1L0ND

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1l0nD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1l0nD02
3HQ7A 2RN0A 3WU2V 1YIQA 3X39A 3ZIYA 5C9MA 3SWSA 4DY9A 1BCCD 155CA 4D6TD 1NU1D 3CXHD 2MHMA 2N18C 2N18B 2L91A 2N9IA 1IRVA 1AOQA 3SLEA 2HV4A 1F1CA 5AURA 1DIQC 1CYJA 5DJQC 5DJQB 1LC1A 1C7MA 2KNCB 2JWAA 1CRCA 1CXCA 3ORVA 1HRCA 1IO3A 1N9CA 1H33A 5C0ZA 1BE3D 3L70D 1RAQA 4J20A 3WFBC 2DGEA 1QYZA 3ZCFA 3ZOXA 2C1DA 3TF5A 1DW0A 1NIRA 1DW1A 1KYOW 3PHLA 1JDLA 2QJYB 1H33B 1CYIA 4UB8V 3RN0A 3NWVA 1CC5A 2ZZS1 5B66V 2K9JB 2RMZA 2C1DB 1NTZD 4O1QA 1CTZA 2ZXYA 3WC8A 1HJ3A 1PPJD 3RLMA 1E2RA 4WQ8A 2PCBB 1YEAA 2V08A 3HQ8A 5DF5A 3TDKA 5DFSA 2CA4B 3CX5W 4XYDB 4WQAA 5CIFB 5CYTR 3L75D 3SVWA 1C6SA 1HCMA 1LMSA 3DMIA 1VYDA 1AOFA 1C75A 3KZIV 4AAOA 4YE1A 1CXAA 1CEDA 1GU2A 2DVHA 2BPBB 1C2NA 1YEBA 1DW3A 3WUIA 4EIFA 5CIGB 3JBTB 1A56A 1BL9A 3H1ID 3L72D 5CIEB 1KB0A 2BH4X 1RAPA 1CIHA 1FJ0A 1K3HA 1WVEC 2FYNB 1M60A 3PLNA 3TGUD 4NFGB 3ZOWA 1CORA 3KHUA 1C2RA 3HQ6A 3FWLA 3PH2B 1HROA 1RZ5A 5TJHA 3VMAA 1MG3D 3VYMA 2GC4D 2VHDA 2Y0DA 1L9JC 1CSXA 3MK7B 3MK7C 5B6QA 2LITA 3L4OA 3CP5A 1CHHA 2N9JA 1CRIA 1YTCA 1GDVA 3HQ9A 2GB8B 2V07A 1KX7A 1H9YA 5GTHV 1SQVD 5GTIV 1COTA 3CU4A 4PW9B 1CTYA 2ZBOA 2YIUB 2PACA 1YNRA 4EIDA 2I8FA 1QL4A 1CRJA 1CIGA 2CE1A 3GG2A 1L0ND 4IL6V 2YCCA 1CO6A 1KX2A 1FOCA 1CCHA 3TYIA 2OZ1A 5KLIB 2CA3B 4FA9A 3CYTI 1HH7A 1NNOA 5EXQA 1CRHA 2QJKB 4WQEA 1GKSA 351CA 1N15A 1W2LA 1N90A 3SJLA 2BGVX 4L1QA 1CNOA 1I54A 2A06D 2PCCB 4AX3A 1DIIC 1CHIA 3NBTA 2OZ1B 1E29A 1W5CT 1J3SA 4AAMA 1KV9A 3A0HV 1EZVD 5B5EV 1S5LV 3RN1A 1EB7A 3PXSA 3BCCD 1IQCA 1FI9A 1DVVA 2BH5X 1CSVA 1QL3A 4A7PA 4PJ0V 1DVHA 1U75B 1A8CA 1DT1A 1ETPA 1SQQD 1LFMA 2LIRA 1C52A 1CIEA 2GIWA 4FA1A 2B12B 2N3YA 1R0QA 3OA8A 1L9BC 1P84D 5TISV 1FCDC 1HZVA 1LC2A 1KB9D 5CICB 4RSZA 5CIDB 1CSUA 1I5TA 2GC7D 2BCNB 4UB6V 4P4QB 1SQPD 1CRGA 1C6RA 2ORLA 3DP5A 4H0JA 4AANA 4WQ7A 3VRDA 1H1OA 1QKSA 3PRJA 2O3JA 3CXHW 3OA8B 3ITKA 3DR0A 3OCDA 1S6VB 1KYOD 3L74D 1FI3A 2FWLA 2MTAC 3NBSA 4EDFA 4FAVA 5CIHB 2D0WA 5IY51 1FI7A 1YICA 3WFCC 1YCCA 3H1HD 2BCCD 3CWBD 3OCDB 4WQDA 4MU8A 4XXLA 1WEJF 3WFEC 4U3FD 3CX5D 1CSWA 2B10B 3L4MA 2D0SA 4N0KA 4L3HA 2AXTV 4WQCA 1I6EA 3RMZA 1CYCA 2Y0CA 3WFDC 1IRWA 1A2SA 1GQ1A 4PWAA 2Y0EA 1SQXD 1YFCA 4WQ9A 2B11B 2YK3A 4JCGA 1CIFA 2QJPB 2AIUA 3SXTA 2B4ZA 1NTMD 4FANA 1M70A 1H31A 2FYUD 2CXBA 2Q3EA 1B7VA 3A0BV 3ZBMA 3C2CA 1BGYD 1NTKD 1HJ5A 1HZUA 1I8OA 2AI5A 3PTZA 2C8SA 3M97X 4O1WA 2C2CA 3ZOOA 1GIWA 5E79V 1I55A 1H31B 2N9YB 1ZRTD 1E8EA 1LS9A 1N50A 3L73D 1NMIA 5H2FV 4WQBA 1U74B 1I8PA 5KKZB 3ZOYA 1NMLA 4RJTA 3A9FA 1CCRA 1OAEA 1AYGA 2YQBA 3H1KD 4GEDB 3H1JD 4FA5A 1I6DA 1IZL0 1QN2A 2BLFB 2FRCA 1GJQA 1CTJA 3L71D 1C6OA 3O5CA 2JQRA 5KAIV 2L4DA 1SQBD 3O1YA 451CA 1F1FA 2CE0A 2C9XB 1AKKA 1OCDA 3GW6A 2QG4A 4FB1A 3PXTA 1KIBA 1ZZHA 1FHBA 2ZONG 1H9XA 2EXVA 4AALA 1HJ4A 1L0LD 1H32A 4PD4D 1CRYA 4L3GA 5KLVD 1MZ4A 4KMGA 1PP9D 2C1UA 4Y5RA 3O0RC 4QAOA 1RZ6A 2C1VA 2XTSB 4H0KA 4K3IA 1M6ZA 1K3GA 2KS1A 3O20A 4V2KA 3VNWA 2IBZD 1MG2D 2JTIB 2ZOOA 1H32B 2B0ZB 3PXWA 4Q5PA 4EICA 4GYDA 1DW2A 5CIBB 4EIEA 4FA4A 1CHJA 4LJIA 5KAFV 3H1LD 2N3BA
chains in the Genus database with same CATH superfamily
3HQ7A 2RN0A 3WU2V 1YIQA 3ZIYA 4DY9A 2IBZI 155CA 4KHXA 3L74J 1NU1D 3USSA 2MHMA 1EXJA 2L91A 1IRVA 2I1JA 1E5WA 4UB6H 5DJQC 1SQVK 1GU4A 2GUVA 1C7MA 1NVOA 1CRCA 1NKNA 1HRCA 4DT0A 3OW2O 1NTZE 4WY4A 1RAQA 1J2JB 2WSCH 1GDTA 2K9JA 2C1DA 4JBZA 3TF5A 1VQ7P 3H1LJ 1KILA 2QJYC 4UB8V 1VL2A 2JEEA 2XZRA 2JWDA 4WY4B 3H32A 2K9JB 2C1DB 1OWAA 4DOJA 2AEJA 1JMMA 2N1TA 1KILB 2AXTH 5DF5A 5DFSA 1RH5B 1RE4A 5CYTR 2IFMA 1RQUA 1LMSA 2AXCA 3H32B 4RKUJ 3TGUE 1FJKA 3DMIA 1VYDA 1SQQK 1VQPP 2O01H 1BE3J 2PAJA 2N1TB 4UB8E 5AW4B 1L4AA 1RHZB 1C2NA 1YEBA 2Q1KA 2QEXP 3CCLP 3WUIA 4AYCA 2KK7A 4PD4H 2R44A 5AVVB 3RL0C 3L72D 1K3HA 3L73G 2FYNC 3EFFK 3RBXA 1L4AB 1JOCA 3L71J 5CBOA 1CORA 3HQ6A 1H0TA 1NTZJ 1URQC 1FZCC 4K35A 1MG3D 3VYMA 1JY3O 1CSXA 3MK7B 4IFMA 1FE6A 1RF0A 3D0WA 1VQ4P 1IZNB 1NH4A 2JP3A 2E74C 2GB8B 2KXPB 4IFDK 4R4MA 2E75C 1CW5A 1H9YA 5APVA 3Q3DA 3C8VA 1COTA 3CU4A 2ZBOA 1YITP 1PP9J 2NPSD 2AEMA 5KTBA 2M3EA 3MUDC 2KZIA 1QL4A 2C0XA 1RE3A 2CE1A 3GG2A 3I56P 2WSEJ 1EQ7A 1BDDA 1KX2A 2JO1A 1FZFA 3L73E 5KLIC 2M5AA 1HH7A 3AE2C 4AQRD 1CRHA 2QJKB 4WQEA 351CA 3BVHA 1W2LA 3G9RA 1YBKA 1VQ9P 4H13C 4L1QA 2A06D 1VQMP 4I2LC 2WSFH 2P67A 1DIIC 3P32A 1QVGO 1MV8A 1E29A 1FOSF 4AAMA 1R8EA 1S5LV 3RN1A 1HF9A 2DW3A 3B8EB 2O1KA 3BCCD 1CSVA 1QL3A 4PJ0V 1X79B 1DVHA 1HH0A 3SWFA 1DT1A 1SQXG 1SVFA 2G3AA 4ZKPA 1GL2C 4I7ZB 4FA1A 2B12B 1FJPA 1R0QA 1L9BC 1P84D 1HVVA 4L74A 1ZR2A 1FCDC 2W8ZA 1LC2A 1KB9D 5CICB 4RSZA 1G1JA 1CSUA 4ZMDA 4NPEA 3HUSC 3W67A 1KFNA 1VQLP 2BCCE 3CCJP 4UB6V 4N3YB 1M1JB 1CRGA 1BDCA 1S5LE 4U3FE 1FS0E 4PV1D 3CXHW 1RQVA 3DR0A 1IFNA 2MTAC 4EDFA 2YNYA 5BU5A 2D0WA 2QVAA 5IY51 1FZEA 5CCHA 1OXZA 3WFCC 3KQGA 3H1HD 3M0DA 2CK3H 3H1JG 3CWBD 4WQDA 2NPSA 4MU8A 1YJNP 4XXLA 3OA7A 1SQXE 2YKPA 4UB6E 3CX5D 1QLED 1OIPA 2B10B 2H88C 3L4MA 1ZV8A 5CBNA 1PPJG 3B5NB 2ZT9D 1QVFO 4L3HA 2B9BA 2KSJA 2AXTV 1SQPJ 1ZN5A 2ZYGA 1IRWA 5CCGD 1ZRTE 2E74D 4PWAA 3L72J 4QMAA 2B11B 4JCGA 2QJPB 2E75D 4YXWH 1NTMD 1M70A 1IFIA 1YJWP 3ZBMA 1SQXK 3PH0A 3RK2D 4GKGA 3C2CA 3H1IG 1HJ5A 1XTGB 2BCCJ 3CCVP 3TNUA 3H1JE 3V2QA 1I8OA 1NWQA 1ZOYC 2V7QJ 2VRSA 1N7SD 3M97X 5KAFE 3AE4C 2AXTE 3W68A 1H88A 3P7KA 4WB4A 1QL1A 1FZGA 4B86A 1E8EA 4W80A 3TNUB 1OVRA 1OW7A 1H8AA 3VYIA 3H1KD 1WMKA 1ZR4A 1N86A 2KLVA 2D2CC 3PJSK 3FX0A 4PD4E 2C9NY 5GTHH 3O5CA 1XTCC 1G2CA 1AQ5A 2L4DA 1IFMA 4M3LA 4HB1A 5AW7B 3O1YA 2K1AA 1L0NG 3AEGC 3H1IE 2C9XB 4N78E 1OCDA 5AW9B 4PV1B 1GL2D 1ZZHA 1ZP0C 1K05A 2C0WA 1JCDA 2WSCJ 1G2CB 1J1EB 1HJ4A 2Q3IA 1H32A 4L3GA 5KLVD 3A7OA 1VDFA 3KDPB 2RH0A 2C1UA 3M06A 3BATA 1NJIQ 2H8PD 1BCCE 5L8RJ 2Y9YA 1VQNP 1EZVG 2ZOOA 3B4SA 2HODA 1H32B 5CHXA 2B0ZB 3PXWA 5CCGA 2P2UA 3HD7A 4Q5PA 5B5EH 2ZT9B 2IX7C 3PP5A 2Z4EA 4FA4A 1SQBJ 1VF5C 4LJIA 3H1LD 1JNMA 1L0NE 3X39A 2O01J 4YPCA 5C9MA 1NKZB 2WPQA 4XFJA 2JDIH 3HD7B 1N7SA 2G8YA 3L70E 2N18B 1JTHA 1L0LJ 1EDLA 1LTIC 2N9IA 3RK2B 3H1HJ 1F1CA 3P8CE 1DIQC 1CYJA 1S9KE 3CWBJ 3CC7P 1N7SB 1Q7YQ 1PIXA 2JWAA 1JTHB 1CXCA 4W7ZA 3CMAP 1IO3A 1EZVE 1N9CA 1N73A 1AV1A 3CXHI 4LGDE 1L0NK 1BE3D 3B71A 3IAOA 1FU1A 1LWUA 5DJUB 4GDOA 3NMDA 2LXBA 1M57D 3A5TA 2KSEA 1DW1A 1KYOW 3V4WA 1N73B 1CYIA 2H43A 3RN0A 3RK3E 1BCCJ 3NWVA 2Q7CA 3D71A 1GL2A 1CC5A 1AVOA 1Y8AA 1LWUB 1IC2A 1LGHB 1NTMJ 2B87A 1NTZD 4O1QA 3CMEP 1CTZA 3WC8A 3RLMA 2PCBB 3NFQA 3HQ8A 3TDKA 1C6SA 5CJ4A 1HCMA 1VQ8P 2FYUG 3AEFC 2QIWA 1AOFA 3C9IA 2B87B 1RF1A 1BGYG 1NTKG 4AAOA 2WITA 4NPFX 1CXAA 2WSFJ 3RL0g 1LT9C 3CC4P 2DVHA 2BPBB 2B89A 2LXCB 5CIGB 1A56A 3BRVB 3HE4B 1U57A 1DEEG 1RF1B 5CIEB 1P84I 3S4RA 2BEZF 3PLNA 1M60A 3TGUD 1LJ2A 1SQVE 2BASA 1K73Q 3LW5H 2JJLA 3M9QA 3K5BA 3V2PA 4ZKUA 1FZBA 1K8AQ 3KHUA 3MP7B 3PH2B 5AVSB 5TISE 4Y99B 5TJHA 3VMAA 1J1DB 2IYOA 2P58A 1L9JC 5B6QA 5APYA 2FFDA 3A2AA 2XU6A 3L75J 3L71G 1HJ0A 1DEBA 3OAKA 2Q6QA 1FZAA 2V07A 2ZYAA 5AW5B 3M0AA 1KX7A 5GTHV 5APQA 1BGYE 1NTKE 2QE7H 4R4LA 5KLVJ 3CXHH 2YIUC 2PACA 2FFDB 3H6PA 1M1KQ 2QSIA 1YNRA 4EIDA 1PZQA 2PFXA 1CRJA 2M8RA 3CX5I 2QM7A 3GHGA 1M7LA 2YKQA 1A02J 1YIJP 4XA4A 2OZ1A 1PP9G 1KN7A 4FA9A 1NNOA 4TT3H 3AE1C 2WQYC 1S72P 1NO4A 3GF7A 1SQQE 3V4QA 2FYUK 5GTHE 3GHGB 4AX3A 1Q86Q 3NBTA 1NTKK 2WZ7A 5APTA 3AE9C 2OZ1B 2WPRA 1W5CT 1MUUA 5APXA 3IFMA 3IR9A 1JB0J 1KV9A 5B5EV 2OYIA 1SQVJ 3CCRP 1KILE 1SP4A 1FI9A 3JCUH 4A7PA 5KAFH 1UIIA 3CI9A 5AW0B 3S1KA 1ETPA 1LFMA 1NU1G 3G3ZA 2LIRA 1CIEA 3GLMA 4OWFA 2N3YA 2LR2A 4H0LD 4IL6X 2OYIB 3I55P 1HZVA 2MJZA 1EZVI 3L35A 2GC7D 1P84H 2IDBA 4P4QB 1SQPD 2ORLA 5B5EE 5AW2B 1H1OA 1DH3A 2O3JA 2BEQD 3MHVA 1HTLC 3HE5A 3OCDA 5AVRB 1FI3A 3M91A 3NBSA 1OW8A 2WMMA 1UIXA 2ITAA 1T8ZA 1FI7A 3V6IA 1VQ6P 1S3JA 2KZJA 1GW3A 2BCCD 2E76B 1QX8A 1X8YA 1YJ9P 3HE5B 3OCDB 2OYHC 3QWOC 1SQQJ 2K9YA 3RGUA 2SPZA 4U3FD 1NU1E 2J59M 1KYOI 5B66H 4GIFA 2OARA 1H0TB 2J58A 2QM8A 4OGQD 1YI2P 1KORA 3CX5H 2FBWC 3RMZA 4WBAA 4JYBA 3O8ZA 2Y0CA 3WFDC 1HWTC 4EYYQ 1A2SA 1LTJC 4H44C 2Y0EA 1SQXD 1YFCA 4WQ9A 2YKOA 3SXTA 2B4ZA 3TGUJ 5DJTB 1B7VA 1NU1K 1OVUA 2CPBA 2C8SA 4O1WA 3KXDA 1SFCC 3MD0A 1GIWA 1OFCX 2O01N 2XNDH 2UWJE 2ZVOB 2M5AB 2N9YB 1ZRTD 4C7NA 1N50A 1QL2A 1NMIA 2W6AA 3UIAA 2YMKA 2P1JA 1U74B 3Q1MA 5KKZB 1USDA 3A9FA 1CCRA 1FDIA 4GOFA 4D6TG 4GEDB 3H1JD 4FA5A 1Y47A 4H0LB 1IZL0 1QN2A 4C7NB 1DIPA 1GJQA 3RK3C 3U59A 5GTIH 1T3UA 4EOTA 1SQBD 4HH2A 2FXPA 3A3YB 2B88A 1YTZI 451CA 1F1FA 2CE0A 1AA0A 1AKKA 2FXOA 4OVNF 3G4SP 2QG4A 4FB1A 3MTUE 2ZXXA 4IL6H 1CZQA 1FHBA 3VTPC 1IFJA 2ZONG 1GK6A 1H9XA 2KP8A 2EXVA 1L0LD 2POHA 3NTNA 1DX7A 4PD4D 3L73J 2A06G 1KYOH 1TU3F 4KMGA 5AVZB 1RZ6A 1R5LA 3CCEP 4JQ0D 3OJAB 4K3IA 3O20A 4N78D 4D6TE 2IZ0A 2IBZD 3CXHE 3RL0D 4ASWA 3VP8A 3BCCG 3Q5PA 3A0HH 4EICA 4OGQB 1SS1A 4GYDA 1DW2A 5CIBB 3LIDA 1CHJA 1URQD 1VQKP 3KZIE 5KAFV 2NPSB 2O1JA 3G6EP 5AVXB 1GD2E 4WWIA 1YQ4C 3SWSA 5AVWB 1BCCD 3F5HA 3N7NA 4L73A 2CPSA 5TISH 2IFNA 2P10A 3MIWA 2XDJA 3IF4A 3SLEA 3EWKA 1PGQA 5DJQB 2K3RA 1LC1A 2HYNA 1YTZT 3LW5J 2NZ2A 3JCUE 4H44D 3ORVA 4U3FJ 3L36A 1FC2C 1LTSC 3H1HG 3N4XA 4BRYA 3L70D 4Z1MH 3HRNA 5M1BA 3CWBG 3WFBC 1PPJE 1JY2N 3D6ZA 1QYZA 1JY3P 3ZCFA 1DW0A 3P8CD 4H13D 3PHLA 1W5CE 1S9KD 3AE6C 2QJYB 1P84E 3AE3C 4WY4C 1NAFA 1SQXJ 5B66V 2JKVA 2W83C 5AVYB 2RKLA 2ZXYA 4CPGA 1KILC 1K04A 1E2RA 5EFWB 1FBMA 1FDMA 5APSA 3WU2H 2A45I 1M90Q 3CX5W 5APUA 4XYDB 3L75D 3SVWA 3D70A 2PP6A 1GMJA 3VMYA 3ZDMA 3GF3A 2N1TC 3CCMP 3A0BH 1GU2A 3AE7C 2WT7A 4KJMA 1DW3A 3R2PA 3SFDC 5B66E 1RE4C 1YYCA 1URQA 1FZCA 3JBTB 1BL9A 3CX5E 3E1RA 1T6AA 5AW8B 5E79H 3H1JJ 3RL0B 1KQLA 1RAPA 1FJ0A 3AE5C 2FYNB 3CC2P 1AVYA 1L4AC 3G71P 1S5LX 2WT7B 1C2RA 2E5YA 4ZNCA 1T2KC 1HROA 1URQB 1FZCB 1RZ5A 3H1KG 4JPZB 3AEAC 3VP9A 2GC4D 2VHDA 1KD1Q 2OTLP 3MK7C 3L4OA 1SLQA 3CP5A 2GA1A 1CHHA 3VMZA 2HODB 4JYCA 3MUDA 4I6MC 2E74B 2E75B 3JSVC 2ZAEB 5AVUB 2MKVA 1SQVD 5GTIV 5KAIH 1NOHA 3II6A 4PW9B 2KUBA 1RF0C 3SWYA 3E7KA 3L74G 2I8FA 3H1IJ 4IL6V 2ZVNB 1K9MQ 1CCHA 4IFFA 1T3JA 1HBWA 5KLIB 2CA3B 3CYTI 5EXQA 2QJKC 1GKSA 1N15A 1N90A 3P8MC 3MGNA 3SJLA 1RE3C 2BGVX 4H13B 5GTIE 1CNOA 1I54A 1CHIA 1QGKB 2A45H 2FXMA 3A0HV 3H1LG 2L5GB 4IL6E 2KI7B 3PXSA 1IQCA 4LC1A 1DVVA 1JCCA 2HPCA 3HUSA 3CCQP 1A8CA 2JR8A 3ABVC 1SQQD 1ZW0A 2Z5HA 1Q82Q 1KYOE 1C52A 3L74E 5BVZA 1GL2B 2GIWA 1L0NJ 4I7ZC 2D2CD 3U1AA 4NPDA 4GODA 2C9LY 5TISV 2H89C 3L70J 2HPCB 3HUSB 4O9BA 2BCNB 2YMYA 5K5GB 1IO4A 1M1JC 1C6RA 3A0HE 3DP5A 4H0JA 4AANA 3NXSA 3VRDA 1BE3G 4IOIH 1S6VB 3CCUP 4FAVA 3FXDA 4DJGA 4Y28J 1KB9I 5KJ7C 1YICA 2OTKE 2W6JH 1YCCA 3C1LA 3VOPA 4OH8B 1KFMA 1HJBA 1WEJF 3WFEC 1OMIA 3Q5SA 1A02F 3E1IA 2ZJSE 1USEA 2WPSA 2Q5UA 5CCHC 1NTZG 2V7QH 2FYUE 3B5NC 1FAVA 3M0DC 3L37A 4RO0A 1VF5D 2J5UA 2KOGA 2WSSH 3AEDC 1Q2NA 1EXIA 5AVTB 1OVVA 1BE3E 1KQFB 1GW4A 2YK3A 1VQOP 1CIFA 2QJPC 2AIUA 3KZIH 1H31A 3F89A 2Q3EA 3A0BV 1IJDB 4C46A 4LLHA 4L75A 4GT1A 3FXEA 1IK7A 1PV3A 3TGUG 4DZOA 3ZOOA 5E79V 1I55A 3L71E 3WU2E 1H31B 2KLUA 1LS9A 2PRRA 3L73D 3SWKA 3AECC 1S2EA 1CI6A 1I8PA 2R3CA 3ZOYA 1NMLA 4RJTA 3TYYA 3FGAD 1OAEA 3A0BE 4HKZH 2P7JA 2D2CB 5AW3B 1G1IA 5CMZA 2FRCA 1CTJA 1KTMA 3KPEA 1YQ3C 2HG5D 1HUCA 2JQRA 1U7MA 1CI6B 5E79E 5KAIV 1PP9E 2FYUJ 1EDKA 1JMBA 1PGOA 1BGYJ 2V4HA 1KQGB 1NTKJ 1GK4A 3VMXA 2IZ1A 1KB9H 1NTZK 3CL3D 3FWNA 3GW6A 4PV1C 3PXTA 3TSIA 3KYQA 3U1CA 1J1EC 1W2EA 1KMIZ 2W6BA 3CD6P 1MZ4A 2A45G 2LKMA 4Y5RA 4QAOA 2C1VA 2XTSB 4H0KA 5KAIE 2IYPA 2KS1A 1K3GA 3VNWA 3R4YA 3QH9A 5KJ7D 2ZT9C 1X22A 1VF5B 1LTBC 2KS1B 1IFDA 3AEEC 4YTPC 1D7MA 5BU8B 2KNCA 2I1KA 1HGZA 5CCGC 4HJGH 3HD7C 4D6TD 5CCHD 3CXHD 2E42A 2KB7P 1LT1A 3VN0A 2N18C 1FOSE 3BRTB 3B5ND 1SQPG 3L4FA 3RK2C 5AW6B 1AOQA 2HV4A 5AURA 4K3AA 1PL5A 4L76A 2QRXA 2KNCB 3L72G 4BXLA 1GZLA 1N7SC 2XNXA 3BASA 4YXDC 3H25A 2AEFA 1ZLLA 2R32A 2R3SA 1H33A 5C0ZA 1JY2O 2FYZA 2BCCG 4J20A 2WPVB 2DGEA 1MFZA 1L2PA 1PGJA 4I1LA 1VQ5P 3ZOXA 2YXRB 4U3FG 2R5DA 1NIRA 1JDLA 3JC22 4EI2A 1N73C 1H33B 2ZZS1 2XV5A 1NU1J 4W7YA 1MZ9A 1LWUC 2RMZA 2YXQB 1SQPE 1HJ3A 1PPJD 4WVZA 4WQ8A 1HGVA 1LT9A 3WUTA 1YEAA 2V08A 4N6JA 1M8OB 1VPCA 2CA4B 1M1JA 4WQAA 3L72E 5CIFB 1N2DC 4TLFA 1AJYA 1C75A 3KZIV 4C7RA 4YE1A 1CEDA 2W27A 1LT9B 5KJ7A 2QA4P 4GOEA 2KIKA 4EIFA 1Q90D 3D6YA 2Y9ZA 3H1ID 1GU5A 1SQPK 2GM4A 4PJ0E 1RF1C 1KB0A 1NYHA 2BH4X 4MN4C 1CIHA 2YO2A 1WVEC 3V5BA 4NFGB 3ZOWA 1DD4A 5C39A 3B5NA 3FWLA 2GUSA 2YO3A 4Y99C 1J1DC 5H2FH 2Y0DA 2LITA 1JY3N 1JEKA 2N9JA 1CRIA 1YTCA 1GDVA 3HQ9A 1S1CX 1SQBG 1Q81Q 1NGMB 1JUNA 3IN6A 1CTYA 2YIUB 2A06E 1AFOA 3WUUA 2FFDC 1OZHA 1CIGA 2WTYA 1L0ND 1L0LG 3HD7D 2YCCA 5AW1B 1CO6A 2HR3A 1FOCA 3TK1A 3TYIA 1KZUB 3I5CA 3BCCE 4BWNA 3EFGA 2ZFCA 3LIEA 4ASVA 2IBZG 5AVQB 4U7JA 2PCCB 3GHGC 3M9BA 2KYVA 1RY3A 1SFCD 1NAYA 4AUWA 1E79H 1KB9E 5APWA 4BRYB 4D6TJ 1KC8Q 1J3SA 1EZVD 1SQBE 1N7LA 2HLOA 1EB7A 2BH5X 2M0BA 1BCCG 1U75B 1OX3A 2E43A 1JM0A 3T97A 1QEXA 3V2RA 4JF7A 1NTMG 2ZYDA 1L0LE 3OA8A 4EIJA 4DCKA 2OYIC 2FKWB 2R5BA 3RK3D 3O6QA 5CIDB 3H1HE 1I5TA 3T97B 3CWBE 4WQ7A 2IBZE 1SQBK 1MFTA 1QKSA 3PRJA 3OA8B 3ITKA 2WVRA 1EC5A 2OYHA 3L70G 1PGPA 1KYOD 3L74D 2FWLA 1LTAC 4RESB 5CIHB 3O6QB 1JY2P 2E5TA 3CLQA 2WSEH 3BCCJ 4HYTB 1L0LK 2ZXEB 2E76C 3EQ2A 1DD3A 2OYHB 3GMAA 4UB8H 2Q9IA 1H89A 2K37A 1CSWA 1NTME 2OYOA 1LTJA 2D0SA 1KQSO 1M56D 2K88A 4N0KA 2M3BA 3L75G 1EDJA 1U7JA 4WQCA 1YHQP 3WUVA 1I6EA 2FY8A 1CYCA 1WT6A 1LTJB 1GQ1A 1EDIA 4H44B 1LTTC 1SFCA 5KLVG 4KT0J 4FANA 2HFED 2OGUA 2FYUD 2CXBA 3M9HA 3MZWB 2Z5IA 1BGYD 1NTKD 1W2BO 1NTMK 3CCSP 3H1KE 1HZUA 2W90A 3S9OA 1MKMA 2AI5A 3PTZA 2C2CA 1SFCB 1X0TA 1CSBA 1BSHA 1NHLA 1IK9A 3WMM0 1ZXGA 5H2FV 4WQBA 1Z56A 3V2NA 5KKZC 3L75E 2OQQA 2PGDA 1AYGA 2YQBA 1AQTA 1I6DA 4H0LC 1R5SA 1SQVG 2BLFB 4WY4D 3RK3B 3L71D 5KLVE 1C6OA 2H7HA 1FDOA 3Q5RA 4XE5B 2I8DA 3HTKA 3SFEC 1KILD 3RBZA 1ZMEC 1WRGA 1Y9BA 1KIBA 2WWWA 5H2FE 3HE4A 5CJ0A 1OW6A 1KV4A 1LNQA 1S4XA 4AALA 3HTKB 2N1TD 1GTWA 1CRYA 1LP1A 3H1LE 1PP9D 3AEBC 3O0RC 1LTGC 2OTJP 3CPWO 3Q2YA 2XKMA 5KLVK 1IFPA 1M6ZA 3H1KJ 4V2KA 1MG2D 2JTIB 1JO5A 1X9VA 1N8RQ 1LP1B 1L4AD 2N9BA 4OGQC 1BSNA 1S5LH 4PD4I 3SSUA 2NRGA 4EIEA 1SQQG 1T2KD 2NPSC 2IPPA 1PFIA 4PJ0H 3AE8C 2E76D 2N3BA
chains in the Genus database with same CATH topology
3HQ7A 2RN0A 3WU2V 1YIQA 3X39A 3ZIYA 5C9MA 3SWSA 4DY9A 1BCCD 155CA 4D6TD 1NU1D 3CXHD 2MHMA 2N18C 2N18B 2L91A 2N9IA 1IRVA 1AOQA 3SLEA 2HV4A 1F1CA 5AURA 1DIQC 1CYJA 5DJQC 5DJQB 1LC1A 1C7MA 2KNCB 2JWAA 1CRCA 1CXCA 3ORVA 1HRCA 1IO3A 1N9CA 1H33A 5C0ZA 1BE3D 3L70D 1RAQA 4J20A 3WFBC 2DGEA 1QYZA 3ZCFA 3ZOXA 2C1DA 3TF5A 1DW0A 1NIRA 1DW1A 1KYOW 3PHLA 1JDLA 2QJYB 1H33B 1CYIA 4UB8V 3RN0A 3NWVA 1CC5A 2ZZS1 5B66V 2K9JB 2RMZA 2C1DB 1NTZD 4O1QA 1CTZA 2ZXYA 3WC8A 1HJ3A 1PPJD 3RLMA 1E2RA 4WQ8A 2PCBB 1YEAA 2V08A 3HQ8A 5DF5A 3TDKA 5DFSA 2CA4B 3CX5W 4XYDB 4WQAA 5CIFB 5CYTR 3L75D 3SVWA 1C6SA 1HCMA 1LMSA 3DMIA 1VYDA 1AOFA 1C75A 3KZIV 4AAOA 4YE1A 1CXAA 1CEDA 1GU2A 2DVHA 2BPBB 1C2NA 1YEBA 1DW3A 3WUIA 4EIFA 5CIGB 3JBTB 1A56A 1BL9A 3H1ID 3L72D 5CIEB 1KB0A 2BH4X 1RAPA 1CIHA 1FJ0A 1K3HA 1WVEC 2FYNB 1M60A 3PLNA 3TGUD 4NFGB 3ZOWA 1CORA 3KHUA 1C2RA 3HQ6A 3FWLA 3PH2B 1HROA 1RZ5A 5TJHA 3VMAA 1MG3D 3VYMA 2GC4D 2VHDA 2Y0DA 1L9JC 1CSXA 3MK7B 3MK7C 5B6QA 2LITA 3L4OA 3CP5A 1CHHA 2N9JA 1CRIA 1YTCA 1GDVA 3HQ9A 2GB8B 2V07A 1KX7A 1H9YA 5GTHV 1SQVD 5GTIV 1COTA 3CU4A 4PW9B 1CTYA 2ZBOA 2YIUB 2PACA 1YNRA 4EIDA 2I8FA 1QL4A 1CRJA 1CIGA 2CE1A 3GG2A 1L0ND 4IL6V 2YCCA 1CO6A 1KX2A 1FOCA 1CCHA 3TYIA 2OZ1A 5KLIB 2CA3B 4FA9A 3CYTI 1HH7A 1NNOA 5EXQA 1CRHA 2QJKB 4WQEA 1GKSA 351CA 1N15A 1W2LA 1N90A 3SJLA 2BGVX 4L1QA 1CNOA 1I54A 2A06D 2PCCB 4AX3A 1DIIC 1CHIA 3NBTA 2OZ1B 1E29A 1W5CT 1J3SA 4AAMA 1KV9A 3A0HV 1EZVD 5B5EV 1S5LV 3RN1A 1EB7A 3PXSA 3BCCD 1IQCA 1FI9A 1DVVA 2BH5X 1CSVA 1QL3A 4A7PA 4PJ0V 1DVHA 1U75B 1A8CA 1DT1A 1ETPA 1SQQD 1LFMA 2LIRA 1C52A 1CIEA 2GIWA 4FA1A 2B12B 2N3YA 1R0QA 3OA8A 1L9BC 1P84D 5TISV 1FCDC 1HZVA 1LC2A 1KB9D 5CICB 4RSZA 5CIDB 1CSUA 1I5TA 2GC7D 2BCNB 4UB6V 4P4QB 1SQPD 1CRGA 1C6RA 2ORLA 3DP5A 4H0JA 4AANA 4WQ7A 3VRDA 1H1OA 1QKSA 3PRJA 2O3JA 3CXHW 3OA8B 3ITKA 3DR0A 3OCDA 1S6VB 1KYOD 3L74D 1FI3A 2FWLA 2MTAC 3NBSA 4EDFA 4FAVA 5CIHB 2D0WA 5IY51 1FI7A 1YICA 3WFCC 1YCCA 3H1HD 2BCCD 3CWBD 3OCDB 4WQDA 4MU8A 4XXLA 1WEJF 3WFEC 4U3FD 3CX5D 1CSWA 2B10B 3L4MA 2D0SA 4N0KA 4L3HA 2AXTV 4WQCA 1I6EA 3RMZA 1CYCA 2Y0CA 3WFDC 1IRWA 1A2SA 1GQ1A 4PWAA 2Y0EA 1SQXD 1YFCA 4WQ9A 2B11B 2YK3A 4JCGA 1CIFA 2QJPB 2AIUA 3SXTA 2B4ZA 1NTMD 4FANA 1M70A 1H31A 2FYUD 2CXBA 2Q3EA 1B7VA 3A0BV 3ZBMA 3C2CA 1BGYD 1NTKD 1HJ5A 1HZUA 1I8OA 2AI5A 3PTZA 2C8SA 3M97X 4O1WA 2C2CA 3ZOOA 1GIWA 5E79V 1I55A 1H31B 2N9YB 1ZRTD 1E8EA 1LS9A 1N50A 3L73D 1NMIA 5H2FV 4WQBA 1U74B 1I8PA 5KKZB 3ZOYA 1NMLA 4RJTA 3A9FA 1CCRA 1OAEA 1AYGA 2YQBA 3H1KD 4GEDB 3H1JD 4FA5A 1I6DA 1IZL0 1QN2A 2BLFB 2FRCA 1GJQA 1CTJA 3L71D 1C6OA 3O5CA 2JQRA 5KAIV 2L4DA 1SQBD 3O1YA 451CA 1F1FA 2CE0A 2C9XB 1AKKA 1OCDA 3GW6A 2QG4A 4FB1A 3PXTA 1KIBA 1ZZHA 1FHBA 2ZONG 1H9XA 2EXVA 4AALA 1HJ4A 1L0LD 1H32A 4PD4D 1CRYA 4L3GA 5KLVD 1MZ4A 4KMGA 1PP9D 2C1UA 4Y5RA 3O0RC 4QAOA 1RZ6A 2C1VA 2XTSB 4H0KA 4K3IA 1M6ZA 1K3GA 2KS1A 3O20A 4V2KA 3VNWA 2IBZD 1MG2D 2JTIB 2ZOOA 1H32B 2B0ZB 3PXWA 4Q5PA 4EICA 4GYDA 1DW2A 5CIBB 4EIEA 4FA4A 1CHJA 4LJIA 5KAFV 3H1LD 2N3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQ7 A;  2RN0 A;  3WU2 V;  1YIQ A;  3X39 A;  3ZIY A;  5C9M A;  3SWS A;  4DY9 A;  1BCC D;  155C A;  4D6T D;  1NU1 D;  3CXH D;  2MHM A;  2N18 C;  2N18 B;  2L91 A;  2N9I A;  1IRV A;  1AOQ A;  3SLE A;  2HV4 A;  1F1C A;  5AUR A;  1DIQ C;  1CYJ A;  5DJQ C;  5DJQ B;  1LC1 A;  1C7M A;  2KNC B;  2JWA A;  1CRC A;  1CXC A;  3ORV A;  1HRC A;  1IO3 A;  1N9C A;  1H33 A;  5C0Z A;  1BE3 D;  3L70 D;  1RAQ A;  4J20 A;  3WFB C;  2DGE A;  1QYZ A;  3ZCF A;  3ZOX A;  2C1D A;  3TF5 A;  1DW0 A;  1NIR A;  1DW1 A;  1KYO W;  3PHL A;  1JDL A;  2QJY B;  1H33 B;  1CYI A;  4UB8 V;  3RN0 A;  3NWV A;  1CC5 A;  2ZZS 1;  5B66 V;  2K9J B;  2RMZ A;  2C1D B;  1NTZ D;  4O1Q A;  1CTZ A;  2ZXY A;  3WC8 A;  1HJ3 A;  1PPJ D;  3RLM A;  1E2R A;  4WQ8 A;  2PCB B;  1YEA A;  2V08 A;  3HQ8 A;  5DF5 A;  3TDK A;  5DFS A;  2CA4 B;  3CX5 W;  4XYD B;  4WQA A;  5CIF B;  5CYT R;  3L75 D;  3SVW A;  1C6S A;  1HCM A;  1LMS A;  3DMI A;  1VYD A;  1AOF A;  1C75 A;  3KZI V;  4AAO A;  4YE1 A;  1CXA A;  1CED A;  1GU2 A;  2DVH A;  2BPB B;  1C2N A;  1YEB A;  1DW3 A;  3WUI A;  4EIF A;  5CIG B;  3JBT B;  1A56 A;  1BL9 A;  3H1I D;  3L72 D;  5CIE B;  1KB0 A;  2BH4 X;  1RAP A;  1CIH A;  1FJ0 A;  1K3H A;  1WVE C;  2FYN B;  1M60 A;  3PLN A;  3TGU D;  4NFG B;  3ZOW A;  1COR A;  3KHU A;  1C2R A;  3HQ6 A;  3FWL A;  3PH2 B;  1HRO A;  1RZ5 A;  5TJH A;  3VMA A;  1MG3 D;  3VYM A;  2GC4 D;  2VHD A;  2Y0D A;  1L9J C;  1CSX A;  3MK7 B;  3MK7 C;  5B6Q A;  2LIT A;  3L4O A;  3CP5 A;  1CHH A;  2N9J A;  1CRI A;  1YTC A;  1GDV A;  3HQ9 A;  2GB8 B;  2V07 A;  1KX7 A;  1H9Y A;  5GTH V;  1SQV D;  5GTI V;  1COT A;  3CU4 A;  4PW9 B;  1CTY A;  2ZBO A;  2YIU B;  2PAC A;  1YNR A;  4EID A;  2I8F A;  1QL4 A;  1CRJ A;  1CIG A;  2CE1 A;  3GG2 A;  1L0N D;  4IL6 V;  2YCC A;  1CO6 A;  1KX2 A;  1FOC A;  1CCH A;  3TYI A;  2OZ1 A;  5KLI B;  2CA3 B;  4FA9 A;  3CYT I;  1HH7 A;  1NNO A;  5EXQ A;  1CRH A;  2QJK B;  4WQE A;  1GKS A;  351C A;  1N15 A;  1W2L A;  1N90 A;  3SJL A;  2BGV X;  4L1Q A;  1CNO A;  1I54 A;  2A06 D;  2PCC B;  4AX3 A;  1DII C;  1CHI A;  3NBT A;  2OZ1 B;  1E29 A;  1W5C T;  1J3S A;  4AAM A;  1KV9 A;  3A0H V;  1EZV D;  5B5E V;  1S5L V;  3RN1 A;  1EB7 A;  3PXS A;  3BCC D;  1IQC A;  1FI9 A;  1DVV A;  2BH5 X;  1CSV A;  1QL3 A;  4A7P A;  4PJ0 V;  1DVH A;  1U75 B;  1A8C A;  1DT1 A;  1ETP A;  1SQQ D;  1LFM A;  2LIR A;  1C52 A;  1CIE A;  2GIW A;  4FA1 A;  2B12 B;  2N3Y A;  1R0Q A;  3OA8 A;  1L9B C;  1P84 D;  5TIS V;  1FCD C;  1HZV A;  1LC2 A;  1KB9 D;  5CIC B;  4RSZ A;  5CID B;  1CSU A;  1I5T A;  2GC7 D;  2BCN B;  4UB6 V;  4P4Q B;  1SQP D;  1CRG A;  1C6R A;  2ORL A;  3DP5 A;  4H0J A;  4AAN A;  4WQ7 A;  3VRD A;  1H1O A;  1QKS A;  3PRJ A;  2O3J A;  3CXH W;  3OA8 B;  3ITK A;  3DR0 A;  3OCD A;  1S6V B;  1KYO D;  3L74 D;  1FI3 A;  2FWL A;  2MTA C;  3NBS A;  4EDF A;  4FAV A;  5CIH B;  2D0W A;  5IY5 1;  1FI7 A;  1YIC A;  3WFC C;  1YCC A;  3H1H D;  2BCC D;  3CWB D;  3OCD B;  4WQD A;  4MU8 A;  4XXL A;  1WEJ F;  3WFE C;  4U3F D;  3CX5 D;  1CSW A;  2B10 B;  3L4M A;  2D0S A;  4N0K A;  4L3H A;  2AXT V;  4WQC A;  1I6E A;  3RMZ A;  1CYC A;  2Y0C A;  3WFD C;  1IRW A;  1A2S A;  1GQ1 A;  4PWA A;  2Y0E A;  1SQX D;  1YFC A;  4WQ9 A;  2B11 B;  2YK3 A;  4JCG A;  1CIF A;  2QJP B;  2AIU A;  3SXT A;  2B4Z A;  1NTM D;  4FAN A;  1M70 A;  1H31 A;  2FYU D;  2CXB A;  2Q3E A;  1B7V A;  3A0B V;  3ZBM A;  3C2C A;  1BGY D;  1NTK D;  1HJ5 A;  1HZU A;  1I8O A;  2AI5 A;  3PTZ A;  2C8S A;  3M97 X;  4O1W A;  2C2C A;  3ZOO A;  1GIW A;  5E79 V;  1I55 A;  1H31 B;  2N9Y B;  1ZRT D;  1E8E A;  1LS9 A;  1N50 A;  3L73 D;  1NMI A;  5H2F V;  4WQB A;  1U74 B;  1I8P A;  5KKZ B;  3ZOY A;  1NML A;  4RJT A;  3A9F A;  1CCR A;  1OAE A;  1AYG A;  2YQB A;  3H1K D;  4GED B;  3H1J D;  4FA5 A;  1I6D A;  1IZL 0;  1QN2 A;  2BLF B;  2FRC A;  1GJQ A;  1CTJ A;  3L71 D;  1C6O A;  3O5C A;  2JQR A;  5KAI V;  2L4D A;  1SQB D;  3O1Y A;  451C A;  1F1F A;  2CE0 A;  2C9X B;  1AKK A;  1OCD A;  3GW6 A;  2QG4 A;  4FB1 A;  3PXT A;  1KIB A;  1ZZH A;  1FHB A;  2ZON G;  1H9X A;  2EXV A;  4AAL A;  1HJ4 A;  1L0L D;  1H32 A;  4PD4 D;  1CRY A;  4L3G A;  5KLV D;  1MZ4 A;  4KMG A;  1PP9 D;  2C1U A;  4Y5R A;  3O0R C;  4QAO A;  1RZ6 A;  2C1V A;  2XTS B;  4H0K A;  4K3I A;  1M6Z A;  1K3G A;  2KS1 A;  3O20 A;  4V2K A;  3VNW A;  2IBZ D;  1MG2 D;  2JTI B;  2ZOO A;  1H32 B;  2B0Z B;  3PXW A;  4Q5P A;  4EIC A;  4GYD A;  1DW2 A;  5CIB B;  4EIE A;  4FA4 A;  1CHJ A;  4LJI A;  5KAF V;  3H1L D;  2N3B A; 
#chains in the Genus database with same CATH topology
 3HQ7 A;  2RN0 A;  3WU2 V;  1YIQ A;  3ZIY A;  4DY9 A;  2IBZ I;  155C A;  4KHX A;  3L74 J;  1NU1 D;  3USS A;  2MHM A;  1EXJ A;  2L91 A;  1IRV A;  2I1J A;  1E5W A;  4UB6 H;  5DJQ C;  1SQV K;  1GU4 A;  2GUV A;  1C7M A;  1NVO A;  1CRC A;  1NKN A;  1HRC A;  4DT0 A;  3OW2 O;  1NTZ E;  4WY4 A;  1RAQ A;  1J2J B;  2WSC H;  1GDT A;  2K9J A;  2C1D A;  4JBZ A;  3TF5 A;  1VQ7 P;  3H1L J;  1KIL A;  2QJY C;  4UB8 V;  1VL2 A;  2JEE A;  2XZR A;  2JWD A;  4WY4 B;  3H32 A;  2K9J B;  2C1D B;  1OWA A;  4DOJ A;  2AEJ A;  1JMM A;  2N1T A;  1KIL B;  2AXT H;  5DF5 A;  5DFS A;  1RH5 B;  1RE4 A;  5CYT R;  2IFM A;  1RQU A;  1LMS A;  2AXC A;  3H32 B;  4RKU J;  3TGU E;  1FJK A;  3DMI A;  1VYD A;  1SQQ K;  1VQP P;  2O01 H;  1BE3 J;  2PAJ A;  2N1T B;  4UB8 E;  5AW4 B;  1L4A A;  1RHZ B;  1C2N A;  1YEB A;  2Q1K A;  2QEX P;  3CCL P;  3WUI A;  4AYC A;  2KK7 A;  4PD4 H;  2R44 A;  5AVV B;  3RL0 C;  3L72 D;  1K3H A;  3L73 G;  2FYN C;  3EFF K;  3RBX A;  1L4A B;  1JOC A;  3L71 J;  5CBO A;  1COR A;  3HQ6 A;  1H0T A;  1NTZ J;  1URQ C;  1FZC C;  4K35 A;  1MG3 D;  3VYM A;  1JY3 O;  1CSX A;  3MK7 B;  4IFM A;  1FE6 A;  1RF0 A;  3D0W A;  1VQ4 P;  1IZN B;  1NH4 A;  2JP3 A;  2E74 C;  2GB8 B;  2KXP B;  4IFD K;  4R4M A;  2E75 C;  1CW5 A;  1H9Y A;  5APV A;  3Q3D A;  3C8V A;  1COT A;  3CU4 A;  2ZBO A;  1YIT P;  1PP9 J;  2NPS D;  2AEM A;  5KTB A;  2M3E A;  3MUD C;  2KZI A;  1QL4 A;  2C0X A;  1RE3 A;  2CE1 A;  3GG2 A;  3I56 P;  2WSE J;  1EQ7 A;  1BDD A;  1KX2 A;  2JO1 A;  1FZF A;  3L73 E;  5KLI C;  2M5A A;  1HH7 A;  3AE2 C;  4AQR D;  1CRH A;  2QJK B;  4WQE A;  351C A;  3BVH A;  1W2L A;  3G9R A;  1YBK A;  1VQ9 P;  4H13 C;  4L1Q A;  2A06 D;  1VQM P;  4I2L C;  2WSF H;  2P67 A;  1DII C;  3P32 A;  1QVG O;  1MV8 A;  1E29 A;  1FOS F;  4AAM A;  1R8E A;  1S5L V;  3RN1 A;  1HF9 A;  2DW3 A;  3B8E B;  2O1K A;  3BCC D;  1CSV A;  1QL3 A;  4PJ0 V;  1X79 B;  1DVH A;  1HH0 A;  3SWF A;  1DT1 A;  1SQX G;  1SVF A;  2G3A A;  4ZKP A;  1GL2 C;  4I7Z B;  4FA1 A;  2B12 B;  1FJP A;  1R0Q A;  1L9B C;  1P84 D;  1HVV A;  4L74 A;  1ZR2 A;  1FCD C;  2W8Z A;  1LC2 A;  1KB9 D;  5CIC B;  4RSZ A;  1G1J A;  1CSU A;  4ZMD A;  4NPE A;  3HUS C;  3W67 A;  1KFN A;  1VQL P;  2BCC E;  3CCJ P;  4UB6 V;  4N3Y B;  1M1J B;  1CRG A;  1BDC A;  1S5L E;  4U3F E;  1FS0 E;  4PV1 D;  3CXH W;  1RQV A;  3DR0 A;  1IFN A;  2MTA C;  4EDF A;  2YNY A;  5BU5 A;  2D0W A;  2QVA A;  5IY5 1;  1FZE A;  5CCH A;  1OXZ A;  3WFC C;  3KQG A;  3H1H D;  3M0D A;  2CK3 H;  3H1J G;  3CWB D;  4WQD A;  2NPS A;  4MU8 A;  1YJN P;  4XXL A;  3OA7 A;  1SQX E;  2YKP A;  4UB6 E;  3CX5 D;  1QLE D;  1OIP A;  2B10 B;  2H88 C;  3L4M A;  1ZV8 A;  5CBN A;  1PPJ G;  3B5N B;  2ZT9 D;  1QVF O;  4L3H A;  2B9B A;  2KSJ A;  2AXT V;  1SQP J;  1ZN5 A;  2ZYG A;  1IRW A;  5CCG D;  1ZRT E;  2E74 D;  4PWA A;  3L72 J;  4QMA A;  2B11 B;  4JCG A;  2QJP B;  2E75 D;  4YXW H;  1NTM D;  1M70 A;  1IFI A;  1YJW P;  3ZBM A;  1SQX K;  3PH0 A;  3RK2 D;  4GKG A;  3C2C A;  3H1I G;  1HJ5 A;  1XTG B;  2BCC J;  3CCV P;  3TNU A;  3H1J E;  3V2Q A;  1I8O A;  1NWQ A;  1ZOY C;  2V7Q J;  2VRS A;  1N7S D;  3M97 X;  5KAF E;  3AE4 C;  2AXT E;  3W68 A;  1H88 A;  3P7K A;  4WB4 A;  1QL1 A;  1FZG A;  4B86 A;  1E8E A;  4W80 A;  3TNU B;  1OVR A;  1OW7 A;  1H8A A;  3VYI A;  3H1K D;  1WMK A;  1ZR4 A;  1N86 A;  2KLV A;  2D2C C;  3PJS K;  3FX0 A;  4PD4 E;  2C9N Y;  5GTH H;  3O5C A;  1XTC C;  1G2C A;  1AQ5 A;  2L4D A;  1IFM A;  4M3L A;  4HB1 A;  5AW7 B;  3O1Y A;  2K1A A;  1L0N G;  3AEG C;  3H1I E;  2C9X B;  4N78 E;  1OCD A;  5AW9 B;  4PV1 B;  1GL2 D;  1ZZH A;  1ZP0 C;  1K05 A;  2C0W A;  1JCD A;  2WSC J;  1G2C B;  1J1E B;  1HJ4 A;  2Q3I A;  1H32 A;  4L3G A;  5KLV D;  3A7O A;  1VDF A;  3KDP B;  2RH0 A;  2C1U A;  3M06 A;  3BAT A;  1NJI Q;  2H8P D;  1BCC E;  5L8R J;  2Y9Y A;  1VQN P;  1EZV G;  2ZOO A;  3B4S A;  2HOD A;  1H32 B;  5CHX A;  2B0Z B;  3PXW A;  5CCG A;  2P2U A;  3HD7 A;  4Q5P A;  5B5E H;  2ZT9 B;  2IX7 C;  3PP5 A;  2Z4E A;  4FA4 A;  1SQB J;  1VF5 C;  4LJI A;  3H1L D;  1JNM A;  1L0N E;  3X39 A;  2O01 J;  4YPC A;  5C9M A;  1NKZ B;  2WPQ A;  4XFJ A;  2JDI H;  3HD7 B;  1N7S A;  2G8Y A;  3L70 E;  2N18 B;  1JTH A;  1L0L J;  1EDL A;  1LTI C;  2N9I A;  3RK2 B;  3H1H J;  1F1C A;  3P8C E;  1DIQ C;  1CYJ A;  1S9K E;  3CWB J;  3CC7 P;  1N7S B;  1Q7Y Q;  1PIX A;  2JWA A;  1JTH B;  1CXC A;  4W7Z A;  3CMA P;  1IO3 A;  1EZV E;  1N9C A;  1N73 A;  1AV1 A;  3CXH I;  4LGD E;  1L0N K;  1BE3 D;  3B71 A;  3IAO A;  1FU1 A;  1LWU A;  5DJU B;  4GDO A;  3NMD A;  2LXB A;  1M57 D;  3A5T A;  2KSE A;  1DW1 A;  1KYO W;  3V4W A;  1N73 B;  1CYI A;  2H43 A;  3RN0 A;  3RK3 E;  1BCC J;  3NWV A;  2Q7C A;  3D71 A;  1GL2 A;  1CC5 A;  1AVO A;  1Y8A A;  1LWU B;  1IC2 A;  1LGH B;  1NTM J;  2B87 A;  1NTZ D;  4O1Q A;  3CME P;  1CTZ A;  3WC8 A;  3RLM A;  2PCB B;  3NFQ A;  3HQ8 A;  3TDK A;  1C6S A;  5CJ4 A;  1HCM A;  1VQ8 P;  2FYU G;  3AEF C;  2QIW A;  1AOF A;  3C9I A;  2B87 B;  1RF1 A;  1BGY G;  1NTK G;  4AAO A;  2WIT A;  4NPF X;  1CXA A;  2WSF J;  3RL0 g;  1LT9 C;  3CC4 P;  2DVH A;  2BPB B;  2B89 A;  2LXC B;  5CIG B;  1A56 A;  3BRV B;  3HE4 B;  1U57 A;  1DEE G;  1RF1 B;  5CIE B;  1P84 I;  3S4R A;  2BEZ F;  3PLN A;  1M60 A;  3TGU D;  1LJ2 A;  1SQV E;  2BAS A;  1K73 Q;  3LW5 H;  2JJL A;  3M9Q A;  3K5B A;  3V2P A;  4ZKU A;  1FZB A;  1K8A Q;  3KHU A;  3MP7 B;  3PH2 B;  5AVS B;  5TIS E;  4Y99 B;  5TJH A;  3VMA A;  1J1D B;  2IYO A;  2P58 A;  1L9J C;  5B6Q A;  5APY A;  2FFD A;  3A2A A;  2XU6 A;  3L75 J;  3L71 G;  1HJ0 A;  1DEB A;  3OAK A;  2Q6Q A;  1FZA A;  2V07 A;  2ZYA A;  5AW5 B;  3M0A A;  1KX7 A;  5GTH V;  5APQ A;  1BGY E;  1NTK E;  2QE7 H;  4R4L A;  5KLV J;  3CXH H;  2YIU C;  2PAC A;  2FFD B;  3H6P A;  1M1K Q;  2QSI A;  1YNR A;  4EID A;  1PZQ A;  2PFX A;  1CRJ A;  2M8R A;  3CX5 I;  2QM7 A;  3GHG A;  1M7L A;  2YKQ A;  1A02 J;  1YIJ P;  4XA4 A;  2OZ1 A;  1PP9 G;  1KN7 A;  4FA9 A;  1NNO A;  4TT3 H;  3AE1 C;  2WQY C;  1S72 P;  1NO4 A;  3GF7 A;  1SQQ E;  3V4Q A;  2FYU K;  5GTH E;  3GHG B;  4AX3 A;  1Q86 Q;  3NBT A;  1NTK K;  2WZ7 A;  5APT A;  3AE9 C;  2OZ1 B;  2WPR A;  1W5C T;  1MUU A;  5APX A;  3IFM A;  3IR9 A;  1JB0 J;  1KV9 A;  5B5E V;  2OYI A;  1SQV J;  3CCR P;  1KIL E;  1SP4 A;  1FI9 A;  3JCU H;  4A7P A;  5KAF H;  1UII A;  3CI9 A;  5AW0 B;  3S1K A;  1ETP A;  1LFM A;  1NU1 G;  3G3Z A;  2LIR A;  1CIE A;  3GLM A;  4OWF A;  2N3Y A;  2LR2 A;  4H0L D;  4IL6 X;  2OYI B;  3I55 P;  1HZV A;  2MJZ A;  1EZV I;  3L35 A;  2GC7 D;  1P84 H;  2IDB A;  4P4Q B;  1SQP D;  2ORL A;  5B5E E;  5AW2 B;  1H1O A;  1DH3 A;  2O3J A;  2BEQ D;  3MHV A;  1HTL C;  3HE5 A;  3OCD A;  5AVR B;  1FI3 A;  3M91 A;  3NBS A;  1OW8 A;  2WMM A;  1UIX A;  2ITA A;  1T8Z A;  1FI7 A;  3V6I A;  1VQ6 P;  1S3J A;  2KZJ A;  1GW3 A;  2BCC D;  2E76 B;  1QX8 A;  1X8Y A;  1YJ9 P;  3HE5 B;  3OCD B;  2OYH C;  3QWO C;  1SQQ J;  2K9Y A;  3RGU A;  2SPZ A;  4U3F D;  1NU1 E;  2J59 M;  1KYO I;  5B66 H;  4GIF A;  2OAR A;  1H0T B;  2J58 A;  2QM8 A;  4OGQ D;  1YI2 P;  1KOR A;  3CX5 H;  2FBW C;  3RMZ A;  4WBA A;  4JYB A;  3O8Z A;  2Y0C A;  3WFD C;  1HWT C;  4EYY Q;  1A2S A;  1LTJ C;  4H44 C;  2Y0E A;  1SQX D;  1YFC A;  4WQ9 A;  2YKO A;  3SXT A;  2B4Z A;  3TGU J;  5DJT B;  1B7V A;  1NU1 K;  1OVU A;  2CPB A;  2C8S A;  4O1W A;  3KXD A;  1SFC C;  3MD0 A;  1GIW A;  1OFC X;  2O01 N;  2XND H;  2UWJ E;  2ZVO B;  2M5A B;  2N9Y B;  1ZRT D;  4C7N A;  1N50 A;  1QL2 A;  1NMI A;  2W6A A;  3UIA A;  2YMK A;  2P1J A;  1U74 B;  3Q1M A;  5KKZ B;  1USD A;  3A9F A;  1CCR A;  1FDI A;  4GOF A;  4D6T G;  4GED B;  3H1J D;  4FA5 A;  1Y47 A;  4H0L B;  1IZL 0;  1QN2 A;  4C7N B;  1DIP A;  1GJQ A;  3RK3 C;  3U59 A;  5GTI H;  1T3U A;  4EOT A;  1SQB D;  4HH2 A;  2FXP A;  3A3Y B;  2B88 A;  1YTZ I;  451C A;  1F1F A;  2CE0 A;  1AA0 A;  1AKK A;  2FXO A;  4OVN F;  3G4S P;  2QG4 A;  4FB1 A;  3MTU E;  2ZXX A;  4IL6 H;  1CZQ A;  1FHB A;  3VTP C;  1IFJ A;  2ZON G;  1GK6 A;  1H9X A;  2KP8 A;  2EXV A;  1L0L D;  2POH A;  3NTN A;  1DX7 A;  4PD4 D;  3L73 J;  2A06 G;  1KYO H;  1TU3 F;  4KMG A;  5AVZ B;  1RZ6 A;  1R5L A;  3CCE P;  4JQ0 D;  3OJA B;  4K3I A;  3O20 A;  4N78 D;  4D6T E;  2IZ0 A;  2IBZ D;  3CXH E;  3RL0 D;  4ASW A;  3VP8 A;  3BCC G;  3Q5P A;  3A0H H;  4EIC A;  4OGQ B;  1SS1 A;  4GYD A;  1DW2 A;  5CIB B;  3LID A;  1CHJ A;  1URQ D;  1VQK P;  3KZI E;  5KAF V;  2NPS B;  2O1J A;  3G6E P;  5AVX B;  1GD2 E;  4WWI A;  1YQ4 C;  3SWS A;  5AVW B;  1BCC D;  3F5H A;  3N7N A;  4L73 A;  2CPS A;  5TIS H;  2IFN A;  2P10 A;  3MIW A;  2XDJ A;  3IF4 A;  3SLE A;  3EWK A;  1PGQ A;  5DJQ B;  2K3R A;  1LC1 A;  2HYN A;  1YTZ T;  3LW5 J;  2NZ2 A;  3JCU E;  4H44 D;  3ORV A;  4U3F J;  3L36 A;  1FC2 C;  1LTS C;  3H1H G;  3N4X A;  4BRY A;  3L70 D;  4Z1M H;  3HRN A;  5M1B A;  3CWB G;  3WFB C;  1PPJ E;  1JY2 N;  3D6Z A;  1QYZ A;  1JY3 P;  3ZCF A;  1DW0 A;  3P8C D;  4H13 D;  3PHL A;  1W5C E;  1S9K D;  3AE6 C;  2QJY B;  1P84 E;  3AE3 C;  4WY4 C;  1NAF A;  1SQX J;  5B66 V;  2JKV A;  2W83 C;  5AVY B;  2RKL A;  2ZXY A;  4CPG A;  1KIL C;  1K04 A;  1E2R A;  5EFW B;  1FBM A;  1FDM A;  5APS A;  3WU2 H;  2A45 I;  1M90 Q;  3CX5 W;  5APU A;  4XYD B;  3L75 D;  3SVW A;  3D70 A;  2PP6 A;  1GMJ A;  3VMY A;  3ZDM A;  3GF3 A;  2N1T C;  3CCM P;  3A0B H;  1GU2 A;  3AE7 C;  2WT7 A;  4KJM A;  1DW3 A;  3R2P A;  3SFD C;  5B66 E;  1RE4 C;  1YYC A;  1URQ A;  1FZC A;  3JBT B;  1BL9 A;  3CX5 E;  3E1R A;  1T6A A;  5AW8 B;  5E79 H;  3H1J J;  3RL0 B;  1KQL A;  1RAP A;  1FJ0 A;  3AE5 C;  2FYN B;  3CC2 P;  1AVY A;  1L4A C;  3G71 P;  1S5L X;  2WT7 B;  1C2R A;  2E5Y A;  4ZNC A;  1T2K C;  1HRO A;  1URQ B;  1FZC B;  1RZ5 A;  3H1K G;  4JPZ B;  3AEA C;  3VP9 A;  2GC4 D;  2VHD A;  1KD1 Q;  2OTL P;  3MK7 C;  3L4O A;  1SLQ A;  3CP5 A;  2GA1 A;  1CHH A;  3VMZ A;  2HOD B;  4JYC A;  3MUD A;  4I6M C;  2E74 B;  2E75 B;  3JSV C;  2ZAE B;  5AVU B;  2MKV A;  1SQV D;  5GTI V;  5KAI H;  1NOH A;  3II6 A;  4PW9 B;  2KUB A;  1RF0 C;  3SWY A;  3E7K A;  3L74 G;  2I8F A;  3H1I J;  4IL6 V;  2ZVN B;  1K9M Q;  1CCH A;  4IFF A;  1T3J A;  1HBW A;  5KLI B;  2CA3 B;  3CYT I;  5EXQ A;  2QJK C;  1GKS A;  1N15 A;  1N90 A;  3P8M C;  3MGN A;  3SJL A;  1RE3 C;  2BGV X;  4H13 B;  5GTI E;  1CNO A;  1I54 A;  1CHI A;  1QGK B;  2A45 H;  2FXM A;  3A0H V;  3H1L G;  2L5G B;  4IL6 E;  2KI7 B;  3PXS A;  1IQC A;  4LC1 A;  1DVV A;  1JCC A;  2HPC A;  3HUS A;  3CCQ P;  1A8C A;  2JR8 A;  3ABV C;  1SQQ D;  1ZW0 A;  2Z5H A;  1Q82 Q;  1KYO E;  1C52 A;  3L74 E;  5BVZ A;  1GL2 B;  2GIW A;  1L0N J;  4I7Z C;  2D2C D;  3U1A A;  4NPD A;  4GOD A;  2C9L Y;  5TIS V;  2H89 C;  3L70 J;  2HPC B;  3HUS B;  4O9B A;  2BCN B;  2YMY A;  5K5G B;  1IO4 A;  1M1J C;  1C6R A;  3A0H E;  3DP5 A;  4H0J A;  4AAN A;  3NXS A;  3VRD A;  1BE3 G;  4IOI H;  1S6V B;  3CCU P;  4FAV A;  3FXD A;  4DJG A;  4Y28 J;  1KB9 I;  5KJ7 C;  1YIC A;  2OTK E;  2W6J H;  1YCC A;  3C1L A;  3VOP A;  4OH8 B;  1KFM A;  1HJB A;  1WEJ F;  3WFE C;  1OMI A;  3Q5S A;  1A02 F;  3E1I A;  2ZJS E;  1USE A;  2WPS A;  2Q5U A;  5CCH C;  1NTZ G;  2V7Q H;  2FYU E;  3B5N C;  1FAV A;  3M0D C;  3L37 A;  4RO0 A;  1VF5 D;  2J5U A;  2KOG A;  2WSS H;  3AED C;  1Q2N A;  1EXI A;  5AVT B;  1OVV A;  1BE3 E;  1KQF B;  1GW4 A;  2YK3 A;  1VQO P;  1CIF A;  2QJP C;  2AIU A;  3KZI H;  1H31 A;  3F89 A;  2Q3E A;  3A0B V;  1IJD B;  4C46 A;  4LLH A;  4L75 A;  4GT1 A;  3FXE A;  1IK7 A;  1PV3 A;  3TGU G;  4DZO A;  3ZOO A;  5E79 V;  1I55 A;  3L71 E;  3WU2 E;  1H31 B;  2KLU A;  1LS9 A;  2PRR A;  3L73 D;  3SWK A;  3AEC C;  1S2E A;  1CI6 A;  1I8P A;  2R3C A;  3ZOY A;  1NML A;  4RJT A;  3TYY A;  3FGA D;  1OAE A;  3A0B E;  4HKZ H;  2P7J A;  2D2C B;  5AW3 B;  1G1I A;  5CMZ A;  2FRC A;  1CTJ A;  1KTM A;  3KPE A;  1YQ3 C;  2HG5 D;  1HUC A;  2JQR A;  1U7M A;  1CI6 B;  5E79 E;  5KAI V;  1PP9 E;  2FYU J;  1EDK A;  1JMB A;  1PGO A;  1BGY J;  2V4H A;  1KQG B;  1NTK J;  1GK4 A;  3VMX A;  2IZ1 A;  1KB9 H;  1NTZ K;  3CL3 D;  3FWN A;  3GW6 A;  4PV1 C;  3PXT A;  3TSI A;  3KYQ A;  3U1C A;  1J1E C;  1W2E A;  1KMI Z;  2W6B A;  3CD6 P;  1MZ4 A;  2A45 G;  2LKM A;  4Y5R A;  4QAO A;  2C1V A;  2XTS B;  4H0K A;  5KAI E;  2IYP A;  2KS1 A;  1K3G A;  3VNW A;  3R4Y A;  3QH9 A;  5KJ7 D;  2ZT9 C;  1X22 A;  1VF5 B;  1LTB C;  2KS1 B;  1IFD A;  3AEE C;  4YTP C;  1D7M A;  5BU8 B;  2KNC A;  2I1K A;  1HGZ A;  5CCG C;  4HJG H;  3HD7 C;  4D6T D;  5CCH D;  3CXH D;  2E42 A;  2KB7 P;  1LT1 A;  3VN0 A;  2N18 C;  1FOS E;  3BRT B;  3B5N D;  1SQP G;  3L4F A;  3RK2 C;  5AW6 B;  1AOQ A;  2HV4 A;  5AUR A;  4K3A A;  1PL5 A;  4L76 A;  2QRX A;  2KNC B;  3L72 G;  4BXL A;  1GZL A;  1N7S C;  2XNX A;  3BAS A;  4YXD C;  3H25 A;  2AEF A;  1ZLL A;  2R32 A;  2R3S A;  1H33 A;  5C0Z A;  1JY2 O;  2FYZ A;  2BCC G;  4J20 A;  2WPV B;  2DGE A;  1MFZ A;  1L2P A;  1PGJ A;  4I1L A;  1VQ5 P;  3ZOX A;  2YXR B;  4U3F G;  2R5D A;  1NIR A;  1JDL A;  3JC2 2;  4EI2 A;  1N73 C;  1H33 B;  2ZZS 1;  2XV5 A;  1NU1 J;  4W7Y A;  1MZ9 A;  1LWU C;  2RMZ A;  2YXQ B;  1SQP E;  1HJ3 A;  1PPJ D;  4WVZ A;  4WQ8 A;  1HGV A;  1LT9 A;  3WUT A;  1YEA A;  2V08 A;  4N6J A;  1M8O B;  1VPC A;  2CA4 B;  1M1J A;  4WQA A;  3L72 E;  5CIF B;  1N2D C;  4TLF A;  1AJY A;  1C75 A;  3KZI V;  4C7R A;  4YE1 A;  1CED A;  2W27 A;  1LT9 B;  5KJ7 A;  2QA4 P;  4GOE A;  2KIK A;  4EIF A;  1Q90 D;  3D6Y A;  2Y9Z A;  3H1I D;  1GU5 A;  1SQP K;  2GM4 A;  4PJ0 E;  1RF1 C;  1KB0 A;  1NYH A;  2BH4 X;  4MN4 C;  1CIH A;  2YO2 A;  1WVE C;  3V5B A;  4NFG B;  3ZOW A;  1DD4 A;  5C39 A;  3B5N A;  3FWL A;  2GUS A;  2YO3 A;  4Y99 C;  1J1D C;  5H2F H;  2Y0D A;  2LIT A;  1JY3 N;  1JEK A;  2N9J A;  1CRI A;  1YTC A;  1GDV A;  3HQ9 A;  1S1C X;  1SQB G;  1Q81 Q;  1NGM B;  1JUN A;  3IN6 A;  1CTY A;  2YIU B;  2A06 E;  1AFO A;  3WUU A;  2FFD C;  1OZH A;  1CIG A;  2WTY A;  1L0N D;  1L0L G;  3HD7 D;  2YCC A;  5AW1 B;  1CO6 A;  2HR3 A;  1FOC A;  3TK1 A;  3TYI A;  1KZU B;  3I5C A;  3BCC E;  4BWN A;  3EFG A;  2ZFC A;  3LIE A;  4ASV A;  2IBZ G;  5AVQ B;  4U7J A;  2PCC B;  3GHG C;  3M9B A;  2KYV A;  1RY3 A;  1SFC D;  1NAY A;  4AUW A;  1E79 H;  1KB9 E;  5APW A;  4BRY B;  4D6T J;  1KC8 Q;  1J3S A;  1EZV D;  1SQB E;  1N7L A;  2HLO A;  1EB7 A;  2BH5 X;  2M0B A;  1BCC G;  1U75 B;  1OX3 A;  2E43 A;  1JM0 A;  3T97 A;  1QEX A;  3V2R A;  4JF7 A;  1NTM G;  2ZYD A;  1L0L E;  3OA8 A;  4EIJ A;  4DCK A;  2OYI C;  2FKW B;  2R5B A;  3RK3 D;  3O6Q A;  5CID B;  3H1H E;  1I5T A;  3T97 B;  3CWB E;  4WQ7 A;  2IBZ E;  1SQB K;  1MFT A;  1QKS A;  3PRJ A;  3OA8 B;  3ITK A;  2WVR A;  1EC5 A;  2OYH A;  3L70 G;  1PGP A;  1KYO D;  3L74 D;  2FWL A;  1LTA C;  4RES B;  5CIH B;  3O6Q B;  1JY2 P;  2E5T A;  3CLQ A;  2WSE H;  3BCC J;  4HYT B;  1L0L K;  2ZXE B;  2E76 C;  3EQ2 A;  1DD3 A;  2OYH B;  3GMA A;  4UB8 H;  2Q9I A;  1H89 A;  2K37 A;  1CSW A;  1NTM E;  2OYO A;  1LTJ A;  2D0S A;  1KQS O;  1M56 D;  2K88 A;  4N0K A;  2M3B A;  3L75 G;  1EDJ A;  1U7J A;  4WQC A;  1YHQ P;  3WUV A;  1I6E A;  2FY8 A;  1CYC A;  1WT6 A;  1LTJ B;  1GQ1 A;  1EDI A;  4H44 B;  1LTT C;  1SFC A;  5KLV G;  4KT0 J;  4FAN A;  2HFE D;  2OGU A;  2FYU D;  2CXB A;  3M9H A;  3MZW B;  2Z5I A;  1BGY D;  1NTK D;  1W2B O;  1NTM K;  3CCS P;  3H1K E;  1HZU A;  2W90 A;  3S9O A;  1MKM A;  2AI5 A;  3PTZ A;  2C2C A;  1SFC B;  1X0T A;  1CSB A;  1BSH A;  1NHL A;  1IK9 A;  3WMM 0;  1ZXG A;  5H2F V;  4WQB A;  1Z56 A;  3V2N A;  5KKZ C;  3L75 E;  2OQQ A;  2PGD A;  1AYG A;  2YQB A;  1AQT A;  1I6D A;  4H0L C;  1R5S A;  1SQV G;  2BLF B;  4WY4 D;  3RK3 B;  3L71 D;  5KLV E;  1C6O A;  2H7H A;  1FDO A;  3Q5R A;  4XE5 B;  2I8D A;  3HTK A;  3SFE C;  1KIL D;  3RBZ A;  1ZME C;  1WRG A;  1Y9B A;  1KIB A;  2WWW A;  5H2F E;  3HE4 A;  5CJ0 A;  1OW6 A;  1KV4 A;  1LNQ A;  1S4X A;  4AAL A;  3HTK B;  2N1T D;  1GTW A;  1CRY A;  1LP1 A;  3H1L E;  1PP9 D;  3AEB C;  3O0R C;  1LTG C;  2OTJ P;  3CPW O;  3Q2Y A;  2XKM A;  5KLV K;  1IFP A;  1M6Z A;  3H1K J;  4V2K A;  1MG2 D;  2JTI B;  1JO5 A;  1X9V A;  1N8R Q;  1LP1 B;  1L4A D;  2N9B A;  4OGQ C;  1BSN A;  1S5L H;  4PD4 I;  3SSU A;  2NRG A;  4EIE A;  1SQQ G;  1T2K D;  2NPS C;  2IPP A;  1PFI A;  4PJ0 H;  3AE8 C;  2E76 D;  2N3B A; 
#chains in the Genus database with same CATH homology
 3HQ7 A;  2RN0 A;  3WU2 V;  1YIQ A;  3X39 A;  3ZIY A;  5C9M A;  3SWS A;  4DY9 A;  1BCC D;  155C A;  4D6T D;  1NU1 D;  3CXH D;  2MHM A;  2N18 C;  2N18 B;  2L91 A;  2N9I A;  1IRV A;  1AOQ A;  3SLE A;  2HV4 A;  1F1C A;  5AUR A;  1DIQ C;  1CYJ A;  5DJQ C;  5DJQ B;  1LC1 A;  1C7M A;  2KNC B;  2JWA A;  1CRC A;  1CXC A;  3ORV A;  1HRC A;  1IO3 A;  1N9C A;  1H33 A;  5C0Z A;  1BE3 D;  3L70 D;  1RAQ A;  4J20 A;  3WFB C;  2DGE A;  1QYZ A;  3ZCF A;  3ZOX A;  2C1D A;  3TF5 A;  1DW0 A;  1NIR A;  1DW1 A;  1KYO W;  3PHL A;  1JDL A;  2QJY B;  1H33 B;  1CYI A;  4UB8 V;  3RN0 A;  3NWV A;  1CC5 A;  2ZZS 1;  5B66 V;  2K9J B;  2RMZ A;  2C1D B;  1NTZ D;  4O1Q A;  1CTZ A;  2ZXY A;  3WC8 A;  1HJ3 A;  1PPJ D;  3RLM A;  1E2R A;  4WQ8 A;  2PCB B;  1YEA A;  2V08 A;  3HQ8 A;  5DF5 A;  3TDK A;  5DFS A;  2CA4 B;  3CX5 W;  4XYD B;  4WQA A;  5CIF B;  5CYT R;  3L75 D;  3SVW A;  1C6S A;  1HCM A;  1LMS A;  3DMI A;  1VYD A;  1AOF A;  1C75 A;  3KZI V;  4AAO A;  4YE1 A;  1CXA A;  1CED A;  1GU2 A;  2DVH A;  2BPB B;  1C2N A;  1YEB A;  1DW3 A;  3WUI A;  4EIF A;  5CIG B;  3JBT B;  1A56 A;  1BL9 A;  3H1I D;  3L72 D;  5CIE B;  1KB0 A;  2BH4 X;  1RAP A;  1CIH A;  1FJ0 A;  1K3H A;  1WVE C;  2FYN B;  1M60 A;  3PLN A;  3TGU D;  4NFG B;  3ZOW A;  1COR A;  3KHU A;  1C2R A;  3HQ6 A;  3FWL A;  3PH2 B;  1HRO A;  1RZ5 A;  5TJH A;  3VMA A;  1MG3 D;  3VYM A;  2GC4 D;  2VHD A;  2Y0D A;  1L9J C;  1CSX A;  3MK7 B;  3MK7 C;  5B6Q A;  2LIT A;  3L4O A;  3CP5 A;  1CHH A;  2N9J A;  1CRI A;  1YTC A;  1GDV A;  3HQ9 A;  2GB8 B;  2V07 A;  1KX7 A;  1H9Y A;  5GTH V;  1SQV D;  5GTI V;  1COT A;  3CU4 A;  4PW9 B;  1CTY A;  2ZBO A;  2YIU B;  2PAC A;  1YNR A;  4EID A;  2I8F A;  1QL4 A;  1CRJ A;  1CIG A;  2CE1 A;  3GG2 A;  1L0N D;  4IL6 V;  2YCC A;  1CO6 A;  1KX2 A;  1FOC A;  1CCH A;  3TYI A;  2OZ1 A;  5KLI B;  2CA3 B;  4FA9 A;  3CYT I;  1HH7 A;  1NNO A;  5EXQ A;  1CRH A;  2QJK B;  4WQE A;  1GKS A;  351C A;  1N15 A;  1W2L A;  1N90 A;  3SJL A;  2BGV X;  4L1Q A;  1CNO A;  1I54 A;  2A06 D;  2PCC B;  4AX3 A;  1DII C;  1CHI A;  3NBT A;  2OZ1 B;  1E29 A;  1W5C T;  1J3S A;  4AAM A;  1KV9 A;  3A0H V;  1EZV D;  5B5E V;  1S5L V;  3RN1 A;  1EB7 A;  3PXS A;  3BCC D;  1IQC A;  1FI9 A;  1DVV A;  2BH5 X;  1CSV A;  1QL3 A;  4A7P A;  4PJ0 V;  1DVH A;  1U75 B;  1A8C A;  1DT1 A;  1ETP A;  1SQQ D;  1LFM A;  2LIR A;  1C52 A;  1CIE A;  2GIW A;  4FA1 A;  2B12 B;  2N3Y A;  1R0Q A;  3OA8 A;  1L9B C;  1P84 D;  5TIS V;  1FCD C;  1HZV A;  1LC2 A;  1KB9 D;  5CIC B;  4RSZ A;  5CID B;  1CSU A;  1I5T A;  2GC7 D;  2BCN B;  4UB6 V;  4P4Q B;  1SQP D;  1CRG A;  1C6R A;  2ORL A;  3DP5 A;  4H0J A;  4AAN A;  4WQ7 A;  3VRD A;  1H1O A;  1QKS A;  3PRJ A;  2O3J A;  3CXH W;  3OA8 B;  3ITK A;  3DR0 A;  3OCD A;  1S6V B;  1KYO D;  3L74 D;  1FI3 A;  2FWL A;  2MTA C;  3NBS A;  4EDF A;  4FAV A;  5CIH B;  2D0W A;  5IY5 1;  1FI7 A;  1YIC A;  3WFC C;  1YCC A;  3H1H D;  2BCC D;  3CWB D;  3OCD B;  4WQD A;  4MU8 A;  4XXL A;  1WEJ F;  3WFE C;  4U3F D;  3CX5 D;  1CSW A;  2B10 B;  3L4M A;  2D0S A;  4N0K A;  4L3H A;  2AXT V;  4WQC A;  1I6E A;  3RMZ A;  1CYC A;  2Y0C A;  3WFD C;  1IRW A;  1A2S A;  1GQ1 A;  4PWA A;  2Y0E A;  1SQX D;  1YFC A;  4WQ9 A;  2B11 B;  2YK3 A;  4JCG A;  1CIF A;  2QJP B;  2AIU A;  3SXT A;  2B4Z A;  1NTM D;  4FAN A;  1M70 A;  1H31 A;  2FYU D;  2CXB A;  2Q3E A;  1B7V A;  3A0B V;  3ZBM A;  3C2C A;  1BGY D;  1NTK D;  1HJ5 A;  1HZU A;  1I8O A;  2AI5 A;  3PTZ A;  2C8S A;  3M97 X;  4O1W A;  2C2C A;  3ZOO A;  1GIW A;  5E79 V;  1I55 A;  1H31 B;  2N9Y B;  1ZRT D;  1E8E A;  1LS9 A;  1N50 A;  3L73 D;  1NMI A;  5H2F V;  4WQB A;  1U74 B;  1I8P A;  5KKZ B;  3ZOY A;  1NML A;  4RJT A;  3A9F A;  1CCR A;  1OAE A;  1AYG A;  2YQB A;  3H1K D;  4GED B;  3H1J D;  4FA5 A;  1I6D A;  1IZL 0;  1QN2 A;  2BLF B;  2FRC A;  1GJQ A;  1CTJ A;  3L71 D;  1C6O A;  3O5C A;  2JQR A;  5KAI V;  2L4D A;  1SQB D;  3O1Y A;  451C A;  1F1F A;  2CE0 A;  2C9X B;  1AKK A;  1OCD A;  3GW6 A;  2QG4 A;  4FB1 A;  3PXT A;  1KIB A;  1ZZH A;  1FHB A;  2ZON G;  1H9X A;  2EXV A;  4AAL A;  1HJ4 A;  1L0L D;  1H32 A;  4PD4 D;  1CRY A;  4L3G A;  5KLV D;  1MZ4 A;  4KMG A;  1PP9 D;  2C1U A;  4Y5R A;  3O0R C;  4QAO A;  1RZ6 A;  2C1V A;  2XTS B;  4H0K A;  4K3I A;  1M6Z A;  1K3G A;  2KS1 A;  3O20 A;  4V2K A;  3VNW A;  2IBZ D;  1MG2 D;  2JTI B;  2ZOO A;  1H32 B;  2B0Z B;  3PXW A;  4Q5P A;  4EIC A;  4GYD A;  1DW2 A;  5CIB B;  4EIE A;  4FA4 A;  1CHJ A;  4LJI A;  5KAF V;  3H1L D;  2N3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...