3ZBMA

Structure of m92a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
455
structure length
455
Chain Sequence
LPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKAPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 148
structure length 455
sequence length 455
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2012-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3zbmA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zbmA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zbmA02
2HX8A 2FYNB 5AURA 1I5TA 1A4AA 1BQ5A 1CXAA 2OJ1A 1AIZA 5DF5A 1CCRA 1I54A 1BL9A 3WU2V 2PCFA 4A2HA 1MZYA 3AG4B 1NIRA 4Q5PA 3ZCFA 3L74D 2MTAA 4KNUA 1CYWA 2QPEB 2V07A 2GB2A 4E9XA 1EZVD 4XYDB 5A7EA 1EHKB 3T9WA 1JZJA 4G7QB 3EH3B 4AI7A 1FI3A 2FQGA 4E9RA 1NIFA 1RCYA 1CIHA 2PP8A 2XXGA 3NSDA 4IL6V 1M57B 1U74B 3KZIV 1JOIA 2PPEA 5PCYA 3T6ZA 1FCDC 3RN1A 1PLBA 1X9UA 3FYEB 1SNRA 4DPCX 1DVVA 3L70D 2XTSB 1DYZA 1C2RA 2BP8A 1L9TA 4YL4A 4DPAX 1CRIA 1E8EA 5I6NA 1RAQA 3H1HD 3SVWA 1HRCA 3QJVB 3NBTA 4F7KA 3WIAA 3QJQB 2CE0A 3L4OA 4H0KA 4WQ9A 4KNSA 5TK2A 1PP9D 1YNRA 3SQRA 1ASPA 3CDZA 1HJ4A 3WC8A 1FHBA 1F1FA 3H1LD 5F7AA 2XV3A 4YSSA 1I8PA 1SJMA 2I85A 1KYOW 2PCCB 1HZVA 1CYXA 2B11B 4PJ0V 5LDUA 1CHIA 1A8ZA 1YIQA 1OE3A 5GTIV 2ZONG 3VYMA 2EIKB 1N90A 3NSCA 3UAAA 4JKNA 1FA4A 1IUZA 1NWOA 3ORVA 2JTIB 2CAKA 5D4IA 2IWKA 1URIA 1P84D 1ID2A 4E9YA 2BO0A 1SDDB 3KW8A 6PCYA 4MU8A 1ETJA 2PPFA 2R7EB 2UX7A 3WI9A 1N50A 4A2EA 3CX5D 3S8FB 2FQEA 1OE1A 1AG0A 3DKHA 2JQRA 155CA 3FU7B 4KNTA 3SBPA 1SQBD 3CDZB 3NT0A 3JBTB 3WFCC 1RKRA 3O1YA 1DW2A 1AG6A 1M6ZA 5H2FV 1L9QA 1J3SA 1ZPUA 3CVDA 4YSOA 3S8GB 1FJ0A 3OCDA 3PH2B 2PP7A 4X4KA 1A56A 3A9FA 4HZ1A 1AOZA 1E65A 1JERA 4DP9X 4L3GA 3X1BA 2XX1A 3S3DB 5B3SB 1IQCA 2MTAC 5I6PA 2OZ1B 1XB3A 1PY0A 2QJKB 3KW7A 3QJTB 5IY51 1ILUA 1COTA 2N9IA 3L72D 4GY4A 4E9QA 2BGVX 2HX7A 1SF3A 1NIBA 2DGEA 3X1NA 1J5DA 1M70A 1NIAA 3SBRA 2VMJA 3MBWB 1AZBA 4M4RB 5I6LA 1ET8A 4GP5B 3NYKA 1KYAA 2CUAA 2BP0B 2IWFA 1FOCA 3EH4B 3AZUA 4F2EA 1AS6A 1WA0X 4DP2X 2N18C 1C6SA 1DVHA 2GIMA 2DYRB 3FQ1A 1AZNA 3H1ID 1B3IA 4AALA 1DW1A 3VNWA 1BCCD 3U25A 1DW3A 2N3BA 1YEBA 4PAZA 1JVLA 3DTUB 2GIWA 2E86A 1RAPA 1W8EA 4BWUA 2LIRA 3MX0B 4CSPA 4WQEA 1ZIBA 2YIUB 1R1CA 2OCCB 4Q8BA 4WKXA 1U75B 4DP7X 1AAJA 4NERA 1A8CA 2D0WA 4L3HA 1LFMA 5B6QA 2BW4A 3T6XA 3NJLA 4A68A 4AZUA 1UATA 1ILSA 4EF3A 1N15A 5B5EV 1LS9A 1KCWA 1AQ8A 2AIUA 4GYDA 2PCBB 1TEFA 1NTDA 4NB7A 2P80D 1MG2C 4V2KA 1I53A 1NICA 1C2NA 2XVBA 1OCZB 1CC3A 1LC1A 5I26A 4HIPA 3H56A 5I6OA 4N4YB 4FA1A 5B7MA 1DIQC 2QT6A 1CTZA 3WFDC 3PAUA 4N0KA 1IC0A 1NPJA 4DP6X 1F1CA 4PD4D 5I28A 3AG1B 4YSPA 2DV6A 4O1WA 1AS8A 1N9CA 1JVOA 1PZCA 1QYZA 1GR7A 1SHXA 1TEGA 2PCYA 3FSVA 3PAZA 3CX5W 2GI0A 3NP3A 4ZK8A 1J5CA 1MG3C 2PPAA 5KAFV 2MHMA 3H1JD 2I8FA 1NIEA 2GC7C 2TSAA 2GHZA 3RMZA 3GYRA 3ZOYA 1BYPA 5TK4A 3UAEA 4HCGA 1IBYA 4NFGB 2TSBA 1CIFA 3PCYA 1H33B 3WKPA 3FSWA 2FT8A 1RZPA 1SFHA 3X1GA 4FANA 3WFEC 1CHHA 2B10B 1AOFA 1NIDA 3FSZA 2XXFA 4JCGA 3CXHD 1JZEA 1OV8A 2IAAC 2GC4D 3CVBA 2CA4B 1CYJA 3PXSA 1KX7A 4BDVB 3WUIA 2CJ3A 4PWAA 3AG3B 4E9WA 1GDVA 2C8SA 1SF5A 2J55A 2AXTV 3S3CB 2BCCD 4UF7C 1PMYA 4G72B 1GSKA 1PNCA 1A2SA 4WQAA 2GBAA 1HFUA 3DR0A 1HJ3A 2JFCA 2EIJB 1IRVA 4RH4A 3D12B 1C7MA 2N18B 1KDJA 3BCCD 5D4HA 4PCYA 1KGYE 2ZONA 3ASNB 4AKPA 2FRCA 5CIEB 2Y69B 4L0PB 2A06D 4FA5A 2C1DB 451CA 5D4JA 1PCSA 1SQXD 3A0BV 1WEJF 1WS8A 2IWEA 1TU2A 2YAMA 4YVNA 3AW5A 3SBQA 1KB9D 2L4DA 4E9VA 1OF0A 3T71A 4DP5X 3SLEA 4A2GA 1KV7A 2J5WA 3FPYA 5B1KA 1CSXA 1BYOA 1ADWA 3ZOOA 2IDUA 3WG7B 5B1JC 1AKKA 2HV4A 5CICB 3TBBA 4N8UA 2ZOOA 1AZRA 4L1QA 4FA7B 4M3HA 4DY9A 1BEXA 1M60A 4YSQA 1E29A 1K3HA 1IKOP 1ZIAA 2FQDA 1W2LA 1OCCB 1A4BA 2UXGA 4K9JA 1BGYD 3UACA 4G70B 3HQ7A 2W88A 1SQVD 3FYIB 3WKQA 3CU4A 2CALA 7PCYA 1E2RA 3ASOB 1JZGA 1AANA 2B3IA 4A67A 1KDIA 1SQPD 2C9XB 3TA4D 1H1OA 4JHVA 1NTMD 1S6VB 2FT6A 1ASQA 1QNIA 1C75A 3DP5A 1MZZA 3DIVA 3ZIYA 5B66V 3H4FA 2CBPA 3T6WA 2WSDA 1CSVA 2VHDA 2YAEA 1SDDA 1DIIC 2YXWA 1A3ZA 9PCYA 2AI5A 1CC5A 1E5YA 3PLYA 1H31B 4A2FA 3N2JA 3CYTI 4FAAB 1NZRA 4QAOA 3G5WA 3L45A 1E67A 3NP4A 1JXGA 3HB3B 2FYUD 3NJMA 5PAZA 2GC7D 1ZDSA 3QJUB 1JDLA 3L75D 1PNDA 3NSYA 1WA2X 2J56A 4YVUA 3L4MA 1GQ1A 2I7SA 4AX3A 1J9RA 2UXFA 5FC9A 1DT1A 4DPBX 2N3YA 2FWLB 2Q9OA 1I6DA 3L71D 3NWVA 4DP8X 1CHJA 2C1UA 2BP0A 2HRGA 2J57A 2XV0A 3CG8A 5KKZB 2QPDB 1CXCA 1BQKA 3NBSA 2ZWNA 1GS8A 3GXUB 1CRJA 1XB8A 1BAWA 2BP8B 1V10A 4HCIA 2IDTA 1PLAA 3PXWA 1XMEB 4YE1A 3TBCA 1E30A 1L9SA 2OZ1A 4GEDB 4EICA 2BZCA 1ET7A 4PW9B 2BZ7A 1GY2A 1NDTA 2YAQA 1AZCA 2UXVA 5TISV 1IZL0 3NJGA 4AANA 2VSKB 1CSUA 2HLEB 4KO7A 2QDVA 1CTYA 4EIDA 4G71B 4GP4B 1ZV2A 4Q89A 1FI7A 2B4ZA 1KYOD 5ANHA 1KBVA 2CE1A 4UB6V 4HALA 2FQFA 2EINB 2DWSA 2VSMB 3JT2A 2AZUA 2CA3B 1HAUA 1NTKD 1IBZA 1ZZHA 1NWPA 1PLCA 3FU7A 3FS9A 4BK5C 3X39A 3M97X 2XU9A 2FJSA 4HHGA 1AZUA 2R7EA 3SXTA 1HCMA 1FWXA 3MK7B 4BWWA 4BXSV 1CIEA 4AKOA 1YFCA 1ETPA 3OA8A 5I5JA 4YSRA 1YEAA 3S3BB 3CZUB 2N0MA 1H31A 2XX0A 4W9ZA 1CORA 4QLWA 1VLXA 4FAVA 3OQRA 2RACA 5B1JA 3OM3B 1RZ5A 2XYBA 2ZXYA 1WS7A 3PXTA 1J9TA 1CRGA 2FT7A 5EHFA 1T5KA 1EB7A 351CA 4E9SA 4GXFA 3ZDWA 3NJFA 4K3IA 2XLLA 4DP1X 1CNOA 2AFNA 2YAHA 3PXLA 1IO3A 3ZOXA 1QLEB 5DFSA 3OMNB 2YAOA 1ZDQA 1OAEA 3SJLA 3OMAB 2B12B 2JKWA 5GTHV 1NINA 1DZ0A 1E5ZA 2IDFA 3NJHA 4WQCA 2MRYA 2EILB 1YICA 3OMIB 1KBWA 4P5SA 2GSMB 1LMSA 2DVHA 2IBZD 1J9SA 3AG2B 5AFAA 1BQRA 4KOCA 4UAHA 1L9JC 3QPKA 1B7VA 1H32A 1L9PA 2GC4C 4A2DA 1RZQA 1VYDA 5KLIB 2I7OA 1W5CT 1GKSA 3OD3A 3QJSB 4G7SB 1SQQD 1L9RA 1ASOA 1SHWA 1AYGA 3ABLB 1I6EA 1XB6A 2PP9A 4HCFA 4F2FA 3ZOWA 1NU1D 3BVDB 1L9OA 2VW7A 2FWLA 2B08A 1WVEC 2H47C 2B0ZB 2UX6A 4NAJA 1IRWA 7PAZA 3CP5A 2IH9A 2XWZA 2QJPB 3V9CA 1PAZA 2WO3B 4RSZA 2C1DA 5C9MA 5EXQA 4TXVB 1NNOA 4U3FD 1C52A 5CIDB 1BXAA 1KCBA 2CCWA 4HHWA 3TYIA 3SWSA 3NJKA 2IDSA 3X1FA 1YCCA 1A65A 2VW6A 2A3TA 4YSCA 3FU9A 1QHQA 2ZBOA 5AKRA 3O20A 3C2CA 1L0LD 4AAMA 3MK7C 5CYTR 1GW0A 1NMLA 5E79V 2YAFA 1C6RA 2BLFB 3HQ9A 3FQ2A 4KOBA 3T6VA 4DP4X 2W8CA 3ABGA 3RYMA 4EIEA 4FA4A 1JZHA 5AZUA 4UB8V 4WQ8A 1ZRTD 2BHFA 5F7BA 2PPDA 1CSWA 4EIFA 1J9QA 2C2CA 1HAWA 1KV9A 5I6MA 1V55B 1HJ5A 1QN2A 3ZBMA 3QQXA 1CTJA 2IH8A 2WO2B 1H33A 3TGUD 1AACA 5B7EA 2AANA 5CIGB 5CIFB 3IN2A 1C6OA 2YQBA 1JZIA 2YK3A 2IDQA 4HAKA 1CRYA 1NTZD 3DMIA 4QKTA 1HH7A 1KIBA 4YSAA 3JTBA 1OE2A 3PPSA 1R0QA 1CCHA 1GU2A 1I8OA 3CVCA 1GJQA 1PPJD 1YLBB 4D6TD 3UABA 3IN0A 1CURA 4MFHA 5IY5B 4FB1A 1PZAA 3CXHW 2GB8B 1MDAA 2HXAA 3N55A 1BXVA 3ZX1A 1L9BC 2PLTA 1AS7A 4WQDA 2EIMB 2N9JA 2X87A 3FPXA 3CWBD 6PAZA 1W6LA 3FQYA 3FT0A 2LITA 1W6WA 3NJNA 2HRHA 3X2QB 3ABMB 1QL3A 1H9YA 3UGEA 1K3GA 1DW0A 1MZ4A 1AOQA 2BWIA 3HQ6A 1KX2A 5KAIV 3IBOA 1WAEA 2H5UA 2ORLA 1ET5A 4O1QA 4KO5A 2QJYB 3AY2A 1A4CA 1OCDA 5CIBB 5B7FA 2ZXWB 2ZZS1 5C0ZA 2VW4A 3VRDA 1TKWA 4A66A 1JZFA 1AR1B 2DYSB 3O5CA 2VM3A 2BW5A 4YSTA 5DJQC 1CRHA 3WNJA 1GS7A 3EHBB 1GIWA 1CYCA 2AZAA 1PZBA 4P5RA 5CIHB 2BH4X 4LJIA 1BXUA 1QL4A 1PF3A 2UXTA 4W1TA 3EF4A 3X1EA 3IEAA 1HROA 2QDWA 4FA9A 3ERXA 2DWTA 1GYCA 5E9NA 2Y1AA 4BDVA 3QJRB 4YSEA 1N70A 3EH5B 2HZHA 3FSAA 1OOWA 3A0HV 1I55A 1CO6A 1CEDA 3O0RC 3NJIA 3RLMA 2JXMA 2FNWA 1FI9A 4Y5RA 1RZ6A 4ENZA 5B1AB 3H4HA 2X88A 4YSDA 1OCOB 5DJQB 4G7RB 2BWDA 1NMIA 4GP8B 4DP0X 1QKSA 2BH5X 2CXBA 1H32B 2YCCA 2H3XC 3C75A 3FU8A 1NPNA 4XXLA 2VM4A 4P4QB 1CUOA 4WQBA 3L73D 2Q5BA 4E9TA 2BPBB 3PAVA 4KO6A 1JXDA 1OCRB 3NSFA 3GDCA 2LLNA 4KO9A 4UANA 4CSZA 1EZLA 2FTAA 3H1KD 4J20A 2DY2A 2XV2A 3BQVA 1BE3D 1M9WA 1CRCA 5I5IA 5I5MA 1KB0A 3OCDB 1F56A 4GYBA 3UADA 4BWTA 4H0JA 2YXVA 1HZUA 2C1VA 4WTQA 1MG3D 1MG2D 1SFDA 2D0SA 2AVFA 1H9XA 8PAZA 2VN3A 3RN0A 2V08A 1X9RA 2YARA 4AKQA 2OV0A 1M56B 4AAOA 3TASA 4YSUA 5KLVD 1LC2A 5I6KA 3V9EA 1YTCA 2PPCA 2P80A 1L0ND 1WA1X 4KMGA 3WFBC 1FFTB 3NJJA 2YAPA 3TU6A 2HX9A 2PACA 1V54B 1CIGA 4JHUA 4BXVA 2NRDA 1JXFA 3IE9A 3HQ8A 3HEIB 2XUWA 1N68A 3OA8B 1GY1A 5B1BB 2BCNB 3WNIA 1GS6X 1CYIA 1S5LV 2EXVA 4WQ7A 3ABKB
chains in the Genus database with same CATH superfamily
2HX8A 3UMNA 4CKQA 2Z0UA 4H8PA 4JHBA 3FQXB 3DOHA 2EEDA 5DK3A 3EFDL 1J05A 5FCUL 1D5ZA 2PCFA 5D7SH 3VXNA 1A4JB 5AYQA 3FB5B 1OHZA 5DS8B 1UA6L 4KROB 3FO2A 3VD5A 5AW2B 2FX7H 1WZAA 4GQQA 2AVGA 2VZOA 3EH3B 1YEJL 3U4KA 3FUHA 4Q14A 2D7PA 1CDUA 4WNQA 3GXPA 4BEIA 4HULB 5F1SA 1D2PA 2W9LA 3IKKA 3VXUA 4N0FA 4P23D 4Z0BL 4ODUA 1QNZH 4L5FL 1A6VH 4N0FB 4NP4H 7CGTA 4FLRA 4WNQB 2HJKB 1U30A 1DYZA 1L9TA 3H1HD 2X4TB 2NXZC 4JKPH 5DS8A 1PIGA 2Q6WA 2NY0C 5DTFB 1ASPA 3F01A 5DJAA 3LIUA 4WUKL 1F1FA 3BWZA 5E2UL 3W11D 3H2QA 4WAFA 3H3KA 2PCCB 5IV2B 2EO9A 2OK0L 1G5GA 1MHCB 1WWBX 3UAAA 2VC2H 2WB1A 2R2EA 4GAAA 5D7KD 3BE1H 1IUZA 4GG8B 3ORVA 5DRWA 5AZ2H 4NZTH 2CAKA 3IDMA 5HHMB 3BMWA 4P59H 2PR4L 4FLHA 5FR3A 2A9NH 1A6ZB 2MFNA 3NUKA 1R0AH 3MLYH 3RIAF 4DZBB 5GGRA 1E4KC 1OSEA 4HZLA 4L8SA 1GMEA 1THCA 1IGJB 1UOWA 1IGTA 2IAMA 2ZUQC 4S1SH 5AUMB 5I1JH 5EH1A 3EO1B 3V6FB 2HKAA 1Q1JL 1RZKL 4P2YA 3L1FA 5CJOH 1AOZA 3S2CA 4K15A 5D7IE 5JDJA 2OPCA 4I5BB 1DLHA 1I82A 3ULVD 3VD4A 4L05A 1SRDA 2QJKB 1FGNH 5FUOH 4PJ9A 1OAXH 2B1AL 5GSVB 4JANB 1JPGB 1EDQA 2HLAB 2WBJA 5HGHA 4NBXB 3TIDA 3X1NA 1Q9KA 5E5RB 4HW6A 2R0ZL 5J13B 4L4VA 5C08B 1GYUA 3LTVA 1OQXA 1KEMH 1NAML 4HIIB 5GRVK 1EQWA 2CDEB 1YY9D 5AOKA 3L8QA 3QUML 1R3HA 5F7DA 4AALA 1DW1A 4XPBL 4OT1L 5HGBA 1XH3B 3LQZB 3GTTA 4CSSA 2LIRA 4D0DB 1TJGH 1OF2B 1Z9SB 5CZXD 5BV7H 1JHLL 3S6CA 1RUPH 2AW2A 3HZVA 2IMMA 4XODA 1G7JA 4HSQA 4HUVB 1DVSA 1DBAL 1TYRA 3FKUS 3MV8D 1X5XA 1ZT7A 3L9RA 3WXWL 4BZ2L 4XNUH 3NH7H 3SOBL 3U2SA 5FB8A 1FNEA 1S5IL 5AB2A 4LCWA 2H6PB 1KFGA 4QXVA 3SGKA 4FG4A 3BOVA 4AIOA 1CTNA 4HS6A 3D3VA 3ILQC 4XAKE 5LVEA 3LSOB 1JIBA 5CGBA 2GJ6D 4O1WA 5BUGA 1F4WL 2PCYA 3QUZD 4HISA 4L1LA 4N3TA 4OLWH 1X4XA 4CKVX 1ZLUH 4DTGH 5EIIA 5GGRY 3NGBC 5HHNB 1TITA 2DIEA 3G7TA 3IXAB 4F58L 1MFCH 1H3PH 3O3BA 2AI0H 4LPUA 1EJOL 1UA6H 1R24B 1PLGL 3POCA 3IU3A 5J1TC 4MJ2A 3QUKA 3WKPA 3BAKA 5E94B 1MIML 3X1GA 2FSEB 3FSZA 3GMMB 3FTYA 3ZKSD 1XGYL 2EJ1A 3HZKB 4MD4A 3SQOL 3QIBD 4UQDA 3GSNB 1NSNL 3H42H 1RUQH 1I7RA 4K5OA 3VG0H 1O6SA 2FATL 2BNRE 3L3KA 1KYOK 4RH4A 1KDJA 5EC1B 1A47A 1KGYE 4AKPA 1KG0B 2Q7YB 1FL6B 2FH6A 3TV3H 3CBKB 3TYGL 3U0TB 4PGEA 5I1LB 2GT9A 3KPTA 4FYSA 4OQTH 3RIFF 1PCSA 1MRDH 3KPSA 1WEJF 5L4MA 5DQDH 2BIIA 1TU2A 2J1XA 2QZ5A 3I75A 3PDDA 5TPWH 5IB3A 3HZYB 2F53D 3EXJA 5JTWA 4DF9A 5I1GL 2P42B 2Y5TB 2ZXBA 4J7RA 2ZUVA 3Q01A 3MRFB 5I0ZA 3GEWB 4JO5A 4ONGL 3M7OA 5HHOE 1I1FA 4NZUH 1JGDA 3IKCB 3BFQG 4M93B 4P9MH 2RFXA 5ID1B 2YSSA 5IFAL 3WNKA 4YIQB 4FA7B 1UM5L 5D9SA 3EG9B 1I8IA 2CPUA 3IJEB 4LNRB 5GZOA 3SE4A 3VW3H 4YGVB 3P0VH 2HRLA 4DERA 2GBVA 1SQPD 4IK6A 3N44F 2FB4H 5FCUH 1ASQA 2V4LA 3V52L 3IDYB 3DP5A 4UNIA 3UTSA 1BZEA 5D6DC 2X70B 1AO7D 1BCIA 1ETZA 4LLQA 3TPUB 2VO8A 4RIRB 3M8OL 1AMYA 4LHUB 1HS6A 1U93B 2APWA 2AI5A 4O02B 1X5JA 1HHKB 2ZX5A 1UXSB 1BZOA 2BDNL 1CIUA 3OPZL 3UTQA 1U2YA 1E67A 3PHOB 1AKJD 1JRHL 3QZWG 1WITA 2NTSP 3TCLA 2WXRA 4WI9A 3I2CL 1R4XA 3VSUA 3ZQWA 2PXYC 3S2AA 2HTKC 3RPIB 3TA3C 5ADOL 5ALCL 5K9OB 2G60H 2DI8A 2UXFA 1J9RA 3QK0A 1DDHB 4X4MA 1XCXA 2H32B 1SXAA 4S10A 3SDXE 2WNXA 1SMOA 2WN2A 3SE6A 2FGZA 3L3HB 4JQVA 1MCJA 2A73B 2XN9E 2X4UA 1CXCA 2L8AA 1CRJA 1A1MA 2OMZA 4GG6F 3LKNA 3WY4A 2ZP8A 1BAWA 4DHLA 1PLAA 1SJEB 5TF1L 5JPNC 4MX7A 2OZ1A 1USZA 3QI9D 3TBWB 4NT6A 1NDTA 4QXUL 3VWKA 4ZW7A 1ZT1A 3QWOB 1CSUA 5C0NC 5T33H 2WP3O 4EUPA 5IB1B 4PJ9C 1J10A 1K3ZA 3HS0C 4GP4B 5I1GH 1FI7A 1R3KA 1KYOD 1O7VA 3VRLE 1UZ8B 1KWKA 4XAWL 1TTCA 4S1DC 4UDTA 4D94A 4HUCA 3T4YA 3FBKA 1CGSL 1OXYA 4BK5C 2XU9A 5J5EA 4NPJA 1VDGA 3OKOB 2ZCKL 4P5TA 3ARFC 3QHFH 3IJYB 3MBEC 4MNGE 4J1UA 3QEGH 4FFYA 4K23L 2F54D 2MOGA 3VI3E 4JFDB 2EUWA 3FK3A 3ETTA 2NY6D 2K6YA 4OCXH 5IG7A 4HFUH 3HE7A 4ISVB 1LNUB 1SEQL 2VJXA 4TMPA 5AW1B 1HKLH 1KPUB 2RACA 1PZSA 1QR4A 5KANG 1YC8A 1TVBA 3OSVA 3APCA 1IFHL 3U9UB 2VXUL 2Y6SD 4M56A 5I8OH 3RVWC 1FZJB 4GXFA 2F58L 2OCJA 4XBEH 1Q9LA 2CK0L 5T1LD 4PJAA 1M7IA 1D3CA 5C9JB 2B12B 1M2VB 4A6YH 4X7TA 4Z7UF 3VXRE 2DTML 5AKVA 4D3CH 2E0PA 1LMSA 1UUSA 1VFBB 4LL9A 1AXIB 1EDHA 1M7XA 1TDQA 4K3DL 4UAHA 4JHZA 3STLB 1WK0A 1KELL 4N0UE 4JM4L 4U1JA 1L9PA 1N3NA 2ESVA 4P5MA 1VYDA 5KLIB 3DYMA 2K78A 3BQUA 4FFZL 2OZ4A 4GRWE 5FYJL 1A2YA 2E59A 1LE9B 5DQDL 4IRSA 3UO1L 3QPQD 3RNKA 1IEHA 1BQHG 2VW7A 5CLYA 1ORSB 4N8CH 1AGFB 5E7FA 2QJPB 5EN2A 4L8BB 1H6UA 5BOJA 3FO9B 1PG7X 1XGTB 1LEIB 3UBHA 1AYRA 5C0CE 4JJ5B 1NFIB 5GRUH 5E08H 2E74C 3HBGA 3DROB 4Z76A 3F5WA 1MVUB 4MNGA 4QF1A 5FM5O 5AKRA 3QI9C 1HILA 1YPZA 5JXEA 2D0HA 5EN3A 4FCHA 4HIHA 1QRNA 4EKJA 3L5HA 4NN7C 5DK0A 2WAHA 2E7LC 3ZBMA 1N6QL 2P8MB 3C8KA 5DD6A 1H33A 3C87A 4HV8B 3DBXA 3V52H 2D2OA 2VXVL 3MYZA 4FP8L 3KS0H 2XTJB 2IDQA 3S37L 4DUVA 3H55A 5DMIL 5D1QB 1YEIL 1JWUB 2HTKD 5K59F 3EF7A 4M8QA 5KYYA 2ADYA 4PRPB 2HWZL 3B2MA 4JRXD 1QHPA 4V1DB 5B38A 1E8ZA 3II3A 5D1QA 1U8NA 3DWTA 4LLMA 5A1AA 3DVNA 4KH9A 3NFSL 5D6DA 4JRWA 4CSTA 4RRPM 1KZYA 1UG9A 3TFKD 3QUMA 2LITA 5DXWA 3I6KA 1MW3A 3C8KB 5DD6B 4P46A 3LAFA 1C5BL 2BK8A 5MHSD 4TVSa 3BVXA 1J5IA 1CICC 4PJXE 2VR8A 4HUNB 5B39G 1UYWL 3T4AA 2WXMA 4NS0A 4O2CA 3FFCD 5BMFH 1ZVSA 4ZXBB 2PWFA 2VM3A 2FYVA 3FU5A 4IOIB 4P2OB 3MRIA 1NFIA 4U0QB 1JL8A 1X4YA 4TNWK 1XGTA 2VDKB 1LEIA 4FA9A 2PW1B 4MJ6B 1HWHB 3VM5A 1RP9A 1F45A 4WFFE 3IU4H 2ZOTA 4LSVL 4NRXA 5KSBE 5E6IC 4IRSB 2JXMA 2FNWA 2VZ3A 2FECL 4ZW8A 1I3GL 4K7PL 4RBPK 3CSFA 2YGVA 4NP4L 2IGFL 5ERWB 3ULUF 1J0ZA 2Y06H 2EYRA 3AU1A 4PJ7F 4UBDD 1NCWH 1BMGA 3GDCA 5CIPA 4YDJB 1ES0A 3GLZA 4LAQH 2Q7AA 1FL3B 3BQVA 1BE3D 3PL6D 3VWKC 4JFED 5CZVH 4MDJB 3PGCA 5C9JA 1GGUA 1Y07A 3GINA 1A6UH 4LEXH 5J4MA 3AQDA 2H2PD 4GPVA 1WUZA 5GZNA 4UU9A 5I6KA 2WM0A 3BP6A 1KTLA 2X4NB 3QWRD 1Y18B 3OLGA 4KVCH 3TU6A 1ED3B 3E80A 3HE7B 1I3UA 4ISVA 4BXVA 5BS0A 3KYKL 5H94B 3HQ8A 2XZQH 2XUWA 4A6YB 1MVYA 1XSIA 2J71A 3GK8L 5L9DH 3IJYA 4LHUG 2GBUA 3MLTB 3FCSA 3SKOA 3ZKND 1I5TA 1DBMH 2W91A 4ELMA 3QO0B 2ZWYA 4JQIH 1BLNA 5FYJH 4Z7UE 1EUUA 3L74D 4KNUA 3UYPA 1MVFA 1CYWA 4XOBA 4G5ZL 2Y2YA 3CC5B 3Q43A 1EZVD 3VRIB 3QQ4B 5E1AA 1Y0LB 1R3KB 4JKLA 1IJNA 3PDOA 1A6VL 4PWHA 3QNYB 3MOQA 1XHHA 3WFCL 4J3OG 2PCXA 4FTVE 1GIGH 3MJ9H 4J4PA 2YEZB 3VMPA 2AMUA 3N1QC 3QIUB 2DLFL 3L3GA 4MA8H 2XHNA 1ZY9A 3G5ZA 3D85A 2CBQA 1HRCA 3HA0A 4F7KA 4IKKA 3N42F 1QO3A 4HWEL 4J2QA 1D5XA 3HUJF 1OO2A 4KK8C 4MAYB 5FW7A 1P4BH 3CVHA 3FONA 4PLKC 1HJ4A 3WC8A 4P3CL 2F7IA 3UC2A 4UQIM 4P48A 3C8HA 1C16A 1OGAB 3KWWB 3V5KB 2VLKD 3WL9B 2ZONG 2APBA 2EIKB 1TCRA 1CLOL 2A9NL 2ZSWA 3NSCA 2WTPA 4H0LC 4LAJH 4JPWH 4TNWF 1UXSA 3ZZSA 3FT2B 5LBVA 4U7MA 2I9TB 4LHUA 2EC9T 3KW8A 1P7BA 4ILDA 4ANUA 1SUHA 5E9DB 1C5BH 3CX5D 3TN0A 3PL6C 4U1KA 4OLUL 3BVVA 1QFWH 5E0FA 1EAQA 4M62L 2PNDA 1A1NA 3F7QA 3F62A 4ZFOA 1AXTH 4WI2A 1J3SA 1FZMA 2JK5B 4ZSOE 5DD5L 1Z5LB 1FJ0A 2GK2A 3RHWK 5HYEA 4YGVA 4GG6B 4OKVB 1A56A 1CBVL 4PLOB 2NOYA 1NBVH 5I1AA 3NAAH 1HEJC 1I4FA 4W4OC 4AYSA 4DP9X 5HDQL 3S3DB 1PSKH 3A3YB 1FLRH 1OAUL 2NY2C 5HYFA 5C0RH 5I23A 2JV6A 3CAFA 4J3VA 2DYPB 2NR6C 3PNWB 5JOPD 4F5CE 5E8OB 1T2XA 5EUOB 1E28A 3EXLA 2B9AA 3MRFA 1OP3K 3X3FH 5EIVA 3P4NA 1QBLH 3LDBB 4N2LA 2C8NA 5DF0A 5IB3B 3ZYOA 5IJVB 3RVXD 1C6SA 4PRHA 5FYLD 1FVEB 2WV3A 2XG5B 3D48R 2BM3A 1GJIA 2VN7A 2A9AA 4JCLA 2ENSA 2FLMA 2WSPA 3CFMA 3KJ4C 3MRLB 4Q52A 5DJXB 4W9IC 1KG0A 4H40A 2XKNB 1ZIBA 2QV4A 4EUPG 4DP7X 5ID0A 1E4WH 3L3KB 2MOQA 1O6SB 4GI9A 2D0WA 3WUWA 5L7XL 2X4PA 3NJLA 2YA2A 2ED8A 3BP5B 3T8XA 3S98A 4GRLD 1G0DA 1JMZA 5HPOA 3VFSA 1S9WB 4E5XB 3HS9A 3QXAA 4GBXD 2DL2A 2YA1A 4MDRA 1FFRA 3NIDE 5CLWA 1NCAL 3ARBB 3NCFB 3RWEB 1S46A 4MXQD 3WS3A 4ELDA 2BCKA 1NCTA 4JM4H 5C09E 3IGLA 4PJDB 4XVSH 5G2NA 5CN3A 1ESOA 1WZ1L 2FHFA 3D18B 3HAEB 4HGWB 4WO0A 3O3BB 4MZRA 3VXME 2BVOB 3N06B 4X9GA 3PL6A 3NSJA 3TJHC 3SN6N 2DIAA 5J6GB 4QO1A 1MG3C 4JY5H 5KAFV 3TS8A 1II4E 4OZ4B 4Y2DD 1T1XA 4NC2B 3GKWH 4F8LA 2CIIB 3G5XB 2FEDC 4UT7H 2WB7A 4KI5D 1F3RB 5LLIC 4OCNC 2VH5L 4L4TD 3IMUA 1SFHA 1ZHLB 5HHVL 4G8FB 4G1MA 3QUZC 1T21B 4PP2A 3I2CH 3CXDH 1A22B 3ARUA 5BUAA 1KX7A 4L37B 3P3TA 2C8SA 1TPXB 2VMCA 2V3FA 3KMDA 3WFDH 3KEHA 3FDWA 4IMKC 5HI4D 1HFUA 3GRWH 4YC2C 4YWGL 3V5DA 1HKLL 4JFPB 5FV1L 3OKEB 1Z9SA 4FMFA 2VL5A 1HCFX 4WEBL 4QT5A 4L0PB 5D2NA 4JM2C 4PGBA 4AGMA 1EFXB 1XH3A 1U8QA 2HCZX 3R06A 1VEMA 1IM3B 2ZXGA 4OCSL 1ZTXE 2CA4A 5F9AC 1GTNA 4P4RA 3AWGA 1KZQA 2A1WL 2BC4B 4LIQH 4OW6A 2L4DA 3WS6A 4DUWA 3GXDA 3I74A 4BGLA 1Z32X 4H88L 3L81A 4F2MA 5KSAC 3JWOL 4P46D 3FPYA 4YHIB 3H3PH 4M1GL 4WWKD 5LBSA 4L1QA 3MROB 1UCBH 1M60A 1MUJA 2K3TA 1KXQE 3DIFB 1RSYA 4PU2A 1FLTX 4JRXA 1TJIH 1LXMA 3NG5A 3VFVA 1U8LA 1OP5K 4RQQB 3HQ7A 3GMOA 2W88A 2OBGA 3SPHA 5AW8B 3KGSA 3QHTC 3U30C 4KTGA 4Z6AT 4QR7A 1MPAH 2CXKA 3U1QA 1IQDB 2ZQKA 5DR5L 3NCEB 3BO8A 1NMCB 4L8SB 4U4IA 3VUAA 1CCZA 3ZLQC 5D7LB 1PU0A 2QADB 2DQGH 4RGOH 2CBPA 2F0CA 1OM3L 3GI9L 1A4KB 1YYCA 2FJGA 4K8RL 3S36L 2AS5M 6FABH 4P9HH 1TQCB 4Q6YA 3EFDH 1WBXB 1U3ZA 5I0DA 1XSOA 1SDAB 3K2IA 4PJ5A 2VDQL 2ZKHL 4Y1AB 5BO1L 4OJFH 1DQJB 4LKXA 4BFOA 3QIWD 4OIBA 4JPIA 1XQ4A 5J9PB 1QEWB 4FERA 2J56A 1KSRA 3JWNE 3V0JA 4XPTL 5C9KA 1HTYA 4HDIB 5HD8D 4PI2A 5I17B 3HMWL 2VDOB 3ZHFA 3MLRH 1JV5B 4KV5F 1RZKC 3X13B 1NM9A 3KJ6L 4MLIA 3FQTA 1ONQB 2AXGA 3NBSA 4NCC1 4PLKD 4XR8C 2W95A 4AYBA 5HHPA 1J0KA 1DSYA 4G2AA 3BRDA 4JFHE 2ED9A 5HGGS 4CN4A 2NY0D 1F3JA 1S9XB 1BXXA 1U2HA 2J8UA 3C5JB 5I18H 1ET7A 4GRLC 5F1IB 4OZHB 3VXUB 2NY3B 2ZSVA 3RJQB 2DQJL 3LNIA 1X5IA 2WC7A 4KO7A 2RCSL 4RWYL 5ESAA 4IDJL 2C3VB 1TSHA 1BZDA 3MV9D 3IGAB 3LMJL 4LOUC 4MCZB 1VZIA 2H41A 2FK9A 3MRHA 1DEEB 1WZ1H 5JW4M 4EI5A 1AHWC 4EIGB 3VXNB 1D5ZB 2PCFB 4UZUA 5INDB 4B96A 3T2QA 1XGRA 2FAUA 4Q2ZA 2CUHA 3ZN6A 1WFMA 4OB5L 3SD5A 3DLQR 4KKLD 5B3NA 3HG1B 2ZKMX 4XP4L 3FU0A 2G75A 1R3LB 1KTRL 2PTVA 3DX7A 4PJDE 4XX1E 5A16A 1PBYA 2KDYA 1B2WL 2XRAL 1SJHB 1UC6A 3V4VH 5SX5H 5B3JE 1A9EB 3NIDB 5SWSA 4XCNB 5F89B 3WJMB 3CHXA 5EC2B 2A6DA 1Z9PA 3O11B 3LXUX 3W81A 1C1EL 1TQVA 4C4BA 3EYVB 5FYKD 4OUUA 2UVEA 4NDMB 1CXIA 1TQUA 1IC5L 5DMKA 2ZYHA 1NINA 1YNTA 1SGKA 4M48L 1JRHI 2IANB 3GGWA 2DW5A 1YICA 1UJ3B 2IQ9L 2E6PA 1RJLB 3L95B 3CZLA 2EDMA 3T5WA 4X4YA 3EBHA 4TQ8A 3QI9A 4YDKL 4TL5A 5CCHE 3KGRA 3L5IA 1B7VA 3KG5A 4O4YH 3N85L 2VLJA 3OAYH 1YUHB 5DDHB 2DQDL 3QAZB 2ALAA 4FHJA 5DUMH 2GFBB 3WLBB 1JMXA 2VR6A 1ZS2A 3GEFA 4NO0D 1E3ZA 3DXAE 2D7TL 3LPPA 2E76C 2IH3A 2PXYD 1T66C 5H4YA 2AHIA 5JHLH 4JFZL 1ZE3H 3WXWH 4Q9RH 1MJ8H 4IDLA 2YA0A 1D7CA 1DBAH 1S5HB 3CN2A 3TYIA 4CUCA 1IL1B 1AE6H 4PV1C 2COVD 4JFQB 1JK9B 2A3TA 4R90L 3U4EB 4UILH 4EMZA 2EIEA 3K2UL 1M3JA 5ICZB 3MGAA 2WYHA 5FO8A 3KM2A 2E9GA 1ZD6A 1BFVL 5I0VA 2D73A 5IB5B 5LXGH 1AHMA 3LRHA 2JJSC 2UWEA 2C2CA 4FQXA 3TT3H 3QVAA 3FQUA 3IFOA 3QNXB 1DBJL 3V0IA 4DN4L 3WGVB 1EVUA 2DICA 3Q6FB 3QHZH 4OLEA 4YEEA 3Q13A 2VC2B 2EAEA 5T3ZH 4WTZG 3IMBA 4N2NA 5FYJE 5JNYA 2JB6A 2HH0H 3NK3A 5DEZA 5FA3B 3PJLA 5IJBC 3OX8B 5F3HA 4WK4B 3RVVD 1CXHA 4LP5A 3MUJA 1W6LA 3VI3B 1W6WA 4UM8B 1RJZB 1IC5H 4S2SB 1G9ML 3TFBA 5CZXC 5DJ0A 3TV8A 2BX5A 2W0FA 1IB5A 4NLAA 5E4AA 1KUMA 3AY2A 5CIBB 3LOWA 4J8RA 4GT7A 3VRDA 4FQPA 2QQKL 1B9KA 2BNUA 1QSEE 4E36A 3LXBA 1A5FH 3GRWA 5EEXA 2C9VA 4ENZA 1FAIL 3FOMA 3GSWA 5F44A 4MKMA 3BW9B 1OAKL 3O6ML 3K6IA 1C12B 2QSTA 3RVTC 5JHDA 2W0FB 2XN9A 5E2WH 4DPRA 1H3UA 1QVOB 4X7CC 3OZ9H 4QRBA 4QOKB 3A6CH 1K4DB 2R2BA 4D7PA 1G7MB 3FOLA 5KEZA 1ZANH 3LS5H 3FTXA 3B2DC 1QKSA 2BH5X 3E7JA 3RTQA 3V4LA 3OX8A 1LWHA 3C75A 3EYFA 5F3HB 3SDXB 2GIYA 2IANE 4GNKB 1NOFA 4B9CA 2XA8H 2WYIA 3BI9X 2G0LA 4OF8A 4H5SA 4PJFB 2JI1A 4OCWL 2DY2A 5FGBC 5LO7A 3MJ7B 4LE8A 1M1XB 2PYFB 1NAKL 5ABDE 4PW4A 5E6RB 3LZFH 3SYCA 3D39A 2A1WH 2VQUA 5EO1B 4F93B 1F90H 3UDWA 1RPKA 4P2RB 5ALCH 4AKQA 5D7HA 2VDPH 5MERA 3FCBA 3QWNA 1F5WA 2O5ZH 2WINB 2ZJSH 5C0JB 3NJJA 2YAPA 3H3BC 3PUCA 2HX9A 4H8QA 5KJRH 1HINH 3IE9A 3OJDA 1XEUA 1M2OA 1KCLA 1ZWIB 3QFDA 4JFQA 3OA8B 1FDLL 1GY1A 4JCWA 1CICA 2DZEA 1CL7I 3PS6A 1YEEL 2FYNB 3F84A 4OLXH 2OMYB 1BQ5A 1KTKE 1CXAA 1BAFL 1TTBA 1E7UA 3K81A 3AM8C 1BL9A 3FCTB 3WEMA 1YMMA 1CFSB 2VR5A 2GFBA 3IDYC 4NQVB 3F7VB 2VUYA 1B0IA 1EBPA 1NPUA 1KJVB 2ENJA 2GITB 2VLJB 3DVIA 3MJGX 5E7BA 3U9WA 4CW1B 4FEIA 3ZYJA 4G7QB 2KI6A 3A24A 5C97A 4EJ1C 3BUYB 2VIRB 3O0RL 1PKQB 5EEVA 4B9ZA 1UJ3A 5AVXB 3SBWA 1X9UA 1IEAA 1MCOL 1OWRM 2EVHA 4DPCX 1QNZL 4L5FH 5CNHA 2J6EA 3W0WE 3UO8B 4WV1C 3ROOA 3U1SL 4ZUUA 1SQ2N 2IVFC 1OZTG 4OUUB 3C6SA 4WENB 3VD0A 4HJEA 3L4OA 5LXGL 4PWJA 1B4JL 2JF1A 3P0YL 2D3VA 1F41A 5ILTH 2CIKB 4F7TB 1E6JH 4YGAB 3TV3L 2CD0A 3TYGH 1SEQH 1RL1A 1A9EA 1ZLEA 4TOYH 5D1QE 2WTOA 2G60L 4A37A 1AKPA 4XP9L 1E5BA 1S4IA 2X4SB 4X6DF 1MEXH 2ICCA 1R3LA 4HKZA 1N12A 3N1FC 4ZAKB 3VXQA 3QDME 3VSTA 3QYMA 2E9BA 4Q2ZB 3RFZC 43C9A 2EYTB 4MNHB 1EGJA 3BDBA 4EOWL 3CQFA 2CJSA 1S7VA 2O5ZL 3WFCC 2BNQE 2FL5B 2ZJSL 1OP9A 3N85H 3P2DA 5CU5A 4G5AA 4TNEA 4G7YH 3JVGC 1ZPUA 3ZL2A 2IQAA 4KROD 2JLPA 1BSIA 3S8GB 3VI4A 2PP7A 1FLRL 1OAUH 3MV9A 3WTXA 2EEXA 4ZSOA 1NBQA 1P1VA 2ADGA 1N5YL 5HI3C 1IKNA 3FQRB 2QVKA 1CLYL 3CN3A 3TT1L 3L72D 2Y6TE 3IJHB 3RWJB 1KBGH 3ZKMC 4K8RC 1B0GB 2E56A 5AVSB 4POZC 3UZEC 3OZ9L 2DWXA 4KQ3H 4BSJA 2AGJH 2AJUL 4AUJA 5CR8A 1RJYA 2G0KA 1P9MC 4GINA 1YN7A 4XE5B 1SBSH 4AK2A 2Z7ZA 4DVBB 3DOIA 3AZUA 5I17A 1T6WA 4R26L 3WD5H 3ARED 1NDMB 2R2CA 1H0DA 1JZ3A 2NY7H 2GIWA 4M9PA 1UT2A 2Q2LA 4WUUD 3LJ3A 4NN5C 5KBMA 3TNNA 3VI4F 1J1XH 2QTVA 3HNTH 4PJGE 4YS4A 2NNRA 4JAMB 4QTIL 1VHPA 3W2DL 2ED6A 2FEJA 4RNRB 2R51A 4NB7A 3P3UA 2DMGA 1LP9E 5I1HL 3UAFA 3VRJA 2G30A 3DHMA 3KLQA 3J07A 5I6OA 1WZMA 4RWYH 1BD2D 4BA8A 3DYPA 4UM9D 4U7KA 4XO9A 3CX5J 2YBGA 5KBPA 1PZ5B 1F1GA 1F4HA 4AYID 3IFPB 4I3SL 4JRXB 3ZDZE 2FJFB 2ZUSA 1HI6B 5HY9B 2Y22A 2WBKA 3RTLA 3AT9A 3CHPA 4DEPB 3LB6C 4AXWB 4GUQA 1BBJB 1ZVHA 1UM5H 5TK4A 3UXFA 2EDWA 3APFA 3H7LA 4YHIA 5D5MB 5F1KC 1T1WA 2X89A 4XN4A 2HT2C 3RGVA 3Q8EA 1YDPA 5DHXB 3IRZA 4HUUB 2EC9U 3ZGIA 4ECNA 5I28A 4FX5A 1D6EB 4PWAA 1IM3A 1NM4A 3DV4B 4DK5A 4ZMVA 1GXEA 1EFXA 3R06B 3S3CB 5FYKE 5DT1H 2FATH 4OF5A 4H25B 2Z35A 4X2UA 2GBAA 4S11A 4PGCB 4PRDA 2WLZA 1F4XL 4JFPA 1BF5A 1EGJH 5JPMA 2N18B 2BSRB 2X41A 3KCWA 4PS4L 1D7BA 5GSRA 5CIEB 4JQVC 2GQHA 4GQRA 1PX4A 3OKDA 4K7PX 3BP7A 1SXSA 2J8UE 5IM7B 3WIHA 1OB1B 4ZFFA 2XFXB 4CVZA 4PP2B 1A9BB 2ITFA 1OGTB 4JHWH 3SPVA 1TNNA 3C2AH 1B4TA 1MCPL 2RCSH 4FZ8H 1YY9C 4HS3A 5E8EB 3VFTA 4R96A 3G5XA 3E6FB 3WFEH 1ZGLM 2GKIA 1BD2A 3M17A 1AKKA 2HV4A 3WG7B 3C6LD 3PJNA 4X42A 3MRJA 5DJDA 4ZUTB 3OKNB 3DRQB 3PREA 1TJHH 2QPUA 3GJEB 1E29A 3QUZB 5E99L 3M7FB 2LTQC 4IKIA 1E90A 3D18A 4NI3A 4JRFA 1FBIH 2V7HA 2YKKA 3A4EA 1XD1A 2BCKB 4ZPVB 3IFLH 5G4NA 4M1CD 4XTRC 2I27N 2OQJA 4MJIB 1BJMA 5D2LB 3QXAB 1BZ7A 1E9PA 4JUTA 3VFSB 1R3JA 4OJFL 4IMKA 2FVNA 3PLYA 4JO1L 2C7UA 4FAAB 1S7XB 3MGTB 1IIKA 2R69H 4WJKB 4Z0XB 5E6ID 1FIGH 4OQTA 4Y2OA 5T5FH 2HKHH 3FQWA 3L1OH 1FVEA 3L4MA 2DQ6A 4HS8H 4MNQE 2CRZA 3FQ4A 4PRHB 5DZ9A 5ENWB 3V7AG 5HYQA 2IADA 1KTCA 1S3KL 3CDCA 4A04A 3QT2A 3P4NB 3EFOA 3O81A 2A74C 3DOSB 3GBDA 2YD0A 3C5ZC 3F7RA 3V0AC 1FNHA 1FSKC 4PD4K 1YUKB 3ARDD 3UJIH 1DSWA 2AXWA 1MH5B 1QPXA 3TBCA 1P9MA 1QAWA 2K8QA 4PJIB 3UBXA 2YAQA 1CLCA 3MUGA 2AXFB 2P24A 2OI9B 2KLSA 2WQVA 5MENB 5ICUA 2HLEB 4XAKD 3F7PC 4O00A 3JTSA 3ZW3A 4J23A 5FXCH 2DQHL 2JK5A 1MSPA 3MREB 4MMZB 3GRGA 3KYMB 3MMEB 1WAAA 3HW7A 3JWNG 1IBZA 1I31A 3OZLA 4ZFQA 3RIFK 3GMRB 2BJML 2FJSA 2X1QA 3TN0B 4U1LB 1PKOA 3GSUA 4N6RA 2F18A 2KT6A 2R1XA 2WKOA 4NNXA 5BRZB 1EAOA 1L0QA 4IGBD 3T65B 3FT2A 4DCQA 4Q9BA 3VD9A 1DTUA 1IAIM 4WY7H 3S3BB 3I9IA 3F2LA 2N0MA 4S0TD 3RNQA 1P5UC 1U0QA 2BY2A 2R1YA 1EEZB 2W59A 3T04D 3UYRL 5GRUL 3KWWA 3V5KA 2DWYA 5C0FB 3JWDH 1TYEB 1CRGA 1S7WB 3ZGHA 1IAMA 4EUPH 1KXTA 4CU8A 1CNOA 1D5XB 3OLIA 1Q0XH 1RMFH 3S3JA 3H0TB 3VXSD 1RLBA 3ELAT 3D85B 5IT2L 3HS8A 1ADQA 1BHGA 4Z3HA 3QIUA 3LNEA 4F9LA 4OCMC 4FTDA 4OGXL 3UBXB 3AGVA 1KELH 4OR1A 5DMJB 2DLEA 4A7VA 3LEXA 5ADPH 1YEGH 2OR9H 1QSEA 3MRCB 4FXGB 3LXCA 2IBGA 1L9RA 2X4QB 3DOSA 3EW3B 3O4OB 4EOWH 2HJLB 1KCRL 2RD0A 2B20A 1GZQA 3THMH 1WVEC 2APSA 1WIOA 3NCYS 4FQIL 5EU5B 1IRWA 3FQWB 2F61A 1JNLH 5CBEA 2C1DA 5C9MA 3C5ZD 4X9BA 3GC3A 2JKTM 3SWSA 1K85A 3B56A 4PIBA 2O5NA 3MNDA 1RZ8B 2BVYA 3ULUH 2R0LH 4B9YA 4IQHA 2CCLA 3HVNA 3LKPB 2VB5A 3ZE0B 4IKNA 3WU1A 4H2AA 1HAWA 3D25A 3SDYH 4JFVA 1TJMA 1FV1A 1QN2A 3C5SB 4X6EA 2IH8A 4RMSA 1DUYB 2HT2D 3TWYA 5J13C 1U8OB 2V7HB 2G3XA 4PJCA 5HHVH 4BKLA 2Y0SA 3FUKA 3MCYA 1DFBL 4M43H 2G5RA 4NFBA 3TJEL 3DC0A 5JZ7D 1LO5B 3AU0A 2E4FA 3PPSA 2O5YH 1GU2A 2WOBA 1SZNA 1Z5YD 3EYQD 3BFWA 2FGWH 2XN9D 4XVJH 2EYRB 3DJ9A 4G9DB 4ZUTA 2VDLL 1L5GA 1GHFH 2YZ1A 4NQDA 5E2VL 3FHEA 5C0AE 2QPSA 4DOHB 1I8UA 3I6SA 2ICES 5D55A 5AWNH 3UCRA 4JM2A 5A2JH 5HD8C 4HIXH 1U3HA 2JXMB 4DO5A 4RETB 2CKBL 3GF8A 3BVNB 4N9GA 1MZ4A 1S9YB 3RY6C 1WIPA 1A9BA 4X6CB 5E2TH 4OLXL 4EE2A 5F9JB 3IXTB 1OCDA 3T2PA 1EERB 3QCTL 5ES4B 2FCBA 1UENA 4NN6C 4YSTA 5L0QC 3AAZA 4UZGA 1CLZL 4K55A 4IOIA 4P2OA 1QFWI 4LSSL 1E9OB 3P9LB 4YLBA 3GSXB 2IGTA 1RUMH 5KJ4A 4MBRA 2EUVA 1Q9WB 4K8RD 4OF3A 2Y1AA 4WK0B 1TOXA 3T4AB 4BDVA 1MCBA 3MACH 4PJIE 4XMPH 4Z7WF 4GAYB 4HUUA 1O5DT 3E0GA 3EYQC 3ATEA 4RGMC 2DB8A 4J3SA 2OW7A 2MNWA 3WIFB 1MLBB 1JYXA 2YCCA 4ZZKA 1HL5A 1S6NA 1PSKL 2ORBH 3B37A 4E41D 4F7MA 3PAVA 3ECQA 5FECB 1KNOB 2HG0A 5HY9A 2I60H 4ZOBA 5EBLB 5FV2A 1DQLL 4XVTL 3U46B 3WV0A 1YNTF 5IWLC 3CLEL 3CZGA 3OCDB 4QIRA 4OZHF 1QKZH 4Y1AE 4P4KA 3VSQA 1I3RA 3GZQA 3P30L 3L4ZA 4M43L 2I5YL 3RZWA 3CCHB 4LEOB 1QRNB 1CN4A 4XB7A 2KLRA 1AIFA 4LK4A 4YBQC 1WA1X 1DJGA 3PWLB 4NHUA 1QFWM 3BZFA 3VDBA 1MVUA 4MNGB 4XN2A 5HYJD 2DLHA 2VLJD 5BMFL 5FEBA 5KYWA 4IIQB 2BCNB 1A1OA 4KUZL 3S35H 3WNIA 1IEBA 1JF1A 2IO5A 4MNQA 1ULVA 1QATA 4FFYL 4KJPC 3VXRA 2YD8A 1CLOH 1ROWA 4MWFA 5DJ2B 5AW5B 1RULH 5HYSG 4IRZH 3ZZQA 5K9KB 2CHXA 3L4VA 5DF5A 3QIUC 1S78D 3ARPA 1UGKA 2EIBA 2AJYH 3RU8H 3O3EB 4B9JA 4JRLA 1NCJA 4FE9A 2WQSA 4B41A 2GB2A 4IRSD 2KS0A 3LCYA 1HHJA 1RZJL 2CM6A 4UT7L 3RWJA 4ONOA 4IL6V 1OTSC 5JW5B 1BWWA 5I8KH 4Z7WB 1HOCB 3L48A 4DAGH 2VXVH 5E23A 3GM0A 2FYYB 3DV6A 3MV9B 2BP8A 4TN9A 3MRKA 3ME0A 2CNZA 5CN1A 4LLWA 4WVRA 2X05A 3NCJL 3SVWA 3DXAA 3AXHA 1XD0A 2FHCA 4W9KC 3KWUA 1T20B 2YQ2A 1MHHB 1TETL 4QY8B 1SLVA 5D7JC 1N0LB 3SQRA 4RAVB 2IJ0C 4HZAA 4XP6L 2NZ9C 5HGDB 5IFHL 4K7FA 43C9B 3IGKA 1F4XH 2QR0B 4GSRA 4HS8L 3SDCC 3VYMA 5HVHB 1MHEB 4OCLC 3QCVH 3QW9A 5GGTA 4XPBH 4HU8A 5D2LE 1IVLA 4ATTA 5KTEH 1GGBH 2VISA 4NX0A 1MNUH 1RIHL 3AC0A 4LRNL 4PS3A 4WU5B 5ESVA 1E0OB 4JRXE 3NEEA 2O72A 4I1RA 4G8EA 1AG6A 5F1OB 1M6ZA 5EZOL 3L2MA 4QRRD 3T0EB 4UDTB 1QTSA 4G9FB 3WEBA 3CBJB 1BVLB 2DQJH 2FEEI 4FI6A 3BEWA 4OCRH 3IFLL 1CLYH 1T4KB 2EZ0C 1IEAB 2ZNXA 3ZKQD 1NEPA 3JXAA 2R0KH 3B8SA 2GJ6E 2V0AA 3ARSA 1A7NL 5HDLA 4PGDA 1PY9A 5DFVC 1I3GH 1NFKA 3FMGH 2P5PA 4OM0H 5I75B 5TF0A 2CUAA 3FT4A 4HX1B 5D7SL 3DDFA 3FRPA 4XCFH 4ZD3H 4DP2X 1N64H 1Q0XL 2DDQL 2G3ZA 3VGAC 1QWHA 4R2GD 5K9OA 5CD3A 5J3HC 3U25A 4PAZA 1OANA 2OMVA 4JLRA 3MX0B 3QQ9D 5IQ9B 1CICB 3G9AB 3UTQB 4UM9B 1MRFH 3UFIA 4ALAH 3FF7A 5J1AA 1CQKA 1DP0A 4HIEA 3WTVA 3E8UL 1KCWA 2NLJA 5LWYH 2GYSA 4XCCH 3TPUA 3T6QC 1W9XA 2X70A 1K2DA 3ESUF 5MERB 2ADIA 1AO7A 2CBTA 4LRIA 4OT1H 4ZZFA 1FG2A 1OCZB 2W38A 5I26A 1OZUA 4Y19B 2Y3AA 3D39B 1B6UA 1CTZA 4X9FA 5D1ZD 1QSZA 4HF5H 2WMPB 2PYFA 3CH1A 4UT9A 4PD4D 4YL9A 5HVFB 3QEUB 4I2XE 4D3CL 4K94L 3EG9A 3QWQB 4F33B 2H9GA 2YSSB 1Q0EA 2RFXB 5ID1A 4HMCA 5I1IL 3WEXB 3LVEA 4Y19E 6TAAA 2Z4QB 1JUFA 3HCVB 1LP9B 2OFQA 4LPTA 3BVUA 1KTDA 3PCYA 4YDLB 2Y5TA 1BZ8A 3S5LB 3SE8H 3UDWC 3QQDA 1SN0A 1D6VL 3NMEA 5I16B 5F71A 4AL8H 2XETA 5KBKA 3CPUA 2E27H 1C12A 4CILA 1GDVA 1BF2A 3S34H 2AXTV 3BQUC 2ZKHH 3HRZB 1FL6A 3VFOB 3BPNB 3BRFA 3WELA 1U36A 5CLXA 2BOBA 3FOMB 4L4TA 1YNLL 1ODAA 1IILE 4KXZI 1R5IA 1YHPA 3V4VL 5L2KD 3BYTA 4ODTL 5HJBA 3BLPX 1OAYL 2WQ8A 5EMYA 4TLSA 4FLQA 2P5WD 3RVUD 4MMXA 2FBRA 5LBGA 2VLKE 2Q8AL 3HZKA 1XIWD 1LILA 5I1EH 2BXZA 4MJ4A 3SLEA 3NZ8A 4XP6H 1KIRB 4CDHA 1JWSA 2XKSA 4OI7A 4OU3A 3CSPA 5CGYD 3CTTA 2OJEA 4M7KL 5JORA 2WKGA 1A6AA 1UCBL 4APQD 2DKMA 2ZOOA 1X5GA 3CN0A 5IGXL 1NUFA 3GI8L 1AOHA 3L4XA 4GQPH 2WAQA 4FQXC 4AYGA 2CH8A 4LVHB 5EBMA 4APXA 4ETYA 4W9DC 2C26A 2CALA 4ODHL 3CSGA 3N43B 3APMA 2HP4A 4JGUA 1S7RA 3PIQA 3WTUA 1Q1JH 1RZKH 1MFDL 1M7DA 4IS6A 3QS3A 1JNNH 1KB5L 4MZ2A 4U0RC 5E6IB 3VVVA 4WF7A 5FB8B 1ODUA 1NMAL 1N5AA 2YSTA 4PJ7B 4F24A 3UIZA 4FNRA 1PIFA 3SYPA 3ESNA 4XMPL 3HZVB 5EFIA 1ZSDA 4B60A 1H31B 2LOEA 3FC8A 2ZD0A 4S1RH 4KFMA 3SQOH 1RIUH 4YPGB 3HB3B 4KQ4H 1AR1C 1ZDSA 3ZSSA 4AMKL 3L75D 1PNDA 4AL8L 2OZ4H 1NFDF 2C9SA 5B38G 2Q86B 2ZKYA 4DPBX 1IGIH 4N2OA 4HIIA 4WW2A 3NWVA 4PB9L 2X10A 3W0WB 3FZUC 1YUHA 5DDHA 3T1FA 4OCWH 2CRIA 3VXSA 3OXRA 2XTSA 4I48B 5GSVA 3PFQA 4YE1A 1UKTA 4X4YB 2LU7A 5JOFA 4WWKB 2W60A 3IDGA 4HKJA 2WUCH 1MELA 5TISV 1CDIA 1HIMH 2J25A 2IANA 3GGWB 3EYUL 1SVBA 1NCNA 4FNUA 4MYPA 2Q20A 5AVVB 5ITBH 3D9AL 3W3BA 4AVJA 3VE0A 1QFHA 5IHHA 5K39A 3SDCB 4AEIH 3T3PE 2EH7L 1I1RA 1A66A 4YR6A 4W9GC 4WGWB 2AZUA 4HZLB 1NTKD 1ANUA 4G9FE 4KZEL 5KSUA 4DZBA 1T2QH 5EF3A 3IRPX 1KN4H 2R7EA 5D7LD 5SWSB 3F8UB 3QP3A 2X4OA 5KS9B 1A5FL 5D96C 1G6RA 3CHSA 4LP4A 1MJ8L 1E6OL 3DUSA 2OMXA 3QBTB 4FL4B 3RWCB 4IBWA 3KJ4B 2XX0A 2ZYRA 4W9ZA 2VDQH 1R5VB 1UKSA 4AIZA 4BUGA 3F6LA 1D6VH 5ELIA 4KQ0A 3VFPB 2JJTA 4NFDA 1HXMA 4KJYA 3U1PA 4K3IA 4PH8A 3FJTA 3KAAA 3MRHB 1FO0L 3FRUA 1QLEB 4CVXA 3V6OC 1MCDA 4X80H 4IJ3C 4PJFE 4ZNEA 1S7SA 3VAEA 4F15C 1YYML 5IREA 2HJKA 1JK8A 3EDFA 2XA8L 4XNQB 2AABL 4YE4L 5F9DC 4JK0D 4OZHA 1HE7A 2MSPA 5F1IA 3NCBB 4KMTH 5HP5A 3MV8B 4XMLH 4HHAA 1LEGB 3ILEA 4Y2LA 4XOCA 4U6TA 1D9KA 4RMVA 4C55A 2I7OA 1ZLSL 4Z7VA 4PY7B 1SHWA 1O9VA 1JV5A 4XWGL 3VFWA 1KTJA 1TUPA 2UVFA 1GZHC 4PJFF 1L9OA 5DVNA 35C8H 2UX6A 3T3PF 1G9NC 3HHMA 3PV6B 2IH9A 3MXVL 3A67L 3BN9D 4Z7UB 1XSJA 5C0GA 5I19L 1MCCA 3QJOA 1P0SE 3OR6A 1UUNA 1NGQL 2XQYK 4LSUL 4PTUA 3W1ZA 1UEYA 4IOSA 3C2CA 4Y4KC 4BINA 4FQQB 4EI6B 4OGYH 2QVMA 2WUBH 4XCEB 3T6VA 4PJAF 1IGYA 4U3SB 1T0MB 4Y7OC 3UTOA 1BW8A 3F83A 1XIWA 4GQ9H 4ETQB 3NDZE 1JDCA 2V33A 3EDKA 2P5WA 2QKIB 3PDGA 3QDMB 4PJ8B 5IR1B 3ULUE 5L2KA 5B7EA 1CGSH 1NMAH 3FB7B 25C8L 4PCSA 4PV8A 1XZ0A 4W81A 1BZQK 2O1AA 4RQQA 4JY6B 2W81C 1KIBA 1AGBB 3TZVD 4NO2B 3DIFA 3VI4E 3UBFA 1ZHNA 4AGLA 2P48B 4KRMB 4OFYD 2ZP9A 1BJ8A 3RGBA 1BGXH 2DQCH 4OI9A 5E56A 1L9BC 2OMTA 1KPRA 1AS7A 3B7UX 2I69A 1ZTXH 6PAZA 3QZWA 3GZKA 3X2QB 3B7SA 1KYDA 4ESKA 4NQSB 3IDXL 3UGEA 4F2MB 5HHXL 4YHLH 2E7BA 4M6OL 2BWIA 2GTZA 4OFIA 2BC4A 1EXUB 5KTEL 1BDYA 5HGAA 2A5UA 4PJHF 3FUNA 3MBEA 3U36B 3FFDB 5F7YC 1HEZB 5E2JA 3KVDD 4QRRE 4GUOA 1ZJBA 5D2NB 1X6LA 3S5ZA 2BW5A 4DW2H 1JFHA 2AQ2A 1JYVA 2DQEL 2FEDD 4GRMA 3FUJA 5C0BD 2A38A 3KPSE 1S3RA 2VLRB 1YEKL 4ONFL 2MCMA 4YHYB 2DWTA 1I8KA 4P2QB 3HS0A 4ZPTB 3TPKA 3ECBB 2NR6D 3Q8FA 1U8IA 5AAMA 4P4KC 2X1PA 1LK2B 4X9IA 1X44A 1FI8C 2NUTA 4F27A 5C0CD 1GOFA 2LHAA 3FMGL 1T83C 2MQ0A 3SDDA 4QRAA 5GQBA 3C6LB 1X5KA 1AP2B 4DP0X 1NGZB 2I60L 1H32B 1NPNA 3PAYA 1YECH 2V9UA 4E9TA 4I4WB 1I75A 1P7KB 1PAMA 3O2DL 4U6XB 2RQEA 4O2EB 3NJVA 4TPRH 2EYSA 4QPEA 5FOBA 3CDFA 4N8VA 5I5MA 1KB0A 4FXKA 4NUMA 1H3GA 1Z6JT 1WE5A 4WUUA 2YEVB 1FE8L 4Y7MA 3X14B 1MG3D 3FB6B 4MJID 3D0LB 1LDPL 1U8PB 1UM4L 2V08A 3IDIB 1BMZA 4HXAH 5FK9B 3WJJC 3WUWG 3ZO0A 3D69A 3SZ6A 4EXPX 4OFQA 1J8HA 4XX5A 1K5WA 1F11A 3BP5A 1V54B 2VERA 3MU3A 3GRWL 4WJ5A 3GB7A 4N2CA 5F6HJ 5LWYL 1J1XL 4CVUA 4HPOL 1VRSA 3N43F 4OSUL 3ROLB 3ABKB 2R9HC 4Y1SA 3L4YA 2XZQL 5AURA 4Q56A 1IC7H 2XG5A 3P9WB 1I54A 2XQ0A 2FWOA 5E6UB 4X6BB 5GGUA 2BVPB 5IJVA 1DHKA 3CFCL 1GA2A 1V7ML 4QDGA 4LP8A 5KVFE 5HHOB 3SCMC 1EHKB 5DJ6A 1LL1A 2AQPA 3R1GL 3MLSH 1CGYA 2PYEA 1T0OA 1WFOA 5CEZD 1FBIL 4HJ1A 5LN4A 3WN6A 4G3YL 5DD0L 2XN2A 3BD4A 3T6ZA 5LGHL 5FHAH 2AK4A 5T1LB 4OKVA 1EK3A 5I6NA 5DK2B 1Z5LA 4YAQB 1DN2A 2DQTL 4GG6A 2ENQA 3F7LA 4IM8A 1A1NB 4TLKA 4JREB 4LF3A 4P5TD 4XNBA 1T5WA 1RU9L 1MFMA 2AEPH 5G5DB 2V2WA 1ZHBA 2D3NA 2ZUTA 1B9ZA 5F8QC 1BG1A 2OYLA 4Y9CA 2I9TA 4AYMC 4TOYL 2HTLC 5HDBE 3VX0A 2OI9C 2VITA 4PYGA 4Y5YA 1ND0A 2TRHA 3AY4A 2BP3A 3HR5A 2UYLB 1MCWM 3BZ4A 5CD5C 1U91A 4ODXB 5KVEL 3VWKD 4MJJA 3OKMB 5EULV 3D69B 4Z23A 4MMYB 4RSYA 5K9QI 1I7ZA 1SQBD 2DMHA 3CDZB 2YRPA 4F1ZA 5IW6A 5A6MA 3CVHB 1RKRA 1AVAA 2X9ZA 4PWEA 2EXYC 5DEJA 4FFTA 1L0XA 1QO3B 2R9HD 4D0CA 1YEGL 4FXKB 2DMBA 3NQIA 4ZMPA 5CILH 1O0VA 4NUGH 3D07A 3QXVA 3L5WA 2E9IA 3T0AA 2JI2A 1P7KA 2MTAC 4JL2A 1YN6A 2A6JA 1EZVY 5AW3B 3RWFA 1RFDL 4UNVA 1VA9A 4JFSA 4R97C 4AIXA 4AT6A 1NGZA 1B0RA 4OFPA 5FLUA 1AKJA 1LQBC 1AZBA 4BZ1L 3QQ4A 2IPKB 3VRIA 2IGFH 1NL0H 4YHPA 1YEJH 2D03L 4MRCA 3EH4B 4AGNA 4AG4L 4F2EA 5FA4B 1OPOA 4OZFB 4U1SB 4HK3J 3SDAB 1U8IB 5FW6A 3VCLB 5BRQA 2FNBA 4BH8A 1FJ1A 2QHRL 3CZSA 3QUXC 2ATKB 3COOA 4BWUA 2YIUB 1T2JA 2GSIB 2GTWB 1VPOL 5IKCB 4HJIA 4LASH 1A8CA 3T6XA 1ITCA 2BW4A 2V8LA 3NFNB 4IRJA 3W11C 4ENEC 1ED3A 1W72A 2EXSA 1AQ8A 1AJ7L 5GZOD 1HEZA 2X4NA 5IVNA 12E8H 4U1NB 5HGAB 4UU9B 1FUNA 1NICA 1EJ6A 1WYJA 2EDRA 4WWID 4NQSA 3DUUB 4M7LH 2N7SA 1GHFL 3VWJB 4JE0A 3PAUA 1RZJC 2IG2L 4N0KA 3B3IB 4FG2A 4MS8C 1FL3A 3WTSA 4KKBC 2P5EB 1ES0B 4QXWA 1QYZA 3BPCA 1KXVA 3IMVA 5GXBB 1KBPA 3L3OB 2ZF8A 1CBVH 4NC1E 4G80B 1U8HB 3O6KL 1OT4A 1XCQB 1U3HD 3PWJA 1CJYA 2YQGA 2Z8WC 1EO8H 4M7LT 4JM2D 4XNUL 2TSBA 3UC0H 1G43A 3PPEA 4XI5C 5F0JB 4H26B 5TDPA 2ED7A 3BGFC 2EDNA 3VFUA 3WFEC 2P5WB 2C1OA 2VUOA 4JCGA 1QPPA 2FX7L 3JVFC 3A6OA 4W93A 5E6YA 5CM1A 3WO3B 2R0LL 3SJVE 5CHNB 4X8CA 1JZ7A 2BCCD 2VR7A 4EI6A 1AE6L 2YIHA 4PJ6A 5EU3B 4E5XG 1HJ3A 1RI8A 4I1NB 3OQ3B 1M71B 2DL9A 4J3XA 4P46C 4R7NB 3O9WB 3UYRH 4IBUA 3O6FB 4YEFA 3IVKB 3R8BB 1N19A 1WAPA 2QSVA 4WK2B 5EBWB 3PV6A 2OYKA 1WF5A 3TVMD 3X3FL 1G1OA 3KPQB 4DP5X 3T1WA 3LQAL 3G5VB 3KPRA 3GKZA 4A2GA 3HRZC 3RAJH 3QPQC 2CO6A 1DL7H 2JKIS 4I7ZC 2DS4A 5EORL 3CIAA 4LCWD 4NYLB 1U8NB 1FFPA 3TBBA 4UTBA 4N8UA 2FJHB 4V1DA 5B3JF 1S8DA 3DYOA 1DDTA 1BEXA 2CXGA 1YRKA 5DVLA 1WFUA 2FQDA 2MKLC 5D4QA 3ZTNL 1JWUA 1BGYD 1MCFA 4OFDA 1AXTL 1XF5A 4I89A 5KYUB 5F7HA 2BNQB 4FQHA 5TF1H 4WLCA 4WFHD 4JQIL 5BZZA 5DLML 3TYFA 1QNIA 1C75A 4K3JH 3B9DA 2WLNA 1ZGLP 3CV5A 3NOIA 1MI5B 4P59L 3GPSA 3QXDB 3HFMH 1GAFL 4F7PB 4PBVC 3QIUD 4WWOA 5DRXA 1A3ZA 4XI5D 1HILB 2VKWA 3KPOA 3QDHA 4A2FA 4L4VD 3DVGB 4AMKH 1NGXB 4TQIA 4Z76B 3G5WA 3NP4A 4QHMA 5CN2A 4ELME 2OL3H 2FYUD 5PAZA 2WBJD 3K4AA 2ZZUT 2X4OB 3QQ3B 4K94C 4N8PA 1ZTMA 4PJ9D 1NAMH 4JZJB 5KSUB 2WPGA 2NYYC 2R0ZH 2VLKB 2XT1B 3CHRA 4QRSB 3RA7L 2R2HA 3VFNB 2ESVE 4YDZA 2XV0A 4LOVA 4YHMH 1MIMH 1DQLH 4RWHA 5K39B 4E42A 1K6QL 1IBGL 2GIXA 5T3ZL 4ELMF 4ES9A 4G8IB 2OS7A 1VFBA 2W60B 4GO8A 1AO7E 5SWSD 3MA9H 4X7TB 1TJHL 5TH2B 4FA8A 1M2VA 3QJXA 5ANHA 3NABH 1M7IB 3T1FB 2KC0A 1Q9LB 2ADFH 1HAUA 1FC2D 3KBEA 4I18A 3ZTJH 2W65B 2ZYIA 3X39A 1QTPA 1MCQA 2AJXL 1TVBB 4KWUA 1E6OH 1DQDL 3II1A 1AQDB 1LNUA 2EDLA 4OLZH 3IWVA 2IFFL 3JWNC 3MNVA 3GI9H 3S36H 4CMMA 1FAIH 1H31A 2MNJB 1PQZB 1NANH 3H9ZA 4WY7L 4XMZA 1UD5A 2VR4A 3OM3B 4A7UA 5K9QG 1KB5B 3BIKA 3LV3B 3INOA 1A6PA 4NZJA 4PJ7A 5DT1L 3BJLA 3DJRA 351CA 2H3NB 3T4YB 3BSZH 2QLVB 1A7OL 1TZOA 1UZ8A 4CBZA 4XO8A 4AEEA 3SJLA 1CFVL 2MPAL 2AJSL 4GW5A 2AKRA 2FGWL 1JE6A 4ZI8A 3QEQB 3GBNH 3NCJH 3AM8A 4RBPH 2KQMA 1G7PB 4TNVF 1I3VA 2Y36H 4MB5A 1YEFH 3QE5A 1MKFA 3MV01 3UAJC 3IF1B 3Q2VA 4QXTA 4YHOH 1HJBC 1NGWB 2F8VA 1G1CA 4W9CC 2WLIB 4FZ8L 1XIWC 3KJ6H 5IBUG 5JORB 3PABA 1C1EH 3LKNB 1XVSA 2F54E 4MJ5B 4NUJB 1JWSB 4HCFA 2EIZB 2X4UB 1XB6A 4HH8A 2A73A 4LSQL 4PW3A 2DEXX 4R7VA 1N7MH 3KGTA 3T0VA 2PUQT 4NOBA 2H32A 4YX2L 2PR4H 4NAJA 4B3VA 2H6UA 4PB0L 4PLNC 1IX2A 4PWGA 3ARVA 4LSUH 4U6YA 3ZE2F 1BXAA 3M6DA 4HHWA 3PHOA 3DO7A 1IC1A 1KFAH 1GRWA 4IGBB 4E9LA 1ECYA 2LQRA 4L4TB 5C0CA 4Q7DA 1MQKL 4RIRA 3S9DB 2VDMH 4H13C 3RYMA 4IIQC 3QDGB 1CSWA 2W80C 1MCNA 4C83A 1CI5A 3OHXA 2NXZB 1HJ5A 3HI5H 3SQBA 3V8OA 2H26B 5C0BA 4QEGA 3UG3A 5SWQA 5CIGB 2OMUA 3B2UD 1C6OA 5FYJU 4B7LA 2X3CA 1U3JA 2Z4QA 4K07A 3MRDB 1EFXD 3OAWA 1JTOA 2HA1A 4Y4KB 1R0QA 2VDRH 4KH2A 3IJEA 1SYSA 1NJ9A 1QTYT 2OL3A 1NJ9B 3IN0A 2M1KA 1R5WA 4YIQA 4JN1L 4JG0H 3P4LA 2A9ML 4HPHA 4I13B 1MDAA 4AY0A 3CH1B 4Y16B 2IH1A 5BS0E 2WMPA 2CK0H 5TDOB 5TGBB 4MMXC 2OMUB 3U79A 1P5UB 5SWQB 4AVKA 1TTFA 4LIQL 2FBOJ 2MPAH 2OXHA 3DPDA 3FT1A 4FP8H 4FHKA 1UWGL 4Z3TA 5E1GA 3JWOH 3RGHA 1SOSA 1WAEA 2H5UA 2VO5A 1WLHA 4QAWA 3SDDC 5CJ5A 2DEYX 3IMWA 5D70H 2VDPB 2ZXWB 4DWHA 3WIHL 3KPMA 4UB0L 2B4CL 1A7PH 5CGYC 2UWEF 4Y4FA 3GXMA 3O5CA 5A2CA 1EZVX 2ARJB 4NXSA 5DJQC 2E4TA 3NESA 3UZQA 2VR3A 3N42B 5EO0A 2BH4X 3MX0A 3RPBA 2N7AA 3GSNA 4LSSH 4XB8A 3W5NA 2H6OA 2QDWA 3HNVL 3KLKA 4YK4B 4EVNA 4I88A 4XH2B 3B7YA 2VZTA 4IJ3B 1CU4L 1J48A 1FC1A 1KJ2A 1MPAL 1XTLA 2WXQA 4XAWH 3SGDI 3VA2C 5KBNC 4KXDA 4ODHH 3ZKXC 1FI9A 1ACCA 5CSZA 3HN8A 3IU3B 4YXHH 1BWMA 4UIMB 4YSDA 2J1YA 4MJ5A 1EV2E 3VYPA 1QZNA 4DVRL 5IOKA 3CIQA 3CUPB 2WLIA 5C0BE 5J6SA 3TBSB 1ZPLA 4XPAH 3FRPG 3K8MA 4CGUB 5JA9A 5E4EC 4UANA 4AW4A 3LIZA 3PQYB 4LSPL 5GZNC 3LSOA 5I8KL 1E2WA 1Q1PA 3BEWB 1TZGL 3UADA 3ZKNC 4CRPA 3EJPA 5CUSL 4BKSC 1BQLL 1FNEB 2AVFA 2OTUB 4HVBA 1KENH 4K7PH 2OZ4L 1GYAA 3IDJB 2F19H 3TASA 3GUTB 3RAJL 2X1WL 3E8UH 1N6QH 2H0FA 2BIPA 4M61B 5ISZB 2OLDA 2VXUH 4JHUA 2NRDA 4H4NA 3L3JA 4JY4B 2L7JA 2W07B 4FFYH 1C7TA 3LRSA 5DC0A 2NQ3A 4D0DA 1MIEL 1AQDA 2F6AA 1IE5A 3JV0A 2XZCH 3BT2L 4K7FB 3IBEA 1XGPA 3Q1SH 3WU2V 4NKMB 3S4SA 3U83A 5HGDA 2CDEA 3W0WD 2CA3A 4P2QE 1IRAY 3TFKC 2E7MA 4HQQL 1RQ5A 2QELA 3C09B 5JHBA 3RY5A 3VXUE 1OTUC 3TIDB 4RSVA 3BUPA 4TF4A 2EH7H 1N26A 1CIHA 1HOCA 2QEJA 1HYSC 4QYAA 3K0YA 3I9AA 4FQLH 4G8IA 5C6PB 2L04A 1PLBA 2DLGA 2BINA 1EEUA 3L70D 4LHUD 4YFLF 3V6FA 1N5YH 1FHNA 3I9GH 5I6XB 3GBLA 5BQ7A 5GJTH 5AUMA 5ETUA 2A4EA 4H0KA 1IGJA 4X5WB 2NY6C 1HZKA 2JWYA 4S0SD 2FHBA 2IAND 4RMRA 2EVIA 2VLKA 4V1DE 4XMKL 5A2FA 2WXJA 1WFIA 2NY4D 2YD7A 1OLZA 2J6EL 2ZWKA 3V55A 1CHIA 2UZYA 3EGSB 1PZ2A 1P84J 4HLZG 3IDMB 1XR8A 3QDJE 4XTRD 4AENB 5D5ME 5J56B 1DSFL 3BGMB 3SGDH 3DVGA 4P0DA 2Y7LA 4C47A 1NWOA 3KYOA 1BIIA 3QH3B 2CM5A 3VXMA 1ID2A 2A83B 5DRXB 1MEXL 5IV2A 3S8FB 1AIFB 3WI9A 2EXWC 1THAA 1VZHA 5IEKA 3SBPA 4JFFE 4AE1A 4CAGA 5DTFA 1NA8A 5IQLA 2Q6WB 3AB0C 4ZDHB 4ENED 5DHDA 3EGXA 2EEAA 3VXPA 1VENA 1P53A 3ZR5A 2A9BA 1NOAA 2HFGH 2KQNA 2CU9A 2WXPA 3S96B 3UC0L 2ZUXA 1U4FA 5FO9B 4MMZC 4PN6A 4RFEA 1IQCA 2F8XC 4I87A 2GJRA 2YXFA 5FECA 1SXZA 3K6OA 4U31A 1TQCC 3A4DA 5J3HD 1LHZA 3ARGC 3AS2A 2X2IA 3D52A 3U4AA 1T6BX 4NBYB 4NYLA 3EJZC 4G5ZH 4QRUB 1KTBA 3MBWB 2CO6B 3BCDA 1KYAA 2ITEA 3PE9A 3GMQB 3FO2B 1S78C 5BS0D 1DBML 3BFOA 3CFBB 2EEFA 3LKOB 3TVMA 1AS6A 4PJ8C 3TO4B 3FB5A 1YEWA 1A4JA 1DBJH 1CDJA 2HKFL 4J12A 5AKSA 3EJTA 1T7VA 5E1IA 4H8UA 1CGVA 4KKQA 2PCPB 3ZZLA 4B7IA 1DW3A 1DEDA 2F1BA 1UZGA 3GJFH 4PRHE 3O6FA 1DBBH 3QZMA 2B0SH 1KBKA 4Z7VF 4CU7A 3UBGA 4F57H 5E00A 1AJ7H 3FULA 4I0KA 4PS8A 3HR6A 2VDKH 3JV4A 1MRFL 4R7DB 1LS9A 2DI7A 3KHOA 5I2IA 4M8RA 5D5MF 1I1CA 4OGAC 1GMIA 4KKAC 2RA1A 2XWXA 2ROYA 4HCRH 5DRZA 1UFGA 3VMNA 5J12B 1Q0YH 4S1DD 2VKXA 3BVNA 1XCTB 4N2BA 4TUUA 3IT8D 2Z31C 4EN2A 1WHPA 4N0CC 1UWGH 1DIQC 4QHUA 5KZCB 2YFOA 3O3DB 3BP4A 4LQFL 4EEEA 5H37H 4CJ1A 4BRJA 4TVPL 4B0MM 3TO2B 3C2SA 4NQDB 3AS1A 1AS8A 1JVOA 1PZCA 1V3JA 4G9DA 4ZOCA 1UWEH 2YGNA 2X6AA 5DMGD 2EDTA 5KVDL 5AOMA 4KKZA 3L3OA 2MHMA 5ADPL 4UTBL 4NRZA 3HG4A 2VZSA 2YC1A 3RMZA 4MKTA 3S7GA 1ZXQA 1AGDA 5IB2B 3K71B 5ICXA 3VWJA 1IBYA 1SOQA 3JT0A 5I71C 4ZW6A 4JGJA 1QUNA 2FT8A 2PYEE 3VGBA 3CVBA 3GK8H 3MTXA 1G7QB 2BHZA 3QJFA 4YDLC 4PJHE 3ZE2B 4UOW0 3BKJH 4IRJB 5I82A 5EDXA 4MTMA 5TDNB 3ULVF 4X98B 5I76B 2GSIA 4ODVH 1WICA 2Y7QB 4FQXD 4FA6A 1U33A 4BFIB 4FA5A 4UCFA 2C1PB 1PKQE 1SMDA 4ODSH 1OQOA 4X7SL 3UPAA 3FN9A 2IWEA 4GSUA 4OZFA 4U1SA 4Q9CA 2FEEL 2HSIA 5D1XC 1OF0A 2ZOLA 1YPZE 2MPVA 3OKLB 4ADIA 4QJ5B 5IHBA 5DSCA 1KV7A 1JZ5A 2Y3NA 3LY6A 4W4NA 4YHPB 2VCOA 1EHLH 2OTWB 5CAYB 2YN5A 3QO1B 4FXGA 4M4RA 4MVBD 4ZJ9A 5TTRA 3TEXA 4BH7B 4DNLA 5B1JC 5D1ZB 5CICB 3KL0A 32C2B 2P45B 2HMID 4DY9A 1OSPH 3L6FB 3UEQA 4GEIA 4IRJC 4NHCH 3TEUA 3MO1B 4L9LB 3O0LA 1IGMH 3CD4A 4D0CB 1XF2A 2NNAA 2F7QA 3B2PA 4JHVA 4JX0A 2B1HH 1S7WA 4OH2A 3ZIYA 2QFRA 4ZTPH 4NNPH 5HHME 4ATWA 5C0FA 1QEXA 1CSVA 5CCKL 4WEEA 1I8LC 2WZAA 2YUVA 3X3GL 1DIIC 2E47A 3L4TA 3QAQA 4XRCB 2D31A 3ZQ9A 1ND0B 3C08L 4ZO6A 2C9PA 5CF3A 3Q2CA 4KZCA 4QRRA 4ZW3A 1KIPB 1I7UA 1YA5A 2ESVD 2HG5B 2ILLA 2YRZA 4LLAA 4UQ3B 4AEHL 1JDLA 1PY4A 3GWJA 2CBMA 4R26H 4XE0A 5IMKA 1UJTA 3GMRA 3IPBA 5CZRA 4B9IA 1ZLWK 4FQCH 1BQLH 2FWLB 4QRTB 3VXSE 5HHOD 3KYMA 2RALA 3MMEA 4G83A 4HKBB 5DHMC 2BFVL 1AI1H 4BZ1A 4POYA 2AK4D 4N3UA 5DK2A 4PJBA 5DUJA 5T1LA 1GGIL 4M5YL 2HWZH 2LR4A 5C3TA 5CWSA 3CFKA 5I9QB 5IIEB 5EUOE 3AS0A 1HQ4A 3MHZA 3WLWC 3MUGB 4NBZB 4HKXA 4APQB 4PW9B 1JF6A 1GY2A 1ZE3C 1N4XL 5HBBA 4G8GB 2VSKB 4N1EA 5DZOA 4KMTL 3HE7D 3DX1A 2Q76A 1UD2A 1TFHA 1FZKA 4RDBA 3BDYL 5HHOA 5EOCJ 2A2QT 4DUXA 4LLVB 5TQ0L 4FNTA 2HT4C 1U58A 5ENWA 3FT3B 4NAMA 4OV6F 1ZHKB 1CK0H 4X50A 1LK3L 5GHWL 1IJ9A 4EDXA 1Y7VA 5GS1C 3BAXA 5EPMB 4ES8A 4I2XB 1CXLA 2XWCA 1LO4H 2ERJC 5ITFA 3BESR 1DQQA 4AVIA 3MGTA 3E8VA 4JFFA 1XXFC 5ICYA 2YN3A 1J8HB 1OEZW 2CO2A 1WS7A 5D2LA 5FK9A 3VXRD 3MUY1 3IDIA 3U0WH 3QIWA 4KJWD 3HE6B 1XH2A 5AOIA 3X14A 1FNGB 5D96B 3OMAB 2CO7B 3ATBA 4PRAA 4JREC 5SX4H 3BPLB 2MRYA 1C5CL 1OW0A 1WD8A 3W38A 1D2OA 4FQ2L 4U6XA 3OMIB 1KBWA 3K74B 4PS7A 4BK4A 5JPMC 1W16A 3MV11 5HHQB 2WQUA 1YMHA 2P46B 2LLGA 5IQ7H 2E3VA 4U7SA 3C60D 3CC1A 4O2FA 1H32A 3NTCL 1BD2B 2VNCA 3M17B 2XBZA 4L4TE 4ZT1A 4P4KD 4R96B 3QXTA 3A21A 3BPOC 4HS3B 5CSBA 4G59C 2VYRE 5HI5D 5AAPA 3P02A 3SPVB