1L0ND

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1l0nD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1l0nD02
1SQVD 5IY51 2MHMA 1L9BC 4NFGB 2N3BA 3O1YA 1DW2A 1NIRA 2BCCD 2N9IA 3FWLA 2RN0A 1P84D 1I54A 1L9JC 1L0LD 1CIFA 3CXHW 3WU2V 4AAOA 1KYOW 1H31A 2PCBB 2BH5X 3H1KD 2CE1A 1CSUA 5CIEB 5DFSA 4EIDA 1M70A 1C6RA 2V08A 1R0QA 1JDLA 5B5EV 3CP5A 3SJLA 2CA4B 2FYUD 3TYIA 1RAQA 1VYDA 2BH4X 5KLVD 2GC4D 5AURA 4FANA 4AAMA 5GTIV 2CA3B 4WQ8A 1CEDA 4GYDA 1KX2A 2O3JA 3L73D 3DMIA 1BE3D 3L4MA 1LC2A 3CWBD 1H31B 1E29A 2DVHA 4EICA 2A06D 2Q3EA 5TJHA 1HZUA 5DJQB 1KX7A 5CIDB 4U3FD 1CYJA 2K9JB 1CRCA 1A2SA 2QJYB 2B10B 1DVHA 1QL3A 1KIBA 1HJ3A 2PCCB 3C2CA 4FA1A 4WQEA 3HQ8A 2KNCB 4PD4D 1FOCA 3RN0A 5CIGB 1CYIA 1NU1D 3L74D 3ZIYA 1N15A 1LC1A 3TF5A 2I8FA 1PP9D 2YK3A 3L75D 3VNWA 3NBSA 1H9YA 1DVVA 3ZBMA 3H1JD 1CRGA 3A0HV 3SXTA 3GG2A 1AOQA 1YICA 1GJQA 1I5TA 1KV9A 3SWSA 1CSWA 2ZONG 4N0KA 2YQBA 1N50A 1QYZA 2VHDA 3RLMA 2C1DA 1AOFA 2JTIB 1BCCD 2ZXYA 3PXSA 3VYMA 3O0RC 3WFEC 1U74B 5C9MA 3OA8A 4MU8A 3VRDA 1B7VA 1QL4A 3L70D 1SQPD 4O1QA 1NMLA 2LITA 2FRCA 1YTCA 5KAIV 1QKSA 1I6DA 2BGVX 1H9XA 4L3HA 4V2KA 1C7MA 5CIHB 1AYGA 3WUIA 2C9XB 2JWAA 1HRCA 3WFCC 4H0KA 4FB1A 3WC8A 1DIIC 5DF5A 2C1DB 1EZVD 3PH2B 2B11B 2DGEA 2AIUA 1FJ0A 3ZOXA 4UB8V 2BCNB 3OA8B 1SQBD 1AKKA 2CE0A 5B6QA 1CC5A 4JCGA 1CHIA 1COTA 1NTZD 2C1UA 1PPJD 4PW9B 5E79V 3O5CA 1YFCA 5GTHV 2ZOOA 1CHHA 1CO6A 2V07A 1DW3A 1OCDA 351CA 1C6SA 1S6VB 2AXTV 1YIQA 2B4ZA 2MTAC 4KMGA 2N9YB 1A8CA 2C8SA 3RMZA 1M6ZA 1H32A 3PLNA 1FHBA 4Y5RA 4QAOA 5DJQC 1GKSA 1ETPA 2FWLA 5TISV 1E8EA 4WQCA 2JQRA 4YE1A 4K3IA 1C2RA 1KB0A 1ZZHA 3MK7B 2BPBB 3MK7C 5CYTR 2QJPB 1I8PA 1FI9A 3L4OA 1CRYA 2RMZA 1CYCA 2GC7D 4WQAA 1CSXA 1CTJA 1FCDC 3CYTI 4O1WA 1RZ5A 4RJTA 1CCRA 1SQXD 1DT1A 5KLIB 2HV4A 3CX5D 3GW6A 3H1ID 2B0ZB 1H32B 1CRHA 3ZOOA 1CSVA 1DW0A 1IQCA 1DW1A 1NNOA 1CORA 1S5LV 4AANA 4Q5PA 3TDKA 1K3GA 4XXLA 2FYNB 3L71D 155CA 3O20A 1GDVA 1GQ1A 4FA9A 2L4DA 1C75A 4AX3A 1CHJA 3TGUD 2D0SA 3A9FA 4FA5A 1EB7A 1N9CA 5H2FV 1DIQC 3A0BV 4WQDA 4WQ9A 1HZVA 3NWVA 3DR0A 3CX5W 4XYDB 1C2NA 1IO3A 2C2CA 3BCCD 1HROA 2ZBOA 1I6EA 4EIEA 4FA4A 1CXAA 2QG4A 2L91A 4FAVA 4PWAA 5CICB 4J20A 1HH7A 4H0JA 3SVWA 4L3GA 2D0WA 3ITKA 1LS9A 3HQ6A 2Y0DA 3ZCFA 1E2RA 3OCDA 3JBTB 1CXCA 1C6OA 3ZOYA 1IRWA 1U75B 2B12B 2C1VA 1BGYD 5EXQA 1LMSA 4AALA 3ORVA 1FI7A 2YCCA 5B66V 4A7PA 1F1CA 1I8OA 2LIRA 3PXWA 1L0ND 1YEAA 1HJ5A 3PXTA 1YCCA 4IL6V 3X39A 1MG3D 1FI3A 3CU4A 1WVEC 1I55A 1WEJF 3H1LD 2N3YA 1W5CT 3WFBC 2AI5A 3HQ7A 1NTMD 3OCDB 2KS1A 3L72D 1F1FA 1RAPA 3NBTA 3PHLA 2BLFB 2IBZD 4EDFA 451CA 1CTZA 4LJIA 1OAEA 4WQ7A 3WFDC 1BL9A 2Y0EA 1MG2D 1CIEA 3KZIV 1W2LA 3HQ9A 1LFMA 1MZ4A 2N9JA 3KHUA 1CCHA 2ZZS1 4GEDB 1CIHA 3VMAA 2OZ1A 2N18B 1CTYA 2N18C 2YIUB 2GB8B 5KKZB 1IRVA 5CIBB 1ZRTD 1J3SA 3M97X 2QJKB 1M60A 1GIWA 1H33A 1SQQD 1CRJA 1N90A 4D6TD 1HCMA 2CXBA 2PACA 1NMIA 1C52A 3PRJA 4EIFA 1YNRA 1CRIA 5C0ZA 3PTZA 1QN2A 2EXVA 2XTSB 1YEBA 1H1OA 1NTKD 2ORLA 4DY9A 4UB6V 3CXHD 3ZOWA 1GU2A 2OZ1B 3DP5A 4PJ0V 1KYOD 4L1QA 1A56A 1HJ4A 1IZL0 1KB9D 5KAFV 3SLEA 3H1HD 2Y0CA 4WQBA 1CIGA 1H33B 2GIWA 1RZ6A 4P4QB 3RN1A 1K3HA 5CIFB 1CNOA 4RSZA
chains in the Genus database with same CATH superfamily
4WWIA 1SQVD 1DEBA 4QMAA 2C0XA 2IDBA 3CWBJ 1H89A 3FWLA 3CXHW 3RGUA 3AEEC 3HUSC 2B88A 3JSVC 1T6AA 3RK3C 5CMZA 2FYUK 1LGHB 1K05A 1OX3A 2CE1A 2E76D 5CIEB 1R0QA 2K9JA 2O01H 1HJBA 2CA4B 3CMAP 3TYIA 1JNMA 1LTJB 2BH4X 4OH8B 3L73E 5KLVD 5AURA 1IFIA 1ZR2A 2KB7P 4I7ZB 4WQ8A 1LWUC 1CEDA 3L37A 3A7OA 5L8RJ 1BE3D 5APQA 1ZV8A 3L4MA 2IFNA 4K35A 2N1TB 3CCLP 1KX7A 4AQRD 1CYJA 1CRCA 1A2SA 2ITAA 2B10B 1KYOH 2NPSA 2QJYC 1URQD 1MFZA 3BVHA 3L75E 2FKWB 3KZIE 4KT0J 1P84I 2HPCA 2IFMA 1NU1D 4N78D 3TF5A 2I8FA 2YK3A 4Y99C 1Z56A 4L76A 5KJ7D 3CCMP 4OWFA 3NBSA 1LTSC 1RH5B 3H1JD 2YMKA 2J5UA 3SXTA 4ZKUA 1NKZB 4ASVA 4IFDK 2JKVA 1YICA 1P84H 1KV9A 3SWSA 2O1JA 2POHA 2SPZA 4N6JA 1VPCA 3RLMA 5KTBA 2CPSA 1H88A 1T3UA 2JTIB 1S3JA 3PXSA 1SQPK 2H88C 3AECC 1EC5A 4UB6E 1AV1A 1UIIA 1QL4A 3C1LA 1BSNA 4ZNCA 1W2EA 3VYIA 1Q90D 3L35A 2A06G 1U57A 1LTJA 3RL0C 1C7MA 3CC4P 2KZJA 4AUWA 4PD4I 3KXDA 2JWAA 4XFJA 1NHLA 1NAYA 2C1DB 2OYHA 5APYA 2AIUA 3L74G 3ZOXA 1SFCD 4UB8V 2MJZA 2UWJE 1SQBD 1AKKA 1PP9G 2CE0A 1CC5A 4JCGA 4PD4H 3RBZA 1NH4A 3L74J 4UB8E 4WY4C 2C1UA 1PP9J 1PPJD 5E79V 2QVAA 1USEA 2OTKE 2BASA 1DW3A 1IK9A 3B5NA 5B5EE 1JTHB 1YBKA 1M1JC 2I1KA 3EQ2A 5E79E 2AXTV 1YIQA 2HODA 1HWTC 1A8CA 1BCCG 5APUA 3Q5PA 2I1JA 1H32A 1HJ0A 5GTIE 1VQ8P 3L4FA 4QAOA 5DJQC 1FAVA 3L71J 3L70G 1GKSA 2AXTE 1BCCJ 5AW7B 3TGUJ 4H44B 1N73C 2BPBB 1JM0A 1NGMB 1S72P 4BRYB 2QJPB 1I8PA 2RMZA 1JCDA 3CX5E 2GC7D 3M9QA 4OGQC 2ZJSE 4WQAA 1CTJA 2YKQA 1SQXD 1DT1A 2HV4A 1ZRTE 3IFMA 3AE1C 1IQCA 1DW1A 1AQ5A 3MHVA 1HTLC 1S5LV 1NTZG 3TDKA 4XXLA 4EI2A 3RK2B 3H32A 5KAIH 2ZT9C 3AE6C 1C75A 2P10A 1CHJA 3HD7C 1YTZT 2KLVA 1NTZJ 1S5LE 4WQ9A 3F89A 3M0AA 2I8DA 1FZAA 1Q81Q 3GHGA 3NWVA 2W6JH 3L72G 1A02J 1SS1A 1G2CB 1RY3A 1J2JB 1JCCA 3LIDA 2WZ7A 1WRGA 3M91A 1CZQA 3M9BA 2G8YA 1CXAA 3L72J 2D0WA 3ITKA 2FBWC 1S2EA 1LJ2A 2VRSA 3M0DA 3HQ6A 2Y0DA 2ZVOB 3OCDA 2WVRA 3ZOYA 1DIPA 1IRWA 1U75B 1L0NE 1E79H 3H1IG 1VQ5P 1LT9C 1RF1A 1YQ3C 1Q86Q 4DZOA 4EYYQ 1FJKA 3H1IJ 4DOJA 1YEAA 1HJ5A 4H0LD 1H0TA 2V7QJ 1DX7A 2CK3H 4BXLA 3CI9A 4IL6V 4D6TG 2LR2A 1KMIZ 2IBZE 2Q1KA 3V2RA 4ASWA 2N3YA 4IFMA 3CC7P 3U1CA 3HQ7A 1NTMD 2M0BA 1FJPA 1PZQA 4IL6E 4ZKPA 3PHLA 4D6TJ 5AVVB 3IR9A 2YMYA 1OVRA 3TNUB 1HF9A 1U7JA 5CCHC 2ZFCA 2HFED 2CPBA 4IOIH 4WQ7A 3W68A 2Y0EA 2E74D 3SFEC 3D0WA 3NXSA 1MZ4A 1L4AC 2N9JA 2JWDA 2OTLP 3KHUA 1CCHA 1RQUA 3O6QB 1GZLA 1N7LA 1K04A 2D2CD 2KS1B 1VQ4P 2OZ1A 1S5LX 1CTYA 2QRXA 1QL1A 2J59M 2GB8B 1OFCX 1DEEG 2YIUC 3MTUE 2PRRA 1OIPA 3Q1MA 3M97X 2QJKB 1BGYG 1OVVA 1OZHA 1SQQD 1LNQA 3PTZA 2XTSB 1BGYJ 2XKMA 3AE5C 1CW5A 4O9BA 1KB9E 3AE3C 3V4QA 4LGDE 3H1LG 2KXPB 2Q6QA 4H0LB 4PJ0V 2E76C 3OJAB 3FXEA 4C7NB 1A56A 5KLVG 1HJ4A 1IZL0 3HUSA 1NVOA 3H1LJ 2P1JA 2Y0CA 4WQBA 1KILD 2GIWA 1YIJP 1SQVK 3U1AA 3BRTB 4PJ0E 2BCCE 2H89C 3I5CA 5KLVJ 2OYIC 1FS0E 1CI6B 5APXA 2WT7A 5IY51 2MHMA 4XE5B 2N3BA 2M8RA 1HBWA 3N7NA 1NIRA 1PGPA 5AVQB 1LWUA 2K1AA 3TNUA 1L9JC 4HB1A 2P58A 4IL6X 1N86A 1KYOW 1NU1G 1URQC 1VQPP 3AEAC 2ZAEB 2PCBB 1KQLA 2D2CB 2FFDB 5DFSA 3G71P 4EIDA 1M70A 2V08A 3CP5A 5KLVK 1WT6A 1NU1J 3IF4A 3P8MC 4WY4B 4C7RA 1VYDA 2KNCA 2IYOA 2GC4D 3NFQA 2NRGA 3MD0A 3VMXA 2A06E 1KX2A 3L73D 1FZEA 1PFIA 2MKVA 1LC2A 1S9KE 4OVNF 3PH0A 3WUTA 2KYVA 5DJQB 2QM8A 2OQQA 2K9JB 2B89A 3L74E 1DVHA 1KV4A 1NU1K 1QL3A 1Q82Q 1KIBA 1PP9E 4WQEA 4B86A 1GL2C 4C7NA 5CIGB 3FXDA 1HGZA 1BSHA 1QEXA 2KOGA 3A3YB 3L75D 1WMKA 2P7JA 4JYBA 1L0LG 1YYCA 3GLMA 3CCVP 3V4WA 1RE4C 5AW0B 1CRGA 4DCKA 3A0HV 2PGDA 1KQGB 3GG2A 4C46A 1OWAA 1D7MA 1L0LJ 4GODA 2NPSB 4EIJA 1BCCE 2V4HA 4N0KA 2YXRB 1SFCC 2N1TD 1JO5A 2FYUG 1N50A 3S9OA 1QYZA 3A0HE 1AOFA 2Q5UA 2HPCB 3L70E 1W2BO 3VYMA 1FDMA 4HYTB 1KD1Q 5C9MA 2FYUJ 3VRDA 1B7VA 4MN4C 1KN7A 3CCEP 4O1QA 3JCUE 2LITA 2FRCA 5KAFE 4XA4A 4WY4A 1I6DA 1EZVE 4TLFA 5APSA 3H6PA 1L0LK 4U3FG 1KC8Q 3WFCC 4H0KA 4FB1A 1M1JA 1SQBK 3PH2B 4W7ZA 3D6YA 4U3FJ 1FJ0A 5AW9B 1JY2N 1JMMA 1GTWA 2BCNB 1NTZE 3FWNA 3CCSP 3CL3D 3I56P 5B6QA 1CHIA 1M57D 1DD3A 3P8CE 1N73A 1HH0A 3H25A 1YFCA 5GTHV 1VF5D 1CHHA 2V07A 2RH0A 2OYHB 2YKOA 3S4RA 2XNDH 4KMGA 1ZP0C 5GTHE 1VQLP 1J1DC 4RKUJ 1FHBA 2B87B 1OW8A 5TISV 2OARA 1SQPG 4WQCA 2JQRA 4YE1A 1C2RA 1KB0A 3MK7B 3R4YA 4LLHA 1JMBA 3B5NB 1CYCA 1VQKP 1SQPJ 3HD7A 5TISE 3H1IE 2R5BA 1XTGB 3M9HA 3CYTI 2K88A 4WB4A 2HODB 4O1WA 4RJTA 5AVXB 3CX5D 1ZLLA 3GW6A 5KLIC 3B8EB 1H32B 1CRHA 1CSVA 2M3EA 2WPRA 4I6MC 4D6TE 1NNOA 1CORA 2E42A 4YXWH 2FYNB 3O20A 4L73A 1JEKA 2L4DA 2D0SA 2FXMA 5AW1B 3EFGA 4H44D 5BVZA 1N9CA 1FE6A 2AEMA 1T2KC 1DIQC 1VF5B 4W7YA 4K3AA 1KORA 3WU2H 3CC2P 1LT9A 2IBZI 2HR3A 4EIEA 4FA4A 1N2DC 2NZ2A 3H32B 1NTMJ 2WTYA 2L5GB 1A02F 4FAVA 2OYIB 4I2LC 3ZDMA 2H43A 1LS9A 1FZCC 1BGYE 1NJIQ 1GW4A 1VQNP 3ZCFA 3RK2D 2E5TA 2B87A 3O8ZA 3GHGB 2E74C 5EXQA 5CCHA 4AALA 3ORVA 1FI7A 4A7PA 1YHQP 3VMZA 3H1LE 1L0ND 1JY2P 1NTMK 1MG3D 1FI3A 1L4AA 1N7SC 1R5SA 3L71G 5KLVE 1GU5A 1PL5A 4NPFX 1WEJF 5AW5B 3TGUG 3HE4A 4GDOA 3WFBC 3CXHI 1PIXA 1HUCA 3OCDB 3D71A 2PFXA 2IBZD 3V2PA 2K37A 1RF1B 4LJIA 4DJGA 3F5HA 1K9MQ 3V2QA 1VQ7P 3BCCG 1J1EB 2XNXA 5APTA 2JO1A 1H0TB 4KJMA 3C8VA 1VL2A 2ZXEB 5AVWB 1NU1E 3BCCJ 4YXDC 1M8OB 1KILC 2N18B 1GL2B 4L74A 1GD2E 1JOCA 5H2FH 3A0BH 1M60A 5AW2B 1H33A 2QEXP 2OYIA 3PRJA 1CRIA 3N4XA 2EXVA 1YEBA 1KYOE 1BDCA 3VOPA 1LTTC 1RE3C 3CXHD 1IFPA 3V6IA 2JEEA 3SFDC 2OZ1B 3W67A 3SWYA 4L1QA 1OMIA 1VQOP 4BWNA 1KB9D 1HVVA 1RF0C 1URQA 1CIGA 2C9NY 1RZ6A 1K3HA 1S1CX 4H13C 1NOHA 3OAKA 5DJTB 2E75C 1P84E 4PV1C 1L0LE 5AW3B 1L9BC 4NFGB 1DW2A 2BCCD 3Q3DA 4U7JA 1EDKA 2RN0A 3H1KE 1I54A 1VDFA 3WU2V 3CLQA 4AAOA 3HUSB 4GKGA 3R2PA 3E1RA 3RK3B 2FYUE 1H31A 2OGUA 2P67A 1CSUA 1C6RA 2JDIH 2C9LY 3SJLA 3M06A 4R4MA 2WT7B 3V2NA 1GL2A 1DH3A 4FANA 1NTKG 3CWBE 3G4SP 1L2PA 1LWUB 2CA3B 4I7ZC 3FX0A 4GYDA 2R5DA 4U3FE 2KIKA 2Q3IA 3DMIA 4NPEA 2YO2A 1NTKJ 1RE4A 5AVTB 1XTCC 2DVHA 3HTKB 3RK3E 3H1HG 2A06D 2N1TC 3RBXA 2Q3EA 2QM7A 1HZUA 3MIWA 4PD4E 1N8RQ 5CCGD 3KQGA 2QJYB 5AVZB 1R8EA 1S9KD 1SFCA 3H1HJ 2PCCB 3C2CA 4FA1A 3WUVA 1SQVG 2KNCB 1FOCA 3RN0A 1EZVI 3L74D 3ZIYA 1N15A 4Y99B 4WY4D 1PP9D 4ZMDA 1SQVJ 3NMDA 3ZBMA 3A5TA 1NTKK 3B71A 2PAJA 1OW7A 2KSJA 1AOQA 1FOSE 4GOEA 1CSWA 2YQBA 2DW3A 3D70A 3VP9A 2W90A 1BCCD 1SQPE 2ZXYA 2WPSA 1AA0A 1PV3A 3O0RC 1ZMEC 3OA8A 3L70D 1KZUB 1BE3G 1NMLA 4JBZA 3AEFC 5KAIV 3RL0B 2LXBA 1KQSO 1NWQA 4V2KA 5CIHB 1AYGA 1BE3J 1HRCA 3AEBC 3WC8A 1DIIC 5DF5A 1EZVD 5KAIE 2Z5IA 2J58A 2M5AA 2B11B 1LP1A 2NPSD 5BU5A 1T8ZA 3BATA 1FZCB 1OW6A 2M3BA 3HTKA 1YJNP 3MP7B 3AE4C 2YXQB 3H1JG 2QSIA 1G1JA 1COTA 2R44A 1NTZD 2K9YA 2A45I 4PW9B 3O5CA 5KJ7C 3GF7A 3KZIH 2KI7B 3H1JJ 1EDIA 351CA 2Q7CA 3T97A 1M1JB 1K73Q 2B9BA 3P8CD 1C6SA 2WITA 5AVYB 3D6ZA 2N9YB 2C8SA 5EFWB 2R32A 3RMZA 3PLNA 1IFNA 1R5LA 1JY2O 4Y5RA 2FWLA 3HE5A 1E8EA 1JB0J 3G6EP 3VN0A 1EDLA 1N73B 4K3IA 3VTPC 4H44C 1FOSF 5CYTR 2QJPC 1FI9A 3E7KA 4OGQB 3ABVC 1FU1A 1FCDC 4UB6H 2BEQD 3VMYA 1RQVA 3JC22 1RZ5A 1CCRA 4DT0A 2WPVB 3H1ID 2B0ZB 1MUUA 1SQBG 1DW0A 3L71E 1YI2P 2W6AA 3TGUE 3PP5A 5CBOA 1EQ7A 1SQBJ 1Q7YQ 4AANA 4Q5PA 3MUDC 1K3GA 1PPJG 2OYOA 1G1IA 1MV8A 2ZT9B 3RK2C 1GQ1A 4FA9A 3HD7B 4AX3A 1FZCA 1EB7A 5CCHD 4WQDA 3BCCE 2WWWA 2Z4EA 3B5ND 2BEZF 4AYCA 1KILE 3DR0A 4XYDB 4UB8H 1IO3A 2C2CA 1DD4A 2P2UA 5AW8B 2IBZG 1HROA 3BASA 2O01N 5DJUB 1I6EA 5B5EH 3K5BA 1LTGC 1N7SA 1VQ6P 2IZ1A 3USSA 1HH7A 3SVWA 5E79H 4PV1B 2H8PD 2KZIA 1KFNA 2WSFH 3IAOA 1USDA 3CX5I 1MKMA 3JBTB 1ZOYC 5GTIH 1SQXG 2WMMA 4EOTA 2B12B 2C1VA 1LT9B 2AXTH 1L0NK 1BGYD 1X0TA 4IFFA 4GIFA 3G9RA 1F1CA 1SQXJ 1I8OA 3PXWA 3CX5H 2WPQA 1YCCA 3L72E 2AXCA 1NAFA 3CU4A 3AE9C 3OW2O 1IC2A 3Q5SA 1I55A 3H1LD 2K3RA 1W5CT 4JYCA 1IZNB 1OVUA 1KILA 4JPZB 4I1LA 2XZRA 1RAPA 1AVYA 3NBTA 1KYOI 1JY3N 451CA 3E1IA 2WSSH 3S1KA 3WFDC 1BL9A 1SQXK 3CMEP 3KZIV 1W2LA 1YITP 3HQ9A 2R3SA 1LFMA 1L4AB 1S5LH 1SP4A 2LXCB 1RE3A 3HE4B 1ZN5A 1EXJA 3I55P 2ZZS1 4GEDB 2WSCH 3A2AA 3TK1A 1M56D 2KSEA 4JF7A 2Z5HA 4RESB 1Y47A 4HKZH 2BCCG 2YIUB 1RF0A 1IRVA 1VQ9P 2YO3A 5CIBB 1ZRTD 2FXPA 1PGOA 2QJKC 3C9IA 1CRJA 1NTKE 2BCCJ 2CXBA 1QVFO 1C52A 4EIFA 4N3YB 2ORLA 4DY9A 4Z1MH 1QLED 2WQYC 4UB6V 3H1HE 1AQTA 1GU2A 1X22A 3DP5A 2E76B 4H0LC 1KYOD 1IK7A 1NTMG 1LTAC 1X8YA 3GF3A 3V5BA 1SQVE 3SWFA 2Y9ZA 1H33B 2JJLA 3MZWB 1GL2D 5CIFB 3TSIA 4RSZA 2JR8A 1GK6A 1LTBC 1FDIA 1T3JA 1M90Q 4Y28J 3O1YA 3AE2C 1BDDA 3MGNA 2N9IA 4IL6H 3CD6P 1P84D 1GDTA 2ZVNB 3SWKA 1L0LD 1CIFA 5BU8B 2W8ZA 1FBMA 5CCGC 4GOFA 3WUUA 1URQB 2W83C 2XV5A 2ZYDA 2N1TA 2E5YA 2BH5X 3H1KD 2D2CC 2GUSA 2FFDC 5AVUB 1JDLA 1SQQG 5B5EV 3AEGC 2HLOA 2FYUD 1RAQA 1YJWP 4YTPC 1JUNA 2FYZA 1SQQJ 1BE3E 5C39A 1AJYA 4AAMA 2GUVA 2W27A 5GTIV 3TYYA 1KB9I 4WBAA 2O3JA 3CWBD 1H31B 3CPWO 2H7HA 1E29A 4EICA 3CCJP 4LC1A 5CBNA 1IFJA 5TJHA 3CXHH 1GMJA 3PJSK 5CIDB 2IX7C 4U3FD 1M1KQ 4N78E 1UIXA 3RK3D 1HJ3A 1KB9H 1Y8AA 1JY3P 2IZ0A 3HQ8A 4PD4D 3L70J 2HG5D 3RL0g 1SQQK 1GK4A 3H1JE 1CYIA 5KKZC 1LC1A 3WMM0 5APWA 1EZVG 3VNWA 2IPPA 1H9YA 2ZYAA 1DVVA 4HJGH 4PJ0H 1TU3F 1GJQA 1I5TA 3AE8C 5CJ4A 3FGAD 4HH2A 2NPSC 2ZONG 1SFCB 3B4SA 1X79B 3HRNA 2IYPA 3P7KA 2VHDA 2C1DA 4YPCA 2PP6A 3AEDC 5CJ0A 3WFEC 1U74B 2LKMA 4MU8A 4JQ0D 1Q2NA 3LW5J 3L73G 3NTNA 1SQPD 2KP8A 2QA4P 1YTCA 1QKSA 5M1BA 2BGVX 1H9XA 1NO4A 5B66H 4L3HA 1OXZA 5KJ7A 4CPGA 3L73J 3WUIA 2C9XB 1FZBA 1JTHA 1SQBE 3P32A 1QL2A 1S4XA 2FY8A 2DGEA 1MFTA 1IFDA 3OA8B 1FC2C 2O1KA 1PPJE 1NTZK 3L75G 1LT1A 3Q2YA 3II6A 1IJDB 3WU2E 1QVGO 1H8AA 1ZW0A 1LTJC 3OA7A 3L75J 2FXOA 1T2KD 1K8AQ 2ZOOA 4BRYA 1CO6A 3CCUP 1OCDA 2A45G 1FZGA 3RL0D 1S6VB 2OYHC 2M5AB 2W6BA 1LP1B 2XDJA 2B4ZA 2MTAC 1J1DB 3EFFK 1M6ZA 2YNYA 1AFOA 3CCRP 1YQ4C 1NYHA 1ETPA 1SLQA 1ZZHA 3MUDA 4GT1A 2ZXXA 3MK7C 3A0HH 4M3LA 3L4OA 1CRYA 1SQXE 3B5NC 3T97B 2QIWA 2G3AA 1CSXA 1X9VA 2KK7A 1E5WA 3KYQA 5KLIB 5APVA 3Q5RA 1KQFB 3JCUH 3ZOOA 2YKPA 1N7SD 5KAFH 3HE5B 1IO4A 1G2CA 1IFMA 2WSEJ 1LTIC 1EDJA 2QE7H 3BRVB 3L71D 155CA 2FYNC 1GDVA 3CXHE 3TGUD 2N9BA 3A9FA 1Y9BA 2RKLA 4FA5A 1FDOA 3VP8A 3KDPB 3CCQP 5H2FV 3A0BV 2XU6A 1HZVA 1SVFA 1VF5C 3LW5H 4OGQD 3IN6A 3CX5W 1C2NA 4R4LA 5H2FE 3BCCD 3A0BE 2ZBOA 1W5CE 2ZYGA 1RHZB 1YTZI 2QG4A 2L91A 2E43A 4PWAA 5CICB 4J20A 4H0JA 4L3GA 2WSFJ 4RO0A 5GTHH 3G3ZA 2KUBA 1E2RA 1CXCA 1C6OA 2ZT9D 3HD7D 4KHXA 3GHGC 2E74B 1HGVA 1FZFA 1AVOA 1KFMA 1LMSA 3KPEA 1YJ9P 2YCCA 5B66V 4L75A 2LIRA 4W80A 1NKNA 5TISH 3PXTA 1NTME 2O01J 3X39A 1N7SB 4NPDA 2V7QH 1WVEC 1EXIA 5B66E 1MZ9A 3O6QA 2A45H 2KLUA 3M0DC 2AI5A 2KS1A 4H13D 3L72D 1F1FA 4TT3H 2AEFA 2BLFB 1QX8A 3QWOC 4EDFA 2E75D 5CHXA 4PV1D 1CTZA 1U7MA 1RF1C 2Y9YA 1ZXGA 1OAEA 3SSUA 1MG2D 1J1EC 1M7LA 1CIEA 2HYNA 2R3CA 3EWKA 4WVZA 2WSCJ 5AVSB 3U59A 1KILB 1CIHA 3VMAA 1SQQE 2N18C 5KKZB 1J3SA 2WSEH 3GMAA 1JY3O 1KTMA 1GIWA 5AW6B 2C0WA 1N90A 2Q9IA 4D6TD 1HCMA 2AEJA 2PACA 3QH9A 1NMIA 1QGKB 1YNRA 1GU4A 5C0ZA 1PGQA 1QN2A 5K5GB 1L0NG 3H1KG 3AE7C 1CI6A 1PGJA 2OTJP 1H1OA 1NTKD 5AW4B 1VQMP 3ZOWA 1L0NJ 3H1KJ 2JP3A 1ZR4A 1L4AD 5CCGA 2GA1A 5KAFV 3SLEA 3H1HD 3L36A 5AVRB 1GW3A 4P4QB 3RN1A 4H13B 2FFDA 1CSBA 1CNOA 3UIAA 3LIEA 3CWBG 2E75B 2GM4A
chains in the Genus database with same CATH topology
1SQVD 5IY51 2MHMA 1L9BC 4NFGB 2N3BA 3O1YA 1DW2A 1NIRA 2BCCD 2N9IA 3FWLA 2RN0A 1P84D 1I54A 1L9JC 1L0LD 1CIFA 3CXHW 3WU2V 4AAOA 1KYOW 1H31A 2PCBB 2BH5X 3H1KD 2CE1A 1CSUA 5CIEB 5DFSA 4EIDA 1M70A 1C6RA 2V08A 1R0QA 1JDLA 5B5EV 3CP5A 3SJLA 2CA4B 2FYUD 3TYIA 1RAQA 1VYDA 2BH4X 5KLVD 2GC4D 5AURA 4FANA 4AAMA 5GTIV 2CA3B 4WQ8A 1CEDA 4GYDA 1KX2A 2O3JA 3L73D 3DMIA 1BE3D 3L4MA 1LC2A 3CWBD 1H31B 1E29A 2DVHA 4EICA 2A06D 2Q3EA 5TJHA 1HZUA 5DJQB 1KX7A 5CIDB 4U3FD 1CYJA 2K9JB 1CRCA 1A2SA 2QJYB 2B10B 1DVHA 1QL3A 1KIBA 1HJ3A 2PCCB 3C2CA 4FA1A 4WQEA 3HQ8A 2KNCB 4PD4D 1FOCA 3RN0A 5CIGB 1CYIA 1NU1D 3L74D 3ZIYA 1N15A 1LC1A 3TF5A 2I8FA 1PP9D 2YK3A 3L75D 3VNWA 3NBSA 1H9YA 1DVVA 3ZBMA 3H1JD 1CRGA 3A0HV 3SXTA 3GG2A 1AOQA 1YICA 1GJQA 1I5TA 1KV9A 3SWSA 1CSWA 2ZONG 4N0KA 2YQBA 1N50A 1QYZA 2VHDA 3RLMA 2C1DA 1AOFA 2JTIB 1BCCD 2ZXYA 3PXSA 3VYMA 3O0RC 3WFEC 1U74B 5C9MA 3OA8A 4MU8A 3VRDA 1B7VA 1QL4A 3L70D 1SQPD 4O1QA 1NMLA 2LITA 2FRCA 1YTCA 5KAIV 1QKSA 1I6DA 2BGVX 1H9XA 4L3HA 4V2KA 1C7MA 5CIHB 1AYGA 3WUIA 2C9XB 2JWAA 1HRCA 3WFCC 4H0KA 4FB1A 3WC8A 1DIIC 5DF5A 2C1DB 1EZVD 3PH2B 2B11B 2DGEA 2AIUA 1FJ0A 3ZOXA 4UB8V 2BCNB 3OA8B 1SQBD 1AKKA 2CE0A 5B6QA 1CC5A 4JCGA 1CHIA 1COTA 1NTZD 2C1UA 1PPJD 4PW9B 5E79V 3O5CA 1YFCA 5GTHV 2ZOOA 1CHHA 1CO6A 2V07A 1DW3A 1OCDA 351CA 1C6SA 1S6VB 2AXTV 1YIQA 2B4ZA 2MTAC 4KMGA 2N9YB 1A8CA 2C8SA 3RMZA 1M6ZA 1H32A 3PLNA 1FHBA 4Y5RA 4QAOA 5DJQC 1GKSA 1ETPA 2FWLA 5TISV 1E8EA 4WQCA 2JQRA 4YE1A 4K3IA 1C2RA 1KB0A 1ZZHA 3MK7B 2BPBB 3MK7C 5CYTR 2QJPB 1I8PA 1FI9A 3L4OA 1CRYA 2RMZA 1CYCA 2GC7D 4WQAA 1CSXA 1CTJA 1FCDC 3CYTI 4O1WA 1RZ5A 4RJTA 1CCRA 1SQXD 1DT1A 5KLIB 2HV4A 3CX5D 3GW6A 3H1ID 2B0ZB 1H32B 1CRHA 3ZOOA 1CSVA 1DW0A 1IQCA 1DW1A 1NNOA 1CORA 1S5LV 4AANA 4Q5PA 3TDKA 1K3GA 4XXLA 2FYNB 3L71D 155CA 3O20A 1GDVA 1GQ1A 4FA9A 2L4DA 1C75A 4AX3A 1CHJA 3TGUD 2D0SA 3A9FA 4FA5A 1EB7A 1N9CA 5H2FV 1DIQC 3A0BV 4WQDA 4WQ9A 1HZVA 3NWVA 3DR0A 3CX5W 4XYDB 1C2NA 1IO3A 2C2CA 3BCCD 1HROA 2ZBOA 1I6EA 4EIEA 4FA4A 1CXAA 2QG4A 2L91A 4FAVA 4PWAA 5CICB 4J20A 1HH7A 4H0JA 3SVWA 4L3GA 2D0WA 3ITKA 1LS9A 3HQ6A 2Y0DA 3ZCFA 1E2RA 3OCDA 3JBTB 1CXCA 1C6OA 3ZOYA 1IRWA 1U75B 2B12B 2C1VA 1BGYD 5EXQA 1LMSA 4AALA 3ORVA 1FI7A 2YCCA 5B66V 4A7PA 1F1CA 1I8OA 2LIRA 3PXWA 1L0ND 1YEAA 1HJ5A 3PXTA 1YCCA 4IL6V 3X39A 1MG3D 1FI3A 3CU4A 1WVEC 1I55A 1WEJF 3H1LD 2N3YA 1W5CT 3WFBC 2AI5A 3HQ7A 1NTMD 3OCDB 2KS1A 3L72D 1F1FA 1RAPA 3NBTA 3PHLA 2BLFB 2IBZD 4EDFA 451CA 1CTZA 4LJIA 1OAEA 4WQ7A 3WFDC 1BL9A 2Y0EA 1MG2D 1CIEA 3KZIV 1W2LA 3HQ9A 1LFMA 1MZ4A 2N9JA 3KHUA 1CCHA 2ZZS1 4GEDB 1CIHA 3VMAA 2OZ1A 2N18B 1CTYA 2N18C 2YIUB 2GB8B 5KKZB 1IRVA 5CIBB 1ZRTD 1J3SA 3M97X 2QJKB 1M60A 1GIWA 1H33A 1SQQD 1CRJA 1N90A 4D6TD 1HCMA 2CXBA 2PACA 1NMIA 1C52A 3PRJA 4EIFA 1YNRA 1CRIA 5C0ZA 3PTZA 1QN2A 2EXVA 2XTSB 1YEBA 1H1OA 1NTKD 2ORLA 4DY9A 4UB6V 3CXHD 3ZOWA 1GU2A 2OZ1B 3DP5A 4PJ0V 1KYOD 4L1QA 1A56A 1HJ4A 1IZL0 1KB9D 5KAFV 3SLEA 3H1HD 2Y0CA 4WQBA 1CIGA 1H33B 2GIWA 1RZ6A 4P4QB 3RN1A 1K3HA 5CIFB 1CNOA 4RSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV D;  5IY5 1;  2MHM A;  1L9B C;  4NFG B;  2N3B A;  3O1Y A;  1DW2 A;  1NIR A;  2BCC D;  2N9I A;  3FWL A;  2RN0 A;  1P84 D;  1I54 A;  1L9J C;  1L0L D;  1CIF A;  3CXH W;  3WU2 V;  4AAO A;  1KYO W;  1H31 A;  2PCB B;  2BH5 X;  3H1K D;  2CE1 A;  1CSU A;  5CIE B;  5DFS A;  4EID A;  1M70 A;  1C6R A;  2V08 A;  1R0Q A;  1JDL A;  5B5E V;  3CP5 A;  3SJL A;  2CA4 B;  2FYU D;  3TYI A;  1RAQ A;  1VYD A;  2BH4 X;  5KLV D;  2GC4 D;  5AUR A;  4FAN A;  4AAM A;  5GTI V;  2CA3 B;  4WQ8 A;  1CED A;  4GYD A;  1KX2 A;  2O3J A;  3L73 D;  3DMI A;  1BE3 D;  3L4M A;  1LC2 A;  3CWB D;  1H31 B;  1E29 A;  2DVH A;  4EIC A;  2A06 D;  2Q3E A;  5TJH A;  1HZU A;  5DJQ B;  1KX7 A;  5CID B;  4U3F D;  1CYJ A;  2K9J B;  1CRC A;  1A2S A;  2QJY B;  2B10 B;  1DVH A;  1QL3 A;  1KIB A;  1HJ3 A;  2PCC B;  3C2C A;  4FA1 A;  4WQE A;  3HQ8 A;  2KNC B;  4PD4 D;  1FOC A;  3RN0 A;  5CIG B;  1CYI A;  1NU1 D;  3L74 D;  3ZIY A;  1N15 A;  1LC1 A;  3TF5 A;  2I8F A;  1PP9 D;  2YK3 A;  3L75 D;  3VNW A;  3NBS A;  1H9Y A;  1DVV A;  3ZBM A;  3H1J D;  1CRG A;  3A0H V;  3SXT A;  3GG2 A;  1AOQ A;  1YIC A;  1GJQ A;  1I5T A;  1KV9 A;  3SWS A;  1CSW A;  2ZON G;  4N0K A;  2YQB A;  1N50 A;  1QYZ A;  2VHD A;  3RLM A;  2C1D A;  1AOF A;  2JTI B;  1BCC D;  2ZXY A;  3PXS A;  3VYM A;  3O0R C;  3WFE C;  1U74 B;  5C9M A;  3OA8 A;  4MU8 A;  3VRD A;  1B7V A;  1QL4 A;  3L70 D;  1SQP D;  4O1Q A;  1NML A;  2LIT A;  2FRC A;  1YTC A;  5KAI V;  1QKS A;  1I6D A;  2BGV X;  1H9X A;  4L3H A;  4V2K A;  1C7M A;  5CIH B;  1AYG A;  3WUI A;  2C9X B;  2JWA A;  1HRC A;  3WFC C;  4H0K A;  4FB1 A;  3WC8 A;  1DII C;  5DF5 A;  2C1D B;  1EZV D;  3PH2 B;  2B11 B;  2DGE A;  2AIU A;  1FJ0 A;  3ZOX A;  4UB8 V;  2BCN B;  3OA8 B;  1SQB D;  1AKK A;  2CE0 A;  5B6Q A;  1CC5 A;  4JCG A;  1CHI A;  1COT A;  1NTZ D;  2C1U A;  1PPJ D;  4PW9 B;  5E79 V;  3O5C A;  1YFC A;  5GTH V;  2ZOO A;  1CHH A;  1CO6 A;  2V07 A;  1DW3 A;  1OCD A;  351C A;  1C6S A;  1S6V B;  2AXT V;  1YIQ A;  2B4Z A;  2MTA C;  4KMG A;  2N9Y B;  1A8C A;  2C8S A;  3RMZ A;  1M6Z A;  1H32 A;  3PLN A;  1FHB A;  4Y5R A;  4QAO A;  5DJQ C;  1GKS A;  1ETP A;  2FWL A;  5TIS V;  1E8E A;  4WQC A;  2JQR A;  4YE1 A;  4K3I A;  1C2R A;  1KB0 A;  1ZZH A;  3MK7 B;  2BPB B;  3MK7 C;  5CYT R;  2QJP B;  1I8P A;  1FI9 A;  3L4O A;  1CRY A;  2RMZ A;  1CYC A;  2GC7 D;  4WQA A;  1CSX A;  1CTJ A;  1FCD C;  3CYT I;  4O1W A;  1RZ5 A;  4RJT A;  1CCR A;  1SQX D;  1DT1 A;  5KLI B;  2HV4 A;  3CX5 D;  3GW6 A;  3H1I D;  2B0Z B;  1H32 B;  1CRH A;  3ZOO A;  1CSV A;  1DW0 A;  1IQC A;  1DW1 A;  1NNO A;  1COR A;  1S5L V;  4AAN A;  4Q5P A;  3TDK A;  1K3G A;  4XXL A;  2FYN B;  3L71 D;  155C A;  3O20 A;  1GDV A;  1GQ1 A;  4FA9 A;  2L4D A;  1C75 A;  4AX3 A;  1CHJ A;  3TGU D;  2D0S A;  3A9F A;  4FA5 A;  1EB7 A;  1N9C A;  5H2F V;  1DIQ C;  3A0B V;  4WQD A;  4WQ9 A;  1HZV A;  3NWV A;  3DR0 A;  3CX5 W;  4XYD B;  1C2N A;  1IO3 A;  2C2C A;  3BCC D;  1HRO A;  2ZBO A;  1I6E A;  4EIE A;  4FA4 A;  1CXA A;  2QG4 A;  2L91 A;  4FAV A;  4PWA A;  5CIC B;  4J20 A;  1HH7 A;  4H0J A;  3SVW A;  4L3G A;  2D0W A;  3ITK A;  1LS9 A;  3HQ6 A;  2Y0D A;  3ZCF A;  1E2R A;  3OCD A;  3JBT B;  1CXC A;  1C6O A;  3ZOY A;  1IRW A;  1U75 B;  2B12 B;  2C1V A;  1BGY D;  5EXQ A;  1LMS A;  4AAL A;  3ORV A;  1FI7 A;  2YCC A;  5B66 V;  4A7P A;  1F1C A;  1I8O A;  2LIR A;  3PXW A;  1L0N D;  1YEA A;  1HJ5 A;  3PXT A;  1YCC A;  4IL6 V;  3X39 A;  1MG3 D;  1FI3 A;  3CU4 A;  1WVE C;  1I55 A;  1WEJ F;  3H1L D;  2N3Y A;  1W5C T;  3WFB C;  2AI5 A;  3HQ7 A;  1NTM D;  3OCD B;  2KS1 A;  3L72 D;  1F1F A;  1RAP A;  3NBT A;  3PHL A;  2BLF B;  2IBZ D;  4EDF A;  451C A;  1CTZ A;  4LJI A;  1OAE A;  4WQ7 A;  3WFD C;  1BL9 A;  2Y0E A;  1MG2 D;  1CIE A;  3KZI V;  1W2L A;  3HQ9 A;  1LFM A;  1MZ4 A;  2N9J A;  3KHU A;  1CCH A;  2ZZS 1;  4GED B;  1CIH A;  3VMA A;  2OZ1 A;  2N18 B;  1CTY A;  2N18 C;  2YIU B;  2GB8 B;  5KKZ B;  1IRV A;  5CIB B;  1ZRT D;  1J3S A;  3M97 X;  2QJK B;  1M60 A;  1GIW A;  1H33 A;  1SQQ D;  1CRJ A;  1N90 A;  4D6T D;  1HCM A;  2CXB A;  2PAC A;  1NMI A;  1C52 A;  3PRJ A;  4EIF A;  1YNR A;  1CRI A;  5C0Z A;  3PTZ A;  1QN2 A;  2EXV A;  2XTS B;  1YEB A;  1H1O A;  1NTK D;  2ORL A;  4DY9 A;  4UB6 V;  3CXH D;  3ZOW A;  1GU2 A;  2OZ1 B;  3DP5 A;  4PJ0 V;  1KYO D;  4L1Q A;  1A56 A;  1HJ4 A;  1IZL 0;  1KB9 D;  5KAF V;  3SLE A;  3H1H D;  2Y0C A;  4WQB A;  1CIG A;  1H33 B;  2GIW A;  1RZ6 A;  4P4Q B;  3RN1 A;  1K3H A;  5CIF B;  1CNO A;  4RSZ A; 
#chains in the Genus database with same CATH topology
 4WWI A;  1SQV D;  1DEB A;  4QMA A;  2C0X A;  2IDB A;  3CWB J;  1H89 A;  3FWL A;  3CXH W;  3RGU A;  3AEE C;  3HUS C;  2B88 A;  3JSV C;  1T6A A;  3RK3 C;  5CMZ A;  2FYU K;  1LGH B;  1K05 A;  1OX3 A;  2CE1 A;  2E76 D;  5CIE B;  1R0Q A;  2K9J A;  2O01 H;  1HJB A;  2CA4 B;  3CMA P;  3TYI A;  1JNM A;  1LTJ B;  2BH4 X;  4OH8 B;  3L73 E;  5KLV D;  5AUR A;  1IFI A;  1ZR2 A;  2KB7 P;  4I7Z B;  4WQ8 A;  1LWU C;  1CED A;  3L37 A;  3A7O A;  5L8R J;  1BE3 D;  5APQ A;  1ZV8 A;  3L4M A;  2IFN A;  4K35 A;  2N1T B;  3CCL P;  1KX7 A;  4AQR D;  1CYJ A;  1CRC A;  1A2S A;  2ITA A;  2B10 B;  1KYO H;  2NPS A;  2QJY C;  1URQ D;  1MFZ A;  3BVH A;  3L75 E;  2FKW B;  3KZI E;  4KT0 J;  1P84 I;  2HPC A;  2IFM A;  1NU1 D;  4N78 D;  3TF5 A;  2I8F A;  2YK3 A;  4Y99 C;  1Z56 A;  4L76 A;  5KJ7 D;  3CCM P;  4OWF A;  3NBS A;  1LTS C;  1RH5 B;  3H1J D;  2YMK A;  2J5U A;  3SXT A;  4ZKU A;  1NKZ B;  4ASV A;  4IFD K;  2JKV A;  1YIC A;  1P84 H;  1KV9 A;  3SWS A;  2O1J A;  2POH A;  2SPZ A;  4N6J A;  1VPC A;  3RLM A;  5KTB A;  2CPS A;  1H88 A;  1T3U A;  2JTI B;  1S3J A;  3PXS A;  1SQP K;  2H88 C;  3AEC C;  1EC5 A;  4UB6 E;  1AV1 A;  1UII A;  1QL4 A;  3C1L A;  1BSN A;  4ZNC A;  1W2E A;  3VYI A;  1Q90 D;  3L35 A;  2A06 G;  1U57 A;  1LTJ A;  3RL0 C;  1C7M A;  3CC4 P;  2KZJ A;  4AUW A;  4PD4 I;  3KXD A;  2JWA A;  4XFJ A;  1NHL A;  1NAY A;  2C1D B;  2OYH A;  5APY A;  2AIU A;  3L74 G;  3ZOX A;  1SFC D;  4UB8 V;  2MJZ A;  2UWJ E;  1SQB D;  1AKK A;  1PP9 G;  2CE0 A;  1CC5 A;  4JCG A;  4PD4 H;  3RBZ A;  1NH4 A;  3L74 J;  4UB8 E;  4WY4 C;  2C1U A;  1PP9 J;  1PPJ D;  5E79 V;  2QVA A;  1USE A;  2OTK E;  2BAS A;  1DW3 A;  1IK9 A;  3B5N A;  5B5E E;  1JTH B;  1YBK A;  1M1J C;  2I1K A;  3EQ2 A;  5E79 E;  2AXT V;  1YIQ A;  2HOD A;  1HWT C;  1A8C A;  1BCC G;  5APU A;  3Q5P A;  2I1J A;  1H32 A;  1HJ0 A;  5GTI E;  1VQ8 P;  3L4F A;  4QAO A;  5DJQ C;  1FAV A;  3L71 J;  3L70 G;  1GKS A;  2AXT E;  1BCC J;  5AW7 B;  3TGU J;  4H44 B;  1N73 C;  2BPB B;  1JM0 A;  1NGM B;  1S72 P;  4BRY B;  2QJP B;  1I8P A;  2RMZ A;  1JCD A;  3CX5 E;  2GC7 D;  3M9Q A;  4OGQ C;  2ZJS E;  4WQA A;  1CTJ A;  2YKQ A;  1SQX D;  1DT1 A;  2HV4 A;  1ZRT E;  3IFM A;  3AE1 C;  1IQC A;  1DW1 A;  1AQ5 A;  3MHV A;  1HTL C;  1S5L V;  1NTZ G;  3TDK A;  4XXL A;  4EI2 A;  3RK2 B;  3H32 A;  5KAI H;  2ZT9 C;  3AE6 C;  1C75 A;  2P10 A;  1CHJ A;  3HD7 C;  1YTZ T;  2KLV A;  1NTZ J;  1S5L E;  4WQ9 A;  3F89 A;  3M0A A;  2I8D A;  1FZA A;  1Q81 Q;  3GHG A;  3NWV A;  2W6J H;  3L72 G;  1A02 J;  1SS1 A;  1G2C B;  1RY3 A;  1J2J B;  1JCC A;  3LID A;  2WZ7 A;  1WRG A;  3M91 A;  1CZQ A;  3M9B A;  2G8Y A;  1CXA A;  3L72 J;  2D0W A;  3ITK A;  2FBW C;  1S2E A;  1LJ2 A;  2VRS A;  3M0D A;  3HQ6 A;  2Y0D A;  2ZVO B;  3OCD A;  2WVR A;  3ZOY A;  1DIP A;  1IRW A;  1U75 B;  1L0N E;  1E79 H;  3H1I G;  1VQ5 P;  1LT9 C;  1RF1 A;  1YQ3 C;  1Q86 Q;  4DZO A;  4EYY Q;  1FJK A;  3H1I J;  4DOJ A;  1YEA A;  1HJ5 A;  4H0L D;  1H0T A;  2V7Q J;  1DX7 A;  2CK3 H;  4BXL A;  3CI9 A;  4IL6 V;  4D6T G;  2LR2 A;  1KMI Z;  2IBZ E;  2Q1K A;  3V2R A;  4ASW A;  2N3Y A;  4IFM A;  3CC7 P;  3U1C A;  3HQ7 A;  1NTM D;  2M0B A;  1FJP A;  1PZQ A;  4IL6 E;  4ZKP A;  3PHL A;  4D6T J;  5AVV B;  3IR9 A;  2YMY A;  1OVR A;  3TNU B;  1HF9 A;  1U7J A;  5CCH C;  2ZFC A;  2HFE D;  2CPB A;  4IOI H;  4WQ7 A;  3W68 A;  2Y0E A;  2E74 D;  3SFE C;  3D0W A;  3NXS A;  1MZ4 A;  1L4A C;  2N9J A;  2JWD A;  2OTL P;  3KHU A;  1CCH A;  1RQU A;  3O6Q B;  1GZL A;  1N7L A;  1K04 A;  2D2C D;  2KS1 B;  1VQ4 P;  2OZ1 A;  1S5L X;  1CTY A;  2QRX A;  1QL1 A;  2J59 M;  2GB8 B;  1OFC X;  1DEE G;  2YIU C;  3MTU E;  2PRR A;  1OIP A;  3Q1M A;  3M97 X;  2QJK B;  1BGY G;  1OVV A;  1OZH A;  1SQQ D;  1LNQ A;  3PTZ A;  2XTS B;  1BGY J;  2XKM A;  3AE5 C;  1CW5 A;  4O9B A;  1KB9 E;  3AE3 C;  3V4Q A;  4LGD E;  3H1L G;  2KXP B;  2Q6Q A;  4H0L B;  4PJ0 V;  2E76 C;  3OJA B;  3FXE A;  4C7N B;  1A56 A;  5KLV G;  1HJ4 A;  1IZL 0;  3HUS A;  1NVO A;  3H1L J;  2P1J A;  2Y0C A;  4WQB A;  1KIL D;  2GIW A;  1YIJ P;  1SQV K;  3U1A A;  3BRT B;  4PJ0 E;  2BCC E;  2H89 C;  3I5C A;  5KLV J;  2OYI C;  1FS0 E;  1CI6 B;  5APX A;  2WT7 A;  5IY5 1;  2MHM A;  4XE5 B;  2N3B A;  2M8R A;  1HBW A;  3N7N A;  1NIR A;  1PGP A;  5AVQ B;  1LWU A;  2K1A A;  3TNU A;  1L9J C;  4HB1 A;  2P58 A;  4IL6 X;  1N86 A;  1KYO W;  1NU1 G;  1URQ C;  1VQP P;  3AEA C;  2ZAE B;  2PCB B;  1KQL A;  2D2C B;  2FFD B;  5DFS A;  3G71 P;  4EID A;  1M70 A;  2V08 A;  3CP5 A;  5KLV K;  1WT6 A;  1NU1 J;  3IF4 A;  3P8M C;  4WY4 B;  4C7R A;  1VYD A;  2KNC A;  2IYO A;  2GC4 D;  3NFQ A;  2NRG A;  3MD0 A;  3VMX A;  2A06 E;  1KX2 A;  3L73 D;  1FZE A;  1PFI A;  2MKV A;  1LC2 A;  1S9K E;  4OVN F;  3PH0 A;  3WUT A;  2KYV A;  5DJQ B;  2QM8 A;  2OQQ A;  2K9J B;  2B89 A;  3L74 E;  1DVH A;  1KV4 A;  1NU1 K;  1QL3 A;  1Q82 Q;  1KIB A;  1PP9 E;  4WQE A;  4B86 A;  1GL2 C;  4C7N A;  5CIG B;  3FXD A;  1HGZ A;  1BSH A;  1QEX A;  2KOG A;  3A3Y B;  3L75 D;  1WMK A;  2P7J A;  4JYB A;  1L0L G;  1YYC A;  3GLM A;  3CCV P;  3V4W A;  1RE4 C;  5AW0 B;  1CRG A;  4DCK A;  3A0H V;  2PGD A;  1KQG B;  3GG2 A;  4C46 A;  1OWA A;  1D7M A;  1L0L J;  4GOD A;  2NPS B;  4EIJ A;  1BCC E;  2V4H A;  4N0K A;  2YXR B;  1SFC C;  2N1T D;  1JO5 A;  2FYU G;  1N50 A;  3S9O A;  1QYZ A;  3A0H E;  1AOF A;  2Q5U A;  2HPC B;  3L70 E;  1W2B O;  3VYM A;  1FDM A;  4HYT B;  1KD1 Q;  5C9M A;  2FYU J;  3VRD A;  1B7V A;  4MN4 C;  1KN7 A;  3CCE P;  4O1Q A;  3JCU E;  2LIT A;  2FRC A;  5KAF E;  4XA4 A;  4WY4 A;  1I6D A;  1EZV E;  4TLF A;  5APS A;  3H6P A;  1L0L K;  4U3F G;  1KC8 Q;  3WFC C;  4H0K A;  4FB1 A;  1M1J A;  1SQB K;  3PH2 B;  4W7Z A;  3D6Y A;  4U3F J;  1FJ0 A;  5AW9 B;  1JY2 N;  1JMM A;  1GTW A;  2BCN B;  1NTZ E;  3FWN A;  3CCS P;  3CL3 D;  3I56 P;  5B6Q A;  1CHI A;  1M57 D;  1DD3 A;  3P8C E;  1N73 A;  1HH0 A;  3H25 A;  1YFC A;  5GTH V;  1VF5 D;  1CHH A;  2V07 A;  2RH0 A;  2OYH B;  2YKO A;  3S4R A;  2XND H;  4KMG A;  1ZP0 C;  5GTH E;  1VQL P;  1J1D C;  4RKU J;  1FHB A;  2B87 B;  1OW8 A;  5TIS V;  2OAR A;  1SQP G;  4WQC A;  2JQR A;  4YE1 A;  1C2R A;  1KB0 A;  3MK7 B;  3R4Y A;  4LLH A;  1JMB A;  3B5N B;  1CYC A;  1VQK P;  1SQP J;  3HD7 A;  5TIS E;  3H1I E;  2R5B A;  1XTG B;  3M9H A;  3CYT I;  2K88 A;  4WB4 A;  2HOD B;  4O1W A;  4RJT A;  5AVX B;  3CX5 D;  1ZLL A;  3GW6 A;  5KLI C;  3B8E B;  1H32 B;  1CRH A;  1CSV A;  2M3E A;  2WPR A;  4I6M C;  4D6T E;  1NNO A;  1COR A;  2E42 A;  4YXW H;  2FYN B;  3O20 A;  4L73 A;  1JEK A;  2L4D A;  2D0S A;  2FXM A;  5AW1 B;  3EFG A;  4H44 D;  5BVZ A;  1N9C A;  1FE6 A;  2AEM A;  1T2K C;  1DIQ C;  1VF5 B;  4W7Y A;  4K3A A;  1KOR A;  3WU2 H;  3CC2 P;  1LT9 A;  2IBZ I;  2HR3 A;  4EIE A;  4FA4 A;  1N2D C;  2NZ2 A;  3H32 B;  1NTM J;  2WTY A;  2L5G B;  1A02 F;  4FAV A;  2OYI B;  4I2L C;  3ZDM A;  2H43 A;  1LS9 A;  1FZC C;  1BGY E;  1NJI Q;  1GW4 A;  1VQN P;  3ZCF A;  3RK2 D;  2E5T A;  2B87 A;  3O8Z A;  3GHG B;  2E74 C;  5EXQ A;  5CCH A;  4AAL A;  3ORV A;  1FI7 A;  4A7P A;  1YHQ P;  3VMZ A;  3H1L E;  1L0N D;  1JY2 P;  1NTM K;  1MG3 D;  1FI3 A;  1L4A A;  1N7S C;  1R5S A;  3L71 G;  5KLV E;  1GU5 A;  1PL5 A;  4NPF X;  1WEJ F;  5AW5 B;  3TGU G;  3HE4 A;  4GDO A;  3WFB C;  3CXH I;  1PIX A;  1HUC A;  3OCD B;  3D71 A;  2PFX A;  2IBZ D;  3V2P A;  2K37 A;  1RF1 B;  4LJI A;  4DJG A;  3F5H A;  1K9M Q;  3V2Q A;  1VQ7 P;  3BCC G;  1J1E B;  2XNX A;  5APT A;  2JO1 A;  1H0T B;  4KJM A;  3C8V A;  1VL2 A;  2ZXE B;  5AVW B;  1NU1 E;  3BCC J;  4YXD C;  1M8O B;  1KIL C;  2N18 B;  1GL2 B;  4L74 A;  1GD2 E;  1JOC A;  5H2F H;  3A0B H;  1M60 A;  5AW2 B;  1H33 A;  2QEX P;  2OYI A;  3PRJ A;  1CRI A;  3N4X A;  2EXV A;  1YEB A;  1KYO E;  1BDC A;  3VOP A;  1LTT C;  1RE3 C;  3CXH D;  1IFP A;  3V6I A;  2JEE A;  3SFD C;  2OZ1 B;  3W67 A;  3SWY A;  4L1Q A;  1OMI A;  1VQO P;  4BWN A;  1KB9 D;  1HVV A;  1RF0 C;  1URQ A;  1CIG A;  2C9N Y;  1RZ6 A;  1K3H A;  1S1C X;  4H13 C;  1NOH A;  3OAK A;  5DJT B;  2E75 C;  1P84 E;  4PV1 C;  1L0L E;  5AW3 B;  1L9B C;  4NFG B;  1DW2 A;  2BCC D;  3Q3D A;  4U7J A;  1EDK A;  2RN0 A;  3H1K E;  1I54 A;  1VDF A;  3WU2 V;  3CLQ A;  4AAO A;  3HUS B;  4GKG A;  3R2P A;  3E1R A;  3RK3 B;  2FYU E;  1H31 A;  2OGU A;  2P67 A;  1CSU A;  1C6R A;  2JDI H;  2C9L Y;  3SJL A;  3M06 A;  4R4M A;  2WT7 B;  3V2N A;  1GL2 A;  1DH3 A;  4FAN A;  1NTK G;  3CWB E;  3G4S P;  1L2P A;  1LWU B;  2CA3 B;  4I7Z C;  3FX0 A;  4GYD A;  2R5D A;  4U3F E;  2KIK A;  2Q3I A;  3DMI A;  4NPE A;  2YO2 A;  1NTK J;  1RE4 A;  5AVT B;  1XTC C;  2DVH A;  3HTK B;  3RK3 E;  3H1H G;  2A06 D;  2N1T C;  3RBX A;  2Q3E A;  2QM7 A;  1HZU A;  3MIW A;  4PD4 E;  1N8R Q;  5CCG D;  3KQG A;  2QJY B;  5AVZ B;  1R8E A;  1S9K D;  1SFC A;  3H1H J;  2PCC B;  3C2C A;  4FA1 A;  3WUV A;  1SQV G;  2KNC B;  1FOC A;  3RN0 A;  1EZV I;  3L74 D;  3ZIY A;  1N15 A;  4Y99 B;  4WY4 D;  1PP9 D;  4ZMD A;  1SQV J;  3NMD A;  3ZBM A;  3A5T A;  1NTK K;  3B71 A;  2PAJ A;  1OW7 A;  2KSJ A;  1AOQ A;  1FOS E;  4GOE A;  1CSW A;  2YQB A;  2DW3 A;  3D70 A;  3VP9 A;  2W90 A;  1BCC D;  1SQP E;  2ZXY A;  2WPS A;  1AA0 A;  1PV3 A;  3O0R C;  1ZME C;  3OA8 A;  3L70 D;  1KZU B;  1BE3 G;  1NML A;  4JBZ A;  3AEF C;  5KAI V;  3RL0 B;  2LXB A;  1KQS O;  1NWQ A;  4V2K A;  5CIH B;  1AYG A;  1BE3 J;  1HRC A;  3AEB C;  3WC8 A;  1DII C;  5DF5 A;  1EZV D;  5KAI E;  2Z5I A;  2J58 A;  2M5A A;  2B11 B;  1LP1 A;  2NPS D;  5BU5 A;  1T8Z A;  3BAT A;  1FZC B;  1OW6 A;  2M3B A;  3HTK A;  1YJN P;  3MP7 B;  3AE4 C;  2YXQ B;  3H1J G;  2QSI A;  1G1J A;  1COT A;  2R44 A;  1NTZ D;  2K9Y A;  2A45 I;  4PW9 B;  3O5C A;  5KJ7 C;  3GF7 A;  3KZI H;  2KI7 B;  3H1J J;  1EDI A;  351C A;  2Q7C A;  3T97 A;  1M1J B;  1K73 Q;  2B9B A;  3P8C D;  1C6S A;  2WIT A;  5AVY B;  3D6Z A;  2N9Y B;  2C8S A;  5EFW B;  2R32 A;  3RMZ A;  3PLN A;  1IFN A;  1R5L A;  1JY2 O;  4Y5R A;  2FWL A;  3HE5 A;  1E8E A;  1JB0 J;  3G6E P;  3VN0 A;  1EDL A;  1N73 B;  4K3I A;  3VTP C;  4H44 C;  1FOS F;  5CYT R;  2QJP C;  1FI9 A;  3E7K A;  4OGQ B;  3ABV C;  1FU1 A;  1FCD C;  4UB6 H;  2BEQ D;  3VMY A;  1RQV A;  3JC2 2;  1RZ5 A;  1CCR A;  4DT0 A;  2WPV B;  3H1I D;  2B0Z B;  1MUU A;  1SQB G;  1DW0 A;  3L71 E;  1YI2 P;  2W6A A;  3TGU E;  3PP5 A;  5CBO A;  1EQ7 A;  1SQB J;  1Q7Y Q;  4AAN A;  4Q5P A;  3MUD C;  1K3G A;  1PPJ G;  2OYO A;  1G1I A;  1MV8 A;  2ZT9 B;  3RK2 C;  1GQ1 A;  4FA9 A;  3HD7 B;  4AX3 A;  1FZC A;  1EB7 A;  5CCH D;  4WQD A;  3BCC E;  2WWW A;  2Z4E A;  3B5N D;  2BEZ F;  4AYC A;  1KIL E;  3DR0 A;  4XYD B;  4UB8 H;  1IO3 A;  2C2C A;  1DD4 A;  2P2U A;  5AW8 B;  2IBZ G;  1HRO A;  3BAS A;  2O01 N;  5DJU B;  1I6E A;  5B5E H;  3K5B A;  1LTG C;  1N7S A;  1VQ6 P;  2IZ1 A;  3USS A;  1HH7 A;  3SVW A;  5E79 H;  4PV1 B;  2H8P D;  2KZI A;  1KFN A;  2WSF H;  3IAO A;  1USD A;  3CX5 I;  1MKM A;  3JBT B;  1ZOY C;  5GTI H;  1SQX G;  2WMM A;  4EOT A;  2B12 B;  2C1V A;  1LT9 B;  2AXT H;  1L0N K;  1BGY D;  1X0T A;  4IFF A;  4GIF A;  3G9R A;  1F1C A;  1SQX J;  1I8O A;  3PXW A;  3CX5 H;  2WPQ A;  1YCC A;  3L72 E;  2AXC A;  1NAF A;  3CU4 A;  3AE9 C;  3OW2 O;  1IC2 A;  3Q5S A;  1I55 A;  3H1L D;  2K3R A;  1W5C T;  4JYC A;  1IZN B;  1OVU A;  1KIL A;  4JPZ B;  4I1L A;  2XZR A;  1RAP A;  1AVY A;  3NBT A;  1KYO I;  1JY3 N;  451C A;  3E1I A;  2WSS H;  3S1K A;  3WFD C;  1BL9 A;  1SQX K;  3CME P;  3KZI V;  1W2L A;  1YIT P;  3HQ9 A;  2R3S A;  1LFM A;  1L4A B;  1S5L H;  1SP4 A;  2LXC B;  1RE3 A;  3HE4 B;  1ZN5 A;  1EXJ A;  3I55 P;  2ZZS 1;  4GED B;  2WSC H;  3A2A A;  3TK1 A;  1M56 D;  2KSE A;  4JF7 A;  2Z5H A;  4RES B;  1Y47 A;  4HKZ H;  2BCC G;  2YIU B;  1RF0 A;  1IRV A;  1VQ9 P;  2YO3 A;  5CIB B;  1ZRT D;  2FXP A;  1PGO A;  2QJK C;  3C9I A;  1CRJ A;  1NTK E;  2BCC J;  2CXB A;  1QVF O;  1C52 A;  4EIF A;  4N3Y B;  2ORL A;  4DY9 A;  4Z1M H;  1QLE D;  2WQY C;  4UB6 V;  3H1H E;  1AQT A;  1GU2 A;  1X22 A;  3DP5 A;  2E76 B;  4H0L C;  1KYO D;  1IK7 A;  1NTM G;  1LTA C;  1X8Y A;  3GF3 A;  3V5B A;  1SQV E;  3SWF A;  2Y9Z A;  1H33 B;  2JJL A;  3MZW B;  1GL2 D;  5CIF B;  3TSI A;  4RSZ A;  2JR8 A;  1GK6 A;  1LTB C;  1FDI A;  1T3J A;  1M90 Q;  4Y28 J;  3O1Y A;  3AE2 C;  1BDD A;  3MGN A;  2N9I A;  4IL6 H;  3CD6 P;  1P84 D;  1GDT A;  2ZVN B;  3SWK A;  1L0L D;  1CIF A;  5BU8 B;  2W8Z A;  1FBM A;  5CCG C;  4GOF A;  3WUU A;  1URQ B;  2W83 C;  2XV5 A;  2ZYD A;  2N1T A;  2E5Y A;  2BH5 X;  3H1K D;  2D2C C;  2GUS A;  2FFD C;  5AVU B;  1JDL A;  1SQQ G;  5B5E V;  3AEG C;  2HLO A;  2FYU D;  1RAQ A;  1YJW P;  4YTP C;  1JUN A;  2FYZ A;  1SQQ J;  1BE3 E;  5C39 A;  1AJY A;  4AAM A;  2GUV A;  2W27 A;  5GTI V;  3TYY A;  1KB9 I;  4WBA A;  2O3J A;  3CWB D;  1H31 B;  3CPW O;  2H7H A;  1E29 A;  4EIC A;  3CCJ P;  4LC1 A;  5CBN A;  1IFJ A;  5TJH A;  3CXH H;  1GMJ A;  3PJS K;  5CID B;  2IX7 C;  4U3F D;  1M1K Q;  4N78 E;  1UIX A;  3RK3 D;  1HJ3 A;  1KB9 H;  1Y8A A;  1JY3 P;  2IZ0 A;  3HQ8 A;  4PD4 D;  3L70 J;  2HG5 D;  3RL0 g;  1SQQ K;  1GK4 A;  3H1J E;  1CYI A;  5KKZ C;  1LC1 A;  3WMM 0;  5APW A;  1EZV G;  3VNW A;  2IPP A;  1H9Y A;  2ZYA A;  1DVV A;  4HJG H;  4PJ0 H;  1TU3 F;  1GJQ A;  1I5T A;  3AE8 C;  5CJ4 A;  3FGA D;  4HH2 A;  2NPS C;  2ZON G;  1SFC B;  3B4S A;  1X79 B;  3HRN A;  2IYP A;  3P7K A;  2VHD A;  2C1D A;  4YPC A;  2PP6 A;  3AED C;  5CJ0 A;  3WFE C;  1U74 B;  2LKM A;  4MU8 A;  4JQ0 D;  1Q2N A;  3LW5 J;  3L73 G;  3NTN A;  1SQP D;  2KP8 A;  2QA4 P;  1YTC A;  1QKS A;  5M1B A;  2BGV X;  1H9X A;  1NO4 A;  5B66 H;  4L3H A;  1OXZ A;  5KJ7 A;  4CPG A;  3L73 J;  3WUI A;  2C9X B;  1FZB A;  1JTH A;  1SQB E;  3P32 A;  1QL2 A;  1S4X A;  2FY8 A;  2DGE A;  1MFT A;  1IFD A;  3OA8 B;  1FC2 C;  2O1K A;  1PPJ E;  1NTZ K;  3L75 G;  1LT1 A;  3Q2Y A;  3II6 A;  1IJD B;  3WU2 E;  1QVG O;  1H8A A;  1ZW0 A;  1LTJ C;  3OA7 A;  3L75 J;  2FXO A;  1T2K D;  1K8A Q;  2ZOO A;  4BRY A;  1CO6 A;  3CCU P;  1OCD A;  2A45 G;  1FZG A;  3RL0 D;  1S6V B;  2OYH C;  2M5A B;  2W6B A;  1LP1 B;  2XDJ A;  2B4Z A;  2MTA C;  1J1D B;  3EFF K;  1M6Z A;  2YNY A;  1AFO A;  3CCR P;  1YQ4 C;  1NYH A;  1ETP A;  1SLQ A;  1ZZH A;  3MUD A;  4GT1 A;  2ZXX A;  3MK7 C;  3A0H H;  4M3L A;  3L4O A;  1CRY A;  1SQX E;  3B5N C;  3T97 B;  2QIW A;  2G3A A;  1CSX A;  1X9V A;  2KK7 A;  1E5W A;  3KYQ A;  5KLI B;  5APV A;  3Q5R A;  1KQF B;  3JCU H;  3ZOO A;  2YKP A;  1N7S D;  5KAF H;  3HE5 B;  1IO4 A;  1G2C A;  1IFM A;  2WSE J;  1LTI C;  1EDJ A;  2QE7 H;  3BRV B;  3L71 D;  155C A;  2FYN C;  1GDV A;  3CXH E;  3TGU D;  2N9B A;  3A9F A;  1Y9B A;  2RKL A;  4FA5 A;  1FDO A;  3VP8 A;  3KDP B;  3CCQ P;  5H2F V;  3A0B V;  2XU6 A;  1HZV A;  1SVF A;  1VF5 C;  3LW5 H;  4OGQ D;  3IN6 A;  3CX5 W;  1C2N A;  4R4L A;  5H2F E;  3BCC D;  3A0B E;  2ZBO A;  1W5C E;  2ZYG A;  1RHZ B;  1YTZ I;  2QG4 A;  2L91 A;  2E43 A;  4PWA A;  5CIC B;  4J20 A;  4H0J A;  4L3G A;  2WSF J;  4RO0 A;  5GTH H;  3G3Z A;  2KUB A;  1E2R A;  1CXC A;  1C6O A;  2ZT9 D;  3HD7 D;  4KHX A;  3GHG C;  2E74 B;  1HGV A;  1FZF A;  1AVO A;  1KFM A;  1LMS A;  3KPE A;  1YJ9 P;  2YCC A;  5B66 V;  4L75 A;  2LIR A;  4W80 A;  1NKN A;  5TIS H;  3PXT A;  1NTM E;  2O01 J;  3X39 A;  1N7S B;  4NPD A;  2V7Q H;  1WVE C;  1EXI A;  5B66 E;  1MZ9 A;  3O6Q A;  2A45 H;  2KLU A;  3M0D C;  2AI5 A;  2KS1 A;  4H13 D;  3L72 D;  1F1F A;  4TT3 H;  2AEF A;  2BLF B;  1QX8 A;  3QWO C;  4EDF A;  2E75 D;  5CHX A;  4PV1 D;  1CTZ A;  1U7M A;  1RF1 C;  2Y9Y A;  1ZXG A;  1OAE A;  3SSU A;  1MG2 D;  1J1E C;  1M7L A;  1CIE A;  2HYN A;  2R3C A;  3EWK A;  4WVZ A;  2WSC J;  5AVS B;  3U59 A;  1KIL B;  1CIH A;  3VMA A;  1SQQ E;  2N18 C;  5KKZ B;  1J3S A;  2WSE H;  3GMA A;  1JY3 O;  1KTM A;  1GIW A;  5AW6 B;  2C0W A;  1N90 A;  2Q9I A;  4D6T D;  1HCM A;  2AEJ A;  2PAC A;  3QH9 A;  1NMI A;  1QGK B;  1YNR A;  1GU4 A;  5C0Z A;  1PGQ A;  1QN2 A;  5K5G B;  1L0N G;  3H1K G;  3AE7 C;  1CI6 A;  1PGJ A;  2OTJ P;  1H1O A;  1NTK D;  5AW4 B;  1VQM P;  3ZOW A;  1L0N J;  3H1K J;  2JP3 A;  1ZR4 A;  1L4A D;  5CCG A;  2GA1 A;  5KAF V;  3SLE A;  3H1H D;  3L36 A;  5AVR B;  1GW3 A;  4P4Q B;  3RN1 A;  4H13 B;  2FFD A;  1CSB A;  1CNO A;  3UIA A;  3LIE A;  3CWB G;  2E75 B;  2GM4 A; 
#chains in the Genus database with same CATH homology
 1SQV D;  5IY5 1;  2MHM A;  1L9B C;  4NFG B;  2N3B A;  3O1Y A;  1DW2 A;  1NIR A;  2BCC D;  2N9I A;  3FWL A;  2RN0 A;  1P84 D;  1I54 A;  1L9J C;  1L0L D;  1CIF A;  3CXH W;  3WU2 V;  4AAO A;  1KYO W;  1H31 A;  2PCB B;  2BH5 X;  3H1K D;  2CE1 A;  1CSU A;  5CIE B;  5DFS A;  4EID A;  1M70 A;  1C6R A;  2V08 A;  1R0Q A;  1JDL A;  5B5E V;  3CP5 A;  3SJL A;  2CA4 B;  2FYU D;  3TYI A;  1RAQ A;  1VYD A;  2BH4 X;  5KLV D;  2GC4 D;  5AUR A;  4FAN A;  4AAM A;  5GTI V;  2CA3 B;  4WQ8 A;  1CED A;  4GYD A;  1KX2 A;  2O3J A;  3L73 D;  3DMI A;  1BE3 D;  3L4M A;  1LC2 A;  3CWB D;  1H31 B;  1E29 A;  2DVH A;  4EIC A;  2A06 D;  2Q3E A;  5TJH A;  1HZU A;  5DJQ B;  1KX7 A;  5CID B;  4U3F D;  1CYJ A;  2K9J B;  1CRC A;  1A2S A;  2QJY B;  2B10 B;  1DVH A;  1QL3 A;  1KIB A;  1HJ3 A;  2PCC B;  3C2C A;  4FA1 A;  4WQE A;  3HQ8 A;  2KNC B;  4PD4 D;  1FOC A;  3RN0 A;  5CIG B;  1CYI A;  1NU1 D;  3L74 D;  3ZIY A;  1N15 A;  1LC1 A;  3TF5 A;  2I8F A;  1PP9 D;  2YK3 A;  3L75 D;  3VNW A;  3NBS A;  1H9Y A;  1DVV A;  3ZBM A;  3H1J D;  1CRG A;  3A0H V;  3SXT A;  3GG2 A;  1AOQ A;  1YIC A;  1GJQ A;  1I5T A;  1KV9 A;  3SWS A;  1CSW A;  2ZON G;  4N0K A;  2YQB A;  1N50 A;  1QYZ A;  2VHD A;  3RLM A;  2C1D A;  1AOF A;  2JTI B;  1BCC D;  2ZXY A;  3PXS A;  3VYM A;  3O0R C;  3WFE C;  1U74 B;  5C9M A;  3OA8 A;  4MU8 A;  3VRD A;  1B7V A;  1QL4 A;  3L70 D;  1SQP D;  4O1Q A;  1NML A;  2LIT A;  2FRC A;  1YTC A;  5KAI V;  1QKS A;  1I6D A;  2BGV X;  1H9X A;  4L3H A;  4V2K A;  1C7M A;  5CIH B;  1AYG A;  3WUI A;  2C9X B;  2JWA A;  1HRC A;  3WFC C;  4H0K A;  4FB1 A;  3WC8 A;  1DII C;  5DF5 A;  2C1D B;  1EZV D;  3PH2 B;  2B11 B;  2DGE A;  2AIU A;  1FJ0 A;  3ZOX A;  4UB8 V;  2BCN B;  3OA8 B;  1SQB D;  1AKK A;  2CE0 A;  5B6Q A;  1CC5 A;  4JCG A;  1CHI A;  1COT A;  1NTZ D;  2C1U A;  1PPJ D;  4PW9 B;  5E79 V;  3O5C A;  1YFC A;  5GTH V;  2ZOO A;  1CHH A;  1CO6 A;  2V07 A;  1DW3 A;  1OCD A;  351C A;  1C6S A;  1S6V B;  2AXT V;  1YIQ A;  2B4Z A;  2MTA C;  4KMG A;  2N9Y B;  1A8C A;  2C8S A;  3RMZ A;  1M6Z A;  1H32 A;  3PLN A;  1FHB A;  4Y5R A;  4QAO A;  5DJQ C;  1GKS A;  1ETP A;  2FWL A;  5TIS V;  1E8E A;  4WQC A;  2JQR A;  4YE1 A;  4K3I A;  1C2R A;  1KB0 A;  1ZZH A;  3MK7 B;  2BPB B;  3MK7 C;  5CYT R;  2QJP B;  1I8P A;  1FI9 A;  3L4O A;  1CRY A;  2RMZ A;  1CYC A;  2GC7 D;  4WQA A;  1CSX A;  1CTJ A;  1FCD C;  3CYT I;  4O1W A;  1RZ5 A;  4RJT A;  1CCR A;  1SQX D;  1DT1 A;  5KLI B;  2HV4 A;  3CX5 D;  3GW6 A;  3H1I D;  2B0Z B;  1H32 B;  1CRH A;  3ZOO A;  1CSV A;  1DW0 A;  1IQC A;  1DW1 A;  1NNO A;  1COR A;  1S5L V;  4AAN A;  4Q5P A;  3TDK A;  1K3G A;  4XXL A;  2FYN B;  3L71 D;  155C A;  3O20 A;  1GDV A;  1GQ1 A;  4FA9 A;  2L4D A;  1C75 A;  4AX3 A;  1CHJ A;  3TGU D;  2D0S A;  3A9F A;  4FA5 A;  1EB7 A;  1N9C A;  5H2F V;  1DIQ C;  3A0B V;  4WQD A;  4WQ9 A;  1HZV A;  3NWV A;  3DR0 A;  3CX5 W;  4XYD B;  1C2N A;  1IO3 A;  2C2C A;  3BCC D;  1HRO A;  2ZBO A;  1I6E A;  4EIE A;  4FA4 A;  1CXA A;  2QG4 A;  2L91 A;  4FAV A;  4PWA A;  5CIC B;  4J20 A;  1HH7 A;  4H0J A;  3SVW A;  4L3G A;  2D0W A;  3ITK A;  1LS9 A;  3HQ6 A;  2Y0D A;  3ZCF A;  1E2R A;  3OCD A;  3JBT B;  1CXC A;  1C6O A;  3ZOY A;  1IRW A;  1U75 B;  2B12 B;  2C1V A;  1BGY D;  5EXQ A;  1LMS A;  4AAL A;  3ORV A;  1FI7 A;  2YCC A;  5B66 V;  4A7P A;  1F1C A;  1I8O A;  2LIR A;  3PXW A;  1L0N D;  1YEA A;  1HJ5 A;  3PXT A;  1YCC A;  4IL6 V;  3X39 A;  1MG3 D;  1FI3 A;  3CU4 A;  1WVE C;  1I55 A;  1WEJ F;  3H1L D;  2N3Y A;  1W5C T;  3WFB C;  2AI5 A;  3HQ7 A;  1NTM D;  3OCD B;  2KS1 A;  3L72 D;  1F1F A;  1RAP A;  3NBT A;  3PHL A;  2BLF B;  2IBZ D;  4EDF A;  451C A;  1CTZ A;  4LJI A;  1OAE A;  4WQ7 A;  3WFD C;  1BL9 A;  2Y0E A;  1MG2 D;  1CIE A;  3KZI V;  1W2L A;  3HQ9 A;  1LFM A;  1MZ4 A;  2N9J A;  3KHU A;  1CCH A;  2ZZS 1;  4GED B;  1CIH A;  3VMA A;  2OZ1 A;  2N18 B;  1CTY A;  2N18 C;  2YIU B;  2GB8 B;  5KKZ B;  1IRV A;  5CIB B;  1ZRT D;  1J3S A;  3M97 X;  2QJK B;  1M60 A;  1GIW A;  1H33 A;  1SQQ D;  1CRJ A;  1N90 A;  4D6T D;  1HCM A;  2CXB A;  2PAC A;  1NMI A;  1C52 A;  3PRJ A;  4EIF A;  1YNR A;  1CRI A;  5C0Z A;  3PTZ A;  1QN2 A;  2EXV A;  2XTS B;  1YEB A;  1H1O A;  1NTK D;  2ORL A;  4DY9 A;  4UB6 V;  3CXH D;  3ZOW A;  1GU2 A;  2OZ1 B;  3DP5 A;  4PJ0 V;  1KYO D;  4L1Q A;  1A56 A;  1HJ4 A;  1IZL 0;  1KB9 D;  5KAF V;  3SLE A;  3H1H D;  2Y0C A;  4WQB A;  1CIG A;  1H33 B;  2GIW A;  1RZ6 A;  4P4Q B;  3RN1 A;  1K3H A;  5CIF B;  1CNO A;  4RSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...