1L0ND

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1l0nD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1l0nD02
2JWAA 3DMIA 5DFSA 1LMSA 1NMLA 4PD4D 1CIGA 1C6OA 1W2LA 2FYUD 1A2SA 2D0SA 1E2RA 2DGEA 2OZ1B 1HJ3A 5DJQB 3WUIA 451CA 1CIHA 4EDFA 2C1DA 3PXWA 4L3HA 2LITA 4Y5RA 1CTYA 1ZRTD 1I6EA 2V08A 5B66V 2BGVX 3ZOXA 1QKSA 4LJIA 5AURA 1GQ1A 3OA8A 3HQ8A 1H31B 2DVHA 1LS9A 3L73D 4U3FD 4FA4A 1B7VA 3OCDB 1E8EA 2PACA 1CHHA 1CYJA 2B12B 3VNWA 1N50A 2QJPB 3HQ9A 1L0LD 4FA9A 1P84D 5H2FV 1MZ4A 4NFGB 1HZVA 1KV9A 2CXBA 2PCCB 1C2NA 1DVHA 1AOQA 3WU2V 1HROA 1C2RA 1M6ZA 1CC5A 3PHLA 1M70A 2YCCA 1CRCA 1LC1A 1C75A 1CCRA 3H1KD 2N9JA 1GKSA 3L74D 4P4QB 1CRJA 2FRCA 2BH4X 1N9CA 4FB1A 1H9XA 1QL4A 3O0RC 1K3HA 5CICB 1CIEA 5TJHA 1FI3A 4J20A 4FANA 2GC7D 1IZL0 2AIUA 351CA 2C1VA 3NWVA 2C1UA 4WQDA 5KAIV 1L0ND 1CRIA 1CXAA 2QJYB 3H1JD 4N0KA 2ZOOA 1S5LV 1L9BC 1SQQD 3SJLA 3GG2A 4IL6V 4WQ8A 1KYOW 1HJ5A 1N90A 1KB0A 1K3GA 2BCNB 3CU4A 2B11B 3VRDA 4EIEA 2ZBOA 4Q5PA 1H9YA 1U74B 2BLFB 2EXVA 4AANA 4RSZA 1U75B 1GDVA 3CWBD 1F1FA 5EXQA 1I8PA 3KHUA 1S6VB 4EIDA 4XXLA 3CX5D 3CXHD 1FHBA 3CXHW 3MK7C 5CYTR 1H32B 1F1CA 2Q3EA 4H0JA 2C1DB 3TYIA 2N18C 1HH7A 1AYGA 1OAEA 1CRHA 3C2CA 3NBSA 3SXTA 4FA1A 4GEDB 2N3BA 3M97X 4WQAA 1PPJD 1YEBA 4PWAA 2PCBB 4RJTA 3NBTA 1YICA 1BL9A 1MG3D 2HV4A 2AI5A 1H32A 1DW2A 3HQ6A 1CNOA 3SVWA 2C2CA 2KNCB 1ETPA 1CRGA 1WEJF 2BH5X 1HRCA 3O20A 1CYCA 1KX7A 2ORLA 2FYNB 1LFMA 1W5CT 4O1WA 1I6DA 1AKKA 1C7MA 1CSUA 3ZOYA 3DR0A 1QYZA 3PRJA 4YE1A 2GC4D 1CHJA 3A0BV 3MK7B 2N3YA 3WFEC 5CIDB 1YCCA 2I8FA 2AXTV 4WQ7A 2YQBA 4V2KA 1CEDA 2A06D 1C52A 2JTIB 3A0HV 3L4MA 4L3GA 2RMZA 3H1HD 5CIHB 3RN0A 3ITKA 1DW0A 2BCCD 3RLMA 1DIQC 1EB7A 2YIUB 1NTZD 2O3JA 3VYMA 4WQEA 3FWLA 4AAMA 1SQPD 1JDLA 1CYIA 2ZXYA 5TISV 1CRYA 1EZVD 4AX3A 1E29A 4JCGA 5IY51 1L9JC 4WQ9A 4FAVA 1NTKD 2CE1A 5CIBB 1DVVA 2FWLA 4WQCA 1GIWA 2L91A 2JQRA 1NMIA 2Y0DA 1DW1A 1CTZA 4AALA 3L71D 1C6RA 1IQCA 3TGUD 3CX5W 1DW3A 5GTIV 3H1LD 1BE3D 1FI9A 2GB8B 1FI7A 1NTMD 3PXTA 1YNRA 3ZOOA 1NU1D 3TDKA 1H33B 3HQ7A 4PJ0V 5KAFV 4UB8V 5DJQC 3WFDC 2LIRA 1AOFA 1I55A 1CO6A 5CIFB 1R0QA 3RMZA 3WFBC 1CSXA 3O5CA 4XYDB 1CSWA 4K3IA 4EIFA 1HZUA 1J3SA 3RN1A 2K9JB 2OZ1A 1PP9D 4UB6V 3L4OA 4QAOA 4O1QA 5CIGB 5KKZB 1H33A 2N18B 2D0WA 1N15A 3A9FA 4FA5A 3PLNA 3KZIV 2RN0A 1RAPA 5E79V 1A8CA 1H1OA 3ZCFA 4EICA 155CA 5B6QA 2IBZD 4DY9A 3TF5A 1NNOA 2B0ZB 3O1YA 2KS1A 3SLEA 3PTZA 1YTCA 3OCDA 1KB9D 4PW9B 2QJKB 1RZ6A 1LC2A 3L70D 1QL3A 3PXSA 1GU2A 1QN2A 1ZZHA 1KYOD 2YK3A 1CHIA 1I54A 2MHMA 2V07A 1SQBD 5CIEB 1CSVA 4A7PA 2CA4B 2ZZS1 1IRVA 1FJ0A 2GIWA 2N9IA 1CXCA 3ZBMA 1VYDA 1SQXD 1YIQA 1A56A 1NIRA 2CE0A 2N9YB 4L1QA 1YEAA 3H1ID 1CIFA 1CTJA 2CA3B 1MG2D 3WFCC 3SWSA 1SQVD 5C9MA 1M60A 1RZ5A 3L72D 1C6SA 1DT1A 3PH2B 4MU8A 1CCHA 1YFCA 3BCCD 5GTHV 1KX2A 2XTSB 3OA8B 1H31A 2C9XB 1I8OA 2B4ZA 4D6TD 1COTA 3L75D 4H0KA 5KLVD 2Y0EA 1IO3A 5KLIB 1BGYD 3VMAA 1FOCA 4AAOA 1HCMA 3ZIYA 1DIIC 2ZONG 1CORA 3CYTI 1FCDC 5B5EV 2C8SA 4KMGA 2MTAC 1OCDA 2B10B 3WC8A 1KIBA 3CP5A 3X39A 3GW6A 1WVEC 5DF5A 3DP5A 2Y0CA 1GJQA 2QG4A 3ORVA 2BPBB 1HJ4A 2VHDA 3ZOWA 1I5TA 1IRWA 4WQBA 3JBTB 1BCCD 5C0ZA 4GYDA 2L4DA 1RAQA
chains in the Genus database with same CATH superfamily
2JWAA 4ZMDA 5KAFE 5DFSA 1LMSA 2NPSC 4PD4D 1FZBA 1CIGA 3H1IE 1W2LA 1SQQG 1Y9BA 2KOGA 3AE3C 3CI9A 1E2RA 3GLMA 1HJ3A 1IO4A 1VQNP 4D6TE 1LTAC 2B87A 1H0TA 3WUIA 4BRYB 4EDFA 2C1DA 1S5LH 5M1BA 1KC8Q 2UWJE 4Y5RA 3CWBG 1Q86Q 3ZOXA 4YXWH 4LJIA 1GQ1A 2QIWA 3M9QA 4JYCA 4DT0A 3OA8A 3P32A 3HQ8A 2DVHA 1NTKE 4I1LA 2FBWC 1E8EA 1IJDB 2JP3A 3L73G 3B71A 1CYJA 4I2LC 3D71A 1SQPJ 3KXDA 3L72G 1K73Q 2V7QJ 1J1DC 4FA9A 4XA4A 1OWAA 4NFGB 3JSVC 4JYBA 2NPSD 1HROA 2BEQD 1M6ZA 1QGKB 5B5EH 1VQPP 1IFJA 3PHLA 3AEFC 3SWKA 5DJUB 1NO4A 2WPRA 3HE4A 1AVYA 3L74D 4P4QB 1CRJA 5APWA 2BH4X 3V2QA 1U7MA 5CICB 1JNMA 1VQ4P 3P8MC 2J5UA 1QVGO 4LLHA 1GK4A 1M56D 1JY3P 2D2CB 3WUUA 1NTME 2C1VA 1RQUA 3CXHH 3RGUA 1OW8A 4WQDA 3HTKB 5KAIV 1L0ND 2A45I 3I5CA 1KILA 1QVFO 2BCCG 2ZOOA 1L0NG 1S5LV 2R44A 3SJLA 5L8RJ 4WQ8A 1YI2P 1HJ5A 1S5LX 2XU6A 1H8AA 1H9YA 1U74B 1SFCC 1L0NK 1F1FA 5AW8B 5EXQA 1VF5C 5AW3B 2ZYGA 1NAYA 4PV1B 3BATA 3TK1A 2IBZG 4EIDA 1VQKP 4CPGA 3HD7D 3CX5E 1EZVG 4OGQB 3TNUB 4W80A 2JKVA 3TYIA 2R32A 3NFQA 2N18C 1HH7A 2PFXA 1OAEA 2W27A 5AVWB 3IN6A 1JB0J 3SXTA 2QJKC 4YPCA 2P7JA 4Z1MH 1N86A 1PPJD 1S4XA 1T8ZA 1YEBA 4PWAA 5CCHC 3SWYA 1KMIZ 2KXPB 2FXOA 2JWDA 5B66E 3KZIE 1OX3A 1MG3D 3V5BA 1SQVJ 3HE5A 5E79E 3HTKA 1CNOA 2KNCB 5APXA 5GTIH 2OYIA 2P67A 4C7RA 2FYNB 3AE1C 3A0BH 4U3FJ 3RL0D 1SFCD 2G3AA 1MKMA 2Z5HA 1C7MA 3LW5H 1QYZA 2CK3H 3V2NA 1PP9G 2FKWB 1CHJA 3A0BV 3A0HH 5CBNA 3H1LE 4IL6H 2M8RA 1BE3J 1AVOA 2C9NY 3MUDA 2JTIB 1NWQA 3L4MA 4L3GA 2KP8A 4L76A 4YXDC 1QL2A 2RMZA 3MUDC 3LIEA 1L4AC 1L0NJ 1LTIC 2M5AA 1YYCA 3CC2P 1DW0A 5GTHE 2P10A 1SQPE 2HODB 1NTZD 1YQ4C 1GL2A 1NU1J 1NTZG 1AFOA 1SQXE 1CRYA 1PGPA 4KT0J 3RL0C 3RK3D 1BE3E 3O8ZA 4WQ9A 2KZIA 1XTGB 3GHGC 1JOCA 4WQCA 2AXTE 2FYZA 1T3JA 2L91A 2WSSH 3KZIH 1DW1A 4D6TJ 1SQVK 4H44D 1DW3A 4EIJA 2WSFJ 3L70J 1N7SA 3RBZA 1JTHA 4JPZB 1FBMA 4UB6H 4D6TG 1LTJB 2D2CD 5GTHH 4GODA 5CJ0A 3WFDC 1PIXA 1X9VA 1S2EA 1N8RQ 4TT3H 2WPVB 1GMJA 3L36A 3G4SP 1G1IA 1HZUA 1PV3A 1T2KC 1LWUA 3CCUP 2OZ1A 1IZNB 2AXTH 2M5AB 2ZXEB 3L4OA 4QAOA 4O1QA 2WPSA 2D0WA 3OA7A 3R4YA 2K1AA 3L73J 3PP5A 4C7NB 1YJ9P 1H1OA 3ZCFA 155CA 1BGYJ 4XFJA 1NNOA 5CBOA 5APQA 2K9YA 3Q3DA 3PTZA 1YTCA 4PV1D 1FZEA 1RZ6A 1LC2A 1YTZI 1PGJA 1VQ8P 3Q2YA 3PXSA 5APTA 1YJWP 1KYOI 5BU8B 2H7HA 1GD2E 3H32B 1CSVA 2LXBA 2ZZS1 2N9IA 1U57A 1JY2N 3IF4A 1J1EC 3A0HE 2CE0A 1SLQA 2HG5D 4C46A 5APVA 1MG2D 2JJLA 3SWSA 1OMIA 1SQVD 1VQ5P 1NU1G 1MUUA 3L72D 1C6SA 2NPSB 3PH2B 2XKMA 2I1JA 4PJ0H 3L75G 1FJKA 5KAIE 2N1TD 3L4FA 1NTMG 2WPQA 4RKUJ 2A45H 1IO3A 1RY3A 4RESB 1GW4A 4GDOA 2ZONG 5AVVB 2GUSA 3V4QA 1CORA 1FCDC 4KMGA 4Y99B 4MN4C 2KLUA 3CCRP 4ASWA 3CLQA 1KIBA 1URQC 3H25A 4ZNCA 1JTHB 1WVEC 2Y0CA 4ZKPA 5CCGA 2FYUK 4KJMA 2BPBB 5APYA 3ZOWA 4R4MA 3WMM0 1BCCD 4H13B 2MKVA 2ZT9D 1RAQA 4WBAA 3RK2C 1NU1E 1QX8A 2D0SA 1JMMA 3AE2C 451CA 1CIHA 1FZFA 3RK3B 2LITA 3L70G 3VMXA 3CCSP 2HPCB 5B66V 2BGVX 1QKSA 5AURA 1LNQA 1SQBG 1M57D 2Z5IA 1LS9A 4U3FD 3M06A 2Y9ZA 1WMKA 1B7VA 3EFGA 1M90Q 1LGHB 5BU5A 1EZVE 1H0TB 2K88A 3HQ9A 1W5CE 2Q6QA 1ZR4A 1MZ4A 2L4DA 1X8YA 2YO2A 1NAFA 1JY2O 2I8DA 3SWFA 1M1JC 2KI7B 1AOQA 3WU2V 1C2RA 3TYYA 5AVQB 1CC5A 5CJ4A 1ZOYC 2E75C 1M70A 2IBZE 1BGYG 3V2RA 1WRGA 1CCRA 5AVTB 2FRCA 2Q9IA 2R3SA 2WSCJ 1H9XA 1ZLLA 1ZP0C 3O0RC 1CIEA 1EDIA 1FI3A 1YITP 2IZ0A 3CWBJ 3KDPB 1S9KE 1UIIA 1KB9I 1H89A 1SQPK 1IFDA 1RF1A 2OYIC 1SQQD 1KYOW 1JY3N 1KB0A 2RH0A 2K9JA 2BCNB 3FXEA 3VRDA 2O1KA 3TNUA 1USEA 4H0LB 1KILE 3TGUE 3CWBD 3M0DA 4K3AA 4TLFA 1KILB 5KLVJ 1M1JA 1GZLA 1S6VB 2OQQA 1EC5A 3CXHD 2E76B 3CXHW 2LR2A 5CYTR 5AVZB 1K04A 1F1CA 4H13C 1NTZJ 5TISH 5AW5B 2FFDA 1EZVI 2WZ7A 5DJTB 2XZRA 3C2CA 5EFWB 4GEDB 2QVAA 3M97X 1SQXJ 1S72P 2A45G 1HUCA 3NBTA 1YICA 1NTKK 2E74B 3BASA 5CCGD 3HQ6A 2ZFCA 3SVWA 1JY3O 1CRGA 1RF1B 3E1RA 3C1LA 1CYCA 1KX7A 3O6QA 4JQ0D 1TU3F 1LFMA 1GL2D 4O1WA 1VF5D 3D0WA 1KORA 1CSUA 1EXIA 3DR0A 1LT9C 1MFZA 1IK9A 3PRJA 2OARA 3MGNA 2QJPC 2Q1KA 4LC1A 3MK7B 2KZJA 2N3YA 3WFEC 1NYHA 1YCCA 2NZ2A 2HODA 1SQBK 4WQ7A 3FX0A 2YQBA 1C52A 4YTPC 2IX7C 3H1HD 2XDJA 3SFDC 2ITAA 2BCCJ 2CPSA 1BCCJ 5CCHD 3ITKA 1M1KQ 3NTNA 5CCGC 1N7SD 3H1HJ 3GHGA 1QLED 2WITA 3FWLA 1ZN5A 1JDLA 4EYYQ 5TISV 3M9BA 1OXZA 1GL2C 2AEMA 4JCGA 1L9JC 1RF0C 2BEZF 1RF0A 3AE4C 2PAJA 5KLVG 2Y0DA 3V6IA 1DEBA 3GF3A 1C6RA 4N6JA 1AV1A 1RE4C 3CX5W 4L73A 1BE3D 3PJSK 2GB8B 1NTMD 2R5BA 1PGQA 3ZOOA 3AE7C 2FYUE 1N2DC 4NPEA 2WMMA 2N1TB 2LIRA 1HGVA 3L75J 1KILC 1R0QA 4BWNA 1E5WA 2K37A 1NU1K 4XYDB 1CSWA 3VYIA 2OTJP 3RN1A 4IFFA 4WY4D 1AQ5A 2K9JB 1PP9D 1L0LJ 4UB6V 5CIGB 1IC2A 1FE6A 1H33A 1N15A 1Y47A 2E43A 5AW4B 3HUSB 3PLNA 1X79B 3B5ND 2KIKA 4H0LD 3WUVA 4OGQD 1RAPA 5E79V 2V7QH 1KQLA 4AQRD 1GDTA 5B6QA 4GKGA 4DY9A 1N73B 3EWKA 3O1YA 2KS1A 3B5NA 1BGYE 2Y9YA 2ZT9B 1UIXA 3OCDA 1FOSE 3L70D 1DX7A 1QN2A 3HRNA 3U59A 2D2CC 2ZVNB 2FYUG 3WU2E 3BRTB 1I54A 2MHMA 2W8ZA 2IFNA 1S3JA 1IRVA 1FDMA 3UIAA 1CXCA 3ZBMA 4U3FG 3OW2O 3AE6C 1SVFA 4L1QA 1J2JB 4W7ZA 2B87B 3H1ID 3HD7A 2CA3B 3AECC 4IFMA 5C9MA 3L71G 1DT1A 1IK7A 1PP9J 1OW7A 3BCCD 2KB7P 3V4WA 3A2AA 3Q1MA 3L70E 4DOJA 2IDBA 3SSUA 1I8OA 4D6TD 3FXDA 2Y0EA 2MJZA 1BGYD 3JC22 4IL6E 3TGUG 1IFPA 1SQVG 2OTLP 3CYTI 5APUA 1NTMJ 1KB9H 5B5EV 1BSNA 5BVZA 1VQMP 3F89A 1OCDA 3L72J 3M91A 2C9LY 2B10B 5AW1B 3N4XA 3GW6A 3KPEA 3DP5A 1MZ9A 4QMAA 2ZVOB 1CW5A 2OGUA 1Q7YQ 2VHDA 2E5YA 3AE9C 2QA4P 3B4SA 4N78E 4GYDA 4H44B 2P58A 1Z56A 1C6OA 1OIPA 4GT1A 2JO1A 3WU2H 2FYNC 1RE3A 2OYOA 2N1TC 1KTMA 2E74C 3L74E 1CTYA 1I6EA 4UB6E 4HKZH 3D70A 2YKQA 3W67A 1RF1C 3AEGC 1K05A 3FGAD 1Q82Q 1ZRTE 2RKLA 2WT7B 2E75B 3L73D 2E5TA 1OVUA 5C39A 2OYHA 1BDCA 1BDDA 2P2UA 1LT9B 3OCDB 3MP7B 2PACA 1CHHA 3VNWA 2B12B 1N50A 2QJPB 2FYUJ 1NTZE 2OYIB 3G71P 1VQ6P 3VN0A 1L0LD 1P84D 3LW5J 4O9BA 2O01J 1L0LG 1HF9A 1JMBA 1GK6A 1RH5B 3CX5I 3L71J 2CXBA 1ZV8A 1C2NA 3TSIA 3CCJP 3D6YA 4EOTA 1PP9E 3P8CE 4DJGA 1EDJA 1CRCA 1ZMEC 5KJ7D 1SQQJ 1VF5B 5KJ7A 4IL6X 1C75A 2J59M 5H2FH 1L4AA 1GKSA 4HH2A 3H1KJ 1N9CA 3RL0g 4FB1A 2KS1B 3B5NB 1X22A 1HBWA 1NVOA 1K9MQ 2W83C 4GOFA 1EXJA 4FANA 3QWOC 351CA 3G9RA 1FJPA 3OJAB 2C1UA 1VQ9P 1Q81Q 3HE5B 3A3YB 1JUNA 2M3EA 2JDIH 1CRIA 4NPFX 1YIJP 1CXAA 3CC4P 3PH0A 4AUWA 1L9BC 3GG2A 4IL6V 1D7MA 2KSEA 4ASVA 1HGZA 2ZBOA 2BLFB 4AANA 4RSZA 2A06G 4WWIA 1GDVA 1FZGA 3KQGA 1I8PA 5AVUB 4ZKUA 1YTZT 1N7SB 4PJ0E 1SQPG 1FHBA 2KYVA 2PP6A 2QJYC 1FZAA 1LTJA 4WVZA 1Q2NA 3BCCE 4H0JA 5AW7B 2C1DB 3L72E 1CRHA 1VQOP 1DIPA 4U7JA 1PL5A 4WQAA 2Z4EA 3AE5C 4DCKA 4H13D 1BL9A 2OYHB 2HV4A 2AI5A 1H32A 2H43A 3VMZA 1KQGB 1ETPA 3O20A 3WUTA 2QEXP 2ORLA 4N3YB 1W5CT 1A02J 2XV5A 1I6DA 1AKKA 1ZW0A 3ZOYA 1QEXA 2V4HA 2O1JA 1JCCA 3H1HG 3FWNA 1DH3A 4JF7A 4YE1A 2IYPA 1FDOA 1LJ2A 1L4AD 5CIDB 2Q7CA 2R3CA 2C0WA 2GM4A 1U7JA 3RL0B 2AXTV 2KSJA 2O01N 4V2KA 1CEDA 3HE4B 3H32A 3A0HV 2P1JA 1SQXK 2QRXA 3Q5SA 3H1IJ 3MZWB 1LTJC 5CIHB 1H88A 3RN0A 1DEEG 3U1CA 2BCCD 5K5GB 2WTYA 3RLMA 1DIQC 1URQB 2QSIA 2WVRA 2YMYA 3VYMA 4WQEA 4AAMA 1CYIA 2ZXYA 1E29A 1QL1A 4H44C 2AEFA 1HJ0A 1NTKD 3RK2B 3HUSC 3USSA 4U3FE 1VL2A 1DVVA 2FWLA 2N1TA 1GIWA 4Y28J 1L4AB 1SQBJ 2IPPA 4AALA 2IYOA 1FZCA 3EFFK 3H1LG 3L71D 1YQ3C 1KD1Q 1NH4A 3RK3C 1OW6A 4WY4A 5GTIV 3H1LD 3IFMA 1FI9A 2SPZA 1VPCA 3PXTA 4HB1A 3TDKA 1H33B 3HQ7A 1LT1A 4HYTB 2N9BA 4PJ0V 4UB8V 1LP1A 1G1JA 3SFEC 2O01H 3RMZA 3WFBC 1N7SC 1N73A 4B86A 4EIFA 2IBZI 1LTBC 4L74A 1FS0E 1SFCB 2R5DA 3AEBC 5KKZB 4FA5A 3CC7P 5AVYB 4PV1C 3P7KA 2KNCA 4K35A 3GMAA 2RN0A 1T2KD 3CD6P 2BASA 1J1EB 4EICA 2L5GB 2IBZD 2B0ZB 4GOEA 3H1JG 3SLEA 1HJBA 2IZ1A 4PW9B 1FC2C 2QM7A 5CMZA 3L71E 2POHA 1GU2A 1ZZHA 1FAVA 3EQ2A 1CHIA 3A5TA 1USDA 2V07A 3C9IA 1NJIQ 2YXQB 3BCCG 5CIEB 3B8EB 3CWBE 2YMKA 5AVRB 4A7PA 2CA4B 1PPJG 3C8VA 1FJ0A 5AW0B 3MHVA 2NRGA 1PPJE 3Q5RA 2ZYDA 1NIRA 1GW3A 2N9YB 1DD3A 1CIFA 1CTJA 1SQQE 4M3LA 3BRVB 1NHLA 1CCHA 5GTHV 1HWTC 1LWUB 2XTSB 2HYNA 1H31A 2C9XB 1SFCA 1VQLP 2B4ZA 1COTA 2PGDA 3L75D 1E79H 4H0KA 1FOCA 3ZIYA 1FU1A 2FY8A 3HD7B 2BCCE 3CXHI 3S9OA 1GU5A 1JEKA 2MTAC 2ZJSE 1WT6A 3WC8A 3CP5A 1T6AA 2YKPA 5DF5A 1GJQA 2J58A 3CMEP 3ZDMA 2QG4A 3ORVA 1NOHA 3H6PA 1HJ4A 1RE3C 4WQBA 3JBTB 3IR9A 3E1IA 1A02F 1M1JB 3DMIA 1SQVE 3II6A 1NMLA 5AW9B 2FYUD 1A2SA 3Q5PA 1W2EA 3M0AA 1LT9A 2DGEA 2OZ1B 3M9HA 4I7ZC 4Y99C 5DJQB 3PXWA 1HVVA 4L3HA 1SQXG 1ZRTD 5B5EE 3RK2D 1FZCC 2FXPA 2KUBA 2V08A 3L37A 3AEDC 1KYOE 1EQ7A 4C7NA 4WY4B 2WSEJ 1H31B 1T3UA 3QH9A 2GA1A 4FA4A 5APSA 3RK3E 3L35A 2JR8A 1MFTA 1LP1B 2AXCA 2OTKE 1P84I 3CPWO 2E75D 1NKZB 5H2FV 1XTCC 3L74G 1BCCE 3CCMP 1Y8AA 1HZVA 3RBXA 1KV9A 2YNYA 2YKOA 3K5BA 2WT7A 5AVXB 2PCCB 2B88A 3IAOA 1R5SA 3H1HE 1DVHA 4GIFA 3NMDA 2G8YA 3H1JE 2YCCA 3T97B 1AJYA 1LC1A 4DZOA 1ZXGA 5KAIH 4EI2A 1KZUB 1L0NE 3H1KD 2ZYAA 1JO5A 2N9JA 2YIUC 2NPSA 3U1AA 1QL4A 1K3HA 5TJHA 4OWFA 4J20A 3KYQA 3GF7A 5KJ7C 2GC7D 1IZL0 2AIUA 2Q3IA 3NWVA 1L2PA 1LTGC 2E76C 4NPDA 1YBKA 2QJYB 1RHZB 3AE8C 3ABVC 3H1JD 4N0KA 3CCEP 2HR3A 1AA0A 1N90A 2OYHC 1K3GA 3VTPC 3CU4A 2B11B 4EIEA 3M0DC 4Q5PA 3HD7C 2EXVA 2XNDH 3VP9A 1NGMB 1U75B 1IFIA 1SQBE 2LKMA 1VQ7P 3KHUA 2JEEA 4KHXA 3MTUE 5KLIC 2H8PD 2XNXA 2FFDC 4XXLA 3CX5D 1OVRA 3L73E 3MK7C 3E7KA 4JBZA 1KB9E 5AVSB 3BCCJ 1H32B 4I6MC 3T97A 5CCHA 2Q3EA 1BE3G 1N73C 1CI6B 1R8EA 1P84E 1AYGA 1L0LE 3N7NA 2HPCA 3NBSA 4FA1A 2E76D 1NTKG 2N3BA 2YO3A 1OZHA 2PCBB 1DD4A 4W7YA 3CCLP 4RJTA 1KFMA 1M7LA 4L75A 3D6ZA 3H1JJ 1DW2A 3H1IG 3JCUE 2C2CA 5AW6B 1OVVA 2KK7A 3S4RA 1WEJF 2BH5X 1HRCA 2A06E 1L0LK 3I55P 3VOPA 1HH0A 2B9BA 3MIWA 2WWWA 3H1KG 1ZR2A 2GC4D 4LGDE 4AYCA 1GTWA 4HJGH 2I8FA 1GL2B 2A06D 2KLVA 1S1CX 1KYOH 3CCQP 1X0TA 2B89A 2WSFH 1OFCX 3CXHE 1FOSF 1P84H 2Q5UA 1SQQK 3I56P 3HUSA 1EB7A 2YIUB 3CX5H 3AEAC 2LXCB 2O3JA 2IFMA 2WQYC 1SQPD 1KQFB 1EZVD 4AX3A 3TGUJ 3A0BE 5IY51 4FAVA 3JCUH 1KQSO 2CE1A 3F5HA 5CIBB 4UB8H 2HFED 2JQRA 1IFNA 1NMIA 1G2CA 1CTZA 1URQA 2ZAEB 1IQCA 3TGUD 1KILD 5KKZC 2WSCH 1FI7A 1YHQP 4RO0A 1IFMA 1M8OB 1YNRA 1NTMK 1NU1D 4WY4C 2W90A 4OVNF 1W2BO 4I7ZB 5KAFV 1KN7A 5DJQC 4N78D 1GU4A 3G6EP 1CI6A 2W6BA 1AOFA 1I55A 1CO6A 5CIFB 1NTKJ 3AEEC 3R2PA 1FZCB 1CSXA 3H1KE 2FFDB 3O5CA 4K3IA 4H0LC 1KFNA 1J3SA 4OGQC 4BXLA 1S9KD 4XE5B 5KTBA 5E79H 1LTSC 2N18B 1NKNA 3A9FA 2DW3A 3GHGB 1JM0A 3KZIV 3MD0A 1LWUC 1BCCG 1J1DB 3VP8A 3O6QB 2K3RA 1A8CA 2ZXXA 5KLVE 2M0BA 2YXRB 3TF5A 1N7LA 1SP4A 1AQTA 4PD4H 5H2FE 2E42A 1KB9D 1KV4A 1JY2P 2HLOA 4UB8E 2QJKB 3B5NC 1FDIA 3H1LJ 4WB4A 1YJNP 1QL3A 1K8AQ 1G2CB 1BSHA 3CMAP 1KYOD 2YK3A 1EDLA 1SQBD 3V2PA 2QM8A 2GIWA 3OAKA 1VYDA 1SQXD 2FXMA 1YIQA 1A56A 1YEAA 2W6JH 4BRYA 3WFCC 2ZT9C 3S1KA 5CHXA 1M60A 1RZ5A 3W68A 2I1KA 2QE7H 4MU8A 1YFCA 1RQVA 2VRSA 5AW2B 1KX2A 5KAFH 3L74J 3NXSA 3OA8B 2W6AA 2AEJA 1CZQA 1Q90D 1SS1A 2H88C 4OH8B 3CL3D 5KLVD 2CPBA 3LIDA 5KLIB 3VMAA 1MV8A 1URQD 4IOIH 5TISE 1CSBA 1S5LE 4PD4E 4AAOA 1HCMA 1DIIC 1VDFA 1PGOA 2PRRA 5B66H 1LTTC 4IFDK 3CCVP 3BVHA 2C8SA 2WSEH 1R5LA 5KLVK 2GUVA 2M3BA 1HTLC 1JCDA 4PD4I 3VMYA 1PZQA 3P8CD 3X39A 3L75E 2H89C 1EDKA 1PFIA 1RE4A 2C0XA 5GTIE 1NTZK 1I5TA 1IRWA 4R4LA 2E74D 5C0ZA 3G3ZA 3A7OA
chains in the Genus database with same CATH topology
2JWAA 3DMIA 5DFSA 1LMSA 1NMLA 4PD4D 1CIGA 1C6OA 1W2LA 2FYUD 1A2SA 2D0SA 1E2RA 2DGEA 2OZ1B 1HJ3A 5DJQB 3WUIA 451CA 1CIHA 4EDFA 2C1DA 3PXWA 4L3HA 2LITA 4Y5RA 1CTYA 1ZRTD 1I6EA 2V08A 5B66V 2BGVX 3ZOXA 1QKSA 4LJIA 5AURA 1GQ1A 3OA8A 3HQ8A 1H31B 2DVHA 1LS9A 3L73D 4U3FD 4FA4A 1B7VA 3OCDB 1E8EA 2PACA 1CHHA 1CYJA 2B12B 3VNWA 1N50A 2QJPB 3HQ9A 1L0LD 4FA9A 1P84D 5H2FV 1MZ4A 4NFGB 1HZVA 1KV9A 2CXBA 2PCCB 1C2NA 1DVHA 1AOQA 3WU2V 1HROA 1C2RA 1M6ZA 1CC5A 3PHLA 1M70A 2YCCA 1CRCA 1LC1A 1C75A 1CCRA 3H1KD 2N9JA 1GKSA 3L74D 4P4QB 1CRJA 2FRCA 2BH4X 1N9CA 4FB1A 1H9XA 1QL4A 3O0RC 1K3HA 5CICB 1CIEA 5TJHA 1FI3A 4J20A 4FANA 2GC7D 1IZL0 2AIUA 351CA 2C1VA 3NWVA 2C1UA 4WQDA 5KAIV 1L0ND 1CRIA 1CXAA 2QJYB 3H1JD 4N0KA 2ZOOA 1S5LV 1L9BC 1SQQD 3SJLA 3GG2A 4IL6V 4WQ8A 1KYOW 1HJ5A 1N90A 1KB0A 1K3GA 2BCNB 3CU4A 2B11B 3VRDA 4EIEA 2ZBOA 4Q5PA 1H9YA 1U74B 2BLFB 2EXVA 4AANA 4RSZA 1U75B 1GDVA 3CWBD 1F1FA 5EXQA 1I8PA 3KHUA 1S6VB 4EIDA 4XXLA 3CX5D 3CXHD 1FHBA 3CXHW 3MK7C 5CYTR 1H32B 1F1CA 2Q3EA 4H0JA 2C1DB 3TYIA 2N18C 1HH7A 1AYGA 1OAEA 1CRHA 3C2CA 3NBSA 3SXTA 4FA1A 4GEDB 2N3BA 3M97X 4WQAA 1PPJD 1YEBA 4PWAA 2PCBB 4RJTA 3NBTA 1YICA 1BL9A 1MG3D 2HV4A 2AI5A 1H32A 1DW2A 3HQ6A 1CNOA 3SVWA 2C2CA 2KNCB 1ETPA 1CRGA 1WEJF 2BH5X 1HRCA 3O20A 1CYCA 1KX7A 2ORLA 2FYNB 1LFMA 1W5CT 4O1WA 1I6DA 1AKKA 1C7MA 1CSUA 3ZOYA 3DR0A 1QYZA 3PRJA 4YE1A 2GC4D 1CHJA 3A0BV 3MK7B 2N3YA 3WFEC 5CIDB 1YCCA 2I8FA 2AXTV 4WQ7A 2YQBA 4V2KA 1CEDA 2A06D 1C52A 2JTIB 3A0HV 3L4MA 4L3GA 2RMZA 3H1HD 5CIHB 3RN0A 3ITKA 1DW0A 2BCCD 3RLMA 1DIQC 1EB7A 2YIUB 1NTZD 2O3JA 3VYMA 4WQEA 3FWLA 4AAMA 1SQPD 1JDLA 1CYIA 2ZXYA 5TISV 1CRYA 1EZVD 4AX3A 1E29A 4JCGA 5IY51 1L9JC 4WQ9A 4FAVA 1NTKD 2CE1A 5CIBB 1DVVA 2FWLA 4WQCA 1GIWA 2L91A 2JQRA 1NMIA 2Y0DA 1DW1A 1CTZA 4AALA 3L71D 1C6RA 1IQCA 3TGUD 3CX5W 1DW3A 5GTIV 3H1LD 1BE3D 1FI9A 2GB8B 1FI7A 1NTMD 3PXTA 1YNRA 3ZOOA 1NU1D 3TDKA 1H33B 3HQ7A 4PJ0V 5KAFV 4UB8V 5DJQC 3WFDC 2LIRA 1AOFA 1I55A 1CO6A 5CIFB 1R0QA 3RMZA 3WFBC 1CSXA 3O5CA 4XYDB 1CSWA 4K3IA 4EIFA 1HZUA 1J3SA 3RN1A 2K9JB 2OZ1A 1PP9D 4UB6V 3L4OA 4QAOA 4O1QA 5CIGB 5KKZB 1H33A 2N18B 2D0WA 1N15A 3A9FA 4FA5A 3PLNA 3KZIV 2RN0A 1RAPA 5E79V 1A8CA 1H1OA 3ZCFA 4EICA 155CA 5B6QA 2IBZD 4DY9A 3TF5A 1NNOA 2B0ZB 3O1YA 2KS1A 3SLEA 3PTZA 1YTCA 3OCDA 1KB9D 4PW9B 2QJKB 1RZ6A 1LC2A 3L70D 1QL3A 3PXSA 1GU2A 1QN2A 1ZZHA 1KYOD 2YK3A 1CHIA 1I54A 2MHMA 2V07A 1SQBD 5CIEB 1CSVA 4A7PA 2CA4B 2ZZS1 1IRVA 1FJ0A 2GIWA 2N9IA 1CXCA 3ZBMA 1VYDA 1SQXD 1YIQA 1A56A 1NIRA 2CE0A 2N9YB 4L1QA 1YEAA 3H1ID 1CIFA 1CTJA 2CA3B 1MG2D 3WFCC 3SWSA 1SQVD 5C9MA 1M60A 1RZ5A 3L72D 1C6SA 1DT1A 3PH2B 4MU8A 1CCHA 1YFCA 3BCCD 5GTHV 1KX2A 2XTSB 3OA8B 1H31A 2C9XB 1I8OA 2B4ZA 4D6TD 1COTA 3L75D 4H0KA 5KLVD 2Y0EA 1IO3A 5KLIB 1BGYD 3VMAA 1FOCA 4AAOA 1HCMA 3ZIYA 1DIIC 2ZONG 1CORA 3CYTI 1FCDC 5B5EV 2C8SA 4KMGA 2MTAC 1OCDA 2B10B 3WC8A 1KIBA 3CP5A 3X39A 3GW6A 1WVEC 5DF5A 3DP5A 2Y0CA 1GJQA 2QG4A 3ORVA 2BPBB 1HJ4A 2VHDA 3ZOWA 1I5TA 1IRWA 4WQBA 3JBTB 1BCCD 5C0ZA 4GYDA 2L4DA 1RAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWA A;  3DMI A;  5DFS A;  1LMS A;  1NML A;  4PD4 D;  1CIG A;  1C6O A;  1W2L A;  2FYU D;  1A2S A;  2D0S A;  1E2R A;  2DGE A;  2OZ1 B;  1HJ3 A;  5DJQ B;  3WUI A;  451C A;  1CIH A;  4EDF A;  2C1D A;  3PXW A;  4L3H A;  2LIT A;  4Y5R A;  1CTY A;  1ZRT D;  1I6E A;  2V08 A;  5B66 V;  2BGV X;  3ZOX A;  1QKS A;  4LJI A;  5AUR A;  1GQ1 A;  3OA8 A;  3HQ8 A;  1H31 B;  2DVH A;  1LS9 A;  3L73 D;  4U3F D;  4FA4 A;  1B7V A;  3OCD B;  1E8E A;  2PAC A;  1CHH A;  1CYJ A;  2B12 B;  3VNW A;  1N50 A;  2QJP B;  3HQ9 A;  1L0L D;  4FA9 A;  1P84 D;  5H2F V;  1MZ4 A;  4NFG B;  1HZV A;  1KV9 A;  2CXB A;  2PCC B;  1C2N A;  1DVH A;  1AOQ A;  3WU2 V;  1HRO A;  1C2R A;  1M6Z A;  1CC5 A;  3PHL A;  1M70 A;  2YCC A;  1CRC A;  1LC1 A;  1C75 A;  1CCR A;  3H1K D;  2N9J A;  1GKS A;  3L74 D;  4P4Q B;  1CRJ A;  2FRC A;  2BH4 X;  1N9C A;  4FB1 A;  1H9X A;  1QL4 A;  3O0R C;  1K3H A;  5CIC B;  1CIE A;  5TJH A;  1FI3 A;  4J20 A;  4FAN A;  2GC7 D;  1IZL 0;  2AIU A;  351C A;  2C1V A;  3NWV A;  2C1U A;  4WQD A;  5KAI V;  1L0N D;  1CRI A;  1CXA A;  2QJY B;  3H1J D;  4N0K A;  2ZOO A;  1S5L V;  1L9B C;  1SQQ D;  3SJL A;  3GG2 A;  4IL6 V;  4WQ8 A;  1KYO W;  1HJ5 A;  1N90 A;  1KB0 A;  1K3G A;  2BCN B;  3CU4 A;  2B11 B;  3VRD A;  4EIE A;  2ZBO A;  4Q5P A;  1H9Y A;  1U74 B;  2BLF B;  2EXV A;  4AAN A;  4RSZ A;  1U75 B;  1GDV A;  3CWB D;  1F1F A;  5EXQ A;  1I8P A;  3KHU A;  1S6V B;  4EID A;  4XXL A;  3CX5 D;  3CXH D;  1FHB A;  3CXH W;  3MK7 C;  5CYT R;  1H32 B;  1F1C A;  2Q3E A;  4H0J A;  2C1D B;  3TYI A;  2N18 C;  1HH7 A;  1AYG A;  1OAE A;  1CRH A;  3C2C A;  3NBS A;  3SXT A;  4FA1 A;  4GED B;  2N3B A;  3M97 X;  4WQA A;  1PPJ D;  1YEB A;  4PWA A;  2PCB B;  4RJT A;  3NBT A;  1YIC A;  1BL9 A;  1MG3 D;  2HV4 A;  2AI5 A;  1H32 A;  1DW2 A;  3HQ6 A;  1CNO A;  3SVW A;  2C2C A;  2KNC B;  1ETP A;  1CRG A;  1WEJ F;  2BH5 X;  1HRC A;  3O20 A;  1CYC A;  1KX7 A;  2ORL A;  2FYN B;  1LFM A;  1W5C T;  4O1W A;  1I6D A;  1AKK A;  1C7M A;  1CSU A;  3ZOY A;  3DR0 A;  1QYZ A;  3PRJ A;  4YE1 A;  2GC4 D;  1CHJ A;  3A0B V;  3MK7 B;  2N3Y A;  3WFE C;  5CID B;  1YCC A;  2I8F A;  2AXT V;  4WQ7 A;  2YQB A;  4V2K A;  1CED A;  2A06 D;  1C52 A;  2JTI B;  3A0H V;  3L4M A;  4L3G A;  2RMZ A;  3H1H D;  5CIH B;  3RN0 A;  3ITK A;  1DW0 A;  2BCC D;  3RLM A;  1DIQ C;  1EB7 A;  2YIU B;  1NTZ D;  2O3J A;  3VYM A;  4WQE A;  3FWL A;  4AAM A;  1SQP D;  1JDL A;  1CYI A;  2ZXY A;  5TIS V;  1CRY A;  1EZV D;  4AX3 A;  1E29 A;  4JCG A;  5IY5 1;  1L9J C;  4WQ9 A;  4FAV A;  1NTK D;  2CE1 A;  5CIB B;  1DVV A;  2FWL A;  4WQC A;  1GIW A;  2L91 A;  2JQR A;  1NMI A;  2Y0D A;  1DW1 A;  1CTZ A;  4AAL A;  3L71 D;  1C6R A;  1IQC A;  3TGU D;  3CX5 W;  1DW3 A;  5GTI V;  3H1L D;  1BE3 D;  1FI9 A;  2GB8 B;  1FI7 A;  1NTM D;  3PXT A;  1YNR A;  3ZOO A;  1NU1 D;  3TDK A;  1H33 B;  3HQ7 A;  4PJ0 V;  5KAF V;  4UB8 V;  5DJQ C;  3WFD C;  2LIR A;  1AOF A;  1I55 A;  1CO6 A;  5CIF B;  1R0Q A;  3RMZ A;  3WFB C;  1CSX A;  3O5C A;  4XYD B;  1CSW A;  4K3I A;  4EIF A;  1HZU A;  1J3S A;  3RN1 A;  2K9J B;  2OZ1 A;  1PP9 D;  4UB6 V;  3L4O A;  4QAO A;  4O1Q A;  5CIG B;  5KKZ B;  1H33 A;  2N18 B;  2D0W A;  1N15 A;  3A9F A;  4FA5 A;  3PLN A;  3KZI V;  2RN0 A;  1RAP A;  5E79 V;  1A8C A;  1H1O A;  3ZCF A;  4EIC A;  155C A;  5B6Q A;  2IBZ D;  4DY9 A;  3TF5 A;  1NNO A;  2B0Z B;  3O1Y A;  2KS1 A;  3SLE A;  3PTZ A;  1YTC A;  3OCD A;  1KB9 D;  4PW9 B;  2QJK B;  1RZ6 A;  1LC2 A;  3L70 D;  1QL3 A;  3PXS A;  1GU2 A;  1QN2 A;  1ZZH A;  1KYO D;  2YK3 A;  1CHI A;  1I54 A;  2MHM A;  2V07 A;  1SQB D;  5CIE B;  1CSV A;  4A7P A;  2CA4 B;  2ZZS 1;  1IRV A;  1FJ0 A;  2GIW A;  2N9I A;  1CXC A;  3ZBM A;  1VYD A;  1SQX D;  1YIQ A;  1A56 A;  1NIR A;  2CE0 A;  2N9Y B;  4L1Q A;  1YEA A;  3H1I D;  1CIF A;  1CTJ A;  2CA3 B;  1MG2 D;  3WFC C;  3SWS A;  1SQV D;  5C9M A;  1M60 A;  1RZ5 A;  3L72 D;  1C6S A;  1DT1 A;  3PH2 B;  4MU8 A;  1CCH A;  1YFC A;  3BCC D;  5GTH V;  1KX2 A;  2XTS B;  3OA8 B;  1H31 A;  2C9X B;  1I8O A;  2B4Z A;  4D6T D;  1COT A;  3L75 D;  4H0K A;  5KLV D;  2Y0E A;  1IO3 A;  5KLI B;  1BGY D;  3VMA A;  1FOC A;  4AAO A;  1HCM A;  3ZIY A;  1DII C;  2ZON G;  1COR A;  3CYT I;  1FCD C;  5B5E V;  2C8S A;  4KMG A;  2MTA C;  1OCD A;  2B10 B;  3WC8 A;  1KIB A;  3CP5 A;  3X39 A;  3GW6 A;  1WVE C;  5DF5 A;  3DP5 A;  2Y0C A;  1GJQ A;  2QG4 A;  3ORV A;  2BPB B;  1HJ4 A;  2VHD A;  3ZOW A;  1I5T A;  1IRW A;  4WQB A;  3JBT B;  1BCC D;  5C0Z A;  4GYD A;  2L4D A;  1RAQ A; 
#chains in the Genus database with same CATH topology
 2JWA A;  4ZMD A;  5KAF E;  5DFS A;  1LMS A;  2NPS C;  4PD4 D;  1FZB A;  1CIG A;  3H1I E;  1W2L A;  1SQQ G;  1Y9B A;  2KOG A;  3AE3 C;  3CI9 A;  1E2R A;  3GLM A;  1HJ3 A;  1IO4 A;  1VQN P;  4D6T E;  1LTA C;  2B87 A;  1H0T A;  3WUI A;  4BRY B;  4EDF A;  2C1D A;  1S5L H;  5M1B A;  1KC8 Q;  2UWJ E;  4Y5R A;  3CWB G;  1Q86 Q;  3ZOX A;  4YXW H;  4LJI A;  1GQ1 A;  2QIW A;  3M9Q A;  4JYC A;  4DT0 A;  3OA8 A;  3P32 A;  3HQ8 A;  2DVH A;  1NTK E;  4I1L A;  2FBW C;  1E8E A;  1IJD B;  2JP3 A;  3L73 G;  3B71 A;  1CYJ A;  4I2L C;  3D71 A;  1SQP J;  3KXD A;  3L72 G;  1K73 Q;  2V7Q J;  1J1D C;  4FA9 A;  4XA4 A;  1OWA A;  4NFG B;  3JSV C;  4JYB A;  2NPS D;  1HRO A;  2BEQ D;  1M6Z A;  1QGK B;  5B5E H;  1VQP P;  1IFJ A;  3PHL A;  3AEF C;  3SWK A;  5DJU B;  1NO4 A;  2WPR A;  3HE4 A;  1AVY A;  3L74 D;  4P4Q B;  1CRJ A;  5APW A;  2BH4 X;  3V2Q A;  1U7M A;  5CIC B;  1JNM A;  1VQ4 P;  3P8M C;  2J5U A;  1QVG O;  4LLH A;  1GK4 A;  1M56 D;  1JY3 P;  2D2C B;  3WUU A;  1NTM E;  2C1V A;  1RQU A;  3CXH H;  3RGU A;  1OW8 A;  4WQD A;  3HTK B;  5KAI V;  1L0N D;  2A45 I;  3I5C A;  1KIL A;  1QVF O;  2BCC G;  2ZOO A;  1L0N G;  1S5L V;  2R44 A;  3SJL A;  5L8R J;  4WQ8 A;  1YI2 P;  1HJ5 A;  1S5L X;  2XU6 A;  1H8A A;  1H9Y A;  1U74 B;  1SFC C;  1L0N K;  1F1F A;  5AW8 B;  5EXQ A;  1VF5 C;  5AW3 B;  2ZYG A;  1NAY A;  4PV1 B;  3BAT A;  3TK1 A;  2IBZ G;  4EID A;  1VQK P;  4CPG A;  3HD7 D;  3CX5 E;  1EZV G;  4OGQ B;  3TNU B;  4W80 A;  2JKV A;  3TYI A;  2R32 A;  3NFQ A;  2N18 C;  1HH7 A;  2PFX A;  1OAE A;  2W27 A;  5AVW B;  3IN6 A;  1JB0 J;  3SXT A;  2QJK C;  4YPC A;  2P7J A;  4Z1M H;  1N86 A;  1PPJ D;  1S4X A;  1T8Z A;  1YEB A;  4PWA A;  5CCH C;  3SWY A;  1KMI Z;  2KXP B;  2FXO A;  2JWD A;  5B66 E;  3KZI E;  1OX3 A;  1MG3 D;  3V5B A;  1SQV J;  3HE5 A;  5E79 E;  3HTK A;  1CNO A;  2KNC B;  5APX A;  5GTI H;  2OYI A;  2P67 A;  4C7R A;  2FYN B;  3AE1 C;  3A0B H;  4U3F J;  3RL0 D;  1SFC D;  2G3A A;  1MKM A;  2Z5H A;  1C7M A;  3LW5 H;  1QYZ A;  2CK3 H;  3V2N A;  1PP9 G;  2FKW B;  1CHJ A;  3A0B V;  3A0H H;  5CBN A;  3H1L E;  4IL6 H;  2M8R A;  1BE3 J;  1AVO A;  2C9N Y;  3MUD A;  2JTI B;  1NWQ A;  3L4M A;  4L3G A;  2KP8 A;  4L76 A;  4YXD C;  1QL2 A;  2RMZ A;  3MUD C;  3LIE A;  1L4A C;  1L0N J;  1LTI C;  2M5A A;  1YYC A;  3CC2 P;  1DW0 A;  5GTH E;  2P10 A;  1SQP E;  2HOD B;  1NTZ D;  1YQ4 C;  1GL2 A;  1NU1 J;  1NTZ G;  1AFO A;  1SQX E;  1CRY A;  1PGP A;  4KT0 J;  3RL0 C;  3RK3 D;  1BE3 E;  3O8Z A;  4WQ9 A;  2KZI A;  1XTG B;  3GHG C;  1JOC A;  4WQC A;  2AXT E;  2FYZ A;  1T3J A;  2L91 A;  2WSS H;  3KZI H;  1DW1 A;  4D6T J;  1SQV K;  4H44 D;  1DW3 A;  4EIJ A;  2WSF J;  3L70 J;  1N7S A;  3RBZ A;  1JTH A;  4JPZ B;  1FBM A;  4UB6 H;  4D6T G;  1LTJ B;  2D2C D;  5GTH H;  4GOD A;  5CJ0 A;  3WFD C;  1PIX A;  1X9V A;  1S2E A;  1N8R Q;  4TT3 H;  2WPV B;  1GMJ A;  3L36 A;  3G4S P;  1G1I A;  1HZU A;  1PV3 A;  1T2K C;  1LWU A;  3CCU P;  2OZ1 A;  1IZN B;  2AXT H;  2M5A B;  2ZXE B;  3L4O A;  4QAO A;  4O1Q A;  2WPS A;  2D0W A;  3OA7 A;  3R4Y A;  2K1A A;  3L73 J;  3PP5 A;  4C7N B;  1YJ9 P;  1H1O A;  3ZCF A;  155C A;  1BGY J;  4XFJ A;  1NNO A;  5CBO A;  5APQ A;  2K9Y A;  3Q3D A;  3PTZ A;  1YTC A;  4PV1 D;  1FZE A;  1RZ6 A;  1LC2 A;  1YTZ I;  1PGJ A;  1VQ8 P;  3Q2Y A;  3PXS A;  5APT A;  1YJW P;  1KYO I;  5BU8 B;  2H7H A;  1GD2 E;  3H32 B;  1CSV A;  2LXB A;  2ZZS 1;  2N9I A;  1U57 A;  1JY2 N;  3IF4 A;  1J1E C;  3A0H E;  2CE0 A;  1SLQ A;  2HG5 D;  4C46 A;  5APV A;  1MG2 D;  2JJL A;  3SWS A;  1OMI A;  1SQV D;  1VQ5 P;  1NU1 G;  1MUU A;  3L72 D;  1C6S A;  2NPS B;  3PH2 B;  2XKM A;  2I1J A;  4PJ0 H;  3L75 G;  1FJK A;  5KAI E;  2N1T D;  3L4F A;  1NTM G;  2WPQ A;  4RKU J;  2A45 H;  1IO3 A;  1RY3 A;  4RES B;  1GW4 A;  4GDO A;  2ZON G;  5AVV B;  2GUS A;  3V4Q A;  1COR A;  1FCD C;  4KMG A;  4Y99 B;  4MN4 C;  2KLU A;  3CCR P;  4ASW A;  3CLQ A;  1KIB A;  1URQ C;  3H25 A;  4ZNC A;  1JTH B;  1WVE C;  2Y0C A;  4ZKP A;  5CCG A;  2FYU K;  4KJM A;  2BPB B;  5APY A;  3ZOW A;  4R4M A;  3WMM 0;  1BCC D;  4H13 B;  2MKV A;  2ZT9 D;  1RAQ A;  4WBA A;  3RK2 C;  1NU1 E;  1QX8 A;  2D0S A;  1JMM A;  3AE2 C;  451C A;  1CIH A;  1FZF A;  3RK3 B;  2LIT A;  3L70 G;  3VMX A;  3CCS P;  2HPC B;  5B66 V;  2BGV X;  1QKS A;  5AUR A;  1LNQ A;  1SQB G;  1M57 D;  2Z5I A;  1LS9 A;  4U3F D;  3M06 A;  2Y9Z A;  1WMK A;  1B7V A;  3EFG A;  1M90 Q;  1LGH B;  5BU5 A;  1EZV E;  1H0T B;  2K88 A;  3HQ9 A;  1W5C E;  2Q6Q A;  1ZR4 A;  1MZ4 A;  2L4D A;  1X8Y A;  2YO2 A;  1NAF A;  1JY2 O;  2I8D A;  3SWF A;  1M1J C;  2KI7 B;  1AOQ A;  3WU2 V;  1C2R A;  3TYY A;  5AVQ B;  1CC5 A;  5CJ4 A;  1ZOY C;  2E75 C;  1M70 A;  2IBZ E;  1BGY G;  3V2R A;  1WRG A;  1CCR A;  5AVT B;  2FRC A;  2Q9I A;  2R3S A;  2WSC J;  1H9X A;  1ZLL A;  1ZP0 C;  3O0R C;  1CIE A;  1EDI A;  1FI3 A;  1YIT P;  2IZ0 A;  3CWB J;  3KDP B;  1S9K E;  1UII A;  1KB9 I;  1H89 A;  1SQP K;  1IFD A;  1RF1 A;  2OYI C;  1SQQ D;  1KYO W;  1JY3 N;  1KB0 A;  2RH0 A;  2K9J A;  2BCN B;  3FXE A;  3VRD A;  2O1K A;  3TNU A;  1USE A;  4H0L B;  1KIL E;  3TGU E;  3CWB D;  3M0D A;  4K3A A;  4TLF A;  1KIL B;  5KLV J;  1M1J A;  1GZL A;  1S6V B;  2OQQ A;  1EC5 A;  3CXH D;  2E76 B;  3CXH W;  2LR2 A;  5CYT R;  5AVZ B;  1K04 A;  1F1C A;  4H13 C;  1NTZ J;  5TIS H;  5AW5 B;  2FFD A;  1EZV I;  2WZ7 A;  5DJT B;  2XZR A;  3C2C A;  5EFW B;  4GED B;  2QVA A;  3M97 X;  1SQX J;  1S72 P;  2A45 G;  1HUC A;  3NBT A;  1YIC A;  1NTK K;  2E74 B;  3BAS A;  5CCG D;  3HQ6 A;  2ZFC A;  3SVW A;  1JY3 O;  1CRG A;  1RF1 B;  3E1R A;  3C1L A;  1CYC A;  1KX7 A;  3O6Q A;  4JQ0 D;  1TU3 F;  1LFM A;  1GL2 D;  4O1W A;  1VF5 D;  3D0W A;  1KOR A;  1CSU A;  1EXI A;  3DR0 A;  1LT9 C;  1MFZ A;  1IK9 A;  3PRJ A;  2OAR A;  3MGN A;  2QJP C;  2Q1K A;  4LC1 A;  3MK7 B;  2KZJ A;  2N3Y A;  3WFE C;  1NYH A;  1YCC A;  2NZ2 A;  2HOD A;  1SQB K;  4WQ7 A;  3FX0 A;  2YQB A;  1C52 A;  4YTP C;  2IX7 C;  3H1H D;  2XDJ A;  3SFD C;  2ITA A;  2BCC J;  2CPS A;  1BCC J;  5CCH D;  3ITK A;  1M1K Q;  3NTN A;  5CCG C;  1N7S D;  3H1H J;  3GHG A;  1QLE D;  2WIT A;  3FWL A;  1ZN5 A;  1JDL A;  4EYY Q;  5TIS V;  3M9B A;  1OXZ A;  1GL2 C;  2AEM A;  4JCG A;  1L9J C;  1RF0 C;  2BEZ F;  1RF0 A;  3AE4 C;  2PAJ A;  5KLV G;  2Y0D A;  3V6I A;  1DEB A;  3GF3 A;  1C6R A;  4N6J A;  1AV1 A;  1RE4 C;  3CX5 W;  4L73 A;  1BE3 D;  3PJS K;  2GB8 B;  1NTM D;  2R5B A;  1PGQ A;  3ZOO A;  3AE7 C;  2FYU E;  1N2D C;  4NPE A;  2WMM A;  2N1T B;  2LIR A;  1HGV A;  3L75 J;  1KIL C;  1R0Q A;  4BWN A;  1E5W A;  2K37 A;  1NU1 K;  4XYD B;  1CSW A;  3VYI A;  2OTJ P;  3RN1 A;  4IFF A;  4WY4 D;  1AQ5 A;  2K9J B;  1PP9 D;  1L0L J;  4UB6 V;  5CIG B;  1IC2 A;  1FE6 A;  1H33 A;  1N15 A;  1Y47 A;  2E43 A;  5AW4 B;  3HUS B;  3PLN A;  1X79 B;  3B5N D;  2KIK A;  4H0L D;  3WUV A;  4OGQ D;  1RAP A;  5E79 V;  2V7Q H;  1KQL A;  4AQR D;  1GDT A;  5B6Q A;  4GKG A;  4DY9 A;  1N73 B;  3EWK A;  3O1Y A;  2KS1 A;  3B5N A;  1BGY E;  2Y9Y A;  2ZT9 B;  1UIX A;  3OCD A;  1FOS E;  3L70 D;  1DX7 A;  1QN2 A;  3HRN A;  3U59 A;  2D2C C;  2ZVN B;  2FYU G;  3WU2 E;  3BRT B;  1I54 A;  2MHM A;  2W8Z A;  2IFN A;  1S3J A;  1IRV A;  1FDM A;  3UIA A;  1CXC A;  3ZBM A;  4U3F G;  3OW2 O;  3AE6 C;  1SVF A;  4L1Q A;  1J2J B;  4W7Z A;  2B87 B;  3H1I D;  3HD7 A;  2CA3 B;  3AEC C;  4IFM A;  5C9M A;  3L71 G;  1DT1 A;  1IK7 A;  1PP9 J;  1OW7 A;  3BCC D;  2KB7 P;  3V4W A;  3A2A A;  3Q1M A;  3L70 E;  4DOJ A;  2IDB A;  3SSU A;  1I8O A;  4D6T D;  3FXD A;  2Y0E A;  2MJZ A;  1BGY D;  3JC2 2;  4IL6 E;  3TGU G;  1IFP A;  1SQV G;  2OTL P;  3CYT I;  5APU A;  1NTM J;  1KB9 H;  5B5E V;  1BSN A;  5BVZ A;  1VQM P;  3F89 A;  1OCD A;  3L72 J;  3M91 A;  2C9L Y;  2B10 B;  5AW1 B;  3N4X A;  3GW6 A;  3KPE A;  3DP5 A;  1MZ9 A;  4QMA A;  2ZVO B;  1CW5 A;  2OGU A;  1Q7Y Q;  2VHD A;  2E5Y A;  3AE9 C;  2QA4 P;  3B4S A;  4N78 E;  4GYD A;  4H44 B;  2P58 A;  1Z56 A;  1C6O A;  1OIP A;  4GT1 A;  2JO1 A;  3WU2 H;  2FYN C;  1RE3 A;  2OYO A;  2N1T C;  1KTM A;  2E74 C;  3L74 E;  1CTY A;  1I6E A;  4UB6 E;  4HKZ H;  3D70 A;  2YKQ A;  3W67 A;  1RF1 C;  3AEG C;  1K05 A;  3FGA D;  1Q82 Q;  1ZRT E;  2RKL A;  2WT7 B;  2E75 B;  3L73 D;  2E5T A;  1OVU A;  5C39 A;  2OYH A;  1BDC A;  1BDD A;  2P2U A;  1LT9 B;  3OCD B;  3MP7 B;  2PAC A;  1CHH A;  3VNW A;  2B12 B;  1N50 A;  2QJP B;  2FYU J;  1NTZ E;  2OYI B;  3G71 P;  1VQ6 P;  3VN0 A;  1L0L D;  1P84 D;  3LW5 J;  4O9B A;  2O01 J;  1L0L G;  1HF9 A;  1JMB A;  1GK6 A;  1RH5 B;  3CX5 I;  3L71 J;  2CXB A;  1ZV8 A;  1C2N A;  3TSI A;  3CCJ P;  3D6Y A;  4EOT A;  1PP9 E;  3P8C E;  4DJG A;  1EDJ A;  1CRC A;  1ZME C;  5KJ7 D;  1SQQ J;  1VF5 B;  5KJ7 A;  4IL6 X;  1C75 A;  2J59 M;  5H2F H;  1L4A A;  1GKS A;  4HH2 A;  3H1K J;  1N9C A;  3RL0 g;  4FB1 A;  2KS1 B;  3B5N B;  1X22 A;  1HBW A;  1NVO A;  1K9M Q;  2W83 C;  4GOF A;  1EXJ A;  4FAN A;  3QWO C;  351C A;  3G9R A;  1FJP A;  3OJA B;  2C1U A;  1VQ9 P;  1Q81 Q;  3HE5 B;  3A3Y B;  1JUN A;  2M3E A;  2JDI H;  1CRI A;  4NPF X;  1YIJ P;  1CXA A;  3CC4 P;  3PH0 A;  4AUW A;  1L9B C;  3GG2 A;  4IL6 V;  1D7M A;  2KSE A;  4ASV A;  1HGZ A;  2ZBO A;  2BLF B;  4AAN A;  4RSZ A;  2A06 G;  4WWI A;  1GDV A;  1FZG A;  3KQG A;  1I8P A;  5AVU B;  4ZKU A;  1YTZ T;  1N7S B;  4PJ0 E;  1SQP G;  1FHB A;  2KYV A;  2PP6 A;  2QJY C;  1FZA A;  1LTJ A;  4WVZ A;  1Q2N A;  3BCC E;  4H0J A;  5AW7 B;  2C1D B;  3L72 E;  1CRH A;  1VQO P;  1DIP A;  4U7J A;  1PL5 A;  4WQA A;  2Z4E A;  3AE5 C;  4DCK A;  4H13 D;  1BL9 A;  2OYH B;  2HV4 A;  2AI5 A;  1H32 A;  2H43 A;  3VMZ A;  1KQG B;  1ETP A;  3O20 A;  3WUT A;  2QEX P;  2ORL A;  4N3Y B;  1W5C T;  1A02 J;  2XV5 A;  1I6D A;  1AKK A;  1ZW0 A;  3ZOY A;  1QEX A;  2V4H A;  2O1J A;  1JCC A;  3H1H G;  3FWN A;  1DH3 A;  4JF7 A;  4YE1 A;  2IYP A;  1FDO A;  1LJ2 A;  1L4A D;  5CID B;  2Q7C A;  2R3C A;  2C0W A;  2GM4 A;  1U7J A;  3RL0 B;  2AXT V;  2KSJ A;  2O01 N;  4V2K A;  1CED A;  3HE4 B;  3H32 A;  3A0H V;  2P1J A;  1SQX K;  2QRX A;  3Q5S A;  3H1I J;  3MZW B;  1LTJ C;  5CIH B;  1H88 A;  3RN0 A;  1DEE G;  3U1C A;  2BCC D;  5K5G B;  2WTY A;  3RLM A;  1DIQ C;  1URQ B;  2QSI A;  2WVR A;  2YMY A;  3VYM A;  4WQE A;  4AAM A;  1CYI A;  2ZXY A;  1E29 A;  1QL1 A;  4H44 C;  2AEF A;  1HJ0 A;  1NTK D;  3RK2 B;  3HUS C;  3USS A;  4U3F E;  1VL2 A;  1DVV A;  2FWL A;  2N1T A;  1GIW A;  4Y28 J;  1L4A B;  1SQB J;  2IPP A;  4AAL A;  2IYO A;  1FZC A;  3EFF K;  3H1L G;  3L71 D;  1YQ3 C;  1KD1 Q;  1NH4 A;  3RK3 C;  1OW6 A;  4WY4 A;  5GTI V;  3H1L D;  3IFM A;  1FI9 A;  2SPZ A;  1VPC A;  3PXT A;  4HB1 A;  3TDK A;  1H33 B;  3HQ7 A;  1LT1 A;  4HYT B;  2N9B A;  4PJ0 V;  4UB8 V;  1LP1 A;  1G1J A;  3SFE C;  2O01 H;  3RMZ A;  3WFB C;  1N7S C;  1N73 A;  4B86 A;  4EIF A;  2IBZ I;  1LTB C;  4L74 A;  1FS0 E;  1SFC B;  2R5D A;  3AEB C;  5KKZ B;  4FA5 A;  3CC7 P;  5AVY B;  4PV1 C;  3P7K A;  2KNC A;  4K35 A;  3GMA A;  2RN0 A;  1T2K D;  3CD6 P;  2BAS A;  1J1E B;  4EIC A;  2L5G B;  2IBZ D;  2B0Z B;  4GOE A;  3H1J G;  3SLE A;  1HJB A;  2IZ1 A;  4PW9 B;  1FC2 C;  2QM7 A;  5CMZ A;  3L71 E;  2POH A;  1GU2 A;  1ZZH A;  1FAV A;  3EQ2 A;  1CHI A;  3A5T A;  1USD A;  2V07 A;  3C9I A;  1NJI Q;  2YXQ B;  3BCC G;  5CIE B;  3B8E B;  3CWB E;  2YMK A;  5AVR B;  4A7P A;  2CA4 B;  1PPJ G;  3C8V A;  1FJ0 A;  5AW0 B;  3MHV A;  2NRG A;  1PPJ E;  3Q5R A;  2ZYD A;  1NIR A;  1GW3 A;  2N9Y B;  1DD3 A;  1CIF A;  1CTJ A;  1SQQ E;  4M3L A;  3BRV B;  1NHL A;  1CCH A;  5GTH V;  1HWT C;  1LWU B;  2XTS B;  2HYN A;  1H31 A;  2C9X B;  1SFC A;  1VQL P;  2B4Z A;  1COT A;  2PGD A;  3L75 D;  1E79 H;  4H0K A;  1FOC A;  3ZIY A;  1FU1 A;  2FY8 A;  3HD7 B;  2BCC E;  3CXH I;  3S9O A;  1GU5 A;  1JEK A;  2MTA C;  2ZJS E;  1WT6 A;  3WC8 A;  3CP5 A;  1T6A A;  2YKP A;  5DF5 A;  1GJQ A;  2J58 A;  3CME P;  3ZDM A;  2QG4 A;  3ORV A;  1NOH A;  3H6P A;  1HJ4 A;  1RE3 C;  4WQB A;  3JBT B;  3IR9 A;  3E1I A;  1A02 F;  1M1J B;  3DMI A;  1SQV E;  3II6 A;  1NML A;  5AW9 B;  2FYU D;  1A2S A;  3Q5P A;  1W2E A;  3M0A A;  1LT9 A;  2DGE A;  2OZ1 B;  3M9H A;  4I7Z C;  4Y99 C;  5DJQ B;  3PXW A;  1HVV A;  4L3H A;  1SQX G;  1ZRT D;  5B5E E;  3RK2 D;  1FZC C;  2FXP A;  2KUB A;  2V08 A;  3L37 A;  3AED C;  1KYO E;  1EQ7 A;  4C7N A;  4WY4 B;  2WSE J;  1H31 B;  1T3U A;  3QH9 A;  2GA1 A;  4FA4 A;  5APS A;  3RK3 E;  3L35 A;  2JR8 A;  1MFT A;  1LP1 B;  2AXC A;  2OTK E;  1P84 I;  3CPW O;  2E75 D;  1NKZ B;  5H2F V;  1XTC C;  3L74 G;  1BCC E;  3CCM P;  1Y8A A;  1HZV A;  3RBX A;  1KV9 A;  2YNY A;  2YKO A;  3K5B A;  2WT7 A;  5AVX B;  2PCC B;  2B88 A;  3IAO A;  1R5S A;  3H1H E;  1DVH A;  4GIF A;  3NMD A;  2G8Y A;  3H1J E;  2YCC A;  3T97 B;  1AJY A;  1LC1 A;  4DZO A;  1ZXG A;  5KAI H;  4EI2 A;  1KZU B;  1L0N E;  3H1K D;  2ZYA A;  1JO5 A;  2N9J A;  2YIU C;  2NPS A;  3U1A A;  1QL4 A;  1K3H A;  5TJH A;  4OWF A;  4J20 A;  3KYQ A;  3GF7 A;  5KJ7 C;  2GC7 D;  1IZL 0;  2AIU A;  2Q3I A;  3NWV A;  1L2P A;  1LTG C;  2E76 C;  4NPD A;  1YBK A;  2QJY B;  1RHZ B;  3AE8 C;  3ABV C;  3H1J D;  4N0K A;  3CCE P;  2HR3 A;  1AA0 A;  1N90 A;  2OYH C;  1K3G A;  3VTP C;  3CU4 A;  2B11 B;  4EIE A;  3M0D C;  4Q5P A;  3HD7 C;  2EXV A;  2XND H;  3VP9 A;  1NGM B;  1U75 B;  1IFI A;  1SQB E;  2LKM A;  1VQ7 P;  3KHU A;  2JEE A;  4KHX A;  3MTU E;  5KLI C;  2H8P D;  2XNX A;  2FFD C;  4XXL A;  3CX5 D;  1OVR A;  3L73 E;  3MK7 C;  3E7K A;  4JBZ A;  1KB9 E;  5AVS B;  3BCC J;  1H32 B;  4I6M C;  3T97 A;  5CCH A;  2Q3E A;  1BE3 G;  1N73 C;  1CI6 B;  1R8E A;  1P84 E;  1AYG A;  1L0L E;  3N7N A;  2HPC A;  3NBS A;  4FA1 A;  2E76 D;  1NTK G;  2N3B A;  2YO3 A;  1OZH A;  2PCB B;  1DD4 A;  4W7Y A;  3CCL P;  4RJT A;  1KFM A;  1M7L A;  4L75 A;  3D6Z A;  3H1J J;  1DW2 A;  3H1I G;  3JCU E;  2C2C A;  5AW6 B;  1OVV A;  2KK7 A;  3S4R A;  1WEJ F;  2BH5 X;  1HRC A;  2A06 E;  1L0L K;  3I55 P;  3VOP A;  1HH0 A;  2B9B A;  3MIW A;  2WWW A;  3H1K G;  1ZR2 A;  2GC4 D;  4LGD E;  4AYC A;  1GTW A;  4HJG H;  2I8F A;  1GL2 B;  2A06 D;  2KLV A;  1S1C X;  1KYO H;  3CCQ P;  1X0T A;  2B89 A;  2WSF H;  1OFC X;  3CXH E;  1FOS F;  1P84 H;  2Q5U A;  1SQQ K;  3I56 P;  3HUS A;  1EB7 A;  2YIU B;  3CX5 H;  3AEA C;  2LXC B;  2O3J A;  2IFM A;  2WQY C;  1SQP D;  1KQF B;  1EZV D;  4AX3 A;  3TGU J;  3A0B E;  5IY5 1;  4FAV A;  3JCU H;  1KQS O;  2CE1 A;  3F5H A;  5CIB B;  4UB8 H;  2HFE D;  2JQR A;  1IFN A;  1NMI A;  1G2C A;  1CTZ A;  1URQ A;  2ZAE B;  1IQC A;  3TGU D;  1KIL D;  5KKZ C;  2WSC H;  1FI7 A;  1YHQ P;  4RO0 A;  1IFM A;  1M8O B;  1YNR A;  1NTM K;  1NU1 D;  4WY4 C;  2W90 A;  4OVN F;  1W2B O;  4I7Z B;  5KAF V;  1KN7 A;  5DJQ C;  4N78 D;  1GU4 A;  3G6E P;  1CI6 A;  2W6B A;  1AOF A;  1I55 A;  1CO6 A;  5CIF B;  1NTK J;  3AEE C;  3R2P A;  1FZC B;  1CSX A;  3H1K E;  2FFD B;  3O5C A;  4K3I A;  4H0L C;  1KFN A;  1J3S A;  4OGQ C;  4BXL A;  1S9K D;  4XE5 B;  5KTB A;  5E79 H;  1LTS C;  2N18 B;  1NKN A;  3A9F A;  2DW3 A;  3GHG B;  1JM0 A;  3KZI V;  3MD0 A;  1LWU C;  1BCC G;  1J1D B;  3VP8 A;  3O6Q B;  2K3R A;  1A8C A;  2ZXX A;  5KLV E;  2M0B A;  2YXR B;  3TF5 A;  1N7L A;  1SP4 A;  1AQT A;  4PD4 H;  5H2F E;  2E42 A;  1KB9 D;  1KV4 A;  1JY2 P;  2HLO A;  4UB8 E;  2QJK B;  3B5N C;  1FDI A;  3H1L J;  4WB4 A;  1YJN P;  1QL3 A;  1K8A Q;  1G2C B;  1BSH A;  3CMA P;  1KYO D;  2YK3 A;  1EDL A;  1SQB D;  3V2P A;  2QM8 A;  2GIW A;  3OAK A;  1VYD A;  1SQX D;  2FXM A;  1YIQ A;  1A56 A;  1YEA A;  2W6J H;  4BRY A;  3WFC C;  2ZT9 C;  3S1K A;  5CHX A;  1M60 A;  1RZ5 A;  3W68 A;  2I1K A;  2QE7 H;  4MU8 A;  1YFC A;  1RQV A;  2VRS A;  5AW2 B;  1KX2 A;  5KAF H;  3L74 J;  3NXS A;  3OA8 B;  2W6A A;  2AEJ A;  1CZQ A;  1Q90 D;  1SS1 A;  2H88 C;  4OH8 B;  3CL3 D;  5KLV D;  2CPB A;  3LID A;  5KLI B;  3VMA A;  1MV8 A;  1URQ D;  4IOI H;  5TIS E;  1CSB A;  1S5L E;  4PD4 E;  4AAO A;  1HCM A;  1DII C;  1VDF A;  1PGO A;  2PRR A;  5B66 H;  1LTT C;  4IFD K;  3CCV P;  3BVH A;  2C8S A;  2WSE H;  1R5L A;  5KLV K;  2GUV A;  2M3B A;  1HTL C;  1JCD A;  4PD4 I;  3VMY A;  1PZQ A;  3P8C D;  3X39 A;  3L75 E;  2H89 C;  1EDK A;  1PFI A;  1RE4 A;  2C0X A;  5GTI E;  1NTZ K;  1I5T A;  1IRW A;  4R4L A;  2E74 D;  5C0Z A;  3G3Z A;  3A7O A; 
#chains in the Genus database with same CATH homology
 2JWA A;  3DMI A;  5DFS A;  1LMS A;  1NML A;  4PD4 D;  1CIG A;  1C6O A;  1W2L A;  2FYU D;  1A2S A;  2D0S A;  1E2R A;  2DGE A;  2OZ1 B;  1HJ3 A;  5DJQ B;  3WUI A;  451C A;  1CIH A;  4EDF A;  2C1D A;  3PXW A;  4L3H A;  2LIT A;  4Y5R A;  1CTY A;  1ZRT D;  1I6E A;  2V08 A;  5B66 V;  2BGV X;  3ZOX A;  1QKS A;  4LJI A;  5AUR A;  1GQ1 A;  3OA8 A;  3HQ8 A;  1H31 B;  2DVH A;  1LS9 A;  3L73 D;  4U3F D;  4FA4 A;  1B7V A;  3OCD B;  1E8E A;  2PAC A;  1CHH A;  1CYJ A;  2B12 B;  3VNW A;  1N50 A;  2QJP B;  3HQ9 A;  1L0L D;  4FA9 A;  1P84 D;  5H2F V;  1MZ4 A;  4NFG B;  1HZV A;  1KV9 A;  2CXB A;  2PCC B;  1C2N A;  1DVH A;  1AOQ A;  3WU2 V;  1HRO A;  1C2R A;  1M6Z A;  1CC5 A;  3PHL A;  1M70 A;  2YCC A;  1CRC A;  1LC1 A;  1C75 A;  1CCR A;  3H1K D;  2N9J A;  1GKS A;  3L74 D;  4P4Q B;  1CRJ A;  2FRC A;  2BH4 X;  1N9C A;  4FB1 A;  1H9X A;  1QL4 A;  3O0R C;  1K3H A;  5CIC B;  1CIE A;  5TJH A;  1FI3 A;  4J20 A;  4FAN A;  2GC7 D;  1IZL 0;  2AIU A;  351C A;  2C1V A;  3NWV A;  2C1U A;  4WQD A;  5KAI V;  1L0N D;  1CRI A;  1CXA A;  2QJY B;  3H1J D;  4N0K A;  2ZOO A;  1S5L V;  1L9B C;  1SQQ D;  3SJL A;  3GG2 A;  4IL6 V;  4WQ8 A;  1KYO W;  1HJ5 A;  1N90 A;  1KB0 A;  1K3G A;  2BCN B;  3CU4 A;  2B11 B;  3VRD A;  4EIE A;  2ZBO A;  4Q5P A;  1H9Y A;  1U74 B;  2BLF B;  2EXV A;  4AAN A;  4RSZ A;  1U75 B;  1GDV A;  3CWB D;  1F1F A;  5EXQ A;  1I8P A;  3KHU A;  1S6V B;  4EID A;  4XXL A;  3CX5 D;  3CXH D;  1FHB A;  3CXH W;  3MK7 C;  5CYT R;  1H32 B;  1F1C A;  2Q3E A;  4H0J A;  2C1D B;  3TYI A;  2N18 C;  1HH7 A;  1AYG A;  1OAE A;  1CRH A;  3C2C A;  3NBS A;  3SXT A;  4FA1 A;  4GED B;  2N3B A;  3M97 X;  4WQA A;  1PPJ D;  1YEB A;  4PWA A;  2PCB B;  4RJT A;  3NBT A;  1YIC A;  1BL9 A;  1MG3 D;  2HV4 A;  2AI5 A;  1H32 A;  1DW2 A;  3HQ6 A;  1CNO A;  3SVW A;  2C2C A;  2KNC B;  1ETP A;  1CRG A;  1WEJ F;  2BH5 X;  1HRC A;  3O20 A;  1CYC A;  1KX7 A;  2ORL A;  2FYN B;  1LFM A;  1W5C T;  4O1W A;  1I6D A;  1AKK A;  1C7M A;  1CSU A;  3ZOY A;  3DR0 A;  1QYZ A;  3PRJ A;  4YE1 A;  2GC4 D;  1CHJ A;  3A0B V;  3MK7 B;  2N3Y A;  3WFE C;  5CID B;  1YCC A;  2I8F A;  2AXT V;  4WQ7 A;  2YQB A;  4V2K A;  1CED A;  2A06 D;  1C52 A;  2JTI B;  3A0H V;  3L4M A;  4L3G A;  2RMZ A;  3H1H D;  5CIH B;  3RN0 A;  3ITK A;  1DW0 A;  2BCC D;  3RLM A;  1DIQ C;  1EB7 A;  2YIU B;  1NTZ D;  2O3J A;  3VYM A;  4WQE A;  3FWL A;  4AAM A;  1SQP D;  1JDL A;  1CYI A;  2ZXY A;  5TIS V;  1CRY A;  1EZV D;  4AX3 A;  1E29 A;  4JCG A;  5IY5 1;  1L9J C;  4WQ9 A;  4FAV A;  1NTK D;  2CE1 A;  5CIB B;  1DVV A;  2FWL A;  4WQC A;  1GIW A;  2L91 A;  2JQR A;  1NMI A;  2Y0D A;  1DW1 A;  1CTZ A;  4AAL A;  3L71 D;  1C6R A;  1IQC A;  3TGU D;  3CX5 W;  1DW3 A;  5GTI V;  3H1L D;  1BE3 D;  1FI9 A;  2GB8 B;  1FI7 A;  1NTM D;  3PXT A;  1YNR A;  3ZOO A;  1NU1 D;  3TDK A;  1H33 B;  3HQ7 A;  4PJ0 V;  5KAF V;  4UB8 V;  5DJQ C;  3WFD C;  2LIR A;  1AOF A;  1I55 A;  1CO6 A;  5CIF B;  1R0Q A;  3RMZ A;  3WFB C;  1CSX A;  3O5C A;  4XYD B;  1CSW A;  4K3I A;  4EIF A;  1HZU A;  1J3S A;  3RN1 A;  2K9J B;  2OZ1 A;  1PP9 D;  4UB6 V;  3L4O A;  4QAO A;  4O1Q A;  5CIG B;  5KKZ B;  1H33 A;  2N18 B;  2D0W A;  1N15 A;  3A9F A;  4FA5 A;  3PLN A;  3KZI V;  2RN0 A;  1RAP A;  5E79 V;  1A8C A;  1H1O A;  3ZCF A;  4EIC A;  155C A;  5B6Q A;  2IBZ D;  4DY9 A;  3TF5 A;  1NNO A;  2B0Z B;  3O1Y A;  2KS1 A;  3SLE A;  3PTZ A;  1YTC A;  3OCD A;  1KB9 D;  4PW9 B;  2QJK B;  1RZ6 A;  1LC2 A;  3L70 D;  1QL3 A;  3PXS A;  1GU2 A;  1QN2 A;  1ZZH A;  1KYO D;  2YK3 A;  1CHI A;  1I54 A;  2MHM A;  2V07 A;  1SQB D;  5CIE B;  1CSV A;  4A7P A;  2CA4 B;  2ZZS 1;  1IRV A;  1FJ0 A;  2GIW A;  2N9I A;  1CXC A;  3ZBM A;  1VYD A;  1SQX D;  1YIQ A;  1A56 A;  1NIR A;  2CE0 A;  2N9Y B;  4L1Q A;  1YEA A;  3H1I D;  1CIF A;  1CTJ A;  2CA3 B;  1MG2 D;  3WFC C;  3SWS A;  1SQV D;  5C9M A;  1M60 A;  1RZ5 A;  3L72 D;  1C6S A;  1DT1 A;  3PH2 B;  4MU8 A;  1CCH A;  1YFC A;  3BCC D;  5GTH V;  1KX2 A;  2XTS B;  3OA8 B;  1H31 A;  2C9X B;  1I8O A;  2B4Z A;  4D6T D;  1COT A;  3L75 D;  4H0K A;  5KLV D;  2Y0E A;  1IO3 A;  5KLI B;  1BGY D;  3VMA A;  1FOC A;  4AAO A;  1HCM A;  3ZIY A;  1DII C;  2ZON G;  1COR A;  3CYT I;  1FCD C;  5B5E V;  2C8S A;  4KMG A;  2MTA C;  1OCD A;  2B10 B;  3WC8 A;  1KIB A;  3CP5 A;  3X39 A;  3GW6 A;  1WVE C;  5DF5 A;  3DP5 A;  2Y0C A;  1GJQ A;  2QG4 A;  3ORV A;  2BPB B;  1HJ4 A;  2VHD A;  3ZOW A;  1I5T A;  1IRW A;  4WQB A;  3JBT B;  1BCC D;  5C0Z A;  4GYD A;  2L4D A;  1RAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...