2QJYB

Crystal structure of rhodobacter sphaeroides double mutant with stigmatellin and uq2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed Structures of the Cytochrome bc1 from the Photosynthetic Bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 67
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjyB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjyB02
2MHMA 5TISV 1ETPA 1DW2A 2BH4X 1EZVD 1U75B 1C2NA 2Y0CA 1DVHA 1B7VA 2QJKB 3TDKA 3RN1A 1A8CA 2ZZS1 4UB8V 4PW9B 1W2LA 1DIIC 2BCNB 2I8FA 1SQBD 5KLIB 2O3JA 3O20A 5B66V 2QJYB 4EIEA 3PHLA 2PCBB 4FB1A 1H32B 1L0LD 4EICA 1E2RA 1E29A 4H0KA 2YK3A 1M60A 3L70D 3WU2V 2C2CA 1QL3A 4PJ0V 1NTKD 1YFCA 2XTSB 4AANA 1FI7A 3SLEA 3ZOOA 2JQRA 1GDVA 4Q5PA 4EIDA 1WEJF 2C1VA 1IRVA 2C9XB 5EXQA 1BE3D 1LFMA 3CP5A 3L74D 2PACA 3SVWA 1E8EA 4O1QA 3SJLA 1EB7A 1I8OA 1K3HA 1AYGA 2BLFB 1YEBA 4V2KA 4J20A 2AI5A 4WQEA 1YTCA 4WQ7A 2AXTV 2YCCA 4YE1A 3WFDC 2CA4B 1H31A 2HV4A 3L71D 1QN2A 4L3HA 5CIEB 1LS9A 2FYUD 3L4MA 3H1LD 4WQBA 2N9YB 3OA8B 5DF5A 2GIWA 3SXTA 1C75A 2FRCA 3NBSA 2JWAA 1KX2A 4RSZA 3TGUD 4FA4A 1CYCA 3ORVA 2Q3EA 3CX5W 3HQ9A 1SQXD 1KV9A 2N9IA 2LIRA 4Y5RA 2L4DA 1KB9D 3KZIV 1ZRTD 2ZXYA 3H1HD 1CTZA 5GTHV 1I8PA 2ORLA 5CIBB 2KS1A 2CE1A 3PTZA 4FA9A 1ZZHA 2MTAC 1CRHA 1CRYA 2DVHA 1CSUA 1F1CA 1KIBA 1GQ1A 1HROA 1N50A 1CRGA 4AALA 1R0QA 3WFBC 4WQDA 5DJQB 1HJ5A 1NMIA 4K3IA 5B6QA 1H33A 2D0WA 5CIDB 3RMZA 4EIFA 3OCDB 5KLVD 1H9XA 4NFGB 1A56A 1HCMA 3O0RC 1IO3A 2QJPB 4IL6V 2FWLA 4FAVA 1KX7A 1FCDC 3ZOXA 1OAEA 5CYTR 1N90A 2RMZA 3FWLA 3PLNA 5CIHB 3OCDA 2KNCB 1C6RA 1F1FA 1NU1D 1C52A 3RN0A 1CSXA 1P84D 1FOCA 3DP5A 3M97X 2B0ZB 2CA3B 3HQ8A 4XXLA 3O5CA 1CEDA 1CHHA 1LMSA 1NTMD 3L4OA 4WQ8A 4H0JA 4AX3A 1H1OA 1L0ND 1FI3A 1HJ3A 4D6TD 3WFCC 3NWVA 1DW0A 3JBTB 1HJ4A 3VYMA 3HQ7A 3L75D 1YCCA 4P4QB 1M70A 2C8SA 4FANA 1H31B 1SQQD 1GKSA 3GG2A 2B12B 1GJQA 2EXVA 4GEDB 4WQCA 3ITKA 1DW1A 1CO6A 2BGVX 3H1JD 1RAPA 1A2SA 1HZVA 5C9MA 2JTIB 3PXSA 1NTZD 1I6DA 1S5LV 2QG4A 2N18B 1DW3A 1K3GA 1KYOW 1GU2A 451CA 1NNOA 3BCCD 1CSVA 3ZBMA 1VYDA 3WC8A 2L91A 4WQ9A 2RN0A 1MG3D 2B11B 3VRDA 3A0BV 1DVVA 1CCRA 1KYOD 1N9CA 1W5CT 4FA1A 1M6ZA 3MK7B 1CC5A 3O1YA 4L1QA 1JDLA 3CXHW 3NBTA 5C0ZA 1AKKA 2IBZD 3DR0A 3L73D 1CSWA 2V07A 1H33B 1CCHA 4QAOA 2OZ1A 4AAMA 1H9YA 3CX5D 5KAFV 1FI9A 3TF5A 4DY9A 1BCCD 2D0SA 4GYDA 1LC2A 1CRIA 1N15A 3PXWA 2CXBA 2ZONG 4MU8A 1DIQC 2Y0EA 155CA 1J3SA 1CTJA 3H1ID 3VNWA 1C2RA 1CRJA 2BH5X 5KAIV 3CU4A 1AOQA 5GTIV 1CHIA 1FJ0A 5H2FV 1AOFA 1MG2D 3ZCFA 2C1UA 2C1DB 1COTA 1QL4A 3H1KD 3ZOWA 3X39A 5TJHA 2FYNB 3VMAA 351CA 1WVEC 1QYZA 1BGYD 3PRJA 5DJQC 1CIFA 2BPBB 2ZBOA 4U3FD 4XYDB 1CXAA 5B5EV 1YEAA 1C6OA 2C1DA 1PP9D 1CNOA 1U74B 1YIQA 2B10B 3A9FA 1CTYA 3SWSA 4PD4D 4EDFA 1CXCA 1S6VB 1OCDA 1HZUA 1RAQA 1RZ6A 4FA5A 1I54A 1NMLA 4LJIA 2AIUA 3ZOYA 3CYTI 1YNRA 1PPJD 2YIUB 3GW6A 1IZL0 2GC7D 4O1WA 3PXTA 1H32A 1L9BC 1NIRA 3TYIA 3DMIA 3HQ6A 2BCCD 1C6SA 3WUIA 1C7MA 1CORA 1LC1A 2K9JB 1KB0A 1SQPD 5CIGB 4WQAA 2LITA 3C2CA 4AAOA 5AURA 2B4ZA 2Y0DA 3ZIYA 2GC4D 5DFSA 1CYIA 2OZ1B 3KHUA 1BL9A 1CIHA 2YQBA 4RJTA 2VHDA 1DT1A 5CIFB 4L3GA 4UB6V 1CIEA 2V08A 5KKZB 1YICA 2A06D 1CHJA 1FHBA 4A7PA 2CE0A 1CIGA 3CWBD 2N18C 1I55A 2N9JA 1CYJA 2PCCB 1RZ5A 1CRCA 4PWAA 3WFEC 1GIWA 3CXHD 2ZOOA 2DGEA 2GB8B 1L9JC 3PH2B 5E79V 1IRWA 4KMGA 1MZ4A 1SQVD 4JCGA 1QKSA 1HH7A 5IY51 1IQCA 1HRCA 3MK7C 3OA8A 5CICB 3RLMA 1I6EA 1I5TA 2N3YA 4N0KA 3L72D 2N3BA 3A0HV
chains in the Genus database with same CATH superfamily
1N7SC 1ETPA 3P8MC 4ZKUA 1T8ZA 1C2NA 2RKLA 3E1IA 1LT9A 2ZAEB 1GDTA 2QJKB 1URQA 3TGUG 2BASA 5CJ4A 3V4WA 4EI2A 1VQKP 1DIIC 1NKZB 1E5WA 3TNUA 1GK4A 2KZJA 5BU8B 2XV5A 1VQ7P 4DT0A 3CX5H 5B66V 1ZR2A 3VMYA 3L72G 4FB1A 1QGKB 2E75B 4EICA 3P8CD 4WY4C 3MTUE 3GF3A 2YMKA 4H44C 3BRVB 2AEMA 1M60A 2QRXA 1GL2A 2POHA 4KT0J 2UWJE 1LWUB 1AV1A 1BGYJ 2E42A 2K1AA 2OTKE 2XTSB 1KFMA 1MUUA 2E74D 1GDVA 2YKPA 1IRVA 1BE3D 4W7ZA 2PACA 3SVWA 1I8OA 1FZCC 1YJ9P 3P7KA 3M0AA 3SWKA 4EOTA 4LLHA 2M0BA 3CXHE 3HUSA 4WQEA 3CCSP 1NTMG 2HV4A 3L71D 4YPCA 1QN2A 2OARA 1DX7A 4Z1MH 4GIFA 2CPSA 3W68A 3SXTA 1C75A 1VQ9P 4QMAA 2BCCJ 3I56P 2SPZA 4RSZA 1CYCA 2P58A 1LTIC 1LTJA 2B87A 1KV9A 1VDFA 2NPSC 1KB9D 1LT9B 1ZRTD 1URQB 2ORLA 1AVYA 3H1KE 1U7JA 2MTAC 1N73B 1CRHA 2WT7A 3TNUB 5APUA 1F1CA 1GQ1A 1HROA 3WFBC 1PP9E 2M8RA 1VQ8P 3CWBJ 4EYYQ 3FXDA 4K3IA 1N7SA 1IZNB 1KYOH 4UB8H 1Q7YQ 3MIWA 5B6QA 1EQ7A 2M3BA 4EIFA 1SQXG 2XNXA 4IFFA 1H9XA 1SQVJ 3L73G 2QJPB 1FCDC 3ZOXA 2Z5IA 3B5NB 3FWLA 1BCCG 3RBZA 1R5LA 2ZYGA 2A45I 3HD7D 5AVTB 2E74C 1GU5A 3AE6C 1NU1D 2M5AA 1Q2NA 2HPCA 3M97X 3HQ8A 4WY4A 4XXLA 3O5CA 4PJ0H 1CHHA 1SQPE 3L4OA 2IDBA 1L0ND 1FI3A 1HJ3A 4D6TD 3AE9C 1EXIA 5CCHD 3VYMA 2E76B 2FYZA 2B12B 1HJBA 1AQTA 1FZAA 2YO2A 1J1DC 2QIWA 1JB0J 2Q3IA 3H1LE 4U3FG 3H1JD 4C7NA 1QVFO 1HZVA 4UB6H 1A02F 1K3GA 1LTJB 1FZCA 4PD4H 3BCCD 1EDJA 4WQ9A 3AE5C 5AW0B 2E75D 3B8EB 3A0BV 2N1TC 3RL0g 1DVVA 1CCRA 2LKMA 4FA1A 3MK7B 2QVAA 2K88A 3NBTA 5C0ZA 1BE3J 1ZLLA 3H32B 1CSWA 1E79H 1CW5A 3Q5PA 1XTGB 1HTLC 2R3CA 2OZ1A 4AAMA 1FU1A 2NPSA 4GODA 1FI9A 2ZVNB 3L71J 3PXWA 1SQBE 1AFOA 2CXBA 2AXTE 3AE1C 1G2CB 2Y0EA 1J3SA 3VNWA 1CRJA 2BH5X 5KAIV 5H2FV 3A0BE 2YXQB 3ZCFA 1GTWA 5B66H 4BWNA 4WY4B 1JY3N 2MKVA 1K04A 1QL1A 3X39A 4NPFX 3PRJA 4JF7A 5DJQC 2ZBOA 1QVGO 1CXAA 2QJKC 5B5EV 1NTKE 2C1DA 1FBMA 2O01J 1CNOA 2B10B 3A9FA 1SQQE 5CBNA 2NRGA 1URQD 1T6AA 1M1JC 3L74E 1EZVG 1HF9A 5CHXA 1HZUA 3VYIA 4RO0A 1NTZE 1RZ6A 2IX7C 2IYOA 2O01H 4XE5B 5H2FE 1PIXA 1FZCB 2OTLP 4IL6E 1OVUA 2WQYC 1IZL0 2I1JA 2GC7D 2FYUE 1S5LH 1H32A 1NU1J 1PP9G 4GOFA 1Q90D 2E5YA 1C7MA 3CCEP 1CORA 2B9BA 3B5ND 4N78D 3D0WA 3C1LA 1L0NJ 1L0LG 2YXRB 2XDJA 4D6TJ 3AE7C 2OZ1B 2FXMA 2NPSB 1BL9A 3L70G 3CX5E 2YQBA 4RJTA 1DT1A 4DOJA 3Q2YA 1CIEA 2N1TA 3H1JJ 1U57A 2CE0A 3EFFK 2QM7A 1I55A 2N9JA 1LT1A 1KZUB 1PGQA 3WFEC 1GIWA 2GB8B 1L9JC 5KLVE 3CMAP 3UIAA 3BCCJ 3FXEA 3S9OA 4B86A 5AVXB 5GTIH 3V4QA 5CICB 1NU1K 2P67A 2IPPA 3T97B 3L72D 3M9QA 3CCLP 1DW2A 2H8PD 1FJPA 3H1LG 1HGVA 2HR3A 1FDMA 1N73C 2L5GB 4L74A 1NTME 3L35A 2ZZS1 4UB8V 3E1RA 2Y9YA 2PAJA 1W2LA 1ZP0C 1ZR4A 3TK1A 3FGAD 2I8FA 2IYPA 5KLIB 1YTZI 3VMZA 2O3JA 2KLVA 3D70A 2QJYB 4JBZA 1PPJE 1NWQA 4EIEA 3PHLA 1Q81Q 1LTAC 2QJPC 1H32B 4ZKPA 3O8ZA 4OWFA 3B5NC 3GMAA 1SQPK 3CPWO 1JY3O 1M1JA 5AW2B 1YITP 4JQ0D 4Y28J 2YO3A 4PV1B 3VN0A 4W80A 3AECC 4YTPC 2ZYAA 1X9VA 1GD2E 1GZLA 4PJ0V 2K37A 2PGDA 2KNCA 1KYOE 4UB8E 3VP8A 1FI7A 1FS0E 2CK3H 3RK2B 2N1TB 4EIDA 1WEJF 3IFMA 1LTTC 2IBZE 1S9KE 2A06E 1EB7A 1LGHB 5CCGC 3V5BA 3E7KA 1KQGB 2KSJA 3D6YA 2C9LY 2AI5A 4WQ7A 2YCCA 1M7LA 3WFDC 1SQVE 4N6JA 5CIEB 4C7RA 1LS9A 1OWAA 4WQBA 2N9YB 3AEGC 1SVFA 1NTKG 2FRCA 3NBSA 3L75G 2JWAA 4PJ0E 1SQQG 3ORVA 2G3AA 4U7JA 1SQXD 3L74G 5AW8B 2N9IA 1DD4A 5KAIH 3M91A 2ZXYA 1NTZG 5CIBB 1SQBK 2CE1A 5TISH 4FA9A 2QSIA 3II6A 1N8RQ 3SFDC 4U3FE 2KYVA 1NAYA 2FYUG 1CRGA 1R0QA 2B88A 3LIEA 3G4SP 1LTGC 1PZQA 4UB6E 5DJQB 4ASWA 1LTSC 1H33A 3CCVP 2D0WA 2NPSD 1GK6A 5B5EH 4PD4E 4MN4C 1Q86Q 3NMDA 1N73A 3D71A 1A56A 3P8CE 4JPZB 1M1JB 2FWLA 5AW7B 1OAEA 2KK7A 5AW4B 5CYTR 1FZGA 3L72J 3Q5SA 2WSEJ 4ZMDA 4W7YA 2W83C 5CIHB 2C0WA 3ABVC 2LXBA 1JCCA 3OAKA 2KNCB 3C8VA 3KQGA 3WU2H 1OFCX 1M56D 5AVZB 1EXJA 3B5NA 1X8YA 1CEDA 2BEZF 1LMSA 4NPEA 5KLVG 2P2UA 4AX3A 1H1OA 1RE3C 2XU6A 2FBWC 4DJGA 4H0LB 3WFCC 2Q1KA 1DEBA 3NWVA 2OQQA 3JBTB 1HJ4A 1LJ2A 3HQ7A 2Q7CA 4P4QB 3H6PA 4FANA 1GKSA 2A45H 3GG2A 4GDOA 2ITAA 2HYNA 1VQ6P 2EXVA 3V2PA 4WQCA 3ITKA 1DW1A 1JM0A 1BGYG 2OYIB 5B66E 1RAPA 2JTIB 3PXSA 1S5LV 3M0DC 3EWKA 5CCGA 1GU2A 5AW5B 2N9BA 2P10A 2IFMA 1VYDA 2R32A 3ZDMA 1FOSF 5AW3B 2YNYA 4O9BA 1DEEG 1JO5A 1M6ZA 1PPJG 1IJDB 4GT1A 3O1YA 1JDLA 1HVVA 3CXHW 4PV1D 1EZVE 1NO4A 3DR0A 1H89A 2V07A 1H33B 2BCCG 1G1IA 1JEKA 1UIIA 1IFJA 1H9YA 3A5TA 3PP5A 2FXPA 1KILE 1PV3A 5BU5A 3TF5A 1KQLA 2D0SA 4GYDA 3RK2D 2N1TD 1CRIA 1S5LE 2ZONG 3H32A 2AXCA 2OGUA 1K9MQ 2KB7P 1CTJA 3H1ID 3S1KA 3CU4A 1AOQA 5DJTB 5GTIV 4I2LC 1CHIA 1KORA 2DW3A 1FJ0A 1L0LE 1SQXJ 1AOFA 1MG2D 2IBZG 4TT3H 1NTMK 2W27A 1PGPA 2A06G 3L70E 2KP8A 1G2CA 1QL4A 3H1KD 3ZOWA 1JMMA 5TJHA 2FYNB 3D6ZA 3CCMP 3VMAA 3BATA 1ZOYC 1SQVG 4HH2A 1QYZA 4D6TE 2BPBB 4XYDB 1YIJP 1T3UA 1C6OA 1PP9D 2WSFJ 1LP1A 1YIQA 2I1KA 4K3AA 1W2BO 3SWSA 1JY2P 1OZHA 3CC7P 5KJ7D 2W6BA 1BDCA 2WSCJ 5KLIC 3O6QB 3QWOC 4BXLA 1RAQA 1S2EA 2QJYC 5GTIE 2JDIH 4FA5A 2WSFH 1RE3A 1NMLA 4LJIA 3CC2P 2AIUA 3V2QA 3CYTI 1YNRA 1P84I 1HBWA 2H43A 1H0TB 3N4XA 3GW6A 1SS1A 2Q9IA 2WITA 3L4FA 1T2KC 1L9BC 3IR9A 1A02J 1SQXK 1WT6A 4PV1C 3GLMA 3USSA 3WUIA 4OVNF 3F5HA 1T3JA 2HODB 1IK7A 2K9JB 1LC1A 1JMBA 5CMZA 1SQPD 1NJIQ 1HGZA 3C2CA 3ZIYA 3WMM0 2Q5UA 1WMKA 3M0DA 3H1HE 3RK2C 1CIHA 4IFDK 1RH5B 1RHZB 3G71P 3PJSK 3CD6P 1IFMA 2PRRA 1XTCC 2FFDC 2J5UA 2XKMA 5KAFH 3GHGB 3CI9A 1YYCA 1AJYA 1J2JB 2WWWA 4H0LD 2PCCB 1VQLP 1RZ5A 3RK3B 4PWAA 1RQUA 3MD0A 4XFJA 3PH2B 1KYOI 4OH8B 1IRWA 1BE3G 4JCGA 1QKSA 1U7MA 3HE4A 5IY51 3AEDC 2KZIA 2IBZI 2WVRA 3OA8A 2R5DA 2JO1A 1I5TA 4K35A 1KQSO 3A0HV 5K5GB 3L71G 2QA4P 1EDLA 5TISV 1HH0A 3V2NA 2BH4X 1VQNP 1GW3A 1N7LA 5KJ7C 1LP1B 1KFNA 1GU4A 2G8YA 2E5TA 3AEBC 2JEEA 1UIXA 3RN1A 3U59A 2JJLA 1A8CA 1MV8A 4PW9B 3T97A 3P32A 1HUCA 4RKUJ 1KB9H 1SQBD 1ZV8A 3L75E 3O20A 4GKGA 1FZEA 5APSA 2VRSA 3H1IJ 1SP4A 4HKZH 2WTYA 1RF0C 3EFGA 2WPVB 1OVRA 4KJMA 5KAIE 1JCDA 2Q6QA 4H0KA 3NXSA 2YK3A 5TISE 3Q3DA 3H1KJ 3WU2V 1NH4A 4N78E 1QL2A 2Z5HA 1L2PA 1ZN5A 2RH0A 3I5CA 5AW1B 3Q5RA 1M57D 1SFCB 2WPRA 1KN7A 1K05A 4PD4I 1IFIA 1NTKD 1PP9J 1BDDA 4AANA 4DZOA 2JQRA 4Q5PA 2CPBA 5B5EE 3VTPC 3F89A 4H0LC 2C9XB 5EXQA 2AEJA 3CP5A 3L74D 3FX0A 4N3YB 5AW6B 1K3HA 1IK9A 4OGQB 2BLFB 3NFQA 1YEBA 4V2KA 1KC8Q 1YQ4C 4J20A 3AE3C 1M8OB 2OYIC 3H25A 3HE4B 2CA4B 1L0NG 2KOGA 2O01N 2FYUD 3L4MA 1HJ0A 4D6TG 3WU2E 1OMIA 3OA8B 5DF5A 2GUSA 1KTMA 3AE4C 5E79H 2FFDA 1OW7A 3TGUD 3IAOA 4FA4A 2Q3EA 5APXA 3CX5W 5CCGD 1QLED 1SQPJ 1NGMB 3KZIV 1FE6A 3IF4A 4R4MA 3OA7A 1MFZA 1KD1Q 1R5SA 3MP7B 1CTZA 3OJAB 1I8PA 1Y47A 2KS1A 1RF1B 3CCRP 1VQPP 3OW2O 2DVHA 1BGYE 1IFNA 3BCCG 1VQ4P 3CXHI 1CSUA 3QH9A 4LC1A 2KLUA 3KXDA 1L0LK 1NMIA 2NZ2A 1CI6B 4L75A 1DH3A 5KJ7A 1TU3F 5CIDB 1VF5C 3RMZA 1Y9BA 3OCDB 2ZFCA 5KLVD 4L76A 4NFGB 3O0RC 1KX7A 3H1HG 2YMYA 1AVOA 1BSHA 1EZVI 2KIKA 2RMZA 1PFIA 3B71A 3CLQA 3PLNA 3RK3D 1YBKA 3VP9A 2JKVA 3A2AA 1RF0A 2BCCE 2ZXXA 2FYNC 1CSXA 1P84D 2GA1A 2KXPB 1OXZA 4HYTB 1SLQA 2B0ZB 2ZXEB 5AVWB 1ZMEC 1NTMD 2YKQA 1OW6A 4WQ8A 1FAVA 4HB1A 3N7NA 4ASVA 1Z56A 1SQBJ 2H88C 2HFED 1OVVA 1M70A 2C8SA 5APTA 2O1JA 2C9NY 3HRNA 1CO6A 4Y99B 5APVA 3K5BA 3CWBE 1A2SA 2WPSA 2FFDB 3KYQA 3R4YA 3VOPA 5CBOA 1I6DA 1NKNA 1QEXA 1MKMA 5AVSB 1KYOW 1NYHA 3TYYA 1NNOA 3ZBMA 2OYIA 2B11B 3VRDA 2KS1B 1NTKJ 4LGDE 3AEAC 1KYOD 1W5CT 2QE7H 1D7MA 3PH0A 3M9BA 1CC5A 4L1QA 4I6MC 1S4XA 5GTHH 3L74J 2IBZD 3L73D 1YI2P 1SFCD 3A0HH 2Z4EA 1QX8A 3MZWB 5KAFV 5AVUB 4GOEA 5BVZA 4DY9A 1BCCD 4I1LA 3GHGC 1N15A 2FYUJ 3RK3C 1DIQC 3RL0D 3G9RA 155CA 5AVRB 2H7HA 4OGQD 2OYOA 2WPQA 1S3JA 3TGUJ 3I55P 3B4SA 3MHVA 2C1UA 5APWA 1L4AB 3JCUH 4JYBA 1S72P 1NTKK 3U1AA 4EIJA 4NPDA 2ZT9B 2P7JA 1SQQK 1HWTC 4U3FD 4I7ZC 5KAFE 1YEAA 3AEEC 1NTZK 2WSEH 1BE3E 3RGUA 2QEXP 4YXDC 5KLVJ 4PD4D 3JC22 1YJWP 1S6VB 2JP3A 2FYUK 1NVOA 5APYA 2QM8A 2A45G 2YKOA 3L71E 1M1KQ 1VPCA 4AQRD 4O1WA 3PXTA 2OTJP 1NIRA 3O6QA 3TYIA 3DMIA 3HQ6A 3BASA 1C6SA 4AYCA 1NTMJ 1SFCC 5CIGB 4WQAA 1H0TA 5AURA 2Y0DA 1KB9E 5DFSA 3SFEC 1ZRTE 5M1BA 3CCJP 1P84H 1MFTA 3KHUA 1YJNP 3EQ2A 2R3SA 1T2KD 2VHDA 3A3YB 4H13B 4L3GA 3KZIH 2I8DA 2HODA 2K9JA 3RL0C 3WUTA 4OGQC 2V08A 5KKZB 1YICA 3R2PA 5KLVK 4A7PA 2N18C 1DIPA 1CYJA 1JOCA 2AEFA 2BEQD 3H1IE 1LTBC 3CXHD 3C9IA 5E79V 2JWDA 3Q1MA 1EDKA 3KDPB 1VF5B 3CCQP 1IQCA 2LXCB 2C0XA 1HRCA 3GHGA 2H89C 3RLMA 1I6EA 5AVYB 2HG5D 2N3BA 3CX5I 2MHMA 3BVHA 1J1EB 2WMMA 1NU1E 3L73J 1EZVD 1IO4A 3CWBG 1JY2N 1U75B 1RF1C 2Y0CA 1DVHA 5AVVB 3A7OA 1B7VA 3TDKA 1OX3A 2R44A 2KUBA 1L0NE 4IOIH 1KILD 1BCCJ 1N86A 4IL6X 3V2RA 2BCNB 2PP6A 3SWFA 4ZNCA 1GL2B 5E79E 3WUVA 1X0TA 1KQFB 2W8ZA 5C39A 1GMJA 4HJGH 2PCBB 3NTNA 2XNDH 1YHQP 3H1JE 1L0LD 5CJ0A 1E2RA 1E29A 3IN6A 3L36A 4YXWH 4AUWA 1RQVA 3L70D 2M3EA 1VL2A 2Y9ZA 1PGJA 2WSCH 2C2CA 3BCCE 1JTHA 1QL3A 3RBXA 2D2CB 2R5BA 4L73A 4U3FJ 1PL5A 1YFCA 1L4AD 3HUSB 3SLEA 5KTBA 2V4HA 3ZOOA 2W90A 2MJZA 1X22A 4M3LA 2C1VA 4XA4A 1LFMA 1E8EA 4O1QA 1CSBA 3SJLA 2ZT9D 1SFCA 1AYGA 1SQVK 4KHXA 2YIUC 1YTZT 4Y99C 1YTCA 1M90Q 2AXTV 4DCKA 2B87B 4YE1A 1H31A 3MUDC 4L3HA 1IC2A 3H1LD 1Y8AA 2GIWA 1WRGA 1KX2A 2WT7B 3AE8C 3HQ9A 3L37A 2O1KA 3TSIA 2LIRA 4Y5RA 2L4DA 2K9YA 1N7SB 1KILC 1RE4C 2GUVA 3H1HD 5GTHV 3PTZA 1ZZHA 1FZFA 1CRYA 3U1CA 2OYHC 1KIBA 1GW4A 1N50A 4AALA 4C46A 4WQDA 1HJ5A 4I7ZB 3HD7C 4RESB 3M9HA 1NOHA 1RF1A 1RY3A 1HCMA 1W2EA 4H13D 1NHLA 1IO3A 2M5AB 3LIDA 4IL6V 1FC2C 4FAVA 1OIPA 2HPCB 4R4LA 1N90A 1IFDA 4CPGA 1FDIA 5APQA 1CI6A 3CXHH 4H44B 1JTHB 5CCHC 1L4AC 1Q82Q 5GTHE 1K73Q 3OCDA 2FY8A 1JY2O 4TLFA 1MZ9A 1C6RA 1F1FA 3CL3D 1VF5D 1C52A 3A0HE 3BRTB 3RN0A 1FOCA 1K8AQ 3H1IG 3DP5A 2J58A 2CA3B 2ZT9C 1VQOP 3HTKA 1JNMA 1JY3P 4H0JA 1KV4A 4C7NB 3GF7A 1AA0A 3VMXA 2KSEA 1DW0A 3L75D 1YCCA 3H1KG 1H31B 1SQQD 4WBAA 2E75C 1GJQA 1LNQA 4GEDB 2K3RA 1H8AA 1BSNA 1FDOA 2BGVX 1L0LJ 3RL0B 1NU1G 5C9MA 3JCUE 1NTZD 2JR8A 2QG4A 3L70J 2N18B 5AW9B 1DW3A 3TGUE 1OW8A 1LWUC 1GL2D 3M06A 451CA 1CSVA 2L91A 3WC8A 2FKWB 2RN0A 1MG3D 3MUDA 3FWNA 3HE5A 2IZ0A 1N9CA 2J59M 3L72E 1FJKA 1VQMP 4BRYA 1AKKA 3H1JG 2D2CD 1CCHA 4H13C 3CMEP 3LW5J 4QAOA 3CX5D 2B89A 3MGNA 1S1CX 1RE4A 1KILA 3CCUP 2E76D 5KKZC 1SQPG 1W5CE 1LC2A 2P1JA 1YQ3C 1FZBA 3H1LJ 2HLOA 1USEA 1DD3A 4MU8A 3LW5H 1VQ5P 1KB9I 2OYHA 1C2RA 2IFNA 1ZW0A 3RK3E 3HD7A 1LT9C 1JUNA 2ZVOB 3AEFC 1URQC 2C1DB 1COTA 1L0NK 2WSSH 1P84E 2E74B 3H1HJ 3HTKB 2GM4A 3KZIE 1J1EC 5AVQB 351CA 1WVEC 1USDA 1BGYD 4WWIA 1CIFA 1FOSE 1CZQA 1NAFA 2ZJSE 5CCHA 1L4AA 2W6JH 2ZYDA 3WUUA 1U74B 1N7SD 2FXOA 1CTYA 1ZXGA 4EDFA 1CXCA 1GL2C 3JSVC 1EDIA 1OCDA 1J1DB 2PFXA 4JYCA 1I54A 3S4RA 2LR2A 3ZOYA 2IZ1A 4IFMA 1AQ5A 1PPJD 3CC4P 2YIUB 3V6IA 1SQBG 3HE5B 2AXTH 4WVZA 1R8EA 2BCCD 5L8RJ 4WY4D 4BRYB 5EFWB 2D2CC 1SQXE 1KB0A 2LITA 3A0BH 4H44D 2B4ZA 3L73E 2GC4D 3KPEA 1CYIA 1LWUA 3HUSC 1S5LX 2E76C 2KI7B 2E43A 3L75J 3SSUA 1KILB 2W6AA 1SQQJ 5CIFB 2V7QJ 2XZRA 4UB6V 1BCCE 3G3ZA 1S9KD 1N2DC 1H88A 2A06D 1CHJA 1FHBA 1CIGA 3CWBD 2OYHB 1NTZJ 1G1JA 1LTJC 1CRCA 2WZ7A 2V7QH 3HD7B 2ZOOA 1EC5A 2DGEA 3AE2C 1X79B 4KMGA 1MZ4A 1PGOA 1SQVD 1IFPA 1HH7A 3MK7C 4WB4A 5DJUB 5H2FH 2N3YA 4N0KA 3G6EP 4IL6H 1KMIZ 3SWYA 3W67A 4AAOA
chains in the Genus database with same CATH topology
2MHMA 5TISV 1ETPA 1DW2A 2BH4X 1EZVD 1U75B 1C2NA 2Y0CA 1DVHA 1B7VA 2QJKB 3TDKA 3RN1A 1A8CA 2ZZS1 4UB8V 4PW9B 1W2LA 1DIIC 2BCNB 2I8FA 1SQBD 5KLIB 2O3JA 3O20A 5B66V 2QJYB 4EIEA 3PHLA 2PCBB 4FB1A 1H32B 1L0LD 4EICA 1E2RA 1E29A 4H0KA 2YK3A 1M60A 3L70D 3WU2V 2C2CA 1QL3A 4PJ0V 1NTKD 1YFCA 2XTSB 4AANA 1FI7A 3SLEA 3ZOOA 2JQRA 1GDVA 4Q5PA 4EIDA 1WEJF 2C1VA 1IRVA 2C9XB 5EXQA 1BE3D 1LFMA 3CP5A 3L74D 2PACA 3SVWA 1E8EA 4O1QA 3SJLA 1EB7A 1I8OA 1K3HA 1AYGA 2BLFB 1YEBA 4V2KA 4J20A 2AI5A 4WQEA 1YTCA 4WQ7A 2AXTV 2YCCA 4YE1A 3WFDC 2CA4B 1H31A 2HV4A 3L71D 1QN2A 4L3HA 5CIEB 1LS9A 2FYUD 3L4MA 3H1LD 4WQBA 2N9YB 3OA8B 5DF5A 2GIWA 3SXTA 1C75A 2FRCA 3NBSA 2JWAA 1KX2A 4RSZA 3TGUD 4FA4A 1CYCA 3ORVA 2Q3EA 3CX5W 3HQ9A 1SQXD 1KV9A 2N9IA 2LIRA 4Y5RA 2L4DA 1KB9D 3KZIV 1ZRTD 2ZXYA 3H1HD 1CTZA 5GTHV 1I8PA 2ORLA 5CIBB 2KS1A 2CE1A 3PTZA 4FA9A 1ZZHA 2MTAC 1CRHA 1CRYA 2DVHA 1CSUA 1F1CA 1KIBA 1GQ1A 1HROA 1N50A 1CRGA 4AALA 1R0QA 3WFBC 4WQDA 5DJQB 1HJ5A 1NMIA 4K3IA 5B6QA 1H33A 2D0WA 5CIDB 3RMZA 4EIFA 3OCDB 5KLVD 1H9XA 4NFGB 1A56A 1HCMA 3O0RC 1IO3A 2QJPB 4IL6V 2FWLA 4FAVA 1KX7A 1FCDC 3ZOXA 1OAEA 5CYTR 1N90A 2RMZA 3FWLA 3PLNA 5CIHB 3OCDA 2KNCB 1C6RA 1F1FA 1NU1D 1C52A 3RN0A 1CSXA 1P84D 1FOCA 3DP5A 3M97X 2B0ZB 2CA3B 3HQ8A 4XXLA 3O5CA 1CEDA 1CHHA 1LMSA 1NTMD 3L4OA 4WQ8A 4H0JA 4AX3A 1H1OA 1L0ND 1FI3A 1HJ3A 4D6TD 3WFCC 3NWVA 1DW0A 3JBTB 1HJ4A 3VYMA 3HQ7A 3L75D 1YCCA 4P4QB 1M70A 2C8SA 4FANA 1H31B 1SQQD 1GKSA 3GG2A 2B12B 1GJQA 2EXVA 4GEDB 4WQCA 3ITKA 1DW1A 1CO6A 2BGVX 3H1JD 1RAPA 1A2SA 1HZVA 5C9MA 2JTIB 3PXSA 1NTZD 1I6DA 1S5LV 2QG4A 2N18B 1DW3A 1K3GA 1KYOW 1GU2A 451CA 1NNOA 3BCCD 1CSVA 3ZBMA 1VYDA 3WC8A 2L91A 4WQ9A 2RN0A 1MG3D 2B11B 3VRDA 3A0BV 1DVVA 1CCRA 1KYOD 1N9CA 1W5CT 4FA1A 1M6ZA 3MK7B 1CC5A 3O1YA 4L1QA 1JDLA 3CXHW 3NBTA 5C0ZA 1AKKA 2IBZD 3DR0A 3L73D 1CSWA 2V07A 1H33B 1CCHA 4QAOA 2OZ1A 4AAMA 1H9YA 3CX5D 5KAFV 1FI9A 3TF5A 4DY9A 1BCCD 2D0SA 4GYDA 1LC2A 1CRIA 1N15A 3PXWA 2CXBA 2ZONG 4MU8A 1DIQC 2Y0EA 155CA 1J3SA 1CTJA 3H1ID 3VNWA 1C2RA 1CRJA 2BH5X 5KAIV 3CU4A 1AOQA 5GTIV 1CHIA 1FJ0A 5H2FV 1AOFA 1MG2D 3ZCFA 2C1UA 2C1DB 1COTA 1QL4A 3H1KD 3ZOWA 3X39A 5TJHA 2FYNB 3VMAA 351CA 1WVEC 1QYZA 1BGYD 3PRJA 5DJQC 1CIFA 2BPBB 2ZBOA 4U3FD 4XYDB 1CXAA 5B5EV 1YEAA 1C6OA 2C1DA 1PP9D 1CNOA 1U74B 1YIQA 2B10B 3A9FA 1CTYA 3SWSA 4PD4D 4EDFA 1CXCA 1S6VB 1OCDA 1HZUA 1RAQA 1RZ6A 4FA5A 1I54A 1NMLA 4LJIA 2AIUA 3ZOYA 3CYTI 1YNRA 1PPJD 2YIUB 3GW6A 1IZL0 2GC7D 4O1WA 3PXTA 1H32A 1L9BC 1NIRA 3TYIA 3DMIA 3HQ6A 2BCCD 1C6SA 3WUIA 1C7MA 1CORA 1LC1A 2K9JB 1KB0A 1SQPD 5CIGB 4WQAA 2LITA 3C2CA 4AAOA 5AURA 2B4ZA 2Y0DA 3ZIYA 2GC4D 5DFSA 1CYIA 2OZ1B 3KHUA 1BL9A 1CIHA 2YQBA 4RJTA 2VHDA 1DT1A 5CIFB 4L3GA 4UB6V 1CIEA 2V08A 5KKZB 1YICA 2A06D 1CHJA 1FHBA 4A7PA 2CE0A 1CIGA 3CWBD 2N18C 1I55A 2N9JA 1CYJA 2PCCB 1RZ5A 1CRCA 4PWAA 3WFEC 1GIWA 3CXHD 2ZOOA 2DGEA 2GB8B 1L9JC 3PH2B 5E79V 1IRWA 4KMGA 1MZ4A 1SQVD 4JCGA 1QKSA 1HH7A 5IY51 1IQCA 1HRCA 3MK7C 3OA8A 5CICB 3RLMA 1I6EA 1I5TA 2N3YA 4N0KA 3L72D 2N3BA 3A0HV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHM A;  5TIS V;  1ETP A;  1DW2 A;  2BH4 X;  1EZV D;  1U75 B;  1C2N A;  2Y0C A;  1DVH A;  1B7V A;  2QJK B;  3TDK A;  3RN1 A;  1A8C A;  2ZZS 1;  4UB8 V;  4PW9 B;  1W2L A;  1DII C;  2BCN B;  2I8F A;  1SQB D;  5KLI B;  2O3J A;  3O20 A;  5B66 V;  2QJY B;  4EIE A;  3PHL A;  2PCB B;  4FB1 A;  1H32 B;  1L0L D;  4EIC A;  1E2R A;  1E29 A;  4H0K A;  2YK3 A;  1M60 A;  3L70 D;  3WU2 V;  2C2C A;  1QL3 A;  4PJ0 V;  1NTK D;  1YFC A;  2XTS B;  4AAN A;  1FI7 A;  3SLE A;  3ZOO A;  2JQR A;  1GDV A;  4Q5P A;  4EID A;  1WEJ F;  2C1V A;  1IRV A;  2C9X B;  5EXQ A;  1BE3 D;  1LFM A;  3CP5 A;  3L74 D;  2PAC A;  3SVW A;  1E8E A;  4O1Q A;  3SJL A;  1EB7 A;  1I8O A;  1K3H A;  1AYG A;  2BLF B;  1YEB A;  4V2K A;  4J20 A;  2AI5 A;  4WQE A;  1YTC A;  4WQ7 A;  2AXT V;  2YCC A;  4YE1 A;  3WFD C;  2CA4 B;  1H31 A;  2HV4 A;  3L71 D;  1QN2 A;  4L3H A;  5CIE B;  1LS9 A;  2FYU D;  3L4M A;  3H1L D;  4WQB A;  2N9Y B;  3OA8 B;  5DF5 A;  2GIW A;  3SXT A;  1C75 A;  2FRC A;  3NBS A;  2JWA A;  1KX2 A;  4RSZ A;  3TGU D;  4FA4 A;  1CYC A;  3ORV A;  2Q3E A;  3CX5 W;  3HQ9 A;  1SQX D;  1KV9 A;  2N9I A;  2LIR A;  4Y5R A;  2L4D A;  1KB9 D;  3KZI V;  1ZRT D;  2ZXY A;  3H1H D;  1CTZ A;  5GTH V;  1I8P A;  2ORL A;  5CIB B;  2KS1 A;  2CE1 A;  3PTZ A;  4FA9 A;  1ZZH A;  2MTA C;  1CRH A;  1CRY A;  2DVH A;  1CSU A;  1F1C A;  1KIB A;  1GQ1 A;  1HRO A;  1N50 A;  1CRG A;  4AAL A;  1R0Q A;  3WFB C;  4WQD A;  5DJQ B;  1HJ5 A;  1NMI A;  4K3I A;  5B6Q A;  1H33 A;  2D0W A;  5CID B;  3RMZ A;  4EIF A;  3OCD B;  5KLV D;  1H9X A;  4NFG B;  1A56 A;  1HCM A;  3O0R C;  1IO3 A;  2QJP B;  4IL6 V;  2FWL A;  4FAV A;  1KX7 A;  1FCD C;  3ZOX A;  1OAE A;  5CYT R;  1N90 A;  2RMZ A;  3FWL A;  3PLN A;  5CIH B;  3OCD A;  2KNC B;  1C6R A;  1F1F A;  1NU1 D;  1C52 A;  3RN0 A;  1CSX A;  1P84 D;  1FOC A;  3DP5 A;  3M97 X;  2B0Z B;  2CA3 B;  3HQ8 A;  4XXL A;  3O5C A;  1CED A;  1CHH A;  1LMS A;  1NTM D;  3L4O A;  4WQ8 A;  4H0J A;  4AX3 A;  1H1O A;  1L0N D;  1FI3 A;  1HJ3 A;  4D6T D;  3WFC C;  3NWV A;  1DW0 A;  3JBT B;  1HJ4 A;  3VYM A;  3HQ7 A;  3L75 D;  1YCC A;  4P4Q B;  1M70 A;  2C8S A;  4FAN A;  1H31 B;  1SQQ D;  1GKS A;  3GG2 A;  2B12 B;  1GJQ A;  2EXV A;  4GED B;  4WQC A;  3ITK A;  1DW1 A;  1CO6 A;  2BGV X;  3H1J D;  1RAP A;  1A2S A;  1HZV A;  5C9M A;  2JTI B;  3PXS A;  1NTZ D;  1I6D A;  1S5L V;  2QG4 A;  2N18 B;  1DW3 A;  1K3G A;  1KYO W;  1GU2 A;  451C A;  1NNO A;  3BCC D;  1CSV A;  3ZBM A;  1VYD A;  3WC8 A;  2L91 A;  4WQ9 A;  2RN0 A;  1MG3 D;  2B11 B;  3VRD A;  3A0B V;  1DVV A;  1CCR A;  1KYO D;  1N9C A;  1W5C T;  4FA1 A;  1M6Z A;  3MK7 B;  1CC5 A;  3O1Y A;  4L1Q A;  1JDL A;  3CXH W;  3NBT A;  5C0Z A;  1AKK A;  2IBZ D;  3DR0 A;  3L73 D;  1CSW A;  2V07 A;  1H33 B;  1CCH A;  4QAO A;  2OZ1 A;  4AAM A;  1H9Y A;  3CX5 D;  5KAF V;  1FI9 A;  3TF5 A;  4DY9 A;  1BCC D;  2D0S A;  4GYD A;  1LC2 A;  1CRI A;  1N15 A;  3PXW A;  2CXB A;  2ZON G;  4MU8 A;  1DIQ C;  2Y0E A;  155C A;  1J3S A;  1CTJ A;  3H1I D;  3VNW A;  1C2R A;  1CRJ A;  2BH5 X;  5KAI V;  3CU4 A;  1AOQ A;  5GTI V;  1CHI A;  1FJ0 A;  5H2F V;  1AOF A;  1MG2 D;  3ZCF A;  2C1U A;  2C1D B;  1COT A;  1QL4 A;  3H1K D;  3ZOW A;  3X39 A;  5TJH A;  2FYN B;  3VMA A;  351C A;  1WVE C;  1QYZ A;  1BGY D;  3PRJ A;  5DJQ C;  1CIF A;  2BPB B;  2ZBO A;  4U3F D;  4XYD B;  1CXA A;  5B5E V;  1YEA A;  1C6O A;  2C1D A;  1PP9 D;  1CNO A;  1U74 B;  1YIQ A;  2B10 B;  3A9F A;  1CTY A;  3SWS A;  4PD4 D;  4EDF A;  1CXC A;  1S6V B;  1OCD A;  1HZU A;  1RAQ A;  1RZ6 A;  4FA5 A;  1I54 A;  1NML A;  4LJI A;  2AIU A;  3ZOY A;  3CYT I;  1YNR A;  1PPJ D;  2YIU B;  3GW6 A;  1IZL 0;  2GC7 D;  4O1W A;  3PXT A;  1H32 A;  1L9B C;  1NIR A;  3TYI A;  3DMI A;  3HQ6 A;  2BCC D;  1C6S A;  3WUI A;  1C7M A;  1COR A;  1LC1 A;  2K9J B;  1KB0 A;  1SQP D;  5CIG B;  4WQA A;  2LIT A;  3C2C A;  4AAO A;  5AUR A;  2B4Z A;  2Y0D A;  3ZIY A;  2GC4 D;  5DFS A;  1CYI A;  2OZ1 B;  3KHU A;  1BL9 A;  1CIH A;  2YQB A;  4RJT A;  2VHD A;  1DT1 A;  5CIF B;  4L3G A;  4UB6 V;  1CIE A;  2V08 A;  5KKZ B;  1YIC A;  2A06 D;  1CHJ A;  1FHB A;  4A7P A;  2CE0 A;  1CIG A;  3CWB D;  2N18 C;  1I55 A;  2N9J A;  1CYJ A;  2PCC B;  1RZ5 A;  1CRC A;  4PWA A;  3WFE C;  1GIW A;  3CXH D;  2ZOO A;  2DGE A;  2GB8 B;  1L9J C;  3PH2 B;  5E79 V;  1IRW A;  4KMG A;  1MZ4 A;  1SQV D;  4JCG A;  1QKS A;  1HH7 A;  5IY5 1;  1IQC A;  1HRC A;  3MK7 C;  3OA8 A;  5CIC B;  3RLM A;  1I6E A;  1I5T A;  2N3Y A;  4N0K A;  3L72 D;  2N3B A;  3A0H V; 
#chains in the Genus database with same CATH topology
 1N7S C;  1ETP A;  3P8M C;  4ZKU A;  1T8Z A;  1C2N A;  2RKL A;  3E1I A;  1LT9 A;  2ZAE B;  1GDT A;  2QJK B;  1URQ A;  3TGU G;  2BAS A;  5CJ4 A;  3V4W A;  4EI2 A;  1VQK P;  1DII C;  1NKZ B;  1E5W A;  3TNU A;  1GK4 A;  2KZJ A;  5BU8 B;  2XV5 A;  1VQ7 P;  4DT0 A;  3CX5 H;  5B66 V;  1ZR2 A;  3VMY A;  3L72 G;  4FB1 A;  1QGK B;  2E75 B;  4EIC A;  3P8C D;  4WY4 C;  3MTU E;  3GF3 A;  2YMK A;  4H44 C;  3BRV B;  2AEM A;  1M60 A;  2QRX A;  1GL2 A;  2POH A;  4KT0 J;  2UWJ E;  1LWU B;  1AV1 A;  1BGY J;  2E42 A;  2K1A A;  2OTK E;  2XTS B;  1KFM A;  1MUU A;  2E74 D;  1GDV A;  2YKP A;  1IRV A;  1BE3 D;  4W7Z A;  2PAC A;  3SVW A;  1I8O A;  1FZC C;  1YJ9 P;  3P7K A;  3M0A A;  3SWK A;  4EOT A;  4LLH A;  2M0B A;  3CXH E;  3HUS A;  4WQE A;  3CCS P;  1NTM G;  2HV4 A;  3L71 D;  4YPC A;  1QN2 A;  2OAR A;  1DX7 A;  4Z1M H;  4GIF A;  2CPS A;  3W68 A;  3SXT A;  1C75 A;  1VQ9 P;  4QMA A;  2BCC J;  3I56 P;  2SPZ A;  4RSZ A;  1CYC A;  2P58 A;  1LTI C;  1LTJ A;  2B87 A;  1KV9 A;  1VDF A;  2NPS C;  1KB9 D;  1LT9 B;  1ZRT D;  1URQ B;  2ORL A;  1AVY A;  3H1K E;  1U7J A;  2MTA C;  1N73 B;  1CRH A;  2WT7 A;  3TNU B;  5APU A;  1F1C A;  1GQ1 A;  1HRO A;  3WFB C;  1PP9 E;  2M8R A;  1VQ8 P;  3CWB J;  4EYY Q;  3FXD A;  4K3I A;  1N7S A;  1IZN B;  1KYO H;  4UB8 H;  1Q7Y Q;  3MIW A;  5B6Q A;  1EQ7 A;  2M3B A;  4EIF A;  1SQX G;  2XNX A;  4IFF A;  1H9X A;  1SQV J;  3L73 G;  2QJP B;  1FCD C;  3ZOX A;  2Z5I A;  3B5N B;  3FWL A;  1BCC G;  3RBZ A;  1R5L A;  2ZYG A;  2A45 I;  3HD7 D;  5AVT B;  2E74 C;  1GU5 A;  3AE6 C;  1NU1 D;  2M5A A;  1Q2N A;  2HPC A;  3M97 X;  3HQ8 A;  4WY4 A;  4XXL A;  3O5C A;  4PJ0 H;  1CHH A;  1SQP E;  3L4O A;  2IDB A;  1L0N D;  1FI3 A;  1HJ3 A;  4D6T D;  3AE9 C;  1EXI A;  5CCH D;  3VYM A;  2E76 B;  2FYZ A;  2B12 B;  1HJB A;  1AQT A;  1FZA A;  2YO2 A;  1J1D C;  2QIW A;  1JB0 J;  2Q3I A;  3H1L E;  4U3F G;  3H1J D;  4C7N A;  1QVF O;  1HZV A;  4UB6 H;  1A02 F;  1K3G A;  1LTJ B;  1FZC A;  4PD4 H;  3BCC D;  1EDJ A;  4WQ9 A;  3AE5 C;  5AW0 B;  2E75 D;  3B8E B;  3A0B V;  2N1T C;  3RL0 g;  1DVV A;  1CCR A;  2LKM A;  4FA1 A;  3MK7 B;  2QVA A;  2K88 A;  3NBT A;  5C0Z A;  1BE3 J;  1ZLL A;  3H32 B;  1CSW A;  1E79 H;  1CW5 A;  3Q5P A;  1XTG B;  1HTL C;  2R3C A;  2OZ1 A;  4AAM A;  1FU1 A;  2NPS A;  4GOD A;  1FI9 A;  2ZVN B;  3L71 J;  3PXW A;  1SQB E;  1AFO A;  2CXB A;  2AXT E;  3AE1 C;  1G2C B;  2Y0E A;  1J3S A;  3VNW A;  1CRJ A;  2BH5 X;  5KAI V;  5H2F V;  3A0B E;  2YXQ B;  3ZCF A;  1GTW A;  5B66 H;  4BWN A;  4WY4 B;  1JY3 N;  2MKV A;  1K04 A;  1QL1 A;  3X39 A;  4NPF X;  3PRJ A;  4JF7 A;  5DJQ C;  2ZBO A;  1QVG O;  1CXA A;  2QJK C;  5B5E V;  1NTK E;  2C1D A;  1FBM A;  2O01 J;  1CNO A;  2B10 B;  3A9F A;  1SQQ E;  5CBN A;  2NRG A;  1URQ D;  1T6A A;  1M1J C;  3L74 E;  1EZV G;  1HF9 A;  5CHX A;  1HZU A;  3VYI A;  4RO0 A;  1NTZ E;  1RZ6 A;  2IX7 C;  2IYO A;  2O01 H;  4XE5 B;  5H2F E;  1PIX A;  1FZC B;  2OTL P;  4IL6 E;  1OVU A;  2WQY C;  1IZL 0;  2I1J A;  2GC7 D;  2FYU E;  1S5L H;  1H32 A;  1NU1 J;  1PP9 G;  4GOF A;  1Q90 D;  2E5Y A;  1C7M A;  3CCE P;  1COR A;  2B9B A;  3B5N D;  4N78 D;  3D0W A;  3C1L A;  1L0N J;  1L0L G;  2YXR B;  2XDJ A;  4D6T J;  3AE7 C;  2OZ1 B;  2FXM A;  2NPS B;  1BL9 A;  3L70 G;  3CX5 E;  2YQB A;  4RJT A;  1DT1 A;  4DOJ A;  3Q2Y A;  1CIE A;  2N1T A;  3H1J J;  1U57 A;  2CE0 A;  3EFF K;  2QM7 A;  1I55 A;  2N9J A;  1LT1 A;  1KZU B;  1PGQ A;  3WFE C;  1GIW A;  2GB8 B;  1L9J C;  5KLV E;  3CMA P;  3UIA A;  3BCC J;  3FXE A;  3S9O A;  4B86 A;  5AVX B;  5GTI H;  3V4Q A;  5CIC B;  1NU1 K;  2P67 A;  2IPP A;  3T97 B;  3L72 D;  3M9Q A;  3CCL P;  1DW2 A;  2H8P D;  1FJP A;  3H1L G;  1HGV A;  2HR3 A;  1FDM A;  1N73 C;  2L5G B;  4L74 A;  1NTM E;  3L35 A;  2ZZS 1;  4UB8 V;  3E1R A;  2Y9Y A;  2PAJ A;  1W2L A;  1ZP0 C;  1ZR4 A;  3TK1 A;  3FGA D;  2I8F A;  2IYP A;  5KLI B;  1YTZ I;  3VMZ A;  2O3J A;  2KLV A;  3D70 A;  2QJY B;  4JBZ A;  1PPJ E;  1NWQ A;  4EIE A;  3PHL A;  1Q81 Q;  1LTA C;  2QJP C;  1H32 B;  4ZKP A;  3O8Z A;  4OWF A;  3B5N C;  3GMA A;  1SQP K;  3CPW O;  1JY3 O;  1M1J A;  5AW2 B;  1YIT P;  4JQ0 D;  4Y28 J;  2YO3 A;  4PV1 B;  3VN0 A;  4W80 A;  3AEC C;  4YTP C;  2ZYA A;  1X9V A;  1GD2 E;  1GZL A;  4PJ0 V;  2K37 A;  2PGD A;  2KNC A;  1KYO E;  4UB8 E;  3VP8 A;  1FI7 A;  1FS0 E;  2CK3 H;  3RK2 B;  2N1T B;  4EID A;  1WEJ F;  3IFM A;  1LTT C;  2IBZ E;  1S9K E;  2A06 E;  1EB7 A;  1LGH B;  5CCG C;  3V5B A;  3E7K A;  1KQG B;  2KSJ A;  3D6Y A;  2C9L Y;  2AI5 A;  4WQ7 A;  2YCC A;  1M7L A;  3WFD C;  1SQV E;  4N6J A;  5CIE B;  4C7R A;  1LS9 A;  1OWA A;  4WQB A;  2N9Y B;  3AEG C;  1SVF A;  1NTK G;  2FRC A;  3NBS A;  3L75 G;  2JWA A;  4PJ0 E;  1SQQ G;  3ORV A;  2G3A A;  4U7J A;  1SQX D;  3L74 G;  5AW8 B;  2N9I A;  1DD4 A;  5KAI H;  3M91 A;  2ZXY A;  1NTZ G;  5CIB B;  1SQB K;  2CE1 A;  5TIS H;  4FA9 A;  2QSI A;  3II6 A;  1N8R Q;  3SFD C;  4U3F E;  2KYV A;  1NAY A;  2FYU G;  1CRG A;  1R0Q A;  2B88 A;  3LIE A;  3G4S P;  1LTG C;  1PZQ A;  4UB6 E;  5DJQ B;  4ASW A;  1LTS C;  1H33 A;  3CCV P;  2D0W A;  2NPS D;  1GK6 A;  5B5E H;  4PD4 E;  4MN4 C;  1Q86 Q;  3NMD A;  1N73 A;  3D71 A;  1A56 A;  3P8C E;  4JPZ B;  1M1J B;  2FWL A;  5AW7 B;  1OAE A;  2KK7 A;  5AW4 B;  5CYT R;  1FZG A;  3L72 J;  3Q5S A;  2WSE J;  4ZMD A;  4W7Y A;  2W83 C;  5CIH B;  2C0W A;  3ABV C;  2LXB A;  1JCC A;  3OAK A;  2KNC B;  3C8V A;  3KQG A;  3WU2 H;  1OFC X;  1M56 D;  5AVZ B;  1EXJ A;  3B5N A;  1X8Y A;  1CED A;  2BEZ F;  1LMS A;  4NPE A;  5KLV G;  2P2U A;  4AX3 A;  1H1O A;  1RE3 C;  2XU6 A;  2FBW C;  4DJG A;  4H0L B;  3WFC C;  2Q1K A;  1DEB A;  3NWV A;  2OQQ A;  3JBT B;  1HJ4 A;  1LJ2 A;  3HQ7 A;  2Q7C A;  4P4Q B;  3H6P A;  4FAN A;  1GKS A;  2A45 H;  3GG2 A;  4GDO A;  2ITA A;  2HYN A;  1VQ6 P;  2EXV A;  3V2P A;  4WQC A;  3ITK A;  1DW1 A;  1JM0 A;  1BGY G;  2OYI B;  5B66 E;  1RAP A;  2JTI B;  3PXS A;  1S5L V;  3M0D C;  3EWK A;  5CCG A;  1GU2 A;  5AW5 B;  2N9B A;  2P10 A;  2IFM A;  1VYD A;  2R32 A;  3ZDM A;  1FOS F;  5AW3 B;  2YNY A;  4O9B A;  1DEE G;  1JO5 A;  1M6Z A;  1PPJ G;  1IJD B;  4GT1 A;  3O1Y A;  1JDL A;  1HVV A;  3CXH W;  4PV1 D;  1EZV E;  1NO4 A;  3DR0 A;  1H89 A;  2V07 A;  1H33 B;  2BCC G;  1G1I A;  1JEK A;  1UII A;  1IFJ A;  1H9Y A;  3A5T A;  3PP5 A;  2FXP A;  1KIL E;  1PV3 A;  5BU5 A;  3TF5 A;  1KQL A;  2D0S A;  4GYD A;  3RK2 D;  2N1T D;  1CRI A;  1S5L E;  2ZON G;  3H32 A;  2AXC A;  2OGU A;  1K9M Q;  2KB7 P;  1CTJ A;  3H1I D;  3S1K A;  3CU4 A;  1AOQ A;  5DJT B;  5GTI V;  4I2L C;  1CHI A;  1KOR A;  2DW3 A;  1FJ0 A;  1L0L E;  1SQX J;  1AOF A;  1MG2 D;  2IBZ G;  4TT3 H;  1NTM K;  2W27 A;  1PGP A;  2A06 G;  3L70 E;  2KP8 A;  1G2C A;  1QL4 A;  3H1K D;  3ZOW A;  1JMM A;  5TJH A;  2FYN B;  3D6Z A;  3CCM P;  3VMA A;  3BAT A;  1ZOY C;  1SQV G;  4HH2 A;  1QYZ A;  4D6T E;  2BPB B;  4XYD B;  1YIJ P;  1T3U A;  1C6O A;  1PP9 D;  2WSF J;  1LP1 A;  1YIQ A;  2I1K A;  4K3A A;  1W2B O;  3SWS A;  1JY2 P;  1OZH A;  3CC7 P;  5KJ7 D;  2W6B A;  1BDC A;  2WSC J;  5KLI C;  3O6Q B;  3QWO C;  4BXL A;  1RAQ A;  1S2E A;  2QJY C;  5GTI E;  2JDI H;  4FA5 A;  2WSF H;  1RE3 A;  1NML A;  4LJI A;  3CC2 P;  2AIU A;  3V2Q A;  3CYT I;  1YNR A;  1P84 I;  1HBW A;  2H43 A;  1H0T B;  3N4X A;  3GW6 A;  1SS1 A;  2Q9I A;  2WIT A;  3L4F A;  1T2K C;  1L9B C;  3IR9 A;  1A02 J;  1SQX K;  1WT6 A;  4PV1 C;  3GLM A;  3USS A;  3WUI A;  4OVN F;  3F5H A;  1T3J A;  2HOD B;  1IK7 A;  2K9J B;  1LC1 A;  1JMB A;  5CMZ A;  1SQP D;  1NJI Q;  1HGZ A;  3C2C A;  3ZIY A;  3WMM 0;  2Q5U A;  1WMK A;  3M0D A;  3H1H E;  3RK2 C;  1CIH A;  4IFD K;  1RH5 B;  1RHZ B;  3G71 P;  3PJS K;  3CD6 P;  1IFM A;  2PRR A;  1XTC C;  2FFD C;  2J5U A;  2XKM A;  5KAF H;  3GHG B;  3CI9 A;  1YYC A;  1AJY A;  1J2J B;  2WWW A;  4H0L D;  2PCC B;  1VQL P;  1RZ5 A;  3RK3 B;  4PWA A;  1RQU A;  3MD0 A;  4XFJ A;  3PH2 B;  1KYO I;  4OH8 B;  1IRW A;  1BE3 G;  4JCG A;  1QKS A;  1U7M A;  3HE4 A;  5IY5 1;  3AED C;  2KZI A;  2IBZ I;  2WVR A;  3OA8 A;  2R5D A;  2JO1 A;  1I5T A;  4K35 A;  1KQS O;  3A0H V;  5K5G B;  3L71 G;  2QA4 P;  1EDL A;  5TIS V;  1HH0 A;  3V2N A;  2BH4 X;  1VQN P;  1GW3 A;  1N7L A;  5KJ7 C;  1LP1 B;  1KFN A;  1GU4 A;  2G8Y A;  2E5T A;  3AEB C;  2JEE A;  1UIX A;  3RN1 A;  3U59 A;  2JJL A;  1A8C A;  1MV8 A;  4PW9 B;  3T97 A;  3P32 A;  1HUC A;  4RKU J;  1KB9 H;  1SQB D;  1ZV8 A;  3L75 E;  3O20 A;  4GKG A;  1FZE A;  5APS A;  2VRS A;  3H1I J;  1SP4 A;  4HKZ H;  2WTY A;  1RF0 C;  3EFG A;  2WPV B;  1OVR A;  4KJM A;  5KAI E;  1JCD A;  2Q6Q A;  4H0K A;  3NXS A;  2YK3 A;  5TIS E;  3Q3D A;  3H1K J;  3WU2 V;  1NH4 A;  4N78 E;  1QL2 A;  2Z5H A;  1L2P A;  1ZN5 A;  2RH0 A;  3I5C A;  5AW1 B;  3Q5R A;  1M57 D;  1SFC B;  2WPR A;  1KN7 A;  1K05 A;  4PD4 I;  1IFI A;  1NTK D;  1PP9 J;  1BDD A;  4AAN A;  4DZO A;  2JQR A;  4Q5P A;  2CPB A;  5B5E E;  3VTP C;  3F89 A;  4H0L C;  2C9X B;  5EXQ A;  2AEJ A;  3CP5 A;  3L74 D;  3FX0 A;  4N3Y B;  5AW6 B;  1K3H A;  1IK9 A;  4OGQ B;  2BLF B;  3NFQ A;  1YEB A;  4V2K A;  1KC8 Q;  1YQ4 C;  4J20 A;  3AE3 C;  1M8O B;  2OYI C;  3H25 A;  3HE4 B;  2CA4 B;  1L0N G;  2KOG A;  2O01 N;  2FYU D;  3L4M A;  1HJ0 A;  4D6T G;  3WU2 E;  1OMI A;  3OA8 B;  5DF5 A;  2GUS A;  1KTM A;  3AE4 C;  5E79 H;  2FFD A;  1OW7 A;  3TGU D;  3IAO A;  4FA4 A;  2Q3E A;  5APX A;  3CX5 W;  5CCG D;  1QLE D;  1SQP J;  1NGM B;  3KZI V;  1FE6 A;  3IF4 A;  4R4M A;  3OA7 A;  1MFZ A;  1KD1 Q;  1R5S A;  3MP7 B;  1CTZ A;  3OJA B;  1I8P A;  1Y47 A;  2KS1 A;  1RF1 B;  3CCR P;  1VQP P;  3OW2 O;  2DVH A;  1BGY E;  1IFN A;  3BCC G;  1VQ4 P;  3CXH I;  1CSU A;  3QH9 A;  4LC1 A;  2KLU A;  3KXD A;  1L0L K;  1NMI A;  2NZ2 A;  1CI6 B;  4L75 A;  1DH3 A;  5KJ7 A;  1TU3 F;  5CID B;  1VF5 C;  3RMZ A;  1Y9B A;  3OCD B;  2ZFC A;  5KLV D;  4L76 A;  4NFG B;  3O0R C;  1KX7 A;  3H1H G;  2YMY A;  1AVO A;  1BSH A;  1EZV I;  2KIK A;  2RMZ A;  1PFI A;  3B71 A;  3CLQ A;  3PLN A;  3RK3 D;  1YBK A;  3VP9 A;  2JKV A;  3A2A A;  1RF0 A;  2BCC E;  2ZXX A;  2FYN C;  1CSX A;  1P84 D;  2GA1 A;  2KXP B;  1OXZ A;  4HYT B;  1SLQ A;  2B0Z B;  2ZXE B;  5AVW B;  1ZME C;  1NTM D;  2YKQ A;  1OW6 A;  4WQ8 A;  1FAV A;  4HB1 A;  3N7N A;  4ASV A;  1Z56 A;  1SQB J;  2H88 C;  2HFE D;  1OVV A;  1M70 A;  2C8S A;  5APT A;  2O1J A;  2C9N Y;  3HRN A;  1CO6 A;  4Y99 B;  5APV A;  3K5B A;  3CWB E;  1A2S A;  2WPS A;  2FFD B;  3KYQ A;  3R4Y A;  3VOP A;  5CBO A;  1I6D A;  1NKN A;  1QEX A;  1MKM A;  5AVS B;  1KYO W;  1NYH A;  3TYY A;  1NNO A;  3ZBM A;  2OYI A;  2B11 B;  3VRD A;  2KS1 B;  1NTK J;  4LGD E;  3AEA C;  1KYO D;  1W5C T;  2QE7 H;  1D7M A;  3PH0 A;  3M9B A;  1CC5 A;  4L1Q A;  4I6M C;  1S4X A;  5GTH H;  3L74 J;  2IBZ D;  3L73 D;  1YI2 P;  1SFC D;  3A0H H;  2Z4E A;  1QX8 A;  3MZW B;  5KAF V;  5AVU B;  4GOE A;  5BVZ A;  4DY9 A;  1BCC D;  4I1L A;  3GHG C;  1N15 A;  2FYU J;  3RK3 C;  1DIQ C;  3RL0 D;  3G9R A;  155C A;  5AVR B;  2H7H A;  4OGQ D;  2OYO A;  2WPQ A;  1S3J A;  3TGU J;  3I55 P;  3B4S A;  3MHV A;  2C1U A;  5APW A;  1L4A B;  3JCU H;  4JYB A;  1S72 P;  1NTK K;  3U1A A;  4EIJ A;  4NPD A;  2ZT9 B;  2P7J A;  1SQQ K;  1HWT C;  4U3F D;  4I7Z C;  5KAF E;  1YEA A;  3AEE C;  1NTZ K;  2WSE H;  1BE3 E;  3RGU A;  2QEX P;  4YXD C;  5KLV J;  4PD4 D;  3JC2 2;  1YJW P;  1S6V B;  2JP3 A;  2FYU K;  1NVO A;  5APY A;  2QM8 A;  2A45 G;  2YKO A;  3L71 E;  1M1K Q;  1VPC A;  4AQR D;  4O1W A;  3PXT A;  2OTJ P;  1NIR A;  3O6Q A;  3TYI A;  3DMI A;  3HQ6 A;  3BAS A;  1C6S A;  4AYC A;  1NTM J;  1SFC C;  5CIG B;  4WQA A;  1H0T A;  5AUR A;  2Y0D A;  1KB9 E;  5DFS A;  3SFE C;  1ZRT E;  5M1B A;  3CCJ P;  1P84 H;  1MFT A;  3KHU A;  1YJN P;  3EQ2 A;  2R3S A;  1T2K D;  2VHD A;  3A3Y B;  4H13 B;  4L3G A;  3KZI H;  2I8D A;  2HOD A;  2K9J A;  3RL0 C;  3WUT A;  4OGQ C;  2V08 A;  5KKZ B;  1YIC A;  3R2P A;  5KLV K;  4A7P A;  2N18 C;  1DIP A;  1CYJ A;  1JOC A;  2AEF A;  2BEQ D;  3H1I E;  1LTB C;  3CXH D;  3C9I A;  5E79 V;  2JWD A;  3Q1M A;  1EDK A;  3KDP B;  1VF5 B;  3CCQ P;  1IQC A;  2LXC B;  2C0X A;  1HRC A;  3GHG A;  2H89 C;  3RLM A;  1I6E A;  5AVY B;  2HG5 D;  2N3B A;  3CX5 I;  2MHM A;  3BVH A;  1J1E B;  2WMM A;  1NU1 E;  3L73 J;  1EZV D;  1IO4 A;  3CWB G;  1JY2 N;  1U75 B;  1RF1 C;  2Y0C A;  1DVH A;  5AVV B;  3A7O A;  1B7V A;  3TDK A;  1OX3 A;  2R44 A;  2KUB A;  1L0N E;  4IOI H;  1KIL D;  1BCC J;  1N86 A;  4IL6 X;  3V2R A;  2BCN B;  2PP6 A;  3SWF A;  4ZNC A;  1GL2 B;  5E79 E;  3WUV A;  1X0T A;  1KQF B;  2W8Z A;  5C39 A;  1GMJ A;  4HJG H;  2PCB B;  3NTN A;  2XND H;  1YHQ P;  3H1J E;  1L0L D;  5CJ0 A;  1E2R A;  1E29 A;  3IN6 A;  3L36 A;  4YXW H;  4AUW A;  1RQV A;  3L70 D;  2M3E A;  1VL2 A;  2Y9Z A;  1PGJ A;  2WSC H;  2C2C A;  3BCC E;  1JTH A;  1QL3 A;  3RBX A;  2D2C B;  2R5B A;  4L73 A;  4U3F J;  1PL5 A;  1YFC A;  1L4A D;  3HUS B;  3SLE A;  5KTB A;  2V4H A;  3ZOO A;  2W90 A;  2MJZ A;  1X22 A;  4M3L A;  2C1V A;  4XA4 A;  1LFM A;  1E8E A;  4O1Q A;  1CSB A;  3SJL A;  2ZT9 D;  1SFC A;  1AYG A;  1SQV K;  4KHX A;  2YIU C;  1YTZ T;  4Y99 C;  1YTC A;  1M90 Q;  2AXT V;  4DCK A;  2B87 B;  4YE1 A;  1H31 A;  3MUD C;  4L3H A;  1IC2 A;  3H1L D;  1Y8A A;  2GIW A;  1WRG A;  1KX2 A;  2WT7 B;  3AE8 C;  3HQ9 A;  3L37 A;  2O1K A;  3TSI A;  2LIR A;  4Y5R A;  2L4D A;  2K9Y A;  1N7S B;  1KIL C;  1RE4 C;  2GUV A;  3H1H D;  5GTH V;  3PTZ A;  1ZZH A;  1FZF A;  1CRY A;  3U1C A;  2OYH C;  1KIB A;  1GW4 A;  1N50 A;  4AAL A;  4C46 A;  4WQD A;  1HJ5 A;  4I7Z B;  3HD7 C;  4RES B;  3M9H A;  1NOH A;  1RF1 A;  1RY3 A;  1HCM A;  1W2E A;  4H13 D;  1NHL A;  1IO3 A;  2M5A B;  3LID A;  4IL6 V;  1FC2 C;  4FAV A;  1OIP A;  2HPC B;  4R4L A;  1N90 A;  1IFD A;  4CPG A;  1FDI A;  5APQ A;  1CI6 A;  3CXH H;  4H44 B;  1JTH B;  5CCH C;  1L4A C;  1Q82 Q;  5GTH E;  1K73 Q;  3OCD A;  2FY8 A;  1JY2 O;  4TLF A;  1MZ9 A;  1C6R A;  1F1F A;  3CL3 D;  1VF5 D;  1C52 A;  3A0H E;  3BRT B;  3RN0 A;  1FOC A;  1K8A Q;  3H1I G;  3DP5 A;  2J58 A;  2CA3 B;  2ZT9 C;  1VQO P;  3HTK A;  1JNM A;  1JY3 P;  4H0J A;  1KV4 A;  4C7N B;  3GF7 A;  1AA0 A;  3VMX A;  2KSE A;  1DW0 A;  3L75 D;  1YCC A;  3H1K G;  1H31 B;  1SQQ D;  4WBA A;  2E75 C;  1GJQ A;  1LNQ A;  4GED B;  2K3R A;  1H8A A;  1BSN A;  1FDO A;  2BGV X;  1L0L J;  3RL0 B;  1NU1 G;  5C9M A;  3JCU E;  1NTZ D;  2JR8 A;  2QG4 A;  3L70 J;  2N18 B;  5AW9 B;  1DW3 A;  3TGU E;  1OW8 A;  1LWU C;  1GL2 D;  3M06 A;  451C A;  1CSV A;  2L91 A;  3WC8 A;  2FKW B;  2RN0 A;  1MG3 D;  3MUD A;  3FWN A;  3HE5 A;  2IZ0 A;  1N9C A;  2J59 M;  3L72 E;  1FJK A;  1VQM P;  4BRY A;  1AKK A;  3H1J G;  2D2C D;  1CCH A;  4H13 C;  3CME P;  3LW5 J;  4QAO A;  3CX5 D;  2B89 A;  3MGN A;  1S1C X;  1RE4 A;  1KIL A;  3CCU P;  2E76 D;  5KKZ C;  1SQP G;  1W5C E;  1LC2 A;  2P1J A;  1YQ3 C;  1FZB A;  3H1L J;  2HLO A;  1USE A;  1DD3 A;  4MU8 A;  3LW5 H;  1VQ5 P;  1KB9 I;  2OYH A;  1C2R A;  2IFN A;  1ZW0 A;  3RK3 E;  3HD7 A;  1LT9 C;  1JUN A;  2ZVO B;  3AEF C;  1URQ C;  2C1D B;  1COT A;  1L0N K;  2WSS H;  1P84 E;  2E74 B;  3H1H J;  3HTK B;  2GM4 A;  3KZI E;  1J1E C;  5AVQ B;  351C A;  1WVE C;  1USD A;  1BGY D;  4WWI A;  1CIF A;  1FOS E;  1CZQ A;  1NAF A;  2ZJS E;  5CCH A;  1L4A A;  2W6J H;  2ZYD A;  3WUU A;  1U74 B;  1N7S D;  2FXO A;  1CTY A;  1ZXG A;  4EDF A;  1CXC A;  1GL2 C;  3JSV C;  1EDI A;  1OCD A;  1J1D B;  2PFX A;  4JYC A;  1I54 A;  3S4R A;  2LR2 A;  3ZOY A;  2IZ1 A;  4IFM A;  1AQ5 A;  1PPJ D;  3CC4 P;  2YIU B;  3V6I A;  1SQB G;  3HE5 B;  2AXT H;  4WVZ A;  1R8E A;  2BCC D;  5L8R J;  4WY4 D;  4BRY B;  5EFW B;  2D2C C;  1SQX E;  1KB0 A;  2LIT A;  3A0B H;  4H44 D;  2B4Z A;  3L73 E;  2GC4 D;  3KPE A;  1CYI A;  1LWU A;  3HUS C;  1S5L X;  2E76 C;  2KI7 B;  2E43 A;  3L75 J;  3SSU A;  1KIL B;  2W6A A;  1SQQ J;  5CIF B;  2V7Q J;  2XZR A;  4UB6 V;  1BCC E;  3G3Z A;  1S9K D;  1N2D C;  1H88 A;  2A06 D;  1CHJ A;  1FHB A;  1CIG A;  3CWB D;  2OYH B;  1NTZ J;  1G1J A;  1LTJ C;  1CRC A;  2WZ7 A;  2V7Q H;  3HD7 B;  2ZOO A;  1EC5 A;  2DGE A;  3AE2 C;  1X79 B;  4KMG A;  1MZ4 A;  1PGO A;  1SQV D;  1IFP A;  1HH7 A;  3MK7 C;  4WB4 A;  5DJU B;  5H2F H;  2N3Y A;  4N0K A;  3G6E P;  4IL6 H;  1KMI Z;  3SWY A;  3W67 A;  4AAO A; 
#chains in the Genus database with same CATH homology
 2MHM A;  5TIS V;  1ETP A;  1DW2 A;  2BH4 X;  1EZV D;  1U75 B;  1C2N A;  2Y0C A;  1DVH A;  1B7V A;  2QJK B;  3TDK A;  3RN1 A;  1A8C A;  2ZZS 1;  4UB8 V;  4PW9 B;  1W2L A;  1DII C;  2BCN B;  2I8F A;  1SQB D;  5KLI B;  2O3J A;  3O20 A;  5B66 V;  2QJY B;  4EIE A;  3PHL A;  2PCB B;  4FB1 A;  1H32 B;  1L0L D;  4EIC A;  1E2R A;  1E29 A;  4H0K A;  2YK3 A;  1M60 A;  3L70 D;  3WU2 V;  2C2C A;  1QL3 A;  4PJ0 V;  1NTK D;  1YFC A;  2XTS B;  4AAN A;  1FI7 A;  3SLE A;  3ZOO A;  2JQR A;  1GDV A;  4Q5P A;  4EID A;  1WEJ F;  2C1V A;  1IRV A;  2C9X B;  5EXQ A;  1BE3 D;  1LFM A;  3CP5 A;  3L74 D;  2PAC A;  3SVW A;  1E8E A;  4O1Q A;  3SJL A;  1EB7 A;  1I8O A;  1K3H A;  1AYG A;  2BLF B;  1YEB A;  4V2K A;  4J20 A;  2AI5 A;  4WQE A;  1YTC A;  4WQ7 A;  2AXT V;  2YCC A;  4YE1 A;  3WFD C;  2CA4 B;  1H31 A;  2HV4 A;  3L71 D;  1QN2 A;  4L3H A;  5CIE B;  1LS9 A;  2FYU D;  3L4M A;  3H1L D;  4WQB A;  2N9Y B;  3OA8 B;  5DF5 A;  2GIW A;  3SXT A;  1C75 A;  2FRC A;  3NBS A;  2JWA A;  1KX2 A;  4RSZ A;  3TGU D;  4FA4 A;  1CYC A;  3ORV A;  2Q3E A;  3CX5 W;  3HQ9 A;  1SQX D;  1KV9 A;  2N9I A;  2LIR A;  4Y5R A;  2L4D A;  1KB9 D;  3KZI V;  1ZRT D;  2ZXY A;  3H1H D;  1CTZ A;  5GTH V;  1I8P A;  2ORL A;  5CIB B;  2KS1 A;  2CE1 A;  3PTZ A;  4FA9 A;  1ZZH A;  2MTA C;  1CRH A;  1CRY A;  2DVH A;  1CSU A;  1F1C A;  1KIB A;  1GQ1 A;  1HRO A;  1N50 A;  1CRG A;  4AAL A;  1R0Q A;  3WFB C;  4WQD A;  5DJQ B;  1HJ5 A;  1NMI A;  4K3I A;  5B6Q A;  1H33 A;  2D0W A;  5CID B;  3RMZ A;  4EIF A;  3OCD B;  5KLV D;  1H9X A;  4NFG B;  1A56 A;  1HCM A;  3O0R C;  1IO3 A;  2QJP B;  4IL6 V;  2FWL A;  4FAV A;  1KX7 A;  1FCD C;  3ZOX A;  1OAE A;  5CYT R;  1N90 A;  2RMZ A;  3FWL A;  3PLN A;  5CIH B;  3OCD A;  2KNC B;  1C6R A;  1F1F A;  1NU1 D;  1C52 A;  3RN0 A;  1CSX A;  1P84 D;  1FOC A;  3DP5 A;  3M97 X;  2B0Z B;  2CA3 B;  3HQ8 A;  4XXL A;  3O5C A;  1CED A;  1CHH A;  1LMS A;  1NTM D;  3L4O A;  4WQ8 A;  4H0J A;  4AX3 A;  1H1O A;  1L0N D;  1FI3 A;  1HJ3 A;  4D6T D;  3WFC C;  3NWV A;  1DW0 A;  3JBT B;  1HJ4 A;  3VYM A;  3HQ7 A;  3L75 D;  1YCC A;  4P4Q B;  1M70 A;  2C8S A;  4FAN A;  1H31 B;  1SQQ D;  1GKS A;  3GG2 A;  2B12 B;  1GJQ A;  2EXV A;  4GED B;  4WQC A;  3ITK A;  1DW1 A;  1CO6 A;  2BGV X;  3H1J D;  1RAP A;  1A2S A;  1HZV A;  5C9M A;  2JTI B;  3PXS A;  1NTZ D;  1I6D A;  1S5L V;  2QG4 A;  2N18 B;  1DW3 A;  1K3G A;  1KYO W;  1GU2 A;  451C A;  1NNO A;  3BCC D;  1CSV A;  3ZBM A;  1VYD A;  3WC8 A;  2L91 A;  4WQ9 A;  2RN0 A;  1MG3 D;  2B11 B;  3VRD A;  3A0B V;  1DVV A;  1CCR A;  1KYO D;  1N9C A;  1W5C T;  4FA1 A;  1M6Z A;  3MK7 B;  1CC5 A;  3O1Y A;  4L1Q A;  1JDL A;  3CXH W;  3NBT A;  5C0Z A;  1AKK A;  2IBZ D;  3DR0 A;  3L73 D;  1CSW A;  2V07 A;  1H33 B;  1CCH A;  4QAO A;  2OZ1 A;  4AAM A;  1H9Y A;  3CX5 D;  5KAF V;  1FI9 A;  3TF5 A;  4DY9 A;  1BCC D;  2D0S A;  4GYD A;  1LC2 A;  1CRI A;  1N15 A;  3PXW A;  2CXB A;  2ZON G;  4MU8 A;  1DIQ C;  2Y0E A;  155C A;  1J3S A;  1CTJ A;  3H1I D;  3VNW A;  1C2R A;  1CRJ A;  2BH5 X;  5KAI V;  3CU4 A;  1AOQ A;  5GTI V;  1CHI A;  1FJ0 A;  5H2F V;  1AOF A;  1MG2 D;  3ZCF A;  2C1U A;  2C1D B;  1COT A;  1QL4 A;  3H1K D;  3ZOW A;  3X39 A;  5TJH A;  2FYN B;  3VMA A;  351C A;  1WVE C;  1QYZ A;  1BGY D;  3PRJ A;  5DJQ C;  1CIF A;  2BPB B;  2ZBO A;  4U3F D;  4XYD B;  1CXA A;  5B5E V;  1YEA A;  1C6O A;  2C1D A;  1PP9 D;  1CNO A;  1U74 B;  1YIQ A;  2B10 B;  3A9F A;  1CTY A;  3SWS A;  4PD4 D;  4EDF A;  1CXC A;  1S6V B;  1OCD A;  1HZU A;  1RAQ A;  1RZ6 A;  4FA5 A;  1I54 A;  1NML A;  4LJI A;  2AIU A;  3ZOY A;  3CYT I;  1YNR A;  1PPJ D;  2YIU B;  3GW6 A;  1IZL 0;  2GC7 D;  4O1W A;  3PXT A;  1H32 A;  1L9B C;  1NIR A;  3TYI A;  3DMI A;  3HQ6 A;  2BCC D;  1C6S A;  3WUI A;  1C7M A;  1COR A;  1LC1 A;  2K9J B;  1KB0 A;  1SQP D;  5CIG B;  4WQA A;  2LIT A;  3C2C A;  4AAO A;  5AUR A;  2B4Z A;  2Y0D A;  3ZIY A;  2GC4 D;  5DFS A;  1CYI A;  2OZ1 B;  3KHU A;  1BL9 A;  1CIH A;  2YQB A;  4RJT A;  2VHD A;  1DT1 A;  5CIF B;  4L3G A;  4UB6 V;  1CIE A;  2V08 A;  5KKZ B;  1YIC A;  2A06 D;  1CHJ A;  1FHB A;  4A7P A;  2CE0 A;  1CIG A;  3CWB D;  2N18 C;  1I55 A;  2N9J A;  1CYJ A;  2PCC B;  1RZ5 A;  1CRC A;  4PWA A;  3WFE C;  1GIW A;  3CXH D;  2ZOO A;  2DGE A;  2GB8 B;  1L9J C;  3PH2 B;  5E79 V;  1IRW A;  4KMG A;  1MZ4 A;  1SQV D;  4JCG A;  1QKS A;  1HH7 A;  5IY5 1;  1IQC A;  1HRC A;  3MK7 C;  3OA8 A;  5CIC B;  3RLM A;  1I6E A;  1I5T A;  2N3Y A;  4N0K A;  3L72 D;  2N3B A;  3A0H V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...