1L0ND

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1l0nD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1l0nD02
2L91A 1HJ3A 5CIHB 3CX5D 4EIFA 1I5TA 1KIBA 1I54A 2DGEA 2GB8B 1C52A 1EZVD 3A9FA 1CYIA 2CA3B 4AANA 1I6DA 3O1YA 4UB6V 1KYOW 2FYNB 5CICB 1FI3A 1HROA 2C1DA 1NTKD 1HZVA 1LMSA 1FJ0A 1DVVA 1HRCA 1C6SA 5C9MA 5AURA 4Q5PA 1IZL0 2N3BA 5DFSA 1CNOA 2C1VA 4JCGA 3VYMA 4EIEA 1C75A 1I8PA 2BPBB 1HZUA 1QKSA 2IBZD 1CIFA 3VRDA 1KX2A 1CRIA 2CE0A 4H0KA 4MU8A 1COTA 5GTHV 1J3SA 2MTAC 4KMGA 1CIGA 2C2CA 4XYDB 1NMIA 1QL4A 1E29A 1H31A 2BCCD 1CO6A 1IRVA 1CORA 3ZIYA 4WQAA 3OCDA 2N9YB 1K3GA 1ETPA 5E79V 3C2CA 3A0BV 2FWLA 1FI7A 1CEDA 5GTIV 4GYDA 2BH4X 1CRYA 2JTIB 1AOQA 1YIQA 1CRCA 3RN1A 2JWAA 1CHIA 5KAFV 1VYDA 1CSXA 1NMLA 5DJQC 1W2LA 2BH5X 3OA8B 1H1OA 1C2NA 3ZBMA 1I55A 1DW3A 3PRJA 3L73D 4J20A 2ORLA 2PACA 4N0KA 1N15A 2CA4B 1I6EA 3TF5A 2Q3EA 1AYGA 1LFMA 3HQ6A 3WC8A 1MG3D 1L0LD 3ZOYA 1HJ5A 3KZIV 3L4MA 1W5CT 1CSWA 3PLNA 3O5CA 1CCRA 3WFEC 3DMIA 1CXCA 1CSVA 3SWSA 3ZOXA 3X39A 1U75B 1CHHA 1CTJA 1MG2D 1KX7A 4FA9A 2K9JB 5IY51 3L70D 2QG4A 5KAIV 3PTZA 1DIIC 1QYZA 4AX3A 4PWAA 3NWVA 1OCDA 3ZOOA 1KB0A 4YE1A 5EXQA 4WQ7A 2LIRA 1ZRTD 4FA1A 4O1QA 2ZXYA 1CC5A 2D0WA 451CA 1H33B 4PJ0V 3L4OA 3H1ID 2PCBB 3O20A 3ZOWA 1C7MA 1CXAA 2OZ1B 1KV9A 3PXTA 3TYIA 2AXTV 4FANA 3CWBD 3L74D 1CTZA 1C2RA 3WFDC 2ZONG 3OA8A 2YCCA 2GC4D 3HQ9A 1CRGA 1FHBA 2B4ZA 1HH7A 2QJKB 4WQEA 3TGUD 2GIWA 3GG2A 1N9CA 1FOCA 3RLMA 2BCNB 2HV4A 1R0QA 4EICA 1GJQA 1L9BC 3ZCFA 1M70A 1CCHA 1CRHA 3TDKA 1DW0A 5CIDB 2N18B 1A56A 1SQXD 2YQBA 2LITA 4LJIA 2I8FA 1C6OA 3PXWA 2V08A 3BCCD 1CHJA 3CP5A 1QN2A 2DVHA 3L72D 2Y0DA 2BLFB 1CIHA 1WVEC 1K3HA 1LS9A 1MZ4A 2V07A 3CXHW 1AOFA 5CIEB 5C0ZA 4RJTA 1NTZD 2XTSB 4V2KA 2KS1A 3GW6A 2B12B 1KYOD 1L0ND 4WQCA 1HCMA 3RN0A 3CYTI 1RZ6A 4L1QA 5B6QA 2FYUD 1HJ4A 5KKZB 1M60A 1C6RA 2C1DB 1U74B 2PCCB 4RSZA 2KNCB 1CYJA 1FCDC 1CIEA 1EB7A 1DIQC 2C1UA 4L3HA 1QL3A 2CE1A 2C9XB 1LC2A 2N9JA 3SVWA 1DT1A 2BGVX 5TISV 2GC7D 2D0SA 4IL6V 1IQCA 2A06D 1H32B 4P4QB 1S5LV 2AIUA 1NNOA 5KLIB 1L9JC 5B66V 5H2FV 4WQ8A 5CIBB 1RAQA 1H9YA 3PH2B 1S6VB 3MK7B 2Y0EA 1F1CA 4H0JA 1E8EA 1GKSA 2N3YA 3OCDB 4PW9B 1I8OA 3CXHD 4PD4D 2O3JA 3RMZA 1OAEA 4QAOA 4WQ9A 1A8CA 2B10B 2CXBA 1YTCA 3HQ7A 1SQQD 1N90A 1LC1A 1DVHA 1WEJF 3H1LD 5B5EV 1DW1A 1SQPD 3DR0A 1IRWA 5CIGB 4EDFA 4WQDA 3NBTA 1NU1D 1BGYD 1DW2A 4K3IA 1GDVA 2ZZS1 3WU2V 1F1FA 1IO3A 1PPJD 3M97X 1CSUA 2B0ZB 1CTYA 1E2RA 5KLVD 4AALA 4WQBA 1SQVD 1GQ1A 1YNRA 1AKKA 4EIDA 3H1KD 1B7VA 2ZOOA 4AAOA 1CYCA 4L3GA 2EXVA 1KB9D 3WUIA 4A7PA 1M6ZA 2AI5A 2N18C 4FAVA 1BL9A 1YCCA 351CA 1PP9D 3PXSA 1GU2A 2FRCA 2QJPB 1H32A 3L71D 1CRJA 3O0RC 3WFBC 3CX5W 2QJYB 3PHLA 2VHDA 3CU4A 3SLEA 1RAPA 1RZ5A 2B11B 4FB1A 3H1HD 5CYTR 1NTMD 4GEDB 1SQBD 1BCCD 1GIWA 3ITKA 3A0HV 4DY9A 4UB8V 1BE3D 2RN0A 3VMAA 1ZZHA 3DP5A 5DF5A 4O1WA 1YEAA 1YFCA 4NFGB 3SXTA 4Y5RA 3ORVA 1H33A 1NIRA 1P84D 1JDLA 1H9XA 4XXLA 3SJLA 2OZ1A 4D6TD 5DJQB 4FA4A 2N9IA 3KHUA 1FI9A 155CA 2YK3A 2Y0CA 2JQRA 3H1JD 2RMZA 3L75D 2ZBOA 3WFCC 3HQ8A 3JBTB 4FA5A 1N50A 5CIFB 3VNWA 4AAMA 5TJHA 1H31B 2C8SA 1A2SA 3FWLA 1YICA 3MK7C 1YEBA 3NBSA 4U3FD 2MHMA 2YIUB 2L4DA
chains in the Genus database with same CATH superfamily
4WWIA 1XTCC 4JYBA 1I5TA 3OW2O 2Y9YA 4K35A 1NAFA 1VQOP 2NPSD 4N78E 1HJBA 2B88A 1JY2P 3Q2YA 1YQ3C 1JTHA 2KSEA 3A7OA 3O1YA 5AVZB 4UB6V 5CICB 1FI3A 1NTKD 5BU8B 1RE3C 1LMSA 5CCHD 1DVVA 1QLED 5DJTB 5BU5A 1C6SA 3CWBJ 2E75D 5AURA 4Q5PA 2HODA 2PRRA 2KK7A 3SSUA 3F5HA 1SQXG 4EIEA 1C75A 3BCCG 2BPBB 2QM8A 1QKSA 3HE5B 1FE6A 1CIFA 4LLHA 2QJPC 5AW2B 5GTHV 1NTMK 3L37A 2MTAC 3JSVC 1CIGA 2NPSA 1KILB 2V4HA 2N1TB 1QL4A 2BCCD 2KOGA 2QJYC 1AA0A 1L0NG 1IRVA 1CORA 3L72J 3RL0B 2N9YB 1K3GA 5E79V 4YTPC 5TISE 1IFMA 5CCHA 2C0XA 1IFIA 4WY4C 4H0LD 2HLOA 4GYDA 1EDKA 1QVGO 2FYUJ 1AOQA 3WU2H 1YIQA 3H1HE 1PFIA 3L36A 1VYDA 2PAJA 2A06G 2IYPA 5DJQC 3OA8B 4KJMA 2XNDH 5AW3B 1SFCD 2CA4B 3TF5A 2J58A 3UIAA 2JJLA 1S1CX 1BSHA 1AYGA 4ASVA 1T6AA 3HQ6A 1H8AA 1L0LD 2H89C 1HJ5A 3S4RA 2OTKE 3WFEC 3DMIA 1DD3A 3CPWO 3USSA 1HWTC 1CHHA 3CCMP 1MFZA 1DD4A 2QG4A 2KS1B 1NTKK 2R3SA 1PV3A 1K73Q 2WSFJ 1NVOA 3ZOOA 1YJWP 2E5TA 4FA1A 3GLMA 3H1IJ 1SFCA 1E79H 3FXDA 3EWKA 1CI6A 1KN7A 3H1KG 2IYOA 2YKOA 3L4OA 3O20A 3M06A 1QX8A 1CXAA 3QWOC 3B5NC 2YMYA 1Q90D 3MUDA 3II6A 3L74D 2WT7B 3L71G 3WFDC 2W6BA 1CRGA 5C39A 2B4ZA 1FDOA 1NKZB 1N73A 3KZIH 1FZFA 4WQEA 5GTIE 1N9CA 2P58A 1FOCA 1K8AQ 3H32A 2W6AA 1S5LX 1PP9J 1RF1A 3ZCFA 3D0WA 2H7HA 2P67A 3D6ZA 3VN0A 1HTLC 1NJIQ 1A56A 1KYOH 1YTZT 3Q5SA 3V2NA 3CP5A 1DEEG 2B87A 1CIHA 1NWQA 3H1HJ 1K3HA 4WB4A 1T2KD 3O6QA 3O8ZA 4RJTA 2XTSB 2OQQA 2LXBA 1KILD 1JOCA 2N1TD 1X0TA 2QEXP 3TNUA 5AW6B 1SLQA 4L1QA 3RL0D 3SWKA 1YBKA 5KKZB 1M60A 1C6RA 2C1DB 2AXTH 2PCCB 3ZDMA 2E76C 2E76B 2YXQB 1KQFB 1JY2O 3AE3C 1G1IA 1OMIA 4D6TJ 1KILE 1LWUB 1FCDC 4OGQC 4OGQB 1GMJA 5KAIE 1QL3A 5K5GB 4H44D 2N9JA 1X79B 4AQRD 3SVWA 3KDPB 2ZFCA 4UB6E 5CHXA 4P4QB 1S5LV 2WSCJ 2M8RA 1EZVG 2FFDA 4W80A 4NPEA 1KZUB 2B89A 1S72P 1URQD 1KILA 1NKNA 1LTSC 3PH2B 2N1TA 4PJ0E 1S6VB 3MK7B 1F1CA 3AE8C 1WMKA 4PW9B 3MIWA 1DEBA 2O3JA 4W7ZA 3L70E 1A8CA 2C0WA 2CXBA 3V4QA 1SQQD 1N90A 1IJDB 1VQ9P 2W6JH 3HUSC 1Q2NA 1SQPD 1MV8A 1HH0A 2JDIH 4WVZA 5CIGB 5E79E 1BGYD 1DW2A 2D2CD 3BRTB 2HFED 4ZNCA 1RY3A 5AW9B 1SQQE 1HJ0A 1F1FA 1URQA 3PP5A 3V2QA 2HYNA 3M97X 1CSUA 4M3LA 3HTKA 1CTYA 1S2EA 4AALA 1ZOYC 2ZT9C 1SQVD 2ZT9B 3HE4B 3CC7P 1AKKA 4EIDA 1SQPE 4AAOA 2Y9ZA 4L3GA 2XV5A 3RGUA 4L74A 2N18C 4Z1MH 1L4AB 4O9BA 2OYOA 3TGUE 2FRCA 2KYVA 3EFGA 3G3ZA 1SQVE 2I1KA 3PHLA 1FZEA 1OW6A 1FZCC 3SLEA 2B11B 1YJ9P 1JTHB 5CYTR 5AVSB 3HD7B 1SQBD 1BCCD 1GIWA 3OA7A 3D71A 1JEKA 1NTZE 1PL5A 2Q9IA 1YFCA 4B86A 2HODB 2WWWA 3NTNA 2Q1KA 5AVQB 1BDCA 3OJAB 4XXLA 2WSCH 3L73J 3AE4C 3C8VA 1USEA 5APYA 2YMKA 1RE4A 2N9IA 4TLFA 2WT7A 1G2CA 2YK3A 2Y0CA 3H1JD 2ZBOA 1U57A 2E74D 4C7NA 3HQ8A 1N50A 3CXHH 4OWFA 2NPSC 2NPSB 4AAMA 3PH0A 3A5TA 1LTBC 1A2SA 1FOSE 3IF4A 2ZYDA 1VQ8P 1LTTC 3NBSA 5B5EE 1VQ5P 1SQQK 2YIUB 3E1RA 1OFCX 2M5AA 3L70J 3G9RA 1MFTA 4ASWA 5CCHC 1KIBA 1SQPK 2E75B 2Q5UA 2O1JA 4W7YA 1C52A 3A0HH 1M57D 4GT1A 4UB8H 3SWYA 1NOHA 3CWBG 1SP4A 1SQVK 1I6DA 3FWNA 1GK4A 1NO4A 4U7JA 2C1DA 2WPSA 2HPCA 1HRCA 5C9MA 5AVUB 1IZL0 2N3BA 3IAOA 1W2BO 4AUWA 3H1LE 3GF3A 1ZW0A 5B66H 3TGUJ 4I2LC 1JCCA 2C1VA 1ZR4A 4JCGA 4I7ZC 3VYMA 4I7ZB 1NTZK 1NU1E 3L72G 2IBZD 4H0LB 3VRDA 2CE0A 4H0KA 2XZRA 4K3AA 1COTA 2KI7B 5KLVE 1CW5A 1SQBK 1MZ9A 2ZXEB 5AVRB 1IC2A 1OX3A 3S1KA 4JBZA 1VF5C 3ZIYA 1JB0J 2WITA 4NPDA 2V7QJ 4WQAA 2FYUG 2C9NY 1N2DC 1P84H 1ETPA 1NTZJ 2FWLA 3N7NA 1H88A 4BWNA 1SFCC 1CEDA 1BDDA 5GTIV 2WSEH 1CI6B 3TK1A 1PGPA 2BH4X 1ZV8A 2Z5HA 1Q81Q 3CCJP 3AEDC 2OYHB 1NTME 3MUDC 1NMLA 1W2LA 2BH5X 1BE3E 3P7KA 2R3CA 1N73C 1GTWA 1I55A 3HD7D 1N73B 3WMM0 3CX5H 1W5CE 3AEEC 2ORLA 2PACA 4PV1B 1N15A 3H32B 3KYQA 1RF1C 2WQYC 2Q3EA 1K05A 5GTHH 1DH3A 3B71A 3MGNA 2AEJA 1EXJA 1VQMP 1G1JA 4LC1A 2OTLP 3BRVB 3L75E 1S9KD 1CSVA 3ZOXA 2B87B 3VYIA 1U75B 1CTJA 1KX7A 1IFPA 3O6QB 2O01N 5IY51 1NU1K 3H1IG 2ZJSE 4U3FE 5KAIV 1PGOA 1QYZA 3MP7B 3L4FA 5KLVK 3TNUB 3MHVA 3NWVA 3VMXA 1OCDA 3HD7A 3Q3DA 1AJYA 1ZMEC 1PPJG 3H1LJ 2W27A 1M90Q 3U1CA 1IZNB 1UIIA 5AVXB 4QMAA 1EC5A 451CA 1NU1J 4PJ0V 1X8YA 3H1ID 1YQ4C 2PCBB 4IFFA 2OZ1B 1KV9A 3EFFK 1USDA 1PP9G 3VOPA 5KLVJ 1JMMA 3A0BE 1FOSF 3HQ9A 1NTKE 1GW4A 1T2KC 4GODA 2GIWA 2FFDB 3GG2A 2AEMA 3IFMA 3RLMA 1KILC 1R0QA 4EICA 2N1TC 1T8ZA 1M70A 3H1HG 5APVA 5AW5B 1M1JA 2NZ2A 3RL0C 3VMYA 5KAFE 3I55P 1SQXD 5EFWB 2I8FA 3CCUP 4OVNF 3BCCD 1CHJA 2BASA 3W68A 5AW4B 2DVHA 4KHXA 1LS9A 2BCCE 4OH8B 1NTMJ 4C7RA 3RK3B 1BE3J 4H44B 1LJ2A 2B12B 1L0ND 1PGJA 2IPPA 4D6TG 1HCMA 4I1LA 1VQ4P 4EOTA 1HJ4A 1U7MA 3L35A 1JY3N 1URQB 4ZMDA 3CCLP 3HTKB 2XNXA 2L5GB 1EDJA 1CZQA 2K88A 1ZN5A 1EB7A 2C1UA 2Z4EA 1LT1A 3L75J 1LC2A 2KZJA 3VMZA 2PFXA 1DT1A 2BGVX 2ZYGA 1IQCA 1EDIA 2A06D 4IFDK 2AIUA 1FBMA 1L9JC 4U3FJ 3C9IA 2G3AA 5CIBB 3CCVP 2JP3A 1FZBA 1L0LE 4PV1D 4NPFX 5AW8B 3H25A 1GKSA 1Y9BA 2KLVA 3OCDB 2A06E 2D2CC 2D2CB 2IX7C 3JCUE 3CD6P 5APQA 4DT0A 1I8OA 3CXHD 2QM7A 4PD4D 4JQ0D 4YXWH 4QAOA 1EQ7A 1S3JA 1AFOA 4WQ9A 2WTYA 2FBWC 2I1JA 4RKUJ 1DVHA 3BATA 1NTKJ 3AE2C 5B5EV 2OYHA 1DW1A 4JPZB 4PD4E 1JCDA 3KQGA 2WZ7A 2BEZF 3NBTA 1G2CB 1VQKP 2XKMA 4C7NB 3WU2V 1SQXK 3CMAP 3CI9A 1IO3A 2B0ZB 1L2PA 4DOJA 4YXDC 1GQ1A 2B9BA 1S5LH 1JUNA 3H1KD 3IR9A 3M0AA 1B7VA 3AEGC 1CYCA 1KB9D 3L74E 1VQ7P 1M6ZA 2AI5A 4FAVA 2M5AB 1BL9A 1W2EA 4IOIH 2BCCJ 3PXSA 1VPCA 5KJ7C 3L71D 3K5BA 2J5UA 1CRJA 1TU3F 3WUVA 1KB9E 1RAPA 1RZ5A 1RF0C 2VRSA 1CSBA 1XTGB 3FXEA 3L71E 2E74B 4IL6E 3ITKA 1GL2B 4DY9A 1L0LK 5KKZC 3L73G 1ZZHA 1KQSO 2HPCB 5H2FE 4O1WA 1YEAA 4NFGB 3CC4P 2RKLA 1LWUC 4Y5RA 3ORVA 1X9VA 3MTUE 1P84D 3RBXA 2QVAA 3SJLA 2OZ1A 3RK3D 1VL2A 2IDBA 1H0TA 3KHUA 3Q5RA 1FJPA 3V5BA 1FI9A 155CA 1HBWA 1L0LJ 3VNWA 3L70G 4WY4D 5TJHA 3EQ2A 2C8SA 1KMIZ 2WSFH 1OVRA 3M9HA 3RK2B 3MK7C 3RK3E 2MHMA 1LTJA 1JNMA 1Z56A 3QH9A 3JC22 3CX5D 1JMBA 4EIFA 4JF7A 2SPZA 2DGEA 2GB8B 2BEQD 3P8CD 1EZVD 3W67A 3WUTA 1Q82Q 2OARA 4AANA 3WUUA 2A45I 2E5YA 3HRNA 1DX7A 1NH4A 3TGUG 2FYNB 4WY4A 2W8ZA 1HROA 1LTAC 1FJ0A 5TISH 4DJGA 1LP1B 1ZLLA 3L74J 2WPVB 2JKVA 2I8DA 5CBNA 1CNOA 2R5DA 2W83C 1BGYE 3SFDC 1L4AC 2OTJP 2GUSA 1CRIA 4MU8A 1YITP 3H6PA 2KSJA 2C2CA 1NTZG 1VDFA 5KTBA 4XYDB 1NMIA 1E29A 2AEFA 1CO6A 3GF7A 2OYIB 2HR3A 1H89A 3OCDA 3HD7C 3C2CA 3A0BV 1FI7A 5AW0B 2H8PD 1KFNA 3BVHA 1CRYA 1Q7YQ 2JWAA 3RN1A 2M3EA 4JYCA 5KAFV 1SQBE 1BCCE 1J1EC 1J1EB 1IFJA 3LW5J 4GOFA 1OXZA 4C46A 5CJ4A 1DW3A 1K04A 3PRJA 2KXPB 1GL2D 4J20A 5AVYB 1HF9A 1I6EA 3OAKA 1M1JC 1MG3D 1M1JB 2YIUC 1PIXA 3L4MA 1LGHB 1CCRA 3H1JE 1YIJP 1CXCA 3WU2E 3X39A 1MG2D 2E75C 1KD1Q 1AQ5A 2K9JB 2W90A 3V2PA 3H1LG 5GTIH 3PTZA 2WSSH 3R4YA 2N9BA 4PWAA 3RK2D 1NU1G 1SQQJ 5EXQA 2H88C 4WQ7A 2LIRA 1ZRTD 1GL2A 1VQPP 1Q86Q 1WRGA 5KLVG 2D0WA 1FAVA 1SQPJ 2JR8A 1H33B 1BGYJ 3ZOWA 3PXTA 1U7JA 1N7LA 4FANA 3CWBD 1YTZI 2P10A 1SQVJ 1C2RA 2YCCA 4H0LC 1HH7A 2QJKB 1LTGC 1A02J 2BCNB 2Q3IA 4IL6X 5CCGD 3MZWB 2UWJE 1GJQA 2IBZI 2K3RA 1IK7A 3SWFA 1NTMG 3TDKA 5CIDB 3R2PA 1J2JB 1SVFA 2IBZE 2LITA 1BE3G 1R5LA 5KAIH 3PXWA 1OZHA 3L72D 1RQVA 1OIPA 2Y0DA 1WVEC 1MKMA 1AOFA 1NAYA 4UB6H 5C0ZA 1NHLA 3P32A 1SQBJ 1BCCJ 1FZGA 2JEEA 2M3BA 2FXMA 3GW6A 5AW1B 2P7JA 1KYOD 3IN6A 1LT9A 2OYHC 4EI2A 3KZIE 4AYCA 3RBZA 4HJGH 3CYTI 1RZ6A 5B6QA 4PJ0H 3CMEP 2FYUD 3L75G 1JY3P 1U74B 2FYZA 5CCGA 2FXPA 3S9OA 2KNCB 4PV1C 1LP1A 1KYOE 1YYCA 1OVUA 4U3FG 3H1JJ 4R4LA 3HUSA 2FYUE 5L8RJ 4H13B 1HGVA 2GC7D 3M0DA 2D0SA 4IL6V 1T3JA 1ZP0C 1NNOA 5KLIC 5KLIB 1A02F 5B66V 5H2FV 5E79H 2R5BA 1H9YA 1KQGB 4H0JA 4N78D 1E8EA 2OYIA 4ZKPA 2N3YA 2AXTE 1HUCA 3CCQP 1S9KE 1NTKG 3PJSK 1OAEA 1OW8A 1K9MQ 2B10B 3HQ7A 3A3YB 4BXLA 1LC1A 1FZCA 1RQUA 2KZIA 3DR0A 1H0TB 1OW7A 1IRWA 1VQLP 4EDFA 2Z5IA 5M1BA 2FFDC 1PPJD 5CJ0A 2BCCG 2CPSA 3D6YA 4WQBA 3H1IE 2V7QH 1FS0E 1LNQA 2ZVNB 1HGZA 2ZOOA 1LTJC 1LTJB 4L75A 4TT3H 3AECC 2QE7H 351CA 1PP9D 2KUBA 3GHGA 2KLUA 2GA1A 2R44A 1GU2A 2QJPB 1H32A 1PPJE 3O0RC 2YO3A 2K37A 2FYUK 3CCSP 3WFBC 2QJYB 2K9JA 2KP8A 3N4XA 1YI2P 1MUUA 1QEXA 3RK3C 4XFJA 1GD2E 4H44C 1SQXE 4FB1A 3H1HD 1PP9E 2YXRB 1AV1A 2NRGA 3BCCE 3Q1MA 4WY4B 2RN0A 3VMAA 5B5EH 1R8EA 3DP5A 4RESB 1URQC 4HKZH 3SXTA 3FX0A 4MN4C 3Q5PA 1L0LG 1L0NE 1H33A 1NIRA 1VF5D 2WPQA 1J1DC 1J1DB 1N86A 4D6TD 4I6MC 5DJQB 1DIPA 4FA4A 3SFEC 2GUVA 2RMZA 1FDMA 3WFCC 2QRXA 1N7SD 4RO0A 4DCKA 3FWLA 1YICA 3T97A 4D6TE 1M56D 1HZVA 1GU4A 2L91A 1HJ3A 5CIHB 1QL2A 4H13D 1NYHA 1I54A 4R4MA 1LTIC 5APUA 3A9FA 3LIEA 5CBOA 3CXHI 4PD4I 1SS1A 1CYIA 3VP8A 2CA3B 3KPEA 3F89A 1JY2N 1FU1A 2P2UA 3L74G 1GZLA 3CXHE 2YNYA 1RE4C 1KYOW 1X22A 3U59A 1T3UA 1YJNP 4BRYA 1N7SA 2KNCA 3AE7C 1FJKA 2JO1A 3MD0A 5DFSA 3B5NB 1JY3O 2O1KA 2G8YA 3BASA 2XU6A 1I8PA 1HZUA 1KX2A 2JWDA 3A0HE 1L0NK 4UB8E 2KIKA 1J3SA 1KB9I 3C1LA 4KMGA 2POHA 1SQXJ 1VQNP 1H31A 3H1KE 2RH0A 3AEAC 1RH5B 3P8MC 3BCCJ 4N6JA 5AVWB 2Q7CA 2E74C 2J59M 1N8RQ 1GL2C 1KTMA 1R5SA 1L0NJ 5B66E 2ITAA 2ZVOB 3VP9A 2JTIB 1AQTA 1CRCA 5AVTB 5APSA 1CHIA 4XE5B 3NFQA 4XA4A 5CMZA 1CSXA 3NMDA 3M91A 1H1OA 1C2NA 1P84I 3ZBMA 2QA4P 5APTA 1RE3A 3L73D 3TYYA 4N0KA 1P84E 1PZQA 1LFMA 1JO5A 2OGUA 3RK2C 3WC8A 3VTPC 3ZOYA 3KZIV 1W5CT 1CSWA 3PLNA 3O5CA 3LIDA 3RL0g 3HE5A 2WMMA 3L73E 1QVFO 3SWSA 1SQQG 2FXOA 4FA9A 3A0BH 1KFMA 2A45G 5AVVB 3CX5I 3L70D 1YHQP 1GDTA 4ZKUA 1SQPG 3U1AA 1DIIC 1LT9C 1LT9B 4AX3A 1EZVI 2IZ1A 3V6IA 3M9QA 3CX5E 1BGYG 2GM4A 1KB0A 1FDIA 4YE1A 2FYNC 2PGDA 4O1QA 5GTHE 3P8CE 5KAFH 2ZXYA 1CC5A 1EZVE 5CCGC 4EYYQ 1EXIA 1SQVG 4L73A 3V2RA 1KQLA 1UIXA 1C7MA 3HUSB 3TYIA 2FY8A 1E5WA 2AXTV 1M1KQ 2WVRA 3M0DC 1CTZA 1FHBA 2ZONG 3OA8A 2GC4D 3H1KJ 4L76A 3G4SP 4GDOA 3TGUD 1ZXGA 1AVOA 2HV4A 4GOEA 1KV4A 2R32A 3AE1C 1L9BC 3CC2P 1CCHA 3L71J 1CRHA 1WT6A 3GMAA 2OYIC 3G6EP 1DW0A 1AVYA 2N18B 1SQBG 1BCCG 1OVVA 2YQBA 2AXCA 4LJIA 1C6OA 3B5ND 1Y8AA 3B8EB 3CL3D 4YPCA 2V08A 4HB1A 1QN2A 2O01J 2BLFB 2YO2A 3I56P 1MZ4A 2V07A 3CXHW 5CIEB 1GW3A 1NTZD 4V2KA 2PP6A 1FZCB 2IFNA 2KS1A 3AE9C 4Y28J 4WQCA 3RN0A 1IK9A 2HG5D 4WBAA 3H1JG 1IFNA 3E7KA 3V4WA 4DZOA 1M7LA 1KC8Q 5DJUB 5APWA 5KJ7D 4RSZA 3JCUH 2YKQA 1PGQA 5BVZA 2LKMA 2E43A 1CYJA 2WSEJ 1CIEA 4L3HA 1DIQC 2Q6QA 2CE1A 2C9XB 2IFMA 4N3YB 2M0BA 3B5NA 5TISV 1FC2C 3GHGC 3GHGB 1BSNA 1H32B 1D7MA 3I5CA 4PD4H 1KORA 4WQ8A 1RAQA 2E76D 2Y0EA 4OGQD 2MJZA 3AEBC 1ZR2A 2H43A 1Y47A 5KJ7A 3RMZA 1GK6A 2YKPA 1RHZB 1YTCA 3D70A 3M9BA 1WEJF 3CCRP 1RF0A 3H1LD 2QIWA 2ZYAA 2QSIA 2IBZG 4GIFA 1ZRTE 1KB9H 4WQDA 1NU1D 4K3IA 1GDVA 3AE6C 3AE5C 2ZZS1 3E1IA 4Y99C 4Y99B 2QJKC 1S4XA 4CPGA 1QL1A 3B4SA 1E2RA 5KLVD 2CPBA 4IL6H 1LWUA 5AW7B 2LXCB 1YNRA 1IFDA 3T97B 2K9YA 5H2FH 2XDJA 3A2AA 3FGAD 3CWBE 1OWAA 2EXVA 2O01H 3WUIA 4A7PA 1YCCA 2DW3A 4IFMA 3G71P 5APXA 1QGKB 3KXDA 2E42A 2ZXXA 1HVVA 3CX5W 2IZ0A 2VHDA 1VF5B 2ZT9D 3CU4A 3LW5H 3CLQA 3AEFC 1NTMD 4GEDB 1FZAA 3L72E 3A0HV 1S5LE 1L4AD 1KYOI 4UB8V 1SFCB 1BE3D 4HH2A 1NGMB 2ZAEB 2LR2A 1GU5A 4BRYB 5DF5A 1N7SC 1N7SB 2K1AA 4LGDE 2FKWB 3TSIA 2CK3H 1JDLA 1H9XA 1M8OB 2KB7P 2MKVA 4HYTB 3CCEP 4H13C 2C9LY 2P1JA 2JQRA 4GKGA 3L75D 3JBTB 4FA5A 3NXSA 5CIFB 1JM0A 1RF1B 1H31B 1VQ6P 1IO4A 3HE4A 4KT0J 2WPRA 1YEBA 4U3FD 4EIJA 2A45H 1EDLA 2L4DA 3ABVC 1L4AA
chains in the Genus database with same CATH topology
2L91A 1HJ3A 5CIHB 3CX5D 4EIFA 1I5TA 1KIBA 1I54A 2DGEA 2GB8B 1C52A 1EZVD 3A9FA 1CYIA 2CA3B 4AANA 1I6DA 3O1YA 4UB6V 1KYOW 2FYNB 5CICB 1FI3A 1HROA 2C1DA 1NTKD 1HZVA 1LMSA 1FJ0A 1DVVA 1HRCA 1C6SA 5C9MA 5AURA 4Q5PA 1IZL0 2N3BA 5DFSA 1CNOA 2C1VA 4JCGA 3VYMA 4EIEA 1C75A 1I8PA 2BPBB 1HZUA 1QKSA 2IBZD 1CIFA 3VRDA 1KX2A 1CRIA 2CE0A 4H0KA 4MU8A 1COTA 5GTHV 1J3SA 2MTAC 4KMGA 1CIGA 2C2CA 4XYDB 1NMIA 1QL4A 1E29A 1H31A 2BCCD 1CO6A 1IRVA 1CORA 3ZIYA 4WQAA 3OCDA 2N9YB 1K3GA 1ETPA 5E79V 3C2CA 3A0BV 2FWLA 1FI7A 1CEDA 5GTIV 4GYDA 2BH4X 1CRYA 2JTIB 1AOQA 1YIQA 1CRCA 3RN1A 2JWAA 1CHIA 5KAFV 1VYDA 1CSXA 1NMLA 5DJQC 1W2LA 2BH5X 3OA8B 1H1OA 1C2NA 3ZBMA 1I55A 1DW3A 3PRJA 3L73D 4J20A 2ORLA 2PACA 4N0KA 1N15A 2CA4B 1I6EA 3TF5A 2Q3EA 1AYGA 1LFMA 3HQ6A 3WC8A 1MG3D 1L0LD 3ZOYA 1HJ5A 3KZIV 3L4MA 1W5CT 1CSWA 3PLNA 3O5CA 1CCRA 3WFEC 3DMIA 1CXCA 1CSVA 3SWSA 3ZOXA 3X39A 1U75B 1CHHA 1CTJA 1MG2D 1KX7A 4FA9A 2K9JB 5IY51 3L70D 2QG4A 5KAIV 3PTZA 1DIIC 1QYZA 4AX3A 4PWAA 3NWVA 1OCDA 3ZOOA 1KB0A 4YE1A 5EXQA 4WQ7A 2LIRA 1ZRTD 4FA1A 4O1QA 2ZXYA 1CC5A 2D0WA 451CA 1H33B 4PJ0V 3L4OA 3H1ID 2PCBB 3O20A 3ZOWA 1C7MA 1CXAA 2OZ1B 1KV9A 3PXTA 3TYIA 2AXTV 4FANA 3CWBD 3L74D 1CTZA 1C2RA 3WFDC 2ZONG 3OA8A 2YCCA 2GC4D 3HQ9A 1CRGA 1FHBA 2B4ZA 1HH7A 2QJKB 4WQEA 3TGUD 2GIWA 3GG2A 1N9CA 1FOCA 3RLMA 2BCNB 2HV4A 1R0QA 4EICA 1GJQA 1L9BC 3ZCFA 1M70A 1CCHA 1CRHA 3TDKA 1DW0A 5CIDB 2N18B 1A56A 1SQXD 2YQBA 2LITA 4LJIA 2I8FA 1C6OA 3PXWA 2V08A 3BCCD 1CHJA 3CP5A 1QN2A 2DVHA 3L72D 2Y0DA 2BLFB 1CIHA 1WVEC 1K3HA 1LS9A 1MZ4A 2V07A 3CXHW 1AOFA 5CIEB 5C0ZA 4RJTA 1NTZD 2XTSB 4V2KA 2KS1A 3GW6A 2B12B 1KYOD 1L0ND 4WQCA 1HCMA 3RN0A 3CYTI 1RZ6A 4L1QA 5B6QA 2FYUD 1HJ4A 5KKZB 1M60A 1C6RA 2C1DB 1U74B 2PCCB 4RSZA 2KNCB 1CYJA 1FCDC 1CIEA 1EB7A 1DIQC 2C1UA 4L3HA 1QL3A 2CE1A 2C9XB 1LC2A 2N9JA 3SVWA 1DT1A 2BGVX 5TISV 2GC7D 2D0SA 4IL6V 1IQCA 2A06D 1H32B 4P4QB 1S5LV 2AIUA 1NNOA 5KLIB 1L9JC 5B66V 5H2FV 4WQ8A 5CIBB 1RAQA 1H9YA 3PH2B 1S6VB 3MK7B 2Y0EA 1F1CA 4H0JA 1E8EA 1GKSA 2N3YA 3OCDB 4PW9B 1I8OA 3CXHD 4PD4D 2O3JA 3RMZA 1OAEA 4QAOA 4WQ9A 1A8CA 2B10B 2CXBA 1YTCA 3HQ7A 1SQQD 1N90A 1LC1A 1DVHA 1WEJF 3H1LD 5B5EV 1DW1A 1SQPD 3DR0A 1IRWA 5CIGB 4EDFA 4WQDA 3NBTA 1NU1D 1BGYD 1DW2A 4K3IA 1GDVA 2ZZS1 3WU2V 1F1FA 1IO3A 1PPJD 3M97X 1CSUA 2B0ZB 1CTYA 1E2RA 5KLVD 4AALA 4WQBA 1SQVD 1GQ1A 1YNRA 1AKKA 4EIDA 3H1KD 1B7VA 2ZOOA 4AAOA 1CYCA 4L3GA 2EXVA 1KB9D 3WUIA 4A7PA 1M6ZA 2AI5A 2N18C 4FAVA 1BL9A 1YCCA 351CA 1PP9D 3PXSA 1GU2A 2FRCA 2QJPB 1H32A 3L71D 1CRJA 3O0RC 3WFBC 3CX5W 2QJYB 3PHLA 2VHDA 3CU4A 3SLEA 1RAPA 1RZ5A 2B11B 4FB1A 3H1HD 5CYTR 1NTMD 4GEDB 1SQBD 1BCCD 1GIWA 3ITKA 3A0HV 4DY9A 4UB8V 1BE3D 2RN0A 3VMAA 1ZZHA 3DP5A 5DF5A 4O1WA 1YEAA 1YFCA 4NFGB 3SXTA 4Y5RA 3ORVA 1H33A 1NIRA 1P84D 1JDLA 1H9XA 4XXLA 3SJLA 2OZ1A 4D6TD 5DJQB 4FA4A 2N9IA 3KHUA 1FI9A 155CA 2YK3A 2Y0CA 2JQRA 3H1JD 2RMZA 3L75D 2ZBOA 3WFCC 3HQ8A 3JBTB 4FA5A 1N50A 5CIFB 3VNWA 4AAMA 5TJHA 1H31B 2C8SA 1A2SA 3FWLA 1YICA 3MK7C 1YEBA 3NBSA 4U3FD 2MHMA 2YIUB 2L4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L91 A;  1HJ3 A;  5CIH B;  3CX5 D;  4EIF A;  1I5T A;  1KIB A;  1I54 A;  2DGE A;  2GB8 B;  1C52 A;  1EZV D;  3A9F A;  1CYI A;  2CA3 B;  4AAN A;  1I6D A;  3O1Y A;  4UB6 V;  1KYO W;  2FYN B;  5CIC B;  1FI3 A;  1HRO A;  2C1D A;  1NTK D;  1HZV A;  1LMS A;  1FJ0 A;  1DVV A;  1HRC A;  1C6S A;  5C9M A;  5AUR A;  4Q5P A;  1IZL 0;  2N3B A;  5DFS A;  1CNO A;  2C1V A;  4JCG A;  3VYM A;  4EIE A;  1C75 A;  1I8P A;  2BPB B;  1HZU A;  1QKS A;  2IBZ D;  1CIF A;  3VRD A;  1KX2 A;  1CRI A;  2CE0 A;  4H0K A;  4MU8 A;  1COT A;  5GTH V;  1J3S A;  2MTA C;  4KMG A;  1CIG A;  2C2C A;  4XYD B;  1NMI A;  1QL4 A;  1E29 A;  1H31 A;  2BCC D;  1CO6 A;  1IRV A;  1COR A;  3ZIY A;  4WQA A;  3OCD A;  2N9Y B;  1K3G A;  1ETP A;  5E79 V;  3C2C A;  3A0B V;  2FWL A;  1FI7 A;  1CED A;  5GTI V;  4GYD A;  2BH4 X;  1CRY A;  2JTI B;  1AOQ A;  1YIQ A;  1CRC A;  3RN1 A;  2JWA A;  1CHI A;  5KAF V;  1VYD A;  1CSX A;  1NML A;  5DJQ C;  1W2L A;  2BH5 X;  3OA8 B;  1H1O A;  1C2N A;  3ZBM A;  1I55 A;  1DW3 A;  3PRJ A;  3L73 D;  4J20 A;  2ORL A;  2PAC A;  4N0K A;  1N15 A;  2CA4 B;  1I6E A;  3TF5 A;  2Q3E A;  1AYG A;  1LFM A;  3HQ6 A;  3WC8 A;  1MG3 D;  1L0L D;  3ZOY A;  1HJ5 A;  3KZI V;  3L4M A;  1W5C T;  1CSW A;  3PLN A;  3O5C A;  1CCR A;  3WFE C;  3DMI A;  1CXC A;  1CSV A;  3SWS A;  3ZOX A;  3X39 A;  1U75 B;  1CHH A;  1CTJ A;  1MG2 D;  1KX7 A;  4FA9 A;  2K9J B;  5IY5 1;  3L70 D;  2QG4 A;  5KAI V;  3PTZ A;  1DII C;  1QYZ A;  4AX3 A;  4PWA A;  3NWV A;  1OCD A;  3ZOO A;  1KB0 A;  4YE1 A;  5EXQ A;  4WQ7 A;  2LIR A;  1ZRT D;  4FA1 A;  4O1Q A;  2ZXY A;  1CC5 A;  2D0W A;  451C A;  1H33 B;  4PJ0 V;  3L4O A;  3H1I D;  2PCB B;  3O20 A;  3ZOW A;  1C7M A;  1CXA A;  2OZ1 B;  1KV9 A;  3PXT A;  3TYI A;  2AXT V;  4FAN A;  3CWB D;  3L74 D;  1CTZ A;  1C2R A;  3WFD C;  2ZON G;  3OA8 A;  2YCC A;  2GC4 D;  3HQ9 A;  1CRG A;  1FHB A;  2B4Z A;  1HH7 A;  2QJK B;  4WQE A;  3TGU D;  2GIW A;  3GG2 A;  1N9C A;  1FOC A;  3RLM A;  2BCN B;  2HV4 A;  1R0Q A;  4EIC A;  1GJQ A;  1L9B C;  3ZCF A;  1M70 A;  1CCH A;  1CRH A;  3TDK A;  1DW0 A;  5CID B;  2N18 B;  1A56 A;  1SQX D;  2YQB A;  2LIT A;  4LJI A;  2I8F A;  1C6O A;  3PXW A;  2V08 A;  3BCC D;  1CHJ A;  3CP5 A;  1QN2 A;  2DVH A;  3L72 D;  2Y0D A;  2BLF B;  1CIH A;  1WVE C;  1K3H A;  1LS9 A;  1MZ4 A;  2V07 A;  3CXH W;  1AOF A;  5CIE B;  5C0Z A;  4RJT A;  1NTZ D;  2XTS B;  4V2K A;  2KS1 A;  3GW6 A;  2B12 B;  1KYO D;  1L0N D;  4WQC A;  1HCM A;  3RN0 A;  3CYT I;  1RZ6 A;  4L1Q A;  5B6Q A;  2FYU D;  1HJ4 A;  5KKZ B;  1M60 A;  1C6R A;  2C1D B;  1U74 B;  2PCC B;  4RSZ A;  2KNC B;  1CYJ A;  1FCD C;  1CIE A;  1EB7 A;  1DIQ C;  2C1U A;  4L3H A;  1QL3 A;  2CE1 A;  2C9X B;  1LC2 A;  2N9J A;  3SVW A;  1DT1 A;  2BGV X;  5TIS V;  2GC7 D;  2D0S A;  4IL6 V;  1IQC A;  2A06 D;  1H32 B;  4P4Q B;  1S5L V;  2AIU A;  1NNO A;  5KLI B;  1L9J C;  5B66 V;  5H2F V;  4WQ8 A;  5CIB B;  1RAQ A;  1H9Y A;  3PH2 B;  1S6V B;  3MK7 B;  2Y0E A;  1F1C A;  4H0J A;  1E8E A;  1GKS A;  2N3Y A;  3OCD B;  4PW9 B;  1I8O A;  3CXH D;  4PD4 D;  2O3J A;  3RMZ A;  1OAE A;  4QAO A;  4WQ9 A;  1A8C A;  2B10 B;  2CXB A;  1YTC A;  3HQ7 A;  1SQQ D;  1N90 A;  1LC1 A;  1DVH A;  1WEJ F;  3H1L D;  5B5E V;  1DW1 A;  1SQP D;  3DR0 A;  1IRW A;  5CIG B;  4EDF A;  4WQD A;  3NBT A;  1NU1 D;  1BGY D;  1DW2 A;  4K3I A;  1GDV A;  2ZZS 1;  3WU2 V;  1F1F A;  1IO3 A;  1PPJ D;  3M97 X;  1CSU A;  2B0Z B;  1CTY A;  1E2R A;  5KLV D;  4AAL A;  4WQB A;  1SQV D;  1GQ1 A;  1YNR A;  1AKK A;  4EID A;  3H1K D;  1B7V A;  2ZOO A;  4AAO A;  1CYC A;  4L3G A;  2EXV A;  1KB9 D;  3WUI A;  4A7P A;  1M6Z A;  2AI5 A;  2N18 C;  4FAV A;  1BL9 A;  1YCC A;  351C A;  1PP9 D;  3PXS A;  1GU2 A;  2FRC A;  2QJP B;  1H32 A;  3L71 D;  1CRJ A;  3O0R C;  3WFB C;  3CX5 W;  2QJY B;  3PHL A;  2VHD A;  3CU4 A;  3SLE A;  1RAP A;  1RZ5 A;  2B11 B;  4FB1 A;  3H1H D;  5CYT R;  1NTM D;  4GED B;  1SQB D;  1BCC D;  1GIW A;  3ITK A;  3A0H V;  4DY9 A;  4UB8 V;  1BE3 D;  2RN0 A;  3VMA A;  1ZZH A;  3DP5 A;  5DF5 A;  4O1W A;  1YEA A;  1YFC A;  4NFG B;  3SXT A;  4Y5R A;  3ORV A;  1H33 A;  1NIR A;  1P84 D;  1JDL A;  1H9X A;  4XXL A;  3SJL A;  2OZ1 A;  4D6T D;  5DJQ B;  4FA4 A;  2N9I A;  3KHU A;  1FI9 A;  155C A;  2YK3 A;  2Y0C A;  2JQR A;  3H1J D;  2RMZ A;  3L75 D;  2ZBO A;  3WFC C;  3HQ8 A;  3JBT B;  4FA5 A;  1N50 A;  5CIF B;  3VNW A;  4AAM A;  5TJH A;  1H31 B;  2C8S A;  1A2S A;  3FWL A;  1YIC A;  3MK7 C;  1YEB A;  3NBS A;  4U3F D;  2MHM A;  2YIU B;  2L4D A; 
#chains in the Genus database with same CATH topology
 4WWI A;  1XTC C;  4JYB A;  1I5T A;  3OW2 O;  2Y9Y A;  4K35 A;  1NAF A;  1VQO P;  2NPS D;  4N78 E;  1HJB A;  2B88 A;  1JY2 P;  3Q2Y A;  1YQ3 C;  1JTH A;  2KSE A;  3A7O A;  3O1Y A;  5AVZ B;  4UB6 V;  5CIC B;  1FI3 A;  1NTK D;  5BU8 B;  1RE3 C;  1LMS A;  5CCH D;  1DVV A;  1QLE D;  5DJT B;  5BU5 A;  1C6S A;  3CWB J;  2E75 D;  5AUR A;  4Q5P A;  2HOD A;  2PRR A;  2KK7 A;  3SSU A;  3F5H A;  1SQX G;  4EIE A;  1C75 A;  3BCC G;  2BPB B;  2QM8 A;  1QKS A;  3HE5 B;  1FE6 A;  1CIF A;  4LLH A;  2QJP C;  5AW2 B;  5GTH V;  1NTM K;  3L37 A;  2MTA C;  3JSV C;  1CIG A;  2NPS A;  1KIL B;  2V4H A;  2N1T B;  1QL4 A;  2BCC D;  2KOG A;  2QJY C;  1AA0 A;  1L0N G;  1IRV A;  1COR A;  3L72 J;  3RL0 B;  2N9Y B;  1K3G A;  5E79 V;  4YTP C;  5TIS E;  1IFM A;  5CCH A;  2C0X A;  1IFI A;  4WY4 C;  4H0L D;  2HLO A;  4GYD A;  1EDK A;  1QVG O;  2FYU J;  1AOQ A;  3WU2 H;  1YIQ A;  3H1H E;  1PFI A;  3L36 A;  1VYD A;  2PAJ A;  2A06 G;  2IYP A;  5DJQ C;  3OA8 B;  4KJM A;  2XND H;  5AW3 B;  1SFC D;  2CA4 B;  3TF5 A;  2J58 A;  3UIA A;  2JJL A;  1S1C X;  1BSH A;  1AYG A;  4ASV A;  1T6A A;  3HQ6 A;  1H8A A;  1L0L D;  2H89 C;  1HJ5 A;  3S4R A;  2OTK E;  3WFE C;  3DMI A;  1DD3 A;  3CPW O;  3USS A;  1HWT C;  1CHH A;  3CCM P;  1MFZ A;  1DD4 A;  2QG4 A;  2KS1 B;  1NTK K;  2R3S A;  1PV3 A;  1K73 Q;  2WSF J;  1NVO A;  3ZOO A;  1YJW P;  2E5T A;  4FA1 A;  3GLM A;  3H1I J;  1SFC A;  1E79 H;  3FXD A;  3EWK A;  1CI6 A;  1KN7 A;  3H1K G;  2IYO A;  2YKO A;  3L4O A;  3O20 A;  3M06 A;  1QX8 A;  1CXA A;  3QWO C;  3B5N C;  2YMY A;  1Q90 D;  3MUD A;  3II6 A;  3L74 D;  2WT7 B;  3L71 G;  3WFD C;  2W6B A;  1CRG A;  5C39 A;  2B4Z A;  1FDO A;  1NKZ B;  1N73 A;  3KZI H;  1FZF A;  4WQE A;  5GTI E;  1N9C A;  2P58 A;  1FOC A;  1K8A Q;  3H32 A;  2W6A A;  1S5L X;  1PP9 J;  1RF1 A;  3ZCF A;  3D0W A;  2H7H A;  2P67 A;  3D6Z A;  3VN0 A;  1HTL C;  1NJI Q;  1A56 A;  1KYO H;  1YTZ T;  3Q5S A;  3V2N A;  3CP5 A;  1DEE G;  2B87 A;  1CIH A;  1NWQ A;  3H1H J;  1K3H A;  4WB4 A;  1T2K D;  3O6Q A;  3O8Z A;  4RJT A;  2XTS B;  2OQQ A;  2LXB A;  1KIL D;  1JOC A;  2N1T D;  1X0T A;  2QEX P;  3TNU A;  5AW6 B;  1SLQ A;  4L1Q A;  3RL0 D;  3SWK A;  1YBK A;  5KKZ B;  1M60 A;  1C6R A;  2C1D B;  2AXT H;  2PCC B;  3ZDM A;  2E76 C;  2E76 B;  2YXQ B;  1KQF B;  1JY2 O;  3AE3 C;  1G1I A;  1OMI A;  4D6T J;  1KIL E;  1LWU B;  1FCD C;  4OGQ C;  4OGQ B;  1GMJ A;  5KAI E;  1QL3 A;  5K5G B;  4H44 D;  2N9J A;  1X79 B;  4AQR D;  3SVW A;  3KDP B;  2ZFC A;  4UB6 E;  5CHX A;  4P4Q B;  1S5L V;  2WSC J;  2M8R A;  1EZV G;  2FFD A;  4W80 A;  4NPE A;  1KZU B;  2B89 A;  1S72 P;  1URQ D;  1KIL A;  1NKN A;  1LTS C;  3PH2 B;  2N1T A;  4PJ0 E;  1S6V B;  3MK7 B;  1F1C A;  3AE8 C;  1WMK A;  4PW9 B;  3MIW A;  1DEB A;  2O3J A;  4W7Z A;  3L70 E;  1A8C A;  2C0W A;  2CXB A;  3V4Q A;  1SQQ D;  1N90 A;  1IJD B;  1VQ9 P;  2W6J H;  3HUS C;  1Q2N A;  1SQP D;  1MV8 A;  1HH0 A;  2JDI H;  4WVZ A;  5CIG B;  5E79 E;  1BGY D;  1DW2 A;  2D2C D;  3BRT B;  2HFE D;  4ZNC A;  1RY3 A;  5AW9 B;  1SQQ E;  1HJ0 A;  1F1F A;  1URQ A;  3PP5 A;  3V2Q A;  2HYN A;  3M97 X;  1CSU A;  4M3L A;  3HTK A;  1CTY A;  1S2E A;  4AAL A;  1ZOY C;  2ZT9 C;  1SQV D;  2ZT9 B;  3HE4 B;  3CC7 P;  1AKK A;  4EID A;  1SQP E;  4AAO A;  2Y9Z A;  4L3G A;  2XV5 A;  3RGU A;  4L74 A;  2N18 C;  4Z1M H;  1L4A B;  4O9B A;  2OYO A;  3TGU E;  2FRC A;  2KYV A;  3EFG A;  3G3Z A;  1SQV E;  2I1K A;  3PHL A;  1FZE A;  1OW6 A;  1FZC C;  3SLE A;  2B11 B;  1YJ9 P;  1JTH B;  5CYT R;  5AVS B;  3HD7 B;  1SQB D;  1BCC D;  1GIW A;  3OA7 A;  3D71 A;  1JEK A;  1NTZ E;  1PL5 A;  2Q9I A;  1YFC A;  4B86 A;  2HOD B;  2WWW A;  3NTN A;  2Q1K A;  5AVQ B;  1BDC A;  3OJA B;  4XXL A;  2WSC H;  3L73 J;  3AE4 C;  3C8V A;  1USE A;  5APY A;  2YMK A;  1RE4 A;  2N9I A;  4TLF A;  2WT7 A;  1G2C A;  2YK3 A;  2Y0C A;  3H1J D;  2ZBO A;  1U57 A;  2E74 D;  4C7N A;  3HQ8 A;  1N50 A;  3CXH H;  4OWF A;  2NPS C;  2NPS B;  4AAM A;  3PH0 A;  3A5T A;  1LTB C;  1A2S A;  1FOS E;  3IF4 A;  2ZYD A;  1VQ8 P;  1LTT C;  3NBS A;  5B5E E;  1VQ5 P;  1SQQ K;  2YIU B;  3E1R A;  1OFC X;  2M5A A;  3L70 J;  3G9R A;  1MFT A;  4ASW A;  5CCH C;  1KIB A;  1SQP K;  2E75 B;  2Q5U A;  2O1J A;  4W7Y A;  1C52 A;  3A0H H;  1M57 D;  4GT1 A;  4UB8 H;  3SWY A;  1NOH A;  3CWB G;  1SP4 A;  1SQV K;  1I6D A;  3FWN A;  1GK4 A;  1NO4 A;  4U7J A;  2C1D A;  2WPS A;  2HPC A;  1HRC A;  5C9M A;  5AVU B;  1IZL 0;  2N3B A;  3IAO A;  1W2B O;  4AUW A;  3H1L E;  3GF3 A;  1ZW0 A;  5B66 H;  3TGU J;  4I2L C;  1JCC A;  2C1V A;  1ZR4 A;  4JCG A;  4I7Z C;  3VYM A;  4I7Z B;  1NTZ K;  1NU1 E;  3L72 G;  2IBZ D;  4H0L B;  3VRD A;  2CE0 A;  4H0K A;  2XZR A;  4K3A A;  1COT A;  2KI7 B;  5KLV E;  1CW5 A;  1SQB K;  1MZ9 A;  2ZXE B;  5AVR B;  1IC2 A;  1OX3 A;  3S1K A;  4JBZ A;  1VF5 C;  3ZIY A;  1JB0 J;  2WIT A;  4NPD A;  2V7Q J;  4WQA A;  2FYU G;  2C9N Y;  1N2D C;  1P84 H;  1ETP A;  1NTZ J;  2FWL A;  3N7N A;  1H88 A;  4BWN A;  1SFC C;  1CED A;  1BDD A;  5GTI V;  2WSE H;  1CI6 B;  3TK1 A;  1PGP A;  2BH4 X;  1ZV8 A;  2Z5H A;  1Q81 Q;  3CCJ P;  3AED C;  2OYH B;  1NTM E;  3MUD C;  1NML A;  1W2L A;  2BH5 X;  1BE3 E;  3P7K A;  2R3C A;  1N73 C;  1GTW A;  1I55 A;  3HD7 D;  1N73 B;  3WMM 0;  3CX5 H;  1W5C E;  3AEE C;  2ORL A;  2PAC A;  4PV1 B;  1N15 A;  3H32 B;  3KYQ A;  1RF1 C;  2WQY C;  2Q3E A;  1K05 A;  5GTH H;  1DH3 A;  3B71 A;  3MGN A;  2AEJ A;  1EXJ A;  1VQM P;  1G1J A;  4LC1 A;  2OTL P;  3BRV B;  3L75 E;  1S9K D;  1CSV A;  3ZOX A;  2B87 B;  3VYI A;  1U75 B;  1CTJ A;  1KX7 A;  1IFP A;  3O6Q B;  2O01 N;  5IY5 1;  1NU1 K;  3H1I G;  2ZJS E;  4U3F E;  5KAI V;  1PGO A;  1QYZ A;  3MP7 B;  3L4F A;  5KLV K;  3TNU B;  3MHV A;  3NWV A;  3VMX A;  1OCD A;  3HD7 A;  3Q3D A;  1AJY A;  1ZME C;  1PPJ G;  3H1L J;  2W27 A;  1M90 Q;  3U1C A;  1IZN B;  1UII A;  5AVX B;  4QMA A;  1EC5 A;  451C A;  1NU1 J;  4PJ0 V;  1X8Y A;  3H1I D;  1YQ4 C;  2PCB B;  4IFF A;  2OZ1 B;  1KV9 A;  3EFF K;  1USD A;  1PP9 G;  3VOP A;  5KLV J;  1JMM A;  3A0B E;  1FOS F;  3HQ9 A;  1NTK E;  1GW4 A;  1T2K C;  4GOD A;  2GIW A;  2FFD B;  3GG2 A;  2AEM A;  3IFM A;  3RLM A;  1KIL C;  1R0Q A;  4EIC A;  2N1T C;  1T8Z A;  1M70 A;  3H1H G;  5APV A;  5AW5 B;  1M1J A;  2NZ2 A;  3RL0 C;  3VMY A;  5KAF E;  3I55 P;  1SQX D;  5EFW B;  2I8F A;  3CCU P;  4OVN F;  3BCC D;  1CHJ A;  2BAS A;  3W68 A;  5AW4 B;  2DVH A;  4KHX A;  1LS9 A;  2BCC E;  4OH8 B;  1NTM J;  4C7R A;  3RK3 B;  1BE3 J;  4H44 B;  1LJ2 A;  2B12 B;  1L0N D;  1PGJ A;  2IPP A;  4D6T G;  1HCM A;  4I1L A;  1VQ4 P;  4EOT A;  1HJ4 A;  1U7M A;  3L35 A;  1JY3 N;  1URQ B;  4ZMD A;  3CCL P;  3HTK B;  2XNX A;  2L5G B;  1EDJ A;  1CZQ A;  2K88 A;  1ZN5 A;  1EB7 A;  2C1U A;  2Z4E A;  1LT1 A;  3L75 J;  1LC2 A;  2KZJ A;  3VMZ A;  2PFX A;  1DT1 A;  2BGV X;  2ZYG A;  1IQC A;  1EDI A;  2A06 D;  4IFD K;  2AIU A;  1FBM A;  1L9J C;  4U3F J;  3C9I A;  2G3A A;  5CIB B;  3CCV P;  2JP3 A;  1FZB A;  1L0L E;  4PV1 D;  4NPF X;  5AW8 B;  3H25 A;  1GKS A;  1Y9B A;  2KLV A;  3OCD B;  2A06 E;  2D2C C;  2D2C B;  2IX7 C;  3JCU E;  3CD6 P;  5APQ A;  4DT0 A;  1I8O A;  3CXH D;  2QM7 A;  4PD4 D;  4JQ0 D;  4YXW H;  4QAO A;  1EQ7 A;  1S3J A;  1AFO A;  4WQ9 A;  2WTY A;  2FBW C;  2I1J A;  4RKU J;  1DVH A;  3BAT A;  1NTK J;  3AE2 C;  5B5E V;  2OYH A;  1DW1 A;  4JPZ B;  4PD4 E;  1JCD A;  3KQG A;  2WZ7 A;  2BEZ F;  3NBT A;  1G2C B;  1VQK P;  2XKM A;  4C7N B;  3WU2 V;  1SQX K;  3CMA P;  3CI9 A;  1IO3 A;  2B0Z B;  1L2P A;  4DOJ A;  4YXD C;  1GQ1 A;  2B9B A;  1S5L H;  1JUN A;  3H1K D;  3IR9 A;  3M0A A;  1B7V A;  3AEG C;  1CYC A;  1KB9 D;  3L74 E;  1VQ7 P;  1M6Z A;  2AI5 A;  4FAV A;  2M5A B;  1BL9 A;  1W2E A;  4IOI H;  2BCC J;  3PXS A;  1VPC A;  5KJ7 C;  3L71 D;  3K5B A;  2J5U A;  1CRJ A;  1TU3 F;  3WUV A;  1KB9 E;  1RAP A;  1RZ5 A;  1RF0 C;  2VRS A;  1CSB A;  1XTG B;  3FXE A;  3L71 E;  2E74 B;  4IL6 E;  3ITK A;  1GL2 B;  4DY9 A;  1L0L K;  5KKZ C;  3L73 G;  1ZZH A;  1KQS O;  2HPC B;  5H2F E;  4O1W A;  1YEA A;  4NFG B;  3CC4 P;  2RKL A;  1LWU C;  4Y5R A;  3ORV A;  1X9V A;  3MTU E;  1P84 D;  3RBX A;  2QVA A;  3SJL A;  2OZ1 A;  3RK3 D;  1VL2 A;  2IDB A;  1H0T A;  3KHU A;  3Q5R A;  1FJP A;  3V5B A;  1FI9 A;  155C A;  1HBW A;  1L0L J;  3VNW A;  3L70 G;  4WY4 D;  5TJH A;  3EQ2 A;  2C8S A;  1KMI Z;  2WSF H;  1OVR A;  3M9H A;  3RK2 B;  3MK7 C;  3RK3 E;  2MHM A;  1LTJ A;  1JNM A;  1Z56 A;  3QH9 A;  3JC2 2;  3CX5 D;  1JMB A;  4EIF A;  4JF7 A;  2SPZ A;  2DGE A;  2GB8 B;  2BEQ D;  3P8C D;  1EZV D;  3W67 A;  3WUT A;  1Q82 Q;  2OAR A;  4AAN A;  3WUU A;  2A45 I;  2E5Y A;  3HRN A;  1DX7 A;  1NH4 A;  3TGU G;  2FYN B;  4WY4 A;  2W8Z A;  1HRO A;  1LTA C;  1FJ0 A;  5TIS H;  4DJG A;  1LP1 B;  1ZLL A;  3L74 J;  2WPV B;  2JKV A;  2I8D A;  5CBN A;  1CNO A;  2R5D A;  2W83 C;  1BGY E;  3SFD C;  1L4A C;  2OTJ P;  2GUS A;  1CRI A;  4MU8 A;  1YIT P;  3H6P A;  2KSJ A;  2C2C A;  1NTZ G;  1VDF A;  5KTB A;  4XYD B;  1NMI A;  1E29 A;  2AEF A;  1CO6 A;  3GF7 A;  2OYI B;  2HR3 A;  1H89 A;  3OCD A;  3HD7 C;  3C2C A;  3A0B V;  1FI7 A;  5AW0 B;  2H8P D;  1KFN A;  3BVH A;  1CRY A;  1Q7Y Q;  2JWA A;  3RN1 A;  2M3E A;  4JYC A;  5KAF V;  1SQB E;  1BCC E;  1J1E C;  1J1E B;  1IFJ A;  3LW5 J;  4GOF A;  1OXZ A;  4C46 A;  5CJ4 A;  1DW3 A;  1K04 A;  3PRJ A;  2KXP B;  1GL2 D;  4J20 A;  5AVY B;  1HF9 A;  1I6E A;  3OAK A;  1M1J C;  1MG3 D;  1M1J B;  2YIU C;  1PIX A;  3L4M A;  1LGH B;  1CCR A;  3H1J E;  1YIJ P;  1CXC A;  3WU2 E;  3X39 A;  1MG2 D;  2E75 C;  1KD1 Q;  1AQ5 A;  2K9J B;  2W90 A;  3V2P A;  3H1L G;  5GTI H;  3PTZ A;  2WSS H;  3R4Y A;  2N9B A;  4PWA A;  3RK2 D;  1NU1 G;  1SQQ J;  5EXQ A;  2H88 C;  4WQ7 A;  2LIR A;  1ZRT D;  1GL2 A;  1VQP P;  1Q86 Q;  1WRG A;  5KLV G;  2D0W A;  1FAV A;  1SQP J;  2JR8 A;  1H33 B;  1BGY J;  3ZOW A;  3PXT A;  1U7J A;  1N7L A;  4FAN A;  3CWB D;  1YTZ I;  2P10 A;  1SQV J;  1C2R A;  2YCC A;  4H0L C;  1HH7 A;  2QJK B;  1LTG C;  1A02 J;  2BCN B;  2Q3I A;  4IL6 X;  5CCG D;  3MZW B;  2UWJ E;  1GJQ A;  2IBZ I;  2K3R A;  1IK7 A;  3SWF A;  1NTM G;  3TDK A;  5CID B;  3R2P A;  1J2J B;  1SVF A;  2IBZ E;  2LIT A;  1BE3 G;  1R5L A;  5KAI H;  3PXW A;  1OZH A;  3L72 D;  1RQV A;  1OIP A;  2Y0D A;  1WVE C;  1MKM A;  1AOF A;  1NAY A;  4UB6 H;  5C0Z A;  1NHL A;  3P32 A;  1SQB J;  1BCC J;  1FZG A;  2JEE A;  2M3B A;  2FXM A;  3GW6 A;  5AW1 B;  2P7J A;  1KYO D;  3IN6 A;  1LT9 A;  2OYH C;  4EI2 A;  3KZI E;  4AYC A;  3RBZ A;  4HJG H;  3CYT I;  1RZ6 A;  5B6Q A;  4PJ0 H;  3CME P;  2FYU D;  3L75 G;  1JY3 P;  1U74 B;  2FYZ A;  5CCG A;  2FXP A;  3S9O A;  2KNC B;  4PV1 C;  1LP1 A;  1KYO E;  1YYC A;  1OVU A;  4U3F G;  3H1J J;  4R4L A;  3HUS A;  2FYU E;  5L8R J;  4H13 B;  1HGV A;  2GC7 D;  3M0D A;  2D0S A;  4IL6 V;  1T3J A;  1ZP0 C;  1NNO A;  5KLI C;  5KLI B;  1A02 F;  5B66 V;  5H2F V;  5E79 H;  2R5B A;  1H9Y A;  1KQG B;  4H0J A;  4N78 D;  1E8E A;  2OYI A;  4ZKP A;  2N3Y A;  2AXT E;  1HUC A;  3CCQ P;  1S9K E;  1NTK G;  3PJS K;  1OAE A;  1OW8 A;  1K9M Q;  2B10 B;  3HQ7 A;  3A3Y B;  4BXL A;  1LC1 A;  1FZC A;  1RQU A;  2KZI A;  3DR0 A;  1H0T B;  1OW7 A;  1IRW A;  1VQL P;  4EDF A;  2Z5I A;  5M1B A;  2FFD C;  1PPJ D;  5CJ0 A;  2BCC G;  2CPS A;  3D6Y A;  4WQB A;  3H1I E;  2V7Q H;  1FS0 E;  1LNQ A;  2ZVN B;  1HGZ A;  2ZOO A;  1LTJ C;  1LTJ B;  4L75 A;  4TT3 H;  3AEC C;  2QE7 H;  351C A;  1PP9 D;  2KUB A;  3GHG A;  2KLU A;  2GA1 A;  2R44 A;  1GU2 A;  2QJP B;  1H32 A;  1PPJ E;  3O0R C;  2YO3 A;  2K37 A;  2FYU K;  3CCS P;  3WFB C;  2QJY B;  2K9J A;  2KP8 A;  3N4X A;  1YI2 P;  1MUU A;  1QEX A;  3RK3 C;  4XFJ A;  1GD2 E;  4H44 C;  1SQX E;  4FB1 A;  3H1H D;  1PP9 E;  2YXR B;  1AV1 A;  2NRG A;  3BCC E;  3Q1M A;  4WY4 B;  2RN0 A;  3VMA A;  5B5E H;  1R8E A;  3DP5 A;  4RES B;  1URQ C;  4HKZ H;  3SXT A;  3FX0 A;  4MN4 C;  3Q5P A;  1L0L G;  1L0N E;  1H33 A;  1NIR A;  1VF5 D;  2WPQ A;  1J1D C;  1J1D B;  1N86 A;  4D6T D;  4I6M C;  5DJQ B;  1DIP A;  4FA4 A;  3SFE C;  2GUV A;  2RMZ A;  1FDM A;  3WFC C;  2QRX A;  1N7S D;  4RO0 A;  4DCK A;  3FWL A;  1YIC A;  3T97 A;  4D6T E;  1M56 D;  1HZV A;  1GU4 A;  2L91 A;  1HJ3 A;  5CIH B;  1QL2 A;  4H13 D;  1NYH A;  1I54 A;  4R4M A;  1LTI C;  5APU A;  3A9F A;  3LIE A;  5CBO A;  3CXH I;  4PD4 I;  1SS1 A;  1CYI A;  3VP8 A;  2CA3 B;  3KPE A;  3F89 A;  1JY2 N;  1FU1 A;  2P2U A;  3L74 G;  1GZL A;  3CXH E;  2YNY A;  1RE4 C;  1KYO W;  1X22 A;  3U59 A;  1T3U A;  1YJN P;  4BRY A;  1N7S A;  2KNC A;  3AE7 C;  1FJK A;  2JO1 A;  3MD0 A;  5DFS A;  3B5N B;  1JY3 O;  2O1K A;  2G8Y A;  3BAS A;  2XU6 A;  1I8P A;  1HZU A;  1KX2 A;  2JWD A;  3A0H E;  1L0N K;  4UB8 E;  2KIK A;  1J3S A;  1KB9 I;  3C1L A;  4KMG A;  2POH A;  1SQX J;  1VQN P;  1H31 A;  3H1K E;  2RH0 A;  3AEA C;  1RH5 B;  3P8M C;  3BCC J;  4N6J A;  5AVW B;  2Q7C A;  2E74 C;  2J59 M;  1N8R Q;  1GL2 C;  1KTM A;  1R5S A;  1L0N J;  5B66 E;  2ITA A;  2ZVO B;  3VP9 A;  2JTI B;  1AQT A;  1CRC A;  5AVT B;  5APS A;  1CHI A;  4XE5 B;  3NFQ A;  4XA4 A;  5CMZ A;  1CSX A;  3NMD A;  3M91 A;  1H1O A;  1C2N A;  1P84 I;  3ZBM A;  2QA4 P;  5APT A;  1RE3 A;  3L73 D;  3TYY A;  4N0K A;  1P84 E;  1PZQ A;  1LFM A;  1JO5 A;  2OGU A;  3RK2 C;  3WC8 A;  3VTP C;  3ZOY A;  3KZI V;  1W5C T;  1CSW A;  3PLN A;  3O5C A;  3LID A;  3RL0 g;  3HE5 A;  2WMM A;  3L73 E;  1QVF O;  3SWS A;  1SQQ G;  2FXO A;  4FA9 A;  3A0B H;  1KFM A;  2A45 G;  5AVV B;  3CX5 I;  3L70 D;  1YHQ P;  1GDT A;  4ZKU A;  1SQP G;  3U1A A;  1DII C;  1LT9 C;  1LT9 B;  4AX3 A;  1EZV I;  2IZ1 A;  3V6I A;  3M9Q A;  3CX5 E;  1BGY G;  2GM4 A;  1KB0 A;  1FDI A;  4YE1 A;  2FYN C;  2PGD A;  4O1Q A;  5GTH E;  3P8C E;  5KAF H;  2ZXY A;  1CC5 A;  1EZV E;  5CCG C;  4EYY Q;  1EXI A;  1SQV G;  4L73 A;  3V2R A;  1KQL A;  1UIX A;  1C7M A;  3HUS B;  3TYI A;  2FY8 A;  1E5W A;  2AXT V;  1M1K Q;  2WVR A;  3M0D C;  1CTZ A;  1FHB A;  2ZON G;  3OA8 A;  2GC4 D;  3H1K J;  4L76 A;  3G4S P;  4GDO A;  3TGU D;  1ZXG A;  1AVO A;  2HV4 A;  4GOE A;  1KV4 A;  2R32 A;  3AE1 C;  1L9B C;  3CC2 P;  1CCH A;  3L71 J;  1CRH A;  1WT6 A;  3GMA A;  2OYI C;  3G6E P;  1DW0 A;  1AVY A;  2N18 B;  1SQB G;  1BCC G;  1OVV A;  2YQB A;  2AXC A;  4LJI A;  1C6O A;  3B5N D;  1Y8A A;  3B8E B;  3CL3 D;  4YPC A;  2V08 A;  4HB1 A;  1QN2 A;  2O01 J;  2BLF B;  2YO2 A;  3I56 P;  1MZ4 A;  2V07 A;  3CXH W;  5CIE B;  1GW3 A;  1NTZ D;  4V2K A;  2PP6 A;  1FZC B;  2IFN A;  2KS1 A;  3AE9 C;  4Y28 J;  4WQC A;  3RN0 A;  1IK9 A;  2HG5 D;  4WBA A;  3H1J G;  1IFN A;  3E7K A;  3V4W A;  4DZO A;  1M7L A;  1KC8 Q;  5DJU B;  5APW A;  5KJ7 D;  4RSZ A;  3JCU H;  2YKQ A;  1PGQ A;  5BVZ A;  2LKM A;  2E43 A;  1CYJ A;  2WSE J;  1CIE A;  4L3H A;  1DIQ C;  2Q6Q A;  2CE1 A;  2C9X B;  2IFM A;  4N3Y B;  2M0B A;  3B5N A;  5TIS V;  1FC2 C;  3GHG C;  3GHG B;  1BSN A;  1H32 B;  1D7M A;  3I5C A;  4PD4 H;  1KOR A;  4WQ8 A;  1RAQ A;  2E76 D;  2Y0E A;  4OGQ D;  2MJZ A;  3AEB C;  1ZR2 A;  2H43 A;  1Y47 A;  5KJ7 A;  3RMZ A;  1GK6 A;  2YKP A;  1RHZ B;  1YTC A;  3D70 A;  3M9B A;  1WEJ F;  3CCR P;  1RF0 A;  3H1L D;  2QIW A;  2ZYA A;  2QSI A;  2IBZ G;  4GIF A;  1ZRT E;  1KB9 H;  4WQD A;  1NU1 D;  4K3I A;  1GDV A;  3AE6 C;  3AE5 C;  2ZZS 1;  3E1I A;  4Y99 C;  4Y99 B;  2QJK C;  1S4X A;  4CPG A;  1QL1 A;  3B4S A;  1E2R A;  5KLV D;  2CPB A;  4IL6 H;  1LWU A;  5AW7 B;  2LXC B;  1YNR A;  1IFD A;  3T97 B;  2K9Y A;  5H2F H;  2XDJ A;  3A2A A;  3FGA D;  3CWB E;  1OWA A;  2EXV A;  2O01 H;  3WUI A;  4A7P A;  1YCC A;  2DW3 A;  4IFM A;  3G71 P;  5APX A;  1QGK B;  3KXD A;  2E42 A;  2ZXX A;  1HVV A;  3CX5 W;  2IZ0 A;  2VHD A;  1VF5 B;  2ZT9 D;  3CU4 A;  3LW5 H;  3CLQ A;  3AEF C;  1NTM D;  4GED B;  1FZA A;  3L72 E;  3A0H V;  1S5L E;  1L4A D;  1KYO I;  4UB8 V;  1SFC B;  1BE3 D;  4HH2 A;  1NGM B;  2ZAE B;  2LR2 A;  1GU5 A;  4BRY B;  5DF5 A;  1N7S C;  1N7S B;  2K1A A;  4LGD E;  2FKW B;  3TSI A;  2CK3 H;  1JDL A;  1H9X A;  1M8O B;  2KB7 P;  2MKV A;  4HYT B;  3CCE P;  4H13 C;  2C9L Y;  2P1J A;  2JQR A;  4GKG A;  3L75 D;  3JBT B;  4FA5 A;  3NXS A;  5CIF B;  1JM0 A;  1RF1 B;  1H31 B;  1VQ6 P;  1IO4 A;  3HE4 A;  4KT0 J;  2WPR A;  1YEB A;  4U3F D;  4EIJ A;  2A45 H;  1EDL A;  2L4D A;  3ABV C;  1L4A A; 
#chains in the Genus database with same CATH homology
 2L91 A;  1HJ3 A;  5CIH B;  3CX5 D;  4EIF A;  1I5T A;  1KIB A;  1I54 A;  2DGE A;  2GB8 B;  1C52 A;  1EZV D;  3A9F A;  1CYI A;  2CA3 B;  4AAN A;  1I6D A;  3O1Y A;  4UB6 V;  1KYO W;  2FYN B;  5CIC B;  1FI3 A;  1HRO A;  2C1D A;  1NTK D;  1HZV A;  1LMS A;  1FJ0 A;  1DVV A;  1HRC A;  1C6S A;  5C9M A;  5AUR A;  4Q5P A;  1IZL 0;  2N3B A;  5DFS A;  1CNO A;  2C1V A;  4JCG A;  3VYM A;  4EIE A;  1C75 A;  1I8P A;  2BPB B;  1HZU A;  1QKS A;  2IBZ D;  1CIF A;  3VRD A;  1KX2 A;  1CRI A;  2CE0 A;  4H0K A;  4MU8 A;  1COT A;  5GTH V;  1J3S A;  2MTA C;  4KMG A;  1CIG A;  2C2C A;  4XYD B;  1NMI A;  1QL4 A;  1E29 A;  1H31 A;  2BCC D;  1CO6 A;  1IRV A;  1COR A;  3ZIY A;  4WQA A;  3OCD A;  2N9Y B;  1K3G A;  1ETP A;  5E79 V;  3C2C A;  3A0B V;  2FWL A;  1FI7 A;  1CED A;  5GTI V;  4GYD A;  2BH4 X;  1CRY A;  2JTI B;  1AOQ A;  1YIQ A;  1CRC A;  3RN1 A;  2JWA A;  1CHI A;  5KAF V;  1VYD A;  1CSX A;  1NML A;  5DJQ C;  1W2L A;  2BH5 X;  3OA8 B;  1H1O A;  1C2N A;  3ZBM A;  1I55 A;  1DW3 A;  3PRJ A;  3L73 D;  4J20 A;  2ORL A;  2PAC A;  4N0K A;  1N15 A;  2CA4 B;  1I6E A;  3TF5 A;  2Q3E A;  1AYG A;  1LFM A;  3HQ6 A;  3WC8 A;  1MG3 D;  1L0L D;  3ZOY A;  1HJ5 A;  3KZI V;  3L4M A;  1W5C T;  1CSW A;  3PLN A;  3O5C A;  1CCR A;  3WFE C;  3DMI A;  1CXC A;  1CSV A;  3SWS A;  3ZOX A;  3X39 A;  1U75 B;  1CHH A;  1CTJ A;  1MG2 D;  1KX7 A;  4FA9 A;  2K9J B;  5IY5 1;  3L70 D;  2QG4 A;  5KAI V;  3PTZ A;  1DII C;  1QYZ A;  4AX3 A;  4PWA A;  3NWV A;  1OCD A;  3ZOO A;  1KB0 A;  4YE1 A;  5EXQ A;  4WQ7 A;  2LIR A;  1ZRT D;  4FA1 A;  4O1Q A;  2ZXY A;  1CC5 A;  2D0W A;  451C A;  1H33 B;  4PJ0 V;  3L4O A;  3H1I D;  2PCB B;  3O20 A;  3ZOW A;  1C7M A;  1CXA A;  2OZ1 B;  1KV9 A;  3PXT A;  3TYI A;  2AXT V;  4FAN A;  3CWB D;  3L74 D;  1CTZ A;  1C2R A;  3WFD C;  2ZON G;  3OA8 A;  2YCC A;  2GC4 D;  3HQ9 A;  1CRG A;  1FHB A;  2B4Z A;  1HH7 A;  2QJK B;  4WQE A;  3TGU D;  2GIW A;  3GG2 A;  1N9C A;  1FOC A;  3RLM A;  2BCN B;  2HV4 A;  1R0Q A;  4EIC A;  1GJQ A;  1L9B C;  3ZCF A;  1M70 A;  1CCH A;  1CRH A;  3TDK A;  1DW0 A;  5CID B;  2N18 B;  1A56 A;  1SQX D;  2YQB A;  2LIT A;  4LJI A;  2I8F A;  1C6O A;  3PXW A;  2V08 A;  3BCC D;  1CHJ A;  3CP5 A;  1QN2 A;  2DVH A;  3L72 D;  2Y0D A;  2BLF B;  1CIH A;  1WVE C;  1K3H A;  1LS9 A;  1MZ4 A;  2V07 A;  3CXH W;  1AOF A;  5CIE B;  5C0Z A;  4RJT A;  1NTZ D;  2XTS B;  4V2K A;  2KS1 A;  3GW6 A;  2B12 B;  1KYO D;  1L0N D;  4WQC A;  1HCM A;  3RN0 A;  3CYT I;  1RZ6 A;  4L1Q A;  5B6Q A;  2FYU D;  1HJ4 A;  5KKZ B;  1M60 A;  1C6R A;  2C1D B;  1U74 B;  2PCC B;  4RSZ A;  2KNC B;  1CYJ A;  1FCD C;  1CIE A;  1EB7 A;  1DIQ C;  2C1U A;  4L3H A;  1QL3 A;  2CE1 A;  2C9X B;  1LC2 A;  2N9J A;  3SVW A;  1DT1 A;  2BGV X;  5TIS V;  2GC7 D;  2D0S A;  4IL6 V;  1IQC A;  2A06 D;  1H32 B;  4P4Q B;  1S5L V;  2AIU A;  1NNO A;  5KLI B;  1L9J C;  5B66 V;  5H2F V;  4WQ8 A;  5CIB B;  1RAQ A;  1H9Y A;  3PH2 B;  1S6V B;  3MK7 B;  2Y0E A;  1F1C A;  4H0J A;  1E8E A;  1GKS A;  2N3Y A;  3OCD B;  4PW9 B;  1I8O A;  3CXH D;  4PD4 D;  2O3J A;  3RMZ A;  1OAE A;  4QAO A;  4WQ9 A;  1A8C A;  2B10 B;  2CXB A;  1YTC A;  3HQ7 A;  1SQQ D;  1N90 A;  1LC1 A;  1DVH A;  1WEJ F;  3H1L D;  5B5E V;  1DW1 A;  1SQP D;  3DR0 A;  1IRW A;  5CIG B;  4EDF A;  4WQD A;  3NBT A;  1NU1 D;  1BGY D;  1DW2 A;  4K3I A;  1GDV A;  2ZZS 1;  3WU2 V;  1F1F A;  1IO3 A;  1PPJ D;  3M97 X;  1CSU A;  2B0Z B;  1CTY A;  1E2R A;  5KLV D;  4AAL A;  4WQB A;  1SQV D;  1GQ1 A;  1YNR A;  1AKK A;  4EID A;  3H1K D;  1B7V A;  2ZOO A;  4AAO A;  1CYC A;  4L3G A;  2EXV A;  1KB9 D;  3WUI A;  4A7P A;  1M6Z A;  2AI5 A;  2N18 C;  4FAV A;  1BL9 A;  1YCC A;  351C A;  1PP9 D;  3PXS A;  1GU2 A;  2FRC A;  2QJP B;  1H32 A;  3L71 D;  1CRJ A;  3O0R C;  3WFB C;  3CX5 W;  2QJY B;  3PHL A;  2VHD A;  3CU4 A;  3SLE A;  1RAP A;  1RZ5 A;  2B11 B;  4FB1 A;  3H1H D;  5CYT R;  1NTM D;  4GED B;  1SQB D;  1BCC D;  1GIW A;  3ITK A;  3A0H V;  4DY9 A;  4UB8 V;  1BE3 D;  2RN0 A;  3VMA A;  1ZZH A;  3DP5 A;  5DF5 A;  4O1W A;  1YEA A;  1YFC A;  4NFG B;  3SXT A;  4Y5R A;  3ORV A;  1H33 A;  1NIR A;  1P84 D;  1JDL A;  1H9X A;  4XXL A;  3SJL A;  2OZ1 A;  4D6T D;  5DJQ B;  4FA4 A;  2N9I A;  3KHU A;  1FI9 A;  155C A;  2YK3 A;  2Y0C A;  2JQR A;  3H1J D;  2RMZ A;  3L75 D;  2ZBO A;  3WFC C;  3HQ8 A;  3JBT B;  4FA5 A;  1N50 A;  5CIF B;  3VNW A;  4AAM A;  5TJH A;  1H31 B;  2C8S A;  1A2S A;  3FWL A;  1YIC A;  3MK7 C;  1YEB A;  3NBS A;  4U3F D;  2MHM A;  2YIU B;  2L4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...