3ZBMA

Structure of m92a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
455
structure length
455
Chain Sequence
LPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKAPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
total genus 148
structure length 455
sequence length 455
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2012-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3zbmA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zbmA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zbmA02
1CCRA 1ET7A 1M9WA 3CVBA 3PCYA 4XXLA 1IBYA 2DV6A 1QLEB 2J5WA 3H4FA 3NBSA 3OQRA 4K9JA 4WQ7A 5C9MA 1KYAA 2PPEA 5CIGB 1NWOA 1PLAA 2AIUA 1C7MA 4DP9X 4BDVA 3NJIA 2C1DB 3L74D 1A8CA 1OCDA 1LC2A 2PCFA 3QQXA 1H33B 2UXFA 3M97X 2WO3B 2XXGA 4KO5A 5I6LA 4MFHA 3A0BV 4EIEA 2QPDB 4JCGA 3MX0B 3S3BB 2FRCA 2PCCB 2IWFA 2VN3A 1CYCA 2JFCA 3FU7A 1ZV2A 1SQXD 1CHJA 7PAZA 1JDLA 1A8ZA 1HROA 2MTAC 2CJ3A 3T6VA 4WQCA 4QKTA 1CO6A 3IN0A 4YSDA 4YVNA 1YNRA 4KO6A 3WUIA 1COTA 3NJMA 1JXFA 1PNCA 2IDUA 3X1NA 2B10B 3T6XA 1I8PA 4Y5RA 2IDQA 3BVDB 4DPBX 4DP1X 2H3XC 2N18B 2QJKB 1DVVA 4DP2X 1PLCA 1OF0A 3AW5A 5E79V 3PAVA 3AZUA 1HCMA 2NRDA 4L0PB 2L4DA 4EF3A 4YSOA 4LJIA 1ZZHA 1NZRA 4DY9A 1PMYA 2GHZA 2Y69B 3FT0A 3RN0A 2XVBA 2CXBA 1QL3A 4QAOA 3CYTI 1J5CA 1T5KA 1W5CT 2ZZS1 2JKWA 1M6ZA 1GJQA 3PXSA 5H2FV 1JXGA 2JQRA 2QJPB 3V9CA 1AOFA 1SQVD 1ZPUA 2VHDA 4G7RB 3H1ID 5IY51 1C75A 3TU6A 2PACA 1AACA 4WQEA 1IC0A 1JZJA 4UF7C 1CNOA 4NB7A 2EIJB 2VM3A 1DVHA 3SBRA 3UAEA 1B3IA 4GY4A 5I26A 1J9QA 2LITA 2AVFA 1OCZB 5PAZA 1EB7A 1FWXA 5I5IA 2BO0A 1PZAA 5I6PA 3CVDA 3TYIA 2BZCA 1B7VA 1BQRA 1CSVA 1J5DA 2PPFA 3HB3B 3KW7A 4AKQA 1PZBA 2BP0B 4NERA 3CG8A 1I54A 2IAAC 3QJTB 1JZHA 4KNUA 4YSCA 5B1KA 2DYSB 4KOBA 1ETJA 4FA4A 1NTZD 2YIUB 2YQBA 2IBZD 2GC7D 1FCDC 2CA4B 1A4CA 1AG0A 3NP3A 4BXSV 4Q5PA 3GYRA 3CWBD 2B11B 4HALA 1I6EA 4A68A 4O1WA 3TGUD 1CHHA 1NU1D 3O20A 1ETPA 1BQ5A 1EZVD 4N4YB 1KYOD 1AS7A 1JZFA 4F2FA 5I5MA 1MZZA 1AS6A 5KAIV 1OCRB 2OV0A 3UADA 2HRHA 6PCYA 2IH9A 3RMZA 1HH7A 3ERXA 2C1DA 4EICA 2XUWA 3MK7C 2BHFA 4GXFA 3S3CB 1H33A 5CIEB 2OCCB 2VSKB 1SDDB 4BWUA 2J56A 1GQ1A 5B5EV 2UX6A 4KOCA 3ORVA 1R1CA 3FSVA 5FC9A 5GTIV 3IE9A 5DJQC 1M56B 1K3HA 1YFCA 4HHGA 2W8CA 4A2DA 1HFUA 1AS8A 3AG1B 2EIMB 4GP5B 4TXVB 1CTZA 3OCDB 2QJYB 1E67A 3JT2A 5AZUA 4AZUA 1YEBA 2ZXYA 2UXGA 2Q9OA 4UAHA 4PAZA 5AKRA 3ZCFA 2PPCA 1DZ0A 1DW0A 2YARA 2ZXWB 3G5WA 4E9RA 1RZ5A 1JZGA 2MRYA 5B3SB 4HCGA 3UACA 3O5CA 1LS9A 4AAOA 4FA1A 1OOWA 1OAEA 1WS8A 1CRJA 3NYKA 2BCCD 2W88A 4E9QA 3OMAB 3WKPA 1E29A 4UB6V 3QJSB 2N0MA 1CC5A 3QJQB 3EF4A 1RAPA 3CX5D 2B08A 1HAWA 1SFDA 1CRHA 2FYUD 1GY2A 4WQBA 3FS9A 2FT8A 2FT7A 5B6QA 3FU8A 3CXHW 1CXAA 4YSRA 3MK7B 3X1EA 3X1BA 2UX7A 3X1FA 1L9OA 1W2LA 4KNTA 1C6RA 1ZIBA 3ZOYA 3ZOXA 2EIKB 4M4RB 1CURA 1PF3A 2HXAA 1GW0A 3NJJA 3RYMA 4EIDA 3OM3B 3CU4A 5DJQB 3ASNB 3EHBB 4YL4A 2MTAA 5TISV 1IUZA 1A4BA 1CYXA 2BP0A 1I8OA 2UXVA 4M3HA 4NAJA 5B7EA 2VSMB 3L71D 1ASPA 3TBBA 1CIEA 2BZ7A 2IDSA 3PLYA 2DGEA 2GI0A 4H0KA 4AANA 3KW8A 4BXVA 4F7KA 1E5YA 1ET8A 3S8GB 3QJRB 1GIWA 1LFMA 2XV0A 3FSZA 2VW6A 5KLVD 5KKZB 3WKQA 4DPCX 1CSWA 3L4OA 2D0SA 1MG3D 4ZK8A 1L9BC 5I6KA 1NPNA 5PCYA 4AALA 2XX1A 1SJMA 1C52A 3SXTA 1GR7A 2QDWA 2R7EB 1BGYD 1H31B 3HEIB 1CSUA 5EHFA 3HQ9A 1PLBA 2GIMA 2WSDA 3HQ7A 1OE2A 2N9JA 4PW9B 1U74B 3BCCD 1CYIA 1GKSA 3RN1A 3SVWA 2HLEB 4QLWA 3SQRA 3WFCC 2FWLA 1JERA 3HQ8A 1SF3A 6PAZA 1S5LV 3ZOOA 1BYOA 2E86A 3OCDA 2PLTA 3A9FA 3PAUA 2X87A 3FQ2A 3FQ1A 4A2GA 4G72B 3EH3B 2HZHA 2UXTA 1CXCA 1FI7A 3DP5A 5AFAA 8PAZA 2X88A 4MU8A 2GBAA 2PCBB 1NTMD 4YE1A 4X4KA 1I53A 1M70A 5B1BB 1HJ4A 1IBZA 1FHBA 3OMIB 451CA 1GY1A 1N68A 1BAWA 1F56A 1ASQA 1NIDA 2B3IA 2N3BA 2GC4C 2I8FA 1SQBD 5ANHA 4YSUA 1CORA 2C9XB 1QYZA 2B4ZA 2FTAA 1N15A 2BLFB 2C2CA 4V2KA 4AKPA 5LDUA 4FB1A 1SQPD 2BWIA 2YAQA 4HAKA 4GP8B 1AOZA 4FA7B 1A4AA 1DW2A 4KMGA 5F7BA 4E9VA 4G7SB 3WFEC 1X9RA 4A2EA 1L9PA 3PXWA 1ASOA 4PWAA 1AR1B 2PP8A 3O0RC 1YICA 5I6MA 1NIFA 2N9IA 1U75B 1MG2C 2CCWA 2V08A 2LLNA 4GP4B 2XX0A 4DP4X 155CA 1NTDA 2IH8A 1HRCA 5I6OA 5CIBB 4HIPA 4YSPA 3PPSA 2A06D 2A3TA 2YAPA 2XTSB 4DP6X 2QDVA 3IBOA 4E9TA 4A2FA 1OE3A 2IDFA 4Q89A 1BXAA 4KO7A 3T6WA 3NJNA 1KCBA 5B1AB 1W8EA 1V10A 1L0LD 2AFNA 4RSZA 5I5JA 2IWKA 1IKOP 3NP4A 4A2HA 1E2RA 1IO3A 3NJLA 3WNIA 1LC1A 1XB6A 1SHWA 2CBPA 5F7AA 4GEDB 1NIEA 1KCWA 1OV8A 4KO9A 1YEAA 1A56A 1PAZA 2WO2B 1L0ND 1H9XA 5E9NA 3X1GA 2I7SA 3NSDA 3T9WA 4E9YA 4P5SA 1NDTA 2YXWA 1N50A 2FT6A 2YK3A 2XV2A 1I55A 3QJUB 2ZWNA 4D6TD 2EXVA 2N3YA 3H56A 4YVUA 2DWTA 4CSZA 4AI7A 5EXQA 1C2NA 2DY2A 1NNOA 351CA 1PY0A 1JVLA 4AKOA 4HHWA 1L9JC 2GIWA 2TSBA 4YSTA 3WIAA 1SQQD 1H31A 2B0ZB 1GSKA 2IWEA 1AANA 1DIQC 4FA5A 1L9TA 4BWWA 5A7EA 3NSYA 1QHQA 1IRVA 3NSFA 1FFTB 5B1JC 3CP5A 1H9YA 1NINA 3IEAA 2YCCA 3H4HA 1GU2A 3QPKA 3DR0A 5B66V 1N9CA 2C8SA 1J3SA 1KV9A 1DYZA 1L9SA 3EH5B 2GB8B 2BH5X 1MZYA 4FAAB 1V54B 1ZDSA 4JHUA 1AZBA 3WG7B 3NJGA 2CUAA 2I7OA 3UABA 5CICB 1WVEC 3CDZB 4E9WA 4JHVA 3L75D 4N8UA 3ZBMA 1OCCB 1XB8A 1XB3A 1CRGA 2P80D 2MHMA 3CXHD 1MZ4A 1OCOB 2PPDA 3HQ6A 2BPBB 2GC4D 3H1LD 2XXFA 1IZL0 1CTJA 2PP9A 4HCIA 1AOQA 1KV7A 1YLBB 4HZ1A 1X9UA 3S3DB 1HZUA 4UB8V 3WC8A 2FNWA 4PCYA 3U25A 3TA4D 1AYGA 1BXVA 3WU2V 2ORLA 1K3GA 3OD3A 3SBQA 1S6VB 1QKSA 2HX9A 1WAEA 2AZAA 3ABGA 5I6NA 1FJ0A 1PP9D 1A3ZA 4E9XA 3NJFA 3L70D 5CIFB 1CHIA 3ZX1A 1NICA 5D4IA 1KBWA 4YSQA 5CIHB 2XLLA 1CRYA 1C6SA 3JBTB 1E5ZA 5D4HA 1AAJA 1VYDA 4YSSA 1NIAA 1FI3A 5AURA 3FPXA 1A65A 1TEGA 5DFSA 3SLEA 2VW4A 3PXTA 2YAMA 1AZNA 1H32B 3ABMB 3GDCA 2PCYA 1KX7A 1KDJA 1WS7A 2XYBA 2OZ1B 1XMEB 2BW5A 2OJ1A 2RACA 4E9SA 3FYEB 1AKKA 1SFHA 3WFBC 1GYCA 3SWSA 4J20A 4NFGB 4L1QA 2YXVA 1KX2A 4GYDA 2XWZA 3H1KD 4G71B 2P80A 1HZVA 1DIIC 3H1HD 4L3GA 1SDDA 1TEFA 1GS8A 4A67A 3TASA 4DP8X 3NJHA 3FU9A 1YCCA 4XYDB 3VNWA 1L9RA 5TK2A 5CIDB 3A0HV 1CIFA 1WA2X 2HV4A 2BW4A 3CVCA 2PP7A 1GS7A 4U3FD 4YSAA 3H1JD 3JTBA 1ZDQA 3SJLA 1WA1X 3ABKB 3X2QB 3UGEA 1PZCA 2CALA 2H5UA 1CUOA 4W1TA 1KGYE 4P5RA 4WKXA 1JVOA 3PAZA 2BWDA 1QL4A 1E8EA 3VYMA 1WEJF 1RKRA 3VRDA 1N70A 3OA8B 3L4MA 4ENZA 5KLIB 1HAUA 1HJ5A 4WQDA 1ILUA 1RAQA 3X39A 1P84D 4WQ8A 1VLXA 2BP8B 3AG2B 3AY2A 1WA0X 5B7FA 4AAMA 1SNRA 5B7MA 1CRIA 1LMSA 1NMLA 2DVHA 3L45A 4UANA 5C0ZA 4BK5C 2YAHA 4L3HA 1NTKD 1BL9A 2VM4A 4RH4A 3ZDWA 3WNJA 3CDZA 1SHXA 2DYRB 1BQKA 1ET5A 2V07A 3ZOWA 1ID2A 4W9ZA 1A2SA 4FAVA 4FANA 1KIBA 1IQCA 1NPJA 2FQFA 3DTUB 7PCYA 1FI9A 1CYWA 5IY5B 4IL6V 1CIHA 1CIGA 2AANA 3ABLB 4P4QB 4BWTA 1JZEA 2EILB 1C2RA 1KDIA 2BGVX 3GXUB 1YTCA 1E30A 4EIFA 2CA3B 1KBVA 3AG3B 1TKWA 4PD4D 1URIA 4WQAA 1NWPA 9PCYA 1JXDA 2I85A 1NMIA 3WFDC 2XV3A 2TSAA 2YAEA 1QNIA 4K3IA 4G7QB 4A66A 4WQ9A 1SF5A 2YAOA 3PXLA 2CE1A 1J9TA 1PNDA 2DWSA 5B1JA 4N0KA 2ZOOA 3O1YA 1ZIAA 4F2EA 2FQGA 2Q5BA 1H32A 1IRWA 1AIZA 2PPAA 2Y1AA 4DP0X 2BCNB 3FYIB 1I6DA 1RCYA 1TU2A 2OZ1A 3MBWB 1W6WA 4H0JA 1NIBA 3L73D 2AZUA 2J55A 4BDVB 1E65A 1W6LA 3ASOB 1YIQA 3PH2B 4DP7X 2R7EA 1BCCD 1R0QA 4FA9A 1RZPA 3C75A 4DP5X 1AZCA 2H47C 1DT1A 1I5TA 1M60A 4G70B 3IN2A 3C2CA 5DF5A 3FU7B 1EHKB 1H1OA 5TK4A 2HX7A 1MG3C 3N55A 3CZUB 1PCSA 3OMNB 2FYNB 1L9QA 1AZRA 3SBPA 2FJSA 3NT0A 1EZLA 3WI9A 3L72D 1KYOW 4JKNA 4CSPA 2HRGA 3RLMA 4YSEA 1J9RA 1FA4A 3N2JA 2GB2A 1J9SA 1N90A 2GSMB 3AG4B 3NBTA 1AQ8A 3NWVA 2FWLB 3T71A 4HCFA 2CE0A 1QN2A 3OA8A 5D4JA 3ZIYA 1AZUA 1DW3A 2BP8A 3BQVA 3DKHA 1F1CA 2IDTA 1BEXA 2C1VA 3EH4B 2ZBOA 1F1FA 2CAKA 2AI5A 5GTHV 2QPEB 2QT6A 3FSAA 3D12B 2ZONG 1HJ3A 2VW7A 1CRCA 2EINB 2ZONA 2XU9A 3KZIV 1JZIA 1UATA 1MG2D 1CC3A 2C1UA 1CCHA 2D0WA 1V55B 2HX8A 1C6OA 1RZ6A 3NJKA 1MDAA 5I28A 2FQDA 4GYBA 3FSWA 2FQEA 3NSCA 3UAAA 3V9EA 5CYTR 1ILSA 1RZQA 3DIVA 2YAFA 1CEDA 3FPYA 1BE3D 3S8FB 1CSXA 4O1QA 1BYPA 3TBCA 1DW1A 2VMJA 2B12B 3QJVB 2N18C 1ZRTD 3DMIA 3FQYA 4DPAX 1M57B 2LIRA 3CX5W 2JXMA 1GDVA 1KB9D 1KB0A 1PPJD 1JOIA 5KAFV 2JTIB 2J57A 4WTQA 1AG6A 4PJ0V 4AX3A 4KNSA 1NIRA 1CYJA 1BXUA 1FOCA 2AXTV 2BH4X 1GS6X 2GC7C 4Q8BA 3T6ZA 1ADWA 1OE1A 1CTYA
chains in the Genus database with same CATH superfamily
3BAEL 2EO1A 4P2RE 3BDXA 3FFCD 4LU5L 1AGBA 2OTUB 2ZG1A 3KJ4B 3T5WA 2AIUA 2O1AA 4K4KA 5T1DH 2Z91A 5DI8A 1FI8C 3WUZA 5CGMA 3X14B 4Y4FC 4HFUH 5FDWB 2DLEA 5I6LA 4KO5A 3O3DB 4FLOA 4JY4B 3UTPE 3AQXA 3A0BV 2X4QB 3B9KA 1EFXB 4IKJA 5L4MA 1G6RB 3NIDB 1XL4A 4Y2DB 4KITB 5GS2D 3GHBH 1IGMH 4QLRA 2MPAL 3AACA 5D9SB 4JPVH 3K81A 2X5PA 4LLVA 4N3TA 4YVNA 1YNRA 4D8PB 2A4CA 1SXNA 4X4ZA 4BQ9A 2D2CC 3LKOA 1UGNA 3JWNH 3U1PA 4UUJA 1C8PA 5CZVL 4M93B 4IRSD 4BFNA 4CVWA 1YY8B 5LO7A 1AMYA 5T5FH 3T0EC 2B2XL 1QZNA 4LSTH 4CC0A 1VEPA 1T83A 5F1NA 2P45B 3NPSC 3ZVVA 1DJIA 3DO3A 2QJPB 3QXAA 2F5BL 2GSGA 1ZPUA 2R69H 4IU2B 2WXLA 4GT7A 3REWA 1NBVL 3IWVA 1AD0A 5TFSL 3V6OA 3KNBA 3QORA 4W70A 3SBRA 2VM3A 2CKBA 5ADPL 2FNBA 2R0LH 4F7TB 1UH3A 5HHPA 5JDJA 2LITA 5GGTA 3LN4A 5CF3A 4WFEE 1IE4A 4KI5E 4Q9RH 1OIOA 1KGCE 1W16A 4N5UA 1A9BB 3RZCA 3PXHA 5JLZB 3VXQA 4L2LA 2ZYRA 5E8EB 5D7JC 2BP0B 3WJJA 2FX9L 2YPVA 3JV5A 4KC3B 1N12A 1A1MB 2OTPA 4U7KA 4XPHL 5EU4B 4FQHA 4PJBB 4JDVA 4RRPM 3B5HA 3TEZA 2PR4H 4M5TA 4GG6E 1O6SA 3AM8C 1RJZA 4PYHA 3DJSA 4PV8A 4UBDC 3WHE1 4FQ2L 1EMTH 1EERB 2VUYA 4UT7H 2CLZB 3DI2B 5T1JA 1DJXA 2JI2A 1NGXB 1D9KC 1YEIH 4OZHE 4H0IA 1CFVL 4JQIH 3E1F1 4G43A 1GGYA 2UWEA 1I1AC 2CIIA 3ERXA 4KRPD 4NQSA 1N4XH 3JTTA 1J87A 3QIUB 5IG7A 2ZJSL 8FABB 5ITBH 4BZ1A 5T3ZD 5ECGA 2J2ZA 1CTNA 3GJFA 4QRSB 2K4WA 3A67L 3ORVA 4Z7AA 1EO8L 5KYUB 2AJXH 3B83A 4A2DA 2X4RB 2VDQB 3BPCA 3T2QA 1HIML 2EIDA 1NL0L 4OM0L 5TE6L 1MUJB 5B39B 3JWDC 4P4KD 3CXHJ 4PAZA 4LFHD 1CFNA 3BQUA 3J2PA 4QRQA 2KZWA 4Y4KB 1PZ2A 2Z92A 2J1WA 2JTYA 5DMIH 3ROLB 5A3ID 4LF3A 4FULA 1D3CA 1UXWA 2AJVH 2YUWA 3NYKA 4QGTA 1BM3H 4PJFF 2Q6WA 2JKXA 4G6AC 4P2CG 5I75B 2N0MA 3ULUE 4KK8C 3VQ1C 5HGBA 2WBJB 4FFZH 4JRYD 2WN2A 4KMLB 5A2LH 1Q90A 1RIUH 2VDRH 1RH8A 5EOCJ 4MMXB 2UX7A 1A7OL 1JDAA 1H6EA 1L4IA 2WGXA 3GFUA 1CURA 4PB9H 5FWQA 4CJ1A 3P2TA 1YEHL 1S9XA 4Q6IA 4UM9B 2JIXD 4OLZH 1RZIA 1IFGA 2XWCA 2VABB 2Z31D 2AI0H 1FIGH 1G7HB 2NLJA 4GAJH 4JM2F 5DJ6B 1U8LB 1XSKA 2VXSL 2OZ4L 1CIEA 1MY5A 3VWJA 5TPWH 2GI0A 5CGBA 3CFCL 2DLFL 4PCTA 3SDDC 1RQ5A 3EYUH 5C0AD 2D03L 3UAJD 2AHIA 3V52L 3LSOA 4UZGA 5GRWA 3ULVD 2EE2A 3GSXA 2NZ9C 5L2KD 1XGRA 2QLVB 3ARBD 3LEYH 2EDDA 4NZTL 3GBEA 4HD5A 4L4JA 5GGVY 5E08L 2RHEA 3QI9B 2DYPA 4KY1H 5G4NA 1BWMA 2Y6SD 3MJ7B 4LHJB 3PQYD 1H31B 2IMNA 3T2NH 1DLHB 3HE6D 3KPRE 3O4LA 4YE4H 4ODSH 3TZVB 3VXMB 3VXOA 4OD3H 4DH2A 4CVZA 3KH3A 4JKMA 3L3IA 1CZ8H 1LJMA 1GKSA 1Z9LA 4OTXL 1SVBA 5EUOA 1MJ8H 5F9WC 4RGOL 1JERA 1NCDH 5MEPB 2EZ0D 2FGWL 5KVGE 5T1MA 1AHWA 1AGFB 43CAA 5I2IA 3MGOA 5I24A 5CEZE 2GK0A 3W9EB 2E7CA 5IB5A 4OI7A 3CPUA 4XP1H 4EI5B 1OHQA 4NHUB 3DGGA 1I53A 2WLNA 1HJ4A 5ACZA 4GXUN 2BJML 5KSAB 2JELL 5C2BL 2FJHB 5ANHA 4YFLF 3IYLW 4ADGA 2YPLA 1M71B 4Y2DD 4NN6B 2DQCL 3QGVA 2K3HA 3GMOA 2BLFB 1MF2L 3H9SB 3JYBA 3Q44A 4JS7A 1LK3H 1OALA 1K6QH 5MP6H 4GP8B 4HUVA 5FCUH 5I1LA 3GBML 1KT2A 3MJ9H 5E2VL 3W0WE 4LSVH 5AOMA 3CUPA 1GA2A 1KWGA 1QHOA 3ULVF 5SWZB 1GSMA 4Z7UB 1FYHB 1LMKA 5FYKU 1NM9A 1W8EA 3V4PL 1CK0L 1XTLA 2W38A 3WFEH 1SY6H 2IANE 4NSKB 2DDQL 2BSED 4E2OA 1A5FL 1YPZF 1CE6B 2PETA 4QRRB 5E9NA 2DMBA 2YMXH 5HHVH 4KI1A 1HNFA 1MW0A 5I8OL 2VDKH 1AZVA 2EXWD 1KBKA 3C09C 2HT4D 3F2LA 3OKLA 4TF4A 3S2AA 3D05A 4JUTA 5FHAH 3MRLA 4RX4D 5BUPA 5FM8A 4KTDL 2DY2A 1R5IA 5AOJA 3M8OL 3P11L 2O5ZL 1IEAA 5EU5B 1RZJH 4GAGL 4XNQB 4YSTA 3M86A 1G9NC 2CO7B 4J12A 4R8WH 5DXWA 1XIWA 1Q0YL 4CMHC 1L9TA 3KPMB 4NXKA 1G9NL 2HSIA 5HHNA 5TQ2L 5KYNA 1DQIA 3IVKB 3NSFA 1I7TA 4N90D 1NCBL 2YCCA 2FBJH 4F7PB 1PGRB 4LVHC 3VFMA 4AYFA 1RP8A 1TVDA 5IP4A 1KXHA 4JHUA 2VLKD 1V3MA 1UB6A 1GGIL 5F7WC 1RUKH 1ZTXE 2YKLH 2Z8RA 3DJRA 4PGJA 2WXQA 5JOFB 1X5HA 4FQCH 4OZFH 4XXCA 3TBWA 1AOQA 1DSFH 1YLBB 3DDFA 5C3IA 4PEEA 4IRSC 5KG9B 3MLPA 4ZXBA 2MCPH 3BAKA 4ZOAA 4BYHA 4YDJB 2DLTA 4LOUD 5DEGA 1LEIA 1O7DC 3SBQA 2N1KA 4PJHF 4M7JL 1UACH 5E2UH 1Q9OA 3ESVF 3GMQA 4U1IB 5G5DA 4A63A 5IB2A 5MI0B 2O93L 1RULL 4LHUG 3LZQA 4S1QL 3CIAA 4U1GC 3WJMB 4Y4KD 1DSYA 1T6VN 5A2BA 5SWSB 4IRZA 4RBPH 4JW3A 4PG2A 3B2PA 1C6SA 5J89A 4ZPVB 2JB6A 1RURH 3EKCA 4P4RA 3U0TA 5AB1A 5GRVL 1M7IA 5EO9B 3GDCA 5AWNL 1S7RA 3MLYL 2DQFA 2EIEA 2J8UE 5F9OH 5BVPL 1KN2H 1XCTA 5DT1H 2OJ1A 1ZLUK 4EZMA 3FUMA 2BOBB 2N56A 2X6AA 2WCPA 3UBXG 4BFRA 1RPUA 1KX2A 4JKWA 5KVEE 1Q9LB 3QS3A 1XCQB 4KFZC 1PG7X 4PU2A 3VDCA 1X5XA 5KUKA 1JUFB 4PJIF 4QPEA 3O3EA 4DT2A 4BQCA 4EDWH 3HW7A 3I9GL 4FNLH 3D18A 4KRPC 4KHTH 4N22A 2CALA 3WIHL 4PJ7A 5I17A 4ZAKA 2PYFB 3CN4A 1I8MB 1NCJA 3WMSA 5T3ZL 4XX1G 3OA8B 2J1KA 3CJJA 3KYMB 3L4CA 5GIRA 1P84D 3SYOA 2BXYA 4UI2A 3QI9D 3LZFH 1U8CA 3CFNA 1A22B 2Q0ZX 3LKPB 2FRGP 5E9DB 1NTKD 1R5VB 3HR5A 2AJ3B 1KJVA 3GEFA 3I6GB 3TZVD 3VXMD 3UPRB 4OQTA 4FAVA 4LLWA 1HZHL 3MNWB 5FHBL 1N19A 1THAA 3S5LB 5JMRA 2A6JB 2AANA 3UDWC 3WXVH 2IV9A 4GW5B 4XC1H 5C0EB 1KIQA 4FYQA 4P46C 4JZJA 3KEDA 3D2UD 4JKKA 4PQXA 3FB8B 1HYSD 1R3HA 1JI1A 1N26A 4ZMQA 3UBXI 1OT1A 3B9EA 4JFEA 2DPKA 4MX7B 4MA3B 3LV3A 2APTA 1S4IA 1UFUA 5LQBL 3SOTA 4Z0XB 4NO2A 2IDCA 2YAEA 3NA9L 1KOAA 1XSJA 5E6YA 4R4BA 5DJAA 1PNDA 5SWQB 1G7QA 4LCIH 3H9SD 2UYLB 3DGCR 2W07A 4WVRA 2PCPB 4PJCA 3MMEB 4GKZB 3IKKA 5DHVH 1HL4A 4K0OA 4B96A 4XVTL 1DLFH 2FSDA 1A3LL 4ZYKB 3M17A 1AQKL 1KTKE 1QSEE 3MLZH 1BZEA 2PCFB 2D7TL 5JNYB 3UAJC 1MFAL 2LR4A 4MS6A 5SWZD 3ULVC 4JR9H 1A7RL 4M48H 2D7QA 3ARBC 3IN2A 3NIGB 4WI0B 3ULVL 2CH8A 4QO1B 2OCJA 2P8MA 4ZFGL 1E8ZA 1BMWA 3N0PB 2DD8H 2P5WA 1K4DB 2VH5L 5EZIH 4ZTOH 3O9WC 4HPHA 2FZ3B 1FA4A 4QRRD 4PP2A 2GSMB 4PMEA 5IR1B 3EOTH 5BNXD 3F7QA 1NFKA 1YAZA 4K3JL 4CNIA 4JB9L 4MD0B 4QHNA 1AZUA 1MCSA 3EDJA 3KYOA 2N7BA 4XGZA 4GQ9L 4HOMA 2VDPL 3N04A 1BQHB 5AL0A 2GIXA 1UM6H 3KJ4C 4G7VL 2J71A 4UOW1 4X6BB 1CS6A 3BZEA 3TS8A 5KYYB 4UTAA 3Q9PA 3W2DH 2DQEL 1OARH 3QEQB 3RIFK 5JYMA 5ILTH 1T3FB 3QA3B 2LAAA 2YQ3A 1IM9A 3RBGA 4Y2DC 1E27A 4K94C 5KYXA 3DIVA 5HHMB 1BE3D 1F1GA 4K94L 2A4ZA 3TBCA 4XHQA 5IUSA 3C60A 1QPKA 5JPNA 3VB8A 2DW5A 2WW8A 1HXKA 5FLUA 4M93C 4E0RA 4NO3B 4TRPL 3LQAC 3HBZA 2WINA 3DTXA 3V4UL 3LQAL 1MNNA 1F4WH 1FOCA 1SUHA 3SSGA 3UBFA 3FONB 4BKSC 1XR9A 5BVJA 1MQKH 3KZ8A 4KMTH 1UGKA 2G30A 2NQCA 2WVVA 4MNHA 2IBZY 3GZKA 4S2SB 3X12B 1NWOA 3A4AA 3RILA 1HSBB 3KVDD 2UY7A 4O58H 4MCMA 2PABA 4O2EB 3LMJH 2EXWC 2QPDB 1I8KA 3FUFA 3MX0B 1UUSA 3S3BB 3IGLA 4K2UH 3RUGA 1ZSDB 2AF2A 1HHJA 1TJGH 3QFJB 3MLXL 2OYKA 3WSQL 4EJ1C 2PTTB 2D31B 3EFDL 3VNZA 3IMUA 1U58A 3MV9B 1JD9A 4PJXB 3RPIB 1IBGH 1L6ZA 4YSOA 2BPBA 4XCEA 4ZQKB 1H3PH 1NAML 5GSRA 3HS8A 3TPUB 2J88H 2APBA 1T0MB 1T2JA 2PTUA 5EC2B 3QUKA 1TFPA 1NQBA 2GQHA 4EN3D 4IBSA 5KVFH 4Y19D 2CJUH 3VD5A 1PKQA 4NN7B 3PWPB 3QDJA 3CH1B 4QCIA 4LOUC 2VDQL 4RMWA 3K1DA 5GZNA 3UTSA 4EIUA 5I8CA 3U7YH 1RJLB 1UXMA 2WLIB 4IRJA 1M6OA 1PEZA 3GGWA 4L29A 2VQUA 4RA3A 4QXGL 4WW2A 5EBGA 4XB3A 4RZCA 4XMTA 3SPJA 3Q8AA 3GPEA 3OHXA 1QW8A 4OQ1A 4Y4KC 4XZUB 3IXAA 3KE0A 3O8XD 2PO6B 2I25N 3FTSA 3B2VH 5F96L 1MWAH 1MCWM 1AG0A 2A9AA 1YO4A 1RERA 3DMMD 1L0YA 4KGLA 3Q0HA 4LBAA 4U1HA 4H7VA 5I75C 3SCMB 4FC3E 2NY1D 1CI5A 5CJ8A 1SXSA 4Z95H 1CDUA 3GSNH 1BQ5A 3ARTA 2WBJC 1T1ZA 2F53E 2J73A 5FOBA 3ZDYB 2HRHA 3T3MB 1T04B 4P5KB 3L9EA 3SGDI 1AFVH 4MMXC 3PHQB 3DSFH 4NJ9H 2OP4H 5ABAA 1UTDA 4A7UA 3G5ZB 2XIBA 1M05B 4Q14A 1U95B 1CTZA 2CCVA 2QJYB 1IEBA 3JT2A 1LXMA 3WD5L 2CHDA 2NY7L 5KVMC 3TL5A 4HPOL 2LABA 1DW0A 3L4UA 4PJGE 1YEDB 1DFXA 3F7LA 4KDWA 3DPBA 3DUUA 4UILH 5I1KL 3QI9C 2EKSA 2V5TA 4N8CH 4FYTA 1N3NA 2YOAA 3S34H 5EG6C 5CNHA 3NQIA 4F58L 3K4DA 4X5RA 2WWOA 4N2LA 5I76B 3VNYA 4XC3H 3TZVC 2WIMA 5JQHC 3DV6B 1CCZA 1GZQB 1NCGA 2FT7A 4PFEA 1DUYB 3VDBA 5HYJB 3ZOYA 3BP4A 3HTLX 5I1IH 4N9GB 2ITDB 1I7UA 3F64A 4OD1H 5LNGA 3EHBB 4EI5C 5D1XA 1SEBA 5ACMA 3SJVB 1KCLA 3BOVA 5DHDA 3OR7A 5B7EA 3QEQD 3IFLH 4NWUH 5KSAC 3TBBA 2BS9A 3INUL 4HUKB 3SGKC 3L7EB 4L5FE 4AANA 2O5YH 3FRPB 5E4IA 4FCAA 4NN6C 4DGYH 2FEJA 4M1GL 3Q6GL 4RMQA 1E5YA 4TVUA 3FT2A 5F1SA 4AC2A 1A6TB 3QJRB 5AVRB 1JYXA 3QARA 1WHOA 3TO2A 1R3JA 2BVPA 4MCNA 3Q1EA 4PREA 1TU2B 2HMID 4NPKA 2GUOB 2GITA 5DQJA 5LGHH 4YBLC 2XN9E 3PNWA 5I6KA 1F4AA 3DUSA 5PCYA 2Y06H 4HS6B 1YMHA 3O45A 2R2CA 4P3CH 4LBEA 2XBDA 3FB7B 1I9RL 1OGAB 3AT8A 2WSKA 3II1A 4HUUA 4IOIA 4LP5A 2Y7OA 3NIGF 1U74B 3C8HA 4K3EH 4M7LL 3TGXA 4DEWA 4L8CB 4Y8DC 1MI5D 1KCUL 4KQ4L 4Y7MA 3KJ6H 1HOCB 5D2NE 2WP3T 4DK3A 2R4SL 2JCCA 5F8RC 4AQOA 1IGFH 3WFBH 1X5YA 2BFVL 4MRBA 3IS0X 2HZHA 5GS0C 4C4UA 2AQ1A 2BX5A 3SGEI 1FFPA 3CFTA 4YL9A 1T20B 4RAVA 5DZVA 3EYVB 1F56A 4YSCA 1N8ZB 5IOPB 3S8WA 2J6WA 2IALB 1JGVH 1RUPL 3QFJD 1LWJA 4FB1A 2Y2WA 2DN7A 1Z5LA 1KXVC 2WIIA 4G1MB 4PJ9B 3TNNB 4ATWA 2AJYL 3KVPA 1AR1B 3MV9D 4P9HH 4PJ8A 3FQTB 3L13A 2R9HD 3QWOA 2VB5A 1JL8A 3HR6A 5IFJA 4HIPA 2Q76A 3QDGB 3PPSA 5C07D 4EVNA 3KGUA 2ZSVA 4QRFA 4NRXB 4H5SB 5C0ND 1G4RA 4ZMZA 2L0DA 4C58B 4KH9A 2WWKT 4LRNH 2QADD 5C09A 2OR9H 1A8JH 3CLEL 2GFBB 2C1PA 3DVNA 3FT4B 5LUMA 1RZKH 3TYFB 4DEUA 4IU3A 3DOSA 3ZTEA 3PWPD 2VXUH 4P5SA 3IJHB 4ZNEE 1XH3B 1YEEL 1I9IH 3FN0L 3OXSB 5MI0C 1JVLA 4WNSA 4JFXB 4U2YA 4ZO8A 5FYKE 1QA9B 1RPQA 2DMHA 2VN6A 3SPVB 1JXKA 1NINA 3LKRB 5AVSB 4EPSA 4BFBD 1ETZA 2X28A 2DRUA 2NW2A 2F15A 5HJBA 3SCMD 1AKJB 2IG2H 1AO7A 2WNXA 3ARYA 4RAUB 4POUB 4DNLA 1DP0A 1UEYA 2PYED 4YWGH 2CKBH 1H15A 3E3QC 4FG4A 3CDZB 3VXRE 4Z5RA 5L4FA 3CX2A 5GGTH 1G1KA 1SLWA 4HISA 2YD7A 5TDNB 1DANT 2QSQA 3AREA 3H1LD 3BPOB 4HIXH 4OF5A 1IZL0 1NFAA 1NGZB 3GBDA 4PBXA 5D2LF 3U25A 5ITFA 3RVTC 3NABL 3TA4D 1YSOA 5ABZA 4ODTH 3VXSE 1MIMH 1BXVA 1ACYH 1GGBH 2VXVL 5DVPA 3T77B 2YPVH 6FABH 1CG9B 1N0XH 2IADB 2W5PA 2HX9A 5IVZA 5I6NA 4J28A 1BD2A 3MRMA 4RQQB 4AL8L 1TYEB 4EN3C 2FBRA 1KBWA 3FT3A 4TQEL 2XTSA 3UXFA 4U7SA 2NNAB 3GSOA 3O41B 4A7GF 2H2PD 1E4KC 1NIAA 3N85L 4N8VB 2DIJA 5INCA 1DEEA 3GM8A 1JMZA 1U8IA 3H3BC 3MNZB 4K5OA 1KX7A 3O2DA 3RX9A 1H3VA 3GJFH 1UOKA 2OZ1B 4E9SA 5FUOH 2AXGA 5C1MB 2H3KA 3L48A 1NKGA 3BJLA 3QQ3A 5I1GL 3VXTA 1CICB 3BKCH 2P80A 3N1QC 1U3HA 3WTUA 4P2RA 1TENA 1D5IH 2C9AA 2NQDA 4R0LA 3CC5B 3EHBD 1QHPA 2ADJB 3ARGA 2BW4A 2E7BA 1WA2X 3EG9A 3MRIA 4PD4K 4XBPA 3BZFB 1IB5A 5AVXB 3ZKMD 1KXTA 2ZP8A 2G75A 4UDUA 3PDOA 1RK1B 3L17A 4JFDD 4N87A 5IEKA 3APDA 2ZSWB 5DRZA 4YHOL 1L5GB 1JVOA 3VSQA 1E8EA 3L4MA 4PM1A 4ENZA 3L2MA 1B3JA 1HJ5A 3ET9F 4O00A 3AY2A 1WA0X 4AAMA 5B7MA 5CLTA 1N7ML 3FU3A 3JWOH 1ZA6A 1P6AB 2YAHA 5DUML 5I30H 1MFUA 3GO1H 3PIQA 2DYRB 3NZHH 4JFZH 5FO9A 2EDJA 3CFJA 3HZ3A 3ATEA 4XXDA 2RFXB 4QOKE 2DQGH 4NC1E 1CL7H 3CCHA 3KPSE 3U1QA 3N42B 3IMVA 4NQXB 4B3EA 1VFUA 3VI3B 3CPLA 1YYLL 3GF8A 4AQ8A 4NM8H 3AG3B 1U8MA 4ZMYA 5CS7A 3CFBB 2F9BT 5HDBE 4L4TD 4Y9GA 5AAMA 3HI1B 1JWMA 5CIPA 3DO7A 3D6GA 4NP4H 3BZDA 3PXLA 5F21B 3K74B 3MLUL 15C8L 2DWSA 4L1TA 4OF8A 3THML 2E46A 3K71B 2WANA 3MN8A 5ECJE 5IVXE 5IMLA 4JG0H 4TSAL 3BKML 4V1DB 4PJ9D 1AIZA 4HJEA 4ONOA 4QTHB 1AR1D 2ALWA 3MO1A 1KEGL 3CFEB 4TLTA 2CDGB 2HJKA 4AJ0A 2ODIA 3ASOB 5BS0B 4GG6A 1IGYA 5BV7B 2A0LD 2H4EA 2Y6TE 2B59A 3H9HA 4U1NB 4LASH 3GLZA 5EN2A 4JFHE 1FQ9C 1HI6A 5AKVA 1SN0A 2HMIC 3MHZA 12E8L 1IKFL 3BUBA 4OZHA 3WTVA 1M1SA 3OKMA 1CYGA 4Q6KA 1RVFH 3RJOA 3SBPA 5KSBE 1TQVA 3L9YA 4B95C 3EYFB 4LNRB 4BHUI 3FB6B 1AKPA 4EOWH 4YGVA 1E9PB 5JUEH 4NQVA 2ESVB 1R24B 1HCYA 4EUPG 3F12A 3EJPA 2UWEF 5BMFL 2V2XA 2C9UA 1EUTA 5LCVL 5I1JH 3BRFA 5EEUA 1TMCB 3MLRH 4ZUTA 3L3KB 1F3RB 4NO5B 3RX7A 4HFWB 4HUXA 2A1WH 5K1VA 5F0PB 5LG1A 2BINA 3KZIV 4BH8A 1HHHB 1MG2D 4WEBH 1IL1B 3GMMB 2QKIB 3ZRSA 4KXDA 2CMRL 3WGVB 1RV6X 3MRQA 2FQDA 4HUCA 4QRBA 1AKJD 1MAMH 4GSXA 2OL3L 4AV5A 5DJZA 1QLRB 1H5BB 3FPYA 3N1MC 3EO1A 3IU3A 5CJOH 5FECA 4MASA 4FRWA 3BW9A 1HXMB 4P5MB 4M62H 4X4XB 4QEGA 2FLBT 1M57B 3UIYA 5GPRA 3UTZA 4H0LC 1M2VA 2AABL 3BWAA 3CZFB 4OZGB 4XXWC 5C0NC 4F24A 1BVLA 5IF0B 1OVZA 2JKIS 5J7CC 2VR9A 1CTYA 3GS7A 3G6DH 2C9QA 5FO2A 4F37K 3D0VB 1CGSL 4YHIB 4QWWD 4HDIB 2W80C 4YDVA 2VE6B 4NN7C 4D0DB 2V9RA 4HIJB 4LSUH 5FYLD 3SKOB 1JYVA 2X70A 2AITA 2V8LA 1A8ZA 2MTAC 5E6RB 3P0VL 1I1FA 2YA1A 3IU4H 4R26H 3TBYB 3WUIA 3KPRA 4LPVA 1VEMA 4NKIL 2PO6C 4MSWB 4P48A 4WK4B 1CICD 1KPUA 3CWGA 4FKKA 3SKMB 3WDIA 2NRDA 5KBNC 3WKNA 4UYPA 4MZ2A 3SCMC 1NZRA 2HKHL 3ZXAC 1KV3A 4I5BB 1M1XA 2O5XH 4PV9B 2NMSA 5KS9E 3BD4A 1UCBH 4ZUVA 3L2NA 4IEFA 3BRGC 2AP2A 3HC0B 1J1XH 1U3ZA 5ERWB 1PVHA 43C9A 1NC4B 4N2HA 1JRHL 4G6MH 1MXGA 4N0UA 3Q2WA 2DBLL 3GXFA 1RK7A 5ESAA 3PABB 3V5HB 2QSTA 4MA1C 3HCVB 3E6FB 2XZQH 1AHKA 4FMVA 3CU1A 1QI5A 2B5IB 2A2QT 2CO6B 2YUXA 4Y5YB 1JNLH 4L23A 3V52H 4B9IA 1PDKA 4WKZB 3GI8H 3L3JB 3FOLA 2I24N 2IGLA 4OT1L 1G84A 5DJXB 4XNAA 1MW2A 3GSVB 3W0WA 2R59A 5CILL 1JZHA 4JDZB 4RISH 3HI6L 4JHAH 3K2MC 1LP9E 3QH3B 3WFZA 5IHLB 2IOIA 2EUZA 3RU8H 2EYSA 2UVFA 3NDYE 2H2PC 4G8FB 3WEAA 2MQGA 1EWHA 4RGNE 1IAKA 3MGAA 3MNVA 2IANA 1C5DB 1CHHA 1EZVD 3S4SG 4CN1A 3EBIA 1HH7A 3R18A 4EICA 2XUWA 2ZT9C 4XAWL 4WUKL 1Z5YD 4ODVH 4XP5H 5AW9B 2XN0A 3LEXB 3KDMB 1G43A 1JGUL 5LWYH 5DZLA 5F97E 3E8UL 1BVNP 1JV2A 3EHBC 5EH1A 4AM0A 4PHXA 1MDTA 3HBPA 4OQTH 2B3RA 5J5EA 5FX3A 1IGIH 2J8HA 3MOAL 1VACB 2DKSA 4LEXL 4NNXB 2Q9OA 3SQBB 2WY3B 3RIAK 1DDHB 4YH6A 5BS0D 4KZEL 5JXAH 5HHXH 2XDHA 4NDMA 3BAXA 1A4KA 1KTDB 3L95A 3P0GB 4JDTH 4FP8L 1E9QA 2VLJB 4RIRB 1KIRA 3IGAB 1WS8A 3OKNA 3ESMA 3FUNA 3WEOA 5BJTA 1RIVL 1IV8A 2OI9B 3T4AA 2X12A 3PWJA 4D0BA 1T0NA 4X6FB 4WO4B 3IDXH 4TUOA 1RAPA 3ARSA 4M56A 4OJFL 1HAWA 4OKVA 1JZ8A 2ZXGA 4E42B 2CXGA 3MXVL 4HMDA 1ZT1A 3WE1A 3NFSL 3RY5A 3OX8A 1IC4H 4JJ5A 1MIEL 4KH2A 4UOZA 4ZFQA 4KNTA 5I0YA 4ZBJA 4Q58C 1YNKL 2RTTA 4GRWF 1MCEA 5E94A 2VJXA 1FF5A 4OR1A 3BIAX 4YL4A 2HH0H 3MYJB 4M3HA 3MODL 1FFOA 3F8UB 3L71D 3TO4B 1MRDH 1S5IL 3BFQG 4TLKA 3CXFA 1D5RA 1CLZL 3REVA 4I8DA 2Y5TB 2DTSA 5I1CH 3ZDZF 1LFMA 3AS1A 4OJEH 3TA3A 1J8HE 3OAYK 1BV8A 1NMBL 2J8UA 5KLVD 4PJ9C 5B3JF 3LY6A 5HDRA 5BQ7A 2APSA 1AR1C 4JKLA 3RX8A 5F7DB 4Y2OA 2N0KA 1H9VA 2Z35A 4QRPD 3HMXH 4FADA 1BGYD 5JHDB 1AOHA 3NZ8A 2GIMA 2HFFA 2A0LC 4I2XB 1KSRA 4ODUB 4KKQA 5F44A 2EO9A 3BZ4B 1K3IA 1E6OL 4JHZA 1CYIA 1CDJA 2X4OA 3WEBA 4UTAH 5IQMA 3ESPA 1J88A 3GUTA 2FJGB 4R7DA 4YXKH 1HHGB 2BNQD 3L3OB 1C5BH 2UZXB 4ESKA 2HFEA 4A2GA 1H3XA 3EH3B 3KVQA 2VDOH 2A74C 1AYRA 3CN1A 5B1BB 4ZMXA 2NY6B 3G6JB 1IBZA 4XMPH 1GY1A 1S7WA 3QEGL 2GC4C 2K6ZA 3V55A 3HE7D 4AYDC 2B4ZA 1A14H 1CTOA 4Z7VB 2EYTA 4AKPA 1NDMB 5C7ZA 2IH1B 2BWIA 4HAKA 2KQMA 2OLDA 1TR7A 1VFBB 4JLRB 5ALCL 1X9RA 4P2OD 3VCLA 4JPIA 3A5VA 1MG2C 2CCWA 1MJUL 4JO8A 5GZOD 1HRCA 3FULA 4NHCH 4A2FA 3MA9H 3FFOA 2WQAA 4FQ1H 4PJAE 1TZAA 3VTMA 5LGKA 1U91B 3EF7A 3QZNA 4LGRB 2AFNA 2FE0A 3LKQA 3ZZLA 1IBHA 5I8EA 5CCKH 3DSNA 5IQ7L 3S4SA 4OZGF 4TNWF 1H6TA 4BKLA 4R3SA 4OZ4A 3ZTDC 2QSCL 2YXWA 4B9KC 1CVRA 5H2BB 4H20L 2G2RB 4QWWC 4TVPE 3TVMA 3IAPA 1QSEA 3FW6A 2AK4E 3LD8B 1CLOH 2V2WB 1XR8A 3W82A 4HMEA 4AEFA 3MRGA 3UP6A 5DWUH 4PVNA 4NUQA 2NQ3A 4JPWL 1YEWA 1LD9A 4MB3A 1GU2A 5FYLL 5KOVC 5B66V 3ES6B 3U36A 4WHTA 2GB8B 4GUPA 1N18A 3HN3A 2ZCLL 1NM4A 1KF9B 3NCJH 3QC5X 4ODWA 2NNCA 4W4OA 4F3FA 2R2EA 3IJSA 3L75D 3TIEA 3CSBA 3QJOA 5AYTA 2CLRB 1CICC 1L0QA 4C8XA 4RMSA 3PP3H 2R1XA 4X0KB 5D6CA 4JCLA 5C6WH 4ZPTB 1EJOL 2QQKH 3JVGA 1TO5A 3OSVA 3KS0H 1S6VB 5HDQH 2AEPH 4AH2B 3E80A 2FX7H 2NY4B 4YHNA 1U6AL 1WAEA 4HJGB 2RBLA 2F54E 3I02A 4KAQL 2F74A 2UVEA 2NUTB 4R83A 1P53A 2C5DC 4B9ZA 1J0HA 1FCGA 3FO1B 5CIHB 2EDFA 4KK6D 3QO1A 1QLEH 3CHQA 1DUZA 3O3UN 5IMKA 1UB5A 2DJSA 4X9BA 1IO4C 4XOBA 4KDVA 5C9KA 1ZK5A 5CLWA 1FI3A 1LEGB 3TX4A 4QJ4B 5IESL 1JPTL 1TEGA 5AZEL 2DM2A 2VDRB 1J9CT 4FLQA 1ADQL 1WS7A 4WO4D 1WUNT 1ORQA 1SHSA 2BW5A 1B6UA 1DR9A 3GTVA 4HS8L 1JGLH 5I16A 5JIDA 4AT6B 1UJ3A 5SV4A 4HIEA 3DA0A 2APXA 5DYOB 4Z3GA 3EYOA 2J44A 4NGHH 2WQXA 4MYWB 5CP7B 2ZTBA 1BYNA 2J5LB 1PD0A 1TEFA 2BNRE 4L3GA 1SDDA 3DWTA 1J5OL 2AGJH 4OCSL 3DIFB 3ZDXB 1A6AB 2BMKB 3CVCA 4FQXA 3CN3A 4G6JH 3TO4D 1PZCA 2M1KA 2P26A 3GMPA 1A9VA 1MCOL 4CU6A 2YA2A 4X6CF 3Q8CA 1KENH 3GXTA 1EVUA 3VRDA 4ES8A 1XSOA 3TYGH 1F8TL 2WLMA 5DD0H 5DJCB 1RZGB 1YY9D 1VLXA 4KV5E 5DMGD 4APQD 1SNRA 4BUQA 1T4KB 1A7PL 4IKIA 5GGVH 4B0MB 4NNPL 1K8IB 1VGKA 4LSRL 5KVDE 5JHDD 1ID2A 1ZA3A 5BV7C 4W9ZA 1WBZB 5CUSH 7PCYA 3RKDD 3SDCA 3IM1A 2ZYIA 5BV7L 1SJHB 5F1IB 2WZ6A 1JZEA 2O6CA 2Y7SA 4W9JC 1U2HA 4N6RA 1P4IH 3N5AA 3VD0A 5EFIB 3VSVA 1IC1A 4OBSA 3FKUS 4KKLD 4FXGA 1NWPA 4J4PD 3GI9H 3AUVA 5GHWH 5I1EL 2NY6D 1JMXA 3LHPH 1ZT4B 3CU7A 4M6MH 3BKYL 3OC5A 1NFDF 1JHLL 1CXKA 1S7TB 5B1JA 2Z6FA 3Q06A 5J6HA 1EEZB 5IBLC 5IJVA 1TDQA 5CJXA 3UMTA 3RL2B 3B6SB 1CDHA 1TNNA 3DXAD 3UTTB 4HLJA 4PGCA 5JR1H 1MVUB 3QHFL 3KWTA 2HLAB 4AZ8A 4H0JA 4PLJC 4WFGE 1HH6B 4HK0A 4DERA 2QKIC 4LDCA 2NW3B 3P4MB 3AWEA 2IO5A 3KXFE 1FL5B 4N0FA 4JZOB 5IB1A 4YLCA 2Y3AA 3CH8A 5GGUB 2YZ1A 3WKML 1H5BC 3FU7B 3LH9A 1QSZA 1RUMH 3GRBA 4C57C 2HX7A 4R7VA 3K4AA 5HY9B 2F53A 3BVNA 4DTGL 4I77H 5DUPH 2VDKB 3PGFH 2BOLA 2VR7A 4OGYH 4X80L 1F18A 5JQIB 4PUBH 3BH8A 3BWUC 2ICWI 3DROA 1FE8L 3I75B 4YHPA 4YZWA 1FORL 1G9ML 4M29A 5DR5H 1EAQA 1FNGA 1G7MA 4PLOB 1IEHA 3SDYH 3VACA 1WZAA 3TBVB 2DI8A 3HC3L 1F58L 2F68X 2QPEB 1TTBA 2CUIA 1OHZA 3KHOA 2XNAB 5HYSB 1FZMA 4PJGA 2VW7A 2EINB 2N7SA 4WZ9A 2YXMA 1DO6A 3FTGA 4LCWB 1LYQA 2FL5A 1YN7A 4Z7VF 5EU6E 3UBGA 3ZUCA 3TWCL 3LNEA 4XBMA 5HHOE 1RZQA 4H26A 4HH8A 2VC2H 4HX1B 4OZFB 4YBHA 3S8FB 1FO0A 5KSUA 1E3FA 1FGNH 4X8JB 4LT7A 4FQLL 1AH1A 1BVNT 4J6RL 3CZEA 1GAFL 1W72A 2ARJB 1BAGA 1UD4A 5J1SC 3V6BR 2R2HA 4OCYL 3VXUB 1P7KB 3HAEG 1VFAB 5FXCH 4NQEE 1OF2A 4MXQD 5H8DA 1G1OA 2HJFA 1ET7A 2NY4D 4BSWB 4HOWA 1IBYA 2OMUA 2QHLA 3RWGA 2XKNB 2VXQA 2Z1KA 3WO4B 1EEYA 2OXGB 1OCDA 2YK1H 2B5IC 2XXGA 4ZMPA 4WV1B 1QFWM 2QV2A 3QIWB 1TSRA 2XJLA 3NZSA 5GRVK 3BSZL 5DJ0A 1MY7A 2XN9A 2Y23A 1CHJA 1FLRL 1KEMH 2SODB 5FV2A 4Q9CA 5BZDB 1RMFH 1FG2A 4KO6A 4XNUL 2JB5H 1T1XB 3T0VA 2B10B 4QHMA 1HKLL 4OLUH 4FFVC 4DP2X 4O2CB 1FL6A 1NGQH 3QQ4B 3VM7A 3T1WA 1FNLA 3L4ZA 3C5ZA 5D2NA 2HTLC 4KKBD 3GLDA 3QJHB 1ZRUA 1SOKA 1T22B 1F45A 2BRRH 3R0NA 4H13C 1VEOA 4RGMB 3SO5A 4R4ND 4R7LA 4FQJH 1JXGA 1S7XB 2B9BA 3WNOA 1RFDL 1SJVA 4H8WH 5HGGS 1TUPA 4TSCL 5KYWA 3PWLB 3A6OA 3VI4F 3T04D 4F7CB 4GW4B 2JKJA 4HV8B 5HVGB 5I6XB 1ONQA 4KKAD 5IMOA 3CE1A 3O2DH 5F7UA 3RNKA 4OW6A 1Q94B 4YR6A 3IFOB 1OCZB 4R6UA 4ICWA 4ZUUB 5TF0A 3ZE0E 2JF1A 4A7SA 1OO2A 3ZMRA 4L3CA 3X3GL 4DUWA 1G7JB 5DS1A 2DH3A 2P1YA 1H8SA 4TUUA 4A1RA 1X6LA 3NIFB 4FA4A 4G5ZH 5CLXA 3VFVB 4HULB 5FEBA 1KPRA 4L1BA 5T1KD 5J57B 1JFQL 2LQRA 2OM5A 2OI9C 1MREH 3FO2B 5BZWA 2NOYA 2ZCHL 2VDNB 4M00A 2C1OA 2H8PB 5EA0H 5BW7A 3ECVA 4EDXB 2M26A 5E1AA 2WUBH 4LPUA 4WO4C 4RMRA 1U3YA 3NRPA 1A9EB 3ARQA 5K39A 2HPOA 3RY6C 3WIFA 2IWGA 4K3DH 3UX9B 2QQNH 2JKLA 3CMOL 3HG2A 3MCLL 3QZLA 4UV7L 4TYUA 3ZL4H 4JDEB 3RGVB 4KFMA 4ZNEA 3BP6B 3U46B 4Z7NB 1WT5C 4MJ4A 1LVEA 5LGYA 3I9PA 3WLBB 5GTIV 3R1GH 3NFNA 1C7TA 3LPWA 3UTTD 2CXKA 2IQAB 4Z7WF 4A2LA 2AEQL 1IBBA 1WZLA 2FYYB 4U6YB 3H55A 2DKUA 2FB4H 3T1FB 1TFHA 3TO4C 1XF4A 3WDJA 5L9DL 4AK2A 3VFGL 4R9HA 5E6SB 3ZKND 4XN2A 1F4YL 2PCXA 3UACA 2RA1A 1T1WA 1YNTF 1ZS8B 1OP9A 2GSIB 4ZO7A 2R1YB 1OAEA 1YY9C 5DMGC 1R3IH 4YK4B 4KROD 2FO4B 3IBEA 4UZSA 5EIIA 3HPLA 4ZUWA 1MFVA 2P4AB 3PGDB 5CIPH 3VXRA 4JHWH 3U82B 3PP4L 5GISH 5ICUA 3BJ91 4PRPB 1JTOA 1S9WB 4KHXH 1K85A 1G7PB 4M5YH 5DD6B 3RKDC 1SM3H 1AQMA 1I7ZA 3VXSA 2BK8A 2XY1A 1ZIBA 4M4RB 4N2GA 3ISWA 3RYMA 2OQJB 4LKCB 4G8IA 2NSXA 2XA3A 3V79C 5HHQB 5IEHA 4KKLC 3X11A 3V0WL 1Y1DA 4J4PC 3KWWA 5K93A 4UQ2A 4GOSA 3VGBA 1IUZA 1MLBA 1OP5H 4IIQA 2N01B 2NY6C 3HZYB 5TGBB 2VL5B 3MBED 2BZ7A 4HUNB 2DGEA 4LCWD 4PS4H 2XG4B 1KJ3L 3JWNC 5FO8B 1G9HA 3EJZC 3FSZA 4U1SB 2H1LM 5SX4I 3WL9A 2XN1A 1P4LB 2B15A 4XCYB 5HSFA 1A02N 1FH5L 1U30A 3CDGB 1RD6A 1OAUL 1S7VA 1MNUH 1PLGH 3A23A 3ARDB 5EUKB 4Z7OF 3MRRB 1P1ZA 4OGQC 2HT3D 3V0DA 3WO3B 5EOTA 1T66C 5BOPA 2J1XA 3P0YH 4N0YH 5CU5A 4XNYH 3WHXA 3RN1A 3T8XA 2CK2A 3L7FB 4RMVA 1PYWB 4NKMB 3B37A 1KZQA 1NJ9A 5L2JB 2QHRH 4OIIL 1FI7A 1RL1A 1TQWA 2X88A 5LAXB 5FUZL 2AV1B 2PCBB 4PJ5E 4XWGL 4AJYV 3ULUH 2CK0H 3ETTA 3QIWD 1HHIA 3EGXA 4XRCB 5IK3A 4U6XA 1SXBA 2C2CA 3ECBA 3I6SA 4LSSL 4BSVB 3LD8C 4JFYB 4BFGA 4G7SB 1NEZB 1NOFA 5DTFB 1YICA 2Z7YA 4QOKA 2EDWA 5T33L 1BQLL 5DDHB 3AXLA 1WFMA 3BZ5A 3QO0A 3KPSA 3OB0H 2GTZA 4MJ6A 4MQ7A 2I07B 3D3VE 5FO7A 3TBTA 1HNYA 2X0UA 2A06D 1T0OA 5D1ZI 3V6ZA 1EDHA 4Q89A 2IDFA 5MEND 3TNMB 2WZPA 3IPEA 3ZMEA 1A66A 3EJQA 5EU3B 4Y16D 3LXBA 3SE3C 2Y2TA 1E2RA 3MLTB 2VKWA 2G3MA 1FPTL 3CLFL 4GFXA 3SN6N 3ALXA 1Y6NR 4KO9A 2K7PA 2AKRA 1O7DE 1H9XA 4XTRD 3UEQA 1AGCB 3W39A 1IC5L 4O02A 2CHZA 5IVXA 2YK3A 2XV2A 3QUMA 4MXQC 5FIEA 2NY4C 4HW6A 2P24B 4MNQB 4WDIA 1DCEA 3HKFA 3LNDA 4JFQA 4N9OB 2WKGA 1MWAB 4TUJA 2CRZA 1KTRL 4DN4H 4ZMTA 4WTZA 1CFBA 2CRIA 1HEJC 4M7KH 5B22A 5CEZH 2RCSL 4HK3J 2IXQA 3GSNB 2COQA 3NSYA 4PJFE 1IRVA 4WQOA 1BOGB 4I1PA 1F3JB 3IEAA 2D3JA 2C8SA 1J3SA 1SJEA 2BSRB 2VJ8A 3OLGA 4IS6A 4WHCA 5KSBA 3BH9A 4KUCD 1DQDH 4U6HA 4LQ1A 3NJGA 2I7OA 1EJ8A 3UABA 5CEYB 4JFFB 1GYUA 3S5ZA 1JPST 2QGEA 1WLHA 4N26A 5KZCB 4AMWA 2XWXA 4GIAA 2BWQA 3H7BA 5DC2A 2DQHL 2J5LC 2PP9A 2J4WH 2NXYB 4HZ1A 1HZUA 4KKBC 4BA8A 1L6XA 4F92B 2OSLB 3O3AB 3WU2V 4G8AC 4R4NC 1IT9L 5E99H 5TE7L 2Z7WA 5T3ZE 3C5XA 3H3PL 1JNNL 4FTDA 1RZFL 1ODUA 1KB9J 3TN0D 4E9XA 5HGHA 4EIZC 2ADFL 3DHJA 3HUJB 2C3HA 1RUQH 4KVNH 4KKAC 5HJ3B 3BP5B 3IFPB 5F2FA 1DQQB 3UYPB 3F01A 3JBTB 1E5ZA 3AMKA 4NCC1 1WC7A 2X4TA 4HU2A 3ARFA 1P84K 2B1HL 4WEEA 2YD8A 3P30H 4IMLA 2DS4A 3AU1A 3PWNA 4AYGA 32C2B 1CGTA 2EO7A 4HJIA 3EADA 1FCCA 1Z9NA 2KLSA 4OJDH 4AITA 1F11B 1XMEB 5AD0A 2FWOA 4QYOB 1VB9A 2YHGA 2XBZA 1R4XA 2Q8AL 3MUY1 1GYCA 3LS4L 4XCCL 4NFGB 5EEZA 3IT8D 4JRXD 2AQRA 2X4UA 1TYJA 4S1SL 4ZFZA 1OY3B 1EQWA 2AXFA 3F62A 3GZOA 4V2BA 4JRYE 4LCYA 5E6IB 4KZDH 4TV3A 3SKNB 5EBMB 5AVWB 5EB9A 3DNKA 3HZVB 2ZE0A 2NTSP 1HSAB 4D2NA 3G9AB 4CSSA 3PGCA 2H5UA 4FLRA 3IJ9A 3ISYA 4AQZA 1E28B 2ZX6A 2ZUXA 1EZVX 1PBYA 3IDMB 5E2WH 2RB8A 2NYYD 3AG2B 3C6LD 1CRIA 1NMLA 2WOBA 1JTPA 4HG4K 1WGVA 3GDBA 4X5XB 1CGWA 3ULVE 3ZKNC 5F7EH 3VD3A 5C7XL 2CU9A 1NPJA 2KHAA 2VRQA 1FI9A 1Z9MA 1JP5A 5KS9A 1TZIB 1FRGH 3U4BH 2IEPA 1N64H 5TE4H 4U05A 1YTCA 4EIFA 1YPZE 4NQCE 3QZWA 1E8WA 2MEJB 2NX5B 1LO5B 2QMKA 4L4VD 4UOW0 2SEBB 5I19H 4MD5B 3MFFB 1PSKL 1YAIA 4WWOA 3SDAD 4OJCA 3GXNA 3HHMA 1HXYA 3Q6FB 4NT6A 4XE5B 4ACPA 4E41B 2OS7A 2Y4SA 1J9TA 2WM0A 1S9YA 4DKEL 3H0TA 1XT5A 5KVEH 1KYDA 3L1GA 2BCKA 5HYIA 3D9AL 3DARA 4JM0A 1AGBB 2EIBA 4K5PA 4PJDA 1LP9A 3EO0A 3WFDH 4YZFF 2Z91B 5DI8B 5A2KH 2W60A 4UTBA 5AG9A 5LB1A 1K72A 2ADIA 2E9GA 5D7SL 1HWHB 1FZOA 3NCBB 4Q9BA 4G6FB 3H2QA 2V9TA 1BCCD 1UM5L 2NY0B 3LEVH 5L8LB 3KLQA 3B9KB 5HJDA 5LG6A 4I48A 1J0IA 2V17H 1S3KH 5C0DA 3V4VA 5K9KA 4AYSA 3QNYB 4LLVB 1AZRA 1TF4A 3BEWA 3MOBL 4K71B 4XB8A 3WI9A 2HT3C 3RLMA 1DO5A 3ZE2B 3SD5A 5C71A 2GTWA 3LKOB 4DGIH 1KFAH 1VPOH 3QIBA 3FUIA 4UUJB 3RGBA 4ONFH 4PJHE 5E0FA 3HZMA 2J72A 5JHLA 4R2GB 3G08A 5K33A 2YGNA 4OM1L 2F1EA 2XPYA 4DQOH 1BFOA 5I1DA 1F1FA 1JZ3A 1KJ2H 4FA6A 2EVFA 3TPKA 5F1NB 3FSAA 2ZD0A 4X4YA 3WO4C 3QXAB 1QBML 2GSGB 4QXVA 1XF3A 4C56D 3ME0A 3REWB 4WV1C 1AD0B 3QIWC 1YQ2A 2WLZA 3KNBB 3QORB 1CCHA 2D0WA 1BIIA 4P8QA 4M3KB 2CKBB 5DSCB 3NJKA 1IMHC 3QWRD 2KYIA 5HHPB 3DBSA 3LN4B 3UG3A 3CBRA 1CXLA 1B0GA 3NDZE 4MQXD 5F7FA 5F89A 4O1QA 1QVOB 3RZCB 3GXDA 2CD0A 4JFFD 4N90E 1DW1A 5FWRA 3VXQB 1SMOA 5KZCD 1CDYA 4OZIB 4IJTA 2WZ0A 2F19H 4I3RH 3MV11 4PJIE 4AK1A 4UIKL 5FPIA 2NXYD 2GHWB 4FQHB 3L5XH 4JDVB 2ARWA 4JG9A 2VLKE 2G2PA 5IOKA 2WAHA 4RGMC 1E40A 1O6SB 4NUGL 3H7LA 1RJZB 4PV8B 1OE1A 4NB7A 4GSUA 2J5WA 3Q1SL 2YMTA 2XOTA 2QQLL 5C9MA 3B9VA 4BK5A 5L4JA 2CUHA 4Q0XL 3TTSA 1NLDL 3OJDA 2Z0BA 1F2XK 4IBZA 5E5UB 5I6XC 1E0OB 2CIIB 4NQSB 3L74D 4ZT1A 5IG7B 3JTTB 5L6YH 1QAWA 2I5YL 1OXYA 2JKSA 4GQQA 1UC6A 1U36A 4HKBA 4BCYA 1J8HA 4LK4A 3BPCB 1Y6MR 1ACCA 4P49A 1BFVH 2QBWA 3BEVB 1AVAA 3OAUL 1AXTH 4I0PA 3P9WB 1AJ7L 3T6XA 1K9TA 4HBCH 5DCCA 1DL7H 2N18B 5J9PA 3IWUA 4IK7A 3V0AC 4QRQB 1OF0A 3WBDA 2Z92B 2DICA 1QEXA 3PAVA 1W0WB 4IKLA 2YFOA 4R4FL 5LN4A 1OAZH 1OM3H 4D3CL 1UXWB 3ZTNL 4P23A 5MEQA 4JFTA 3WKYA 2L04A 2ZXCA 4UU9A 2VDNL 1QL3A 1J5CA 3D51A 4F20A 1W5CT 2FIRT 2Q6WB 1S8DA 3VU1A 1U4FA 1BLNA 2ZUVA 3SBWA 1IAIM 2ED8A 5HGBB 3V9CA 2QVFB 2YKKA 4G7RB 4IK6A 2ZOUA 1JF1A 1UOVA 2NPLX 3HNVH 2WK2A 4UF7C 3ARXA 4QRAA 1IKNA 2FWSA 4UQIM 1JPSH 2WQ8A 5ETUA 2YD9A 4C4BA 3B2XA 1S9XB 4Q6IB 4F9PA 3WOVA 1RZIB 4BJLA 1KN4L 2F6AA 4KTEH 5JIMA 3TN0C 5TF1H 3LZLA 1Y07A 2A6IA 2NSMA 4ZS6C 1E8YA 3VWJB 4PJAA 1WEJH 4Z3FA 1DQLH 3E1ZA 2A9ML 4YK4C 3LRSA 3LSOB 1TZGH 4WI5A 1MPAH 2ADYA 4HZLA 3GSXB 2ZCKL 1UENA 1NSNH 4FG6D 3VXME 3O0RH 2YGQA 3FO9A 5BOZG 2OR7A 2DYPB 1QNZL 3JTSA 3EUDA 3HZKA 1A1NA 4OUOA 4D9LH 2V33A 4RESB 2HVJA 2OV0A 3MUGB 3GZPA 3O3BA 4WI7A 4EEEA 2C1DA 3IJEB 3I9AA 3O4LB 4NKDA 4ES9A 3P2DA 3ZT7A 4DO6A 2ZXAA 5D6DC 4CVZB 4WGKA 3L3IB 1R1CA 3FSVA 1QLFA 3IGFA 2ROXA 3QVAA 5T1MB 1AHWB 2AK4A 2VOTA 43CAB 3MGOB 4KJWC 5I2IB 2GK0B 4KDTA 3N41B 2GT9A 3F65A 3BIKA 5IB5B 1WZMA 4MJJA 3H9SE 1I1YB 5CFHA 5ACZB 4G6FD 1JHKL 4KPHH 2NY0D 2MMXA 2ZXBA 3B9KD 5BO1H 2AW2A 1X44A 2YPLB 3VFRA 2NYYC 2PW1A 1YNLL 1CRJA 1M7UA 1S78D 2ZKMX 3GMOB 3I50L 3UJTH 2QSVA 3OMAB 5LNEA 2DIAA 4JO3H 1LL1A 3DJZA 3VGHA 1S7QA 3IF1A 2XRAL 4IHOA 1KT2B 4P2QD 4IGBD 2XWBA 4RFNB 3C08L 1JV5A 4KVCH 3CUPB 2ZICA 3QUXA 4NYLA 3AB0B 3X1EA 1L9OA 1HWGB 2W1NA 4YEEA 4Z3EA 4QRRE 5DJQB 1BQUA 2F54A 5GRJL 4OLYH 1DQMH 3GXMA 5AKSA 2A6DA 5H94A 3QORD 3PLYA 2P3YA 4F15C 5EZPA 4K23H 4BXVA 3QW9A 4W81A 2H0JA 2XV0A 3BAWA 3MRLB 5DGRA 5DLML 5CZXD 1TMQA 4K9EH 1R5IB 5IW1A 4S1DD 5EZLA 1IEAB 2Z3FA 4KGJA 4AW7A 4AVJA 1XIWB 3PRZA 2BNRA 4N1CA 1X4XA 5IQ9A 1I7TB 1LE5A 3MRJA 2FWLA 3VFMB 1W8OA 4AYFB 5BOJA 5E5RB 4PY8I 5DD1H 5K1JA 3NCYP 4V33A 5IHBA 3AGVA 3ZUNC 1Z32X 1UB6B 2AQPA 3DP5A 5AFAA 4G80A 3VD4A 4ZMVA 1GZPA 3UCQA 4YE1A 2QFPA 1M70A 1AGEA 1A1OA 4UB0L 5C70A 1ERNA 3TBWB 3UTOA 4OB5H 1FO0H 4BA0A 4ZXBB 1Y0LB 2AMUA 2ZUSA 3IMWA 1UVQA 4IDJH 2B1OA 3KLDA 1LEIB 1DCLA 2WTRA 5DEGB 5IROD 1W72H 1QO3B 1Z9OA 2MIZA 2ZPKH 4KMGA 4X7TB 1Q9OB 4A2EA 1ASOA 2VLRB 5IB2B 4YOKA 5I6MA 1KIUA 3K3QA 5AVYB 3NSJA 3L3DA 4N2IA 3F5WA 2JB6B 4K8RD 4QAWA 4GIPD 4P4RB 4MQXC 2Y7MA 2VXQH 4PJEF 3U0TB 5ES4B 3MA7A 4L5FH 2V7HB 1M7IB 2C7UA 3K2UH 1S7RB 1HDMA 3EDEA 1EEQA 2DQFB 4QUOA 5GJSL 3CXDH 1XF2A 4TTGA 4PHZA 1WVZA 1JK9B 1XCTB 1LC1A 2BDNL 3HG4A 4KWUA 1SHWA 1BMGA 5JIIA 4GEDB 1IM3A 1CDIA 1OV8A 2NXYC 3SHSA 3BAYA 3OAWA 2V0AA 4E9YA 1NGYA 2WQUA 2YXFA 3VRJA 1I55A 1QSVA 1UWGH 4NWTH 4PRNA 3O3EB 1A6PA 1B2WL 2H2SD 4Y19E 5L0QB 3PREA 2YD4A 3DX0A 3KXFA 4HHWA 4X2UA 3D18B 4OLWH 4GMSL 1ITBB 2HFGL 2KLTA 3SQOH 2I26N 3VWJD 1JWUA 1AANA 2B0SH 2HUEA 5I17B 4ZAKB 1F5WA 1HL5A 1INDH 3QISA 5F3FA 5DS2A 3HNTL 5GIRB 1BEYH 2Q87A 4HH9A 5DHEA 3OJ2C 5FGBC 1V54B 3AXIA 5J8OA 2FATH 1KB9K 1CFSA 1GCFA 1KJVB 1AE6L 4ONGH 1L9MA 4XMWA 4PB0H 3HQ6A 4LLWB 4UT9L 2ZP9A 4HHAA 1QFWI 4RWHA 4NBYB 5E6IC 3WC8A 1TCRA 4KJYA 3ZHNA 1KIQB 3TJHC 4ODXA 4JZJB 5C6TH 3DRQB 3Q8BA 1QWNA 1EHAA 1DANU 1MCBA 1R3HB 1Y1UA 4G2AA 4KUZL 1LO4L 4JFEB 4UQBA 4YXHL 1UH2A 3U30B 2FBOJ 3LV3B 3VGDA 1IFHL 1FJ0A 3IRZA 4NO2B 3TIDB 2EEXA 5D4IA 3DYMA 4UQAA 1MCPH 5D72L 4DGVL 3D52A 3FQWA 1HU8A 4R4BB 1U8HA 5DJAB 1HINH 5HHOA 1EHXA 2XWRA 1G7QB 2W07B 4PJCB 3FTVA 1V27A 1EAPB 5DVKA 2XYBA 3ETSA 1H3GA 3M17B 5FKAA 3NIGE 4KXZI 3UH8A 4N2BA 3WFBC 4QXUH 2ICES 2ZNXA 5ICYA 2WN3A 5FYKH 4GYDA 2XWZA 3FU0A 3BC9A 3PPEA 2HB0A 5DA0B 4NQEA 4DSYA 2N4IA 1T2QL 1WCQA 1DIIC 2QLYA 3P3RA 4L37A 2CR0A 1IVLA 2ZZUT 4Z9KB 4KX9A 3KS0J 3AABA 1ND0A 4PW3A 4B50A 2P8MB 5D93B 4HJ1A 3A6BL 3NAAL 3T4YB 4UQ3A 4R7XA 4E5XG 2P5WB 3QUZD 4TQHA 2D4FA 5IFHH 1SN2A 3H1JD 1WZKA 3SJLA 1NCAH 1CGYA 4S0SD 5F70A 3MACL 1NC2A 4PP2B 2I9TA 2E3VA 1O5PA 1DHKA 1FIEA 1EEUA 2P42B 3D4YA 1OQXA 4QHNB 5D7JA 3HMWH 5GJTL 3VFWA 4ALAC 1H0DA 5KLIB 3C5SB 5HYEA 5JHBA 4ALAL 3KYOB 4XGZB 1NCCL 5DRWA 1KELL 4XP4L 1D6VL 4L3HA 3EYSH 3BZEB 3AM8A 1NCWH 1CD8A 1F1AA 2V07A 3LJ3A 1XIWD 4FTVD 3NK4A 2NY0C 1OT2A 4O9HH 3B9KC 1XF1A 1MCDA 3G7TA 5M95B 3M1BA 1RZKC 2WUCL 3SYCA 3WENA 2F08A 1IM9B 1G1CA 4RSVA 2HPTA 1S78C 1J48A 1E27B 1E7UA 5KYXB 1CBVH 4AQEB 3RQ3A 4K71C 1TKWA 1WWAX 1BBDL 4P9ML 4EI6B 1P2CA 4HBQA 4PVBA 5E1IA 3C60B 5JPNB 1MI5E 1X5FA 2UZPA 2XYCA 2X1OA 4YNYA 4E0RB 1GHFL 2BSTA 4XP6L 1YUKB 4GI8A 5JW4M 2WINB 3DTXB 4R2GC 3NACH 3SGJC 4ZDHA 3ALWA 1RU9H 2WXGA 1KYOJ 2DQJH 2O26U 1T83C 1XR9B 2G9HB 2Y1AA 3QXVA 1HOEA 4WFFE 2WVVB 3HS0B 3HPJA 2BCNB 4I3GA 2VLRD 3O2VL 4YN3A 5AW0B 2AEIT 5ISZD 1KFGA 2FJUB 4LVOB 4H4NA 4MB5A 5CJQL 3QORC 3QFJE 4NRZA 2UY7B 1ED3B 4S10A 1TSHA 4U1MA 3SO3B 4TOYH 1K4CA 1R0QA 3C75A 3HC4H 1AC6A 1I8KB 2ETWA 4LPTA 3GD1C 3PHSA 4X9YA 1UURA 5GGTL 3RUGB 2V7NB 2PXYB 3RZCC 1EHKB 1ZWIA 3S88H 1HHJB 5CZXC 2AJZA 5I18L 3EFOB 4HETA 3C2SA 4S1DC 3RTQD 3WJJC 1ML0A 3LNIA 1L9QA 5C07E 5D7LD 4UCFA 3WY4A 5IREA 2D0HA 5D2LE 3ALPA 4Y88A 1U58B 3WEXA 4F33A 5AOZA 1J9SA 5D7HA 1MVFA 2A5UA 2ED9A 2IPKA 2BC4A 1H3WM 1N0XL 2F7IA 1QN2A 1B6DA 2F8VA 2G60L 4DGWC 3H85A 2FHCA 2P5ED 2PW2A 2IDTA 5GSRB 4WHYG 5IQNA 3SDDA 3S36L 5K9QI 1KG0A 3CX5J 3STBA 2A9NH 3D12B 2ZONG 2Z64C 3PWPE 5DLLA 1YEGH 3RWFA 1FAKT 2F1BA 3QUKB 5ALBH 1R0AH 4A7VA 3QXWA 4BZ1L 1PKQB 1V55B 3WN5B 3QDJB 3SOBL 4QCIB 1SRDA 4F91B 3UTSB 4P3DA 1D7DA 1OSPL 2CA3A 4L29B 1M6OB 3GGWB 1MCLA 4WW2B 4XHJC 4RZCB 4O02H 2N18C 3RDTD 3OHXB 3QUMH 1N6QL 3IXAB 4HXAL 4FYSA 4MZRA 1EDYA 2J6EA 2PYEE 3U9PL 3UC0L 1G87A 4K8RC 3VGAB 1B9KA 3WE6B 1P0SE 3O6LH 1DEDA 2WWMD 4K8RL 1E6JH 3AVEA 1M9WA 1QLEB 1WK0A 4K9JA 1NGWB 1CF8H 2L4OA 3MBWA 5CIGB 4LFHG 1T1ZB 5FOBB 4XP9L 2YD1A 1E3XA 5CSZB 1ZVSA 3JWOC 2OFQA 3S3SA 3G3LA 1NA8A 2VO8A 4IOFD 3QEUA 2C26A 1SDYA 4M8RA 4EIEA 1WAAF 5A40E 4LEBA 3KBPA 2PCCB 4Q6IC 3CVIL 4NPYB 2FUQA 2PKDA 1MW1A 2A77H 3QQDB 4JY5H 2H2SC 1IEBB 3HNSH 3N43B 3P77A 2DL2A 5IT2L 2IDQA 3VWJC 2W65A 2Z65C 4ANWA 2QJKB 4NM8L 3H2PA 5CINH 1DBJH 1H6UA 3NRFA 3AZUA 3VG0L 1HCMA 2VDLH 4OFVA 2DM3A 3DPBB 4V11A 3DUUB 5IIEA 1N3NB 3RWEA 2MFNA 4GKOA 3PXSA 1I3GL 2G3XA 3FRUB 2X41A 4PJ5A 2MCAA 3H1ID 5L88L 2G5BA 4I1RA 4ODHL 3QPQD 4CADB 1I3UA 3F7VB 5KEZA 5DMYA 1BAFL 1N9PA 2AQ3A 3STLA 3BP4B 4JFDE 1I7UB 4UINL 5D1XB 2H6UA 1SEBB 1KTBA 5E8PA 1LO0H 3ZYZA 5IMMA 4NERA 4NQQA 3D3VA 3OR7B 2MJWA 2X2YA 4JN1L 4MLSA 2TAAA 1BFTA 4MDIB 4WNQA 3VW3H 3V6FA 4P04A 4RFOL 1XBRA 1FFNA 3FT2B 3R7RA 1RIHL 2VAAA 25C8L 1R3JB 2BVPB 2FX8L 4H88H 4PREB 2X0VA 1I6EA 1BVOA 5DQJB 5FYJD 4IRSA 5I5MA 1ZV5A 1MFEL 3PNWB 1BJ8A 2L3BA 2D7PA 4KTYA 3V10A 2UWEE 4RFNC 3UADA 2IH9A 1PJ9A 1QKZL 1YMHB 2EH7H 1BIHA 3AB0C 3O45B 4LBEB 2VSKB 4IKKA 1E4XI 4BEIA 1WWBX 4IOIB 3QHZL 4MCYA 5DJQC 1K3HA 4L4TE 2JJTC 2MH4A 1AS8A 2EIMB 4GP5B 4TXVB 2JCCB 3MRKB 4X6EA 2ZAHA 4GG8A 4YUEH 1YEBA 3W5NA 2R29L 2Z4QA 4PJFA 4WUUD 2LU4A 4AGLA 4O5LH 5I66A 1JZ2A 4RAVB 4HAFA 2WKOF 5FGSA 5ENWA 3UL4A 4WCYH 1F90H 4CU8A 5D1ZD 1DFBH 4M6NL 5B38B 2PXYD 2CSPA 4Y4HA 1TO4A 3TT3H 2W88A 4W9DC 3BMWA 2DWEA 4IM8A 4BKTC 1Z5LB 2WIIB 3EF4A 4ICXA 3FK3A 1XIWC 4PJ8B 3HI5H 1U3NA 3QWOB 5C0GB 5IFJB 2Q76B 4TNWK 4EVNB 2W0FA 5DRNB 3GSQA 3WIHA 4JM2A 2ZSVB 4EIDA 2F58H 1HEHC 1ZKAA 4UTBH 1GCYA 5DJ2A 5C09B 3UJJL 1D7FA 4FG0A 4DAGL 1W0VA 2C1PB 3DVNB 1L7IH 3E2HB 5E8OA 4ZW6A 1MRCL 2VC2B 4XXCC 4IU3B 3V4VH 3GHEL 4P4KA 1OCWL 2V2TA 1EH9A 2F61A 3FMGH 5CU9A 3MFGB 3KPNA 3NFPA 2YUVA 5JQ6H 4JG5A 1KNOA 4PVMA 4UZUA 3Q9QA 3X13A 3DIDA 2FD6L 4JJOA 3O11A 3GTNA 2R7EB 5E2TL 5JHLH 2DJUA 4PG2C 1PZ3A 1KULA 2CUMA 4IRZL 4OCRH 1HESA 2KDYA 2I69A 3RVWC 2GEEA 4JRYA 2ZYHA 3BKJH 3FQXA 3UIZA 5F3BB 3BDYL 2NW2B 1AO7B 3T3PB 3MZTA 1A7QH 1M7XA 3KR3H 3O2WL 4XMLL 4KRLB 3RTQC 3RWJA 3SY0A 5LGJA 4AOFA 2X87A 3CZGA 1TOXA 3FF8A 2E7MA 4BZ2L 4PLKD 4L8BA 4Z5RB 1IC7H 3UG4A 1MQ8A 2AQQA 2JIXA 3UGUA 1KJMB 2WXKA 2Z31A 4DZBA 2J20A 3DI3B 3N40F 5B3NA 1V3JA 4G3YL 5LXVA 1GW6A 4HU8A 5ITFB 4YSUA 1WISA 4Z7QF 1D5BA 1OTSD 1N15A 3K7UA 2G5RA 3LPFA 3UAJA 2IFFL 2P7TA 2BZDA 3OG6B 4FABH 2HWZL 5F7BA 5TD4A 5FYLE 3ORJA 2OYMA 3L9RA 1BD2B 1ZJBA 3MRMB 4ZAKC 4M61A 1NTDA 4M5SA 4NCC2 4JO4L 4ZFFA 3FT3B 1EUUA 3WMPA 2XTSB 3PQYA 4BFJA 3GSOB 3H9ZA 2BFGA 3QZMA 5DD3L 1YPZA 3HE6A 3NJNA 4NQCA 3GUFA 5INCB 2TRYA 1PPIA 4ZOEA 1TLKA 1U8IB 4NP9A 3RL1A 2E27H 2JXMB 3MV8D 1XB6A 4DOHE 3VFTA 2AXGB 2EDQA 4ZW8A 3UZEA 2V5YA 1XV8A 2R0KL 3QQ3B 3VXTB 4JZJC 3X14A 1MCJA 5FDWA 1U3HB 1N50A 3T0AA 5GGRY 4XZ4A 4NZRH 2EXVA 4R0LB 3U4KA 3H56A 1M42A 4EXPX 3FOMB 3U30C 5D1XD 4XBPB 3LH2L 3EG9B 3HFFA 4R96A 4Y2DA 5FUCC 3QRGL 3VMNA 3RAJH 1KXTB 1L9JC 1M7DA 2G75B 1JCVA 3QUHA 4LCUA 3PDOB 1YJDC 4G6KH 4IOFC 4UDUB 4XNXL 3ZYIA 4D8PA 4TS6A 5IEKB 5DRZB 1YJDL 4IBTA 4PJDF 1MFCL 4J8QA 1FNHA 1QBBA 1TZOA 2ZOKA 3H4HA 1UH4A 3QPKA 4I3SH 4PSPA 4PR5A 4QKXB 3JSSA 1UZGA 1LLAA 2GY5A 4HQQH 4S1RL 1PKOA 3BPNB 3WG7B 3PIQB 4M1DL 4HGMA 4JHVA 4PMFA 3L54A 4PJHA 3CFJB 3DYPA 3DVGA 3US9A 1FUNA 4GRWE 4IU2A 3CCHB 3P3SA 4HWZA 2XZZA 4BK8A 4CU7A 2Q20A 4YAQA 1OB1A 1AYGA 1X4YA 5F7YC 2BM3A 2BVEA 3ZHFA 1FL3B 2E6JA 1YUHB 4NOBA 4HEME 3L4TA 4RX4A 1N67A 1PP9D 3T0BA 1A3ZA 3T0WA 1A7NL 1QBLL 3ZDZE 1JWMB 5CIPB 3DO7B 4UNIA 3QPQC 5B3JE 1ZPLA 3GB7A 2Q1EA 1A65A 1X4ZA 4K7PL 1EGJH 3K91A 3PXTA 5IMLB 2EYRA 1RK0A 2KERA 5ICZA 1NAMA 3KPQA 5BPPA 1WIPA 1IAII 4PJ8D 4X98A 1Z3GL 4B9FA 4PJIA 1G4MA 1PY9A 4OGZA 4JKPH 2HJKB 4TVPH 2VLKA 1RUAL 5GGQL 4M8VA 4QYAA 1CD1A 5KJRL 4OSUL 3CNKA 1IGYB 3H9HB 3H1KD 1HZVA 1RP9A 5EN2B 1HI6B 1BF8A 4MAZA 1XFPA 1CIDA 3IMTA 3FU9A 2ZIDA 4ILDA 5C09D 3U6XA 1PG7H 4JFPB 2X4RA 4R5TA 3OKMB 1CIFA 3VXPB 1XTMA 1YECH 2W9LA 2DQDH 4WLCA 5FYJL 3UG5A 5H4ZA 5JPNC 1AYOA 1QYGH 2NT1A 4YGVB 4BFOA 1CUOA 3FL7A 4W1TA