1L0ND

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1l0nD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1l0nD02
4XXLA 3KZIV 1FJ0A 2KS1A 3L75D 1SQXD 3JBTB 1NIRA 1DW3A 3MK7C 2HV4A 1W2LA 4MU8A 1MZ4A 3L73D 2RMZA 1IO3A 155CA 3O1YA 1SQVD 3FWLA 1CRCA 2Y0EA 4PJ0V 1I8OA 2I8FA 5KLIB 5AURA 1GQ1A 1PP9D 1CO6A 2DVHA 1HCMA 1FCDC 2YCCA 2N3BA 1K3GA 2CA4B 1YEAA 2ORLA 1CHJA 1CEDA 1IRVA 5C0ZA 1CSUA 2ZXYA 3A0HV 2VHDA 1HJ5A 2B10B 5DF5A 1YCCA 2C2CA 5DJQC 1QYZA 1CXCA 1HJ4A 3RN0A 5E79V 3O20A 4L3HA 2BGVX 1U74B 1CIGA 4N0KA 1NTKD 4L1QA 4PW9B 2BH4X 2QJYB 2FYUD 1LFMA 1CRHA 2D0WA 2QJKB 3ZOWA 3WC8A 4FA5A 4Q5PA 2CA3B 4XYDB 1R0QA 3L4MA 4H0JA 3H1ID 4YE1A 5B66V 2O3JA 1KV9A 2FRCA 4EIDA 3ZOYA 1C75A 2LIRA 4EIEA 1HJ3A 3ZOOA 1VYDA 1F1FA 1OAEA 5GTHV 1DIIC 1BGYD 3H1HD 2Y0DA 1YIQA 1C2RA 2N9JA 3CU4A 2OZ1B 1F1CA 1MG3D 2Y0CA 5EXQA 5TJHA 4QAOA 1ETPA 3WFDC 1COTA 1AYGA 4AAOA 4FA4A 3ZCFA 3CXHD 1E2RA 2GC4D 1KB0A 1I6DA 2OZ1A 1N50A 2ZBOA 1I55A 1YICA 1J3SA 1M60A 1CIEA 2V08A 3CXHW 3HQ7A 4P4QB 2QJPB 1FOCA 3ZBMA 1CNOA 1H33A 3SWSA 4RSZA 2FWLA 4A7PA 1WVEC 1HZVA 3RLMA 1QL3A 1CRIA 4WQDA 2PACA 3DP5A 3VMAA 3GW6A 4L3GA 3RN1A 4H0KA 1CTZA 1H9YA 3HQ6A 4UB8V 2C8SA 1I5TA 3PRJA 1CCRA 1L0LD 1YNRA 5KLVD 4FB1A 3NBTA 3TYIA 1CYCA 1CTYA 3VYMA 1BL9A 2B4ZA 3HQ8A 3RMZA 2N18C 3PLNA 1CC5A 1CXAA 1CSVA 1LC1A 3TF5A 3PHLA 1DW1A 1L9BC 4WQEA 1M6ZA 1IRWA 2C1VA 3HQ9A 4FA9A 3MK7B 4AX3A 1N15A 1CHHA 2YQBA 1DVVA 1CRYA 1QL4A 5CIDB 2L4DA 3DMIA 1HRCA 5CIEB 3VRDA 1H33B 1NNOA 1IZL0 5KAFV 2N9IA 2LITA 2MHMA 3NBSA 3H1JD 1A56A 1SQBD 2XTSB 4IL6V 2FYNB 2BCCD 1BE3D 1L0ND 4GEDB 5IY51 1S6VB 3CX5D 1YFCA 4UB6V 1B7VA 4NFGB 1CHIA 1IQCA 5DJQB 2KNCB 3L74D 1BCCD 4KMGA 3ZIYA 3GG2A 2A06D 1GKSA 3ITKA 2BPBB 5C9MA 3ZOXA 4DY9A 2Q3EA 5CIBB 2AIUA 1RAPA 1NTMD 1GU2A 1AKKA 1I8PA 3NWVA 5CYTR 3WU2V 1CCHA 2BCNB 1QKSA 2GIWA 1HZUA 2L91A 2N3YA 1M70A 1H31B 351CA 2QG4A 2B11B 2RN0A 1FI3A 2CE0A 1AOFA 1CSXA 1CSWA 4FAVA 3PTZA 4U3FD 5TISV 1GJQA 1GDVA 2C1DA 1SQPD 2B12B 3A0BV 2CXBA 1E29A 1RAQA 1A8CA 2DGEA 1LC2A 5CIHB 1KYOW 2EXVA 2B0ZB 2IBZD 2D0SA 4WQ7A 2PCCB 1JDLA 2AI5A 3H1KD 5CIFB 1RZ6A 5KKZB 1CRGA 1EZVD 2ZZS1 4O1WA 1CYIA 3CWBD 3TDKA 1CIHA 3WUIA 4FANA 1HH7A 2C9XB 3L72D 3L4OA 1ZRTD 4O1QA 5B5EV 2AXTV 1KIBA 2ZOOA 4K3IA 3SLEA 1GIWA 1FI9A 1QN2A 2BH5X 1CYJA 1CIFA 3SVWA 4PD4D 1NMLA 1EB7A 1DT1A 3KHUA 4WQ8A 2V07A 4EICA 1LS9A 3CYTI 3O0RC 3OA8B 3PXTA 451CA 5H2FV 2N18B 1H32A 4EIFA 3OCDA 4LJIA 1W5CT 4WQAA 4WQBA 1KX2A 2BLFB 1DW2A 4AALA 1A2SA 3CX5W 1NU1D 2MTAC 3BCCD 3L70D 1C7MA 1H32B 4GYDA 1E8EA 2C1UA 1NMIA 3OA8A 2PCBB 4WQCA 2JTIB 4PWAA 5DFSA 1I6EA 3ORVA 1N9CA 1H1OA 1KYOD 5B6QA 3A9FA 1PPJD 2GB8B 1C2NA 1C6RA 1P84D 2K9JB 1L9JC 2JQRA 1N90A 1S5LV 3X39A 2YK3A 3M97X 1C6SA 2YIUB 3L71D 3O5CA 4FA1A 4WQ9A 1YEBA 3WFEC 1ZZHA 4RJTA 1FI7A 5KAIV 5CIGB 5CICB 3WFBC 4Y5RA 3VNWA 1K3HA 1MG2D 1C6OA 3DR0A 3H1LD 1CRJA 1H9XA 3PXSA 3C2CA 3CP5A 3WFCC 4AAMA 1CORA 3TGUD 1AOQA 1KB9D 4AANA 1HROA 1RZ5A 2C1DB 4JCGA 2CE1A 1KX7A 1CTJA 2N9YB 1DIQC 1LMSA 4V2KA 1OCDA 2GC7D 2ZONG 1DW0A 1WEJF 1H31A 1FHBA 4J20A 2JWAA 1DVHA 5GTIV 1NTZD 1U75B 1SQQD 1C52A 4EDFA 3OCDB 3SJLA 3PXWA 3SXTA 3PH2B 1I54A 1YTCA 4D6TD
chains in the Genus database with same CATH superfamily
1LGHB 1LTAC 2MJZA 3CMEP 5AW6B 1DW3A 5KTBA 2FXOA 1S4XA 3GHGA 2HV4A 1K73Q 4R4LA 1MZ4A 5AW8B 4EIJA 5L8RJ 3O1YA 3IF4A 1JOCA 2N1TC 3FWLA 1CRCA 2Y0EA 4PJ0V 2WT7B 3NFQA 5TISE 1GQ1A 3CMAP 1EZVG 3CCUP 1NTZK 1OXZA 2YCCA 4Y99B 3BRVB 1WRGA 2W6BA 3AECC 4WY4B 3WU2H 1HGZA 5C0ZA 4IOIH 2LKMA 3TNUB 2YKQA 1URQD 3H1HJ 3U1CA 5DF5A 1LT1A 2C2CA 4BRYA 3U59A 3WUTA 1BCCE 2AXTE 3L73J 1A02F 1JY2P 4N0KA 1GK6A 4C7RA 2BH4X 2QJYB 1NTMG 1L4AB 2AXTH 3A0HH 3WC8A 2KP8A 1J1DB 2I1KA 4YE1A 4CPGA 2O3JA 2FRCA 1U7MA 4I2LC 1W2BO 3CCSP 3A0HE 1D7MA 2ZT9C 1FS0E 2ZFCA 1OAEA 5GTHV 4GDOA 5CJ0A 3ZDMA 5CBNA 1LWUC 2Y0DA 3FXEA 3I5CA 1KILE 3HUSC 3CU4A 1MG3D 2Y0CA 5TJHA 4QAOA 3WFDC 3OA7A 1AYGA 3SFEC 5KKZC 4YXWH 4WB4A 1KB0A 1I6DA 1LTJC 5AW9B 4H0LB 1J3SA 2L5GB 2W6AA 4P4QB 3RK2C 2Y9YA 3CXHH 5CCGC 2M8RA 2FWLA 3L73G 4A7PA 1YYCA 1H0TB 1YJNP 1WVEC 1OZHA 1YTZT 1CRIA 4WQDA 2PACA 1IJDB 1SQPE 2C9LY 1G2CA 3JC22 2GUVA 4H13C 1ZR2A 3CXHE 2IYOA 3H1LG 1BL9A 1CXAA 3TF5A 1Q7YQ 1DW1A 1ZN5A 3L75E 1M6ZA 1IRWA 2C1VA 3HQ9A 3D71A 1IK7A 1W5CE 2PP6A 1BCCJ 4AX3A 1GU4A 1RF1A 2WVRA 1CRYA 1QL4A 3AE7C 3KZIE 1NYHA 5APVA 2L4DA 1SQXG 3JCUE 2QE7H 3SSUA 3II6A 1NNOA 1S1CX 4XA4A 4Y28J 1IZL0 5GTIH 2N9IA 1MUUA 2YO2A 2LITA 1ZXGA 1A56A 2OYHA 4IL6V 2NPSA 3JCUH 1CZQA 1KYOI 5IY51 1FDIA 2P7JA 4EYYQ 1M1JA 2B87A 2ZVOB 1IQCA 2HR3A 4GOEA 3L74D 1NVOA 3QWOC 2WPRA 4KMGA 3ZIYA 3GG2A 3H1JE 2Q1KA 1GKSA 3RK3D 4KJMA 1J2JB 2QRXA 3CWBJ 2H88C 3AE3C 2QJYC 4L75A 2GM4A 3HE4A 1NTMD 1GU2A 3NWVA 4HJGH 5B5EH 1LP1B 5CCGD 2GIWA 1J1DC 2HODA 1HZUA 2N3YA 4OWFA 1H31B 351CA 1MFZA 2A06E 5CJ4A 2RN0A 1G1IA 2B88A 2OYIC 1GDVA 1RF0C 2C1DA 1SQPD 2ZYDA 4I1LA 3GF3A 1LC2A 2GUSA 1KYOW 3L75G 2HPCA 3LIEA 1AQTA 5DJTB 1AQ5A 3B5NC 2NZ2A 3BATA 3L70J 5AW4B 5CBOA 3H1KD 1M90Q 1M1JC 5KKZB 1CRGA 1EZVD 4O1WA 5GTHE 3CLQA 1PIXA 2QJPC 2NPSC 3GMAA 3G3ZA 1GL2B 1FI9A 3L37A 1CYJA 2R32A 4PD4D 2A45G 1GDTA 1LT9C 2LXBA 4L73A 3PJSK 1VDFA 2OYIA 1LS9A 3O0RC 1SQBK 3OA8B 4B86A 3PXTA 451CA 5H2FV 2M5AB 1KB9E 1X22A 1IFIA 4GODA 2HFED 1SLQA 4WQBA 4U3FE 2QVAA 1KMIZ 4DZOA 1A2SA 3L70D 1C7MA 1HF9A 1H32B 1KZUB 1PGPA 2FFDC 2JR8A 4WQCA 3EFGA 2WSCH 3HD7D 3NMDA 3T97A 2WMMA 5CHXA 5DFSA 3L74E 1I6EA 3ORVA 1QLED 1GL2D 2IFNA 1KYOD 5B6QA 2GB8B 2JO1A 3LW5H 2K9JB 1L9JC 4H44B 1S5LV 1A02J 2KSEA 1JTHA 1KQGB 2YIUB 4UB8H 2FYNC 1VQLP 1NU1G 3G6EP 3L75J 1YHQP 2W27A 5KAIV 4Y5RA 2BEZF 2WQYC 2V7QH 1PP9G 3VNWA 2Z5IA 1JTHB 1C6OA 3B8EB 4UB8E 1SQVJ 2IBZG 2DW3A 2K9JA 3IR9A 3CP5A 1CORA 3TGUD 1UIIA 4AANA 1K8AQ 1RZ5A 1DH3A 1L2PA 1DIQC 3WUUA 3ABVC 3AE6C 4V2KA 1USDA 4M3LA 1OCDA 3H1HE 3AEGC 1DW0A 3RBXA 1IFJA 1EZVE 2OTLP 1PFIA 1U75B 1JY3N 2NPSD 4C46A 1I54A 2M5AA 3A5TA 1L0LG 2D2CC 4XXLA 2KS1A 3L36A 3L75D 2OYIB 1SFCB 3D6ZA 3JBTB 2V4HA 1KILB 2M3BA 3O6QB 1LTIC 1LJ2A 4MU8A 5E79E 1IO3A 1U57A 1ZMEC 155CA 1SQVD 2I8DA 2WPSA 1I8OA 2K9YA 2YO3A 1JY3P 1X9VA 5AURA 3BRTB 1CO6A 2E75C 2DVHA 1L4AD 4JYCA 2AEMA 3QH9A 1OFCX 1PL5A 1Q81Q 1GL2C 1SQQJ 1DD3A 1IRVA 1CSUA 3A0HV 2VHDA 1YBKA 2J59M 2C9NY 1QYZA 1FZGA 1CXCA 4I7ZC 1G1JA 3H25A 1W2EA 2R3CA 2FFDA 1BSHA 3HD7B 4L3HA 2E76B 2BGVX 2POHA 1U74B 3C1LA 2E74B 1LP1A 2KYVA 1PZQA 1S2EA 1T3JA 2JWDA 3MHVA 1CRHA 3ZOWA 2MKVA 1YITP 4Q5PA 2CA3B 1FDOA 2KZIA 4K3AA 4ZKUA 3H1ID 2P2UA 3AEAC 3AE4C 1M1KQ 4IL6E 3TGUE 3ZOYA 3AEFC 4JYBA 3CL3D 5APSA 2WSEJ 3ZOOA 5AVWB 2B87B 3A7OA 1DIIC 3V5BA 3EFFK 3H1HD 1VQPP 1C2RA 5TISH 2Z4EA 1SQVK 3LW5J 2IZ1A 1OX3A 1VF5D 2E74D 3G9RA 1ETPA 1NO4A 1COTA 4HYTB 1HTLC 3CXHD 2GC4D 3Q1MA 4OH8B 2OZ1A 1M56D 4ASWA 1YICA 1NKNA 1M60A 2V08A 1AVYA 1NTZG 1FOCA 1CNOA 5KAIE 1USEA 1HZVA 2YMYA 2HG5D 3RLMA 2IDBA 3RK2D 2FKWB 3VP8A 3VMZA 1CTZA 4UB8V 5APUA 3WUVA 1FZCB 1I5TA 1NJIQ 2BCCJ 3D70A 1CTYA 3V2RA 1BGYJ 3S9OA 4D6TE 2N18C 1LC1A 3PP5A 5AVSB 1L9BC 1SQQK 3CC7P 4OVNF 1MFTA 2C0WA 4FA9A 3KQGA 1CHHA 4DCKA 1SP4A 3DMIA 3I56P 3F5HA 1KYOE 1PGJA 4DT0A 1NTMJ 2QM7A 1ZOYC 1URQB 1FBMA 1KB9I 3H1JD 3L70G 2OYHC 1YTZI 1L0LJ 1VQ6P 3H32A 3S4RA 2BCCD 1N73C 4GEDB 1BGYG 3CX5D 1KTMA 1YFCA 3P8CD 4HH2A 3CCRP 5H2FE 1IZNB 1B7VA 3TGUG 4NFGB 1CHIA 2YMKA 1Q82Q 3CWBE 5DJQB 2KNCB 4RESB 1FC2C 2E76C 2A06D 1SQBE 2XNXA 1VF5C 2E74C 1JUNA 1QX8A 1LNQA 3V4QA 4DY9A 3RBZA 2AIUA 1OIPA 1L4AA 3GLMA 3RK3C 1I8PA 1FJKA 1N7SA 1CCHA 1JB0J 1N7SC 1HWTC 4NPEA 1M70A 1FZBA 1ZW0A 2P67A 2QG4A 3KYQA 3HE5B 1FI3A 1L0NJ 1CSXA 1LTBC 3LIDA 2JP3A 4H13D 3KZIH 2B12B 2Q3IA 3TNUA 2K1AA 2B9BA 1SQPG 1GW4A 1E29A 3E1IA 5CCGA 1Z56A 2I1JA 4NPDA 5CIHB 4WVZA 3L74J 2EXVA 1FZFA 4WY4A 2D0SA 4AQRD 3SWYA 1IFNA 5AVYB 4PD4E 3GF7A 2AI5A 5CIFB 1LTGC 1CIHA 1VQ8P 4FANA 3L72D 1N73A 3B5ND 3AEEC 5APWA 5B5EV 1S9KD 2AXTV 4BXLA 4ZMDA 4K3IA 1PV3A 4IL6X 2BH5X 3VOPA 4OGQD 1OW8A 1ZLLA 4N78D 4EI2A 3KHUA 1SQPJ 1R5SA 1IFDA 3Q5SA 3VMXA 4R4MA 2N18B 1S72P 1QL2A 4EIFA 3OCDA 4LJIA 5B66E 5AVQB 4AALA 2YNYA 2FXMA 3H1KJ 5K5GB 1E8EA 3MIWA 2WSFJ 2JTIB 4PWAA 1JO5A 1EDIA 1FU1A 5BVZA 1NH4A 2RKLA 1PPJG 1N9CA 1H1OA 2FYZA 2ZYGA 3WMM0 2JQRA 1N90A 3CD6P 1NTZJ 3C9IA 3X39A 2UWJE 2ZT9B 4TT3H 1NU1E 3M97X 2R3SA 2LXCB 4D6TJ 1JNMA 4U7JA 1YEBA 1N73B 5GTHH 3H6PA 3CXHI 1FI7A 5CIGB 1GK4A 5KLVK 1KYOH 1YQ3C 2CPSA 3E7KA 1R5LA 3MUDC 1K3HA 1MG2D 3DR0A 1LTJB 4W80A 4H0LC 1CRJA 2QSIA 3BCCJ 1ZV8A 2Q6QA 2O01J 2IZ0A 1AOQA 1VF5B 3GHGC 1HVVA 2Q7CA 1CTJA 2N9YB 1SVFA 4YPCA 3HE5A 2WPQA 1JEKA 1FOSF 1TU3F 4H44D 3B4SA 3MZWB 2ZONG 5CCHA 1NHLA 1GD2E 2YXRB 3FWNA 1FHBA 2JWAA 1DVHA 2W90A 2WZ7A 1SQQD 1C52A 4EDFA 1N7SB 3L72E 2W6JH 1JY2N 4D6TD 2KIKA 2WSEH 3KZIV 5AVXB 5KLVG 1FJ0A 3CCVP 1EDKA 3R2PA 1Q2NA 1WMKA 1SQXD 3TK1A 1BDDA 2P1JA 3AE8C 4IFDK 1DEEG 4OGQC 5CCHD 2H89C 1W2LA 2RMZA 3AE9C 4KT0J 1KD1Q 3H1LJ 2M3EA 1NTZE 3V6IA 2KNCA 1VQOP 3M9QA 2O01H 2H43A 3TGUJ 1K04A 2OTKE 2WSSH 3N4XA 1T2KC 2QIWA 4O9BA 2WWWA 1HCMA 2N9BA 2KUBA 4GKGA 3H32B 4ASVA 2PRRA 1YIJP 4PV1D 1YEAA 3K5BA 1URQA 1CEDA 1BDCA 3CX5E 1NTKG 1XTGB 3EQ2A 2W83C 2H7HA 2A06G 3AE1C 5AVRB 1SQXJ 1YCCA 3AE5C 1HJ4A 1U7JA 5E79V 1IFPA 3IAOA 1RQUA 1NTKD 4L1QA 2BASA 3CCMP 4PW9B 1CW5A 1QVFO 1KV4A 1LFMA 1QEXA 1IO4A 2YXQB 2QJKB 1Y8AA 1NGMB 1YI2P 1R0QA 2AXCA 4IL6H 5B66V 1FZCA 4EIDA 1P84E 1C75A 3FX0A 4EIEA 1HJ3A 5E79H 4YXDC 1N2DC 2A45I 4UB6E 1VYDA 1F1FA 2FYUE 1YIQA 3L4FA 2N9JA 2OZ1B 1P84H 1F1CA 1NWQA 2O01N 1M8OB 4K35A 3ZCFA 2FY8A 5C39A 1E2RA 3CC2P 1SQXE 1N50A 1FZEA 3USSA 1I55A 2FYUJ 1CIEA 3CXHW 3G71P 3HQ7A 2IPPA 2QJPB 3ZBMA 1H33A 2Q9IA 2KK7A 1S9KE 3E1RA 3H1IJ 2Y9ZA 3DP5A 1Q90D 1QVGO 3VMAA 3GW6A 4L3GA 2LR2A 1EXJA 1H9YA 4AYCA 4MN4C 2C8SA 3M9BA 3PRJA 1LT9B 2ZXXA 1L0LD 1YNRA 3IN6A 3A0BH 3D6YA 4FB1A 1BE3J 2AEFA 3NBTA 5KAFH 3TYIA 1S5LH 4PD4H 1CYCA 1GW3A 3VYMA 1KN7A 2B4ZA 3PLNA 1KQLA 1CSVA 3RK3E 3OJAB 5AVTB 4OGQB 1N15A 1IK9A 3JSVC 1NTME 5KJ7A 1S5LE 2YQBA 3HD7A 2FFDB 1DVVA 2N1TB 1VQMP 1AFOA 2OGUA 5CIDB 3P8CE 1HRCA 3VRDA 1YJ9P 1BCCG 5B5EE 1PP9E 5APTA 5KAFV 2XDJA 4KHXA 2MHMA 3Q5RA 1DX7A 1SQBD 4RKUJ 1BE3G 5B66H 2FYNB 5KLVJ 1L0ND 1MZ9A 4C7NB 1EQ7A 3H1KE 1DIPA 5KAIH 4L74A 5AW5B 2JJLA 3A2AA 5AW7B 5APYA 3RL0D 2KXPB 3ITKA 5AW3B 3O6QA 2RH0A 1BE3E 2BPBB 1KILA 3Q3DA 1SFCA 1JY2O 3SFDC 3L72J 2KS1B 3EWKA 1RAPA 4UB6H 4PD4I 3IFMA 3M0DA 1L0LK 2G3AA 1AKKA 3WU2V 1K05A 2L91A 2D2CB 4W7ZA 1PGOA 2CK3H 3W67A 2OARA 2CE0A 1AOFA 1UIXA 1CSWA 2PGDA 4FAVA 3PTZA 4U3FD 1KILC 1N86A 2K88A 3A0BV 1EXIA 2CXBA 2ZVNB 1LWUB 1A8CA 2DGEA 1E79H 3RL0g 1AJYA 1JCDA 2B0ZB 1HJBA 3A3YB 3FGAD 4WQ7A 2ZYAA 2PCCB 1NOHA 5KLIC 1RZ6A 2E5YA 2ZZS1 2IFMA 3TDKA 2E75B 3WUIA 2C9XB 3NTNA 3L4OA 2KLVA 1NKZB 3O8ZA 1OVUA 2A45H 1JY3O 3B5NA 2XU6A 4HKZH 3Q5PA 1KIBA 2ZOOA 2H8PD 5APQA 1H89A 1QN2A 1CIFA 3SVWA 1LTSC 1RQVA 3VP9A 1NMLA 1RF0A 1DT1A 1M57D 3T97B 4LGDE 2V07A 4EICA 1ZRTE 1RF1C 1SQQG 1H32A 1QL1A 1M7LA 4WQAA 3KPEA 1NTKE 1KX2A 1L0NE 4PJ0E 2O1KA 1NU1D 3M0DC 2FYUG 1SS1A 3HTKA 2C1UA 3BVHA 3OA8A 3Q2YA 4JPZB 2PCBB 2KLUA 3H1JG 3HRNA 1BSNA 2HLOA 3A9FA 1C2NA 3VN0A 1P84D 1R8EA 3V2PA 3CPWO 1FOSE 1GL2A 1FZAA 1NTMK 3BCCE 1P84I 1C6SA 2GA1A 1X8YA 2KB7P 4FA1A 2IBZI 4WQ9A 3WFEC 2M0BA 1FAVA 2Q5UA 1ZZHA 2R44A 5CICB 3WFBC 4AUWA 1JCCA 1T8ZA 1LTTC 1Y47A 1KQSO 4N6JA 1H9XA 3PXSA 1NU1J 2HPCB 3CC4P 2OTJP 3C2CA 4IFFA 2WSFH 3WFCC 4AAMA 1KB9D 1MKMA 4JCGA 2C1DB 2CE1A 1PP9J 1KX7A 4H0LD 1RE3C 1YQ4C 1LMSA 3L70E 3HTKB 5EFWB 3P8MC 2AEJA 2FYUK 1EZVI 2D2CD 1H31A 4J20A 2HODB 3CX5I 1NTZD 1J1EB 2KZJA 3H1LE 3PXWA 4RO0A 3PH2B 4L76A 2VRSA 5AVVB 1YTCA 3L71J 3HE4B 3M91A 3W68A 1NU1K 3CCJP 1RE3A 2PFXA 1NIRA 4GT1A 3MK7C 3L73D 3VMYA 2WSCJ 2B89A 2KI7B 3C8VA 2J58A 4JQ0D 5APXA 4IFMA 4D6TG 3B5NB 1VQ7P 2I8FA 3SWKA 5KLIB 3L72G 1M1JB 1DD4A 1PP9D 3A0BE 2YKOA 4WBAA 1HUCA 1NAYA 1FCDC 2N3BA 1K3GA 1L0NK 2CA4B 3VTPC 4N3YB 1NAFA 2NPSB 5GTIE 2OYHB 1VQNP 2K37A 2E5TA 4W7YA 2ORLA 1CHJA 3VYIA 1LWUA 2ZXYA 3V4WA 4DOJA 2W8ZA 1HJ5A 2B10B 2XV5A 5DJQC 1ZR4A 3RN0A 3O20A 1RF1B 2ITAA 1IC2A 4GOFA 1CIGA 3MGNA 1KFMA 3CI9A 2FYUD 1EC5A 1KFNA 2O1JA 2D0WA 3RK3B 3S1KA 1FJPA 5KAFE 4FA5A 1XTCC 2NRGA 3NXSA 4XYDB 1RY3A 1SQVE 3RGUA 3L4MA 4H0JA 1CSBA 1PPJE 2WITA 1KV9A 3CX5H 2LIRA 1G2CB 4H44C 3KDPB 5AVUB 1JM0A 4JF7A 1H0TA 2YIUC 3L71E 1BGYD 5BU8B 2K3RA 4C7NA 1H8AA 5EXQA 1NTKK 2SPZA 3M0AA 3MUDA 1HGVA 1EDJA 4AAOA 2OYOA 3P32A 1KB9H 4FA4A 1L0LE 1NTKJ 2WPVB 1WT6A 2ZBOA 1VQ5P 2PAJA 3V2NA 4WWIA 3SWSA 2ZJSE 4RSZA 1RE4A 3H1HG 2C0XA 2N1TA 1QL3A 2E43A 1T2KD 1X79B 3RN1A 1HJ0A 4H0KA 2Z5HA 3HQ6A 2BEQD 3H1JJ 1N7LA 1SQBJ 1CCRA 1J1EC 1JMMA 4QMAA 3B71A 5KLVD 1AA0A 2IBZE 3TSIA 3P7KA 3H1IE 3CWBG 4PV1C 3HQ8A 3RMZA 1CC5A 1OW6A 1RHZB 3PHLA 3OW2O 4WQEA 1SFCC 2QM8A 3BASA 1LT9A 1FE6A 3MK7B 2P58A 1MV8A 4LLHA 2OQQA 2KOGA 2G8YA 4TLFA 1AV1A 4BRYB 1OWAA 1T6AA 4WY4D 5CIEB 1GZLA 5AW1B 1H33B 5BU5A 1YJWP 2ZXEB 1OVVA 1ZP0C 3H1KG 5CMZA 3NBSA 4EOTA 2XTSB 1JMBA 3L71G 2QEXP 3PH0A 1BE3D 3G4SP 3D0WA 1S6VB 4U3FJ 1SQBG 4UB6V 2E76D 3AEDC 1DEBA 2WT7A 4BWNA 4I7ZB 3F89A 1SQPK 1BCCD 3KXDA 1GU5A 2YKPA 1SQVG 3HD7C 1K9MQ 5AW0B 5KJ7C 1BGYE 3GHGB 1EDLA 2P10A 1H88A 3RL0C 5C9MA 3ZOXA 3AEBC 2Q3EA 1VQ4P 1N7SD 2HYNA 5CIBB 3MP7B 1FDMA 1KQFB 4XE5B 3M06A 5CYTR 1AVOA 5AW2B 2WTYA 2BCNB 1Q86Q 4N78E 1QKSA 5AVZB 1GMJA 1X0TA 3CCEP 1HH0A 3L74G 2B11B 1OW7A 1IFMA 5TISV 1GJQA 1HBWA 3FXDA 4Z1MH 1S5LX 1RAQA 2JEEA 4U3FG 5H2FH 2BCCE 3U1AA 1KILD 2IBZD 5DJUB 2CPBA 1JDLA 2ZAEB 1SFCD 1VQ9P 1QGKB 1CYIA 3CWBD 2R5BA 3HUSA 1HH7A 2KSJA 1ZRTD 4Y99C 2BCCG 4O1QA 1VQKP 4ZKPA 4WY4C 3SLEA 1GIWA 2XZRA 1SQXK 4ZNCA 2E42A 1EB7A 5M1BA 1FZCC 3OAKA 1CI6B 2JKVA 3UIAA 4WQ8A 2IX7C 1RH5B 2XKMA 3CYTI 2N1TD 3MTUE 4PV1B 1GTWA 3MD0A 4PJ0H 3WU2E 1W5CT 2FBWC 4DJGA 2BLFB 1DW2A 3CX5W 2E75D 2MTAC 3BCCD 3CCQP 1L4AC 4I6MC 4GYDA 2QJKC 1NMIA 4GIFA 4JBZA 1CI6A 1SQQE 5KJ7D 1S3JA 1Y9BA 3V2QA 1VPCA 1PPJD 2V7QJ 1C6RA 1KORA 2QA4P 1LTJA 2FXPA 3L35A 1URQC 3AE2C 4HB1A 3CCLP 2YK3A 1RE4C 3L71D 3O5CA 3BCCG 3HUSB 4RJTA 2JDIH 4NPFX 1PGQA 1OVRA 3I55P 3H1LD 2XNDH 3N7NA 2IYPA 4YTPC 3RK2B 1KC8Q 1VL2A 1OMIA 1HROA 3M9HA 4LC1A 4XFJA 3RL0B 2R5DA 1L0NG 3SWFA 3TYYA 2GC7D 4H13B 2ZT9D 3L73E 1WEJF 2J5UA 5GTIV 5KLVE 3H1IG 3OCDB 3SJLA 1E5WA 3R4YA 3SXTA 1T3UA 5CCHC 1N8RQ
chains in the Genus database with same CATH topology
4XXLA 3KZIV 1FJ0A 2KS1A 3L75D 1SQXD 3JBTB 1NIRA 1DW3A 3MK7C 2HV4A 1W2LA 4MU8A 1MZ4A 3L73D 2RMZA 1IO3A 155CA 3O1YA 1SQVD 3FWLA 1CRCA 2Y0EA 4PJ0V 1I8OA 2I8FA 5KLIB 5AURA 1GQ1A 1PP9D 1CO6A 2DVHA 1HCMA 1FCDC 2YCCA 2N3BA 1K3GA 2CA4B 1YEAA 2ORLA 1CHJA 1CEDA 1IRVA 5C0ZA 1CSUA 2ZXYA 3A0HV 2VHDA 1HJ5A 2B10B 5DF5A 1YCCA 2C2CA 5DJQC 1QYZA 1CXCA 1HJ4A 3RN0A 5E79V 3O20A 4L3HA 2BGVX 1U74B 1CIGA 4N0KA 1NTKD 4L1QA 4PW9B 2BH4X 2QJYB 2FYUD 1LFMA 1CRHA 2D0WA 2QJKB 3ZOWA 3WC8A 4FA5A 4Q5PA 2CA3B 4XYDB 1R0QA 3L4MA 4H0JA 3H1ID 4YE1A 5B66V 2O3JA 1KV9A 2FRCA 4EIDA 3ZOYA 1C75A 2LIRA 4EIEA 1HJ3A 3ZOOA 1VYDA 1F1FA 1OAEA 5GTHV 1DIIC 1BGYD 3H1HD 2Y0DA 1YIQA 1C2RA 2N9JA 3CU4A 2OZ1B 1F1CA 1MG3D 2Y0CA 5EXQA 5TJHA 4QAOA 1ETPA 3WFDC 1COTA 1AYGA 4AAOA 4FA4A 3ZCFA 3CXHD 1E2RA 2GC4D 1KB0A 1I6DA 2OZ1A 1N50A 2ZBOA 1I55A 1YICA 1J3SA 1M60A 1CIEA 2V08A 3CXHW 3HQ7A 4P4QB 2QJPB 1FOCA 3ZBMA 1CNOA 1H33A 3SWSA 4RSZA 2FWLA 4A7PA 1WVEC 1HZVA 3RLMA 1QL3A 1CRIA 4WQDA 2PACA 3DP5A 3VMAA 3GW6A 4L3GA 3RN1A 4H0KA 1CTZA 1H9YA 3HQ6A 4UB8V 2C8SA 1I5TA 3PRJA 1CCRA 1L0LD 1YNRA 5KLVD 4FB1A 3NBTA 3TYIA 1CYCA 1CTYA 3VYMA 1BL9A 2B4ZA 3HQ8A 3RMZA 2N18C 3PLNA 1CC5A 1CXAA 1CSVA 1LC1A 3TF5A 3PHLA 1DW1A 1L9BC 4WQEA 1M6ZA 1IRWA 2C1VA 3HQ9A 4FA9A 3MK7B 4AX3A 1N15A 1CHHA 2YQBA 1DVVA 1CRYA 1QL4A 5CIDB 2L4DA 3DMIA 1HRCA 5CIEB 3VRDA 1H33B 1NNOA 1IZL0 5KAFV 2N9IA 2LITA 2MHMA 3NBSA 3H1JD 1A56A 1SQBD 2XTSB 4IL6V 2FYNB 2BCCD 1BE3D 1L0ND 4GEDB 5IY51 1S6VB 3CX5D 1YFCA 4UB6V 1B7VA 4NFGB 1CHIA 1IQCA 5DJQB 2KNCB 3L74D 1BCCD 4KMGA 3ZIYA 3GG2A 2A06D 1GKSA 3ITKA 2BPBB 5C9MA 3ZOXA 4DY9A 2Q3EA 5CIBB 2AIUA 1RAPA 1NTMD 1GU2A 1AKKA 1I8PA 3NWVA 5CYTR 3WU2V 1CCHA 2BCNB 1QKSA 2GIWA 1HZUA 2L91A 2N3YA 1M70A 1H31B 351CA 2QG4A 2B11B 2RN0A 1FI3A 2CE0A 1AOFA 1CSXA 1CSWA 4FAVA 3PTZA 4U3FD 5TISV 1GJQA 1GDVA 2C1DA 1SQPD 2B12B 3A0BV 2CXBA 1E29A 1RAQA 1A8CA 2DGEA 1LC2A 5CIHB 1KYOW 2EXVA 2B0ZB 2IBZD 2D0SA 4WQ7A 2PCCB 1JDLA 2AI5A 3H1KD 5CIFB 1RZ6A 5KKZB 1CRGA 1EZVD 2ZZS1 4O1WA 1CYIA 3CWBD 3TDKA 1CIHA 3WUIA 4FANA 1HH7A 2C9XB 3L72D 3L4OA 1ZRTD 4O1QA 5B5EV 2AXTV 1KIBA 2ZOOA 4K3IA 3SLEA 1GIWA 1FI9A 1QN2A 2BH5X 1CYJA 1CIFA 3SVWA 4PD4D 1NMLA 1EB7A 1DT1A 3KHUA 4WQ8A 2V07A 4EICA 1LS9A 3CYTI 3O0RC 3OA8B 3PXTA 451CA 5H2FV 2N18B 1H32A 4EIFA 3OCDA 4LJIA 1W5CT 4WQAA 4WQBA 1KX2A 2BLFB 1DW2A 4AALA 1A2SA 3CX5W 1NU1D 2MTAC 3BCCD 3L70D 1C7MA 1H32B 4GYDA 1E8EA 2C1UA 1NMIA 3OA8A 2PCBB 4WQCA 2JTIB 4PWAA 5DFSA 1I6EA 3ORVA 1N9CA 1H1OA 1KYOD 5B6QA 3A9FA 1PPJD 2GB8B 1C2NA 1C6RA 1P84D 2K9JB 1L9JC 2JQRA 1N90A 1S5LV 3X39A 2YK3A 3M97X 1C6SA 2YIUB 3L71D 3O5CA 4FA1A 4WQ9A 1YEBA 3WFEC 1ZZHA 4RJTA 1FI7A 5KAIV 5CIGB 5CICB 3WFBC 4Y5RA 3VNWA 1K3HA 1MG2D 1C6OA 3DR0A 3H1LD 1CRJA 1H9XA 3PXSA 3C2CA 3CP5A 3WFCC 4AAMA 1CORA 3TGUD 1AOQA 1KB9D 4AANA 1HROA 1RZ5A 2C1DB 4JCGA 2CE1A 1KX7A 1CTJA 2N9YB 1DIQC 1LMSA 4V2KA 1OCDA 2GC7D 2ZONG 1DW0A 1WEJF 1H31A 1FHBA 4J20A 2JWAA 1DVHA 5GTIV 1NTZD 1U75B 1SQQD 1C52A 4EDFA 3OCDB 3SJLA 3PXWA 3SXTA 3PH2B 1I54A 1YTCA 4D6TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XXL A;  3KZI V;  1FJ0 A;  2KS1 A;  3L75 D;  1SQX D;  3JBT B;  1NIR A;  1DW3 A;  3MK7 C;  2HV4 A;  1W2L A;  4MU8 A;  1MZ4 A;  3L73 D;  2RMZ A;  1IO3 A;  155C A;  3O1Y A;  1SQV D;  3FWL A;  1CRC A;  2Y0E A;  4PJ0 V;  1I8O A;  2I8F A;  5KLI B;  5AUR A;  1GQ1 A;  1PP9 D;  1CO6 A;  2DVH A;  1HCM A;  1FCD C;  2YCC A;  2N3B A;  1K3G A;  2CA4 B;  1YEA A;  2ORL A;  1CHJ A;  1CED A;  1IRV A;  5C0Z A;  1CSU A;  2ZXY A;  3A0H V;  2VHD A;  1HJ5 A;  2B10 B;  5DF5 A;  1YCC A;  2C2C A;  5DJQ C;  1QYZ A;  1CXC A;  1HJ4 A;  3RN0 A;  5E79 V;  3O20 A;  4L3H A;  2BGV X;  1U74 B;  1CIG A;  4N0K A;  1NTK D;  4L1Q A;  4PW9 B;  2BH4 X;  2QJY B;  2FYU D;  1LFM A;  1CRH A;  2D0W A;  2QJK B;  3ZOW A;  3WC8 A;  4FA5 A;  4Q5P A;  2CA3 B;  4XYD B;  1R0Q A;  3L4M A;  4H0J A;  3H1I D;  4YE1 A;  5B66 V;  2O3J A;  1KV9 A;  2FRC A;  4EID A;  3ZOY A;  1C75 A;  2LIR A;  4EIE A;  1HJ3 A;  3ZOO A;  1VYD A;  1F1F A;  1OAE A;  5GTH V;  1DII C;  1BGY D;  3H1H D;  2Y0D A;  1YIQ A;  1C2R A;  2N9J A;  3CU4 A;  2OZ1 B;  1F1C A;  1MG3 D;  2Y0C A;  5EXQ A;  5TJH A;  4QAO A;  1ETP A;  3WFD C;  1COT A;  1AYG A;  4AAO A;  4FA4 A;  3ZCF A;  3CXH D;  1E2R A;  2GC4 D;  1KB0 A;  1I6D A;  2OZ1 A;  1N50 A;  2ZBO A;  1I55 A;  1YIC A;  1J3S A;  1M60 A;  1CIE A;  2V08 A;  3CXH W;  3HQ7 A;  4P4Q B;  2QJP B;  1FOC A;  3ZBM A;  1CNO A;  1H33 A;  3SWS A;  4RSZ A;  2FWL A;  4A7P A;  1WVE C;  1HZV A;  3RLM A;  1QL3 A;  1CRI A;  4WQD A;  2PAC A;  3DP5 A;  3VMA A;  3GW6 A;  4L3G A;  3RN1 A;  4H0K A;  1CTZ A;  1H9Y A;  3HQ6 A;  4UB8 V;  2C8S A;  1I5T A;  3PRJ A;  1CCR A;  1L0L D;  1YNR A;  5KLV D;  4FB1 A;  3NBT A;  3TYI A;  1CYC A;  1CTY A;  3VYM A;  1BL9 A;  2B4Z A;  3HQ8 A;  3RMZ A;  2N18 C;  3PLN A;  1CC5 A;  1CXA A;  1CSV A;  1LC1 A;  3TF5 A;  3PHL A;  1DW1 A;  1L9B C;  4WQE A;  1M6Z A;  1IRW A;  2C1V A;  3HQ9 A;  4FA9 A;  3MK7 B;  4AX3 A;  1N15 A;  1CHH A;  2YQB A;  1DVV A;  1CRY A;  1QL4 A;  5CID B;  2L4D A;  3DMI A;  1HRC A;  5CIE B;  3VRD A;  1H33 B;  1NNO A;  1IZL 0;  5KAF V;  2N9I A;  2LIT A;  2MHM A;  3NBS A;  3H1J D;  1A56 A;  1SQB D;  2XTS B;  4IL6 V;  2FYN B;  2BCC D;  1BE3 D;  1L0N D;  4GED B;  5IY5 1;  1S6V B;  3CX5 D;  1YFC A;  4UB6 V;  1B7V A;  4NFG B;  1CHI A;  1IQC A;  5DJQ B;  2KNC B;  3L74 D;  1BCC D;  4KMG A;  3ZIY A;  3GG2 A;  2A06 D;  1GKS A;  3ITK A;  2BPB B;  5C9M A;  3ZOX A;  4DY9 A;  2Q3E A;  5CIB B;  2AIU A;  1RAP A;  1NTM D;  1GU2 A;  1AKK A;  1I8P A;  3NWV A;  5CYT R;  3WU2 V;  1CCH A;  2BCN B;  1QKS A;  2GIW A;  1HZU A;  2L91 A;  2N3Y A;  1M70 A;  1H31 B;  351C A;  2QG4 A;  2B11 B;  2RN0 A;  1FI3 A;  2CE0 A;  1AOF A;  1CSX A;  1CSW A;  4FAV A;  3PTZ A;  4U3F D;  5TIS V;  1GJQ A;  1GDV A;  2C1D A;  1SQP D;  2B12 B;  3A0B V;  2CXB A;  1E29 A;  1RAQ A;  1A8C A;  2DGE A;  1LC2 A;  5CIH B;  1KYO W;  2EXV A;  2B0Z B;  2IBZ D;  2D0S A;  4WQ7 A;  2PCC B;  1JDL A;  2AI5 A;  3H1K D;  5CIF B;  1RZ6 A;  5KKZ B;  1CRG A;  1EZV D;  2ZZS 1;  4O1W A;  1CYI A;  3CWB D;  3TDK A;  1CIH A;  3WUI A;  4FAN A;  1HH7 A;  2C9X B;  3L72 D;  3L4O A;  1ZRT D;  4O1Q A;  5B5E V;  2AXT V;  1KIB A;  2ZOO A;  4K3I A;  3SLE A;  1GIW A;  1FI9 A;  1QN2 A;  2BH5 X;  1CYJ A;  1CIF A;  3SVW A;  4PD4 D;  1NML A;  1EB7 A;  1DT1 A;  3KHU A;  4WQ8 A;  2V07 A;  4EIC A;  1LS9 A;  3CYT I;  3O0R C;  3OA8 B;  3PXT A;  451C A;  5H2F V;  2N18 B;  1H32 A;  4EIF A;  3OCD A;  4LJI A;  1W5C T;  4WQA A;  4WQB A;  1KX2 A;  2BLF B;  1DW2 A;  4AAL A;  1A2S A;  3CX5 W;  1NU1 D;  2MTA C;  3BCC D;  3L70 D;  1C7M A;  1H32 B;  4GYD A;  1E8E A;  2C1U A;  1NMI A;  3OA8 A;  2PCB B;  4WQC A;  2JTI B;  4PWA A;  5DFS A;  1I6E A;  3ORV A;  1N9C A;  1H1O A;  1KYO D;  5B6Q A;  3A9F A;  1PPJ D;  2GB8 B;  1C2N A;  1C6R A;  1P84 D;  2K9J B;  1L9J C;  2JQR A;  1N90 A;  1S5L V;  3X39 A;  2YK3 A;  3M97 X;  1C6S A;  2YIU B;  3L71 D;  3O5C A;  4FA1 A;  4WQ9 A;  1YEB A;  3WFE C;  1ZZH A;  4RJT A;  1FI7 A;  5KAI V;  5CIG B;  5CIC B;  3WFB C;  4Y5R A;  3VNW A;  1K3H A;  1MG2 D;  1C6O A;  3DR0 A;  3H1L D;  1CRJ A;  1H9X A;  3PXS A;  3C2C A;  3CP5 A;  3WFC C;  4AAM A;  1COR A;  3TGU D;  1AOQ A;  1KB9 D;  4AAN A;  1HRO A;  1RZ5 A;  2C1D B;  4JCG A;  2CE1 A;  1KX7 A;  1CTJ A;  2N9Y B;  1DIQ C;  1LMS A;  4V2K A;  1OCD A;  2GC7 D;  2ZON G;  1DW0 A;  1WEJ F;  1H31 A;  1FHB A;  4J20 A;  2JWA A;  1DVH A;  5GTI V;  1NTZ D;  1U75 B;  1SQQ D;  1C52 A;  4EDF A;  3OCD B;  3SJL A;  3PXW A;  3SXT A;  3PH2 B;  1I54 A;  1YTC A;  4D6T D; 
#chains in the Genus database with same CATH topology
 1LGH B;  1LTA C;  2MJZ A;  3CME P;  5AW6 B;  1DW3 A;  5KTB A;  2FXO A;  1S4X A;  3GHG A;  2HV4 A;  1K73 Q;  4R4L A;  1MZ4 A;  5AW8 B;  4EIJ A;  5L8R J;  3O1Y A;  3IF4 A;  1JOC A;  2N1T C;  3FWL A;  1CRC A;  2Y0E A;  4PJ0 V;  2WT7 B;  3NFQ A;  5TIS E;  1GQ1 A;  3CMA P;  1EZV G;  3CCU P;  1NTZ K;  1OXZ A;  2YCC A;  4Y99 B;  3BRV B;  1WRG A;  2W6B A;  3AEC C;  4WY4 B;  3WU2 H;  1HGZ A;  5C0Z A;  4IOI H;  2LKM A;  3TNU B;  2YKQ A;  1URQ D;  3H1H J;  3U1C A;  5DF5 A;  1LT1 A;  2C2C A;  4BRY A;  3U59 A;  3WUT A;  1BCC E;  2AXT E;  3L73 J;  1A02 F;  1JY2 P;  4N0K A;  1GK6 A;  4C7R A;  2BH4 X;  2QJY B;  1NTM G;  1L4A B;  2AXT H;  3A0H H;  3WC8 A;  2KP8 A;  1J1D B;  2I1K A;  4YE1 A;  4CPG A;  2O3J A;  2FRC A;  1U7M A;  4I2L C;  1W2B O;  3CCS P;  3A0H E;  1D7M A;  2ZT9 C;  1FS0 E;  2ZFC A;  1OAE A;  5GTH V;  4GDO A;  5CJ0 A;  3ZDM A;  5CBN A;  1LWU C;  2Y0D A;  3FXE A;  3I5C A;  1KIL E;  3HUS C;  3CU4 A;  1MG3 D;  2Y0C A;  5TJH A;  4QAO A;  3WFD C;  3OA7 A;  1AYG A;  3SFE C;  5KKZ C;  4YXW H;  4WB4 A;  1KB0 A;  1I6D A;  1LTJ C;  5AW9 B;  4H0L B;  1J3S A;  2L5G B;  2W6A A;  4P4Q B;  3RK2 C;  2Y9Y A;  3CXH H;  5CCG C;  2M8R A;  2FWL A;  3L73 G;  4A7P A;  1YYC A;  1H0T B;  1YJN P;  1WVE C;  1OZH A;  1YTZ T;  1CRI A;  4WQD A;  2PAC A;  1IJD B;  1SQP E;  2C9L Y;  1G2C A;  3JC2 2;  2GUV A;  4H13 C;  1ZR2 A;  3CXH E;  2IYO A;  3H1L G;  1BL9 A;  1CXA A;  3TF5 A;  1Q7Y Q;  1DW1 A;  1ZN5 A;  3L75 E;  1M6Z A;  1IRW A;  2C1V A;  3HQ9 A;  3D71 A;  1IK7 A;  1W5C E;  2PP6 A;  1BCC J;  4AX3 A;  1GU4 A;  1RF1 A;  2WVR A;  1CRY A;  1QL4 A;  3AE7 C;  3KZI E;  1NYH A;  5APV A;  2L4D A;  1SQX G;  3JCU E;  2QE7 H;  3SSU A;  3II6 A;  1NNO A;  1S1C X;  4XA4 A;  4Y28 J;  1IZL 0;  5GTI H;  2N9I A;  1MUU A;  2YO2 A;  2LIT A;  1ZXG A;  1A56 A;  2OYH A;  4IL6 V;  2NPS A;  3JCU H;  1CZQ A;  1KYO I;  5IY5 1;  1FDI A;  2P7J A;  4EYY Q;  1M1J A;  2B87 A;  2ZVO B;  1IQC A;  2HR3 A;  4GOE A;  3L74 D;  1NVO A;  3QWO C;  2WPR A;  4KMG A;  3ZIY A;  3GG2 A;  3H1J E;  2Q1K A;  1GKS A;  3RK3 D;  4KJM A;  1J2J B;  2QRX A;  3CWB J;  2H88 C;  3AE3 C;  2QJY C;  4L75 A;  2GM4 A;  3HE4 A;  1NTM D;  1GU2 A;  3NWV A;  4HJG H;  5B5E H;  1LP1 B;  5CCG D;  2GIW A;  1J1D C;  2HOD A;  1HZU A;  2N3Y A;  4OWF A;  1H31 B;  351C A;  1MFZ A;  2A06 E;  5CJ4 A;  2RN0 A;  1G1I A;  2B88 A;  2OYI C;  1GDV A;  1RF0 C;  2C1D A;  1SQP D;  2ZYD A;  4I1L A;  3GF3 A;  1LC2 A;  2GUS A;  1KYO W;  3L75 G;  2HPC A;  3LIE A;  1AQT A;  5DJT B;  1AQ5 A;  3B5N C;  2NZ2 A;  3BAT A;  3L70 J;  5AW4 B;  5CBO A;  3H1K D;  1M90 Q;  1M1J C;  5KKZ B;  1CRG A;  1EZV D;  4O1W A;  5GTH E;  3CLQ A;  1PIX A;  2QJP C;  2NPS C;  3GMA A;  3G3Z A;  1GL2 B;  1FI9 A;  3L37 A;  1CYJ A;  2R32 A;  4PD4 D;  2A45 G;  1GDT A;  1LT9 C;  2LXB A;  4L73 A;  3PJS K;  1VDF A;  2OYI A;  1LS9 A;  3O0R C;  1SQB K;  3OA8 B;  4B86 A;  3PXT A;  451C A;  5H2F V;  2M5A B;  1KB9 E;  1X22 A;  1IFI A;  4GOD A;  2HFE D;  1SLQ A;  4WQB A;  4U3F E;  2QVA A;  1KMI Z;  4DZO A;  1A2S A;  3L70 D;  1C7M A;  1HF9 A;  1H32 B;  1KZU B;  1PGP A;  2FFD C;  2JR8 A;  4WQC A;  3EFG A;  2WSC H;  3HD7 D;  3NMD A;  3T97 A;  2WMM A;  5CHX A;  5DFS A;  3L74 E;  1I6E A;  3ORV A;  1QLE D;  1GL2 D;  2IFN A;  1KYO D;  5B6Q A;  2GB8 B;  2JO1 A;  3LW5 H;  2K9J B;  1L9J C;  4H44 B;  1S5L V;  1A02 J;  2KSE A;  1JTH A;  1KQG B;  2YIU B;  4UB8 H;  2FYN C;  1VQL P;  1NU1 G;  3G6E P;  3L75 J;  1YHQ P;  2W27 A;  5KAI V;  4Y5R A;  2BEZ F;  2WQY C;  2V7Q H;  1PP9 G;  3VNW A;  2Z5I A;  1JTH B;  1C6O A;  3B8E B;  4UB8 E;  1SQV J;  2IBZ G;  2DW3 A;  2K9J A;  3IR9 A;  3CP5 A;  1COR A;  3TGU D;  1UII A;  4AAN A;  1K8A Q;  1RZ5 A;  1DH3 A;  1L2P A;  1DIQ C;  3WUU A;  3ABV C;  3AE6 C;  4V2K A;  1USD A;  4M3L A;  1OCD A;  3H1H E;  3AEG C;  1DW0 A;  3RBX A;  1IFJ A;  1EZV E;  2OTL P;  1PFI A;  1U75 B;  1JY3 N;  2NPS D;  4C46 A;  1I54 A;  2M5A A;  3A5T A;  1L0L G;  2D2C C;  4XXL A;  2KS1 A;  3L36 A;  3L75 D;  2OYI B;  1SFC B;  3D6Z A;  3JBT B;  2V4H A;  1KIL B;  2M3B A;  3O6Q B;  1LTI C;  1LJ2 A;  4MU8 A;  5E79 E;  1IO3 A;  1U57 A;  1ZME C;  155C A;  1SQV D;  2I8D A;  2WPS A;  1I8O A;  2K9Y A;  2YO3 A;  1JY3 P;  1X9V A;  5AUR A;  3BRT B;  1CO6 A;  2E75 C;  2DVH A;  1L4A D;  4JYC A;  2AEM A;  3QH9 A;  1OFC X;  1PL5 A;  1Q81 Q;  1GL2 C;  1SQQ J;  1DD3 A;  1IRV A;  1CSU A;  3A0H V;  2VHD A;  1YBK A;  2J59 M;  2C9N Y;  1QYZ A;  1FZG A;  1CXC A;  4I7Z C;  1G1J A;  3H25 A;  1W2E A;  2R3C A;  2FFD A;  1BSH A;  3HD7 B;  4L3H A;  2E76 B;  2BGV X;  2POH A;  1U74 B;  3C1L A;  2E74 B;  1LP1 A;  2KYV A;  1PZQ A;  1S2E A;  1T3J A;  2JWD A;  3MHV A;  1CRH A;  3ZOW A;  2MKV A;  1YIT P;  4Q5P A;  2CA3 B;  1FDO A;  2KZI A;  4K3A A;  4ZKU A;  3H1I D;  2P2U A;  3AEA C;  3AE4 C;  1M1K Q;  4IL6 E;  3TGU E;  3ZOY A;  3AEF C;  4JYB A;  3CL3 D;  5APS A;  2WSE J;  3ZOO A;  5AVW B;  2B87 B;  3A7O A;  1DII C;  3V5B A;  3EFF K;  3H1H D;  1VQP P;  1C2R A;  5TIS H;  2Z4E A;  1SQV K;  3LW5 J;  2IZ1 A;  1OX3 A;  1VF5 D;  2E74 D;  3G9R A;  1ETP A;  1NO4 A;  1COT A;  4HYT B;  1HTL C;  3CXH D;  2GC4 D;  3Q1M A;  4OH8 B;  2OZ1 A;  1M56 D;  4ASW A;  1YIC A;  1NKN A;  1M60 A;  2V08 A;  1AVY A;  1NTZ G;  1FOC A;  1CNO A;  5KAI E;  1USE A;  1HZV A;  2YMY A;  2HG5 D;  3RLM A;  2IDB A;  3RK2 D;  2FKW B;  3VP8 A;  3VMZ A;  1CTZ A;  4UB8 V;  5APU A;  3WUV A;  1FZC B;  1I5T A;  1NJI Q;  2BCC J;  3D70 A;  1CTY A;  3V2R A;  1BGY J;  3S9O A;  4D6T E;  2N18 C;  1LC1 A;  3PP5 A;  5AVS B;  1L9B C;  1SQQ K;  3CC7 P;  4OVN F;  1MFT A;  2C0W A;  4FA9 A;  3KQG A;  1CHH A;  4DCK A;  1SP4 A;  3DMI A;  3I56 P;  3F5H A;  1KYO E;  1PGJ A;  4DT0 A;  1NTM J;  2QM7 A;  1ZOY C;  1URQ B;  1FBM A;  1KB9 I;  3H1J D;  3L70 G;  2OYH C;  1YTZ I;  1L0L J;  1VQ6 P;  3H32 A;  3S4R A;  2BCC D;  1N73 C;  4GED B;  1BGY G;  3CX5 D;  1KTM A;  1YFC A;  3P8C D;  4HH2 A;  3CCR P;  5H2F E;  1IZN B;  1B7V A;  3TGU G;  4NFG B;  1CHI A;  2YMK A;  1Q82 Q;  3CWB E;  5DJQ B;  2KNC B;  4RES B;  1FC2 C;  2E76 C;  2A06 D;  1SQB E;  2XNX A;  1VF5 C;  2E74 C;  1JUN A;  1QX8 A;  1LNQ A;  3V4Q A;  4DY9 A;  3RBZ A;  2AIU A;  1OIP A;  1L4A A;  3GLM A;  3RK3 C;  1I8P A;  1FJK A;  1N7S A;  1CCH A;  1JB0 J;  1N7S C;  1HWT C;  4NPE A;  1M70 A;  1FZB A;  1ZW0 A;  2P67 A;  2QG4 A;  3KYQ A;  3HE5 B;  1FI3 A;  1L0N J;  1CSX A;  1LTB C;  3LID A;  2JP3 A;  4H13 D;  3KZI H;  2B12 B;  2Q3I A;  3TNU A;  2K1A A;  2B9B A;  1SQP G;  1GW4 A;  1E29 A;  3E1I A;  5CCG A;  1Z56 A;  2I1J A;  4NPD A;  5CIH B;  4WVZ A;  3L74 J;  2EXV A;  1FZF A;  4WY4 A;  2D0S A;  4AQR D;  3SWY A;  1IFN A;  5AVY B;  4PD4 E;  3GF7 A;  2AI5 A;  5CIF B;  1LTG C;  1CIH A;  1VQ8 P;  4FAN A;  3L72 D;  1N73 A;  3B5N D;  3AEE C;  5APW A;  5B5E V;  1S9K D;  2AXT V;  4BXL A;  4ZMD A;  4K3I A;  1PV3 A;  4IL6 X;  2BH5 X;  3VOP A;  4OGQ D;  1OW8 A;  1ZLL A;  4N78 D;  4EI2 A;  3KHU A;  1SQP J;  1R5S A;  1IFD A;  3Q5S A;  3VMX A;  4R4M A;  2N18 B;  1S72 P;  1QL2 A;  4EIF A;  3OCD A;  4LJI A;  5B66 E;  5AVQ B;  4AAL A;  2YNY A;  2FXM A;  3H1K J;  5K5G B;  1E8E A;  3MIW A;  2WSF J;  2JTI B;  4PWA A;  1JO5 A;  1EDI A;  1FU1 A;  5BVZ A;  1NH4 A;  2RKL A;  1PPJ G;  1N9C A;  1H1O A;  2FYZ A;  2ZYG A;  3WMM 0;  2JQR A;  1N90 A;  3CD6 P;  1NTZ J;  3C9I A;  3X39 A;  2UWJ E;  2ZT9 B;  4TT3 H;  1NU1 E;  3M97 X;  2R3S A;  2LXC B;  4D6T J;  1JNM A;  4U7J A;  1YEB A;  1N73 B;  5GTH H;  3H6P A;  3CXH I;  1FI7 A;  5CIG B;  1GK4 A;  5KLV K;  1KYO H;  1YQ3 C;  2CPS A;  3E7K A;  1R5L A;  3MUD C;  1K3H A;  1MG2 D;  3DR0 A;  1LTJ B;  4W80 A;  4H0L C;  1CRJ A;  2QSI A;  3BCC J;  1ZV8 A;  2Q6Q A;  2O01 J;  2IZ0 A;  1AOQ A;  1VF5 B;  3GHG C;  1HVV A;  2Q7C A;  1CTJ A;  2N9Y B;  1SVF A;  4YPC A;  3HE5 A;  2WPQ A;  1JEK A;  1FOS F;  1TU3 F;  4H44 D;  3B4S A;  3MZW B;  2ZON G;  5CCH A;  1NHL A;  1GD2 E;  2YXR B;  3FWN A;  1FHB A;  2JWA A;  1DVH A;  2W90 A;  2WZ7 A;  1SQQ D;  1C52 A;  4EDF A;  1N7S B;  3L72 E;  2W6J H;  1JY2 N;  4D6T D;  2KIK A;  2WSE H;  3KZI V;  5AVX B;  5KLV G;  1FJ0 A;  3CCV P;  1EDK A;  3R2P A;  1Q2N A;  1WMK A;  1SQX D;  3TK1 A;  1BDD A;  2P1J A;  3AE8 C;  4IFD K;  1DEE G;  4OGQ C;  5CCH D;  2H89 C;  1W2L A;  2RMZ A;  3AE9 C;  4KT0 J;  1KD1 Q;  3H1L J;  2M3E A;  1NTZ E;  3V6I A;  2KNC A;  1VQO P;  3M9Q A;  2O01 H;  2H43 A;  3TGU J;  1K04 A;  2OTK E;  2WSS H;  3N4X A;  1T2K C;  2QIW A;  4O9B A;  2WWW A;  1HCM A;  2N9B A;  2KUB A;  4GKG A;  3H32 B;  4ASV A;  2PRR A;  1YIJ P;  4PV1 D;  1YEA A;  3K5B A;  1URQ A;  1CED A;  1BDC A;  3CX5 E;  1NTK G;  1XTG B;  3EQ2 A;  2W83 C;  2H7H A;  2A06 G;  3AE1 C;  5AVR B;  1SQX J;  1YCC A;  3AE5 C;  1HJ4 A;  1U7J A;  5E79 V;  1IFP A;  3IAO A;  1RQU A;  1NTK D;  4L1Q A;  2BAS A;  3CCM P;  4PW9 B;  1CW5 A;  1QVF O;  1KV4 A;  1LFM A;  1QEX A;  1IO4 A;  2YXQ B;  2QJK B;  1Y8A A;  1NGM B;  1YI2 P;  1R0Q A;  2AXC A;  4IL6 H;  5B66 V;  1FZC A;  4EID A;  1P84 E;  1C75 A;  3FX0 A;  4EIE A;  1HJ3 A;  5E79 H;  4YXD C;  1N2D C;  2A45 I;  4UB6 E;  1VYD A;  1F1F A;  2FYU E;  1YIQ A;  3L4F A;  2N9J A;  2OZ1 B;  1P84 H;  1F1C A;  1NWQ A;  2O01 N;  1M8O B;  4K35 A;  3ZCF A;  2FY8 A;  5C39 A;  1E2R A;  3CC2 P;  1SQX E;  1N50 A;  1FZE A;  3USS A;  1I55 A;  2FYU J;  1CIE A;  3CXH W;  3G71 P;  3HQ7 A;  2IPP A;  2QJP B;  3ZBM A;  1H33 A;  2Q9I A;  2KK7 A;  1S9K E;  3E1R A;  3H1I J;  2Y9Z A;  3DP5 A;  1Q90 D;  1QVG O;  3VMA A;  3GW6 A;  4L3G A;  2LR2 A;  1EXJ A;  1H9Y A;  4AYC A;  4MN4 C;  2C8S A;  3M9B A;  3PRJ A;  1LT9 B;  2ZXX A;  1L0L D;  1YNR A;  3IN6 A;  3A0B H;  3D6Y A;  4FB1 A;  1BE3 J;  2AEF A;  3NBT A;  5KAF H;  3TYI A;  1S5L H;  4PD4 H;  1CYC A;  1GW3 A;  3VYM A;  1KN7 A;  2B4Z A;  3PLN A;  1KQL A;  1CSV A;  3RK3 E;  3OJA B;  5AVT B;  4OGQ B;  1N15 A;  1IK9 A;  3JSV C;  1NTM E;  5KJ7 A;  1S5L E;  2YQB A;  3HD7 A;  2FFD B;  1DVV A;  2N1T B;  1VQM P;  1AFO A;  2OGU A;  5CID B;  3P8C E;  1HRC A;  3VRD A;  1YJ9 P;  1BCC G;  5B5E E;  1PP9 E;  5APT A;  5KAF V;  2XDJ A;  4KHX A;  2MHM A;  3Q5R A;  1DX7 A;  1SQB D;  4RKU J;  1BE3 G;  5B66 H;  2FYN B;  5KLV J;  1L0N D;  1MZ9 A;  4C7N B;  1EQ7 A;  3H1K E;  1DIP A;  5KAI H;  4L74 A;  5AW5 B;  2JJL A;  3A2A A;  5AW7 B;  5APY A;  3RL0 D;  2KXP B;  3ITK A;  5AW3 B;  3O6Q A;  2RH0 A;  1BE3 E;  2BPB B;  1KIL A;  3Q3D A;  1SFC A;  1JY2 O;  3SFD C;  3L72 J;  2KS1 B;  3EWK A;  1RAP A;  4UB6 H;  4PD4 I;  3IFM A;  3M0D A;  1L0L K;  2G3A A;  1AKK A;  3WU2 V;  1K05 A;  2L91 A;  2D2C B;  4W7Z A;  1PGO A;  2CK3 H;  3W67 A;  2OAR A;  2CE0 A;  1AOF A;  1UIX A;  1CSW A;  2PGD A;  4FAV A;  3PTZ A;  4U3F D;  1KIL C;  1N86 A;  2K88 A;  3A0B V;  1EXI A;  2CXB A;  2ZVN B;  1LWU B;  1A8C A;  2DGE A;  1E79 H;  3RL0 g;  1AJY A;  1JCD A;  2B0Z B;  1HJB A;  3A3Y B;  3FGA D;  4WQ7 A;  2ZYA A;  2PCC B;  1NOH A;  5KLI C;  1RZ6 A;  2E5Y A;  2ZZS 1;  2IFM A;  3TDK A;  2E75 B;  3WUI A;  2C9X B;  3NTN A;  3L4O A;  2KLV A;  1NKZ B;  3O8Z A;  1OVU A;  2A45 H;  1JY3 O;  3B5N A;  2XU6 A;  4HKZ H;  3Q5P A;  1KIB A;  2ZOO A;  2H8P D;  5APQ A;  1H89 A;  1QN2 A;  1CIF A;  3SVW A;  1LTS C;  1RQV A;  3VP9 A;  1NML A;  1RF0 A;  1DT1 A;  1M57 D;  3T97 B;  4LGD E;  2V07 A;  4EIC A;  1ZRT E;  1RF1 C;  1SQQ G;  1H32 A;  1QL1 A;  1M7L A;  4WQA A;  3KPE A;  1NTK E;  1KX2 A;  1L0N E;  4PJ0 E;  2O1K A;  1NU1 D;  3M0D C;  2FYU G;  1SS1 A;  3HTK A;  2C1U A;  3BVH A;  3OA8 A;  3Q2Y A;  4JPZ B;  2PCB B;  2KLU A;  3H1J G;  3HRN A;  1BSN A;  2HLO A;  3A9F A;  1C2N A;  3VN0 A;  1P84 D;  1R8E A;  3V2P A;  3CPW O;  1FOS E;  1GL2 A;  1FZA A;  1NTM K;  3BCC E;  1P84 I;  1C6S A;  2GA1 A;  1X8Y A;  2KB7 P;  4FA1 A;  2IBZ I;  4WQ9 A;  3WFE C;  2M0B A;  1FAV A;  2Q5U A;  1ZZH A;  2R44 A;  5CIC B;  3WFB C;  4AUW A;  1JCC A;  1T8Z A;  1LTT C;  1Y47 A;  1KQS O;  4N6J A;  1H9X A;  3PXS A;  1NU1 J;  2HPC B;  3CC4 P;  2OTJ P;  3C2C A;  4IFF A;  2WSF H;  3WFC C;  4AAM A;  1KB9 D;  1MKM A;  4JCG A;  2C1D B;  2CE1 A;  1PP9 J;  1KX7 A;  4H0L D;  1RE3 C;  1YQ4 C;  1LMS A;  3L70 E;  3HTK B;  5EFW B;  3P8M C;  2AEJ A;  2FYU K;  1EZV I;  2D2C D;  1H31 A;  4J20 A;  2HOD B;  3CX5 I;  1NTZ D;  1J1E B;  2KZJ A;  3H1L E;  3PXW A;  4RO0 A;  3PH2 B;  4L76 A;  2VRS A;  5AVV B;  1YTC A;  3L71 J;  3HE4 B;  3M91 A;  3W68 A;  1NU1 K;  3CCJ P;  1RE3 A;  2PFX A;  1NIR A;  4GT1 A;  3MK7 C;  3L73 D;  3VMY A;  2WSC J;  2B89 A;  2KI7 B;  3C8V A;  2J58 A;  4JQ0 D;  5APX A;  4IFM A;  4D6T G;  3B5N B;  1VQ7 P;  2I8F A;  3SWK A;  5KLI B;  3L72 G;  1M1J B;  1DD4 A;  1PP9 D;  3A0B E;  2YKO A;  4WBA A;  1HUC A;  1NAY A;  1FCD C;  2N3B A;  1K3G A;  1L0N K;  2CA4 B;  3VTP C;  4N3Y B;  1NAF A;  2NPS B;  5GTI E;  2OYH B;  1VQN P;  2K37 A;  2E5T A;  4W7Y A;  2ORL A;  1CHJ A;  3VYI A;  1LWU A;  2ZXY A;  3V4W A;  4DOJ A;  2W8Z A;  1HJ5 A;  2B10 B;  2XV5 A;  5DJQ C;  1ZR4 A;  3RN0 A;  3O20 A;  1RF1 B;  2ITA A;  1IC2 A;  4GOF A;  1CIG A;  3MGN A;  1KFM A;  3CI9 A;  2FYU D;  1EC5 A;  1KFN A;  2O1J A;  2D0W A;  3RK3 B;  3S1K A;  1FJP A;  5KAF E;  4FA5 A;  1XTC C;  2NRG A;  3NXS A;  4XYD B;  1RY3 A;  1SQV E;  3RGU A;  3L4M A;  4H0J A;  1CSB A;  1PPJ E;  2WIT A;  1KV9 A;  3CX5 H;  2LIR A;  1G2C B;  4H44 C;  3KDP B;  5AVU B;  1JM0 A;  4JF7 A;  1H0T A;  2YIU C;  3L71 E;  1BGY D;  5BU8 B;  2K3R A;  4C7N A;  1H8A A;  5EXQ A;  1NTK K;  2SPZ A;  3M0A A;  3MUD A;  1HGV A;  1EDJ A;  4AAO A;  2OYO A;  3P32 A;  1KB9 H;  4FA4 A;  1L0L E;  1NTK J;  2WPV B;  1WT6 A;  2ZBO A;  1VQ5 P;  2PAJ A;  3V2N A;  4WWI A;  3SWS A;  2ZJS E;  4RSZ A;  1RE4 A;  3H1H G;  2C0X A;  2N1T A;  1QL3 A;  2E43 A;  1T2K D;  1X79 B;  3RN1 A;  1HJ0 A;  4H0K A;  2Z5H A;  3HQ6 A;  2BEQ D;  3H1J J;  1N7L A;  1SQB J;  1CCR A;  1J1E C;  1JMM A;  4QMA A;  3B71 A;  5KLV D;  1AA0 A;  2IBZ E;  3TSI A;  3P7K A;  3H1I E;  3CWB G;  4PV1 C;  3HQ8 A;  3RMZ A;  1CC5 A;  1OW6 A;  1RHZ B;  3PHL A;  3OW2 O;  4WQE A;  1SFC C;  2QM8 A;  3BAS A;  1LT9 A;  1FE6 A;  3MK7 B;  2P58 A;  1MV8 A;  4LLH A;  2OQQ A;  2KOG A;  2G8Y A;  4TLF A;  1AV1 A;  4BRY B;  1OWA A;  1T6A A;  4WY4 D;  5CIE B;  1GZL A;  5AW1 B;  1H33 B;  5BU5 A;  1YJW P;  2ZXE B;  1OVV A;  1ZP0 C;  3H1K G;  5CMZ A;  3NBS A;  4EOT A;  2XTS B;  1JMB A;  3L71 G;  2QEX P;  3PH0 A;  1BE3 D;  3G4S P;  3D0W A;  1S6V B;  4U3F J;  1SQB G;  4UB6 V;  2E76 D;  3AED C;  1DEB A;  2WT7 A;  4BWN A;  4I7Z B;  3F89 A;  1SQP K;  1BCC D;  3KXD A;  1GU5 A;  2YKP A;  1SQV G;  3HD7 C;  1K9M Q;  5AW0 B;  5KJ7 C;  1BGY E;  3GHG B;  1EDL A;  2P10 A;  1H88 A;  3RL0 C;  5C9M A;  3ZOX A;  3AEB C;  2Q3E A;  1VQ4 P;  1N7S D;  2HYN A;  5CIB B;  3MP7 B;  1FDM A;  1KQF B;  4XE5 B;  3M06 A;  5CYT R;  1AVO A;  5AW2 B;  2WTY A;  2BCN B;  1Q86 Q;  4N78 E;  1QKS A;  5AVZ B;  1GMJ A;  1X0T A;  3CCE P;  1HH0 A;  3L74 G;  2B11 B;  1OW7 A;  1IFM A;  5TIS V;  1GJQ A;  1HBW A;  3FXD A;  4Z1M H;  1S5L X;  1RAQ A;  2JEE A;  4U3F G;  5H2F H;  2BCC E;  3U1A A;  1KIL D;  2IBZ D;  5DJU B;  2CPB A;  1JDL A;  2ZAE B;  1SFC D;  1VQ9 P;  1QGK B;  1CYI A;  3CWB D;  2R5B A;  3HUS A;  1HH7 A;  2KSJ A;  1ZRT D;  4Y99 C;  2BCC G;  4O1Q A;  1VQK P;  4ZKP A;  4WY4 C;  3SLE A;  1GIW A;  2XZR A;  1SQX K;  4ZNC A;  2E42 A;  1EB7 A;  5M1B A;  1FZC C;  3OAK A;  1CI6 B;  2JKV A;  3UIA A;  4WQ8 A;  2IX7 C;  1RH5 B;  2XKM A;  3CYT I;  2N1T D;  3MTU E;  4PV1 B;  1GTW A;  3MD0 A;  4PJ0 H;  3WU2 E;  1W5C T;  2FBW C;  4DJG A;  2BLF B;  1DW2 A;  3CX5 W;  2E75 D;  2MTA C;  3BCC D;  3CCQ P;  1L4A C;  4I6M C;  4GYD A;  2QJK C;  1NMI A;  4GIF A;  4JBZ A;  1CI6 A;  1SQQ E;  5KJ7 D;  1S3J A;  1Y9B A;  3V2Q A;  1VPC A;  1PPJ D;  2V7Q J;  1C6R A;  1KOR A;  2QA4 P;  1LTJ A;  2FXP A;  3L35 A;  1URQ C;  3AE2 C;  4HB1 A;  3CCL P;  2YK3 A;  1RE4 C;  3L71 D;  3O5C A;  3BCC G;  3HUS B;  4RJT A;  2JDI H;  4NPF X;  1PGQ A;  1OVR A;  3I55 P;  3H1L D;  2XND H;  3N7N A;  2IYP A;  4YTP C;  3RK2 B;  1KC8 Q;  1VL2 A;  1OMI A;  1HRO A;  3M9H A;  4LC1 A;  4XFJ A;  3RL0 B;  2R5D A;  1L0N G;  3SWF A;  3TYY A;  2GC7 D;  4H13 B;  2ZT9 D;  3L73 E;  1WEJ F;  2J5U A;  5GTI V;  5KLV E;  3H1I G;  3OCD B;  3SJL A;  1E5W A;  3R4Y A;  3SXT A;  1T3U A;  5CCH C;  1N8R Q; 
#chains in the Genus database with same CATH homology
 4XXL A;  3KZI V;  1FJ0 A;  2KS1 A;  3L75 D;  1SQX D;  3JBT B;  1NIR A;  1DW3 A;  3MK7 C;  2HV4 A;  1W2L A;  4MU8 A;  1MZ4 A;  3L73 D;  2RMZ A;  1IO3 A;  155C A;  3O1Y A;  1SQV D;  3FWL A;  1CRC A;  2Y0E A;  4PJ0 V;  1I8O A;  2I8F A;  5KLI B;  5AUR A;  1GQ1 A;  1PP9 D;  1CO6 A;  2DVH A;  1HCM A;  1FCD C;  2YCC A;  2N3B A;  1K3G A;  2CA4 B;  1YEA A;  2ORL A;  1CHJ A;  1CED A;  1IRV A;  5C0Z A;  1CSU A;  2ZXY A;  3A0H V;  2VHD A;  1HJ5 A;  2B10 B;  5DF5 A;  1YCC A;  2C2C A;  5DJQ C;  1QYZ A;  1CXC A;  1HJ4 A;  3RN0 A;  5E79 V;  3O20 A;  4L3H A;  2BGV X;  1U74 B;  1CIG A;  4N0K A;  1NTK D;  4L1Q A;  4PW9 B;  2BH4 X;  2QJY B;  2FYU D;  1LFM A;  1CRH A;  2D0W A;  2QJK B;  3ZOW A;  3WC8 A;  4FA5 A;  4Q5P A;  2CA3 B;  4XYD B;  1R0Q A;  3L4M A;  4H0J A;  3H1I D;  4YE1 A;  5B66 V;  2O3J A;  1KV9 A;  2FRC A;  4EID A;  3ZOY A;  1C75 A;  2LIR A;  4EIE A;  1HJ3 A;  3ZOO A;  1VYD A;  1F1F A;  1OAE A;  5GTH V;  1DII C;  1BGY D;  3H1H D;  2Y0D A;  1YIQ A;  1C2R A;  2N9J A;  3CU4 A;  2OZ1 B;  1F1C A;  1MG3 D;  2Y0C A;  5EXQ A;  5TJH A;  4QAO A;  1ETP A;  3WFD C;  1COT A;  1AYG A;  4AAO A;  4FA4 A;  3ZCF A;  3CXH D;  1E2R A;  2GC4 D;  1KB0 A;  1I6D A;  2OZ1 A;  1N50 A;  2ZBO A;  1I55 A;  1YIC A;  1J3S A;  1M60 A;  1CIE A;  2V08 A;  3CXH W;  3HQ7 A;  4P4Q B;  2QJP B;  1FOC A;  3ZBM A;  1CNO A;  1H33 A;  3SWS A;  4RSZ A;  2FWL A;  4A7P A;  1WVE C;  1HZV A;  3RLM A;  1QL3 A;  1CRI A;  4WQD A;  2PAC A;  3DP5 A;  3VMA A;  3GW6 A;  4L3G A;  3RN1 A;  4H0K A;  1CTZ A;  1H9Y A;  3HQ6 A;  4UB8 V;  2C8S A;  1I5T A;  3PRJ A;  1CCR A;  1L0L D;  1YNR A;  5KLV D;  4FB1 A;  3NBT A;  3TYI A;  1CYC A;  1CTY A;  3VYM A;  1BL9 A;  2B4Z A;  3HQ8 A;  3RMZ A;  2N18 C;  3PLN A;  1CC5 A;  1CXA A;  1CSV A;  1LC1 A;  3TF5 A;  3PHL A;  1DW1 A;  1L9B C;  4WQE A;  1M6Z A;  1IRW A;  2C1V A;  3HQ9 A;  4FA9 A;  3MK7 B;  4AX3 A;  1N15 A;  1CHH A;  2YQB A;  1DVV A;  1CRY A;  1QL4 A;  5CID B;  2L4D A;  3DMI A;  1HRC A;  5CIE B;  3VRD A;  1H33 B;  1NNO A;  1IZL 0;  5KAF V;  2N9I A;  2LIT A;  2MHM A;  3NBS A;  3H1J D;  1A56 A;  1SQB D;  2XTS B;  4IL6 V;  2FYN B;  2BCC D;  1BE3 D;  1L0N D;  4GED B;  5IY5 1;  1S6V B;  3CX5 D;  1YFC A;  4UB6 V;  1B7V A;  4NFG B;  1CHI A;  1IQC A;  5DJQ B;  2KNC B;  3L74 D;  1BCC D;  4KMG A;  3ZIY A;  3GG2 A;  2A06 D;  1GKS A;  3ITK A;  2BPB B;  5C9M A;  3ZOX A;  4DY9 A;  2Q3E A;  5CIB B;  2AIU A;  1RAP A;  1NTM D;  1GU2 A;  1AKK A;  1I8P A;  3NWV A;  5CYT R;  3WU2 V;  1CCH A;  2BCN B;  1QKS A;  2GIW A;  1HZU A;  2L91 A;  2N3Y A;  1M70 A;  1H31 B;  351C A;  2QG4 A;  2B11 B;  2RN0 A;  1FI3 A;  2CE0 A;  1AOF A;  1CSX A;  1CSW A;  4FAV A;  3PTZ A;  4U3F D;  5TIS V;  1GJQ A;  1GDV A;  2C1D A;  1SQP D;  2B12 B;  3A0B V;  2CXB A;  1E29 A;  1RAQ A;  1A8C A;  2DGE A;  1LC2 A;  5CIH B;  1KYO W;  2EXV A;  2B0Z B;  2IBZ D;  2D0S A;  4WQ7 A;  2PCC B;  1JDL A;  2AI5 A;  3H1K D;  5CIF B;  1RZ6 A;  5KKZ B;  1CRG A;  1EZV D;  2ZZS 1;  4O1W A;  1CYI A;  3CWB D;  3TDK A;  1CIH A;  3WUI A;  4FAN A;  1HH7 A;  2C9X B;  3L72 D;  3L4O A;  1ZRT D;  4O1Q A;  5B5E V;  2AXT V;  1KIB A;  2ZOO A;  4K3I A;  3SLE A;  1GIW A;  1FI9 A;  1QN2 A;  2BH5 X;  1CYJ A;  1CIF A;  3SVW A;  4PD4 D;  1NML A;  1EB7 A;  1DT1 A;  3KHU A;  4WQ8 A;  2V07 A;  4EIC A;  1LS9 A;  3CYT I;  3O0R C;  3OA8 B;  3PXT A;  451C A;  5H2F V;  2N18 B;  1H32 A;  4EIF A;  3OCD A;  4LJI A;  1W5C T;  4WQA A;  4WQB A;  1KX2 A;  2BLF B;  1DW2 A;  4AAL A;  1A2S A;  3CX5 W;  1NU1 D;  2MTA C;  3BCC D;  3L70 D;  1C7M A;  1H32 B;  4GYD A;  1E8E A;  2C1U A;  1NMI A;  3OA8 A;  2PCB B;  4WQC A;  2JTI B;  4PWA A;  5DFS A;  1I6E A;  3ORV A;  1N9C A;  1H1O A;  1KYO D;  5B6Q A;  3A9F A;  1PPJ D;  2GB8 B;  1C2N A;  1C6R A;  1P84 D;  2K9J B;  1L9J C;  2JQR A;  1N90 A;  1S5L V;  3X39 A;  2YK3 A;  3M97 X;  1C6S A;  2YIU B;  3L71 D;  3O5C A;  4FA1 A;  4WQ9 A;  1YEB A;  3WFE C;  1ZZH A;  4RJT A;  1FI7 A;  5KAI V;  5CIG B;  5CIC B;  3WFB C;  4Y5R A;  3VNW A;  1K3H A;  1MG2 D;  1C6O A;  3DR0 A;  3H1L D;  1CRJ A;  1H9X A;  3PXS A;  3C2C A;  3CP5 A;  3WFC C;  4AAM A;  1COR A;  3TGU D;  1AOQ A;  1KB9 D;  4AAN A;  1HRO A;  1RZ5 A;  2C1D B;  4JCG A;  2CE1 A;  1KX7 A;  1CTJ A;  2N9Y B;  1DIQ C;  1LMS A;  4V2K A;  1OCD A;  2GC7 D;  2ZON G;  1DW0 A;  1WEJ F;  1H31 A;  1FHB A;  4J20 A;  2JWA A;  1DVH A;  5GTI V;  1NTZ D;  1U75 B;  1SQQ D;  1C52 A;  4EDF A;  3OCD B;  3SJL A;  3PXW A;  3SXT A;  3PH2 B;  1I54 A;  1YTC A;  4D6T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...