1L0ND

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1l0nD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1l0nD02
5IY51 3RN0A 1MG3D 1WEJF 2B11B 4UB8V 3PHLA 4WQ9A 1QN2A 2YIUB 1LC1A 1L0ND 1E2RA 1GKSA 1YTCA 1C6RA 3SLEA 1C6SA 1HJ3A 2VHDA 1S6VB 2YCCA 2QJYB 1CRHA 4Q5PA 5CIHB 2C1UA 2V07A 1JDLA 2LITA 2IBZD 1E8EA 3H1LD 4RJTA 1YICA 5GTIV 5KKZB 1SQBD 5DJQC 1CIHA 3DR0A 1F1CA 4WQBA 1C2NA 2B12B 5TISV 2DVHA 3PLNA 1E29A 1GDVA 2BH4X 2KS1A 2YK3A 4GYDA 3ORVA 1QL3A 4AAMA 1CXCA 3VRDA 5CICB 1QL4A 1CIFA 1K3HA 1I6DA 1CCHA 1NTMD 2PCCB 3PXSA 1I54A 2AI5A 2I8FA 1SQXD 3A0HV 1K3GA 4AAOA 1RZ6A 1CHHA 2C1VA 2Y0DA 3HQ8A 1YIQA 2MHMA 1CRGA 2RN0A 3DMIA 3O20A 2N18B 1HRCA 3ZIYA 1VYDA 5TJHA 4YE1A 3WC8A 1FJ0A 2DGEA 3WFDC 4EIDA 1IRVA 4WQDA 1ZZHA 4GEDB 3L70D 3WUIA 4FA5A 1MZ4A 2L91A 2C9XB 4Y5RA 1YNRA 1IZL0 1DW2A 1LFMA 1YEAA 1CYCA 2ZOOA 2GC4D 1IRWA 3L4OA 2GB8B 2A06D 3O0RC 1C7MA 5EXQA 1CEDA 4AANA 3M97X 4V2KA 2QG4A 1I6EA 4NFGB 1CSUA 4PD4D 3OCDA 1HJ4A 3OCDB 4QAOA 1KX7A 2Y0EA 3H1HD 2V08A 4FA1A 4EIEA 1IO3A 4P4QB 5C0ZA 3CX5W 1NU1D 2N3BA 3ITKA 1FI3A 3C2CA 1A8CA 3L75D 1R0QA 5KAFV 1P84D 1GU2A 3JBTB 2B4ZA 2CE1A 2FWLA 1M6ZA 1N15A 2BPBB 4AALA 1H33B 3ZOWA 5B6QA 2BH5X 1M60A 5DF5A 3H1JD 3NWVA 1KB0A 1DVHA 2BCCD 4L3HA 3RLMA 5E79V 3HQ9A 1S5LV 3NBTA 1KIBA 3NBSA 2EXVA 1CRYA 3MK7B 2N9YB 3VNWA 4WQCA 3SVWA 2YQBA 1J3SA 2PACA 1CCRA 3X39A 2ZONG 1DVVA 3L73D 2BLFB 3HQ6A 2ORLA 3CXHD 1CRJA 2ZBOA 1W2LA 3CXHW 3BCCD 1I8PA 1CIGA 2GIWA 1CSVA 3PTZA 2JWAA 3WU2V 5C9MA 1RAQA 3SWSA 2D0WA 2N18C 4A7PA 3ZCFA 1NIRA 3GW6A 2JQRA 4PW9B 4PJ0V 1YEBA 1ZRTD 3KHUA 1U74B 3A0BV 1KYOD 2JTIB 1AKKA 1QKSA 1GIWA 2C2CA 3TGUD 1H9XA 1BCCD 1EB7A 1H31B 4WQEA 3CU4A 1KYOW 1QYZA 3CYTI 4JCGA 1A2SA 1CHIA 5CIFB 3L74D 1HJ5A 4L3GA 3A9FA 1FI7A 1MG2D 1C6OA 1U75B 4L1QA 1ETPA 1CNOA 1CIEA 3WFEC 451CA 1SQPD 3SJLA 4H0JA 1DW3A 1HZUA 3OA8A 1BGYD 1DW1A 3OA8B 2RMZA 1I8OA 3PRJA 1PP9D 3RMZA 4FAVA 2CE0A 3TF5A 3H1KD 4DY9A 1DIIC 2FYUD 3ZOYA 5CYTR 2D0SA 4D6TD 4UB6V 4EDFA 1CTZA 1H33A 4H0KA 1CYJA 1PPJD 1HCMA 2L4DA 3O1YA 4EICA 4RSZA 3ZOXA 5CIBB 1CTJA 3MK7C 1DIQC 1N50A 5CIDB 2C1DB 3L4MA 1H32A 1CRIA 3H1ID 1H32B 4FA4A 4EIFA 2AIUA 1CO6A 2AXTV 1CC5A 4AX3A 3PXWA 5CIEB 2KNCB 1H1OA 1H9YA 4FA9A 3WFCC 2QJPB 2ZZS1 4O1WA 1GQ1A 3SXTA 4WQAA 1LMSA 3TYIA 1BL9A 1CRCA 4MU8A 3ZOOA 2OZ1A 4PWAA 1OAEA 2PCBB 4K3IA 2OZ1B 2N9IA 1AOFA 2CXBA 1N9CA 1C52A 5DFSA 155CA 1W5CT 1KB9D 3TDKA 3VYMA 5KAIV 4WQ7A 1L9BC 1L9JC 5KLVD 5B66V 2BGVX 3PH2B 4N0KA 2N9JA 5H2FV 3WFBC 1CSXA 1AYGA 2BCNB 5GTHV 1RAPA 1DW0A 1HROA 1KX2A 351CA 5DJQB 1YFCA 3FWLA 4WQ8A 2LIRA 1C75A 1GJQA 1AOQA 3KZIV 1YCCA 1CTYA 1H31A 2GC7D 3ZBMA 5KLIB 1LC2A 4J20A 1LS9A 2ZXYA 3RN1A 4LJIA 4IL6V 1SQVD 1IQCA 2B0ZB 1FI9A 1N90A 2Y0CA 1L0LD 5CIGB 1CSWA 1BE3D 5B5EV 2FRCA 1NMLA 3PXTA 1HH7A 3DP5A 4FB1A 5AURA 3CWBD 4KMGA 1KV9A 1FHBA 2O3JA 1B7VA 4U3FD 1CORA 1OCDA 1DT1A 4O1QA 2CA3B 2XTSB 2Q3EA 1NTKD 4XXLA 3VMAA 3CP5A 2FYNB 1WVEC 1C2RA 3HQ7A 2B10B 1FCDC 1A56A 4XYDB 2K9JB 3CX5D 3GG2A 1F1FA 1CYIA 1FOCA 1CHJA 2C8SA 2HV4A 1COTA 1NTZD 3O5CA 1NNOA 1I55A 2MTAC 2CA4B 3L71D 3L72D 4FANA 2N3YA 2C1DA 1M70A 2QJKB 1I5TA 1EZVD 1SQQD 1NMIA 1RZ5A 1HZVA 1CXAA
chains in the Genus database with same CATH superfamily
2M3BA 4ASVA 1ZR2A 1PGOA 4ZMDA 1WEJF 2QVAA 4HJGH 1BDDA 2LXBA 1RY3A 1LC1A 3EQ2A 1E2RA 1YTCA 4GIFA 3SLEA 3MTUE 1HJ3A 2VHDA 1Q81Q 3L73G 1NTZE 2QJYB 2P1JA 1CRHA 4Q5PA 1VQLP 4OWFA 2C1UA 2V07A 4DOJA 3G3ZA 1RQVA 5CCHD 2LITA 1Z56A 1P84E 1U7MA 4H0LC 3A0HE 3KPEA 2FYUK 1FOSF 1HVVA 2O01N 1C2NA 3WUUA 3V4WA 3A5TA 2C0XA 3PLNA 1E29A 1Y9BA 3CC7P 3ORVA 1EDIA 1GK6A 3H1HJ 3VRDA 1QL4A 4N78E 1CIFA 1AQTA 1FDIA 2ITAA 3AE2C 1KV4A 1I6DA 3TNUB 5AW6B 3HD7D 1LTJC 3L75J 3PXSA 3TGUG 1SP4A 2WITA 1GMJA 1N7SA 3NFQA 2OYIC 2Q5UA 2Z5HA 1CRGA 3KQGA 3ZIYA 5TJHA 4YE1A 1IJDB 3BCCE 1ZW0A 2WT7A 4RO0A 1X9VA 4GEDB 3WUIA 1GW3A 2B9BA 2ZT9D 3CPWO 1YNRA 2K9YA 1YEAA 1PP9G 1CYCA 2ZOOA 1LTBC 4ASWA 3GMAA 3M9QA 2K88A 3AEFC 1EC5A 3RK2B 2Q9IA 1ZRTE 4NPEA 2QG4A 2IYPA 2QJKC 4NFGB 4D6TG 4PD4D 1BCCE 1JMBA 3U1AA 2KIKA 1VQNP 1S5LE 3H1HD 1MFTA 5APTA 2WPVB 3AE3C 4P4QB 2J5UA 2IPPA 3L75D 1R0QA 3CX5I 1FJKA 1NOHA 1GU2A 1N73A 2FWLA 3V2RA 1N15A 4LLHA 1FDOA 1RE3C 1M90Q 2BH5X 1K04A 1LTGC 5DF5A 3IFMA 1P84I 2QA4P 4GODA 3RLMA 1ZMEC 1HJ0A 3NBTA 3V5BA 1KIBA 1CRYA 4H44B 3VNWA 4WQCA 2FYUE 4DT0A 2PACA 1CCRA 1NTKK 3P8MC 2WSEJ 1PIXA 2O01J 5AW2B 1H88A 2G3AA 2GM4A 3L4FA 3M9BA 2ORLA 3CXHD 3I5CA 1PPJE 2UWJE 2PRRA 3H1JE 2IBZI 1BGYJ 2ZVOB 4I7ZC 3H1IE 2WTYA 3IAOA 1CIGA 1BSHA 2GIWA 3H1KJ 1SFCC 2GA1A 3PTZA 2M5AB 4YXWH 1QGKB 2D0WA 1FC2C 2N18C 1JOCA 1VDFA 1IFIA 1PZQA 4A7PA 3L73E 3ZCFA 2ZYGA 2O1KA 4HH2A 2JQRA 2FXMA 3VMYA 1KYOD 2E74B 4AYCA 1NHLA 1J1DB 1GIWA 3CCRP 4WVZA 1H31B 2JP3A 1OVVA 1QYZA 3JSVC 3A9FA 1BSNA 5APXA 2D2CD 3SFDC 1LTAC 3AE5C 1MZ9A 2JWDA 2JO1A 1YIJP 4TLFA 4H0JA 1BGYD 2AEFA 1KQSO 2ZFCA 1S72P 4DCKA 2AXTH 3TF5A 3H1KD 1SQXK 1VF5B 1VQOP 1DEBA 4UB8H 1EZVG 1SQQG 5CCGA 3B5ND 1FU1A 1RF0A 1BE3E 1L4AC 3Q3DA 1H33A 1LT9A 1OIPA 2PP6A 2BEZF 1LTIC 3AEGC 4BRYA 1S3JA 2NPSD 1L0NG 1FZFA 1URQC 2NPSA 1N86A 1FJPA 4WY4B 5B66H 2J59M 2AXTV 1CC5A 1KILC 2KNCA 1SQVJ 1NTKE 1JMMA 3D6ZA 3LW5H 3WFCC 1URQA 4DZOA 2OYHC 2ZZS1 1L0LJ 4D6TE 1LMSA 3TYIA 3L35A 4I2LC 3NXSA 3G71P 2FFDA 3MP7B 1OAEA 4K3IA 2OZ1B 3TK1A 1AOFA 3L71E 3L72E 2QM8A 3CMEP 1Y8AA 2KUBA 3KZIH 2KLUA 4C7NA 2CK3H 1NU1K 3CI9A 5B66V 4U3FJ 1QLED 1HH0A 3WFBC 2BCNB 1NTMG 1RAPA 2B89A 4H0LB 5CBOA 1YFCA 5B5EE 3FWLA 1NTZJ 1OW7A 2V7QJ 5APVA 3F5HA 1J2JB 1FZCA 1H8AA 2LIRA 3KZIV 1YCCA 1CTYA 3GLMA 3ZBMA 1LC2A 1GL2C 2ZXYA 1SQVD 3L70G 1VQPP 1LTJB 2Y0CA 1G2CA 1L0LD 2OYIB 3PJSK 3HTKA 4I1LA 1Q86Q 3DP5A 4GOEA 4EIJA 3H1LJ 1SQXE 1B7VA 2A45H 4R4LA 1QVFO 4U3FD 1SQBJ 1DT1A 4B86A 3M0DA 2FY8A 4UB8E 2E5TA 2ZXEB 1GD2E 3CCQP 1U57A 4IFDK 3CX5D 3GG2A 1F1FA 2C8SA 1CHJA 1NTZD 3FXDA 3Q5PA 1LP1A 3EWKA 2N3YA 2C1DA 3G4SP 2QJKB 5CHXA 2QJPC 3CCMP 1NMIA 1ZV8A 1RZ5A 2KYVA 3MUDC 5IY51 5GTIE 5AVWB 2Y9ZA 1L0LK 2L5GB 3JC22 3U59A 3RN0A 3M9HA 2B11B 2I8DA 3D70A 2IX7C 4OVNF 1KMIZ 1GKSA 1SQPK 1RH5B 1JY3O 1S6VB 1JO5A 2K1AA 3WU2H 1NU1E 1SQQE 1LJ2A 3CWBJ 2IBZD 1E8EA 1P84H 3H1LD 3BCCG 1OFCX 1SQBD 3RBZA 2N1TA 4WQBA 4PJ0H 2DVHA 1N2DC 2KS1A 2B87A 3JCUE 1H0TA 4GYDA 1ZXGA 1Q7YQ 1QL3A 4EYYQ 3CCJP 2KLVA 3GF7A 4I7ZB 2R3SA 2RH0A 2PCCB 1T2KC 3G6EP 2YKOA 2I8FA 3A0HV 1BCCG 1KILE 3LIEA 4C46A 1KFMA 3AE1C 2WSFH 4AAOA 1SFCB 4W80A 1K9MQ 2P7JA 1E5WA 2C1VA 2E74D 1M1JA 2XV5A 1S5LX 3H1JJ 1EDJA 3S9OA 2N18B 3RK3C 1VYDA 1HGVA 1N7LA 4H13C 3WC8A 3WFDC 2IFNA 1IRVA 4WQDA 1FAVA 2OGUA 1MZ4A 1J1EC 3U1CA 2L91A 5KLVK 2C9XB 1DW2A 1LFMA 3USSA 2FYNC 2VRSA 5KAFE 3D0WA 1RE4C 2GC4D 3L73J 1IRWA 3HE4A 3L4OA 3O0RC 2A06D 2ZVNB 1CEDA 4AANA 2Q3IA 3O6QB 3M97X 4V2KA 2FYUG 3QH9A 1HJ4A 5E79E 3OCDB 1HTLC 2Y0EA 3FXEA 1PPJG 1XTGB 5KJ7D 4L76A 3L70E 2OTLP 3VMXA 3AECC 3SWYA 5KJ7A 1YHQP 2R5BA 3CX5W 4O9BA 2N3BA 3ITKA 1GK4A 3H1IG 1VQ4P 2KZJA 1FZEA 3CC4P 3OJAB 4AALA 2BEQD 2YKQA 1H33B 5B6QA 1EZVI 1SQPE 3AE8C 1M60A 3H1JD 4LGDE 1L4AB 3TGUJ 2Q1KA 1DVHA 3CD6P 1CW5A 3HQ9A 1S5LV 1YI2P 1W2BO 1EQ7A 3P7KA 2KZIA 1JTHA 2N9YB 3RL0D 3W68A 3WU2E 3SVWA 2YQBA 1URQB 5CCHA 4K35A 3MIWA 2M0BA 3L73D 1KILB 3HQ6A 1AVYA 4PJ0E 2OYHB 3L36A 3A0BE 5AVTB 4Y99C 1PP9J 1TU3F 3HD7C 4GDOA 1N7SC 4IL6H 4GT1A 2JWAA 4GOFA 2FXOA 2W90A 5APQA 2E75D 3HD7A 1AV1A 1QX8A 3SWSA 3I56P 5AVUB 2OTJP 4D6TJ 3V2QA 1NIRA 3GW6A 4PW9B 1YEBA 1MFZA 1OX3A 3KHUA 4XFJA 1U74B 3M91A 3VN0A 1QKSA 2H43A 2HYNA 4U7JA 1Q90D 2ZAEB 1BE3G 2A45I 3TGUD 3CU4A 5KLVE 1DD3A 3CCEP 3V2NA 3CYTI 1IK7A 2IFMA 5CIFB 4HKZH 4OH8B 4L3GA 4JQ0D 1MG2D 1U75B 4L1QA 5BU5A 1VQ6P 1GL2B 3H32B 3Q5RA 2H8PD 1NTKG 3HTKB 1DW3A 1JUNA 2LXCB 1AVOA 1DW1A 3OA8B 2RMZA 1JM0A 1YBKA 1PP9D 3L37A 1IO4A 1LWUA 3RMZA 1A02J 1NAYA 1N73C 4IOIH 2HODA 4NPFX 3L71G 3L74E 4BWNA 3L72G 1JNMA 1DIIC 1R8EA 4N6JA 4D6TD 1T8ZA 1CTZA 1SLQA 3T97A 5AW1B 1PFIA 4H0KA 2G8YA 3VMZA 2HLOA 2L4DA 1HCMA 4EICA 3LIDA 3RK3E 1DIQC 1N50A 3CC2P 2C1DB 1H32A 4FA4A 2YXRB 4EIFA 1HGZA 1G1JA 3PXWA 5H2FH 1H9YA 4FA9A 1ZR4A 2QJPB 2NRGA 4O1WA 2SPZA 1IC2A 2QEXP 1RQUA 4MU8A 1KN7A 4PWAA 2PCBB 2N9IA 3GHGA 2CXBA 3P8CE 4PV1D 1KB9D 2JKVA 2R5DA 3M06A 2DW3A 1GW4A 3Q5SA 2BGVX 3PH2B 4IL6E 2N9JA 5H2FV 3FGAD 1CSXA 2E76D 4RESB 1NH4A 1CI6B 1MV8A 1HROA 1OWAA 351CA 1SQXG 2W6BA 1DX7A 1ZOYC 5B5EH 2IZ1A 2JEEA 4WQ8A 1AQ5A 1JCDA 1G1IA 2LR2A 3B71A 1C75A 1SQQJ 3E7KA 3MD0A 2D2CC 3HE5B 4J20A 1K73Q 4LJIA 2HG5D 2CPSA 3CXHH 5AW8B 3VYIA 3IN6A 1FI9A 1EDKA 2WWWA 1L0NJ 1CSWA 2GUSA 2JDIH 2KXPB 2ZXXA 5B5EV 2FRCA 3IR9A 3BASA 3BVHA 1HH7A 3BRVB 3F89A 2HPCA 2C0WA 3RK3B 2PFXA 4H13B 4KMGA 1FHBA 3AE6C 3KXDA 5CCGC 2PAJA 1NWQA 1RF0C 1OCDA 3HUSA 4O1QA 3RGUA 2XTSB 1RF1A 2Q3EA 1J1EB 1LT9C 2KP8A 1NU1G 1QEXA 2O1JA 2FYNB 1SVFA 3A2AA 3B5NA 3R2PA 1W5CE 2IZ0A 4XYDB 1ZLLA 2WPRA 1CYIA 1Y47A 2NPSC 3CLQA 3O5CA 1I5TA 1EZVD 1SQQD 1NTMJ 2OTKE 3MHVA 2WSEH 2O01H 1NO4A 1CXAA 2BCCG 5GTIH 1NAFA 1HJBA 4CPGA 5H2FE 4UB8V 5TISH 2FFDC 3PHLA 4WQ9A 1QN2A 1L0ND 1T3UA 1UIXA 2YCCA 1DH3A 3H1HE 1U7JA 4W7YA 1JDLA 1PL5A 1IFPA 5BU8B 1JTHB 3L75E 5GTIV 4XE5B 3ABVC 3DR0A 1F1CA 2B12B 5TISV 2AEJA 3JCUH 1FZCC 2W6JH 2BH4X 1YYCA 2A45G 1CXCA 1HF9A 3TNUA 1YQ4C 1OXZA 4BXLA 4Y99B 1CCHA 1NTMD 5APUA 1LNQA 2YMYA 3HD7B 1CSBA 1VQKP 1K3GA 1N7SB 2Z4EA 4NPDA 1K8AQ 3CXHE 2I1JA 2MHMA 2RN0A 3O20A 2FYZA 1S9KD 5AW0B 1NVOA 1D7MA 1FJ0A 2HR3A 2WT7B 4EIDA 3C9IA 1ZZHA 4FA5A 3L70D 1SQPG 4Y5RA 3M0DC 5KAFH 1HBWA 4JPZB 3KDPB 3RK2D 3B4SA 3UIAA 2GB8B 1KZUB 1KYOE 2LKMA 4EOTA 2C9LY 2K9JA 2E43A 1OW6A 1MUUA 1CSUA 5E79H 3BCCJ 2HFED 4QAOA 2FKWB 2W27A 3N4XA 3TSIA 2V08A 4FA1A 1IO3A 5C0ZA 5M1BA 3C2CA 1OVUA 1SQVK 5KAFV 2YIUC 1P84D 2B4ZA 3MGNA 2BPBB 3OA7A 1N73B 4YXDC 3BRTB 2WSCH 3PH0A 5TISE 1PV3A 1BGYE 3NWVA 2P2UA 1USDA 3SWFA 1KB0A 1BCCJ 5E79V 4WB4A 5KAIH 3AE7C 1KQLA 4H44D 5KKZC 3M0AA 4N78D 3H1KE 2EXVA 1R5SA 2MJZA 2N1TC 5APWA 1J3SA 2XDJA 4I6MC 3X39A 1DVVA 2BLFB 5KLVG 1KC8Q 1CRJA 2V7QH 3A0BH 1E79H 1NTZK 1DEEG 5K5GB 1Q2NA 2BCCE 3BCCD 3A3YB 4HB1A 3CXHI 2M5AA 1CSVA 4RKUJ 3WU2V 1AJYA 2FYUJ 5C9MA 1M1JC 3HRNA 2K37A 3N7NA 2WVRA 4PJ0V 3L74G 1ZRTD 2E5YA 4R4MA 3A0BV 1PGJA 1DIPA 3H1IJ 1FS0E 1S2EA 1BCCD 2H7HA 1EB7A 4WQEA 1CZQA 1M7LA 3A7OA 4JCGA 1A2SA 2AXCA 3OAKA 3Q1MA 1KYOI 3MZWB 3L74D 1HJ5A 2E42A 2BASA 1FI7A 1SQBK 1C6OA 1YJNP 3CWBG 1VQ9P 2D2CB 3WFEC 5AVQB 4MN4C 3WUVA 4UB6E 1WMKA 1GU5A 1WT6A 4Z1MH 4AQRD 4OGQC 3SJLA 2Z5IA 4H13D 5KJ7C 1HWTC 1VF5D 2R32A 2C9NY 2XU6A 3SWKA 2FYUD 3ZOYA 1VQ7P 1L0LE 1NKNA 3CCLP 1AFOA 1NJIQ 1LTSC 1Q82Q 2P67A 1CYJA 1PPJD 1LT9B 1PGPA 2QM7A 3S4RA 3ZOXA 1CTJA 3MK7C 5CIDB 4BRYB 3L4MA 4IL6X 1JY2N 3H1ID 4WY4D 3RL0C 4WY4A 2NPSB 3EFFK 5CCHC 1LT1A 5KAIE 2AIUA 4U3FE 4AX3A 5CIEB 2KNCB 2YO3A 5GTHH 5AW3B 3SXTA 1NKZB 4WQAA 5AVSB 1BE3J 3CX5E 1BL9A 3ZOOA 2OZ1A 2OYOA 2FFDB 2CPBA 4JYCA 1HUCA 3BATA 1W5CT 2JR8A 3TDKA 4JYBA 2E75C 3VYMA 3RL0g 4WQ7A 4C7NB 5DJUB 2RKLA 4N0KA 3CCSP 1NTKJ 4H0LD 5GTHV 5APYA 1KX2A 2I1KA 5KTBA 2FBWC 4ZKUA 1KTMA 1X22A 2OQQA 3L71J 3L72J 3VTPC 3AE9C 1FZCB 1GJQA 1AOQA 2GC7D 2IBZE 2ZYDA 1N7SD 2ZT9C 2QRXA 3H1LE 2B88A 3RN1A 4IL6V 1SQBE 3CCUP 1LTJA 2B0ZB 1SS1A 1N90A 2OYIA 5CIGB 1G2CB 1BE3D 5AW9B 2P10A 5CBNA 2OARA 1LWUC 1NMLA 3PXTA 4FB1A 2W83C 3SFEC 5AURA 2YKPA 3IF4A 5AVYB 1UIIA 2O3JA 1VQ5P 1K05A 1ZN5A 1CORA 5BVZA 3H1HG 2CA3B 1NTKD 4XXLA 1GDTA 5AW4B 3HQ7A 3L75G 1FCDC 1A56A 1X8YA 2K9JB 1COTA 4W7ZA 2MTAC 2CA4B 3L71D 3L72D 2YNYA 4FANA 1LP1B 1M70A 3KYQA 3CWBE 5EFWB 1QL2A 1HZVA 1SQXJ 1WRGA 2WZ7A 2A06E 1FDMA 1MG3D 2FXPA 1JY3N 4WBAA 1VQ8P 5GTHE 3GHGC 2YIUB 1M57D 3WMM0 3FWNA 4PD4H 1C6RA 1C6SA 1RE3A 1YTZT 4PV1C 2QIWA 1M56D 1T3JA 2YMKA 3ZDMA 3AEAC 5CIHB 3O8ZA 1YJ9P 3R4YA 1KD1Q 4ZKPA 2M8RA 2E76C 4RJTA 2KSEA 1YICA 5KKZB 5DJQC 4HYTB 1CIHA 5AVRB 2N1TB 3CMAP 2XKMA 3LW5J 3QWOC 3VP9A 1GDVA 2YK3A 2KS1B 1IFNA 2B87B 4Y28J 1H0TB 1PGQA 2J58A 1QVGO 5KLIC 4AAMA 3AEBC 5CICB 5DJTB 2Y9YA 1NU1J 3V6IA 1K3HA 1OMIA 2JJLA 5CJ4A 3G9RA 1I54A 2AI5A 1SQXD 1SFCD 3E1RA 3D6YA 4KJMA 1SFCA 3V2PA 1FE6A 1RZ6A 3WUTA 1CHHA 1KQFB 2Y0DA 4JF7A 3HQ8A 1YIQA 4M3LA 2MKVA 4DJGA 3H25A 1M1JB 3DMIA 1HRCA 1KB9H 1MKMA 3W67A 2BCCJ 4XA4A 2XNDH 2DGEA 3SSUA 1JB0J 1OZHA 4YPCA 1AA0A 3HUSC 1RF1C 1BGYG 1OVRA 1LGHB 1IZL0 3OW2O 1IFDA 2V4HA 1X79B 3E1IA 3B5NC 1C7MA 5EXQA 3HE4B 3H1KG 3O6QA 1KYOH 2ZJSE 1KORA 1I6EA 2AEMA 4WWIA 1BDCA 3TGUE 3OCDA 4K3AA 1KX7A 4L75A 4C7RA 4OGQB 4EIEA 1NU1D 1IFJA 1FI3A 5CCGD 1A8CA 3NMDA 1FZGA 3JBTB 2CE1A 1M6ZA 1L2PA 1FBMA 1EXJA 1NGMB 2QJYC 3ZOWA 5C39A 1L4AD 3Q2YA 1L4AA 1PP9E 3AE4C 3PP5A 4PD4E 2BCCD 4L3HA 2IDBA 3AEEC 2P58A 3L70J 2PGDA 1DD4A 3GF3A 3NBSA 3P32A 3RBXA 1JY2O 1URQD 3MK7B 1KQGB 3RL0B 5CMZA 3II6A 3C1LA 1KILD 3B8EB 1LTTC 2ZONG 4ZNCA 1KILA 3V4QA 2OYHA 3S1KA 2WSCJ 1SQPJ 2ZBOA 1W2LA 2H88C 3CXHW 3VP8A 1X0TA 1I8PA 1SQQK 1KFNA 1RAQA 2E75B 2R3CA 2KOGA 2KK7A 1L0NK 1SQVG 1N8RQ 1H89A 1VL2A 2JTIB 1AKKA 2YO2A 1IK9A 1L0LG 4IFFA 1KB9E 2C2CA 2POHA 1H9XA 1KYOW 2WQYC 4KT0J 5L8RJ 3D71A 1CHIA 3RK2C 1GL2D 2KI7B 1ZP0C 4L73A 1ETPA 1CNOA 1CIEA 1GL2A 2ZT9B 1VQMP 451CA 4UB6H 2WSFJ 3H32A 4U3FG 2KB7P 1T6AA 1SQPD 2M3EA 1HZUA 3OA8A 1YQ3C 1I8OA 1OW8A 3PRJA 2K3RA 4AUWA 1NTMK 1LWUB 4FAVA 5KLVJ 2H89C 2CE0A 1NTZG 4DY9A 1W2EA 1JCCA 2AXTE 4TT3H 2HODB 1JY2P 2Q7CA 5CYTR 4PD4I 1EXIA 2D0SA 4UB6V 4EDFA 4L74A 3T97B 5APSA 3O1YA 4RSZA 5CIBB 4N3YB 4H44C 1FZBA 2KSJA 3CCVP 1CRIA 1H32B 1S4XA 3CL3D 3C8VA 3NTNA 1CO6A 1EDLA 2W8ZA 5B66E 2N9BA 3L74J 1YITP 5AW7B 1GZLA 1H1OA 5CJ0A 1GQ1A 2IBZG 2YXQB 4QMAA 3MUDA 3CX5H 3H1LG 1CRCA 1SQBG 1USEA 2WPQA 3GHGB 1N9CA 1C52A 5DFSA 4IFMA 2WMMA 1EZVE 1RHZB 5AVZB 155CA 4JBZA 3KZIE 5KAIV 4PV1B 1FZAA 1FOSE 3A0HH 1L9BC 1L9JC 5KLVD 1IFMA 2N1TD 4LC1A 1AYGA 1CI6A 2E74C 1KB9I 1DW0A 2E76B 1J1DC 1L0NE 5DJQB 4YTPC 2Q6QA 4EI2A 3TYYA 5AVVB 2IYOA 4KHXA 2GUVA 2R44A 1IZNB 3AEDC 5AW5B 1VPCA 1H31A 1YTZI 3HE5A 5KLIB 1M1KQ 1LS9A 3FX0A 2WPSA 1A02F 1T2KD 3H6PA 1IQCA 2WSSH 1XTCC 2XZRA 1M8OB 2W6AA 1YJWP 5AVXB 2QSIA 2A06G 1VF5C 3RK3D 2HPCB 1NTME 3CWBD 1KV9A 1JEKA 1R5LA 1NYHA 3I55P 1SQVE 3HUSB 2ZYAA 3K5BA 1RF1B 3VMAA 3VOPA 3CP5A 3EFGA 1WVEC 1C2RA 1RE4A 2B10B 1S9KE 1S1CX 3B5NB 1QL1A 1FOCA 2HV4A 4OGQD 1S5LH 4WY4C 1NNOA 1JY3P 1GU4A 1I55A 2NZ2A 4GKGA 3P8CD 1GTWA 3H1JG 2XNXA 2QE7H
chains in the Genus database with same CATH topology
5IY51 3RN0A 1MG3D 1WEJF 2B11B 4UB8V 3PHLA 4WQ9A 1QN2A 2YIUB 1LC1A 1L0ND 1E2RA 1GKSA 1YTCA 1C6RA 3SLEA 1C6SA 1HJ3A 2VHDA 1S6VB 2YCCA 2QJYB 1CRHA 4Q5PA 5CIHB 2C1UA 2V07A 1JDLA 2LITA 2IBZD 1E8EA 3H1LD 4RJTA 1YICA 5GTIV 5KKZB 1SQBD 5DJQC 1CIHA 3DR0A 1F1CA 4WQBA 1C2NA 2B12B 5TISV 2DVHA 3PLNA 1E29A 1GDVA 2BH4X 2KS1A 2YK3A 4GYDA 3ORVA 1QL3A 4AAMA 1CXCA 3VRDA 5CICB 1QL4A 1CIFA 1K3HA 1I6DA 1CCHA 1NTMD 2PCCB 3PXSA 1I54A 2AI5A 2I8FA 1SQXD 3A0HV 1K3GA 4AAOA 1RZ6A 1CHHA 2C1VA 2Y0DA 3HQ8A 1YIQA 2MHMA 1CRGA 2RN0A 3DMIA 3O20A 2N18B 1HRCA 3ZIYA 1VYDA 5TJHA 4YE1A 3WC8A 1FJ0A 2DGEA 3WFDC 4EIDA 1IRVA 4WQDA 1ZZHA 4GEDB 3L70D 3WUIA 4FA5A 1MZ4A 2L91A 2C9XB 4Y5RA 1YNRA 1IZL0 1DW2A 1LFMA 1YEAA 1CYCA 2ZOOA 2GC4D 1IRWA 3L4OA 2GB8B 2A06D 3O0RC 1C7MA 5EXQA 1CEDA 4AANA 3M97X 4V2KA 2QG4A 1I6EA 4NFGB 1CSUA 4PD4D 3OCDA 1HJ4A 3OCDB 4QAOA 1KX7A 2Y0EA 3H1HD 2V08A 4FA1A 4EIEA 1IO3A 4P4QB 5C0ZA 3CX5W 1NU1D 2N3BA 3ITKA 1FI3A 3C2CA 1A8CA 3L75D 1R0QA 5KAFV 1P84D 1GU2A 3JBTB 2B4ZA 2CE1A 2FWLA 1M6ZA 1N15A 2BPBB 4AALA 1H33B 3ZOWA 5B6QA 2BH5X 1M60A 5DF5A 3H1JD 3NWVA 1KB0A 1DVHA 2BCCD 4L3HA 3RLMA 5E79V 3HQ9A 1S5LV 3NBTA 1KIBA 3NBSA 2EXVA 1CRYA 3MK7B 2N9YB 3VNWA 4WQCA 3SVWA 2YQBA 1J3SA 2PACA 1CCRA 3X39A 2ZONG 1DVVA 3L73D 2BLFB 3HQ6A 2ORLA 3CXHD 1CRJA 2ZBOA 1W2LA 3CXHW 3BCCD 1I8PA 1CIGA 2GIWA 1CSVA 3PTZA 2JWAA 3WU2V 5C9MA 1RAQA 3SWSA 2D0WA 2N18C 4A7PA 3ZCFA 1NIRA 3GW6A 2JQRA 4PW9B 4PJ0V 1YEBA 1ZRTD 3KHUA 1U74B 3A0BV 1KYOD 2JTIB 1AKKA 1QKSA 1GIWA 2C2CA 3TGUD 1H9XA 1BCCD 1EB7A 1H31B 4WQEA 3CU4A 1KYOW 1QYZA 3CYTI 4JCGA 1A2SA 1CHIA 5CIFB 3L74D 1HJ5A 4L3GA 3A9FA 1FI7A 1MG2D 1C6OA 1U75B 4L1QA 1ETPA 1CNOA 1CIEA 3WFEC 451CA 1SQPD 3SJLA 4H0JA 1DW3A 1HZUA 3OA8A 1BGYD 1DW1A 3OA8B 2RMZA 1I8OA 3PRJA 1PP9D 3RMZA 4FAVA 2CE0A 3TF5A 3H1KD 4DY9A 1DIIC 2FYUD 3ZOYA 5CYTR 2D0SA 4D6TD 4UB6V 4EDFA 1CTZA 1H33A 4H0KA 1CYJA 1PPJD 1HCMA 2L4DA 3O1YA 4EICA 4RSZA 3ZOXA 5CIBB 1CTJA 3MK7C 1DIQC 1N50A 5CIDB 2C1DB 3L4MA 1H32A 1CRIA 3H1ID 1H32B 4FA4A 4EIFA 2AIUA 1CO6A 2AXTV 1CC5A 4AX3A 3PXWA 5CIEB 2KNCB 1H1OA 1H9YA 4FA9A 3WFCC 2QJPB 2ZZS1 4O1WA 1GQ1A 3SXTA 4WQAA 1LMSA 3TYIA 1BL9A 1CRCA 4MU8A 3ZOOA 2OZ1A 4PWAA 1OAEA 2PCBB 4K3IA 2OZ1B 2N9IA 1AOFA 2CXBA 1N9CA 1C52A 5DFSA 155CA 1W5CT 1KB9D 3TDKA 3VYMA 5KAIV 4WQ7A 1L9BC 1L9JC 5KLVD 5B66V 2BGVX 3PH2B 4N0KA 2N9JA 5H2FV 3WFBC 1CSXA 1AYGA 2BCNB 5GTHV 1RAPA 1DW0A 1HROA 1KX2A 351CA 5DJQB 1YFCA 3FWLA 4WQ8A 2LIRA 1C75A 1GJQA 1AOQA 3KZIV 1YCCA 1CTYA 1H31A 2GC7D 3ZBMA 5KLIB 1LC2A 4J20A 1LS9A 2ZXYA 3RN1A 4LJIA 4IL6V 1SQVD 1IQCA 2B0ZB 1FI9A 1N90A 2Y0CA 1L0LD 5CIGB 1CSWA 1BE3D 5B5EV 2FRCA 1NMLA 3PXTA 1HH7A 3DP5A 4FB1A 5AURA 3CWBD 4KMGA 1KV9A 1FHBA 2O3JA 1B7VA 4U3FD 1CORA 1OCDA 1DT1A 4O1QA 2CA3B 2XTSB 2Q3EA 1NTKD 4XXLA 3VMAA 3CP5A 2FYNB 1WVEC 1C2RA 3HQ7A 2B10B 1FCDC 1A56A 4XYDB 2K9JB 3CX5D 3GG2A 1F1FA 1CYIA 1FOCA 1CHJA 2C8SA 2HV4A 1COTA 1NTZD 3O5CA 1NNOA 1I55A 2MTAC 2CA4B 3L71D 3L72D 4FANA 2N3YA 2C1DA 1M70A 2QJKB 1I5TA 1EZVD 1SQQD 1NMIA 1RZ5A 1HZVA 1CXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IY5 1;  3RN0 A;  1MG3 D;  1WEJ F;  2B11 B;  4UB8 V;  3PHL A;  4WQ9 A;  1QN2 A;  2YIU B;  1LC1 A;  1L0N D;  1E2R A;  1GKS A;  1YTC A;  1C6R A;  3SLE A;  1C6S A;  1HJ3 A;  2VHD A;  1S6V B;  2YCC A;  2QJY B;  1CRH A;  4Q5P A;  5CIH B;  2C1U A;  2V07 A;  1JDL A;  2LIT A;  2IBZ D;  1E8E A;  3H1L D;  4RJT A;  1YIC A;  5GTI V;  5KKZ B;  1SQB D;  5DJQ C;  1CIH A;  3DR0 A;  1F1C A;  4WQB A;  1C2N A;  2B12 B;  5TIS V;  2DVH A;  3PLN A;  1E29 A;  1GDV A;  2BH4 X;  2KS1 A;  2YK3 A;  4GYD A;  3ORV A;  1QL3 A;  4AAM A;  1CXC A;  3VRD A;  5CIC B;  1QL4 A;  1CIF A;  1K3H A;  1I6D A;  1CCH A;  1NTM D;  2PCC B;  3PXS A;  1I54 A;  2AI5 A;  2I8F A;  1SQX D;  3A0H V;  1K3G A;  4AAO A;  1RZ6 A;  1CHH A;  2C1V A;  2Y0D A;  3HQ8 A;  1YIQ A;  2MHM A;  1CRG A;  2RN0 A;  3DMI A;  3O20 A;  2N18 B;  1HRC A;  3ZIY A;  1VYD A;  5TJH A;  4YE1 A;  3WC8 A;  1FJ0 A;  2DGE A;  3WFD C;  4EID A;  1IRV A;  4WQD A;  1ZZH A;  4GED B;  3L70 D;  3WUI A;  4FA5 A;  1MZ4 A;  2L91 A;  2C9X B;  4Y5R A;  1YNR A;  1IZL 0;  1DW2 A;  1LFM A;  1YEA A;  1CYC A;  2ZOO A;  2GC4 D;  1IRW A;  3L4O A;  2GB8 B;  2A06 D;  3O0R C;  1C7M A;  5EXQ A;  1CED A;  4AAN A;  3M97 X;  4V2K A;  2QG4 A;  1I6E A;  4NFG B;  1CSU A;  4PD4 D;  3OCD A;  1HJ4 A;  3OCD B;  4QAO A;  1KX7 A;  2Y0E A;  3H1H D;  2V08 A;  4FA1 A;  4EIE A;  1IO3 A;  4P4Q B;  5C0Z A;  3CX5 W;  1NU1 D;  2N3B A;  3ITK A;  1FI3 A;  3C2C A;  1A8C A;  3L75 D;  1R0Q A;  5KAF V;  1P84 D;  1GU2 A;  3JBT B;  2B4Z A;  2CE1 A;  2FWL A;  1M6Z A;  1N15 A;  2BPB B;  4AAL A;  1H33 B;  3ZOW A;  5B6Q A;  2BH5 X;  1M60 A;  5DF5 A;  3H1J D;  3NWV A;  1KB0 A;  1DVH A;  2BCC D;  4L3H A;  3RLM A;  5E79 V;  3HQ9 A;  1S5L V;  3NBT A;  1KIB A;  3NBS A;  2EXV A;  1CRY A;  3MK7 B;  2N9Y B;  3VNW A;  4WQC A;  3SVW A;  2YQB A;  1J3S A;  2PAC A;  1CCR A;  3X39 A;  2ZON G;  1DVV A;  3L73 D;  2BLF B;  3HQ6 A;  2ORL A;  3CXH D;  1CRJ A;  2ZBO A;  1W2L A;  3CXH W;  3BCC D;  1I8P A;  1CIG A;  2GIW A;  1CSV A;  3PTZ A;  2JWA A;  3WU2 V;  5C9M A;  1RAQ A;  3SWS A;  2D0W A;  2N18 C;  4A7P A;  3ZCF A;  1NIR A;  3GW6 A;  2JQR A;  4PW9 B;  4PJ0 V;  1YEB A;  1ZRT D;  3KHU A;  1U74 B;  3A0B V;  1KYO D;  2JTI B;  1AKK A;  1QKS A;  1GIW A;  2C2C A;  3TGU D;  1H9X A;  1BCC D;  1EB7 A;  1H31 B;  4WQE A;  3CU4 A;  1KYO W;  1QYZ A;  3CYT I;  4JCG A;  1A2S A;  1CHI A;  5CIF B;  3L74 D;  1HJ5 A;  4L3G A;  3A9F A;  1FI7 A;  1MG2 D;  1C6O A;  1U75 B;  4L1Q A;  1ETP A;  1CNO A;  1CIE A;  3WFE C;  451C A;  1SQP D;  3SJL A;  4H0J A;  1DW3 A;  1HZU A;  3OA8 A;  1BGY D;  1DW1 A;  3OA8 B;  2RMZ A;  1I8O A;  3PRJ A;  1PP9 D;  3RMZ A;  4FAV A;  2CE0 A;  3TF5 A;  3H1K D;  4DY9 A;  1DII C;  2FYU D;  3ZOY A;  5CYT R;  2D0S A;  4D6T D;  4UB6 V;  4EDF A;  1CTZ A;  1H33 A;  4H0K A;  1CYJ A;  1PPJ D;  1HCM A;  2L4D A;  3O1Y A;  4EIC A;  4RSZ A;  3ZOX A;  5CIB B;  1CTJ A;  3MK7 C;  1DIQ C;  1N50 A;  5CID B;  2C1D B;  3L4M A;  1H32 A;  1CRI A;  3H1I D;  1H32 B;  4FA4 A;  4EIF A;  2AIU A;  1CO6 A;  2AXT V;  1CC5 A;  4AX3 A;  3PXW A;  5CIE B;  2KNC B;  1H1O A;  1H9Y A;  4FA9 A;  3WFC C;  2QJP B;  2ZZS 1;  4O1W A;  1GQ1 A;  3SXT A;  4WQA A;  1LMS A;  3TYI A;  1BL9 A;  1CRC A;  4MU8 A;  3ZOO A;  2OZ1 A;  4PWA A;  1OAE A;  2PCB B;  4K3I A;  2OZ1 B;  2N9I A;  1AOF A;  2CXB A;  1N9C A;  1C52 A;  5DFS A;  155C A;  1W5C T;  1KB9 D;  3TDK A;  3VYM A;  5KAI V;  4WQ7 A;  1L9B C;  1L9J C;  5KLV D;  5B66 V;  2BGV X;  3PH2 B;  4N0K A;  2N9J A;  5H2F V;  3WFB C;  1CSX A;  1AYG A;  2BCN B;  5GTH V;  1RAP A;  1DW0 A;  1HRO A;  1KX2 A;  351C A;  5DJQ B;  1YFC A;  3FWL A;  4WQ8 A;  2LIR A;  1C75 A;  1GJQ A;  1AOQ A;  3KZI V;  1YCC A;  1CTY A;  1H31 A;  2GC7 D;  3ZBM A;  5KLI B;  1LC2 A;  4J20 A;  1LS9 A;  2ZXY A;  3RN1 A;  4LJI A;  4IL6 V;  1SQV D;  1IQC A;  2B0Z B;  1FI9 A;  1N90 A;  2Y0C A;  1L0L D;  5CIG B;  1CSW A;  1BE3 D;  5B5E V;  2FRC A;  1NML A;  3PXT A;  1HH7 A;  3DP5 A;  4FB1 A;  5AUR A;  3CWB D;  4KMG A;  1KV9 A;  1FHB A;  2O3J A;  1B7V A;  4U3F D;  1COR A;  1OCD A;  1DT1 A;  4O1Q A;  2CA3 B;  2XTS B;  2Q3E A;  1NTK D;  4XXL A;  3VMA A;  3CP5 A;  2FYN B;  1WVE C;  1C2R A;  3HQ7 A;  2B10 B;  1FCD C;  1A56 A;  4XYD B;  2K9J B;  3CX5 D;  3GG2 A;  1F1F A;  1CYI A;  1FOC A;  1CHJ A;  2C8S A;  2HV4 A;  1COT A;  1NTZ D;  3O5C A;  1NNO A;  1I55 A;  2MTA C;  2CA4 B;  3L71 D;  3L72 D;  4FAN A;  2N3Y A;  2C1D A;  1M70 A;  2QJK B;  1I5T A;  1EZV D;  1SQQ D;  1NMI A;  1RZ5 A;  1HZV A;  1CXA A; 
#chains in the Genus database with same CATH topology
 2M3B A;  4ASV A;  1ZR2 A;  1PGO A;  4ZMD A;  1WEJ F;  2QVA A;  4HJG H;  1BDD A;  2LXB A;  1RY3 A;  1LC1 A;  3EQ2 A;  1E2R A;  1YTC A;  4GIF A;  3SLE A;  3MTU E;  1HJ3 A;  2VHD A;  1Q81 Q;  3L73 G;  1NTZ E;  2QJY B;  2P1J A;  1CRH A;  4Q5P A;  1VQL P;  4OWF A;  2C1U A;  2V07 A;  4DOJ A;  3G3Z A;  1RQV A;  5CCH D;  2LIT A;  1Z56 A;  1P84 E;  1U7M A;  4H0L C;  3A0H E;  3KPE A;  2FYU K;  1FOS F;  1HVV A;  2O01 N;  1C2N A;  3WUU A;  3V4W A;  3A5T A;  2C0X A;  3PLN A;  1E29 A;  1Y9B A;  3CC7 P;  3ORV A;  1EDI A;  1GK6 A;  3H1H J;  3VRD A;  1QL4 A;  4N78 E;  1CIF A;  1AQT A;  1FDI A;  2ITA A;  3AE2 C;  1KV4 A;  1I6D A;  3TNU B;  5AW6 B;  3HD7 D;  1LTJ C;  3L75 J;  3PXS A;  3TGU G;  1SP4 A;  2WIT A;  1GMJ A;  1N7S A;  3NFQ A;  2OYI C;  2Q5U A;  2Z5H A;  1CRG A;  3KQG A;  3ZIY A;  5TJH A;  4YE1 A;  1IJD B;  3BCC E;  1ZW0 A;  2WT7 A;  4RO0 A;  1X9V A;  4GED B;  3WUI A;  1GW3 A;  2B9B A;  2ZT9 D;  3CPW O;  1YNR A;  2K9Y A;  1YEA A;  1PP9 G;  1CYC A;  2ZOO A;  1LTB C;  4ASW A;  3GMA A;  3M9Q A;  2K88 A;  3AEF C;  1EC5 A;  3RK2 B;  2Q9I A;  1ZRT E;  4NPE A;  2QG4 A;  2IYP A;  2QJK C;  4NFG B;  4D6T G;  4PD4 D;  1BCC E;  1JMB A;  3U1A A;  2KIK A;  1VQN P;  1S5L E;  3H1H D;  1MFT A;  5APT A;  2WPV B;  3AE3 C;  4P4Q B;  2J5U A;  2IPP A;  3L75 D;  1R0Q A;  3CX5 I;  1FJK A;  1NOH A;  1GU2 A;  1N73 A;  2FWL A;  3V2R A;  1N15 A;  4LLH A;  1FDO A;  1RE3 C;  1M90 Q;  2BH5 X;  1K04 A;  1LTG C;  5DF5 A;  3IFM A;  1P84 I;  2QA4 P;  4GOD A;  3RLM A;  1ZME C;  1HJ0 A;  3NBT A;  3V5B A;  1KIB A;  1CRY A;  4H44 B;  3VNW A;  4WQC A;  2FYU E;  4DT0 A;  2PAC A;  1CCR A;  1NTK K;  3P8M C;  2WSE J;  1PIX A;  2O01 J;  5AW2 B;  1H88 A;  2G3A A;  2GM4 A;  3L4F A;  3M9B A;  2ORL A;  3CXH D;  3I5C A;  1PPJ E;  2UWJ E;  2PRR A;  3H1J E;  2IBZ I;  1BGY J;  2ZVO B;  4I7Z C;  3H1I E;  2WTY A;  3IAO A;  1CIG A;  1BSH A;  2GIW A;  3H1K J;  1SFC C;  2GA1 A;  3PTZ A;  2M5A B;  4YXW H;  1QGK B;  2D0W A;  1FC2 C;  2N18 C;  1JOC A;  1VDF A;  1IFI A;  1PZQ A;  4A7P A;  3L73 E;  3ZCF A;  2ZYG A;  2O1K A;  4HH2 A;  2JQR A;  2FXM A;  3VMY A;  1KYO D;  2E74 B;  4AYC A;  1NHL A;  1J1D B;  1GIW A;  3CCR P;  4WVZ A;  1H31 B;  2JP3 A;  1OVV A;  1QYZ A;  3JSV C;  3A9F A;  1BSN A;  5APX A;  2D2C D;  3SFD C;  1LTA C;  3AE5 C;  1MZ9 A;  2JWD A;  2JO1 A;  1YIJ P;  4TLF A;  4H0J A;  1BGY D;  2AEF A;  1KQS O;  2ZFC A;  1S72 P;  4DCK A;  2AXT H;  3TF5 A;  3H1K D;  1SQX K;  1VF5 B;  1VQO P;  1DEB A;  4UB8 H;  1EZV G;  1SQQ G;  5CCG A;  3B5N D;  1FU1 A;  1RF0 A;  1BE3 E;  1L4A C;  3Q3D A;  1H33 A;  1LT9 A;  1OIP A;  2PP6 A;  2BEZ F;  1LTI C;  3AEG C;  4BRY A;  1S3J A;  2NPS D;  1L0N G;  1FZF A;  1URQ C;  2NPS A;  1N86 A;  1FJP A;  4WY4 B;  5B66 H;  2J59 M;  2AXT V;  1CC5 A;  1KIL C;  2KNC A;  1SQV J;  1NTK E;  1JMM A;  3D6Z A;  3LW5 H;  3WFC C;  1URQ A;  4DZO A;  2OYH C;  2ZZS 1;  1L0L J;  4D6T E;  1LMS A;  3TYI A;  3L35 A;  4I2L C;  3NXS A;  3G71 P;  2FFD A;  3MP7 B;  1OAE A;  4K3I A;  2OZ1 B;  3TK1 A;  1AOF A;  3L71 E;  3L72 E;  2QM8 A;  3CME P;  1Y8A A;  2KUB A;  3KZI H;  2KLU A;  4C7N A;  2CK3 H;  1NU1 K;  3CI9 A;  5B66 V;  4U3F J;  1QLE D;  1HH0 A;  3WFB C;  2BCN B;  1NTM G;  1RAP A;  2B89 A;  4H0L B;  5CBO A;  1YFC A;  5B5E E;  3FWL A;  1NTZ J;  1OW7 A;  2V7Q J;  5APV A;  3F5H A;  1J2J B;  1FZC A;  1H8A A;  2LIR A;  3KZI V;  1YCC A;  1CTY A;  3GLM A;  3ZBM A;  1LC2 A;  1GL2 C;  2ZXY A;  1SQV D;  3L70 G;  1VQP P;  1LTJ B;  2Y0C A;  1G2C A;  1L0L D;  2OYI B;  3PJS K;  3HTK A;  4I1L A;  1Q86 Q;  3DP5 A;  4GOE A;  4EIJ A;  3H1L J;  1SQX E;  1B7V A;  2A45 H;  4R4L A;  1QVF O;  4U3F D;  1SQB J;  1DT1 A;  4B86 A;  3M0D A;  2FY8 A;  4UB8 E;  2E5T A;  2ZXE B;  1GD2 E;  3CCQ P;  1U57 A;  4IFD K;  3CX5 D;  3GG2 A;  1F1F A;  2C8S A;  1CHJ A;  1NTZ D;  3FXD A;  3Q5P A;  1LP1 A;  3EWK A;  2N3Y A;  2C1D A;  3G4S P;  2QJK B;  5CHX A;  2QJP C;  3CCM P;  1NMI A;  1ZV8 A;  1RZ5 A;  2KYV A;  3MUD C;  5IY5 1;  5GTI E;  5AVW B;  2Y9Z A;  1L0L K;  2L5G B;  3JC2 2;  3U59 A;  3RN0 A;  3M9H A;  2B11 B;  2I8D A;  3D70 A;  2IX7 C;  4OVN F;  1KMI Z;  1GKS A;  1SQP K;  1RH5 B;  1JY3 O;  1S6V B;  1JO5 A;  2K1A A;  3WU2 H;  1NU1 E;  1SQQ E;  1LJ2 A;  3CWB J;  2IBZ D;  1E8E A;  1P84 H;  3H1L D;  3BCC G;  1OFC X;  1SQB D;  3RBZ A;  2N1T A;  4WQB A;  4PJ0 H;  2DVH A;  1N2D C;  2KS1 A;  2B87 A;  3JCU E;  1H0T A;  4GYD A;  1ZXG A;  1Q7Y Q;  1QL3 A;  4EYY Q;  3CCJ P;  2KLV A;  3GF7 A;  4I7Z B;  2R3S A;  2RH0 A;  2PCC B;  1T2K C;  3G6E P;  2YKO A;  2I8F A;  3A0H V;  1BCC G;  1KIL E;  3LIE A;  4C46 A;  1KFM A;  3AE1 C;  2WSF H;  4AAO A;  1SFC B;  4W80 A;  1K9M Q;  2P7J A;  1E5W A;  2C1V A;  2E74 D;  1M1J A;  2XV5 A;  1S5L X;  3H1J J;  1EDJ A;  3S9O A;  2N18 B;  3RK3 C;  1VYD A;  1HGV A;  1N7L A;  4H13 C;  3WC8 A;  3WFD C;  2IFN A;  1IRV A;  4WQD A;  1FAV A;  2OGU A;  1MZ4 A;  1J1E C;  3U1C A;  2L91 A;  5KLV K;  2C9X B;  1DW2 A;  1LFM A;  3USS A;  2FYN C;  2VRS A;  5KAF E;  3D0W A;  1RE4 C;  2GC4 D;  3L73 J;  1IRW A;  3HE4 A;  3L4O A;  3O0R C;  2A06 D;  2ZVN B;  1CED A;  4AAN A;  2Q3I A;  3O6Q B;  3M97 X;  4V2K A;  2FYU G;  3QH9 A;  1HJ4 A;  5E79 E;  3OCD B;  1HTL C;  2Y0E A;  3FXE A;  1PPJ G;  1XTG B;  5KJ7 D;  4L76 A;  3L70 E;  2OTL P;  3VMX A;  3AEC C;  3SWY A;  5KJ7 A;  1YHQ P;  2R5B A;  3CX5 W;  4O9B A;  2N3B A;  3ITK A;  1GK4 A;  3H1I G;  1VQ4 P;  2KZJ A;  1FZE A;  3CC4 P;  3OJA B;  4AAL A;  2BEQ D;  2YKQ A;  1H33 B;  5B6Q A;  1EZV I;  1SQP E;  3AE8 C;  1M60 A;  3H1J D;  4LGD E;  1L4A B;  3TGU J;  2Q1K A;  1DVH A;  3CD6 P;  1CW5 A;  3HQ9 A;  1S5L V;  1YI2 P;  1W2B O;  1EQ7 A;  3P7K A;  2KZI A;  1JTH A;  2N9Y B;  3RL0 D;  3W68 A;  3WU2 E;  3SVW A;  2YQB A;  1URQ B;  5CCH A;  4K35 A;  3MIW A;  2M0B A;  3L73 D;  1KIL B;  3HQ6 A;  1AVY A;  4PJ0 E;  2OYH B;  3L36 A;  3A0B E;  5AVT B;  4Y99 C;  1PP9 J;  1TU3 F;  3HD7 C;  4GDO A;  1N7S C;  4IL6 H;  4GT1 A;  2JWA A;  4GOF A;  2FXO A;  2W90 A;  5APQ A;  2E75 D;  3HD7 A;  1AV1 A;  1QX8 A;  3SWS A;  3I56 P;  5AVU B;  2OTJ P;  4D6T J;  3V2Q A;  1NIR A;  3GW6 A;  4PW9 B;  1YEB A;  1MFZ A;  1OX3 A;  3KHU A;  4XFJ A;  1U74 B;  3M91 A;  3VN0 A;  1QKS A;  2H43 A;  2HYN A;  4U7J A;  1Q90 D;  2ZAE B;  1BE3 G;  2A45 I;  3TGU D;  3CU4 A;  5KLV E;  1DD3 A;  3CCE P;  3V2N A;  3CYT I;  1IK7 A;  2IFM A;  5CIF B;  4HKZ H;  4OH8 B;  4L3G A;  4JQ0 D;  1MG2 D;  1U75 B;  4L1Q A;  5BU5 A;  1VQ6 P;  1GL2 B;  3H32 B;  3Q5R A;  2H8P D;  1NTK G;  3HTK B;  1DW3 A;  1JUN A;  2LXC B;  1AVO A;  1DW1 A;  3OA8 B;  2RMZ A;  1JM0 A;  1YBK A;  1PP9 D;  3L37 A;  1IO4 A;  1LWU A;  3RMZ A;  1A02 J;  1NAY A;  1N73 C;  4IOI H;  2HOD A;  4NPF X;  3L71 G;  3L74 E;  4BWN A;  3L72 G;  1JNM A;  1DII C;  1R8E A;  4N6J A;  4D6T D;  1T8Z A;  1CTZ A;  1SLQ A;  3T97 A;  5AW1 B;  1PFI A;  4H0K A;  2G8Y A;  3VMZ A;  2HLO A;  2L4D A;  1HCM A;  4EIC A;  3LID A;  3RK3 E;  1DIQ C;  1N50 A;  3CC2 P;  2C1D B;  1H32 A;  4FA4 A;  2YXR B;  4EIF A;  1HGZ A;  1G1J A;  3PXW A;  5H2F H;  1H9Y A;  4FA9 A;  1ZR4 A;  2QJP B;  2NRG A;  4O1W A;  2SPZ A;  1IC2 A;  2QEX P;  1RQU A;  4MU8 A;  1KN7 A;  4PWA A;  2PCB B;  2N9I A;  3GHG A;  2CXB A;  3P8C E;  4PV1 D;  1KB9 D;  2JKV A;  2R5D A;  3M06 A;  2DW3 A;  1GW4 A;  3Q5S A;  2BGV X;  3PH2 B;  4IL6 E;  2N9J A;  5H2F V;  3FGA D;  1CSX A;  2E76 D;  4RES B;  1NH4 A;  1CI6 B;  1MV8 A;  1HRO A;  1OWA A;  351C A;  1SQX G;  2W6B A;  1DX7 A;  1ZOY C;  5B5E H;  2IZ1 A;  2JEE A;  4WQ8 A;  1AQ5 A;  1JCD A;  1G1I A;  2LR2 A;  3B71 A;  1C75 A;  1SQQ J;  3E7K A;  3MD0 A;  2D2C C;  3HE5 B;  4J20 A;  1K73 Q;  4LJI A;  2HG5 D;  2CPS A;  3CXH H;  5AW8 B;  3VYI A;  3IN6 A;  1FI9 A;  1EDK A;  2WWW A;  1L0N J;  1CSW A;  2GUS A;  2JDI H;  2KXP B;  2ZXX A;  5B5E V;  2FRC A;  3IR9 A;  3BAS A;  3BVH A;  1HH7 A;  3BRV B;  3F89 A;  2HPC A;  2C0W A;  3RK3 B;  2PFX A;  4H13 B;  4KMG A;  1FHB A;  3AE6 C;  3KXD A;  5CCG C;  2PAJ A;  1NWQ A;  1RF0 C;  1OCD A;  3HUS A;  4O1Q A;  3RGU A;  2XTS B;  1RF1 A;  2Q3E A;  1J1E B;  1LT9 C;  2KP8 A;  1NU1 G;  1QEX A;  2O1J A;  2FYN B;  1SVF A;  3A2A A;  3B5N A;  3R2P A;  1W5C E;  2IZ0 A;  4XYD B;  1ZLL A;  2WPR A;  1CYI A;  1Y47 A;  2NPS C;  3CLQ A;  3O5C A;  1I5T A;  1EZV D;  1SQQ D;  1NTM J;  2OTK E;  3MHV A;  2WSE H;  2O01 H;  1NO4 A;  1CXA A;  2BCC G;  5GTI H;  1NAF A;  1HJB A;  4CPG A;  5H2F E;  4UB8 V;  5TIS H;  2FFD C;  3PHL A;  4WQ9 A;  1QN2 A;  1L0N D;  1T3U A;  1UIX A;  2YCC A;  1DH3 A;  3H1H E;  1U7J A;  4W7Y A;  1JDL A;  1PL5 A;  1IFP A;  5BU8 B;  1JTH B;  3L75 E;  5GTI V;  4XE5 B;  3ABV C;  3DR0 A;  1F1C A;  2B12 B;  5TIS V;  2AEJ A;  3JCU H;  1FZC C;  2W6J H;  2BH4 X;  1YYC A;  2A45 G;  1CXC A;  1HF9 A;  3TNU A;  1YQ4 C;  1OXZ A;  4BXL A;  4Y99 B;  1CCH A;  1NTM D;  5APU A;  1LNQ A;  2YMY A;  3HD7 B;  1CSB A;  1VQK P;  1K3G A;  1N7S B;  2Z4E A;  4NPD A;  1K8A Q;  3CXH E;  2I1J A;  2MHM A;  2RN0 A;  3O20 A;  2FYZ A;  1S9K D;  5AW0 B;  1NVO A;  1D7M A;  1FJ0 A;  2HR3 A;  2WT7 B;  4EID A;  3C9I A;  1ZZH A;  4FA5 A;  3L70 D;  1SQP G;  4Y5R A;  3M0D C;  5KAF H;  1HBW A;  4JPZ B;  3KDP B;  3RK2 D;  3B4S A;  3UIA A;  2GB8 B;  1KZU B;  1KYO E;  2LKM A;  4EOT A;  2C9L Y;  2K9J A;  2E43 A;  1OW6 A;  1MUU A;  1CSU A;  5E79 H;  3BCC J;  2HFE D;  4QAO A;  2FKW B;  2W27 A;  3N4X A;  3TSI A;  2V08 A;  4FA1 A;  1IO3 A;  5C0Z A;  5M1B A;  3C2C A;  1OVU A;  1SQV K;  5KAF V;  2YIU C;  1P84 D;  2B4Z A;  3MGN A;  2BPB B;  3OA7 A;  1N73 B;  4YXD C;  3BRT B;  2WSC H;  3PH0 A;  5TIS E;  1PV3 A;  1BGY E;  3NWV A;  2P2U A;  1USD A;  3SWF A;  1KB0 A;  1BCC J;  5E79 V;  4WB4 A;  5KAI H;  3AE7 C;  1KQL A;  4H44 D;  5KKZ C;  3M0A A;  4N78 D;  3H1K E;  2EXV A;  1R5S A;  2MJZ A;  2N1T C;  5APW A;  1J3S A;  2XDJ A;  4I6M C;  3X39 A;  1DVV A;  2BLF B;  5KLV G;  1KC8 Q;  1CRJ A;  2V7Q H;  3A0B H;  1E79 H;  1NTZ K;  1DEE G;  5K5G B;  1Q2N A;  2BCC E;  3BCC D;  3A3Y B;  4HB1 A;  3CXH I;  2M5A A;  1CSV A;  4RKU J;  3WU2 V;  1AJY A;  2FYU J;  5C9M A;  1M1J C;  3HRN A;  2K37 A;  3N7N A;  2WVR A;  4PJ0 V;  3L74 G;  1ZRT D;  2E5Y A;  4R4M A;  3A0B V;  1PGJ A;  1DIP A;  3H1I J;  1FS0 E;  1S2E A;  1BCC D;  2H7H A;  1EB7 A;  4WQE A;  1CZQ A;  1M7L A;  3A7O A;  4JCG A;  1A2S A;  2AXC A;  3OAK A;  3Q1M A;  1KYO I;  3MZW B;  3L74 D;  1HJ5 A;  2E42 A;  2BAS A;  1FI7 A;  1SQB K;  1C6O A;  1YJN P;  3CWB G;  1VQ9 P;  2D2C B;  3WFE C;  5AVQ B;  4MN4 C;  3WUV A;  4UB6 E;  1WMK A;  1GU5 A;  1WT6 A;  4Z1M H;  4AQR D;  4OGQ C;  3SJL A;  2Z5I A;  4H13 D;  5KJ7 C;  1HWT C;  1VF5 D;  2R32 A;  2C9N Y;  2XU6 A;  3SWK A;  2FYU D;  3ZOY A;  1VQ7 P;  1L0L E;  1NKN A;  3CCL P;  1AFO A;  1NJI Q;  1LTS C;  1Q82 Q;  2P67 A;  1CYJ A;  1PPJ D;  1LT9 B;  1PGP A;  2QM7 A;  3S4R A;  3ZOX A;  1CTJ A;  3MK7 C;  5CID B;  4BRY B;  3L4M A;  4IL6 X;  1JY2 N;  3H1I D;  4WY4 D;  3RL0 C;  4WY4 A;  2NPS B;  3EFF K;  5CCH C;  1LT1 A;  5KAI E;  2AIU A;  4U3F E;  4AX3 A;  5CIE B;  2KNC B;  2YO3 A;  5GTH H;  5AW3 B;  3SXT A;  1NKZ B;  4WQA A;  5AVS B;  1BE3 J;  3CX5 E;  1BL9 A;  3ZOO A;  2OZ1 A;  2OYO A;  2FFD B;  2CPB A;  4JYC A;  1HUC A;  3BAT A;  1W5C T;  2JR8 A;  3TDK A;  4JYB A;  2E75 C;  3VYM A;  3RL0 g;  4WQ7 A;  4C7N B;  5DJU B;  2RKL A;  4N0K A;  3CCS P;  1NTK J;  4H0L D;  5GTH V;  5APY A;  1KX2 A;  2I1K A;  5KTB A;  2FBW C;  4ZKU A;  1KTM A;  1X22 A;  2OQQ A;  3L71 J;  3L72 J;  3VTP C;  3AE9 C;  1FZC B;  1GJQ A;  1AOQ A;  2GC7 D;  2IBZ E;  2ZYD A;  1N7S D;  2ZT9 C;  2QRX A;  3H1L E;  2B88 A;  3RN1 A;  4IL6 V;  1SQB E;  3CCU P;  1LTJ A;  2B0Z B;  1SS1 A;  1N90 A;  2OYI A;  5CIG B;  1G2C B;  1BE3 D;  5AW9 B;  2P10 A;  5CBN A;  2OAR A;  1LWU C;  1NML A;  3PXT A;  4FB1 A;  2W83 C;  3SFE C;  5AUR A;  2YKP A;  3IF4 A;  5AVY B;  1UII A;  2O3J A;  1VQ5 P;  1K05 A;  1ZN5 A;  1COR A;  5BVZ A;  3H1H G;  2CA3 B;  1NTK D;  4XXL A;  1GDT A;  5AW4 B;  3HQ7 A;  3L75 G;  1FCD C;  1A56 A;  1X8Y A;  2K9J B;  1COT A;  4W7Z A;  2MTA C;  2CA4 B;  3L71 D;  3L72 D;  2YNY A;  4FAN A;  1LP1 B;  1M70 A;  3KYQ A;  3CWB E;  5EFW B;  1QL2 A;  1HZV A;  1SQX J;  1WRG A;  2WZ7 A;  2A06 E;  1FDM A;  1MG3 D;  2FXP A;  1JY3 N;  4WBA A;  1VQ8 P;  5GTH E;  3GHG C;  2YIU B;  1M57 D;  3WMM 0;  3FWN A;  4PD4 H;  1C6R A;  1C6S A;  1RE3 A;  1YTZ T;  4PV1 C;  2QIW A;  1M56 D;  1T3J A;  2YMK A;  3ZDM A;  3AEA C;  5CIH B;  3O8Z A;  1YJ9 P;  3R4Y A;  1KD1 Q;  4ZKP A;  2M8R A;  2E76 C;  4RJT A;  2KSE A;  1YIC A;  5KKZ B;  5DJQ C;  4HYT B;  1CIH A;  5AVR B;  2N1T B;  3CMA P;  2XKM A;  3LW5 J;  3QWO C;  3VP9 A;  1GDV A;  2YK3 A;  2KS1 B;  1IFN A;  2B87 B;  4Y28 J;  1H0T B;  1PGQ A;  2J58 A;  1QVG O;  5KLI C;  4AAM A;  3AEB C;  5CIC B;  5DJT B;  2Y9Y A;  1NU1 J;  3V6I A;  1K3H A;  1OMI A;  2JJL A;  5CJ4 A;  3G9R A;  1I54 A;  2AI5 A;  1SQX D;  1SFC D;  3E1R A;  3D6Y A;  4KJM A;  1SFC A;  3V2P A;  1FE6 A;  1RZ6 A;  3WUT A;  1CHH A;  1KQF B;  2Y0D A;  4JF7 A;  3HQ8 A;  1YIQ A;  4M3L A;  2MKV A;  4DJG A;  3H25 A;  1M1J B;  3DMI A;  1HRC A;  1KB9 H;  1MKM A;  3W67 A;  2BCC J;  4XA4 A;  2XND H;  2DGE A;  3SSU A;  1JB0 J;  1OZH A;  4YPC A;  1AA0 A;  3HUS C;  1RF1 C;  1BGY G;  1OVR A;  1LGH B;  1IZL 0;  3OW2 O;  1IFD A;  2V4H A;  1X79 B;  3E1I A;  3B5N C;  1C7M A;  5EXQ A;  3HE4 B;  3H1K G;  3O6Q A;  1KYO H;  2ZJS E;  1KOR A;  1I6E A;  2AEM A;  4WWI A;  1BDC A;  3TGU E;  3OCD A;  4K3A A;  1KX7 A;  4L75 A;  4C7R A;  4OGQ B;  4EIE A;  1NU1 D;  1IFJ A;  1FI3 A;  5CCG D;  1A8C A;  3NMD A;  1FZG A;  3JBT B;  2CE1 A;  1M6Z A;  1L2P A;  1FBM A;  1EXJ A;  1NGM B;  2QJY C;  3ZOW A;  5C39 A;  1L4A D;  3Q2Y A;  1L4A A;  1PP9 E;  3AE4 C;  3PP5 A;  4PD4 E;  2BCC D;  4L3H A;  2IDB A;  3AEE C;  2P58 A;  3L70 J;  2PGD A;  1DD4 A;  3GF3 A;  3NBS A;  3P32 A;  3RBX A;  1JY2 O;  1URQ D;  3MK7 B;  1KQG B;  3RL0 B;  5CMZ A;  3II6 A;  3C1L A;  1KIL D;  3B8E B;  1LTT C;  2ZON G;  4ZNC A;  1KIL A;  3V4Q A;  2OYH A;  3S1K A;  2WSC J;  1SQP J;  2ZBO A;  1W2L A;  2H88 C;  3CXH W;  3VP8 A;  1X0T A;  1I8P A;  1SQQ K;  1KFN A;  1RAQ A;  2E75 B;  2R3C A;  2KOG A;  2KK7 A;  1L0N K;  1SQV G;  1N8R Q;  1H89 A;  1VL2 A;  2JTI B;  1AKK A;  2YO2 A;  1IK9 A;  1L0L G;  4IFF A;  1KB9 E;  2C2C A;  2POH A;  1H9X A;  1KYO W;  2WQY C;  4KT0 J;  5L8R J;  3D71 A;  1CHI A;  3RK2 C;  1GL2 D;  2KI7 B;  1ZP0 C;  4L73 A;  1ETP A;  1CNO A;  1CIE A;  1GL2 A;  2ZT9 B;  1VQM P;  451C A;  4UB6 H;  2WSF J;  3H32 A;  4U3F G;  2KB7 P;  1T6A A;  1SQP D;  2M3E A;  1HZU A;  3OA8 A;  1YQ3 C;  1I8O A;  1OW8 A;  3PRJ A;  2K3R A;  4AUW A;  1NTM K;  1LWU B;  4FAV A;  5KLV J;  2H89 C;  2CE0 A;  1NTZ G;  4DY9 A;  1W2E A;  1JCC A;  2AXT E;  4TT3 H;  2HOD B;  1JY2 P;  2Q7C A;  5CYT R;  4PD4 I;  1EXI A;  2D0S A;  4UB6 V;  4EDF A;  4L74 A;  3T97 B;  5APS A;  3O1Y A;  4RSZ A;  5CIB B;  4N3Y B;  4H44 C;  1FZB A;  2KSJ A;  3CCV P;  1CRI A;  1H32 B;  1S4X A;  3CL3 D;  3C8V A;  3NTN A;  1CO6 A;  1EDL A;  2W8Z A;  5B66 E;  2N9B A;  3L74 J;  1YIT P;  5AW7 B;  1GZL A;  1H1O A;  5CJ0 A;  1GQ1 A;  2IBZ G;  2YXQ B;  4QMA A;  3MUD A;  3CX5 H;  3H1L G;  1CRC A;  1SQB G;  1USE A;  2WPQ A;  3GHG B;  1N9C A;  1C52 A;  5DFS A;  4IFM A;  2WMM A;  1EZV E;  1RHZ B;  5AVZ B;  155C A;  4JBZ A;  3KZI E;  5KAI V;  4PV1 B;  1FZA A;  1FOS E;  3A0H H;  1L9B C;  1L9J C;  5KLV D;  1IFM A;  2N1T D;  4LC1 A;  1AYG A;  1CI6 A;  2E74 C;  1KB9 I;  1DW0 A;  2E76 B;  1J1D C;  1L0N E;  5DJQ B;  4YTP C;  2Q6Q A;  4EI2 A;  3TYY A;  5AVV B;  2IYO A;  4KHX A;  2GUV A;  2R44 A;  1IZN B;  3AED C;  5AW5 B;  1VPC A;  1H31 A;  1YTZ I;  3HE5 A;  5KLI B;  1M1K Q;  1LS9 A;  3FX0 A;  2WPS A;  1A02 F;  1T2K D;  3H6P A;  1IQC A;  2WSS H;  1XTC C;  2XZR A;  1M8O B;  2W6A A;  1YJW P;  5AVX B;  2QSI A;  2A06 G;  1VF5 C;  3RK3 D;  2HPC B;  1NTM E;  3CWB D;  1KV9 A;  1JEK A;  1R5L A;  1NYH A;  3I55 P;  1SQV E;  3HUS B;  2ZYA A;  3K5B A;  1RF1 B;  3VMA A;  3VOP A;  3CP5 A;  3EFG A;  1WVE C;  1C2R A;  1RE4 A;  2B10 B;  1S9K E;  1S1C X;  3B5N B;  1QL1 A;  1FOC A;  2HV4 A;  4OGQ D;  1S5L H;  4WY4 C;  1NNO A;  1JY3 P;  1GU4 A;  1I55 A;  2NZ2 A;  4GKG A;  3P8C D;  1GTW A;  3H1J G;  2XNX A;  2QE7 H; 
#chains in the Genus database with same CATH homology
 5IY5 1;  3RN0 A;  1MG3 D;  1WEJ F;  2B11 B;  4UB8 V;  3PHL A;  4WQ9 A;  1QN2 A;  2YIU B;  1LC1 A;  1L0N D;  1E2R A;  1GKS A;  1YTC A;  1C6R A;  3SLE A;  1C6S A;  1HJ3 A;  2VHD A;  1S6V B;  2YCC A;  2QJY B;  1CRH A;  4Q5P A;  5CIH B;  2C1U A;  2V07 A;  1JDL A;  2LIT A;  2IBZ D;  1E8E A;  3H1L D;  4RJT A;  1YIC A;  5GTI V;  5KKZ B;  1SQB D;  5DJQ C;  1CIH A;  3DR0 A;  1F1C A;  4WQB A;  1C2N A;  2B12 B;  5TIS V;  2DVH A;  3PLN A;  1E29 A;  1GDV A;  2BH4 X;  2KS1 A;  2YK3 A;  4GYD A;  3ORV A;  1QL3 A;  4AAM A;  1CXC A;  3VRD A;  5CIC B;  1QL4 A;  1CIF A;  1K3H A;  1I6D A;  1CCH A;  1NTM D;  2PCC B;  3PXS A;  1I54 A;  2AI5 A;  2I8F A;  1SQX D;  3A0H V;  1K3G A;  4AAO A;  1RZ6 A;  1CHH A;  2C1V A;  2Y0D A;  3HQ8 A;  1YIQ A;  2MHM A;  1CRG A;  2RN0 A;  3DMI A;  3O20 A;  2N18 B;  1HRC A;  3ZIY A;  1VYD A;  5TJH A;  4YE1 A;  3WC8 A;  1FJ0 A;  2DGE A;  3WFD C;  4EID A;  1IRV A;  4WQD A;  1ZZH A;  4GED B;  3L70 D;  3WUI A;  4FA5 A;  1MZ4 A;  2L91 A;  2C9X B;  4Y5R A;  1YNR A;  1IZL 0;  1DW2 A;  1LFM A;  1YEA A;  1CYC A;  2ZOO A;  2GC4 D;  1IRW A;  3L4O A;  2GB8 B;  2A06 D;  3O0R C;  1C7M A;  5EXQ A;  1CED A;  4AAN A;  3M97 X;  4V2K A;  2QG4 A;  1I6E A;  4NFG B;  1CSU A;  4PD4 D;  3OCD A;  1HJ4 A;  3OCD B;  4QAO A;  1KX7 A;  2Y0E A;  3H1H D;  2V08 A;  4FA1 A;  4EIE A;  1IO3 A;  4P4Q B;  5C0Z A;  3CX5 W;  1NU1 D;  2N3B A;  3ITK A;  1FI3 A;  3C2C A;  1A8C A;  3L75 D;  1R0Q A;  5KAF V;  1P84 D;  1GU2 A;  3JBT B;  2B4Z A;  2CE1 A;  2FWL A;  1M6Z A;  1N15 A;  2BPB B;  4AAL A;  1H33 B;  3ZOW A;  5B6Q A;  2BH5 X;  1M60 A;  5DF5 A;  3H1J D;  3NWV A;  1KB0 A;  1DVH A;  2BCC D;  4L3H A;  3RLM A;  5E79 V;  3HQ9 A;  1S5L V;  3NBT A;  1KIB A;  3NBS A;  2EXV A;  1CRY A;  3MK7 B;  2N9Y B;  3VNW A;  4WQC A;  3SVW A;  2YQB A;  1J3S A;  2PAC A;  1CCR A;  3X39 A;  2ZON G;  1DVV A;  3L73 D;  2BLF B;  3HQ6 A;  2ORL A;  3CXH D;  1CRJ A;  2ZBO A;  1W2L A;  3CXH W;  3BCC D;  1I8P A;  1CIG A;  2GIW A;  1CSV A;  3PTZ A;  2JWA A;  3WU2 V;  5C9M A;  1RAQ A;  3SWS A;  2D0W A;  2N18 C;  4A7P A;  3ZCF A;  1NIR A;  3GW6 A;  2JQR A;  4PW9 B;  4PJ0 V;  1YEB A;  1ZRT D;  3KHU A;  1U74 B;  3A0B V;  1KYO D;  2JTI B;  1AKK A;  1QKS A;  1GIW A;  2C2C A;  3TGU D;  1H9X A;  1BCC D;  1EB7 A;  1H31 B;  4WQE A;  3CU4 A;  1KYO W;  1QYZ A;  3CYT I;  4JCG A;  1A2S A;  1CHI A;  5CIF B;  3L74 D;  1HJ5 A;  4L3G A;  3A9F A;  1FI7 A;  1MG2 D;  1C6O A;  1U75 B;  4L1Q A;  1ETP A;  1CNO A;  1CIE A;  3WFE C;  451C A;  1SQP D;  3SJL A;  4H0J A;  1DW3 A;  1HZU A;  3OA8 A;  1BGY D;  1DW1 A;  3OA8 B;  2RMZ A;  1I8O A;  3PRJ A;  1PP9 D;  3RMZ A;  4FAV A;  2CE0 A;  3TF5 A;  3H1K D;  4DY9 A;  1DII C;  2FYU D;  3ZOY A;  5CYT R;  2D0S A;  4D6T D;  4UB6 V;  4EDF A;  1CTZ A;  1H33 A;  4H0K A;  1CYJ A;  1PPJ D;  1HCM A;  2L4D A;  3O1Y A;  4EIC A;  4RSZ A;  3ZOX A;  5CIB B;  1CTJ A;  3MK7 C;  1DIQ C;  1N50 A;  5CID B;  2C1D B;  3L4M A;  1H32 A;  1CRI A;  3H1I D;  1H32 B;  4FA4 A;  4EIF A;  2AIU A;  1CO6 A;  2AXT V;  1CC5 A;  4AX3 A;  3PXW A;  5CIE B;  2KNC B;  1H1O A;  1H9Y A;  4FA9 A;  3WFC C;  2QJP B;  2ZZS 1;  4O1W A;  1GQ1 A;  3SXT A;  4WQA A;  1LMS A;  3TYI A;  1BL9 A;  1CRC A;  4MU8 A;  3ZOO A;  2OZ1 A;  4PWA A;  1OAE A;  2PCB B;  4K3I A;  2OZ1 B;  2N9I A;  1AOF A;  2CXB A;  1N9C A;  1C52 A;  5DFS A;  155C A;  1W5C T;  1KB9 D;  3TDK A;  3VYM A;  5KAI V;  4WQ7 A;  1L9B C;  1L9J C;  5KLV D;  5B66 V;  2BGV X;  3PH2 B;  4N0K A;  2N9J A;  5H2F V;  3WFB C;  1CSX A;  1AYG A;  2BCN B;  5GTH V;  1RAP A;  1DW0 A;  1HRO A;  1KX2 A;  351C A;  5DJQ B;  1YFC A;  3FWL A;  4WQ8 A;  2LIR A;  1C75 A;  1GJQ A;  1AOQ A;  3KZI V;  1YCC A;  1CTY A;  1H31 A;  2GC7 D;  3ZBM A;  5KLI B;  1LC2 A;  4J20 A;  1LS9 A;  2ZXY A;  3RN1 A;  4LJI A;  4IL6 V;  1SQV D;  1IQC A;  2B0Z B;  1FI9 A;  1N90 A;  2Y0C A;  1L0L D;  5CIG B;  1CSW A;  1BE3 D;  5B5E V;  2FRC A;  1NML A;  3PXT A;  1HH7 A;  3DP5 A;  4FB1 A;  5AUR A;  3CWB D;  4KMG A;  1KV9 A;  1FHB A;  2O3J A;  1B7V A;  4U3F D;  1COR A;  1OCD A;  1DT1 A;  4O1Q A;  2CA3 B;  2XTS B;  2Q3E A;  1NTK D;  4XXL A;  3VMA A;  3CP5 A;  2FYN B;  1WVE C;  1C2R A;  3HQ7 A;  2B10 B;  1FCD C;  1A56 A;  4XYD B;  2K9J B;  3CX5 D;  3GG2 A;  1F1F A;  1CYI A;  1FOC A;  1CHJ A;  2C8S A;  2HV4 A;  1COT A;  1NTZ D;  3O5C A;  1NNO A;  1I55 A;  2MTA C;  2CA4 B;  3L71 D;  3L72 D;  4FAN A;  2N3Y A;  2C1D A;  1M70 A;  2QJK B;  1I5T A;  1EZV D;  1SQQ D;  1NMI A;  1RZ5 A;  1HZV A;  1CXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...