2QJYB

Crystal structure of rhodobacter sphaeroides double mutant with stigmatellin and uq2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor-complexed Structures of the Cytochrome bc1 from the Photosynthetic Bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Cytochrome b
total genus 67
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjyB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjyB02
4FA4A 5B6QA 1HZUA 3CXHD 1KYOD 1E29A 3CX5D 4D6TD 1CSXA 2BLFB 3CP5A 1LC1A 3TDKA 1RAPA 1C6SA 5CIFB 1FI9A 1CXCA 4IL6V 3PTZA 3H1HD 1CORA 4WQBA 5CIHB 2LIRA 4AANA 1HZVA 1RAQA 1I54A 2N3BA 3HQ7A 3GW6A 1CSWA 4YE1A 1C2NA 1KX7A 1F1CA 2YIUB 4FA9A 1CRYA 1CCHA 1N50A 2O3JA 1YFCA 1DIQC 1OCDA 3A0HV 1PPJD 4A7PA 3L71D 1AOQA 3C2CA 1NMLA 1CIGA 2PCCB 2BH5X 4L3HA 2D0SA 1YEBA 4KMGA 4FANA 5CICB 1HCMA 1PP9D 4O1QA 5IY51 4GYDA 2BH4X 2C1DB 1LFMA 3SLEA 3PHLA 1RZ6A 4Q5PA 1J3SA 2AIUA 4WQ7A 5KKZB 1COTA 1CHJA 1H9YA 2XTSB 4PD4D 2QJKB 3ZOWA 5DF5A 1I8OA 2ZONG 2Y0DA 1F1FA 1C6RA 2PACA 1DW3A 1GIWA 3HQ9A 5C0ZA 1BE3D 4EIEA 4AALA 2FWLA 2FYNB 3H1ID 5EXQA 1GDVA 4WQAA 2D0WA 1CIHA 1GQ1A 351CA 1MZ4A 1HRCA 1HJ5A 1CRGA 3ORVA 1IRVA 3WFDC 1KIBA 1E8EA 5CYTR 3VRDA 1N90A 3DP5A 2C1DA 2OZ1A 1QYZA 2B11B 2GIWA 3VNWA 4QAOA 1YTCA 1H9XA 1K3HA 1CYCA 4WQEA 1M70A 2ZZS1 3H1JD 1I8PA 1C75A 1L9BC 4K3IA 1CC5A 1CIEA 2N9JA 1KB9D 1CHIA 1WVEC 2Y0EA 1EZVD 1YNRA 1S5LV 2N18C 2C9XB 1DIIC 2N3YA 4WQ9A 1CTYA 4EDFA 1BCCD 4EICA 2I8FA 1CTJA 5CIGB 1CNOA 2BCNB 3H1LD 3ZCFA 1LS9A 2C1UA 3JBTB 2Q3EA 1QL3A 1SQXD 2C2CA 1CTZA 2KNCB 1I55A 2QJYB 5DFSA 4EIDA 3ZOYA 5DJQB 1AYGA 4PW9B 3VMAA 4H0KA 2L91A 1H31A 1KV9A 4Y5RA 3CXHW 1K3GA 2N9IA 1SQBD 1QL4A 2HV4A 2N18B 1S6VB 3FWLA 3KHUA 1FI3A 3PRJA 4FA5A 3O20A 1OAEA 1NMIA 3PLNA 2B12B 1CXAA 1KX2A 2CA3B 1GJQA 2B0ZB 5B5EV 3WUIA 2CXBA 2B4ZA 2A06D 5GTIV 2QG4A 2MHMA 3L4OA 3A0BV 4UB8V 1QKSA 2YK3A 3OCDB 3ZBMA 1BL9A 2MTAC 1N9CA 1H33A 3L74D 1M60A 1HJ3A 4DY9A 1H32A 3DR0A 1IRWA 1KYOW 1FHBA 3L70D 1I6EA 2DVHA 2KS1A 3WFBC 1A2SA 4WQDA 1GU2A 1CRHA 3CWBD 3HQ8A 3PXSA 2GC7D 4V2KA 3SJLA 1CSUA 3WC8A 3ITKA 1DW1A 2QJPB 1U74B 1LC2A 5B66V 1IZL0 1C2RA 3PXTA 3WFEC 2JWAA 3PXWA 1YICA 1ETPA 4P4QB 2C8SA 2Y0CA 1C52A 3L75D 1W2LA 2LITA 1FOCA 3WU2V 5KAFV 5GTHV 3A9FA 3TGUD 5KAIV 4FB1A 4O1WA 1NNOA 3MK7B 1YCCA 4RJTA 1NTZD 3L72D 2EXVA 3NBSA 3X39A 2PCBB 4AX3A 1IQCA 1H31B 2RN0A 2V08A 2C1VA 3SVWA 2BCCD 1HJ4A 3ZOXA 4N0KA 3OA8B 1L0ND 2JTIB 4GEDB 4J20A 3ZOOA 1DW0A 5KLIB 5TJHA 4AAOA 1A56A 2K9JB 1DW2A 4L1QA 1YIQA 1B7VA 1C7MA 4RSZA 1I6DA 3CU4A 1CRJA 3O0RC 3L73D 2CA4B 3VYMA 1DT1A 3NBTA 4FAVA 2GB8B 5DJQC 5AURA 4EIFA 1CRCA 3BCCD 2ZOOA 3RLMA 1H1OA 1R0QA 3OA8A 3PH2B 1CIFA 2ZBOA 4XXLA 2YCCA 1A8CA 1IO3A 1E2RA 1DVHA 1YEAA 1M6ZA 4LJIA 3H1KD 1I5TA 3O1YA 3CX5W 1FJ0A 1BGYD 3RN0A 3RN1A 2JQRA 1AKKA 1CO6A 4L3GA 1RZ5A 1WEJF 2BGVX 2FRCA 1FCDC 2CE1A 1P84D 3HQ6A 5E79V 1H32B 1QN2A 2CE0A 4U3FD 5KLVD 4WQCA 1U75B 4JCGA 4MU8A 3L4MA 5CIEB 1HH7A 1CCRA 3MK7C 4H0JA 4PJ0V 3NWVA 2RMZA 1CSVA 1KB0A 1GKSA 1L0LD 5TISV 5CIDB 3OCDA 2AXTV 2B10B 2VHDA 3ZIYA 1JDLA 1SQQD 1MG3D 4WQ8A 3RMZA 1CYJA 1FI7A 2OZ1B 3TF5A 1VYDA 3SWSA 1SQPD 1ZRTD 4UB6V 4AAMA 5C9MA 3DMIA 1CYIA 2IBZD 2DGEA 1EB7A 1CRIA 4XYDB 155CA 2ZXYA 4FA1A 1NU1D 1NTKD 3WFCC 1C6OA 2FYUD 5H2FV 1ZZHA 1CEDA 1NIRA 1SQVD 5CIBB 2BPBB 2N9YB 1CHHA 2V07A 3CYTI 3SXTA 1NTMD 3GG2A 2ORLA 1N15A 2AI5A 3M97X 1L9JC 1W5CT 2YQBA 1H33B 2GC4D 3KZIV 1HROA 1DVVA 1MG2D 3O5CA 1AOFA 1LMSA 451CA 4PWAA 3TYIA 4NFGB 2L4DA
chains in the Genus database with same CATH superfamily
1HZUA 3CXHD 2QE7H 2YKOA 1E29A 5KAIH 1SQBK 1LWUB 4D6TD 3CP5A 2WVRA 3KDPB 4TLFA 1S5LH 2Q9IA 1H89A 4I7ZC 4IL6V 1LT9B 4PJ0E 1L0NE 1CORA 4WQBA 1SQPE 2KSJA 3M9BA 1HZVA 1RAQA 1SLQA 4NPFX 1IFMA 1M1JB 1M1JC 1URQA 5TISE 5AVQB 5E79E 1CSWA 2YIUB 1OVRA 4WWIA 5B5EE 4PD4H 1NGMB 1YFCA 1URQD 1PPJD 1XTGB 2H89C 1FJPA 2BH5X 1L0LK 1R5SA 2D0SA 4KMGA 4FANA 1YQ4C 3H1JJ 2KS1B 4GYDA 1Q81Q 1LFMA 1SQQK 3KQGA 2JEEA 3AE3C 1X8YA 4WQ7A 5KKZB 1PL5A 1S4XA 3A0BH 1I8OA 2Y0DA 1F1FA 1GU5A 1FZAA 3CCUP 1H0TA 2PACA 4IFMA 2W83C 1EDJA 1H0TB 1SS1A 3W68A 1HF9A 1YIJP 3H1ID 3V4QA 2N1TA 2W8ZA 1PP9G 1KN7A 4U3FG 2WSFJ 3KZIE 3U59A 3CC4P 1CIHA 3L74E 2AEMA 1MZ4A 2B89A 2XU6A 1DEBA 1IRVA 3WFDC 2BASA 2KNCA 5CYTR 3CC7P 1SQBJ 3MHVA 1RF0C 2WSCH 3JC22 4PD4E 2OZ1A 1QYZA 2GIWA 5KLVG 1H9XA 1PGOA 2KZJA 4NPDA 4KJMA 2A45H 4BRYB 1DX7A 4DJGA 4K3IA 5APYA 3SWKA 2JWDA 2HPCB 2N9JA 3L71G 1KB9D 1JY2N 1OWAA 2QM7A 1NO4A 1CTYA 1G2CB 3VP8A 4LC1A 2NPSC 4IOIH 4EICA 4EIJA 2I8FA 1OVVA 2H7HA 1JCDA 2KIKA 1PGJA 1LS9A 3JBTB 1E79H 1GL2D 1X22A 2E42A 4HKZH 4EIDA 3SWFA 1UIIA 3KYQA 3V2RA 1YTZI 1CZQA 5AW6B 3BRTB 1MKMA 3I5CA 4Y5RA 4GODA 3MGNA 1MUUA 1QL4A 2N18B 4K35A 3FWLA 2N1TB 2G8YA 2R32A 1FDIA 3TGUG 4FA5A 1P84H 2B12B 1JB0J 1KX2A 3A5TA 4JF7A 2IDBA 2CA3B 3GHGC 1FOSF 1GJQA 1VQKP 2HODA 1M56D 3AE5C 5GTIV 1NTZG 3L4OA 2MJZA 3A0BV 2YK3A 3OCDB 1L0LE 2MTAC 2LR2A 3RL0g 3L74D 2OTJP 2QVAA 5KJ7D 4DY9A 3RK3C 3WU2H 1A2SA 4JYBA 5CCGA 1GU2A 2HPCA 1SQBG 1CRHA 3CWBD 3HQ8A 1KILB 4V2KA 1CSUA 3WC8A 2AXTH 1J1DB 2R5BA 2QJPB 1LC2A 1EZVI 2K9YA 3NMDA 4L74A 1VQ5P 3H1LG 4NPEA 3PXWA 1P84I 3L75D 2AEJA 1KMIZ 5AVZB 3A9FA 3L74G 2CPSA 2LKMA 3L75J 2M3EA 1KILD 3D0WA 3CCEP 2Q7CA 1SQPK 2M8RA 1KQGB 5APVA 1T3UA 5APUA 2FYUE 3HD7A 1JTHA 3X39A 1SQXK 1IQCA 1NTKG 2D2CC 1VQ6P 1KQLA 1S3JA 2B88A 3ZOXA 3MIWA 5BU8B 3OA8B 1S1CX 1J1EB 1L0ND 2W27A 1DW0A 3HTKB 2K9JB 1AVOA 5AW4B 1LTJB 1L0NJ 2OYIB 2CA4B 3VYMA 2NPSA 1YJWP 1DT1A 5AURA 2I8DA 1VQ9P 3L75E 1GL2A 3E1RA 4ZNCA 2KP8A 1ZMEC 3Q3DA 3AEBC 1JY3O 3A3YB 1DVHA 3O1YA 3GLMA 3CX5W 3CCVP 3D70A 2BCCE 3A0HH 2WSCJ 2HYNA 2P58A 1P84D 3TK1A 3P8CE 3V5BA 3L35A 2FXOA 4U3FD 5KLVD 4EI2A 2KB7P 2M3BA 4M3LA 1VQ8P 1HVVA 4H0JA 3LIEA 4AYCA 2E43A 1VQMP 1IK9A 4D6TE 2POHA 1L0LD 3CX5E 4BXLA 2B10B 3E7KA 1SQXG 2H8PD 1SQQD 4WQ8A 3RMZA 2WPVB 1CYJA 2B87A 2QJPC 3TF5A 1VYDA 2E75B 5AVSB 4IFDK 3DMIA 1NU1J 3LW5H 1A02F 5GTHH 4LGDE 3S1KA 5KAFH 1CRIA 4EOTA 1J2JB 5KLIC 4XYDB 155CA 1RF1A 2ZYDA 2IFNA 5H2FV 1CEDA 3TNUA 1SQVD 1KQFB 3SXTA 1G1IA 3G6EP 2M5AA 3P8MC 3AE1C 1VQ4P 2NPSB 1BGYJ 3GG2A 2OYIA 1OMIA 1Z56A 3RBXA 1S5LE 1X9VA 1W5CT 1H33B 2GC4D 5CCHD 1FZGA 1OIPA 1MG2D 1LMSA 2K1AA 2AXTE 4FA4A 5AVXB 2IYOA 3CX5D 5GTIH 2AXCA 3FWNA 2WSFH 4HH2A 2ZT9C 4XE5B 1BSNA 3AECC 1EDLA 2E5YA 3CX5H 5CCHC 3SWYA 1SQVK 3PTZA 3OA7A 3GHGB 4HJGH 5AVVB 3C8VA 4GOEA 1N7SD 3H1HD 5CIHB 2LIRA 4AANA 4Y28J 5KKZC 1I54A 1IC2A 1FS0E 4B86A 1VQLP 3GW6A 1MZ9A 4FA9A 1CRYA 2C0XA 1N50A 2WPSA 2O3JA 2WSEH 1JNMA 1IFNA 3A0HV 1T2KD 1QVFO 1W2BO 1AOQA 3C1LA 4UB6H 1VQNP 1AQ5A 1YEBA 1LJ2A 1PP9D 3NFQA 1KTMA 3AE6C 3SLEA 3PHLA 4Q5PA 1SQPG 2M0BA 3HUSB 1SFCC 2XTSB 3ZOWA 3D71A 3U1AA 1NTKK 2O1JA 1DW3A 3S4RA 1BE3D 4OGQD 1FBMA 2JP3A 4EIEA 3BCCE 1GL2B 4CPGA 2E76B 3AEFC 4WQAA 2BEQD 2WSSH 1GQ1A 351CA 1LWUC 2UWJE 1HRCA 3EQ2A 2FBWC 3C9IA 2XZRA 1HJ5A 3HD7B 3EWKA 2RKLA 5AW1B 3ORVA 1FZFA 3B5NB 1SQVG 1N90A 3B5NC 5AVTB 1LT9C 4ZKPA 2WT7B 3VNWA 1OW6A 2SPZA 4GDOA 4W7YA 3BVHA 3MTUE 1CYCA 1NAYA 1EDIA 5M1BA 4MN4C 1AVYA 1CC5A 2ZXEB 1YITP 1CIEA 1KILE 1CHIA 1WVEC 4H0LD 3B5ND 2Y0EA 5KAFE 3A2AA 4LLHA 5CJ0A 2N18C 1JMMA 3CXHE 3RBZA 4EDFA 3VYIA 1BCCD 2A45G 5AVUB 3GHGA 2OGUA 2YIUC 1QL2A 5CIGB 1NTMK 3ZDMA 1RH5B 1L4AA 3H1LD 1GMJA 1KFMA 3USSA 1QL3A 1PV3A 1SQXD 2WZ7A 3G9RA 3PH0A 2ZFCA 4H0LC 2KNCB 1L0LG 1SQXJ 3W67A 3AE4C 4W7ZA 2H43A 4I2LC 1H31A 1MFZA 1TU3F 2OYHC 2XNDH 1AA0A 2HV4A 2PGDA 1EC5A 3K5BA 1FI3A 3O20A 1OAEA 1Y47A 1CXAA 2B0ZB 3WUIA 3GF3A 5AW7B 4H44B 1FJKA 2A06D 2QG4A 1DIPA 2MHMA 3JCUE 3CC2P 2XKMA 3QH9A 2QSIA 1BL9A 1M60A 1BDDA 2WPRA 5AW9B 2OQQA 1HJ3A 2V7QJ 1QEXA 3IAOA 1L4AB 3I56P 1K8AQ 1IRWA 1K9MQ 3RL0C 2GUSA 2YMYA 2KS1A 3WFBC 2E76C 4H44D 5CJ4A 2GC7D 3SJLA 3VMXA 3CWBJ 3TYYA 1M8OB 2WMMA 2C9LY 1L0NG 1OW8A 5CMZA 2JWAA 1YICA 4OGQB 2OTKE 3WU2V 1FOCA 1Q86Q 5EFWB 3H1KJ 4N78D 4ASWA 4O1WA 1MV8A 3MK7B 1BCCG 4C7RA 4U3FE 3L72D 1K04A 1JM0A 2HLOA 5TISH 1GD2E 5E79H 2PCBB 2V08A 2C1VA 4BWNA 3SVWA 1HJ4A 2ZYGA 2C9NY 2IYPA 3L74J 2Q3IA 2JKVA 3CX5I 3AEGC 1S9KD 4RESB 1FE6A 1VQPP 1DW2A 2Y9ZA 2M5AB 4GOFA 1YIQA 1B7VA 1Q82Q 2FFDB 4RSZA 2HG5D 4GT1A 1S2EA 1IFPA 2YO3A 1FU1A 3E1IA 5B66H 1G2CA 2PAJA 1CRCA 2XDJA 1W2EA 3A0BE 3HE5B 5AVWB 1R0QA 3OA8A 2WQYC 3PH2B 2BCCG 1L2PA 1CI6B 1A8CA 1IO3A 1E2RA 3HD7D 1YEAA 3H1JE 4JYCA 1NTMJ 3VMYA 3RN0A 1ZV8A 2NRGA 3RN1A 3L72G 1KQSO 2JQRA 3KXDA 3H1KE 1CO6A 4L3GA 1RZ5A 3VMZA 1WEJF 1FCDC 3RK3B 3HQ6A 4JBZA 5CBNA 3VOPA 1H32B 2R3CA 1QN2A 4I6MC 1VL2A 2WTYA 4PV1D 3L4MA 1KYOE 3HD7C 1HH7A 3SFDC 3Q2YA 1CCRA 2KYVA 4PJ0V 2KLUA 1AFOA 1M1JA 1URQC 3PP5A 3OW2O 2IFMA 1VF5D 5TISV 5CIDB 1KILA 3OCDA 2AXTV 2P67A 3CXHI 1RQVA 1FDOA 2VHDA 3HE4A 1JDLA 3G4SP 1MG3D 1RY3A 2AEFA 2OZ1B 3SWSA 1IK7A 1JY3N 4UB8H 5KTBA 4AAMA 1LNQA 1CYIA 3H1JG 5C39A 2DGEA 1T2KC 3JCUH 2IBZG 1YQ3C 1NU1D 1NTKD 3CMAP 2ZYAA 1NIRA 3G71P 5H2FE 2BPBB 2N9YB 1CHHA 2V07A 1NTKJ 2FYNC 4C7NB 1J1EC 3CI9A 4Y99C 4EYYQ 3CCLP 3M97X 1LTJC 1HROA 1DVVA 1AJYA 1WRGA 3H1IG 1N73C 2L4DA 4WBAA 5B6QA 2CPBA 1KYOD 2HR3A 4OH8B 1LTBC 2PP6A 2OYHB 1JTHB 1C6SA 2MKVA 2IBZI 1K73Q 2YXRB 1FZCC 2Q5UA 1NKNA 1WMKA 2E74B 1HGVA 1FI9A 3MUDC 3SSUA 3RK2D 3AE8C 2ITAA 2N3BA 1SFCB 5GTIE 1BGYE 3MUDA 1KX7A 5APSA 1OCDA 1HH0A 1L0NK 5BVZA 1NH4A 4N3YB 4WB4A 3QWOC 2W6AA 5CICB 5IY51 1HJBA 2KK7A 1BSHA 1YYCA 3M0DC 1Q7YQ 1QGKB 1RZ6A 2E5TA 2A45I 2AIUA 2ZAEB 2HODB 2YMKA 2E75C 2QJKB 2R3SA 1SQQG 3EFFK 5AW5B 1C6RA 4D6TJ 1N73A 3VP9A 1USDA 2W6JH 2N1TD 1GIWA 1CSBA 3HQ9A 5AW8B 1EXIA 3CCJP 1QL1A 1U7MA 2P2UA 3AE7C 1OZHA 2JO1A 3CL3D 2YO2A 2OYOA 4C46A 1ZOYC 1CRGA 3V6IA 5KLVK 1KORA 1FDMA 2P10A 2N1TC 1KIBA 1E8EA 2B87B 1KYOH 3VRDA 3G3ZA 5K5GB 1SVFA 3DP5A 3FXEA 4Y99B 2C1DA 2FYUG 2B11B 5APWA 1YTCA 1K3HA 4RO0A 1USEA 4WQEA 1M70A 3H1JD 2R44A 4GKGA 1OFCX 1ZN5A 1KZUB 3BASA 1R8EA 1L9BC 2ZXXA 1SFCA 1D7MA 3IFMA 4JQ0D 5CHXA 1PP9E 3N4XA 2FXMA 1JEKA 3F5HA 1DD4A 2C9XB 1DIIC 3A0HE 2VRSA 3TGUE 2K3RA 2IPPA 2WT7A 1JY2P 1QVGO 3V2NA 1KILC 1CTJA 4L73A 3CCQP 1N7LA 4PV1C 2R5DA 2C1UA 2Q3EA 1OVUA 4H13C 2B9BA 3I55P 2FYZA 1ZW0A 4WY4D 5DJQB 1AYGA 4PW9B 3VMAA 3CXHH 1XTCC 5APQA 1KV9A 3L70G 3O8ZA 3MP7B 1K3GA 1SQBD 3KHUA 1M57D 2V7QH 2G3AA 1NMIA 3H32B 2OARA 2WWWA 1JMBA 4HYTB 4U7JA 5B5EV 1IFDA 2JR8A 2P1JA 2CXBA 2B4ZA 1DEEG 5APXA 4IFFA 4R4MA 3L73G 1JY3P 4DT0A 4UB8V 2JDIH 2Z4EA 1HTLC 2L5GB 3WUVA 5BU5A 1OW7A 2FYUK 4L75A 1N9CA 1IFIA 1H33A 1ZLLA 1RE4A 1NTZK 3L70J 5KJ7A 4KHXA 1SQVE 1Q2NA 1H32A 3DR0A 2IZ1A 1YJ9P 1KYOW 1FHBA 1NTKE 2OYIC 1HWTC 1RE3A 1IZNB 1M7LA 1SP4A 4ASVA 3II6A 3H1LJ 1LTAC 2IBZE 3ITKA 3WMM0 1IO4A 3BCCJ 3BATA 1U74B 3AEAC 3PXTA 1JY2O 3HE4B 3RK2B 3M9HA 2QM8A 4P4QB 3HE5A 1VF5B 3VTPC 5GTHE 4H13D 1K05A 2A06E 2LITA 5KAFV 4XFJA 1E5WA 1BDCA 3TGUD 5KAIV 1QLED 4FB1A 1A02J 3RGUA 1CI6A 2FFDA 1NTZD 1PZQA 2IZ0A 1JO5A 1IFJA 2EXVA 1P84E 3AEDC 4AQRD 3H6PA 1LTGC 1NTZJ 2BCCJ 1CW5A 4KT0J 4AX3A 1KV4A 2RN0A 4YXDC 1RE4C 4N0KA 1UIXA 1JOCA 4H0LB 1YBKA 1IJDB 1L0LJ 4J20A 1N2DC 4PV1B 3R2PA 4WY4A 2OYHA 4H13B 3CU4A 3Q5PA 1RHZB 1CRJA 3O0RC 4D6TG 3SFEC 2NPSD 3NBTA 1NHLA 4FAVA 4ZKUA 1PFIA 5DJQC 4EIFA 3RLMA 1H1OA 1KFNA 2FYUJ 4AUWA 2ZBOA 4XXLA 1URQB 2QJKC 4PD4I 4IL6X 1M6ZA 3H1KD 1FJ0A 4XA4A 1BGYD 4GIFA 1VQ7P 1AKKA 4UB6E 2O01J 1L4AC 2FRCA 3L72J 3S9OA 1YJNP 3D6YA 4OGQC 2WPQA 4I7ZB 2CE0A 4RKUJ 4WQCA 3M0AA 4JCGA 4MU8A 5CIEB 3WUTA 3M91A 3MK7C 3F89A 3BCCG 3GMAA 3WU2E 1GKSA 1FAVA 2ZVOB 3IN6A 3OAKA 5AVRB 2ZJSE 2K88A 5AW3B 1H8AA 5L8RJ 3H1HJ 3NXSA 4UB6V 5C9MA 3L37A 3EFGA 1YI2P 1EB7A 3CLQA 4WY4B 1X79B 2ZXYA 3LIDA 1R5LA 3CYTI 1HUCA 1KB9H 3M06A 2K9JA 2LXCB 1LTJA 1PPJG 3L70E 3RK3E 2ORLA 3B5NA 1RF0A 4QMAA 2RH0A 1OXZA 2YQBA 3MZWB 3KZIV 3O5CA 1AOFA 451CA 3H1LE 4NFGB 3PJSK 3M0DA 2Z5IA 1EZVG 2YXQB 4U3FJ 1KC8Q 2XV5A 2GM4A 1L4AD 1T6AA 3VN0A 3H1HE 1CSXA 2BLFB 1DH3A 3RL0B 5AW2B 1LC1A 3TDKA 1RAPA 1BE3J 1VDFA 1NU1E 5CBOA 2QEXP 5CIFB 4YTPC 3T97B 2D2CD 1CXCA 4WVZA 3OJAB 3FX0A 3HQ7A 1FC2C 4YE1A 1C2NA 3A7OA 1F1CA 2LXBA 3L71J 1CCHA 2O01N 1DIQC 4N6JA 1SQVJ 4A7PA 3L71D 1N7SB 2BEZF 3C2CA 3L73E 1NMLA 1CIGA 2PCCB 1EXJA 1KB9E 3AEEC 4L3HA 1HCMA 1NU1G 4O1QA 1SQBE 2BH4X 2C1DB 2J59M 1LT1A 5AVYB 1LWUA 3R4YA 1J3SA 3JSVC 1COTA 1BE3E 1CHJA 2K37A 1M90Q 2P7JA 1H9YA 3FGAD 4PD4D 5DF5A 2ZONG 1BGYG 3B71A 1Y9BA 2Q1KA 1BCCJ 1GK6A 1SQQE 5C0ZA 3H1IJ 2PRRA 5APTA 2FFDC 2ZT9B 3V2PA 3O6QA 4AALA 1N8RQ 2FWLA 2FYNB 5EXQA 1GU4A 1GDVA 3NTNA 3GF7A 1QX8A 2O1KA 4WY4C 1NTZE 2D0WA 3H25A 3CCRP 2QIWA 1NOHA 4C7NA 1FZCB 1NAFA 1GW3A 2E74C 4K3AA 3RL0D 2ZT9D 1HBWA 4QAOA 1J1DC 4H44C 1S9KE 4JPZB 4O9BA 5B66E 2ZVNB 2IX7C 2ZZS1 1I8PA 3L36A 1C75A 1AQTA 3IF4A 2KUBA 1OX3A 1LGHB 3WUUA 3N7NA 3CWBG 4IL6E 1EZVD 1U7JA 1YNRA 1S5LV 2WSEJ 5CCHA 1NU1K 4WQ9A 2N3YA 2XNXA 3M9QA 1FZBA 1M1KQ 1H88A 4DCKA 1KD1Q 5DJTB 1CNOA 2BCNB 3H32A 3ZCFA 1RQUA 2KLVA 3AE9C 1LTTC 2JJLA 2C2CA 1CTZA 1GL2C 1KYOI 1LP1B 1W5CE 1I55A 2GA1A 2QJYB 5DFSA 1NTMG 2J5UA 3ZOYA 4H0KA 1N7SC 2L91A 3B8EB 3H1KG 3CWBE 3CXHW 2Z5HA 2N9IA 2D2CB 1S6VB 3PRJA 4HB1A 3HTKA 4W80A 3PLNA 4DOJA 1LTIC 1RF1C 3B4SA 3FXDA 1YTZT 1N73B 3KPEA 1QKSA 1NVOA 1YHQP 3ZBMA 3AE2C 1VF5C 1NYHA 1EZVE 4DZOA 4IL6H 1GK4A 3P8CD 2PFXA 3L70D 3RK3D 1I6EA 2DVHA 4WQDA 2V4HA 3PXSA 1ZRTE 4Z1MH 3Q5SA 2KXPB 1SFCD 3HUSA 1DW1A 4YXWH 1HGZA 4OVNF 1PGQA 5B66V 2A06G 1IZL0 1C2RA 3WFEC 3Q1MA 2QRXA 1WT6A 1ETPA 2C8SA 3MD0A 1PIXA 2Y0CA 1C52A 4TT3H 2YKQA 1W2LA 4BRYA 5GTHV 1DD3A 1LTSC 2CK3H 1BCCE 1N86A 1T3JA 4YPCA 1NNOA 5H2FH 3H1IE 1YCCA 1G1JA 4RJTA 3CMEP 4PJ0H 2DW3A 2GUVA 3NBSA 4L76A 1H31B 1JUNA 2BCCD 1VPCA 2NZ2A 2W6BA 1VQOP 3HUSC 3Q5RA 3L4FA 3V4WA 3O6QB 2JTIB 4GEDB 3ZOOA 4ZMDA 5KLIB 1EQ7A 4AAOA 5TJHA 5CCGC 1A56A 3L72E 2O01H 3L73J 4L1QA 2J58A 3CCSP 1C7MA 1LP1A 2Y9YA 1I6DA 2C0WA 4UB8E 2N9BA 3L73D 2FXPA 2H88C 2GB8B 3L71E 2FY8A 3BCCD 2ZOOA 2QA4P 4R4LA 3V2QA 4I1LA 1CIFA 2HFED 5CCGD 2YCCA 2I1KA 1GZLA 1FZEA 3TGUJ 3TNUB 4LJIA 1I5TA 2E75D 4OWFA 1MFTA 1RF1B 3TSIA 1S5LX 3P32A 2E76D 2KOGA 2BGVX 1LT9A 3RK2C 2CE1A 5KLVJ 1N7SA 2W90A 5E79V 2E74D 2YKPA 2KI7B 3P7KA 2KSEA 1U75B 5KAIE 3CD6P 3UIAA 2WITA 3NWVA 1PGPA 2RMZA 1CSVA 1KB0A 5DJUB 2FKWB 1SQQJ 3HRNA 2YNYA 1JCCA 1NJIQ 1ZR4A 3ZIYA 1SQPJ 3CPWO 3U1CA 1FI7A 1NTME 1FZCA 3BRVB 1ZP0C 1SQPD 1ZRTD 3IR9A 1EDKA 1ZR2A 1U57A 1Y8AA 2IBZD 3T97A 5B5EH 1BE3G 1GTWA 3KZIH 5KLVE 3H1HG 1KB9I 4FA1A 3WFCC 1C6OA 2FYUD 1ZZHA 1NKZB 3D6ZA 5CIBB 5AW0B 2OTLP 2Q6QA 3ABVC 3CCMP 1AV1A 1NTMD 1X0TA 1S72P 1GDTA 1RE3C 1FOSE 1N15A 1PP9J 2AI5A 1GW4A 4N78E 1ZXGA 1SQXE 2KZIA 1Q90D 5KJ7C 1PPJE 1L9JC 3LW5J 2I1JA 1NWQA 1HJ0A 4PWAA 3TYIA 1T8ZA 3L75G 2QJYC
chains in the Genus database with same CATH topology
4FA4A 5B6QA 1HZUA 3CXHD 1KYOD 1E29A 3CX5D 4D6TD 1CSXA 2BLFB 3CP5A 1LC1A 3TDKA 1RAPA 1C6SA 5CIFB 1FI9A 1CXCA 4IL6V 3PTZA 3H1HD 1CORA 4WQBA 5CIHB 2LIRA 4AANA 1HZVA 1RAQA 1I54A 2N3BA 3HQ7A 3GW6A 1CSWA 4YE1A 1C2NA 1KX7A 1F1CA 2YIUB 4FA9A 1CRYA 1CCHA 1N50A 2O3JA 1YFCA 1DIQC 1OCDA 3A0HV 1PPJD 4A7PA 3L71D 1AOQA 3C2CA 1NMLA 1CIGA 2PCCB 2BH5X 4L3HA 2D0SA 1YEBA 4KMGA 4FANA 5CICB 1HCMA 1PP9D 4O1QA 5IY51 4GYDA 2BH4X 2C1DB 1LFMA 3SLEA 3PHLA 1RZ6A 4Q5PA 1J3SA 2AIUA 4WQ7A 5KKZB 1COTA 1CHJA 1H9YA 2XTSB 4PD4D 2QJKB 3ZOWA 5DF5A 1I8OA 2ZONG 2Y0DA 1F1FA 1C6RA 2PACA 1DW3A 1GIWA 3HQ9A 5C0ZA 1BE3D 4EIEA 4AALA 2FWLA 2FYNB 3H1ID 5EXQA 1GDVA 4WQAA 2D0WA 1CIHA 1GQ1A 351CA 1MZ4A 1HRCA 1HJ5A 1CRGA 3ORVA 1IRVA 3WFDC 1KIBA 1E8EA 5CYTR 3VRDA 1N90A 3DP5A 2C1DA 2OZ1A 1QYZA 2B11B 2GIWA 3VNWA 4QAOA 1YTCA 1H9XA 1K3HA 1CYCA 4WQEA 1M70A 2ZZS1 3H1JD 1I8PA 1C75A 1L9BC 4K3IA 1CC5A 1CIEA 2N9JA 1KB9D 1CHIA 1WVEC 2Y0EA 1EZVD 1YNRA 1S5LV 2N18C 2C9XB 1DIIC 2N3YA 4WQ9A 1CTYA 4EDFA 1BCCD 4EICA 2I8FA 1CTJA 5CIGB 1CNOA 2BCNB 3H1LD 3ZCFA 1LS9A 2C1UA 3JBTB 2Q3EA 1QL3A 1SQXD 2C2CA 1CTZA 2KNCB 1I55A 2QJYB 5DFSA 4EIDA 3ZOYA 5DJQB 1AYGA 4PW9B 3VMAA 4H0KA 2L91A 1H31A 1KV9A 4Y5RA 3CXHW 1K3GA 2N9IA 1SQBD 1QL4A 2HV4A 2N18B 1S6VB 3FWLA 3KHUA 1FI3A 3PRJA 4FA5A 3O20A 1OAEA 1NMIA 3PLNA 2B12B 1CXAA 1KX2A 2CA3B 1GJQA 2B0ZB 5B5EV 3WUIA 2CXBA 2B4ZA 2A06D 5GTIV 2QG4A 2MHMA 3L4OA 3A0BV 4UB8V 1QKSA 2YK3A 3OCDB 3ZBMA 1BL9A 2MTAC 1N9CA 1H33A 3L74D 1M60A 1HJ3A 4DY9A 1H32A 3DR0A 1IRWA 1KYOW 1FHBA 3L70D 1I6EA 2DVHA 2KS1A 3WFBC 1A2SA 4WQDA 1GU2A 1CRHA 3CWBD 3HQ8A 3PXSA 2GC7D 4V2KA 3SJLA 1CSUA 3WC8A 3ITKA 1DW1A 2QJPB 1U74B 1LC2A 5B66V 1IZL0 1C2RA 3PXTA 3WFEC 2JWAA 3PXWA 1YICA 1ETPA 4P4QB 2C8SA 2Y0CA 1C52A 3L75D 1W2LA 2LITA 1FOCA 3WU2V 5KAFV 5GTHV 3A9FA 3TGUD 5KAIV 4FB1A 4O1WA 1NNOA 3MK7B 1YCCA 4RJTA 1NTZD 3L72D 2EXVA 3NBSA 3X39A 2PCBB 4AX3A 1IQCA 1H31B 2RN0A 2V08A 2C1VA 3SVWA 2BCCD 1HJ4A 3ZOXA 4N0KA 3OA8B 1L0ND 2JTIB 4GEDB 4J20A 3ZOOA 1DW0A 5KLIB 5TJHA 4AAOA 1A56A 2K9JB 1DW2A 4L1QA 1YIQA 1B7VA 1C7MA 4RSZA 1I6DA 3CU4A 1CRJA 3O0RC 3L73D 2CA4B 3VYMA 1DT1A 3NBTA 4FAVA 2GB8B 5DJQC 5AURA 4EIFA 1CRCA 3BCCD 2ZOOA 3RLMA 1H1OA 1R0QA 3OA8A 3PH2B 1CIFA 2ZBOA 4XXLA 2YCCA 1A8CA 1IO3A 1E2RA 1DVHA 1YEAA 1M6ZA 4LJIA 3H1KD 1I5TA 3O1YA 3CX5W 1FJ0A 1BGYD 3RN0A 3RN1A 2JQRA 1AKKA 1CO6A 4L3GA 1RZ5A 1WEJF 2BGVX 2FRCA 1FCDC 2CE1A 1P84D 3HQ6A 5E79V 1H32B 1QN2A 2CE0A 4U3FD 5KLVD 4WQCA 1U75B 4JCGA 4MU8A 3L4MA 5CIEB 1HH7A 1CCRA 3MK7C 4H0JA 4PJ0V 3NWVA 2RMZA 1CSVA 1KB0A 1GKSA 1L0LD 5TISV 5CIDB 3OCDA 2AXTV 2B10B 2VHDA 3ZIYA 1JDLA 1SQQD 1MG3D 4WQ8A 3RMZA 1CYJA 1FI7A 2OZ1B 3TF5A 1VYDA 3SWSA 1SQPD 1ZRTD 4UB6V 4AAMA 5C9MA 3DMIA 1CYIA 2IBZD 2DGEA 1EB7A 1CRIA 4XYDB 155CA 2ZXYA 4FA1A 1NU1D 1NTKD 3WFCC 1C6OA 2FYUD 5H2FV 1ZZHA 1CEDA 1NIRA 1SQVD 5CIBB 2BPBB 2N9YB 1CHHA 2V07A 3CYTI 3SXTA 1NTMD 3GG2A 2ORLA 1N15A 2AI5A 3M97X 1L9JC 1W5CT 2YQBA 1H33B 2GC4D 3KZIV 1HROA 1DVVA 1MG2D 3O5CA 1AOFA 1LMSA 451CA 4PWAA 3TYIA 4NFGB 2L4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA4 A;  5B6Q A;  1HZU A;  3CXH D;  1KYO D;  1E29 A;  3CX5 D;  4D6T D;  1CSX A;  2BLF B;  3CP5 A;  1LC1 A;  3TDK A;  1RAP A;  1C6S A;  5CIF B;  1FI9 A;  1CXC A;  4IL6 V;  3PTZ A;  3H1H D;  1COR A;  4WQB A;  5CIH B;  2LIR A;  4AAN A;  1HZV A;  1RAQ A;  1I54 A;  2N3B A;  3HQ7 A;  3GW6 A;  1CSW A;  4YE1 A;  1C2N A;  1KX7 A;  1F1C A;  2YIU B;  4FA9 A;  1CRY A;  1CCH A;  1N50 A;  2O3J A;  1YFC A;  1DIQ C;  1OCD A;  3A0H V;  1PPJ D;  4A7P A;  3L71 D;  1AOQ A;  3C2C A;  1NML A;  1CIG A;  2PCC B;  2BH5 X;  4L3H A;  2D0S A;  1YEB A;  4KMG A;  4FAN A;  5CIC B;  1HCM A;  1PP9 D;  4O1Q A;  5IY5 1;  4GYD A;  2BH4 X;  2C1D B;  1LFM A;  3SLE A;  3PHL A;  1RZ6 A;  4Q5P A;  1J3S A;  2AIU A;  4WQ7 A;  5KKZ B;  1COT A;  1CHJ A;  1H9Y A;  2XTS B;  4PD4 D;  2QJK B;  3ZOW A;  5DF5 A;  1I8O A;  2ZON G;  2Y0D A;  1F1F A;  1C6R A;  2PAC A;  1DW3 A;  1GIW A;  3HQ9 A;  5C0Z A;  1BE3 D;  4EIE A;  4AAL A;  2FWL A;  2FYN B;  3H1I D;  5EXQ A;  1GDV A;  4WQA A;  2D0W A;  1CIH A;  1GQ1 A;  351C A;  1MZ4 A;  1HRC A;  1HJ5 A;  1CRG A;  3ORV A;  1IRV A;  3WFD C;  1KIB A;  1E8E A;  5CYT R;  3VRD A;  1N90 A;  3DP5 A;  2C1D A;  2OZ1 A;  1QYZ A;  2B11 B;  2GIW A;  3VNW A;  4QAO A;  1YTC A;  1H9X A;  1K3H A;  1CYC A;  4WQE A;  1M70 A;  2ZZS 1;  3H1J D;  1I8P A;  1C75 A;  1L9B C;  4K3I A;  1CC5 A;  1CIE A;  2N9J A;  1KB9 D;  1CHI A;  1WVE C;  2Y0E A;  1EZV D;  1YNR A;  1S5L V;  2N18 C;  2C9X B;  1DII C;  2N3Y A;  4WQ9 A;  1CTY A;  4EDF A;  1BCC D;  4EIC A;  2I8F A;  1CTJ A;  5CIG B;  1CNO A;  2BCN B;  3H1L D;  3ZCF A;  1LS9 A;  2C1U A;  3JBT B;  2Q3E A;  1QL3 A;  1SQX D;  2C2C A;  1CTZ A;  2KNC B;  1I55 A;  2QJY B;  5DFS A;  4EID A;  3ZOY A;  5DJQ B;  1AYG A;  4PW9 B;  3VMA A;  4H0K A;  2L91 A;  1H31 A;  1KV9 A;  4Y5R A;  3CXH W;  1K3G A;  2N9I A;  1SQB D;  1QL4 A;  2HV4 A;  2N18 B;  1S6V B;  3FWL A;  3KHU A;  1FI3 A;  3PRJ A;  4FA5 A;  3O20 A;  1OAE A;  1NMI A;  3PLN A;  2B12 B;  1CXA A;  1KX2 A;  2CA3 B;  1GJQ A;  2B0Z B;  5B5E V;  3WUI A;  2CXB A;  2B4Z A;  2A06 D;  5GTI V;  2QG4 A;  2MHM A;  3L4O A;  3A0B V;  4UB8 V;  1QKS A;  2YK3 A;  3OCD B;  3ZBM A;  1BL9 A;  2MTA C;  1N9C A;  1H33 A;  3L74 D;  1M60 A;  1HJ3 A;  4DY9 A;  1H32 A;  3DR0 A;  1IRW A;  1KYO W;  1FHB A;  3L70 D;  1I6E A;  2DVH A;  2KS1 A;  3WFB C;  1A2S A;  4WQD A;  1GU2 A;  1CRH A;  3CWB D;  3HQ8 A;  3PXS A;  2GC7 D;  4V2K A;  3SJL A;  1CSU A;  3WC8 A;  3ITK A;  1DW1 A;  2QJP B;  1U74 B;  1LC2 A;  5B66 V;  1IZL 0;  1C2R A;  3PXT A;  3WFE C;  2JWA A;  3PXW A;  1YIC A;  1ETP A;  4P4Q B;  2C8S A;  2Y0C A;  1C52 A;  3L75 D;  1W2L A;  2LIT A;  1FOC A;  3WU2 V;  5KAF V;  5GTH V;  3A9F A;  3TGU D;  5KAI V;  4FB1 A;  4O1W A;  1NNO A;  3MK7 B;  1YCC A;  4RJT A;  1NTZ D;  3L72 D;  2EXV A;  3NBS A;  3X39 A;  2PCB B;  4AX3 A;  1IQC A;  1H31 B;  2RN0 A;  2V08 A;  2C1V A;  3SVW A;  2BCC D;  1HJ4 A;  3ZOX A;  4N0K A;  3OA8 B;  1L0N D;  2JTI B;  4GED B;  4J20 A;  3ZOO A;  1DW0 A;  5KLI B;  5TJH A;  4AAO A;  1A56 A;  2K9J B;  1DW2 A;  4L1Q A;  1YIQ A;  1B7V A;  1C7M A;  4RSZ A;  1I6D A;  3CU4 A;  1CRJ A;  3O0R C;  3L73 D;  2CA4 B;  3VYM A;  1DT1 A;  3NBT A;  4FAV A;  2GB8 B;  5DJQ C;  5AUR A;  4EIF A;  1CRC A;  3BCC D;  2ZOO A;  3RLM A;  1H1O A;  1R0Q A;  3OA8 A;  3PH2 B;  1CIF A;  2ZBO A;  4XXL A;  2YCC A;  1A8C A;  1IO3 A;  1E2R A;  1DVH A;  1YEA A;  1M6Z A;  4LJI A;  3H1K D;  1I5T A;  3O1Y A;  3CX5 W;  1FJ0 A;  1BGY D;  3RN0 A;  3RN1 A;  2JQR A;  1AKK A;  1CO6 A;  4L3G A;  1RZ5 A;  1WEJ F;  2BGV X;  2FRC A;  1FCD C;  2CE1 A;  1P84 D;  3HQ6 A;  5E79 V;  1H32 B;  1QN2 A;  2CE0 A;  4U3F D;  5KLV D;  4WQC A;  1U75 B;  4JCG A;  4MU8 A;  3L4M A;  5CIE B;  1HH7 A;  1CCR A;  3MK7 C;  4H0J A;  4PJ0 V;  3NWV A;  2RMZ A;  1CSV A;  1KB0 A;  1GKS A;  1L0L D;  5TIS V;  5CID B;  3OCD A;  2AXT V;  2B10 B;  2VHD A;  3ZIY A;  1JDL A;  1SQQ D;  1MG3 D;  4WQ8 A;  3RMZ A;  1CYJ A;  1FI7 A;  2OZ1 B;  3TF5 A;  1VYD A;  3SWS A;  1SQP D;  1ZRT D;  4UB6 V;  4AAM A;  5C9M A;  3DMI A;  1CYI A;  2IBZ D;  2DGE A;  1EB7 A;  1CRI A;  4XYD B;  155C A;  2ZXY A;  4FA1 A;  1NU1 D;  1NTK D;  3WFC C;  1C6O A;  2FYU D;  5H2F V;  1ZZH A;  1CED A;  1NIR A;  1SQV D;  5CIB B;  2BPB B;  2N9Y B;  1CHH A;  2V07 A;  3CYT I;  3SXT A;  1NTM D;  3GG2 A;  2ORL A;  1N15 A;  2AI5 A;  3M97 X;  1L9J C;  1W5C T;  2YQB A;  1H33 B;  2GC4 D;  3KZI V;  1HRO A;  1DVV A;  1MG2 D;  3O5C A;  1AOF A;  1LMS A;  451C A;  4PWA A;  3TYI A;  4NFG B;  2L4D A; 
#chains in the Genus database with same CATH topology
 1HZU A;  3CXH D;  2QE7 H;  2YKO A;  1E29 A;  5KAI H;  1SQB K;  1LWU B;  4D6T D;  3CP5 A;  2WVR A;  3KDP B;  4TLF A;  1S5L H;  2Q9I A;  1H89 A;  4I7Z C;  4IL6 V;  1LT9 B;  4PJ0 E;  1L0N E;  1COR A;  4WQB A;  1SQP E;  2KSJ A;  3M9B A;  1HZV A;  1RAQ A;  1SLQ A;  4NPF X;  1IFM A;  1M1J B;  1M1J C;  1URQ A;  5TIS E;  5AVQ B;  5E79 E;  1CSW A;  2YIU B;  1OVR A;  4WWI A;  5B5E E;  4PD4 H;  1NGM B;  1YFC A;  1URQ D;  1PPJ D;  1XTG B;  2H89 C;  1FJP A;  2BH5 X;  1L0L K;  1R5S A;  2D0S A;  4KMG A;  4FAN A;  1YQ4 C;  3H1J J;  2KS1 B;  4GYD A;  1Q81 Q;  1LFM A;  1SQQ K;  3KQG A;  2JEE A;  3AE3 C;  1X8Y A;  4WQ7 A;  5KKZ B;  1PL5 A;  1S4X A;  3A0B H;  1I8O A;  2Y0D A;  1F1F A;  1GU5 A;  1FZA A;  3CCU P;  1H0T A;  2PAC A;  4IFM A;  2W83 C;  1EDJ A;  1H0T B;  1SS1 A;  3W68 A;  1HF9 A;  1YIJ P;  3H1I D;  3V4Q A;  2N1T A;  2W8Z A;  1PP9 G;  1KN7 A;  4U3F G;  2WSF J;  3KZI E;  3U59 A;  3CC4 P;  1CIH A;  3L74 E;  2AEM A;  1MZ4 A;  2B89 A;  2XU6 A;  1DEB A;  1IRV A;  3WFD C;  2BAS A;  2KNC A;  5CYT R;  3CC7 P;  1SQB J;  3MHV A;  1RF0 C;  2WSC H;  3JC2 2;  4PD4 E;  2OZ1 A;  1QYZ A;  2GIW A;  5KLV G;  1H9X A;  1PGO A;  2KZJ A;  4NPD A;  4KJM A;  2A45 H;  4BRY B;  1DX7 A;  4DJG A;  4K3I A;  5APY A;  3SWK A;  2JWD A;  2HPC B;  2N9J A;  3L71 G;  1KB9 D;  1JY2 N;  1OWA A;  2QM7 A;  1NO4 A;  1CTY A;  1G2C B;  3VP8 A;  4LC1 A;  2NPS C;  4IOI H;  4EIC A;  4EIJ A;  2I8F A;  1OVV A;  2H7H A;  1JCD A;  2KIK A;  1PGJ A;  1LS9 A;  3JBT B;  1E79 H;  1GL2 D;  1X22 A;  2E42 A;  4HKZ H;  4EID A;  3SWF A;  1UII A;  3KYQ A;  3V2R A;  1YTZ I;  1CZQ A;  5AW6 B;  3BRT B;  1MKM A;  3I5C A;  4Y5R A;  4GOD A;  3MGN A;  1MUU A;  1QL4 A;  2N18 B;  4K35 A;  3FWL A;  2N1T B;  2G8Y A;  2R32 A;  1FDI A;  3TGU G;  4FA5 A;  1P84 H;  2B12 B;  1JB0 J;  1KX2 A;  3A5T A;  4JF7 A;  2IDB A;  2CA3 B;  3GHG C;  1FOS F;  1GJQ A;  1VQK P;  2HOD A;  1M56 D;  3AE5 C;  5GTI V;  1NTZ G;  3L4O A;  2MJZ A;  3A0B V;  2YK3 A;  3OCD B;  1L0L E;  2MTA C;  2LR2 A;  3RL0 g;  3L74 D;  2OTJ P;  2QVA A;  5KJ7 D;  4DY9 A;  3RK3 C;  3WU2 H;  1A2S A;  4JYB A;  5CCG A;  1GU2 A;  2HPC A;  1SQB G;  1CRH A;  3CWB D;  3HQ8 A;  1KIL B;  4V2K A;  1CSU A;  3WC8 A;  2AXT H;  1J1D B;  2R5B A;  2QJP B;  1LC2 A;  1EZV I;  2K9Y A;  3NMD A;  4L74 A;  1VQ5 P;  3H1L G;  4NPE A;  3PXW A;  1P84 I;  3L75 D;  2AEJ A;  1KMI Z;  5AVZ B;  3A9F A;  3L74 G;  2CPS A;  2LKM A;  3L75 J;  2M3E A;  1KIL D;  3D0W A;  3CCE P;  2Q7C A;  1SQP K;  2M8R A;  1KQG B;  5APV A;  1T3U A;  5APU A;  2FYU E;  3HD7 A;  1JTH A;  3X39 A;  1SQX K;  1IQC A;  1NTK G;  2D2C C;  1VQ6 P;  1KQL A;  1S3J A;  2B88 A;  3ZOX A;  3MIW A;  5BU8 B;  3OA8 B;  1S1C X;  1J1E B;  1L0N D;  2W27 A;  1DW0 A;  3HTK B;  2K9J B;  1AVO A;  5AW4 B;  1LTJ B;  1L0N J;  2OYI B;  2CA4 B;  3VYM A;  2NPS A;  1YJW P;  1DT1 A;  5AUR A;  2I8D A;  1VQ9 P;  3L75 E;  1GL2 A;  3E1R A;  4ZNC A;  2KP8 A;  1ZME C;  3Q3D A;  3AEB C;  1JY3 O;  3A3Y B;  1DVH A;  3O1Y A;  3GLM A;  3CX5 W;  3CCV P;  3D70 A;  2BCC E;  3A0H H;  2WSC J;  2HYN A;  2P58 A;  1P84 D;  3TK1 A;  3P8C E;  3V5B A;  3L35 A;  2FXO A;  4U3F D;  5KLV D;  4EI2 A;  2KB7 P;  2M3B A;  4M3L A;  1VQ8 P;  1HVV A;  4H0J A;  3LIE A;  4AYC A;  2E43 A;  1VQM P;  1IK9 A;  4D6T E;  2POH A;  1L0L D;  3CX5 E;  4BXL A;  2B10 B;  3E7K A;  1SQX G;  2H8P D;  1SQQ D;  4WQ8 A;  3RMZ A;  2WPV B;  1CYJ A;  2B87 A;  2QJP C;  3TF5 A;  1VYD A;  2E75 B;  5AVS B;  4IFD K;  3DMI A;  1NU1 J;  3LW5 H;  1A02 F;  5GTH H;  4LGD E;  3S1K A;  5KAF H;  1CRI A;  4EOT A;  1J2J B;  5KLI C;  4XYD B;  155C A;  1RF1 A;  2ZYD A;  2IFN A;  5H2F V;  1CED A;  3TNU A;  1SQV D;  1KQF B;  3SXT A;  1G1I A;  3G6E P;  2M5A A;  3P8M C;  3AE1 C;  1VQ4 P;  2NPS B;  1BGY J;  3GG2 A;  2OYI A;  1OMI A;  1Z56 A;  3RBX A;  1S5L E;  1X9V A;  1W5C T;  1H33 B;  2GC4 D;  5CCH D;  1FZG A;  1OIP A;  1MG2 D;  1LMS A;  2K1A A;  2AXT E;  4FA4 A;  5AVX B;  2IYO A;  3CX5 D;  5GTI H;  2AXC A;  3FWN A;  2WSF H;  4HH2 A;  2ZT9 C;  4XE5 B;  1BSN A;  3AEC C;  1EDL A;  2E5Y A;  3CX5 H;  5CCH C;  3SWY A;  1SQV K;  3PTZ A;  3OA7 A;  3GHG B;  4HJG H;  5AVV B;  3C8V A;  4GOE A;  1N7S D;  3H1H D;  5CIH B;  2LIR A;  4AAN A;  4Y28 J;  5KKZ C;  1I54 A;  1IC2 A;  1FS0 E;  4B86 A;  1VQL P;  3GW6 A;  1MZ9 A;  4FA9 A;  1CRY A;  2C0X A;  1N50 A;  2WPS A;  2O3J A;  2WSE H;  1JNM A;  1IFN A;  3A0H V;  1T2K D;  1QVF O;  1W2B O;  1AOQ A;  3C1L A;  4UB6 H;  1VQN P;  1AQ5 A;  1YEB A;  1LJ2 A;  1PP9 D;  3NFQ A;  1KTM A;  3AE6 C;  3SLE A;  3PHL A;  4Q5P A;  1SQP G;  2M0B A;  3HUS B;  1SFC C;  2XTS B;  3ZOW A;  3D71 A;  3U1A A;  1NTK K;  2O1J A;  1DW3 A;  3S4R A;  1BE3 D;  4OGQ D;  1FBM A;  2JP3 A;  4EIE A;  3BCC E;  1GL2 B;  4CPG A;  2E76 B;  3AEF C;  4WQA A;  2BEQ D;  2WSS H;  1GQ1 A;  351C A;  1LWU C;  2UWJ E;  1HRC A;  3EQ2 A;  2FBW C;  3C9I A;  2XZR A;  1HJ5 A;  3HD7 B;  3EWK A;  2RKL A;  5AW1 B;  3ORV A;  1FZF A;  3B5N B;  1SQV G;  1N90 A;  3B5N C;  5AVT B;  1LT9 C;  4ZKP A;  2WT7 B;  3VNW A;  1OW6 A;  2SPZ A;  4GDO A;  4W7Y A;  3BVH A;  3MTU E;  1CYC A;  1NAY A;  1EDI A;  5M1B A;  4MN4 C;  1AVY A;  1CC5 A;  2ZXE B;  1YIT P;  1CIE A;  1KIL E;  1CHI A;  1WVE C;  4H0L D;  3B5N D;  2Y0E A;  5KAF E;  3A2A A;  4LLH A;  5CJ0 A;  2N18 C;  1JMM A;  3CXH E;  3RBZ A;  4EDF A;  3VYI A;  1BCC D;  2A45 G;  5AVU B;  3GHG A;  2OGU A;  2YIU C;  1QL2 A;  5CIG B;  1NTM K;  3ZDM A;  1RH5 B;  1L4A A;  3H1L D;  1GMJ A;  1KFM A;  3USS A;  1QL3 A;  1PV3 A;  1SQX D;  2WZ7 A;  3G9R A;  3PH0 A;  2ZFC A;  4H0L C;  2KNC B;  1L0L G;  1SQX J;  3W67 A;  3AE4 C;  4W7Z A;  2H43 A;  4I2L C;  1H31 A;  1MFZ A;  1TU3 F;  2OYH C;  2XND H;  1AA0 A;  2HV4 A;  2PGD A;  1EC5 A;  3K5B A;  1FI3 A;  3O20 A;  1OAE A;  1Y47 A;  1CXA A;  2B0Z B;  3WUI A;  3GF3 A;  5AW7 B;  4H44 B;  1FJK A;  2A06 D;  2QG4 A;  1DIP A;  2MHM A;  3JCU E;  3CC2 P;  2XKM A;  3QH9 A;  2QSI A;  1BL9 A;  1M60 A;  1BDD A;  2WPR A;  5AW9 B;  2OQQ A;  1HJ3 A;  2V7Q J;  1QEX A;  3IAO A;  1L4A B;  3I56 P;  1K8A Q;  1IRW A;  1K9M Q;  3RL0 C;  2GUS A;  2YMY A;  2KS1 A;  3WFB C;  2E76 C;  4H44 D;  5CJ4 A;  2GC7 D;  3SJL A;  3VMX A;  3CWB J;  3TYY A;  1M8O B;  2WMM A;  2C9L Y;  1L0N G;  1OW8 A;  5CMZ A;  2JWA A;  1YIC A;  4OGQ B;  2OTK E;  3WU2 V;  1FOC A;  1Q86 Q;  5EFW B;  3H1K J;  4N78 D;  4ASW A;  4O1W A;  1MV8 A;  3MK7 B;  1BCC G;  4C7R A;  4U3F E;  3L72 D;  1K04 A;  1JM0 A;  2HLO A;  5TIS H;  1GD2 E;  5E79 H;  2PCB B;  2V08 A;  2C1V A;  4BWN A;  3SVW A;  1HJ4 A;  2ZYG A;  2C9N Y;  2IYP A;  3L74 J;  2Q3I A;  2JKV A;  3CX5 I;  3AEG C;  1S9K D;  4RES B;  1FE6 A;  1VQP P;  1DW2 A;  2Y9Z A;  2M5A B;  4GOF A;  1YIQ A;  1B7V A;  1Q82 Q;  2FFD B;  4RSZ A;  2HG5 D;  4GT1 A;  1S2E A;  1IFP A;  2YO3 A;  1FU1 A;  3E1I A;  5B66 H;  1G2C A;  2PAJ A;  1CRC A;  2XDJ A;  1W2E A;  3A0B E;  3HE5 B;  5AVW B;  1R0Q A;  3OA8 A;  2WQY C;  3PH2 B;  2BCC G;  1L2P A;  1CI6 B;  1A8C A;  1IO3 A;  1E2R A;  3HD7 D;  1YEA A;  3H1J E;  4JYC A;  1NTM J;  3VMY A;  3RN0 A;  1ZV8 A;  2NRG A;  3RN1 A;  3L72 G;  1KQS O;  2JQR A;  3KXD A;  3H1K E;  1CO6 A;  4L3G A;  1RZ5 A;  3VMZ A;  1WEJ F;  1FCD C;  3RK3 B;  3HQ6 A;  4JBZ A;  5CBN A;  3VOP A;  1H32 B;  2R3C A;  1QN2 A;  4I6M C;  1VL2 A;  2WTY A;  4PV1 D;  3L4M A;  1KYO E;  3HD7 C;  1HH7 A;  3SFD C;  3Q2Y A;  1CCR A;  2KYV A;  4PJ0 V;  2KLU A;  1AFO A;  1M1J A;  1URQ C;  3PP5 A;  3OW2 O;  2IFM A;  1VF5 D;  5TIS V;  5CID B;  1KIL A;  3OCD A;  2AXT V;  2P67 A;  3CXH I;  1RQV A;  1FDO A;  2VHD A;  3HE4 A;  1JDL A;  3G4S P;  1MG3 D;  1RY3 A;  2AEF A;  2OZ1 B;  3SWS A;  1IK7 A;  1JY3 N;  4UB8 H;  5KTB A;  4AAM A;  1LNQ A;  1CYI A;  3H1J G;  5C39 A;  2DGE A;  1T2K C;  3JCU H;  2IBZ G;  1YQ3 C;  1NU1 D;  1NTK D;  3CMA P;  2ZYA A;  1NIR A;  3G71 P;  5H2F E;  2BPB B;  2N9Y B;  1CHH A;  2V07 A;  1NTK J;  2FYN C;  4C7N B;  1J1E C;  3CI9 A;  4Y99 C;  4EYY Q;  3CCL P;  3M97 X;  1LTJ C;  1HRO A;  1DVV A;  1AJY A;  1WRG A;  3H1I G;  1N73 C;  2L4D A;  4WBA A;  5B6Q A;  2CPB A;  1KYO D;  2HR3 A;  4OH8 B;  1LTB C;  2PP6 A;  2OYH B;  1JTH B;  1C6S A;  2MKV A;  2IBZ I;  1K73 Q;  2YXR B;  1FZC C;  2Q5U A;  1NKN A;  1WMK A;  2E74 B;  1HGV A;  1FI9 A;  3MUD C;  3SSU A;  3RK2 D;  3AE8 C;  2ITA A;  2N3B A;  1SFC B;  5GTI E;  1BGY E;  3MUD A;  1KX7 A;  5APS A;  1OCD A;  1HH0 A;  1L0N K;  5BVZ A;  1NH4 A;  4N3Y B;  4WB4 A;  3QWO C;  2W6A A;  5CIC B;  5IY5 1;  1HJB A;  2KK7 A;  1BSH A;  1YYC A;  3M0D C;  1Q7Y Q;  1QGK B;  1RZ6 A;  2E5T A;  2A45 I;  2AIU A;  2ZAE B;  2HOD B;  2YMK A;  2E75 C;  2QJK B;  2R3S A;  1SQQ G;  3EFF K;  5AW5 B;  1C6R A;  4D6T J;  1N73 A;  3VP9 A;  1USD A;  2W6J H;  2N1T D;  1GIW A;  1CSB A;  3HQ9 A;  5AW8 B;  1EXI A;  3CCJ P;  1QL1 A;  1U7M A;  2P2U A;  3AE7 C;  1OZH A;  2JO1 A;  3CL3 D;  2YO2 A;  2OYO A;  4C46 A;  1ZOY C;  1CRG A;  3V6I A;  5KLV K;  1KOR A;  1FDM A;  2P10 A;  2N1T C;  1KIB A;  1E8E A;  2B87 B;  1KYO H;  3VRD A;  3G3Z A;  5K5G B;  1SVF A;  3DP5 A;  3FXE A;  4Y99 B;  2C1D A;  2FYU G;  2B11 B;  5APW A;  1YTC A;  1K3H A;  4RO0 A;  1USE A;  4WQE A;  1M70 A;  3H1J D;  2R44 A;  4GKG A;  1OFC X;  1ZN5 A;  1KZU B;  3BAS A;  1R8E A;  1L9B C;  2ZXX A;  1SFC A;  1D7M A;  3IFM A;  4JQ0 D;  5CHX A;  1PP9 E;  3N4X A;  2FXM A;  1JEK A;  3F5H A;  1DD4 A;  2C9X B;  1DII C;  3A0H E;  2VRS A;  3TGU E;  2K3R A;  2IPP A;  2WT7 A;  1JY2 P;  1QVG O;  3V2N A;  1KIL C;  1CTJ A;  4L73 A;  3CCQ P;  1N7L A;  4PV1 C;  2R5D A;  2C1U A;  2Q3E A;  1OVU A;  4H13 C;  2B9B A;  3I55 P;  2FYZ A;  1ZW0 A;  4WY4 D;  5DJQ B;  1AYG A;  4PW9 B;  3VMA A;  3CXH H;  1XTC C;  5APQ A;  1KV9 A;  3L70 G;  3O8Z A;  3MP7 B;  1K3G A;  1SQB D;  3KHU A;  1M57 D;  2V7Q H;  2G3A A;  1NMI A;  3H32 B;  2OAR A;  2WWW A;  1JMB A;  4HYT B;  4U7J A;  5B5E V;  1IFD A;  2JR8 A;  2P1J A;  2CXB A;  2B4Z A;  1DEE G;  5APX A;  4IFF A;  4R4M A;  3L73 G;  1JY3 P;  4DT0 A;  4UB8 V;  2JDI H;  2Z4E A;  1HTL C;  2L5G B;  3WUV A;  5BU5 A;  1OW7 A;  2FYU K;  4L75 A;  1N9C A;  1IFI A;  1H33 A;  1ZLL A;  1RE4 A;  1NTZ K;  3L70 J;  5KJ7 A;  4KHX A;  1SQV E;  1Q2N A;  1H32 A;  3DR0 A;  2IZ1 A;  1YJ9 P;  1KYO W;  1FHB A;  1NTK E;  2OYI C;  1HWT C;  1RE3 A;  1IZN B;  1M7L A;  1SP4 A;  4ASV A;  3II6 A;  3H1L J;  1LTA C;  2IBZ E;  3ITK A;  3WMM 0;  1IO4 A;  3BCC J;  3BAT A;  1U74 B;  3AEA C;  3PXT A;  1JY2 O;  3HE4 B;  3RK2 B;  3M9H A;  2QM8 A;  4P4Q B;  3HE5 A;  1VF5 B;  3VTP C;  5GTH E;  4H13 D;  1K05 A;  2A06 E;  2LIT A;  5KAF V;  4XFJ A;  1E5W A;  1BDC A;  3TGU D;  5KAI V;  1QLE D;  4FB1 A;  1A02 J;  3RGU A;  1CI6 A;  2FFD A;  1NTZ D;  1PZQ A;  2IZ0 A;  1JO5 A;  1IFJ A;  2EXV A;  1P84 E;  3AED C;  4AQR D;  3H6P A;  1LTG C;  1NTZ J;  2BCC J;  1CW5 A;  4KT0 J;  4AX3 A;  1KV4 A;  2RN0 A;  4YXD C;  1RE4 C;  4N0K A;  1UIX A;  1JOC A;  4H0L B;  1YBK A;  1IJD B;  1L0L J;  4J20 A;  1N2D C;  4PV1 B;  3R2P A;  4WY4 A;  2OYH A;  4H13 B;  3CU4 A;  3Q5P A;  1RHZ B;  1CRJ A;  3O0R C;  4D6T G;  3SFE C;  2NPS D;  3NBT A;  1NHL A;  4FAV A;  4ZKU A;  1PFI A;  5DJQ C;  4EIF A;  3RLM A;  1H1O A;  1KFN A;  2FYU J;  4AUW A;  2ZBO A;  4XXL A;  1URQ B;  2QJK C;  4PD4 I;  4IL6 X;  1M6Z A;  3H1K D;  1FJ0 A;  4XA4 A;  1BGY D;  4GIF A;  1VQ7 P;  1AKK A;  4UB6 E;  2O01 J;  1L4A C;  2FRC A;  3L72 J;  3S9O A;  1YJN P;  3D6Y A;  4OGQ C;  2WPQ A;  4I7Z B;  2CE0 A;  4RKU J;  4WQC A;  3M0A A;  4JCG A;  4MU8 A;  5CIE B;  3WUT A;  3M91 A;  3MK7 C;  3F89 A;  3BCC G;  3GMA A;  3WU2 E;  1GKS A;  1FAV A;  2ZVO B;  3IN6 A;  3OAK A;  5AVR B;  2ZJS E;  2K88 A;  5AW3 B;  1H8A A;  5L8R J;  3H1H J;  3NXS A;  4UB6 V;  5C9M A;  3L37 A;  3EFG A;  1YI2 P;  1EB7 A;  3CLQ A;  4WY4 B;  1X79 B;  2ZXY A;  3LID A;  1R5L A;  3CYT I;  1HUC A;  1KB9 H;  3M06 A;  2K9J A;  2LXC B;  1LTJ A;  1PPJ G;  3L70 E;  3RK3 E;  2ORL A;  3B5N A;  1RF0 A;  4QMA A;  2RH0 A;  1OXZ A;  2YQB A;  3MZW B;  3KZI V;  3O5C A;  1AOF A;  451C A;  3H1L E;  4NFG B;  3PJS K;  3M0D A;  2Z5I A;  1EZV G;  2YXQ B;  4U3F J;  1KC8 Q;  2XV5 A;  2GM4 A;  1L4A D;  1T6A A;  3VN0 A;  3H1H E;  1CSX A;  2BLF B;  1DH3 A;  3RL0 B;  5AW2 B;  1LC1 A;  3TDK A;  1RAP A;  1BE3 J;  1VDF A;  1NU1 E;  5CBO A;  2QEX P;  5CIF B;  4YTP C;  3T97 B;  2D2C D;  1CXC A;  4WVZ A;  3OJA B;  3FX0 A;  3HQ7 A;  1FC2 C;  4YE1 A;  1C2N A;  3A7O A;  1F1C A;  2LXB A;  3L71 J;  1CCH A;  2O01 N;  1DIQ C;  4N6J A;  1SQV J;  4A7P A;  3L71 D;  1N7S B;  2BEZ F;  3C2C A;  3L73 E;  1NML A;  1CIG A;  2PCC B;  1EXJ A;  1KB9 E;  3AEE C;  4L3H A;  1HCM A;  1NU1 G;  4O1Q A;  1SQB E;  2BH4 X;  2C1D B;  2J59 M;  1LT1 A;  5AVY B;  1LWU A;  3R4Y A;  1J3S A;  3JSV C;  1COT A;  1BE3 E;  1CHJ A;  2K37 A;  1M90 Q;  2P7J A;  1H9Y A;  3FGA D;  4PD4 D;  5DF5 A;  2ZON G;  1BGY G;  3B71 A;  1Y9B A;  2Q1K A;  1BCC J;  1GK6 A;  1SQQ E;  5C0Z A;  3H1I J;  2PRR A;  5APT A;  2FFD C;  2ZT9 B;  3V2P A;  3O6Q A;  4AAL A;  1N8R Q;  2FWL A;  2FYN B;  5EXQ A;  1GU4 A;  1GDV A;  3NTN A;  3GF7 A;  1QX8 A;  2O1K A;  4WY4 C;  1NTZ E;  2D0W A;  3H25 A;  3CCR P;  2QIW A;  1NOH A;  4C7N A;  1FZC B;  1NAF A;  1GW3 A;  2E74 C;  4K3A A;  3RL0 D;  2ZT9 D;  1HBW A;  4QAO A;  1J1D C;  4H44 C;  1S9K E;  4JPZ B;  4O9B A;  5B66 E;  2ZVN B;  2IX7 C;  2ZZS 1;  1I8P A;  3L36 A;  1C75 A;  1AQT A;  3IF4 A;  2KUB A;  1OX3 A;  1LGH B;  3WUU A;  3N7N A;  3CWB G;  4IL6 E;  1EZV D;  1U7J A;  1YNR A;  1S5L V;  2WSE J;  5CCH A;  1NU1 K;  4WQ9 A;  2N3Y A;  2XNX A;  3M9Q A;  1FZB A;  1M1K Q;  1H88 A;  4DCK A;  1KD1 Q;  5DJT B;  1CNO A;  2BCN B;  3H32 A;  3ZCF A;  1RQU A;  2KLV A;  3AE9 C;  1LTT C;  2JJL A;  2C2C A;  1CTZ A;  1GL2 C;  1KYO I;  1LP1 B;  1W5C E;  1I55 A;  2GA1 A;  2QJY B;  5DFS A;  1NTM G;  2J5U A;  3ZOY A;  4H0K A;  1N7S C;  2L91 A;  3B8E B;  3H1K G;  3CWB E;  3CXH W;  2Z5H A;  2N9I A;  2D2C B;  1S6V B;  3PRJ A;  4HB1 A;  3HTK A;  4W80 A;  3PLN A;  4DOJ A;  1LTI C;  1RF1 C;  3B4S A;  3FXD A;  1YTZ T;  1N73 B;  3KPE A;  1QKS A;  1NVO A;  1YHQ P;  3ZBM A;  3AE2 C;  1VF5 C;  1NYH A;  1EZV E;  4DZO A;  4IL6 H;  1GK4 A;  3P8C D;  2PFX A;  3L70 D;  3RK3 D;  1I6E A;  2DVH A;  4WQD A;  2V4H A;  3PXS A;  1ZRT E;  4Z1M H;  3Q5S A;  2KXP B;  1SFC D;  3HUS A;  1DW1 A;  4YXW H;  1HGZ A;  4OVN F;  1PGQ A;  5B66 V;  2A06 G;  1IZL 0;  1C2R A;  3WFE C;  3Q1M A;  2QRX A;  1WT6 A;  1ETP A;  2C8S A;  3MD0 A;  1PIX A;  2Y0C A;  1C52 A;  4TT3 H;  2YKQ A;  1W2L A;  4BRY A;  5GTH V;  1DD3 A;  1LTS C;  2CK3 H;  1BCC E;  1N86 A;  1T3J A;  4YPC A;  1NNO A;  5H2F H;  3H1I E;  1YCC A;  1G1J A;  4RJT A;  3CME P;  4PJ0 H;  2DW3 A;  2GUV A;  3NBS A;  4L76 A;  1H31 B;  1JUN A;  2BCC D;  1VPC A;  2NZ2 A;  2W6B A;  1VQO P;  3HUS C;  3Q5R A;  3L4F A;  3V4W A;  3O6Q B;  2JTI B;  4GED B;  3ZOO A;  4ZMD A;  5KLI B;  1EQ7 A;  4AAO A;  5TJH A;  5CCG C;  1A56 A;  3L72 E;  2O01 H;  3L73 J;  4L1Q A;  2J58 A;  3CCS P;  1C7M A;  1LP1 A;  2Y9Y A;  1I6D A;  2C0W A;  4UB8 E;  2N9B A;  3L73 D;  2FXP A;  2H88 C;  2GB8 B;  3L71 E;  2FY8 A;  3BCC D;  2ZOO A;  2QA4 P;  4R4L A;  3V2Q A;  4I1L A;  1CIF A;  2HFE D;  5CCG D;  2YCC A;  2I1K A;  1GZL A;  1FZE A;  3TGU J;  3TNU B;  4LJI A;  1I5T A;  2E75 D;  4OWF A;  1MFT A;  1RF1 B;  3TSI A;  1S5L X;  3P32 A;  2E76 D;  2KOG A;  2BGV X;  1LT9 A;  3RK2 C;  2CE1 A;  5KLV J;  1N7S A;  2W90 A;  5E79 V;  2E74 D;  2YKP A;  2KI7 B;  3P7K A;  2KSE A;  1U75 B;  5KAI E;  3CD6 P;  3UIA A;  2WIT A;  3NWV A;  1PGP A;  2RMZ A;  1CSV A;  1KB0 A;  5DJU B;  2FKW B;  1SQQ J;  3HRN A;  2YNY A;  1JCC A;  1NJI Q;  1ZR4 A;  3ZIY A;  1SQP J;  3CPW O;  3U1C A;  1FI7 A;  1NTM E;  1FZC A;  3BRV B;  1ZP0 C;  1SQP D;  1ZRT D;  3IR9 A;  1EDK A;  1ZR2 A;  1U57 A;  1Y8A A;  2IBZ D;  3T97 A;  5B5E H;  1BE3 G;  1GTW A;  3KZI H;  5KLV E;  3H1H G;  1KB9 I;  4FA1 A;  3WFC C;  1C6O A;  2FYU D;  1ZZH A;  1NKZ B;  3D6Z A;  5CIB B;  5AW0 B;  2OTL P;  2Q6Q A;  3ABV C;  3CCM P;  1AV1 A;  1NTM D;  1X0T A;  1S72 P;  1GDT A;  1RE3 C;  1FOS E;  1N15 A;  1PP9 J;  2AI5 A;  1GW4 A;  4N78 E;  1ZXG A;  1SQX E;  2KZI A;  1Q90 D;  5KJ7 C;  1PPJ E;  1L9J C;  3LW5 J;  2I1J A;  1NWQ A;  1HJ0 A;  4PWA A;  3TYI A;  1T8Z A;  3L75 G;  2QJY C; 
#chains in the Genus database with same CATH homology
 4FA4 A;  5B6Q A;  1HZU A;  3CXH D;  1KYO D;  1E29 A;  3CX5 D;  4D6T D;  1CSX A;  2BLF B;  3CP5 A;  1LC1 A;  3TDK A;  1RAP A;  1C6S A;  5CIF B;  1FI9 A;  1CXC A;  4IL6 V;  3PTZ A;  3H1H D;  1COR A;  4WQB A;  5CIH B;  2LIR A;  4AAN A;  1HZV A;  1RAQ A;  1I54 A;  2N3B A;  3HQ7 A;  3GW6 A;  1CSW A;  4YE1 A;  1C2N A;  1KX7 A;  1F1C A;  2YIU B;  4FA9 A;  1CRY A;  1CCH A;  1N50 A;  2O3J A;  1YFC A;  1DIQ C;  1OCD A;  3A0H V;  1PPJ D;  4A7P A;  3L71 D;  1AOQ A;  3C2C A;  1NML A;  1CIG A;  2PCC B;  2BH5 X;  4L3H A;  2D0S A;  1YEB A;  4KMG A;  4FAN A;  5CIC B;  1HCM A;  1PP9 D;  4O1Q A;  5IY5 1;  4GYD A;  2BH4 X;  2C1D B;  1LFM A;  3SLE A;  3PHL A;  1RZ6 A;  4Q5P A;  1J3S A;  2AIU A;  4WQ7 A;  5KKZ B;  1COT A;  1CHJ A;  1H9Y A;  2XTS B;  4PD4 D;  2QJK B;  3ZOW A;  5DF5 A;  1I8O A;  2ZON G;  2Y0D A;  1F1F A;  1C6R A;  2PAC A;  1DW3 A;  1GIW A;  3HQ9 A;  5C0Z A;  1BE3 D;  4EIE A;  4AAL A;  2FWL A;  2FYN B;  3H1I D;  5EXQ A;  1GDV A;  4WQA A;  2D0W A;  1CIH A;  1GQ1 A;  351C A;  1MZ4 A;  1HRC A;  1HJ5 A;  1CRG A;  3ORV A;  1IRV A;  3WFD C;  1KIB A;  1E8E A;  5CYT R;  3VRD A;  1N90 A;  3DP5 A;  2C1D A;  2OZ1 A;  1QYZ A;  2B11 B;  2GIW A;  3VNW A;  4QAO A;  1YTC A;  1H9X A;  1K3H A;  1CYC A;  4WQE A;  1M70 A;  2ZZS 1;  3H1J D;  1I8P A;  1C75 A;  1L9B C;  4K3I A;  1CC5 A;  1CIE A;  2N9J A;  1KB9 D;  1CHI A;  1WVE C;  2Y0E A;  1EZV D;  1YNR A;  1S5L V;  2N18 C;  2C9X B;  1DII C;  2N3Y A;  4WQ9 A;  1CTY A;  4EDF A;  1BCC D;  4EIC A;  2I8F A;  1CTJ A;  5CIG B;  1CNO A;  2BCN B;  3H1L D;  3ZCF A;  1LS9 A;  2C1U A;  3JBT B;  2Q3E A;  1QL3 A;  1SQX D;  2C2C A;  1CTZ A;  2KNC B;  1I55 A;  2QJY B;  5DFS A;  4EID A;  3ZOY A;  5DJQ B;  1AYG A;  4PW9 B;  3VMA A;  4H0K A;  2L91 A;  1H31 A;  1KV9 A;  4Y5R A;  3CXH W;  1K3G A;  2N9I A;  1SQB D;  1QL4 A;  2HV4 A;  2N18 B;  1S6V B;  3FWL A;  3KHU A;  1FI3 A;  3PRJ A;  4FA5 A;  3O20 A;  1OAE A;  1NMI A;  3PLN A;  2B12 B;  1CXA A;  1KX2 A;  2CA3 B;  1GJQ A;  2B0Z B;  5B5E V;  3WUI A;  2CXB A;  2B4Z A;  2A06 D;  5GTI V;  2QG4 A;  2MHM A;  3L4O A;  3A0B V;  4UB8 V;  1QKS A;  2YK3 A;  3OCD B;  3ZBM A;  1BL9 A;  2MTA C;  1N9C A;  1H33 A;  3L74 D;  1M60 A;  1HJ3 A;  4DY9 A;  1H32 A;  3DR0 A;  1IRW A;  1KYO W;  1FHB A;  3L70 D;  1I6E A;  2DVH A;  2KS1 A;  3WFB C;  1A2S A;  4WQD A;  1GU2 A;  1CRH A;  3CWB D;  3HQ8 A;  3PXS A;  2GC7 D;  4V2K A;  3SJL A;  1CSU A;  3WC8 A;  3ITK A;  1DW1 A;  2QJP B;  1U74 B;  1LC2 A;  5B66 V;  1IZL 0;  1C2R A;  3PXT A;  3WFE C;  2JWA A;  3PXW A;  1YIC A;  1ETP A;  4P4Q B;  2C8S A;  2Y0C A;  1C52 A;  3L75 D;  1W2L A;  2LIT A;  1FOC A;  3WU2 V;  5KAF V;  5GTH V;  3A9F A;  3TGU D;  5KAI V;  4FB1 A;  4O1W A;  1NNO A;  3MK7 B;  1YCC A;  4RJT A;  1NTZ D;  3L72 D;  2EXV A;  3NBS A;  3X39 A;  2PCB B;  4AX3 A;  1IQC A;  1H31 B;  2RN0 A;  2V08 A;  2C1V A;  3SVW A;  2BCC D;  1HJ4 A;  3ZOX A;  4N0K A;  3OA8 B;  1L0N D;  2JTI B;  4GED B;  4J20 A;  3ZOO A;  1DW0 A;  5KLI B;  5TJH A;  4AAO A;  1A56 A;  2K9J B;  1DW2 A;  4L1Q A;  1YIQ A;  1B7V A;  1C7M A;  4RSZ A;  1I6D A;  3CU4 A;  1CRJ A;  3O0R C;  3L73 D;  2CA4 B;  3VYM A;  1DT1 A;  3NBT A;  4FAV A;  2GB8 B;  5DJQ C;  5AUR A;  4EIF A;  1CRC A;  3BCC D;  2ZOO A;  3RLM A;  1H1O A;  1R0Q A;  3OA8 A;  3PH2 B;  1CIF A;  2ZBO A;  4XXL A;  2YCC A;  1A8C A;  1IO3 A;  1E2R A;  1DVH A;  1YEA A;  1M6Z A;  4LJI A;  3H1K D;  1I5T A;  3O1Y A;  3CX5 W;  1FJ0 A;  1BGY D;  3RN0 A;  3RN1 A;  2JQR A;  1AKK A;  1CO6 A;  4L3G A;  1RZ5 A;  1WEJ F;  2BGV X;  2FRC A;  1FCD C;  2CE1 A;  1P84 D;  3HQ6 A;  5E79 V;  1H32 B;  1QN2 A;  2CE0 A;  4U3F D;  5KLV D;  4WQC A;  1U75 B;  4JCG A;  4MU8 A;  3L4M A;  5CIE B;  1HH7 A;  1CCR A;  3MK7 C;  4H0J A;  4PJ0 V;  3NWV A;  2RMZ A;  1CSV A;  1KB0 A;  1GKS A;  1L0L D;  5TIS V;  5CID B;  3OCD A;  2AXT V;  2B10 B;  2VHD A;  3ZIY A;  1JDL A;  1SQQ D;  1MG3 D;  4WQ8 A;  3RMZ A;  1CYJ A;  1FI7 A;  2OZ1 B;  3TF5 A;  1VYD A;  3SWS A;  1SQP D;  1ZRT D;  4UB6 V;  4AAM A;  5C9M A;  3DMI A;  1CYI A;  2IBZ D;  2DGE A;  1EB7 A;  1CRI A;  4XYD B;  155C A;  2ZXY A;  4FA1 A;  1NU1 D;  1NTK D;  3WFC C;  1C6O A;  2FYU D;  5H2F V;  1ZZH A;  1CED A;  1NIR A;  1SQV D;  5CIB B;  2BPB B;  2N9Y B;  1CHH A;  2V07 A;  3CYT I;  3SXT A;  1NTM D;  3GG2 A;  2ORL A;  1N15 A;  2AI5 A;  3M97 X;  1L9J C;  1W5C T;  2YQB A;  1H33 B;  2GC4 D;  3KZI V;  1HRO A;  1DVV A;  1MG2 D;  3O5C A;  1AOF A;  1LMS A;  451C A;  4PWA A;  3TYI A;  4NFG B;  2L4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...