDJ A;  3VP8 A;  1VQ6 P;  1HJ0 A;  2C8S A;  2GM4 A;  2M3E A;  1FU1 A;  4AX3 A;  1HBW A;  1QYZ A;  1L0L G;  1IO4 A;  1A2S A;  5AVS B;  3G4S P;  1YJN P;  1OAE A;  3H1J E;  1VQ8 P;  4H0L B;  3RL0 B;  2FRC A;  3W68 A;  2PP6 A;  1NTM E;  3WFD C;  1N90 A;  2Y0D A;  4C46 A;  1EC5 A;  2KS1 B;  3AEF C;  1KV9 A;  2YKP A;  1RF1 B;  1KYO I;  1COT A;  3OA7 A;  5KAI V;  2FKW B;  1DD4 A;  1NU1 K;  1GTW A;  2WQY C;  4W80 A;  2ZVN B;  3HD7 B;  4U3F E;  5KLV E;  1USD A;  1EZV G;  3PH2 B;  2Q7C A;  4L1Q A;  2O01 N;  1AQ5 A;  1S9K E;  1G1I A;  1CIG A;  3C2C A;  1QLE D;  3H1H J;  4DCK A;  2B4Z A;  5M1B A;  1HF9 A;  2NPS B;  1I8P A;  1GU4 A;  2E43 A;  1VF5 C;  2HYN A;  1OW6 A;  1LNQ A;  2XU6 A;  2NPS A;  2Y0E A;  3MIW A;  1RF0 A;  5CMZ A;  3ZOX A;  1WT6 A;  1SQX G;  3PXT A;  1KD1 Q;  2ZYA A;  1SQP K;  4EIC A;  1YCC A;  1FOC A;  1PV3 A;  1Q7Y Q;  4GDO A;  1KC8 Q;  3MHV A;  1DIP A;  5CIC B;  3U1A A;  4YTP C;  3Q5R A;  4I7Z C;  2KLU A;  1OVV A;  1U75 B;  1CO6 A;  4EID A;  1BGY D;  1QX8 A;  2AIU A;  3JCU H;  1VQ5 P;  1JY3 N;  1Q81 Q;  5CBN A;  3TGU E;  4EIJ A;  1WMK A;  4N0K A;  4ASW A;  1JTH A;  3HUS A;  3L73 D;  3M97 X;  2D2C C;  1T2K C;  3SVW A;  2E76 C;  2N1T B;  5CIH B;  1YIJ P;  3A7O A;  4TT3 H;  1JY2 N;  1I8O A;  1ZRT E;  2C0W A;  1YIC A;  1LTG C;  1ZP0 C;  1RY3 A;  4C7N B;  4KJM A;  2IDB A;  1TU3 F;  2E75 D;  4KT0 J;  4Z1M H;  3IFM A;  2ZAE B;  5AW3 B;  1EDK A;  1FJ0 A;  5CJ4 A;  4Q5P A;  5KAF E;  1T8Z A;  2J59 M;  5KAF V;  5APY A;  4P4Q B;  3WFB C;  1CXA A;  3M0A A;  4RO0 A;  3SLE A;  2AEJ A;  3I56 P;  3VYM A;  4ASV A;  1C6R A;  3PXS A;  2ZXX A;  1FC2 C;  3CC4 P;  1R8E A;  2KNC A;  5KLI B;  1BCC D;  4I1L A;  2BH5 X;  5C39 A;  1YIQ A;  4ZKP A;  3L75 G;  1QL1 A;  2EXV A;  4WQC A;  1YFC A;  3S1K A;  1N7S C;  3FWN A;  1EDL A;  4UB8 E;  2WPQ A;  1NML A;  3NBT A;  4ZKU A;  3H1J J;  1FDO A;  5AW7 B;  1L4A C;  3RLM A;  4HYT B;  3RK3 C;  1DX7 A;  2GA1 A;  1CZQ A;  3L74 E;  1NTM J;  3VP9 A;  4K3I A;  2DVH A;  3L71 D;  4RSZ A;  3WC8 A;  5KAI H;  3S9O A;  2ZT9 B;  3B5N B;  5C0Z A;  3AEB C;  1Q86 Q;  4FA1 A;  3W67 A;  1VQ9 P;  4W7Z A;  1GU2 A;  3SXT A;  3BCC G;  1CTZ A;  2CE1 A;  3CI9 A;  4U3F J;  1L0N E;  5KLV J;  1IFN A;  1VQM P;  2KK7 A;  5AW2 B;  1X79 B;  2C1U A;  2KZJ A;  1I6E A;  3A3Y B;  3MK7 B;  2YKQ A;  2Q6Q A;  3AE1 C;  2P7J A;  2RH0 A;  3M9Q A;  3TDK A;  3M0D C;  4MU8 A;  1HTL C;  4JF7 A;  1KFN A;  3ZBM A;  2C0X A;  2E74 B;  3K5B A;  2HOD B;  2O1K A;  2LR2 A;  4JPZ B;  2HR3 A;  1AOQ A;  3L72 D;  2HV4 A;  1I54 A;  3B71 A;  1WEJ F;  1USE A;  3II6 A;  1NU1 D;  4GOE A;  1MKM A;  1FZE A;  3MP7 B;  5DJQ C;  2POH A;  1LC1 A;  2FYN B;  1HCM A;  3O20 A;  3I55 P;  3CX5 I;  1CRY A;  3O1Y A;  5AVV B;  5IY5 1;  1M8O B;  3G6E P;  1SQB E;  2I8D A;  2VHD A;  1S72 P;  2FY8 A;  1JEK A;  1W2E A;  3TGU J;  1M60 A;  1PL5 A;  2AXT E;  4K35 A;  4NPF X;  4H0L C;  1WVE C;  4IL6 E;  3RL0 C;  1A56 A;  2JTI B;  155C A;  1KYO W;  2ZBO A;  5CCH A;  5CID B;  4AAM A;  1E5W A;  2IYP A;  3KDP B;  1JCC A;  3FWL A;  1Y8A A;  3V4W A;  4IL6 V;  1YEB A;  4WY4 B;  1L0L E;  2E74 D;  1KQL A;  1M1K Q;  1W5C E;  1EDI A;  1U7J A;  2GUS A;  1RF1 C;  2MTA C;  3CX5 D;  1AFO A;  2WSS H;  2V7Q J;  1FBM A;  2M5A B;  1KIL A;  1LWU A;  3Q1M A;  1YQ3 C;  2B88 A;  1KB9 E;  2D0S A;  2V7Q H;  3C9I A;  1B7V A;  2MKV A;  1J1E B;  2CPB A;  3HD7 C;  1GKS A;  4V2K A;  5KLV K;  4HKZ H;  1IJD B;  2L91 A;  1LTT C;  5KAF H;  3G9R A;  1OVU A;  4GOF A;  1DEB A;  2O01 J;  2JR8 A;  3V2R A;  1R0Q A;  4I6M C;  2O01 H;  1BL9 A;  1SQV K;  4D6T D;  1JMB A;  3VOP A;  2NPS C;  1M1J B;  1YJ9 P;  1N73 B;  3CWB E;  1EZV E;  4N3Y B;  1LMS A;  2G3A A;  1ZN5 A;  2PGD A;  1DW1 A;  4W7Y A;  2C1V A;  1OMI A;  1CRH A;  2WPV B;  1KFM A;  1Z56 A;  1Q82 Q;  4WWI A;  1FDM A;  1JY2 P;  1WRG A;  1ZOY C;  3CL3 D;  2R44 A;  2FYU K;  4KHX A;  1NTZ K;  1K8A Q;  3A2A A;  3H1I D;  2YQB A;  1BGY G;  3L74 J;  3OA8 A;  3L35 A;  1CSB A;  1JCD A;  1NKN A;  3WUT A;  4PV1 B;  3L73 G;  1AVO A;  2GB8 B;  1VF5 D;  1CW5 A;  3MUD C;  1AJY A;  3RK2 B;  1SQQ E;  1H8A A;  1SQX E;  2Z5I A;  3CCV P;  1L0N J;  5AVT B;  4XA4 A;  2VRS A;  3WMM 0;  2N1T C;  5APW A;  4WQ7 A;  1D7M A;  1PGJ A;  2R3S A;  2DGE A;  1W2L A;  3P7K A;  1CRG A;  2QM7 A;  2YKO A;  1GL2 A;  3L74 G;  2CA3 B;  2IBZ I;  3OJA B;  1M70 A;  1AOF A;  2C9L Y;  1ZW0 A;  4GED B;  3L37 A;  3D0W A;  2B11 B;  5B5E E;  2QJP B;  2D2C D;  3KPE A;  1T2K D;  2NZ2 A;  2QJK B;  2E76 D;  1YTC A;  2HLO A;  2N3Y A;  1BCC G;  1RE4 A;  5L8R J;  3TNU B;  5B5E V;  4JQ0 D;  3N7N A;  1N50 A;  1RHZ B;  1K05 A;  1CHH A;  4PD4 E;  3VMA A;  3Q5S A;  1A8C A;  2GC7 D;  1FJK A;  1ZZH A;  1I55 A;  3SFD C;  3HQ9 A;  4PV1 D;  2I8F A;  1KZU B;  5KLI C;  3MD0 A;  3HE4 A;  1SQB J;  3GHG B;  3SFE C;  5CIE B;  1EB7 A;  2IBZ D;  1FZC A;  1URQ B;  3HE5 B;  1KOR A;  4WQ8 A;  3L71 G;  4O1Q A;  1QEX A;  1JMM A;  2WSC J;  1IFD A;  2C1D B;  3O6Q A;  3JC2 2;  4EI2 A;  1CIE A;  3RMZ A;  1YJW P;  1ZME C;  4JBZ A;  1LP1 B;  3CCM P;  4OGQ B;  1VQO P;  2WSF J;  3L70 E;  4IL6 H;  5TIS V;  1JUN A;  1N86 A;  2W8Z A;  1H89 A;  3L75 E;  2IYO A;  1L0L J;  3ZCF A;  1GK4 A;  2ZT9 C;  3B5N C;  2WPS A;  1RE3 A;  3TK1 A;  1N7S D;  1H33 B;  5EXQ A;  1SFC A;  4FB1 A;  1FDI A;  1LFM A;  1KB9 H;  1L0N K;  1L4A D;  1KIB A;  1KQG B;  1LGH B;  3RK3 D;  1P84 I;  2W6J H;  3L72 G;  2N18 B;  2KB7 P;  3MK7 C;  5AW0 B;  3SWY A;  1PGO A;  3H1J D;  2Q9I A;  1VQL P;  2OTJ P;  1NU1 G;  4Y5R A;  1OW7 A;  3BCC E;  2E74 C;  1NTK K;  4IL6 X;  1H1O A;  3BAT A;  3CCE P;  5KKZ B;  1PP9 E;  1FJP A;  1H9X A;  3USS A;  1ZR2 A;  2E42 A;  4DY9 A;  5APS A;  2FYN C;  4AQR D;  4DJG A;  1P84 D;  1K3H A;  3CCL P;  5DF5 A;  2OYI B;  1W2B O;  1HH0 A;  2ZVO B;  4H13 C;  3VMZ A;  2IFM A;  1U57 A;  5AW9 B;  3RGU A;  4CPG A;  1QGK B;  1SQX J;  1SQV D;  2OYI A;  1IRW A;  1C6S A;  3AE6 C;  3M9B A;  2ZZS 1;  1CI6 A;  5E79 E;  5APX A;  3CWB G;  3O5C A;  3E7K A;  5BVZ A;  3CXH I;  1T6A A;  2HPC A;  2A45 I;  1BE3 D;  5E79 V;  4EOT A;  4N6J A;  4EDF A;  1VYD A;  3T97 A;  1KIL C;  4WY4 C;  2FYU D;  1NTZ D;  4O9B A;  1L0L K;  2QM8 A;  3SWF A;  2OGU A;  1C52 A;  1X8Y A;  3ORV A;  5CIG B;  1R5S A;  1CNO A;  2H43 A;  3B4S A;  2W6A A;  1IZN B;  5B5E H;  1SQQ G;  1YTZ T;  4D6T G;  1J1E C;  1VQP P;  4NFG B;  1FZA A;  4H0L D;  3RL0 D;  2YO3 A;  2MJZ A;  1YHQ P;  3L4O A;  5CCG C;  3CCS P;  3CME P;  1W5C T;  3CXH D;  2Z4E A;  1R5L A;  2N9J A;  2R5D A;  2YMK A;  1YBK A;  2WMM A;  4PD4 H;  3GW6 A;  3NFQ A;  2O1J A;  4WQE A;  5KJ7 C;  1FE6 A;  4BXL A;  1M56 D;  2LIT A;  1JTH B;  3HUS B;  3H1I G;  2PAJ A;  3H32 A;  1M1J C;  3AE2 C;  1N73 C;  2R32 A;  2O3J A;  5AVY B;  3AE9 C;  3HD7 D;  5GTH E;  1PGP A;  2K9J A;  1KYO E;  1PFI A;  1G2C B;  3NWV A;  5DJT B;  2ORL A;  3WFC C;  2WVR A;  3IN6 A;  1NGM B;  5GTH V;  2OQQ A;  1YEA A;  1LJ2 A;  5TIS H;  1LTJ B;  3L70 J;  2K88 A;  1G2C A;  3IR9 A;  2B0Z B;  3L75 J;  1IFJ A;  5BU8 B;  2NPS D;  4PV1 C;  2KI7 B;  3LID A;  1HRC A;  1LTJ A;  4PWA A;  2QIW A;  4HB1 A;  3RK2 C;  1DD3 A;  2YO2 A;  4B86 A;  1BGY E;  2XV5 A;  1OIP A;  1YI2 P;  3AEC C;  2KNC B;  1RH5 B;  2P58 A;  3L73 E;  3LIE A;  2QJY B;  3F5H A;  1GL2 C;  3C1L A;  1QVF O;  2YXR B;  4YPC A;  4EYY Q;  1H31 A;  4Y28 J;  2A06 D;  4LC1 A;  1KX7 A;  3L70 G;  1GMJ A;  3CU4 A;  2KYV A;  3BCC J;  3H1K D;  1DW2 A;  1NO4 A;  3OAK A;  3A0H E;  1PIX A;  2QJP C;  4L74 A;  3A0H V;  2QJK C;  2N1T D;  1JY3 O;  2IZ0 A;  3D6Z A;  4WQB A;  1GDT A;  1YQ4 C;  3ZDM A;  2IBZ G;  4UB8 V;  4BWN A;  1JY2 O;  2BCC D;  1SLQ A;  1BDC A;  4GIF A;  1IRV A;  2B87 A;  1GK6 A;  1HWT C;  2IZ1 A;  1FOS E;  1F1F A;  4FA4 A;  3A0B E;  2JQR A;  3CLQ A;  2BEZ F;  2K1A A;  1LTS C;  3OCD B;  1PZQ A;  1BCC E;  1BSH A;  3GHG C;  3A0B V;  1C2N A;  1URQ C;  4AAN A;  1LT9 A;  3OCD A;  2N9Y B;  1NTK D;  2WPR A;  2KLV A;  4C7R A;  5E79 H;  1CXC A;  1PP9 G;  3DMI A;  2BCN B;  2Y0C A;  1KQS O;  2ZXY A;  1VQN P;  3LW5 J;  4O1W A;  4EIE A;  2QRX A;  3V5B A;  4OGQ C;  2B89 A;  3LW5 H;  4N78 D;  1RZ6 A;  3L71 E;  1FZG A;  1GW4 A;  1BDD A;  1A02 J;  4XXL A;  2XKM A;  4L75 A;  2FFD A;  4YE1 A;  4JYC A;  4IOI H;  5AW4 B;  1T3U A;  1FS0 E;  3E1I A;  3A5T A;  3GLM A;  2N18 C;  4M3L A;  5BU5 A;  1KQF B;  2KOG A;  3M06 A;  2ZT9 D;  3B5N D;  3NTN A;  5B66 E;  1VDF A;  2ITA A;  2KIK A;  4H13 B;  2JWA A;  3WUV A;  3HTK A;  4MN4 C;  4L76 A;  5B66 V;  1X22 A;  2B9B A;  3DR0 A;  1OVR A;  5KKZ C;  1IFI A;  1JDL A;  3L72 E;  1HRO A;  2BAS A;  2YNY A;  3KXD A;  5APU A;  3ZIY A;  1AV1 A;  5CIB B;  1OWA A;  3VMX A;  5GTH H;  3CCU P;  1YIT P;  1KYO H;  3V2Q A;  3AE5 C;  1GZL A;  2AXT V;  4H0J A;  2QG4 A;  1OW8 A;  1OX3 A;  3CC7 P;  1H0T A;  1NU1 E;  3AEG C;  1NTM K;  1SQV G;  1KIL B;  1LWU B;  1CRJ A;  1SQP D;  2Q3I A;  2JJL A;  3KQG A;  2OYI C;  1BE3 G;  1H9Y A;  3GF7 A;  3SWK A;  3H1L D;  3JSV C;  5APT A;  2LXB A;  5CBO A;  5AVQ B;  3TYI A;  1BGY J;  2FYU G;  1NTZ G;  2M3B A;  2Q5U A;  3PP5 A;  1J2J B;  2W90 A;  1JNM A;  5C9M A;  3L73 J;  2GC4 D;  5AW5 B;  3G71 P;  4QMA A;  3AEE C;  1JM0 A;  2HG5 D;  2QE7 H;  3ZOO A;  4Y99 B;  2PRR A;  4H13 D;  2IX7 C;  2R3C A;  1JOC A;  1RF0 C;  1MG3 D;  1OXZ A;  3KHU A;  3CX5 E;  3EFF K;  3A0H H;  2A45 G;  1RAP A;  3OA8 B;  1CSV A;  2OTK E;  2ZXE B;  4UB8 H;  3FX0 A;  1DVV A;  4J20 A;  1ZV8 A;  2BH4 X;  4FA5 A;  2ZOO A;  2LIR A;  1FI7 A;  1KIL D;  4WY4 D;  2K3R A;  2Q3E A;  3ZOY A;  2OZ1 A;  4GKG A;  5AW1 B;  1XTG B;  3CD6 P;  2FXM A;  2OTL P;  4D6T E;  3HUS C;  1BCC J;  3A0B H;  4RES B;  2H88 C;  1DVH A;  3H1H D;  1IQC A;  1FAV A;  1VL2 A;  1HGV A;  1N15 A;  3H25 A;  4WQ9 A;  3P8C D;  1CSU A;  5CCG D;  3AE8 C;  5DFS A;  1GL2 B;  4XE5 B;  1CYJ A;  3EFG A;  2ZYD A;  2GIW A;  2H7H A;  1NIR A;  1LTJ C;  3H1I E;  3BVH A;  4H44 B;  5KJ7 D;  2CA4 B;  3L71 J;  1PGQ A;  1H88 A;  1F1C A;  3U1C A;  1NOH A;  4LGD E;  2YMY A;  1LTA C;  4ZMD A;  1J1D B;  2A06 G;  3H1K G;  2PCB B;  1YNR A;  4A7P A;  1KB0 A;  1GU5 A;  3HE4 B;  2QJY C;  1S3J A;  4OVN F;  1FZC B;  3HRN A;  2V07 A;  1GQ1 A;  4FAV A;  4AYC A;  1DEE G;  2D0W A;  4NPD A;  3RK2 D;  1GW3 A;  2Y9Z A;  3N4X A;  2AI5 A;  5B66 H;  1N7S A;  3O6Q B;  2ZJS E;  1K04 A;  1VQK P;  1KX2 A;  2BCC G;  2N3B A;  3L72 J;  1L4A A;  2WZ7 A;  3Q5P A;  4IFF A;  1GL2 D;  2AXT H;  5AUR A;  3FGA D;  3UIA A;  2WSC H;  1M90 Q;  1LTB C;  1NU1 J;  2W6B A;  1CCR A;  3JBT B;  2WSF H;  3S4R A;  2FXO A;  1NTK G;  1SFC B;  1CHI A;  1AKK A;  1RQU A;  1HZU A;  1Q90 D;  2Z5H A;  1PPJ D;  1I6D A;  2CE0 A;  4WQD A;  1EXI A;  1H32 A;  2XDJ A;  4AUW A;  3VYI A;  2W83 C;  3V2N A;  2IBZ E;  3IAO A;  2AEM A;  3M9H A;  3BCC D;  451C A;  1CIF A;  3KZI E;  1VQ7 P;  4ZNC A;  3FXE A;  3KZI V;  3O0R C;  2XNX A;  3SJL A;  1CYC A;  4XYD B;  3A9F A;  1Y47 A;  2JDI H;  1FCD C;  1NTM D;  1URQ D;  3CWB J;  1FI9 A;  3D71 A;  4WQA A;  1CYI A;  2HFE D;  1C7M A;  4YXD C;  1QKS A;  1M57 D;  3CX5 H;  3TSI A;  1SS1 A;  3CX5 W;  1CRI A;  2R5B A;  3P32 A;  1COR A;  4OGQ D;  3ABV C;  3R2P A;  1QVG O;  2OYH B;  3RK3 E;  5KTB A;  4U3F D;  5KLV D;  1Q2N A;  1SFC D;  3CCR P;  2DW3 A;  2IPP A;  5AVW B;  2OYH A;  1ZR4 A;  1CI6 B;  1S9K D;  1SQB K;  1SQQ J;  4D6T J;  2HPC B;  3AE7 C;  1NWQ A;  3TF5 A;  3PRJ A;  1A02 F;  4DOJ A;  4UB6 E;  1LTI C;  5KAI E;  5CCH C;  2B12 B;  1SQP G;  1IK7 A;  3T97 B;  4UB6 V;  1BSN A;  3H1L G;  1RZ5 A;  3DP5 A;  2M0B A;  2E5T A;  3B8E B;  4QAO A;  2KS1 A;  2LXC B;  2ZYG A;  3H1I J;  1RF1 A;  1LWU C;  3PTZ A;  1CTY A;  1P84 E;  3HQ7 A;  1S1C X;  5CYT R;  3HD7 A;  4LJI A;  2KZI A;  4RKU J;  5APV A;  1AQT A;  1LS9 A;  1ZXG A;  1KV4 A;  1HUC A;  4OWF A;  1KMI Z;  2P1J A;  1L9J C;  1M7L A;  1SQV E;  1CTJ A;  4U7J A;  4JYB A;  1FHB A;  2E75 B;  1HVV A;  2XTS B;  2KSJ A;  3TGU D;  2L5G B;  1BE3 E;  3H32 B;  2PFX A;  1KYO D;  3AED C;  5DJU B;  1CHJ A;  3U59 A;  1Y9B A;  1CRC A;  4Y99 C;  4L3G A;  2K9J B;  1ZRT D;  2FYU E;  2M8R A;  1NTZ E;  2OAR A;  1CC5 A;  3AE3 C;  3D6Y A;  2CK3 H;  1JO5 A;  2YIU B;  2NRG A;  2JKV A;  1GJQ A;  1CSW A;  2WWW A;  2V4H A;  3QH9 A;  1C2R A;  4L3H A;  2BLF B;  3H1H G;  1VQ4 P;  2I1J A;  3D70 A;  2KXP B;  1CSX A;  3PHL A;  3QWO C;  3V6I A;  3MUD A;  3CXH E;  3MTU E;  1X0T A;  1CED A;  1E29 A;  1SQQ K;  1U74 B;  5TJH A;  5H2F E;  3MGN A;  1IFM A;  1SQX K;  2AEF A;  1AVY A;  1UII A;  2N1T A;  4I2L C;  3I5C A;  4RJT A;  1E8E A;  5H2F V;  1H31 B;  2WTY A;  3KZI H;  2RN0 A;  1IZL 0;  4C7N A;  351C A;  4H44 C;  2J58 A;  3L74 D;  2N9I A;  2C2C A;  2ZON G;  1T3J A;  1RE4 C;  1FOS F;  2P2U A;  2CXB A;  3L36 A;  1PP9 J;  5GTI E;  3F89 A;  1VPC A;  1J1D C;  2PAC A;  2BEQ D;  2G8Y A;  5GTI V;  1CCH A;  1UIX A;  2UWJ E;  2B87 B;  1MZ9 A;  1MZ4 A; 
#chains in the Genus database with same CATH homology
 3TYI A;  4L1Q A;  1L0N D;  1HZV A;  1CIG A;  5CIE B;  1EB7 A;  2IBZ D;  3C2C A;  5C9M A;  4WQ8 A;  4O1Q A;  3CP5 A;  2GC4 D;  3VNW A;  2B10 B;  2B4Z A;  1I8P A;  2C1D B;  3ZOO A;  1CIE A;  3RMZ A;  2V08 A;  2Y0E A;  5TIS V;  1MG3 D;  3KHU A;  1QN2 A;  1MG2 D;  3ZOX A;  1M6Z A;  3WFE C;  3ZCF A;  1RAP A;  3PXT A;  3OA8 B;  2FWL A;  1CSV A;  4EIC A;  1YCC A;  1FOC A;  1ETP A;  1DVV A;  1H33 B;  4J20 A;  5EXQ A;  2BH4 X;  4FB1 A;  5CIC B;  4FA5 A;  2ZOO A;  2LIR A;  1FI7 A;  2Q3E A;  1LFM A;  3ZOY A;  1KIB A;  2OZ1 A;  1U75 B;  1CO6 A;  1C75 A;  4EID A;  1BGY D;  1OCD A;  1IO3 A;  2AIU A;  2N18 B;  3NBS A;  4PJ0 V;  3MK7 C;  1SQB D;  4N0K A;  3L73 D;  3M97 X;  1DVH A;  3SVW A;  3H1H D;  1IQC A;  1QL4 A;  3CYT I;  3H1J D;  5CIH B;  3RN1 A;  1N15 A;  4Y5R A;  1I8O A;  4WQ9 A;  1CSU A;  1S5L V;  4AAO A;  1YIC A;  3HQ8 A;  1H1O A;  5DFS A;  1CYJ A;  5KKZ B;  2GIW A;  2YCC A;  1H9X A;  1NIR A;  1L0L D;  2CA4 B;  3X39 A;  1RAQ A;  1LC2 A;  4DY9 A;  1FJ0 A;  1F1C A;  4Q5P A;  1E2R A;  4JCG A;  1P84 D;  1K3H A;  1KB9 D;  5KAF V;  5DF5 A;  4P4Q B;  3WFB C;  1CXA A;  3ITK A;  3SLE A;  4AAL A;  3VYM A;  2PCB B;  1C6R A;  1YNR A;  3PXS A;  4A7P A;  3RN0 A;  1KB0 A;  1SQV D;  5KLI B;  1IRW A;  1C6S A;  1BCC D;  3CXH W;  2ZZS 1;  3L4M A;  3O5C A;  2BH5 X;  2V07 A;  1YIQ A;  1GQ1 A;  4FAV A;  1GIW A;  1BE3 D;  1HJ4 A;  2D0W A;  2EXV A;  4WQC A;  1YFC A;  5E79 V;  3CWB D;  2AI5 A;  1EZV D;  4EDF A;  1VYD A;  1KX2 A;  1NML A;  3NBT A;  2N3B A;  2FYU D;  1NTZ D;  3WU2 V;  1L9B C;  3RLM A;  1C52 A;  4K3I A;  2DVH A;  3L71 D;  5AUR A;  3ORV A;  4RSZ A;  5CIG B;  1CNO A;  3WC8 A;  5C0Z A;  1CCR A;  3JBT B;  4NFG B;  4FA1 A;  1CHI A;  1AKK A;  3L4O A;  1GU2 A;  3SXT A;  1HZU A;  1DT1 A;  1W5C T;  1PPJ D;  1SQQ D;  1DW0 A;  2CE0 A;  2OZ1 B;  1CTZ A;  2CE1 A;  1H32 A;  3CXH D;  4WQD A;  2N9J A;  1J3S A;  3GW6 A;  1SQX D;  2C1U A;  4KMG A;  1I6E A;  4WQE A;  3MK7 B;  3BCC D;  2LIT A;  3TDK A;  451C A;  1DW3 A;  1CIF A;  2O3J A;  1CIH A;  4MU8 A;  1S6V B;  4FAN A;  3ZBM A;  4EIF A;  3KZI V;  3NWV A;  1N9C A;  2ORL A;  3O0R C;  3WFC C;  3SJL A;  1AOQ A;  3L72 D;  5GTH V;  1YEA A;  1CYC A;  4XYD B;  3A9F A;  2HV4 A;  1FCD C;  1NTM D;  1I54 A;  1WEJ F;  1FI9 A;  2BGV X;  4WQA A;  2B0Z B;  3PXW A;  2L4D A;  1NU1 D;  1CYI A;  1C7M A;  1GDV A;  1QKS A;  3VRD A;  1HRC A;  5DJQ C;  1FI3 A;  4PWA A;  1LC1 A;  2FYN B;  3CX5 W;  1CRI A;  1HCM A;  3O20 A;  1COR A;  1CRY A;  1DIQ C;  4PD4 D;  3O1Y A;  1AYG A;  1QL3 A;  4U3F D;  5KLV D;  5IY5 1;  1DII C;  2KNC B;  2VHD A;  2QJY B;  4GYD A;  1M60 A;  3GG2 A;  3TF5 A;  3PRJ A;  1H31 A;  2A06 D;  1HJ5 A;  1KX7 A;  1WVE C;  1A56 A;  2JTI B;  3CU4 A;  2B12 B;  3H1K D;  3WUI A;  155C A;  1KYO W;  1DW2 A;  2ZBO A;  5CID B;  4AAM A;  5B6Q A;  4UB6 V;  3FWL A;  1K3G A;  1C6O A;  1NNO A;  1YEB A;  2C9X B;  1RZ5 A;  4IL6 V;  2PCC B;  1HJ3 A;  3DP5 A;  1NMI A;  4QAO A;  3L70 D;  3A0H V;  2KS1 A;  2MTA C;  3CX5 D;  3L75 D;  4FA9 A;  4WQB A;  3PTZ A;  1CTY A;  3HQ7 A;  2D0S A;  4UB8 V;  1B7V A;  5CYT R;  1GKS A;  4V2K A;  2BCC D;  2BPB B;  3SWS A;  2L91 A;  4LJI A;  1LS9 A;  2MHM A;  1IRV A;  1F1F A;  4FA4 A;  2JQR A;  1H32 B;  1L9J C;  5CIF B;  1R0Q A;  3OCD B;  1CTJ A;  3ZOW A;  1FHB A;  3A0B V;  1C2N A;  2XTS B;  1BL9 A;  3TGU D;  4AAN A;  4D6T D;  2RMZ A;  3OCD A;  1KYO D;  2N9Y B;  1NTK D;  1CHJ A;  1CXC A;  1CRC A;  1LMS A;  2BCN B;  3DMI A;  1DW1 A;  2C1D A;  2Y0C A;  1I5T A;  4L3G A;  2K9J B;  2ZXY A;  1ZRT D;  2C1V A;  3HQ6 A;  4O1W A;  4EIE A;  1CRH A;  1CC5 A;  1HH7 A;  1PP9 D;  2YIU B;  1RZ6 A;  3H1I D;  2YQB A;  4XXL A;  1GJQ A;  3PLN A;  3OA8 A;  1CSW A;  4YE1 A;  1C2R A;  4L3H A;  2BLF B;  2GB8 B;  2YK3 A;  1H33 A;  5DJQ B;  1CSX A;  3PHL A;  4PW9 B;  4H0K A;  1CED A;  2N18 C;  1E29 A;  5TJH A;  1U74 B;  2C8S A;  4AX3 A;  1QYZ A;  4WQ7 A;  4RJT A;  2DGE A;  1E8E A;  1A2S A;  1W2L A;  5H2F V;  2JWA A;  1H31 B;  5B66 V;  1CRG A;  1OAE A;  3DR0 A;  2CA3 B;  2RN0 A;  1JDL A;  1IZL 0;  1M70 A;  1HRO A;  2FRC A;  1AOF A;  3ZIY A;  5CIB B;  351C A;  4GED B;  3WFD C;  1N90 A;  2B11 B;  2Y0D A;  2AXT V;  2QJP B;  4H0J A;  3L74 D;  2QG4 A;  2N9I A;  1KV9 A;  2C2C A;  2ZON G;  2QJK B;  1YTC A;  1COT A;  2N3Y A;  2CXB A;  5KAI V;  5B5E V;  1CRJ A;  1N50 A;  1SQP D;  2PAC A;  1CHH A;  3VMA A;  1A8C A;  1H9Y A;  2GC7 D;  5GTI V;  1ZZH A;  1I6D A;  3H1L D;  1I55 A;  1CCH A;  3HQ9 A;  3PH2 B;  1MZ4 A;  2I8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...