3ZBMA

Structure of m92a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
455
structure length
455
Chain Sequence
LPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKAPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
total genus 148
structure length 455
sequence length 455
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2012-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3zbmA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zbmA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zbmA02
4LJIA 3GYRA 1V54B 2YXWA 4FA1A 1NINA 2QJYB 1OCRB 1BE3D 1J9SA 2WSDA 4HCIA 1J9RA 3PXLA 3CVDA 1HAWA 2OCCB 4CSZA 3ABKB 4DP7X 4AI7A 1SF5A 1AKKA 4BDVA 1SQXD 4GEDB 1E65A 2PPFA 3SBPA 4AZUA 3S3DB 3UAEA 4GXFA 3SQRA 5AURA 1CUOA 1EB7A 2N9IA 3OCDA 2PP9A 1NTDA 5AZUA 2GIMA 1HROA 4U3FD 2CE1A 1QL4A 3CXHD 4FA4A 5H2FV 1HAUA 2YCCA 5I26A 3OMIB 1EZLA 3IN2A 1NTMD 3H1KD 1GY1A 3HB3B 1KYOW 5CYTR 1C75A 2B10B 5I6MA 1OCZB 5CICB 1OAEA 2IH8A 2MTAC 2CUAA 3CVCA 2PP7A 5B7MA 5C9MA 1H32B 2DYRB 1CXCA 1KDJA 2DYSB 2GHZA 2JKWA 3QJTB 1CHIA 4M3HA 1CC5A 1ET5A 1IBYA 1CSUA 5GTHV 3X39A 1CRYA 2ZOOA 3OMAB 1L9SA 1AS7A 5D4HA 3C2CA 2XV0A 1GS6X 2IDQA 3VYMA 3UAAA 4A2EA 2CE0A 3NP4A 1I6EA 3DR0A 4KO6A 1IBZA 2VN3A 3AW5A 2OZ1A 1ETPA 3A9FA 1KGYE 3RN1A 1NIEA 2BH5X 1OE1A 1ZIBA 4HIPA 3ORVA 1GKSA 3ZX1A 1A8CA 1OCDA 3NJLA 2BP8A 1L9RA 2Y1AA 4YSUA 2N3BA 3ZDWA 4DP8X 1DVVA 5EXQA 1A3ZA 1NWPA 3JBTB 1CRGA 2J57A 2N9JA 4FA5A 1N50A 1ILSA 1CC3A 1ETJA 2HZHA 3EHBB 3PCYA 4YVNA 1L9JC 1E29A 2XV2A 1RAPA 1SQQD 4PCYA 3OM3B 1B3IA 2B4ZA 1JVLA 1KV9A 2A3TA 1CORA 1CTZA 2JXMA 1E5YA 1NICA 2Q5BA 2W8CA 5CIGB 2YIUB 3SVWA 4L1QA 1JZHA 1TEGA 3PH2B 8PAZA 3HQ6A 1I8PA 4N4YB 1CYXA 2PPDA 3PXWA 4GY4A 5D4IA 1NIRA 1SDDB 2BP0A 3FYEB 1ZZHA 1GY2A 1EHKB 2DGEA 2UX6A 1OCCB 2YXVA 3NJJA 1YNRA 1M57B 1OF0A 2R7EA 4RH4A 1FA4A 1FI9A 3ASNB 3NWVA 2FJSA 2PACA 4YL4A 2HX8A 5IY5B 4GP8B 2IWEA 3HQ8A 1NPNA 1FJ0A 1H9XA 2AANA 4YSCA 2ZBOA 1RZ5A 1SHXA 1CHJA 5I6PA 3NP3A 1C6SA 1H9YA 4UAHA 2P80D 1WEJF 3S3CB 3NJGA 4O1WA 4WTQA 3CDZA 2C8SA 2IDUA 3CXHW 4P4QB 4EF3A 5TISV 2L4DA 4YSOA 4AKOA 1F56A 2CALA 1WA2X 1C6OA 3JT2A 1P84D 1K3GA 4AAOA 1C7MA 2GC7C 3SLEA 2DV6A 3NJFA 2I85A 4K9JA 4WQDA 1AR1B 3G5WA 3SXTA 2HRHA 2HX9A 3BVDB 2C1DB 1HFUA 3OA8B 2IH9A 2B12B 1XB3A 1QN2A 1YFCA 3ASOB 3KZIV 1OV8A 1A4CA 1N90A 1RZQA 1X9RA 3QJVB 4HAKA 3N2JA 5AFAA 3FQYA 2AVFA 4DY9A 1HJ5A 5B5EV 1ILUA 3NJHA 1QYZA 1U75B 4L3GA 1N15A 4KNTA 451CA 3NYKA 1T5KA 1XMEB 5AKRA 1AZCA 2FQGA 2AFNA 5C0ZA 2DWSA 1BQ5A 1N70A 2EIKB 3NJNA 4WQAA 3MK7B 4BWTA 1KCWA 2PCYA 1SQVD 5TK2A 1CNOA 4WKXA 2XVBA 4YSTA 4PJ0V 1PF3A 3WUIA 1HRCA 1LFMA 4PD4D 3VRDA 1FWXA 2UXVA 4YSDA 2Y69B 1CRCA 4KO9A 5E9NA 4P5RA 1A8ZA 3TBBA 3UADA 2VM4A 4MFHA 3WKPA 2VW7A 6PAZA 3TASA 5I6OA 1A65A 2CXBA 3CX5W 2CJ3A 3EH5B 2VSKB 1AANA 3QQXA 2EIJB 4PW9B 1JZGA 1CURA 4DP2X 1CRHA 1PLCA 4DPBX 2EILB 4E9VA 2A06D 1I8OA 1L0LD 2BH4X 1PLAA 2YARA 3KW7A 4CSPA 2XTSB 4JCGA 4E9SA 4QKTA 2FWLB 3M97X 3FU7B 1BQRA 1AYGA 1LC1A 2VSMB 1WAEA 5CIDB 2N18B 2YAFA 3DP5A 2PLTA 2BCNB 3O5CA 1MG2D 1JZJA 1TU2A 3N55A 4YSAA 1H33B 3GDCA 1NIBA 3NBTA 1GS8A 2VW4A 1GSKA 351CA 3L74D 1OE2A 2PPAA 3U25A 2N18C 3DMIA 1FFTB 2BPBB 1MG2C 3DKHA 4YVUA 2FT7A 1CYJA 3X1FA 1WS7A 1AOQA 5DJQB 2UX7A 1M9WA 2QPEB 3UGEA 3H4HA 4E9QA 1H31B 1IZL0 1PMYA 2YAPA 3OMNB 4M4RB 2IBZD 4GP5B 2XYBA 3NJIA 3L4OA 2BW5A 2QDWA 1CO6A 2XUWA 2BO0A 2D0SA 1PZBA 5DJQC 2TSAA 4DP4X 4V2KA 3PXTA 1LC2A 4J20A 1AOZA 2FNWA 2BLFB 3NJKA 3ZCFA 3ERXA 3NT0A 3IN0A 5CIFB 1NMIA 1KBWA 4FA7B 1W6LA 1QKSA 4FAVA 1MZYA 3CP5A 2XWZA 2BWDA 3GXUB 5B1JA 4E9TA 4FA9A 4G7RB 1HZVA 3EH4B 1AZNA 2BZ7A 3OQRA 3WU2V 2AI5A 4WQ9A 1ASQA 1YCCA 4G7QB 4F2EA 1AAJA 1IC0A 1XB6A 5B7FA 4E9RA 2DY2A 3UACA 1AIZA 2I7OA 1SF3A 1RAQA 1PNDA 1ZIAA 2HX7A 1LMSA 4EIEA 2VMJA 2PCBB 3X1GA 1IQCA 1F1CA 3FSVA 4AKQA 4KOBA 155CA 1GDVA 2OJ1A 3AG1B 2CA4B 3O1YA 1C2NA 3SBQA 4E9XA 2D0WA 1VYDA 2AZUA 2AIUA 1L9QA 1ZV2A 1BYPA 1YTCA 1ASOA 3EF4A 3RN0A 4TXVB 2PP8A 2I8FA 3H1JD 1AS6A 1OE3A 3FU8A 3PPSA 3CZUB 5I5MA 1F1FA 1KIBA 1JXGA 1GR7A 1C52A 1CCHA 2ZZS1 5KAFV 1JZFA 3QJSB 4F7KA 1CHHA 1J5CA 4Y5RA 4PAZA 4DP1X 1L0ND 2BWIA 1MZZA 1M56B 2MTAA 1DVHA 2C9XB 2FQDA 3O0RC 2VM3A 2ZONA 3X1EA 4BK5C 1ID2A 1JZIA 3L73D 3A0HV 2W88A 2JQRA 2ZXYA 1GJQA 2BGVX 1CRIA 4HCGA 3WI9A 1BGYD 1ADWA 2NRDA 5KKZB 1PZAA 4DPCX 1HJ4A 5KLIB 3S8FB 1MZ4A 2EIMB 3FYIB 1WVEC 1NDTA 2CAKA 2WO3B 3NSYA 1EZVD 3X1NA 1H32A 4A2GA 5FC9A 1QNIA 1M60A 1RZPA 2E86A 3ZOOA 1CIHA 2V08A 1I6DA 1X9UA 1SNRA 4BDVB 6PCYA 5I28A 1BCCD 1FOCA 1KYOD 4W9ZA 3WNJA 3T6ZA 3WFEC 1CYWA 2BW4A 3CG8A 2PCFA 4HHWA 4JHVA 4HHGA 3UABA 3ZOWA 1WA0X 3H1LD 4WQ8A 3OCDB 3FS9A 5I6NA 2PCCB 1IO3A 1FI3A 1YEAA 1NNOA 1AZUA 4DP6X 2GC4D 4WQCA 2CCWA 1W5CT 1HJ3A 1MDAA 1HH7A 3ZBMA 4NB7A 1CIFA 3QJRB 2LLNA 1IRWA 3H1ID 1NTKD 1LS9A 1FCDC 3H56A 2GC4C 4NAJA 1OOWA 4YSEA 3V9EA 2YAHA 1CSVA 4ENZA 1DW3A 1W2LA 5E79V 1L9PA 2GI0A 3ZOXA 3FPXA 5LDUA 3ABGA 4K3IA 1JVOA 2JTIB 3PLYA 1U74B 2GIWA 3RLMA 4DP9X 1C2RA 1HCMA 1DT1A 3MK7C 4AANA 1J3SA 1TEFA 2ZWNA 2C1VA 1H1OA 4Q8BA 5B7EA 1B7VA 1FHBA 2V07A 3V9CA 1DZ0A 3AY2A 1YLBB 1C6RA 5I5IA 1BL9A 4KO5A 4AAMA 2N3YA 1CSXA 1SDDA 1GS7A 5PAZA 1JZEA 4FANA 1DYZA 2OZ1B 3PAZA 3IE9A 3JTBA 3L71D 1NWOA 2BCCD 4AKPA 3T6VA 5B6QA 3FU9A 2HRGA 3EH3B 1CYIA 2UXGA 2VHDA 1AS8A 2DWTA 3ZIYA 2J56A 5B1AB 2YQBA 4DP5X 1DW2A 1AACA 2BP8B 4P5SA 2HXAA 5D4JA 3RYMA 4YSSA 5B1BB 2X87A 1E30A 1QL3A 4N8UA 1KBVA 2QT6A 1UATA 3FQ2A 1V55B 4G7SB 4DPAX 1DW0A 1E5ZA 1NIAA 2H47C 2YAMA 1J5DA 1I53A 5CIBB 1M70A 4A66A 3PAVA 3CYTI 3L45A 2XV3A 2LIRA 4UB8V 3WIAA 1ZDQA 1BEXA 3OD3A 2YAQA 4E9WA 5IY51 2UXTA 1SHWA 1CSWA 4BXVA 1S5LV 2C1DA 3OA8A 2BP0B 4EIDA 7PCYA 3X1BA 4Q5PA 2FQEA 2GB8B 2IAAC 4G71B 4KMGA 2R7EB 2XXGA 4Q89A 1BQKA 2ZXWB 4XYDB 3AZUA 3WC8A 3ABMB 4NERA 3MBWB 4GP4B 4NFGB 3AG3B 1A56A 2BZCA 3L75D 2JFCA 4ZK8A 4F2FA 1SJMA 2EINB 2FTAA 4A2DA 4JKNA 4WQEA 2PPEA 2HLEB 4YE1A 2TSBA 3C75A 3D12B 3IEAA 2LITA 1KX7A 1PP9D 4BWWA 5F7BA 3BCCD 1CEDA 1URIA 2I7SA 4A67A 1IKOP 1COTA 3TU6A 1ZPUA 2YAEA 3CDZB 2CA3B 4L3HA 2B08A 5KAIV 1GYCA 1W6WA 3FPYA 1JOIA 2IDFA 1YIQA 1A2SA 1DIIC 3H1HD 4D6TD 3NSDA 5GTIV 1QLEB 1J9QA 1NZRA 2XX0A 3NSFA 1RZ6A 3L4MA 4MU8A 1KV7A 3DTUB 3PXSA 2RACA 3ABLB 4JHUA 4PWAA 3IBOA 4YSRA 4A68A 4FAAB 2IDTA 1NMLA 2GSMB 1GIWA 2XX1A 4KNUA 1JXDA 2YK3A 3FQ1A 4WQBA 3BQVA 1I54A 1L9BC 2C2CA 4H0JA 2QJKB 3HQ7A 4WQ7A 3NSCA 5F7AA 4A2FA 1CIGA 4AX3A 1JDLA 3WKQA 1AOFA 5DF5A 1XB8A 1AG6A 4X4KA 1R0QA 4IL6V 4QAOA 1DW1A 1KDIA 2VW6A 3AG4B 3FSWA 1SQPD 2FWLA 2H5UA 2J55A 1E67A 1AG0A 3FU7A 3MX0B 1PY0A 3WFCC 1L9TA 1SFHA 1SQBD 1DIQC 1GQ1A 2N0MA 3RMZA 2UXFA 5KLVD 1KYAA 4KOCA 1ET7A 3CX5D 2BHFA 3WNIA 5EHFA 2B11B 1HZUA 1H33A 3WFBC 1OCOB 2C1UA 1A4AA 2FT8A 2XXFA 3HEIB 5TK4A 3T71A 3TBCA 1IUZA 4DP0X 3A0BV 3FSZA 4HALA 2ORLA 4G72B 2WO2B 3T6WA 5A7EA 1NPJA 1WS8A 3L70D 1PAZA 3NJMA 5I5JA 2IWKA 4W1TA 2FYUD 5CIHB 1H31A 3CWBD 2IDSA 2X88A 1KX2A 1NTZD 4UF7C 1SFDA 4HCFA 4KNSA 1KB0A 1BYOA 2OV0A 4YSQA 3ZOYA 1VLXA 5CIEB 2GB2A 2EXVA 5I6KA 4EIFA 3X2QB 2CBPA 1NIFA 1KCBA 2B3IA 5PCYA 5ANHA 1GU2A 3T9WA 3WG7B 1FI7A 5B1KA 1E8EA 3FT0A 4BWUA 3SWSA 4G70B 1NIDA 4A2HA 2MRYA 1PCSA 3PAUA 2HV4A 1A4BA 1J9TA 4EICA 2XU9A 1ZDSA 2PPCA 2XLLA 4O1QA 1BXUA 2ZONG 1YEBA 1GW0A 4YSPA 5B3SB 1S6VB 2GC7D 1E2RA 1I55A 3TYIA 3H4FA 2J5WA 1CYCA 1ASPA 1ET8A 3FSAA 1NU1D 1ZRTD 4RSZA 3SJLA 5B66V 1RCYA 1RKRA 1W8EA 3TGUD 2FQFA 2IWFA 7PAZA 3NBSA 1KB9D 1PPJD 5DFSA 1N9CA 2QPDB 1QHQA 4L0PB 2B0ZB 4XXLA 2MHMA 3L72D 3VNWA 1AZBA 1PZCA 1CIEA 1K3HA 4N0KA 4AALA 1CCRA 4UB6V 4GYDA 1CTJA 3CVBA 1JXFA 3WFDC 1JERA 3QJQB 1PLBA 1BXVA 2FRCA 2Q9OA 3S8GB 3TA4D 4GYBA 1CRJA 2FYNB 2DVHA 2QJPB 1V10A 1WA1X 4FB1A 3HQ9A 1L9OA 2H3XC 3KW8A 4UANA 4E9YA 3AG2B 1AZRA 3DIVA 2FT6A 3QPKA 1IRVA 1BAWA 9PCYA 1PNCA 2AXTV 2AZAA 1I5TA 1AQ8A 4BXSV 4QLWA 1MG3D 1CTYA 3QJUB 1R1CA 1TKWA 2GBAA 1CXAA 1M6ZA 4H0KA 3T6XA 2QDVA 1N68A 3O20A 1BXAA 4KO7A 3CU4A 3S3BB 5B1JC 3SBRA 2P80A 5I6LA 2YAOA 1YICA 4HZ1A 1MG3C
chains in the Genus database with same CATH superfamily
3MRLA 2CG9X 4NDMA 2AABL 1LE5B 5F89B 2QVIA 3CVDA 4RSYA 3QZBA 3LXAA 3ROLB 1G7JA 3VXRD 4A7TA 1PIFA 2EKSA 5JO5A 1IAKB 3JYCA 4L4VA 2BJML 4DGIH 1AGFB 2OYMA 3E0GA 3UIYA 2N9IA 1MI5B 1FDLH 2MKWA 1A7BA 2CRMA 3RUGF 1GJIA 4HSCX 3CXHD 3DXAD 4M1DH 5ILTL 1D3CA 2B1AH 2XOTA 5BS0B 1MCBA 4PHZA 2UZYA 4X98B 1OAEA 3VXQA 3NA4A 2W80C 3MLYL 2BRRH 5H2BA 5DQJA 3ARQA 3HB3C 4Z76A 1MFVA 1FG9C 4PLJD 1V3MA 4G7YH 4AYEC 2NZ1A 3P77A 3VQ1C 2FEEI 2NR6A 4LLDA 4RX4A 4WEUD 3HN8A 4CSSA 3MUHL 1T83A 1AY1L 1UB5A 1YMHA 2Y5TB 5HGBB 5F88B 1HDMB 4A2EA 1OSPH 4MJID 3QQ4B 4NN7B 1LHZA 4ELDA 4M6NL 4ZX6A 4QOKB 4GOSA 1OSZA 3ZRFC 3RN1A 1DUYB 1DQJA 1SN5A 1OCWL 3OAUL 5C0IA 2BZDA 2GTWB 4AVJA 3NJLA 2AJ3B 4G9DA 3ZDWA 1DVVA 4JRYA 2PW1B 1U3ZA 4TLKA 4YO0A 3P73B 3VRJA 3DJZA 2ZIDA 5C08B 3CZFA 3ZKXC 4O00A 4PWFA 2WP3T 3NQKA 5EIQA 1YRKA 4HWZA 4Z0BH 5F9JB 3AU1B 1KV9A 2R27A 3TIEA 1INDL 5A7EA 3WS3B 2QHLA 3L13A 4WQOA 1FFOA 4G6JH 4F7TA 4X4XA 1MREH 1VEPA 3L5IA 4ODWA 4Z7NE 2X4PA 1A5FL 1K8IA 4YHML 4GXVH 2YSTA 4HEPG 4OFQA 3VX1A 1TCMA 3VXOB 4JRXD 4K0OA 1UOLA 2NY4C 4NQSB 3TJHD 3KPMB 5DHVB 1M7UA 4S1QH 1AFVL 2PXYD 3C5ZD 3CX5K 1E6JL 3GSWB 2V5TA 3BPNC 1AHWA 3RWJB 5KVDH 2CXKA 4N0RA 4OLXH 4N2EA 3TWCL 2JWYA 3LV3B 1I8IA 5E51A 1LEGA 4V2BA 2F58L 3NIFB 1C6OA 1NBZA 3WIIH 4B5EA 2GC7C 1IM9B 1JZ4A 3BZ4B 5FOBA 5KSUA 5EO1B 3S35H 3F62A 1N5YL 4MXWL 2HX9A 5EUKA 4XOEA 4Z3FA 3QZWG 5CCKL 3DMMC 3V10A 1X9RA 4FLQA 1RZQA 2XTJE 2OXHA 2XN2A 4MWFA 5AFAA 1AR1C 4DY9A 4ACTA 4L9DA 2N01B 4LCWA 4WTZA 4LSTL 4PRPA 1C5CL 5F9OH 2YWZA 3ZDZB 4YHNA 1T7WA 3U79A 1UUSA 6FABH 3MAWA 3B2PA 1MFCH 5EC2B 4Y8DC 1AZZC 1PLGL 1R3KB 1TTGA 4KO9A 1JK8A 4CC1A 1CD9B 1JRHH 3KPSA 1X4XA 2UUDH 5SX4H 3RVXD 4GFXA 5B22A 4F5CA 2BNQE 2BSBA 1DQLL 1L9MA 2VSKB 3ATAA 3D3VE 1YJDH 3ILEA 1CFVH 4GEIA 1K5WA 3BH9A 3BVXA 5BUAA 3T0XA 1B90A 3G7TA 1QRNA 3BW9A 5JA9A 1B0IA 2E0PA 4G6FD 4QKTA 2IPKA 1IM3A 1NEZA 3MGAA 2NTSP 1N12A 4LEXH 1H3TA 3WIFB 1FCGA 1EAQA 4HSQA 4LVEA 4PV1C 4NZRL 1I3VA 2ADGB 5KSAB 2VQUA 4C57C 1OD9A 4OLWH 1ZVYA 1DQKA 4OKVB 3VXRE 3CZJA 4IOIB 5A2LH 1VA9A 1IO4C 4YDJB 1SY6A 4FP8H 2LR4A 4S1DC 1X7QA 2XYCA 4GG8B 4Z9KB 5C0RL 4HKXA 1WT5C 2BSSB 3OG6B 3K6NA 4OJCA 3ZHDA 3TYGH 4ETYA 2H1XA 1TZGH 3DXAE 2YLHA 3NJKA 3DDFA 5EO9A 4ZFOB 2OYLA 5B39B 2QMKA 3U6RB 2OMYB 4QHPA 1RZ8A 3OF6D 3ULSA 4LEOB 4H8WL 4CVZA 3VFSA 5IP4A 4FA9A 2JCCF 4Q9BA 2BZ7A 2PO6B 3UG3A 2BVTA 2K78A 4NM4L 3S34H 4DKFH 1J5OH 4AQ8A 2G5BA 1NMAL 1YVLA 2D7MA 2MPAL 2WTPA 3OLIA 4KKRA 1EBPA 4ZS6C 4RAVA 4PV9B 4OZIA 4EQ3A 4IOSD 4MJIE 4ODTL 1KB9J 3TCLA 2XN1A 2DB8A 4RFNB 4BFRA 5ESAB 1LILA 3R06B 1Z2KA 2G2RA 4GW5B 1CDJA 3VM5A 1CTOA 2MCPH 2O6EA 4A6YA 4BIKA 3WNPA 3L9BA 5KAFV 4FQCL 2AABH 3VVVA 1YN6A 1JDCA 4KKBD 2Q3XA 5CEZD 1CG9A 1JD7A 2WBJB 4JFWA 1YDPB 5DZJA 2CKNA 1DVHA 4QO1B 3IGLA 3GRGA 1EAJA 1BZDA 2BJMH 3LPFA 2CJTA 3D4GA 2DMBA 1KB5A 3S8FB 5JHDB 4AKOA 1HHHB 3QUYA 4FLHA 4GUPB 3VGEA 1EZVD 4WW1A 1AGEA 1TEYA 3ARPA 3GM0A 5ILTH 4BDVB 3II3A 2VUKA 4F20A 4JRXE 1HU8A 5B4MD 3F65A 4PB9L 2C1PB 3BEWA 1IO3A 4JPVL 3GHBL 2R9HD 3QFJD 4NQCD 4HUVA 1Y7VA 2Y36L 3F5WB 4GXUN 4NXKA 5ITBL 4JQIL 3NRQA 3F3HA 2HG5A 5LXVA 4G7VL 5F6HI 4R96A 1YEDA 2VNCA 5G4NA 2ENYA 4X9YA 3IM1A 4KX8A 4R7DB 5DHXB 1AY1H 4JZNA 5F7DB 3HHRB 4AENB 3FPXA 4M6NH 3HMXL 4R2GC 3Q9PA 1OB1A 2UYLA 3DYMA 3M88A 3CN4A 2B77A 1OCWH 3OAUH 4URTB 1KACB 1T1XB 1MPAL 3E7JA 4FXKB 4J4PC 1YLBB 3RY5A 3ETBF 4KH9A 2N3YA 3TEXA 1ECYA 4I0PA 3MACL 4ENED 1PZ5A 3MDJA 3U4KA 1Q4NX 3QXAB 3HE7A 2GJ6D 2VHDA 1EFQA 1FNGB 1MHHB 4AEIL 3I9PA 2DQFA 2XA3A 5TF0A 2DWEB 4MMXC 3VSUA 1INDH 2ARWA 1HE7A 3REWA 4MVBD 4UU9B 4G43A 4WIQA 3RWHA 5BQ7A 2QADC 3L9RB 3PHAA 4BFBD 4A7GF 1A5FH 4YHMH 4A37A 2WXNA 3L6FA 4WDIA 4C4BA 1BPLB 1FSKB 4U7KA 3U36A 1JZ2A 1EJ6A 5IEHA 1AFVH 1E6JH 3EH1A 3BIAX 4AYSA 4ADGA 4FNQA 4HPYL 5FK9A 3ZYJA 4XWGL 1TTUA 2KZWA 3TWCH 2WQAA 3WC8A 4KXAA 5D7EA 3GWJA 3ZDXB 4P2OA 3M1OA 4U1MB 1A56A 5A16B 4YS4A 2F58H 1U8HB 3AREB 2LFGA 4YNYB 4JGUA 5F7MC 2WXGA 2WM0A 2EDKA 2WAHA 1N5YH 1HHIB 4MXWH 4QHKI 1T22B 2I7SA 3BVUA 4ABVA 4ZMXA 5I8OL 2CA3B 5CCKH 1DO5A 3SJVA 3SDYL 3CHOA 3FPYA 2WXHA 4K71C 1KOAA 2IAMA 2XTLA 4BFKA 4GQ9L 4Q6IA 4LSTH 4ODUA 3DRTA 1C5CH 3C6SB 2Y6TE 4JFOB 2OL3L 4PGJA 1GIWA 2WTOA 5GGRB 3ARZA 3STBA 2ZCKL 3O3AB 1JGUL 4H0JA 3IJYA 3G5YA 1PLGH 3WJLC 2O6CA 5D1XB 3BGAA 3FHAA 3AG4B 1SQPD 2AXGA 3MREA 1Z1WA 2BNUA 4FXGC 5CUSL 4YXLL 5JZ7D 1DIQC 2N0MA 2YPKA 1IEAB 1DQLH 3VDAA 4WEBL 2M1KA 4PJ5A 1ZCRA 3ZQWA 3WFBC 1G1KA 5EOTB 2VR3A 4IDLA 1WFOA 3RNQB 5GZOC 1KMGA 3VE0A 4PI2A 4NOBA 4XBGA 5K9JL 1HL4A 2AEOA 2B5IC 1E7VA 3SDDD 2ISDA 3CFKB 3EFOB 4BZ2A 4P59L 5FF6A 1C9SA 3STLB 1SFDA 1VESA 1CU4L 5E8EA 1R3LA 1XH1A 4JRLA 2OJZL 2X3AA 3UYPA 1KCBA 4NZRH 5CEZE 4JKPL 3UC2A 5IJDC 5F6IC 1WTLA 3T2NL 1CZ8L 2VZ3A 4NUJB 4L48A 2EVIA 2VKWA 2YEQA 2IFGA 1M4KA 4WNQA 1N59B 3BPOC 5DYFA 3ARGB 2ZONG 1HINL 4AIZA 1NFKA 4APQB 5D2LF 3MJ9A 2JIXB 2OYPA 5C0RH 2Q10A 3EJPA 4FQ2L 4PQXA 1I1YA 1W8EA 3QWRD 3L1GA 3CSGA 1NC2B 1N9CA 1CGXA 3P0VL 3MLTA 4MLSA 5BRQA 4KK9D 1J8KA 3D2UB 4L0PB 1BOGA 3K6IA 1CIEA 4XPGL 2WXOA 4P5TA 3FO1A 4FKEA 4H8WH 4WO4A 1KUMA 2QKIB 4K8RL 2DW5A 4W93A 2JTDA 2KERA 2FRCA 1J8SA 4RZCA 1OP5H 2ZXBA 5J1AB 2FECI 3QFJE 4NQCE 3UJIL 1RZGA 2RALA 4NM4H 4CKQA 1TO4A 2YFOA 2RCSL 1HJCA 2DYPB 4EDWL 1U8NB 2A77L 4PJ8B 1NMAH 2MPAH 4YXKL 4X6CE 4QGYA 3SPGA 2CUHA 3NPZB 3V79C 4ODTH 4HIQA 3IFPA 5EPMA 4WWKA 1B0RB 1BXAA 3MRGA 1PZ3A 2R29L 3H9SD 1H3UA 2X4QB 4LDLB 4BV1A 2YRBA 3Q44A 4LCCC 4ZW8A 3GBML 4MTMA 3M07A 1GZQB 3TH4T 5E9DA 2VDLB 1XTMA 4FQCH 1J9SA 1IGFL 1Y6MR 4PVBA 5K59F 4O2FB 1S7WB 3GSNB 4XB8A 1KGWA 2GJ6E 5T1KB 1NCIA 5FM8A 1OANA 3DO7A 3OKNB 2VOTA 4L4TA 3LZPA 2Q7YA 2H32B 2IO5A 5GGTA 3BH8B 1KIPA 2YCCA 2F5BL 3OMIB 3NEEA 3TV8A 1KXTB 3RWFA 3HB3D 3VGDA 1M7DA 3DURA 2LU4A 4X5XA 4KV5F 3KPLB 3HZKB 4K9EL 4MCYA 1IAOA 3SQBB 4U1HA 1PGRB 4F9LC 1OAYH 3E3QE 4JPVH 3GHBH 3WEBA 1A1OB 1HEZB 1BF8A 2Y36H 1BZ7A 5FLVA 5ITBH 4JQIH 3BE1L 2FJHB 1ZA3B 3GS0A 2J3SA 4HIHB 3DWTA 1EAPA 4G7VH 2WQUA 3I85A 1U8MA 2FYYB 4OUUA 4E9LA 4QJ5B 4XOAA 5EBLB 2GQHA 5ID0B 4KO6A 2KQMA 3OKDB 5HHPB 3MV7B 2WZPA 3A9FA 3QUKB 4XXCA 3DVNA 3BP4B 4Z7VB 1OE1A 3RTLA 3BCFA 3HMXH 2K8MA 2R2HA 5AVXB 3TOPA 3OZKA 3GB7A 4PJBB 4L18A 3NSJA 1MPAH 4OF7A 5EXQA 3EAKA 1CRGA 2G3MA 2V0AA 1LVEA 4BELD 4WHYG 1KBBA 2F8IA 3QUZD 1M1XB 4HLZG 4KMQA 3KPOA 3MACH 2L7JA 5C0DB 4IBZA 4M8RA 1F4AA 3Q48A 4XN7A 2NUPA 2R69L 3QPQC 4XTRD 4AEIH 1CORA 2NXYC 4HWUA 1A02N 1KWGA 3VXUD 3FFCA 4L3CB 3HQ6A 1II4E 4N4YB 1QWHA 1P7QD 1MCHA 3RZCB 1MCWM 4FQXB 3ZTCC 1FA4A 3K2UL 2N7SA 2GITA 2GYSA 2PETA 4M00A 3KL3A 1Q9OB 3ZYZA 3ZE1F 3SPCA 4GQRA 5FYKL 2HJKB 1UXWB 4IBYA 1MIML 2E7DA 3H7BB 1CHJA 4OGAC 5IF0B 1GOFA 2IALA 1TJIL 3SYAA 1NCDL 1KENL 4F8TA 1P5VB 4HPYH 3GJEA 2O72A 4JM2F 4XWGH 4EF3A 4PJFB 4CC4C 2D7NA 4HEME 1C7MA 3DVGA 5IV2A 2Z1PA 1ZY9A 1KLUB 3DMMD 4MQSB 4OGZA 4P5KB 1S3RA 4X50A 5AW1B 1AR1D 1W0WB 3GMQB 4F7PA 1TVBA 1QACA 5DRZB 3C2SA 5IM7B 5I8OH 4G8GD 5ENWA 3SDYH 4TTDC 5B5EV 1ZPLA 3CVIL 1QATA 1PPIA 2W0KA 3WS6C 3KXFA 4Q9RL 4GQ9H 4FULA 5F97E 5C0ZA 2DWSA 1VZHA 2C1OA 2VYRE 4TKWA 2OL3H 1LMIA 5IBUB 5MEQB 1XCQA 1CNOA 4YSTA 2ZCKH 3PXHA 1JGUH 5DRXA 5DFVD 3RKDC 4AGLA 5CLTA 1Q0YL 3MRDA 3Q5YA 1T20B 4H26B 4E2OA 2FHCA 1YUHB 3US9A 5DK0B 5BXFB 4L37B 4JFYB 4YXLH 5CUSH 4I1RA 2ROXA 1MCPL 4WUKL 3RL1A 3ZRCC 4P2QB 4WEBH 4B0MM 3PF2A 3HI6L 4IS6A 4EMZA 1HX0A 3OKKA 2OMBA 3GSQB 1PY4A 5DVLA 5CIPH 2E59A 3SKNB 1IC4L 2YRLA 5C07B 4PJ9D 4GINA 1RSYA 5F7LB 4K5NA 4QYOA 1CFNA 4PY8J 3WFEL 3BYTA 5K9JH 5M95B 1RK0B 4P3DB 5DSCA 5GGUA 2YAFA 4P59H 3DXAB 3H9SE 3C6EA 1XCXA 3KPQA 1CU4H 5EF0A 1NIBA 1GS8A 3B9KA 1MWAB 2W60B 3SO3C 2OJZH 1W72H 4ZUTB 351CA 1OL0A 1XGYL 2XPYA 2P5ED 4QHNB 2N18C 4JKPH 2KLSA 4C4KO 4S1DD 4YVUA 3T2NH 3U4EB 5A6LA 4QAMB 1CZ8H 3D50A 3WNMA 1AOQA 2QVMA 3FB7A 1HH9B 3TURA 3V4UL 2GBUA 4M6ML 3ZKNC 3CHQA 1FRGL 2DQEH 1JF1A 2IBZD 4O4YL 2N1KA 5DLLA 1HINH 3HC2A 2DICA 2BSCA 2XUWA 5J3HC 2F74A 4N87A 3U4AA 4FQ2H 4EN3D 1BM3L 5ERWA 3BRGC 5LAPA 4MJIB 3P0VH 1MEXL 3L3OA 2FO4B 4U6YA 4FA7B 3CXHK 4FAVA 2BWDA 4XPGH 2WQ8A 5B1JA 3ZE2B 3NIGB 5DFTA 2EVFA 2V7NB 2FWUA 4K8RH 4MXQC 3QXDA 2YZ1A 3FW6A 1ZLWK 4YDVB 4ZS6D 3UJIH 1E0OB 5H37A 1E2VA 4QRPA 2RCSH 3WNNA 1AIZA 4IHOA 4EDWH 2A77H 4GW5A 3V4VB 5CU5A 2VMJA 4ONGL 2ITFA 3ABZA 5KN5B 2NTFB 1LE5A 5FX3A 1VFAB 5F89A 1YQVL 4YXKH 1BGXL 4RA3A 4KKCC 5F0LB 5A6IA 4RGND 3NACL 4Y2DD 2EACA 5EDXA 3BH4A 3ROLA 3P69A 5J6SA 1IAKA 2VZTA 3KGTA 4N2DA 2W94A 5LNDA 2R29H 1GR7A 2HRLA 4AEFA 2CH8A 1SXNA 3A4AA 3GBMH 1MI5A 3NRFA 3PWPB 4WNSA 1CHHA 2X5PA 5H35B 4G9FD 2GBTA 1IGFH 3N41F 4OF3A 4ZAKD 3FRUB 2PXYB 2VM3A 2QVFB 4M48L 3ZN6A 3IYLW 3KDPB 5B3NA 5BS0A 1PU0A 1VKXB 4X98A 3O41B 1IBFA 2NRDA 5KKZB 3VXUE 2XWTB 4M5YL 4FFWD 2OZ4A 4Z3TA 4MJ2A 2DJSA 2P28B 1RZPA 3VI4E 2F5BH 4L1BA 2Z31C 2J73A 4YUEL 3P3TA 2AHIA 2YXFA 1FOCA 2WQVA 3T6ZA 2Y5TA 2BVYA 2BW4A 5HGBA 5F88A 1HDMA 3HOGA 4MHHG 4K9EH 3QQ4A 1UG9A 2NXZC 4QOKA 2LGNA 3KLKA 3MLZL 1G7LB 1DUYA 5HDBE 2V7HB 4PJDE 4DP6X 3S4SG 1JF6A 2GTWA 3QULA 3BE1H 2AJ3A 4QXUL 4XH2B 1KBKA 3WNOA 5C1MB 1T1WB 4R2GD 2PW1A 4RGOL 5FV1L 3P73A 1CMOA 2JE8A 1DW3A 4L3EB 5C08A 2AS5M 5AYQA 4OLZL 1ZLVK 2D0FA 5F9JA 2OZNA 5HVFB 3AU1A 2PR9A 3CU1A 5EU5B 4G8GE 3KJ4B 3S0PA 3WS3A 4FG6C 3K46A 5AKVA 1JK9B 2APSA 2VH5L 4WI5A 1DJYA 1GKOA 1JZEA 3OV6A 4QDGA 2ZCHL 3L71D 2AK4B 4G6FB 2UWEE 5DZ9A 2DOCA 4WWID 1QLRB 3VXOA 4GLRI 3MKKA 3R4DA 2R69H 3WMQA 2LTQC 4DQOL 2QADD 1CT8B 4NQSA 5CD5D 3KPMA 5D4JA 5DHVA 3I6KB 1GGYA 3G5VB 2V2XB 3GSWA 4R4FL 1EXGA 3RWJA 1SGKA 5C0CD 3C8HA 3LV3A 4C4UA 3K2UH 2W9LA 4RGMB 3CDCA 4A66A 3HMWL 5EDSA 3PIQB 5GRWA 2X4UB 3AADB 1IM9A 2Y6SD 3F8UB 4K15A 4WK4B 5FYKH 3BZ4A 5GJSL 5EO1A 2EP6A 3LQMA 1NGWB 1MIMH 4N2GA 2IXQB 4RRPA 5I30L 3O2DA 3RPBA 4EIDA 1JIBA 4JDEB 1TJIH 2NY6C 1NCDH 1KENH 3GJFK 3TBVB 4MB5A 1FF5A 1GL4B 4XYDB 4P57B 1YJDC 3ESOA 3L54A 3H0TB 4N28A 1X4YA 3UFIA 5CJOL 3ZTDC 1D5MB 1AGBB 2P5EE 2TSBA 4U7SA 5ABZA 3UJTH 5AKSA 4UT9A 1Z9MA 5EC2A 2DQTL 3DOSB 2Q76B 1R3KA 2XVKA 1DIIC 5IBTL 3SPVB 3CVIH 1KV7A 1ZTMA 4Q9RH 1CF1A 4U6HB 3IBOA 5IB2A 2RQ8A 2R1WA 3SDXB 2DBJA 4AXWB 1G6VK 1UA3A 3BIBX 5EBWB 3SPJA 2X0UA 4UM9A 3G6JF 2KUTA 1CFBA 5K93A 3DHJA 1Q0YH 3X17A 3KLHD 3FUDA 4ONHB 2J55A 5ELIA 2Z7YA 2Q2EB 3T4YB 1GQ1A 3WIFA 4YLBA 2LAAA 5GZOD 2WNXA 3BQUC 1MCPH 4WUKH 5EHFA 2FT8A 7PCYA 1XVSA 3HI6H 2ADGA 2W65B 5K9OB 5KSAA 1RL1A 2FCBA 2W95A 3T6WA 4OKVA 1IC4H 4RGNE 2IWKA 3WFEH 4HA1A 4CUCA 1I8KB 4YDJA 4IRJC 2IDSA 2X88A 3DJ9A 1SMDA 3GZOA 4GG8A 5IVXE 1I4FB 4M6AA 2EXVA 2X6MA 2BSSA 1WGOA 5ANHA 1JXKA 4G9FE 5E56A 3RY6C 3WG7B 1XGYH 4YE0A 4HFUL 3V6ZB 4ZFOA 1F58L 1QYGL 3HAEB 3ZIMA 3FTZA 5B39A 3U30B 3U6RA 5L4JA 2OMYA 3VFTB 4J2XA 5CNHA 3F6JA 4RMBA 4OV5B 2PPCA 1G1CA 2JB5L 2E46A 4LEOA 4M6MH 3MMEB 4NQCB 3JWNG 4ZTPL 1FRGH 4U7MA 4O4YH 1TPXC 3PV6B 3TYIA 3U2IA 4YHIB 2PO6A 2N59A 4IK6A 2GJPA 3SJLA 1RKRA 3GF8A 5CHNB 3WFCL 1BM3H 4X6CB 2F54B 2OMTB 3ZZQA 1MEXH 2J8OA 2QSTA 3NZ8B 1M9SA 3UH8A 2Y7MA 4G5AA 4PV9A 1PLBA 1T89A 3C60B 1FG2A 3QQNA 4OBRA 2R4SL 3LNGA 4PYHA 4PBXA 4M5TA 1DBBL 5IUSA 5ESAA 4MA1B 3R06A 2OI9C 4I1PA 2VM9A 2NY3C 3AG2B 1IBDA 2PTVA 1CVSC 4WGKA 3K5SA 4ONGH 3KJ4C 2XRAL 1KJ3L 2GJ6B 4P4RB 1YQVH 1BGXH 3CFIC 2WBJA 5DJ0B 1JGDB 4UOJA 2HJFB 1YDPA 3NACH 1KBPA 2P52A 4QO1A 4LLQB 4IJ3C 2BXZA 4EI5B 3ARDC 5A3IC 4I0CC 4K7PY 5CJXC 4ESKA 1V54B 2X38A 5JHDA 1OCRB 1HHHA 4GUPA 1J9RA 5D96C 1BMZA 3KCPA 4CSZA 3D52A 1WLHA 3MV9B 1KBGL 4G8AC 4MZ2A 4PVNA 2BOBB 4DETA 3Q2WA 4BDVA 1KULA 2VR6A 4M48H 3LNHA 4HK3N 2X12A 1E28B 4IK7A 3MV8D 4K5OA 2HWZL 1M6OB 2C1PA 2A99A 4KNQA 4BQCA 4M5YH 3NCXA 3OKOB 5I1LB 3F5WA 1SN2A 3KLSA 1YC7A 5C0CE 1NTMD 1KYOW 5DU7A 4YUEH 2MEJB 3CSFA 4HJSA 4R7DA 2WANA 4EPSA 5F7DA 2C7FA 1Y1DA 4AENA 2CUAA 3JWNC 1OB0A 2B3RA 3MLZH 1ZAGA 4OZFH 4R7LA 4GKSB 1T1XA 1BA9A 2COVD 4FXKA 4MS8D 4QXUH 1NCOA 1DUZB 3DOIA 3GPSA 1I7UB 3C2CA 3P4OB 1A6UL 1MVUB 3AY4A 4RGOH 5G4MA 3CLWA 3UO8B 1OP3K 5EIIG 3L4XA 3D05A 4JJ5B 5TF1L 4KJPC 3ARFB 3V5DB 4UTCA 4OLZH 3E9UA 3QXAA 3VFWB 4WKZB 2WLIB 3PJNA 1FNGA 1MHHA 3LRHA 3RFRA 3NN8A 2GABA 3KWWB 2DWEA 4UQ2B 5DD6B 3EYUL 1NWPA 1ACXA 4GS7B 4X9IA 3KZ8A 2R1YB 4UU9A 2B20A 3QPQD 2VH5H 3FT9A 4NYLB 2NXYD 3L9RA 1HXKA 1TIUA 3FSOA 4WTXA 4JRFA 4HG4J 3GD1C 2ZCHH 35C8L 1DJXA 2K9UA 2YLKA 3SDDB 3WTYA 2Q5BA 3F7PC 4NZFA 2CKBB 4DQOH 2Q20A 1Z6JT 2C8NA 4RIRB 3U1PA 2BERA 4R4FH 1CI5A 1NGZB 1DJWA 4Y2OB 3QI9A 1E4WL 1M57B 4HVBA 1AD0B 2KKQA 3GXFA 3MA9L 1BBDL 5FCUL 3BMWA 3HMWH 4RMTA 4U1MA 2EDMA 5A16A 3AREA 1U8HA 5I6XB 4GP8B 3Q2CA 4YNYA 2W5PA 3V0AC 1FJ0A 5BV7L 3F85A 3TCTA 5GJSH 4F7CB 1HHIA 4NCDA 3KD4A 5HDOA 5I30H 1T22A 1P7KB 3NJGA 5HYJA 2CA3A 4M29A 1RERA 1WWWX 4K3GA 3K5RA 2L4DA 2VERA 3B9DA 3RWDB 3LZQA 4NUPA 5CJOH 2YA2A 4MX7B 3UBXB 1WZKA 3SXTA 3C6SA 4JFOA 2P5WB 4TTDD 5GGRA 3FNKA 3O3AA 3QDMD 1I1AC 3QJHB 2DQTH 1N90A 5B38G 2CPUA 1UM6L 1QW9A 3AACA 3H54A 1CK0L 3FZUD 1HJ5A 3N3EA 5D1XA 5G5DB 5IBTH 2WLMA 3BVVA 1T5KA 2EEFA 2FQGA 3SBWC 3D48R 2P43B 4JM2C 3TV3L 2BWQA 1IEAA 4QRQB 5TK2A 4Y1SA 5AOKA 1FFRA 3VRDA 4BINA 5EOTA 3NK4A 3NFSL 1HZKA 3LXBA 3RNQA 1KGXA 1UT2A 3WD5L 3A6OA 5D5MF 3MJ7A 3CZLA 4XNZB 1BFVL 4CAGA 1IVTA 3FH5A 4FFTA 1M1SA 1OWWA 2NYYC 4I88A 4YHPB 3CFKA 3EFOA 2CXBA 4C56B 4FFZA 3STLA 4U6XB 5D1ZC 3TBYB 4EVNB 4QXTB 1R75A 4PJAE 1ZS2A 3V9FA 4YFEA 2ZUUA 2QFRA 2QQNL 2P46B 4PJIB 5GGVY 3SDCA 4Z5RB 2XTSB 5D7JB 3ULVL 3GMOB 4NUJA 1O75A 2FWLB 3BT2L 4QRFA 5IOKA 3S2CA 1QX1A 3FULA 5CIDB 1N59A 3O2VL 3MJ6A 5A2JH 3FTYA 3ARGA 3KYOB 1BVNP 3QORC 4BZ1A 4APQA 4GEJA 2OR7A 4XN8A 2JIXA 1GRWA 4B50A 1N2RB 2PPAA 3ZKND 4K55A 1NC2A 4HFUH 2EIZB 4DFIA 4LVNC 1F58H 1BMGA 1QYGH 2BVUA 3D2UA 4Y4FD 3BX7C 3QA3B 5J3HD 1QG3A 5F9AC 2G4EA 2E6JA 4AV5A 2JB5H 4ZTPH 3MV8E 2QKIA 2R59A 4YFLF 2BW5A 2ZXGA 4U0RC 3NFNB 2O5XL 5BZXA 2C3HA 5J1AA 4NAQA 3FTGB 1PJ9A 1OK8A 5CR8A 3WFCH 4JCLA 1OQOA 1GA2A 1WUZA 2DYPA 1U8NA 4PJ8A 4MXQD 4Q6YA 1N0LB 5DD5L 3HCVB 4YN3A 5CF3A 1W6LA 2EICA 2YD0A 3GSVB 2K4AA 3L3GB 2HRPL 3SKUD 2ICCA 4AGPA 3TZVC 4JZOB 2XKNB 2XXMB 2R4SH 4TNEA 3RUGE 1WE5A 1RLBA 1B0RA 2CBTA 1DBBH 4FCHA 1P69B 4NHCL 4BBWA 5DQ9B 4IIQB 1KTJA 2X4QA 2DIBA 2AQ1A 1R24B 4TLSA 5AVVB 1GZQA 3TC9A 1F3JB 1JV2B 3X1GA 3FSVA 4X6DB 4KOBA 2XRAH 3KBPA 1KJ3H 1C1EL 2H8PB 4O2FA 1S7WA 3GSNA 4MASA 4FJYA 4AL8L 1DVZA 4R4BB 2I69A 5GSRB 1YTCA 1ASOA 5CWSB 1A8JH 4P46C 1JG9A 2ITCB 5T1KA 4F8LA 3HVDA 2MNUA 3OKNA 4DEWA 1XCWA 3BGFB 2YWYA 1L7TL 3DRQB 4M02A 1J5CA 1FL6B 5D1QB 3QSKB 4TNGA 1FZMB 2H32A 4W4OA 3BH8A 3F6IA 1KBGH 3HN5A 1BQUA 2R56L 2VZ1A 1KXTA 4BHUI 4J3XA 5E00B 5HDBB 1BGYD 3KPLA 2EDHA 1NANH 3HZKA 4PJEB 1PZAA 1WTGT 5CINL 5DS2A 2HWZH 3SQBA 5T1LD 5K33A 3NSYA 1A1OA 1HEZA 1M2VB 2Z65C 4A2GA 1SQMA 3V0GA 3T04D 2FJHA 1ZA3A 1ZANL 3T8XB 2NXZD 4HIHA 4CRPA 5I1AA 2FYYA 4EDXB 3DUHA 5KVEE 4KU1A 3FQTB 5EBLA 1C12B 5SX5K 5ID0A 3QARA 2GTZB 1OWRM 3OKDA 4HF5L 3MV7A 5HHPA 2WLHA 1YEAA 3A22A 3QUKA 4Z7VA 3BP4A 3QEQD 2XQBL 4FC3E 4WSGA 3WBDA 2EUVA 4X80L 1DQTA 1H0DB 1M42A 4RMWA 4PJBA 1HH7A 5CGTA 4QJ4B 2V5SA 1TZHB 3VXMD 3GLEA 5EZPA 1FH2A 4MMZB 5IZ7A 1G6RL 1A6UH 4OCXL 4ENZA 4MCNA 3T08A 1M1XA 1X5IA 1I82A 4KUCD 5C0DA 1U74B 2GIWA 3MLWL 5TD4A 3QDME 4AANA 2P3YA 1T6VN 4UNVA 1SJXA 4CU8A 4DPRA 1X5HA 4L3CA 3RBSA 2VDOL 4AMWA 3EYUH 4WWOA 3SO5A 1GS7A 1KZQA 2J12B 3RZCA 4WI2A 3QEUB 1OLZA 4FQXA 4OJDH 4QTHB 4WNJA 4AKPA 2ZJSL 1K4DB 2VXQA 2VL5B 3N1GC 1Q9OA 4PJ9B 2E6QA 4UT7L 3PHOB 5J6GB 4K94L 3C6LB 1CF8L 2HJKA 5C9JB 1UXWA 5AL8A 4LNRB 5DEGB 1QL3A 3H7BA 4KKAC 4O02B 5ESQB 5IF0A 4DH2A 4JANB 4PGDB 4MZ3A 1P5VA 1E4WH 2YAMA 4PJFA 1DVUA 2L04A 4CVUA 3MA9H 5FCUH 1BBDH 4D2NA 1KLUA 5E94B 2YAQA 4Z95L 3QWNA 5BV7H 4XBEL 4P5KA 4PH8A 1W0WA 2BFVL 3GMQA 4P49A 5F7FA 5FGBC 4BXVA 1BW8A 2CO6A 5DRZA 5IM7A 1AC0A 4L4JA 2R7EB 2XXGA 1IL1A 3FUMA 2YOAA 1XGUB 1RZFL 1EHLL 3ZO0A 2JFCA 2W9EL 5KUKA 4F80A 1QBML 3OJDB 5C0EB 5HYEA 3H2PA 2EDJA 3CDZB 5IB3B 2B08A 2A74A 2WO4A 1UM6H 5L0QB 5DO2C 1CK0H 3GRBA 1T20A 4BQ8A 4R7VA 4H26A 2HUHA 2X44D 1BD2D 5EEUA 1YUHA 5DK0A 3RP1A 5BXFA 4JHUA 1NUDA 4A68A 4L37A 4JFYA 1D5RA 3TV3H 4X4MA 1G0XA 3B2MA 4RGNB 4P2QA 4Y2DB 3Q8BA 5CJQL 3HQ7A 2VRKA 3S96B 3QJZA 4IIQC 2J43A 3GSQA 2DMKA 1ZE3H 3NFSH 4BFEA 2ZXAA 5JYLA 1X5LA 3WD5H 3BQUD 4IL6V 5C07A 2VW6A 5K9KA 2E76C 1BFVH 3ISWA 1L9TA 1CXKA 3VWKD 1RK0A 4P3DA 4PJHF 3FJTA 4X5QA 3ARWA 3DXAA 1HL9A 4AVKA 4M62L 2B11B 2B7DT 4ZAKB 2C1UA 1XD1A 4H0HB 3RDTD 3NCFB 1MWAA 2W60A 2I9LB 3VGAC 2EADA 3A0BV 4IRJD 2QQNH 3BGFC 4XO5A 4ZUTA 1FLTX 2JCCE 2ZCLL 4QHNA 3VWJC 1E2ZA 3NH7L 3ZL2A 3U4EA 5IWLC 3ULVH 4YLCA 1HH9A 3BT2H 3CFDB 4Z7UB 4FLRA 5IK3B 3W3BA 3O2VH 1A6VL 1XZWA 2ZX6A 4ONFL 1WFJA 4D0DB 1VLXA 3G3LA 4JFZL 3N44B 3TO4B 1OAKL 3GS7A 4DFHA 4R0LC 2Z8WC 1WZMA 1EO5A 4BWUA 1WFTA 3LQAC 1FO0B 4MJIA 4OFKA 5CGYC 5FHBL 2OYKA 2HT4D 2FO4A 4POYA 1I3RB 2XLLA 4MQ7B 3AGWA 4JFDB 1TU2B 3FHEA 3FO0L 2PYED 1HYRC 1E2RA 1CD1B 2J5WA 1EJOL 2V7NA 4ZOAA 3GMLB 2NT0A 2O5XH 1KTDB 3EJZC 1NU1D 1K4CB 3BIKB 4YDVA 4LSSL 1KB9D 4OZGF 4Q0XH 2H0EA 4F7MB 2MHMA 1TYJA 2ZOKB 3V4VA 3ELAT 4X7TB 5KN5A 5DD5H 3ULUF 2NTFA 5GHWL 2WUCL 1VFAA 5SWSB 5A2IH 4DEUA 3WFDC 5BRZB 5HDQL 2HRPH 4NLAA 4Y1TA 3ZT7A 3A4DA 2HFTA 1HWGB 4TVUA 3DK0A 3FTWA 3QEQE 2DVHA 1LWHA 1PJWA 4NHCH 4Y16C 5D7IF 4WV1C 3PWPA 2ZNXA 2E9BA 2FT6A 3DIVA 3GO1L 3VXME 5KVDE 2I07B 5H35A 3ARDD 3IT8D 4K9EC 5C0ND 1C1EH 5A3ID 3ZZ1A 1Q0EA 4RAUB 3VRIB 3FRUA 2PXYA 5C0GB 4AL8H 3O20A 5DD0L 3CU4A 4I87A 4NQED 2BCMA 5I6LA 1VKXA 4IIZA 4HZ1A 4GG6F 3O41A 4K07A 3WUZA 1IJ9A 3ROOB 2ZE0A 4G6ML 1U42A 2XWTA 4WFFD 1NINA 1L7TH 1BE3D 4HCIA 2QBWA 4N2BA 1GGIL 3QRGL 1IZJA 1GGTA 4KMTL 3K0YA 5GS0L 3UTTD 4DP7X 1LLAA 4OAWB 2AC0A 1XR8B 2R56H 2DQCL 4HKZB 2ICEB 3UAEA 3GLAA 4POUB 3AQYA 2WLKA 5IJCC 3ARTA 5CINH 2IIJA 4ANKA 3HS8A 5FR3A 2OP4H 3CBRA 1E50A 3PGCB 1HROA 1G7LA 4MYPA 4F91B 2V7HA 1OT1A 1E3ZA 2L7UA 2VDQL 4JPKL 1L4IA 1G7HB 1TVDA 4LMQI 1J05B 3V0HA 3EFFB 4BUQA 4XH2A 1ZANH 2BX5A 5I6MA 5HYSB 1T1WA 4F37F 2FDBP 1IGML 2CNZA 4FA8A 3CX5J 1IFHL 2EIEA 1J0JA 3FOLB 4L3EA 5AW0B 3CTTA 4HF5H 1U92B 4ERSL 5EFIB 1KV3A 2FYVA 4X80H 3BDYL 1ACCA 5EU5A 4F33B 4KJPD 1MOEA 5JMOC 3NAAL 3UG5A 1JK9A 3VD5A 1T6WA 5L0QC 1KXVA 1CFQB 4MJ6B 4KUZL 5IVZB 1G6RH 1U2HA 4OCXH 3VB9A 4CSTA 4ZFFB 1N6QL 1Z9OA 1ETPA 3GZPA 2AK4A 5L8KB 5DVNA 1KIRB 4WWNA 3MLWH 4DGVL 1QLRA 4N0YL 4B9JA 1CT8A 1L9RA 3VI3F 3I6KA 3PHSA 4GIAA 4ZX4A 4IRSB 3G5VA 3JBTB 2V2XA 1MCQA 2VDOH 1BD2E 3AJ7A 3L3JB 1AR2A 2N9JA 1H9DA 3SD5A 3EHBB 2A6KB 5JXED 4OIBA 2ZJSH 1DVFC 1P9MC 1RAPA 5FUCC 3OM3B 3QZPA 2UY6B 2AQTA 2GUOB 1G94A 3PIQA 1WIOA 2X4UA 3CVBA 1NICA 4UT7H 4K94H 3V5KB 4YLQT 2YIUB 1CF8H 5JLZB 1DHKA 1NGWA 2PPDA 3C09B 2IXQA 3HS0C 2VE6A 3K80A 4OZHB 2AJSL 1SDDB 2E7LA 3L5WB 1WSST 2QPFA 4MDJA 4JDEA 4BH7B 4A1RA 3TBVA 3KYNB 4P57A 3ULVF 5D2NB 4DUWA 1PD0A 3H0TA 5DURD 1QFPA 3U1SH 3OF6A 3HQ8A 2AANA 1D5MA 1H6FA 1AGBA 1WWCA 4Z95H 4JHAL 4XBEH 2Z7WA 2WQWA 1NDGB 2BFVH 4MA3B 4O1WA 3DOSA 3VMPA 2Q76A 1CD0A 4P4QB 4QTIL 3CPUA 4HWNA 1BREA 1RZFH 1EHLH 4NRXB 1J1PL 3SPVA 1I1AD 4NKMB 2DH2A 2W9EH 3B4NA 4U6HA 1CIDA 1HHKA 2NY5C 3SDXA 5IFAL 1QBMH 1R3JB 3ZYOA 4AXWA 2VZSA 1HHJA 4MCMA 5EBWA 3LHPL 3EUDA 3K4DA 1AYOA 4JM2D 4WI0B 2Z35B 2PYEE 1W8NA 1BDYA 3EJRA 4U1GC 451CA 4YHYB 4ONHA 4PJAB 5TQ0L 3RA7L 3T4YA 4LK4A 5TDOB 2PCYA 1SQVD 5AQ0A 4A55A 3I9GL 3NZHL 5D7KD 1NAMB 3OHXB 5CJQH 5L6YL 4PD4D 1GW6A 2NYYD 1FJ1B 4LCVA 4N9GB 3A6CL 4NKDB 5K9OA 1VEMA 2W65A 1NOFA 5D93B 1A4JB 5I16B 5D1ZD 1JZ5A 2VM4A 4CN4A 2BOLA 1I8KA 4N0FB 3CX5W 2WGXA 5JORB 3BN3B 4M7LL 1I4FA 4M62H 3U4BL 4XP9L 3L16A 2E74C 1PLAA 4RMQA 4CSPA 1GYVA 1H3WM 3V6ZA 3G6DL 3NH7H 3QORD 3HAEA 4Z6AT 1LC1A 5GXBB 4OV5A 4NQEE 4NQCA 2BCNB 1A6VH 1DQML 4ONFH 3PV6A 2DAVA 4V2CB 4WFFE 4JFZH 1OAKH 5CHNA 2BPBB 4X6CA 2F54A 4NP4L 3UTTE 2OMTA 4TV3A 5J89A 4TUOB 5FHBH 4ZXBB 3LXUX 5E7FA 43CAB 3OMNB 1CLYL 3NZ8A 2XYBA 3FO0H 1DJIA 3C60A 3SGEH 1EJOH 1VFBB 2WYTA 4LSSH 1YCSA 1WDAA 5K59E 3NT0A 2ESVD 4M9PA 3TZVD 3LCYA 5IREA 2X53A 1NMIA 1KBWA 3JWNE 1XIWC 5LAXB 3TJEL 2ARJQ 4X5WB 5GHWH 2WUCH 1D7DA 2GJ6A 4P4RA 1TTAA 3TPUB 5HDQH 1LEIB 1PFOA 3FO9B 2CLRB 4QEGA 4NKQB 5DJ0A 2BXYA 1JGDA 4N1HB 2HJFA 3RWCB 4NJ9L 4XN9A 4LLQA 4E36A 2I26N 2NY1D 1RJLB 4EI5A 1A64A 3JWDC 4ODSL 4EJ1C 2EUXA 1W8OA 2WJ5A 3GO1H 3QXVA 4MKMA 2G60L 4KV5E 1NSNL 5AW3B 4CDHA 3WTSA 155CA 1QUPA 3MV9A 2BOBA 1KJ2H 1EDQA 3LRSB 3ENEA 5DD0H 1MFAL 2WLJA 1E28A 2XZQL 3W2DL 2J25A 4N0CC 3IF1B 1M6OA 4S0SD 1YEWA 2XWDA 4QRRD 5L8LB 4G6MH 5E1QA 1INEH 3OKOA 3H2WA 5MEND 4BQBA 1AO7B 3GTNA 1GGIH 3QRGH 5I1LA 5IOPB 4KMTH 1JUFB 2NNAB 5GS0H 1S7XB 2VLRB 2AXJA 2K45A 3D8MA 2WXIA 3EJUA 1QFHA 3K71B 4ICWA 2DQCH 5E0FA 3VXSD 1HS6A 4DPCX 1HJ4A 4OI9A 4X6FA 1LM8V 1ES0B 2VDQH 1ZHNB 4JPKH 4P48A 4GKSA 4PS8A 1L5GB 1A22B 4DW2L 1DUZA 1RLWA 2BY0A 1I7UA 2ED8A 2Z92B 3P4OA 4ETQB 1MVUA 2GVYA 2YC1B 2YGOA 2F53D 1IGMH 5F0PB 4JJ5A 1IFHH 3ULAB 3ARFA 1MFBL 2VWEC 3V5DA 3P2TA 1GC1L 1YY9C 4HX1B 3VFWA 4WKZA 2WLIA 4ERSH 5FFOA 1HNGA 3BDYH 3KWWA 4L2YA 4UQ2A 1NTKD 1G9ML 4G1MB 5DD6A 4HFWB 3NAAH 2R1YA 3VO0A 2J1ZA 4NYLA 3PUUA 1R19A 1TNNA 3FN0L 4KUZH 4UB0L 1N6QH 2EDLA 4PGBB 5E2UL 5AOMA 1RUAL 2HT3C 1C2RA 1WITA 1J3SA 1LP9F 5ALCL 2O1AA 3SDDA 3DOHA 4DGVH 4N0YH 4ZMOA 3OHXC 2CKBA 1WWAX 4HUCA 2Y5QA 4PRHD 1WZLA 3ATBA 4RIRA 5A6MA 1YG9A 3RJDA 3P02A 4HEMA 3BD4A 2QVKA 1GZPB 3BAIA 1NGZA 4GAYB 2COQA 1AD0A 1JGVL 3FU9A 4JL1A 4HSAC 4LDEB 5D7KE 1FYHB 4LOEA 1EA9C 5J9PB 2OSXA 4ZMAT 4F7CA 3CK0L 3SZKC 3WJMB 4HBQA 3EO0B 1P7KA 1P6WA 2AJSH 3HBQA 5KJ4A 5ISZD 3M7FB 4B3EA 2H47C 3BLKA 5FM5M 4FHJA 3RWDA 4Y4FB 2J8HA 4MX7A 3UBXA 1JAEA 2Z7ZA 1L6PA 2ERJB 4WK0B 3TIDA 4EUPB 2P5WA 1YMMB 4OGQC 4GKLA 4JHAH 1H5BB 4Q5PA 2WSPA 4S10A 4Q89A 1KYUA 3QJHA 4OW6A 2JI1A 2MMXA 2P24B 2BCKB 3AZUA 4LAQL 4ZXBC 3X3FL 4QTIH 1QSZA 4KTEL 5G5DA 2Y06L 4JKNA 4MA7L 3OXSB 2HLEB 2AEQL 5MHSD 2ZOLB 3IEAA 2LITA 1KX7A 2VZUA 4NNYB 4QRQA 5DO2D 4BWWA 5IFAH 1URIA 2ED9A 2PW2B 2J2ZB 3S5LB 3TU6A 1ZPUA 2JVUA 4L3HA 3J2PA 5AW8B 3LHPH 2IDFA 1SOQA 4Y5YB 1NM9A 4IQHA 4HC1A 1OW0C 1NFDE 3EXLA 1P4LB 4TNFA 4X8GA 5TQ0H 4YSRA 4YHPA 3P0GB 3P0YL 4PJXF 3MRFB 4C56A 5DZPA 2ESVE 3MRJB 1T7ZA 1ZV5A 2Z4QB 1L9BC 2JLLA 4U6XA 3I9GH 3NZHH 4QXTA 4MNHA 5L6YH 1HIML 1CIGA 2B0SL 5EU7E 3A6CH 3VXPB 5CCGE 4PJIA 1R0QA 5D7LB 4Z5RA 2XTSA 1KDIA 5D7JA 3GMOA 3ZQ9A 2FWLA 4KZCA 3MX0B 2VJ8A 3WFCC 1LMKA 4LGRB 2FL5B 4K8RD 4C83B 5GRVL 3VWJD 3KYOA 4M7LH 3U4BH 4OGYL 1XHHA 5CCHE 3QQ9D 4XP9H 3WENA 3WO3B 1U8QB 1N2RA 4RBPH 3PXJA 5HGDB 1NPJA 3NJMA 2EIZA 3G6DH 2DLIA 3VYOA 1RK1B 1AOHA 1FE8L 1A7OL 3SGDH 1F3DJ 3QA3A 3CWBD 3BVWA 3TS8A 1F4WL 4OQTA 1LO4L 4KNSA 3JZYA 2YGVA 1DQMH 1BVZA 3NFNA 4QRRE 2HYMA 5ADOL 3WEAA 1PL3A 3FTGA 4FEMA 5MENE 4FJ6A 3MC0A 1N8OE 1RP9A 1EEZB 3DI3B 3QG6B 2WOBA 4NP4H 1N0LA 3HCVA 3C8DA 3LAFA 4JZJB 3SKJL 3GSVA 3CIQA 4NUGL 1BXUA 1CLYH 3DX2A 3L3GA 1KJMB 2Y3NA 3HJEA 4WRLA 3VXSE 4PUBL 3I9IA 4JZOA 2IGTA 1WBYB 4RSZA 2EUWA 1IVLA 3AB0B 2BVOB 4RCAA 1IEHA 1R4XA 4NPYB 5DQ9A 3DJSA 2AQSA 1R24A 4WFED 5HJ3B 2YMXL 2EH7L 4KH2A 5IROC 4UB6V 1F3JA 2WKGA 1JV2A 1XZ0B 3TJEH 4X6DA 1B3JA 3OKYA 2F53E 3AMLA 3B5GA 2H8PA 5I1IL 4PIRF 4AQOA 2Q9OA 5IMLB 3HNVL 4R4BA 1PZUB 4LLWB 5GSRA 3TA4D 2CHWA 3NRPA 4NJ9H 5CWSA 1CRJA 5JPMB 4Y5VB 1JYNA 2ITCA 3R8BB 2W07B 4BK5A 3DRQA 4ODSH 1MFMA 1IRVA 4YZFF 5CSBA 1FL6A 5D1QA 4CILA 2G60H 1FZMA 1NSNH 3TVMC 1R1CA 3P54A 4MAUH 4KX9A 1M6ZA 4YHLL 1F42A 4JFQB 2MWCA 1J87A 4LIQE 2C9UA 5E00A 2RR3A 1MFAH 1NBVL 4PJEA 2XZQH 2MKLC 4PRHE 5FS5A 3W2DH 3ZHLA 4JY6B 4GBXC 1M2VA 1BWMA 3TA3C 2Z7UA 4O51B 2IH1B 1DBAL 1WAAF 3DVFA 4EDXA 3B8SA 4PJGB 4ZS7L 1SEQL 3FQTA 4JMXA 2YXMA 5IQ7L 4OF6A 3MRCB 4FMVA 1C12A 1BFOB 2GTZA 4G8GA 1SY6L 4U3FD 1RY7B 3VSQA 4CADB 4D7BA 3BHBB 5KSBE 5CBEB 5ISZE 4JVWA 3ETTA 1H0DA 2FEDC 1GY1A 5BZDB 1TZHA 3KR3L 3VD4A 1VCBC 5GGQL 3T3PB 3EOYG 4ANXA 4DW2H 1QTPA 4R97B 4MMZA 1MW1A 4HS8L 4M9OA 3DYPA 2CR6A 2XWRA 1MFBH 4HJ0C 1GC1H 1UUNA 5HD8C 3X39A 1AQDB 4OBSA 1G9MH 3SYCA 4KITB 2PCFB 2CE0A 5EU6B 3CVHL 4CC0A 1FAIL 3QEUA 4QTHA 5MHSE 5E24E 2PWDA 4N8VB 4UB0H 3D09A 1K4DA 3FN0H 2JQZA 2D7PA 5E2UH 2VL5A 5ALBL 5DUML 1RUAH 4PJ9A 1A8CA 5ALCH 3PHOA 5F7UA 3VWKB 5J6GA 3C6LA 5C9JA 4BD4A 2QSQA 5M7QA 3LN4B 1YN7A 3U0WL 1DVFD 4LNRA 4O02A 5DEGA 5ESQA 3QDJD 4JANA 4PGDA 4PG9B 3RDTB 2WSKA 1BLIA 2BP3A 2NDGA 4YFDB 3ILDA 1JGVH 4PCYA 2W92A 3ZHFA 5EUOB 5CIGB 2FSEB 5E94A 3PE9A 2APBA 5IW6B 4QNPF 3CK0H 2DQJL 1KXQA 4Z7OF 3GZKA 3EBIA 2R7EA 2VDML 3FU3A 3ASNB 1KB5L 1XGUA 4A7VA 2PACA 1D9KD 3G6JE 2A6JB 4ZUVB 1J1XL 3KM2A 4AK1A 2V33A 3OJDA 5C0EA 4H4NA 4FTDA 4NX0A 5IHHA 3CDZA 5ICXB 5IB3A 1ZGLB 3HZMB 1UJ3B 4XPAL 5EB9A 3RTQB 4LAQH 2Y0SA 4HUXB 3X3FH 4YGVB 1OGAB 3JT2A 4BFFA 3AXIA 3JWOL 3KS0J 4KRPC 2Y06H 2DV6A 3L48A 4KTEH 2NY0C 5JQ6L 4P23C 1A9EB 5J13C 5D6DC 4MA7H 3BISA 2QZ5A 3FCTB 2AEQH 2O6DA 2PCPB 2H9GA 3OMZA 1Z9NA 4HIXL 5C0BB 4LOFA 1EDYA 2VQTA 3D0WA 4W68A 4Y2DA 5D2LB 1HNYA 3S96A 5CN3A 5E6ZA 3FXIC 3EO9L 4FI6A 4BQ9A 3PWJB 1T7XA 3GXPA 4KNTA 2ZD0A 5BPPA 1E8ZA 3KYMB 5IVXA 4KMLB 1NLBL 3TEUA 2YD5A 4WI7A 3SCMC 3JVGC 4G9FA 3WHXB 4BRVA 3P0YH 3IJHB 3KS0H 3CXHJ 3D87B 1LFMA 4FG4A 4PSPA 4WFEE 5DMGD 4ZAKA 2L8AA 5E9NA 1HIMH 2I9LA 2B0SH 4P5RA 2Q87A 2A6DB 2KDGA 1B4RA 2R1XB 1UKSA 3QQ3B 1KFGA 1OP4A 2VDNL 5B21A 3CFDA 4Z7UA 5CKAA 5IK3A 4BHUA 1MFEL 1REIA 5IFJB 4D0DA 3SODB 3HUJB 3WTWA 4DP2X 3IRCA 2OFQA 3TO4A 4OGYH 1HXYB 2ATAA 4UV7L 4FF9A 1Q1JL 3M97X 1FO0A 2QV2A 4I3RL 1FE8H 1A7OH 2JKRM 5JXAL 1I3RA 4MQ7A 5A2FA 4B97A 2WXFA 2Z3FA 4JFDA 1F4WH 3UAFA 1JZJA 1TU2A 3WNLA 5EF2A 1LO4H 1CD1A 4ANWA 2BNRB 1KJVB 1QA9B 2FATL 3GMLA 4HGWB 1KTDA 1K4CA 3BIKA 3WEOA 1X5AA 1CYJA 5AVUB 3TM6A 4AL8C 4F7MA 4GAJL 4CL7A 2YPVA 2ZOKA 4X7TA 4JFFB 5CJBA 1A7PL 3SKJH 4XPHL 4NUGH 4JX0A 5BRZA 5SWSA 4OIAA 4PUBH 2HKAA 1XIWD 5EG6C 5IVOA 3MRRB 3VDCA 5CS7A 1DBML 2EH7H 2YMXH 3NVQA 2I07A 2H2SC 3G5XB 2VISB 4K7PL 4M8QB 5DRWB 4GUQA 4KK5C 5I1IH 3WU2V 3SE3C 2KZ1B 4RAUA 3PL6B 5F9DC 4ACPA 3VRIA 5C0GA 5L4MA 3PABB 1MCEA 3HNVH 3UACA 3P3YA 1LO0L 5E99L 5EORL 3SDAC 3ARBD 3VTMA 3ROOA 4D7PA 5KVGL 2KH2B 3FO2B 1BMWA 4U31A 1T7VA 2CA4B 4TVPL 3SBQA 5B8CB 3WSQL 3I50L 4OAWA 1HZHL 2D3JA 3EF4A 1XR8A 4YHLH 3EH2A 2I8FA 4PGCB 4HKZA 2ICEA 1HEHC 2VR7A 3VFOB 4AIOA 1C52A 3CFMA 1NBVH 5CJ8A 4ORGB 3KVPA 3OR6B 2DN7A 2OW7A 5FUCE 3PGCA 5DURB 3QDJE 2CSPA 4J8RB 1CCZA 3AAZB 3QIUB 4QRUB 1G7HA 1TKWB 3NG5A 3QRBA 1J05A 3R1GL 3EFFA 1DBAH 4MJHA 4JDVB 3DJRA 5HYSA 3TFBA 4ZS7H 4GRLC 1SEQH 4H7VA 5IQ7H 2HB0A 4UBDC 5CM1A 2WVTA 2ZWLT 3FOLA 3LZFL 5A2KH 1U92A 1COBA 2M26A 1SY6H 3ZE1B 3RWGB 4FFYA 2VCOA 1QNIA 1M60A 5EFIA 3TN0D 1ROCA 1TNMA 3QFDB 4UQ9A 4F33A 1YY9D 3RTQC 4RNRB 1RIHL 5GGQH 3BP6B 1CFQA 2F7OA 4MJ6A 3LIZL 5IVZA 4ZFFA 4HS8H 4LSPL 5AVWB 1FI3A 4L29B 1NNOA 3CN2A 3KWTA 1KIRA 4FKKA 4I18B 3ILQC 1JWSB 2EO1A 2NNCA 5F1NB 1T04B 4IRSA 2HT3D 4B9FA 1P4BL 2DQMA 3L3JA 2H1LM 3CVHH 5JHBA 1FAIH 4K3IA 2A6KA 3PLYA 2CGZA 4FNRA 5FA4B 4Q8BA 1TEFA 5ALBH 5DUMH 1JI1A 2UY6A 1B7VA 2GUOA 1LO2L 2V07A 3V5KA 1DZ0A 2NX5B 4IGBD 5JLZA 2DLFL 4NSKB 3RI5K 1QHPA 4EIGB 1BL9A 3WYRA 3U0WH 4OZHA 3GJFH 1CSXA 1SDDA 4LHUB 3L5WA 1CTMA 4TULL 3IE9A 4UOQA 3B5HA 1S7UB 3INUL 4BH7A 3KYNA 2EUZA 3J7HA 1ODUA 1RD6A 5D2NA 2A4ZA 1OTUC 4L8DB 1S9XB 2CO1A 2A83B 3UTOA 4DHLA 2CR0A 1VENA 2ZXEB 4EE2A 3Q5OA 4UOW0 5DJAB 4WAFA 4PD4K 5C3LD 3FUHA 4QCIB 1NDGA 3MLSL 4MA3A 2DQJH 4BKTC 3UXFA 4F57L 2CIKB 2VDMH 1ACYL 3L5HA 3SKOB 1KB5H 5HHNB 5AB1A 3BMVA 4NRXA 4GO6B 4CA4A 4NKMA 1AC6A 3GKWL 3UDWA 5FYLL 5DT1L 5D5ME 2G9HB 1R3JA 4FFVC 1J1XH 4BFIB 5EZIL 4LSUL 3S37L 3ZL4L 4G82A 4WI0A 2Z35A 1QI4A 2WXQA 4XPAH 1E40A 3H1ZA 3AG3B 3HLKA 2HPOA 2F8VA 1SJMA 3JWOH 4PJAA 3F7LA 4KK6D 5JQ6H 5TDOA 4TQEL 2H26B 1XX9C 4HIXH 1NAMA 3OHXA 1FJ1A 3CHXA 4N9GA 4NKDA 3UC0L 3EO9H 2NY1B 3E2HC 3N91A 5CSZB 3JTTB 4FABL 1A4JA 4LSRL 4Z7QF 5I16A 5KUMA 1EGJL 1XR9B 4XZ4A 2V17L 5DVPA 4ZI8A 5HHOB 1SRDA 5T3XL 2WBXA 4FAAB 1NLBH 2IDTA 4N0FA 3Q2NA 1IMHC 3GMRA 1JXDA 3OC5A 1FPTL 5JORA 3LKQB 1H8SA 4J27A 4NQTA 2J6WA 2ZF8A 1UJTA 3GI9L 5CLZA 5I8EB 4CJ0A 3ZHKA 3QUXC 4XB7A 2DIJA 3O4OB 4L8SB 2CO4A 3L08A 2J8UF 1PY0A 2VDNH 4B9ZA 1CXIA 2P4AB 1G7PB 1HZUA 1MFEH 3FN3A 3S3PA 4ABUA 5DJXB 5ID1B 4KTGA 4JVPA 1Q1JH 1CL7L 2EC8A 3BLBA 4TUOA 3QIUC 4ZXBA 4I3RH 1I7RB 43CAA 5JXAH 3N41B 5FXCH 1BYOA 1XTLA 1JZDC 4YSQA 1XBRA 1QABA 5FKAB 5FM5O 1VFBA 1P4UA 2FATH 3S36X 5J11B 4MZRA 3QZOA 5CN2A 2MRYA 1PCSA 3TWYA 4IM8A 1KT2B 2G5RA 4GAJH 4PWIA 4XXWC 5LAXA 4NC2B 1SXCA 4X5WA 1A7PH 4XPHH 1S6VB 4QKXB 3TPUA 4Z7OB 1LEIA 3FO9A 2CLRA 2H0PA 4ZPVB 4FERA 3RWCA 1GZHC 3F7VB 5IROD 1HXMB 3TGUD 1E5CA 3NIDF 4E0RB 1RJLA 3LX9A 2N3JA 4JG5A 4E5XB 1HSAB 1QHOA 5ADPL 2VWEE 4OJFL 1DBMH 3ESMA 3MI6A 4N25A 4K7PH 4XNXL 3SKMB 3RX8A 1I85C 4PRHB 4ZSOE 2Z34A 2ZUQC 4JM0A 2VXSL 1Z5YD 3LRSA 4LCIL 4J3BA 4R90L 3MRMB 5JTWA 3TVMD 3WN6A 1LO0H 4W9CC 5E99H 3TF7C 3F00A 4LASL 5EORH 1CDGA 3IF1A 4F2MB 1PNCA 1SDAB 1NOLA 4NN6B 3BAWA 3U2JA 5KVGH 4OZIF 4N2AA 4BXSV 1AO7A 5IOPA 2IF7A 4TVPH 2OL3B 1JUFA 2NNAA 1S7XA 2VLRA 3WSQH 2XN0A 3I50H 1HZHH 3JQOB 2DM2A 3K71A 3OSVA 1SDYA 3TA3D 4XO9A 1IARB 3GUTB 4Z3EA 2R4RL 5IFHL 5E4EB 1N19A 1ES0A 1FHGA 1ZHNA 3CGTA 5DS1A 4AI7A 1RK7A 3MUJA 3R1GH 1L5GA 2XY2A 2Z92A 4ETQA 2ETWA 2YC1A 4LNVA 3OPUA 5CIPB 4G5ZL 1FCCA 3N85L 1NTDA 3LZFH 4FA4A 4HX1A 5LQBL 4HJIA 3FB6B 4Y4KC 3APCA 4FA6A 2NY2D 1SLXA 2VRAA 4G1MA 4HFWA 1NEUA 5CICB 4KK8D 4DAGL 3M17B 2YA0A 3WXWL 2QLVB 3BEVB 5DWPA 3LIZH 2Z4TA 3OWRA 1G0DA 4PGBA 4LSPH 2NLJB 4CMHC 2GHZA 2EDTA 1TVHB 5I0XA 2M83A 4BSWB 3DHMA 5EEVA 3MSPA 4WHCA 2B15A 1AS7A 3FONB 3F2LA 2XV0A 2AEIT 2JJUA 1I6EA 1P4BH 1GZPA 4GAYA 3WMPA 1IILE 2FH6A 1KTLB 4PREB 1AXSB 3O0RH 1B4LA 1F2XK 4ODVL 3ZMEA 5GGSY 4AUUA 3VD3A 2V5MA 4U6VL 3RHWK 5J9PA 4UQIM 1LO2H 3UTZB 1IRAY 3AS0A 3JUYA 3IU3B 2DLFH 2GJZB 3WJMA 2F0CA 1W2KT 3RWIB 4JNXA 1M7IA 5LDSA 3UZVB 4TULH 2IWGA 3INUH 2BP5M 4TN9A 3ARXA 2BRQA 3PQYB 2J5LC 1ZA6B 1CLVA 2QL1A 4XN5A 2AJYL 2B4ZA 4Y4FA 2I25N 4D8OA 4LOUC 3S3JA 2WHVA 4YHKL 4EUPA 3W0WB 4XE0A 2GK2A 1F6AB 2EVGA 3D51A 3WNKA 1F90L 1H5BA 3MLSH 1EDHA 4QXWA 2P24A 4X83A 1JYXA 2BCKA 4F57H 3MBEB 1UD4A 1ACYH 1FIEA 2ZZUT 1N0XL 4XMUA 1NAKL 3U0PB 2QTVA 3OXSA 3FBQA 4IBSA 3GKWH 3TFKD 5FYLH 2ZOLA 3UEZA 5I75C 4NNYA 5J11C 4RFOL 3S3CB 2PW2A 4KRPD 2J2ZA 4NBYB 4LSUH 4HIJB 1E4KC 5EZIH 1JHKL 2NY0D 1OGSA 3S37H 1MJJB 4PJHE 1NGPL 4P23D 3QIBB 1NC4B 1TXKA 3VFPB 1AJ7L 5HI5C 3ZT5A 3W5MA 1SXZA 4Y5YA 3ZL4H 4C4KT 3DTXB 3QJXA 2DQIL 3CSTA 4AAOA 1OHQA 5JO5B 2DJUA 3D06A 1P4LA 2I85A 3MLPA 1T1ZB 3E8VA 4G59C 2DZEA 2KLTA 3BVDB 3VSVA 4B7LA 5EA0L 3MRFA 1SM3L 2VMCA 3MRJA 2Z4QA 4RMUA 1YFCA 1A6AB 1SBSL 3KZIV 1EEUA 5IIEB 2GTQA 1Q9LB 3LN5B 3DBSA 4UNIA 3FQYA 3DX8B 4U3HA 3SCMD 3UC0H 3VXPA 1ILUA 3RGHA 1S46A 1JDDA 1HE8A 4FABH 5D7LA 4LSRH 3CE1A 1EGJH 2Z0BA 3THML 2V17H 4OV6F 3MX0A 3NJNA 5T3XH 1VERA 2FL5A 4C83A 2SODB 4WKXA 2WQSA 1FPTH 1TZAA 3D30A 4YSDA 1U8QA 3GI9H 1WBXB 1G7MB 5G2NA 5HGDA 1A1NB 4UZUA 2L7EA 3UADA 2WZAA 2VW7A 2P7TB 2VSDA 1RK1A 3JT0A 2NZIA 4AJVA 4CVXB 1X9LA 1OK0A 1T2JA 3RE0A 4RMSA 4Y4HC 4OZGE 5J06A 3GXMA 3RGBA 4Y9BA 3SE4C 4I1NB 4NIYE 5AB9A 1FVDB 3KW7A 2Q3ZA 3VRLE 4XZUB 4AH2B 1EEZA 3QG6A 3O3DB 4U1SB 5B1CA 1D5XB 3IJ8A 1CL7H 2HG0A 5KBKA 4W9JC 3FB8B 4FOMA 3EJTA 4JZJA 4ZD3L 3D9AL 2XZCL 1RP8A 1KJMA 3ZXAC 1PEZA 3NBTA 3CZFB 4NN5C 3KCWA 1GSKA 4KJWC 1QSFD 4P2RB 1WBYA 3S48A 4AOFA 2BVOA 4OF8A 5E1GA 4NPYA 5DJQB 3ZR5A 3KAAA 1QBBA 4E9QA 5HJ3A 4JQVC 3EBGA 3Q1SH 4Y19D 5DYOB 1XZ0A 2F6AA 1TT6A 4LCYB 4POZC 4GG6E 3GDBA 5IMLA 2Z1KA 4ILDA 1UC6A 4J20A 3AM8A 4LLWA 4P4KC 5ACZB 5JPMA 1H3PL 2C3VB 1YZZA 2H2SD 2QPUA 3QH3B 2OJEB 4JO1L 4KDTA 4KK5D 3L95B 4U33A 4Y5VA 2W07A 3GXUB 5ADPH 1MZYA 2NY7L 2W0PA 4OJFH 5ACLA 3LNEA 3WGVB 2BSDA 5DJ2B 3QDGD 2AXWA 4XNXH 3SDAD 1U3NA 4WQ9A 1S78C 4R6UA 4S2SB 4LPCA 1GIGL 4NO0D 2VXSH 4JFQA 3ZUNC 3NESA 1ZSDB 4R90H 3CN1A 5F96L 2MHAB 1PNDA 2HX7A 4LASH 4JY6A 4NZDA 1PCXA 5IJKC 4BYHA 2OJ1A 3JZ7A 1CICD 5F71A 3BJ91 3T4AB 2OXHB 3P3UA 4HV8B 2FX8L 4O51A 4Y1AB 1ZV2A 2IH1A 1GC1C 5D71L 4AE0A 3NCJL 3PPSA 3H1JD 2FGZA 4PJGA 1X5MA 2V2TB 3FL7A 3T09A 3MRCA 1NCGA 1BFOA 1G9MC 1JZFA 4P3CL 4A7GA 3Q05A 4I7ZC 4KJQD 3BPCB 4ZDHB 1FVCB 3J8F7 2R4RH 5E6IC 1D9KB 3BHBA 3IE4A 4GRLD 3VNZA 5CBEA 3KL5A 4CADA 2MTAA 4UBDD 4NC0B 1JK8B 1VFMA 3X1EA 2D3NA 3DETC 5BZDA 2X41A 3D08A 1FNEB 1M71B 3O9WB 4LKCB 4MNQB 3B9AA 4ZFOL 3VI3E 4DVRL 2EIMB 4G5ZH 3N85H 5DJ8B 2FHBA 3F7RA 4GRWB 1ZXKA 2YMTA 4M7KL 5LQBH 2FEEL 2JQAA 2DQDL 2M8XA 1JCKA 1AQDA 4JJOA 4PRAB 4QRSB 4HOZA 5FO8B 3PWNA 2PCFA 5EMYA 5EU6A 4DAGH 3ILQD 2EDXA 3WXWH 4HZLB 2DMCA 2CHDA 4N8VA 3IXAB 3EIFA 1UH2A 4Q9CA 5IJBC 3VWKA 1HJ3A 3EJQA 3LN4A 4PWGA 3GQFA 4MLIA 4PMFA 1NKOA 1UWEL 3QIWB 4NAJA 5DO8A 1BQHB 3RDTA 4PG9A 1ESOA 1CE6B 3WFBL 4XCNB 2VLJD 1L9PA 4DQAA 2FR4B 1T0PB 5F7EL 4YDNA 4XPFL 3FRPB 4ODVH 2DIEA 4U6VH 5DVOA 5EUOA 4KRLB 5ESVB 2FSEA 5IW6A 1UACL 1UXLA 5DQDL 4V1DB 5DZLA 3MNVB 3BRFA 3V8OA 1U8PB 1C08B 2H2PD 3GBNL 4ZTOL 4WTZG 2OZ1B 1TFPA 3N6YA 4NKIL 3RIFF 2PTTB 1BCIA 2NR6C 5F1IB 4BKLB 4JEGB 2KS0A 1T83C 3K2IA 3ZTJG 2EEAA 2AJYH 2BP8B 1IIKA 5CU9A 2A6JA 2F7PA 4JFXB 4FXTA 1E30A 4ZUVA 4NZ8A 4YHKH 5JPNB 2QT6A 1R46A 5DVKA 4PJ7B 3R7RA 5ICXA 2AITA 1F90H 1ZGLA 3HZMA 1UJ3A 2J6EL 1G7QB 4HUXA 4FFVD 3LHAA 1OGAA 4YGVA 3CZEA 1N0XH 4JLRB 1NAKH 4J5VA 3O3EB 4XCEB 1BEXA 4L8CB 5I19H 3OHMB 1A9EA 3LH8A 1MFDL 3FCTA 2PCPA 1I9RL 1KLFB 5C0BA 4RFOH 5CMAB 3LH2L 5D2LA 2GB8B 1L9NA 3WU1A 1JHKH 1NEZG 2O5ZL 4GI9A 1NGPH 1TTBA 3PWJA 1AJ7H 3P9LB 3WLWC <