3ZBMA

Structure of m92a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
455
structure length
455
Chain Sequence
b'LPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKAPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
total genus 148
structure length 455
sequence length 455
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2012-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3zbmA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zbmA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zbmA02
2XWZA 3TU6A 2TSBA 1NINA 2B08A 2XV0A 3NSYA 3SBQA 1JOIA 1L0ND 4WKXA 4GP4B 1I8OA 4HCGA 1OCOB 1AS8A 4HZ1A 1WS8A 3S3DB 5KLVD 2OJ1A 3JTBA 3EH4B 1HZVA 3L70D 3WFBC 2PPCA 1CRYA 3JT2A 1CIHA 1KV7A 3D12B 2GC4D 2DYRB 2PP7A 2J56A 4A2DA 4W9ZA 3H1KD 4WQ9A 3VNWA 2CBPA 2DY2A 4BK5C 3NBSA 2ZWNA 2V07A 1FI7A 1CEDA 2XLLA 1W8EA 1CYWA 1HZUA 1CO6A 1NIAA 1YICA 1KX7A 1BE3D 1E5YA 1IO3A 1SQPD 1AZBA 1V10A 1ILSA 2BZ7A 1JZEA 1QL4A 4HCFA 3ZDWA 1LS9A 4AANA 3ZOOA 1CTJA 3ABMB 5DF5A 5D4HA 5C0ZA 1CC5A 3AG1B 4BWTA 1B3IA 2EIJB 5IY5B 1GS7A 1PZCA 1OE2A 1CURA 1NIBA 3OQRA 1LC1A 4E9SA 5CICB 5I26A 1K3HA 4RSZA 2GSMB 2GBAA 2PCBB 4ZK8A 1NTKD 2V08A 1KYOW 3O1YA 3NJMA 3OA8A 3M97X 4A66A 3O5CA 5E9NA 5CIBB 2AANA 1QNIA 1CUOA 4P5RA 1OF0A 3RYMA 4JHVA 1J9SA 3T9WA 1JZGA 1SQVD 1DVHA 5B5EV 1FI9A 4AKQA 5I28A 2HV4A 4JCGA 1XB8A 1M9WA 4DP9X 3OMAB 1RKRA 2AVFA 2D0SA 1WA0X 1N70A 2EINB 4DP7X 2PP8A 1OV8A 1QN2A 1IUZA 1C6RA 4E9XA 1H31B 1E67A 3X39A 2VM4A 3EH5B 1W5CT 3FU9A 2BWDA 5I6PA 1BQKA 1E30A 4FAAB 4F7KA 1UATA 4BWWA 2IWKA 3FU8A 1AOZA 1X9RA 1L9BC 4E9WA 1CYCA 5E79V 2C1DA 1R1CA 3MX0B 4GY4A 3NJHA 1L9RA 3T71A 5I6LA 1MG2C 3CVBA 4YE1A 3TGUD 1R0QA 3FPXA 4Q5PA 3NJLA 1OE1A 5I5IA 3S8FB 1JDLA 3EH3B 1T5KA 4ENZA 1GR7A 1KYOD 4A2HA 4A67A 4DP5X 3PXLA 3ZIYA 4QKTA 1MDAA 3FQ1A 4G70B 2IDUA 1CXAA 1FCDC 4AZUA 2VN3A 1PLBA 3FYEB 1GKSA 3DIVA 5B1AB 5TK4A 3BQVA 4KNTA 1M6ZA 4BDVA 1ID2A 3WNJA 1ZDSA 2XX0A 1YNRA 4A2GA 2C9XB 1URIA 4F2FA 2GB8B 3WC8A 1NDTA 2MTAA 3SBPA 1JERA 3KW7A 2MHMA 3A0HV 4MU8A 1L9PA 1YTCA 2GIMA 4P4QB 3QPKA 4HHGA 1AZUA 2CAKA 3FSVA 3SJLA 1U75B 3WFDC 4DP8X 1MZ4A 1WEJF 1YCCA 2VW4A 5ANHA 5CYTR 1AANA 1ET5A 2PPDA 5C9MA 2FJSA 4PJ0V 1QYZA 3HEIB 1IZL0 1H33B 3EHBB 1CIGA 3NSCA 1DT1A 2UXFA 4EF3A 2JTIB 1NIEA 5D4IA 1CORA 2FWLB 4E9TA 1AZCA 1TU2A 2BP8B 1HJ3A 4DP4X 4F2EA 2B10B 5CIHB 4U3FD 1ZDQA 3NSFA 1J3SA 1MZZA 2N18B 1JVOA 3WG7B 1ADWA 3RMZA 3C75A 1M60A 1CYJA 1NTDA 3PXTA 4WQEA 3T6XA 1AS6A 3EF4A 1OOWA 4YSOA 1PPJD 3MK7C 1I6DA 1AZRA 1CIEA 2N9JA 1PAZA 2YAHA 3ASNB 3FU7A 2IDTA 1SDDB 1WVEC 1IBZA 1EHKB 351CA 2ZBOA 4A2FA 1DW3A 5D4JA 3NJNA 5KLIB 4HALA 2JQRA 3CX5D 1YLBB 2GC4C 3UADA 4YSEA 4KO6A 1KX2A 2YXVA 1CSXA 5KAIV 4A68A 1CNOA 1M56B 2XYBA 3ZCFA 2BO0A 4GP8B 3L4MA 5B1JA 5CIFB 4FAVA 2AIUA 3NWVA 1C2RA 2QJPB 1HRCA 1JXGA 4GP5B 2I7OA 4N0KA 1QL3A 3CP5A 4YSTA 1ILUA 2GI0A 3H1HD 3DTUB 2HZHA 2FT8A 4YL4A 4Q8BA 2OZ1B 3AZUA 3GXUB 1BXVA 1PLCA 3ZX1A 4HHWA 1I55A 1DVVA 3SQRA 1ZIBA 1E2RA 1EZLA 4BXSV 5B7FA 2BH4X 3MK7B 1W2LA 2B12B 5I6KA 3ORVA 2PCCB 8PAZA 4WQ8A 1JZJA 4TXVB 1C2NA 1GDVA 5TISV 1DW2A 2TSAA 3H1JD 1CXCA 2EILB 5F7BA 5CIGB 5FC9A 1J5CA 1L9SA 3FQYA 1AZNA 3IN2A 1A8CA 2XV3A 3OCDB 2HRHA 3T6WA 1I5TA 1SF5A 4PAZA 9PCYA 1BL9A 1CTYA 2P80A 3AG3B 3CDZB 3OMIB 2LIRA 1NWPA 4EIEA 1TEGA 2IDSA 1OCCB 3NYKA 3S3CB 3PH2B 3H4HA 3RLMA 3CG8A 4JKNA 1PZAA 4BWUA 1H9XA 4O1QA 5PAZA 1JXFA 4H0JA 1WA1X 3HB3B 1CCRA 4G72B 3O0RC 1GYCA 4Y5RA 2FQDA 1ZRTD 4IL6V 2XXGA 3H56A 2AZAA 4YVNA 2YQBA 3FSWA 1VLXA 1FFTB 2FNWA 3ZOXA 1C7MA 2MRYA 2VMJA 1AOQA 2CALA 3ZOWA 4PD4D 4WQAA 2FYUD 2IH9A 2XXFA 4LJIA 2BP0A 4FA4A 1ET8A 1HJ5A 2ZXYA 1H32A 4E9RA 1PF3A 2EXVA 1HJ4A 2C8SA 3SLEA 4AAOA 2VM3A 5PCYA 3X1GA 4L3HA 3AG4B 1B7VA 2HX8A 2PLTA 4E9VA 3DP5A 1RAQA 2B0ZB 4G7RB 3L71D 3TA4D 4N4YB 2R7EB 4QLWA 3L45A 1DIIC 3RN1A 1CRGA 1GS6X 1M57B 4J20A 1TKWA 2Y69B 1FOCA 2N3BA 2YAEA 3JBTB 4WQDA 2XUWA 3ABGA 3PAUA 4XYDB 3S3BB 2CUAA 2H3XC 1A2SA 1OCRB 3PCYA 3AG2B 3QJUB 2EIKB 3CZUB 1SFHA 3V9EA 3NBTA 1CYIA 5DFSA 1ETJA 2GHZA 2P80D 4NFGB 3FS9A 3PXWA 3UAAA 3V9CA 1I53A 1U74B 1CHIA 3ABKB 5B6QA 3CU4A 1BQRA 1SHXA 1ASQA 1NZRA 3G5WA 4YSQA 4WQ7A 1E29A 1EZVD 1HCMA 2BHFA 1J9RA 3ABLB 3UABA 2AZUA 1A56A 2HRGA 4UAHA 3KW8A 3WKQA 5KKZB 3WNIA 4WQBA 1NIRA 1X9UA 4E9QA 3X1FA 2CE1A 4YSDA 1BXUA 1L9TA 1NTMD 1C75A 3PLYA 1FWXA 1PZBA 2LLNA 1EB7A 1H33A 4DPBX 2B4ZA 1AIZA 2HLEB 3FPYA 2H47C 2C2CA 3GDCA 2WO3B 1A4AA 1BAWA 1JZFA 2XU9A 1CRJA 2YAOA 3QJSB 1AYGA 1KBWA 2CE0A 1A4BA 4GEDB 1A8ZA 1XB3A 5LDUA 3CWBD 3X1EA 1LC2A 4GYBA 3VYMA 1N50A 3CYTI 4UB6V 2Q9OA 2FT6A 155CA 2D0WA 4PCYA 1I54A 4K9JA 2QDVA 3C2CA 1IKOP 1W6WA 2QPEB 1NMIA 5DJQC 4O1WA 5AURA 4WTQA 2MTAC 1SDDA 4NB7A 2HX9A 1AOFA 1N9CA 1C6SA 1N68A 3AW5A 3PPSA 1I8PA 1AG0A 7PCYA 4NAJA 1P84D 2BH5X 4UF7C 1SF3A 3DKHA 4EIDA 3ERXA 3L73D 1AS7A 1GY2A 2C1VA 1ASPA 2PCYA 1BQ5A 4KO9A 2C1DB 1SHWA 1ET7A 5I5JA 4GYDA 5IY51 1LFMA 4AI7A 4YSAA 1QHQA 2FT7A 1XB6A 5AKRA 3NJGA 3NT0A 1N15A 1F1CA 1KBVA 2PACA 3N2JA 2QJKB 2BCCD 2OZ1A 5B1BB 3L74D 3FSAA 2PPEA 4KOCA 4BXVA 1M70A 1ASOA 5CIDB 2W8CA 1H1OA 1COTA 1ZZHA 4BDVB 3FYIB 1CHHA 1GQ1A 3CXHW 2UX7A 5DJQB 3NJKA 3WI9A 2OV0A 4CSZA 2CA3B 1CSUA 2LITA 3L75D 3L4OA 4CSPA 2XX1A 3FSZA 2EIMB 4L0PB 1ETPA 2IWEA 1RCYA 1AKKA 4YSPA 1GY1A 1FI3A 1KB9D 1CSWA 2IH8A 4E9YA 2FQEA 1KIBA 1S5LV 1W6LA 3O20A 3OCDA 3UGEA 2DYSB 1PY0A 3QJVB 3WU2V 2X88A 2PPAA 3NJIA 1F1FA 1K3GA 1HAWA 3CDZA 4DY9A 3FQ2A 3U25A 4AKOA 1CC3A 1RZ6A 2BCNB 3RN0A 1OCZB 3PAZA 5AZUA 3TBCA 3WIAA 3NP3A 1MG3D 3H1LD 3IE9A 3WKPA 2BZCA 3NJJA 3DMIA 3X2QB 2HX7A 2X87A 3SWSA 2DWTA 3A0BV 2A3TA 6PAZA 3HQ6A 4FANA 2Q5BA 2BLFB 2H5UA 2UXTA 3FU7B 5B3SB 1NNOA 2FRCA 2IWFA 5B66V 3L72D 1PLAA 5B7EA 5GTHV 1KYAA 4K3IA 2AFNA 1OCDA 2IBZD 1HROA 1IC0A 3OD3A 1PMYA 4FB1A 2GC7D 2JKWA 2AXTV 3CXHD 2VSMB 2B11B 4A2EA 4KOBA 3BCCD 1E65A 1WA2X 1IRWA 3ZBMA 1FA4A 2FTAA 1A65A 3TASA 1PNCA 4H0KA 1SFDA 3H4FA 2I8FA 2R7EA 2UXGA 1KCWA 1H31A 2YARA 1V54B 1IRVA 1OAEA 4L1QA 3CVCA 4P5SA 2J57A 4DP2X 3SBRA 3QJQB 2RACA 1PCSA 2ORLA 1GS8A 5B1KA 1E8EA 1ZPUA 4G71B 1J9TA 4L3GA 4PWAA 2CJ3A 1CSVA 1NWOA 2VHDA 1JZHA 3CVDA 1BXAA 1VYDA 1SQBD 2A06D 2ZOOA 2CA4B 2N3YA 2XV2A 1GJQA 1NU1D 1H9YA 1QKSA 4HCIA 1IBYA 2NRDA 4YSRA 1HAUA 1DIQC 5TK2A 2N9IA 1NIFA 2CCWA 5I5MA 1SQQD 4YVUA 1IQCA 4AALA 4NERA 4WQCA 2YAPA 1WAEA 3ASOB 4DP0X 4EIFA 1GW0A 4XXLA 3UACA 4AKPA 2WO2B 4DP1X 1CIFA 2YCCA 1SNRA 3IEAA 4AAMA 1NPNA 4HIPA 3UAEA 3X1BA 2VW6A 4YSSA 2YAFA 1L0LD 4FA1A 1DW1A 1NIDA 1HH7A 4KNUA 3NSDA 1MZYA 3OM3B 1PP9D 1RAPA 1I6EA 5CIEB 2DGEA 4FA5A 4FA9A 1CHJA 3AY2A 5EXQA 3QJRB 3OA8B 3QJTB 5B7MA 1RZQA 4GXFA 2BW5A 2ZXWB 4DPAX 1KB0A 5I6NA 3SVWA 1YFCA 3KZIV 2FWLA 2BP0B 1F56A 1TEFA 1NPJA 2BP8A 1SJMA 1H32B 2N0MA 4MFHA 4YSUA 2YK3A 4YSCA 1CCHA 1V55B 3SXTA 7PAZA 3DR0A 2BWIA 3H1ID 1NICA 5KAFV 1RZ5A 1N90A 1XMEB 5H2FV 2YIUB 1BGYD 1L9JC 451CA 1KCBA 3FT0A 1DYZA 3HQ7A 5AFAA 3PAVA 1AR1B 2PCFA 3BVDB 2N18C 2DWSA 1QLEB 2XVBA 3TYIA 2IAAC 1NMLA 1JZIA 1C6OA 3CX5W 1DZ0A 2I85A 1L9QA 3OMNB 1JVLA 2UX6A 3WFCC 1E5ZA 1WS7A 1CTZA 1YEBA 1J9QA 2VW7A 6PCYA 4FA7B 1BCCD 5GTIV 2UXVA 5I6MA 3MBWB 1AG6A 1CRCA 4M4RB 1KGYE 2QT6A 1AQ8A 1C52A 1BEXA 4X4KA 1GSKA 4G7SB 1A3ZA 2YAQA 1MG3C 3HQ9A 2JXMA 2OCCB 3ZOYA 2J5WA 1OE3A 1ZV2A 5EHFA 4KO5A 2BW4A 1LMSA 1MG2D 1CRIA 2BGVX 1L9OA 1FJ0A 4KMGA 1KDIA 2IDQA 2ZONA 3A9FA 2WSDA 4UANA 2W88A 4N8UA 4V2KA 4Q89A 2PPFA 4JHUA 2FQFA 4G7QB 1YIQA 2FQGA 3WUIA 4RH4A 1ZIAA 3IN0A 2YAMA 3QQXA 2XTSB 5I6OA 2GC7C 1KDJA 2IDFA 5A7EA 3HQ8A 2GIWA 3T6VA 2CXBA 1HFUA 2AI5A 2B3IA 2J55A 1AAJA 3N55A 4KO7A 2L4DA 1S6VB 2C1UA 4M3HA 1GIWA 5B1JC 3WFEC 3NJFA 3S8GB 4EICA 3PXSA 2DVHA 1AACA 1YEAA 4UB8V 2HXAA 2QDWA 1GU2A 2GB2A 2QPDB 2I7SA 4DPCX 4W1TA 4KNSA 1A4CA 1J5DA 1BYOA 4D6TD 2DV6A 3X1NA 2FYNB 3T6ZA 4DP6X 3IBOA 4QAOA 3TBBA 1JXDA 2PP9A 2YXWA 1DW0A 1KV9A 4PW9B 3NP4A 2QJYB 3VRDA 2BPBB 2JFCA 4HAKA 1CRHA 3GYRA 5F7AA 4AX3A 1BYPA 2E86A 2VSKB 2ZONG 1CYXA 1PNDA 2ZZS1 1FHBA 1NTZD 1RZPA 2Y1AA 1SQXD
chains in the Genus database with same CATH superfamily
3UP1A 1GIGL 5T33L 1B90A 5MENB 1JOIA 4OZIE 4G9FD 3V0GA 3C6SB 2R1XA 5ACZB 3FUEA 5J3HD 3ZKXC 2JKRM 4PS4H 2CHWA 4TM9A 4XMLL 3VYPA 5DK0A 1R6VA 4HKJB 1YPZE 1N12A 1R3IH 4X7CC 2CMRL 5F44A 4DQAA 4WHTA 1YSOA 2MCPH 5ESQA 3IDJB 4HX1A 4FC3E 2ZWNA 2TAAA 5CGBA 4KX8A 4U6XB 2B0SH 4JPKL 4GKSA 1I3UA 2J2ZB 4LVOB 5C7XL 4KJPD 5CCJA 5IKCA 1AC6A 4GT7A 2ITCA 2YSSA 1TPXB 5EMYA 5B1CA 1A6ZB 2X1XR 1Q0EA 3WTSA 2MOVA 1U2CA 5HI5D 1DUZA 4BV1A 2DQUH 5D7LD 4AYDC 5IR1A 3SDCD 4X5RA 4HEPG 5IHBA 1DQMH 3QZBA 4N2MA 2JIXA 4UZUA 3OA8A 3NA4A 1G7JA 4KQ3L 2FSEA 4W9HC 5KVMC 4R4FL 5E03A 4F2ME 1LM8V 3TVMB 1GGYA 4O9HL 2K8MA 4CMMA 5IREA 1EZVX 5GSRB 4Y5XB 4XNMB 2CDGA 3RWHA 1IUZA 3ZTNH 1YAIA 4KKPA 3WUWA 3DPBA 4M56A 2EZ0C 1AR2A 3MLRL 3KS0H 2A2QT 4QKXB 4RFEB 4FAAB 4N2BA 2NXZB 2F18A 1UATA 3VWJC 4Q9BA 5BMFL 2HT2C 3C8KA 4RMBA 4JFPA 3TIDB 5EU3A 4OGAC 2F58H 5JPMB 5BV7L 2V5RA 3FO1B 1KYOJ 1A5FH 4KMLB 3NFSH 2YC1A 5KSVA 4HS3A 3MYJB 4A6YL 3NCWA 3AVEA 5CMAB 3N5AA 3VVVA 1CU4H 3M7FB 4G5ZL 1QFWH 1RUMH 3VI4B 1HE8A 5CGTA 2E75C 5IB5A 3D0AA 5C0DB 2E8YA 1BLNA 2OZ4L 1AKJB 3TH4T 1CDYA 1KTRL 1JE6A 5J1SC 1MZ4A 4W81A 5FYKD 1BA9A 4F92B 4KK5C 5C9MA 2IANA 2YBGA 5B3JF 1O7DC 2UXFA 2EE6A 1HOCA 1YQVL 2JCCB 3IE4A 2BP8B 4W70A 4YXHL 2ARJA 4EPSA 4U3FD 1LD9B 2WUBH 3VXRB 2R0ZL 2HMID 1UZGA 1JGIA 1VZGA 1R3LB 5FYKL 5BZDA 15C8H 4FI6A 4NAQA 3TBYA 4Y9FA 3FU7A 1JPSL 2JQRA 1J8RA 4HZLA 4X5LA 2UY7B 4PJXB 4U6HB 3SJVA 4BUGA 2V2XB 5D6CB 4PRPE 1AHMA 1NBZB 4H4NA 3PL6D 2LAGB 1KB5H 4WSKA 3DX9B 3GMNB 1MFCH 5AAMA 4J3SA 1U4FA 3IJSA 3PWUB 2NOYA 4PRDA 4Q8BA 2OZ1B 4U6YA 1PLCA 4RAHA 4QRBA 1W15A 1CG9A 5AOKA 3TO4A 4Q6KA 1UM4H 3QIWB 5I1IH 1G7MA 3W2DH 1E4WH 3L5XH 2Y7NA 3FB8B 1E4KA 2OZNA 3DX6B 4NBYB 5I2IB 5JOFB 5JW3H 4FQXB 3PGCB 2QKIB 1TOXA 4V2CB 3UTQB 2B59B 3D25A 2QLYA 3QCUL 4PAZA 4F9PA 1GW6A 2CLVB 4ODUB 3AG3B 3U4BH 1C8PA 4MNQE 1DO6A 1FFQA 3P9LA 5SWSB 4GUOA 1P4BL 3FU5A 4XAWL 3RGBA 4OQ1A 2FQDA 4WFEE 3VI3B 3DURB 1TVHB 1AGFA 5KZCD 1KJMB 1D9KD 5KAQF 2G60H 5L0QC 1WICA 1C7MA 2AABH 4PRBB 3ARBD 1I9JL 5D1XD 3D51A 1KBGH 3R8BB 4JDVA 1S8DB 1RZKC 3HRZC 4JZNB 3O3AB 5IROD 2MNUA 3KPQA 3ARZA 1PF3A 4QXUL 3CQPA 1I3GL 3FUNA 2VXVL 3C5ZA 4BH8B 4JW3A 3SQOL 1M42A 5SX4H 3GMLA 1PKQB 2IAMD 2VL5B 2X09A 3G6AA 5CN3A 2ZD0A 4HGKC 2G2NA 3D69B 4OCSL 2CUAA 3APCA 3VD0A 4L9LA 3EYVB 4OM1H 3P3RA 2H6UA 1D5BA 2P5WA 4FYTA 3TL5A 1XAUA 4DAGH 3IJ9A 2VCOA 2CO7B 2ADJA 4XNQB 3TN0B 1X4YA 3KPSB 2FUQA 1TYEB 4JFFE 1KFAH 3VXNB 5K9JH 1VFUA 3S96A 3BZDA 3TWYA 1FGNH 1ERNA 3HN3A 5KVFE 4QAWA 3EGSA 5DK3A 1OEZW 3RVUC 3DRTA 5C0IA 4LQFL 4E9QA 1EV2E 1KLFB 1CZ8H 1VZHA 5CLZA 5KJ7E 1UJ3A 2WXRA 4I2XE 3BEVA 1GL4B 3R0MA 1V7ML 1H33A 2Y1YA 3I50L 4OLYH 3QUGA 2WLIA 3GKWL 3KPOA 4P49A 1DJZA 4MA3A 5CEYB 2IPKB 2MPVA 3L9EA 1Z3GL 2XU9A 3O2DH 4L3ED 5DRZB 3VXPA 2FL5A 3ZQ9A 3QORD 4K9EL 3IMUA 5LDUA 2OJEB 3X1EA 1EQWA 3KCPA 1N50A 2G3XA 2HT4C 5F72S 4L0ZA 3RPIA 3GMMA 5HYSG 2P46B 2PTTA 1E3ZA 2AVGA 2QVMA 4QJ5B 3VE0A 2HX9A 1AOFA 4YX2L 2Z31B 3FU0A 3CU7A 1CE6A 2MPAL 1TO5A 1NFDE 1FNSL 1GMEA 3MU3A 5IVZB 3CQQA 2FATH 4L1LA 1M7XA 3QUMA 3B3IA 4HISA 4H13C 1NAMH 3GZKA 2C1DB 4F7MB 5HHQA 4X9GA 5TPWL 4UAOB 2C3GA 1C7SA 4ZW6A 3WUZA 3FZUD 3G6JA 4XAKE 1BAFH 1OAQL 2I60H 1HIMH 1KBVA 2HRLA 2ZWLT 4P9HH 5L2KD 4NENA 2BCCD 2WQ8A 5HDQL 5EWIL 3V5DB 3L74D 4KZDH 3UBXB 4MRBA 2X7LA 4R97B 5GJTH 1HCFX 1UT1A 3GWJA 3V0WL 4AQ1B 1IBDA 1DQJB 1L0QA 3EJZC 5IBTL 4E5XA 4N26A 5EN2B 1GY1A 1A6AB 3NPZB 4WO4D 4XWGL 1RK1B 2B1OA 4ZTEA 5HDOA 1KIBA 1S5LV 3O20A 1IC5H 1PY0A 3I74A 4G9FB 3HHSA 4PIRF 5EU7E 3U0WH 3TEYA 2AJXH 4X7EC 2W9DH 1WFUA 3EO0B 4S11A 3GMQA 2X42A 1CPUA 2FO4B 2YQ3A 2APSA 1XR8A 4L05A 2XV6B 3LB6D 5IIEB 3NZHL 4QAMB 3CCHB 5ISZB 4KX9A 1MCOL 5FUZH 4UQ2A 1UQSA 2Y23A 3EGXB 2Y07L 3I9GL 3L1GA 5C0AA 5LO7A 4LNRB 2R0KL 1WAPA 1I1AA 1N5AB 4I88A 4DHLA 5DWPA 4ZAKC 1CGUA 4BFRA 4IOSA 5I30L 3MRRA 5D7HA 1H6FA 5JPNB 4B50A 3FO0L 4PJ5A 4XZUA 5D7LB 4IBTA 3K1KC 3AWEA 3GZOA 3B5GA 3OSKA 4OZ4A 3SDCB 1JD7A 2FSDA 1H31A 5E0FA 3SN6N 2XKNB 1CDUA 3GJEB 1D5ZA 1M2VA 4P5SA 2WV3A 3BDYH 3OAZK 4HJTA 3QEQD 3IGAB 4JFEE 3ULVC 2PO6D 4NIKB 4X5XB 5KYXB 1CF8H 2EDTA 4BZYA 3WAJA 5K5YA 2XWJB 4UT9A 2N3YA 1GJQA 1OTTC 3CK0H 4J6RL 5GGSA 3PGFL 1OANA 4NPYA 5I8CB 4M1CC 4AGQA 2N9IA 4TRPH 1HI6A 3LH2H 2ZXCA 2HPOA 5F0PB 4FYSA 4XGZB 5EC2B 1YEGH 4CADA 3G6JF 5DZPA 4HUUB 2Z7UA 1GW0A 4H8WH 1R0AH 1P7KA 4GMSH 2A9ML 4DP1X 1ZS8B 2ESVB 3TFKD 4J2QA 2NT0A 4IGBC 2H9GA 4H1LH 4WV1A 1J1XH 4XXCC 2BY1A 5A1AA 2WWKO 1QX1A 3M17B 2KHAA 2B5IB 2C9AA 5EH1A 5FW8A 3U9PH 1QBML 3AAZB 5EBGA 3IKCB 2J73A 3I9IA 4GXFA 3VJ6B 3VNYA 4N0CD 1JTTA 2R29A 4ZW7A 3GTNA 4F93B 1QLEH 2EDQA 4Z7OF 4OLZH 2AW2A 2Y5EA 4OLXL 4YSUA 5IQ7H 3EBAA 4R4BA 3OJMB 4WGKA 4YS4A 5BVJA 3KL5A 1RJZB 2D73A 1RLWA 4H8QA 4B9FA 5JHLA 3S36L 3ETSA 4PB9H 3TPUA 1UFUA 2WBJB 4ZUSA 5HI4C 5CJ8A 5LB1A 2Y3NA 2N59A 1SN2A 1NANI 2FE0A 3H9HB 1JWUA 1KTDA 1PW3A 5IOPA 5FM8A 3CFBA 3TZVC 4OU3A 1U95B 1E5ZA 5ANMB 5I16A 1XVSA 4H88L 3NCEB 4R90H 4YDLB 6PCYA 1DSWA 3VRIA 5GTIV 4W9JC 4NX0A 1P5UA 3MBWB 3RWEB 4ZYKA 5J9PA 1PZUB 2ICWB 2PCPA 5D7JD 4X6DE 1MG3C 5L4MA 2JXMA 2XQ0A 3PV6B 2ZQKA 1O6TA 1ZHNA 1P6WA 2X1WL 3IBEA 2Y06L 4QRPD 5EHFA 3UEQA 1DN0B 3MCKA 2PW2A 2BGVX 4HJ0D 4JLRB 3PL6B 2PNDA 3KBPA 1AP2A 2AJUH 1YEDA 3ZR5A 2NY1C 5GRUH 1B0RA 4JFYB 3T8XB 1N8OE 2BSSB 4G7QB 5CP3A 1ZIAA 3K80A 2WHVA 1EAPB 2GC7C 2DMBA 2O30A 4M6OH 4KY1L 5LQBL 3Q44A 4ZMVA 5EA0H 1IGCL 2CZNA 4LRIA 1KXHA 1EFXD 4LBEA 1ONQB 1FUNA 4NIYE 3MJ9A 1VFBA 5EU4A 4DZBB 5AVWB 3MV01 4LEXH 2FYNB 2FUTA 4X80H 4LHJB 4YDNA 4NQXA 3KGTA 3BP5A 3S3SA 3QXTA 4GG8B 2KLTA 1NEZB 3WFEH 4W9IC 3O3EB 3CHPA 3D87B 2D7QA 2ZUTA 4DZ8A 1UB5B 2VQ1A 2Q1EA 3MRIA 4FYRA 4MVBC 4ZPTA 3FQ4A 1PD1A 4L5FE 4U1MA 1ZANH 3PP3H 2QVTA 2DKSA 1WBXA 3RWIB 2Y6SC 4TSAH 5JOPD 3MA9H 2PPCA 1BFOA 4MD0B 2DF3A 1D9KB 1T66D 2PP7A 4TPRH 5CLTA 2VDQH 2V17H 3ARBB 5D1XB 2VAAB 3KDMB 1F45A 4XOEA 2AQ3A 4HWBH 4UTAL 5ESAB 3KPPA 1SQPD 1QO3A 3CMGA 1V10A 2Q8BL 1NCTA 1XZ0A 2I24N 5I8KH 2WIIA 3T77A 4FLQA 3JWDC 3NIGF 3QWRD 5CJ5A 4JB9L 3TPKA 2IAMB 5JYMA 4OZIA 5JHDB 1W9XA 3AU1A 3CPLA 3SYQA 3AQDA 2R9HD 4OLVL 5IBUG 4ZK8A 3MAWA 3V52L 4D0BA 5L7XL 2P44B 1U3ZA 3I3BA 5CJOH 5D7SH 5FK9A 5CIBB 4P4KC 2DICA 3GJFA 2ETWA 3EUUA 1J9SA 1KGJA 4F1SA 1A3RL 5G55A 2WCPA 1XB8A 2X6MA 3QFJE 1IU1A 3ZE1F 5LXVA 3HZ3A 1IZKA 1WA0X 2ZP8A 3QDJE 4KVNL 1E2ZA 3FTGB 4OVUA 5D70L 1QN2A 5D8JL 3RWFA 4E9XA 4EQ3A 4YHZL 1H5BA 3BP7B 4HBCL 3HAEH 4ZSOE 1A7PH 3LZQA 4ZX3A 3RGVD 4F7KA 4HT1L 4L3EB 1X9RA 3VFRB 4XVOA 3D6GA 3RY5A 1CYCA 4ABUA 4J4PA 4NC0B 2VDLH 2DLFL 2VQUA 1RHHA 4IJTA 3TM6A 3UTZA 1K2DA 3OPUA 1XIWB 4FHJA 4X5WB 5HPMB 3GI9H 4YAQA 4N0YH 5BS0A 3LKRB 3FQ1A 3QDGE 4LPYA 3MLUH 4X6CE 2C1PB 5LCVH 2CM6A 1RJLB 3VRLF 1ID2A 1P7BA 3DBXB 3MRMB 2YKLL 1CTOA 3FONB 1IM9B 3QPQC 3A0HV 1WHPA 4M02A 4QHPA 2D7PA 2WC7A 4HAFA 4AJVA 1Z9OA 3OQ3B 3Q2CA 3KWWB 4NQSB 2CAKA 4KITB 5L2KB 2WQUA 4GUQA 2WM0A 1WEJF 1K9TA 2QLVB 3M7OA 4U1GB 3QHZH 4H8PA 2G2RA 4MNGB 2BOLA 3IJ8A 5EF0A 1X5KA 5D4IA 2FWLB 4Z0XA 5GGTH 1FVCA 4OI8A 4HXBH 5FKPB 2BMKB 1D5XB 2CO6B 3ECQA 2B10B 4F2EA 5A2IH 3UP6A 2WVTA 4BIKA 3ZDYF 1H3PH 1SXNA 1A2YA 4WO4B 3DMMA 3PXTA 3A47A 3FN9A 3T6XA 4XBGA 3X14B 4EOWH 3EZ8A 2BHZA 3QA3B 4Z7QF 2O93L 3QBTB 1YJDL 4M62H 3QARA 3LN9A 2PXYD 3FJTA 3ILQC 3FL7A 1EDQA 4IRZH 2GC4C 5A7BA 5FCSH 3ZQWA 1KYOK 1IIIA 1T20A 2C4XA 5I1JH 5I5RA 3WJLC 4D9RD 1D6VL 2QMKA 4KI5C 1U8LA 3MBXH 1GZHA 5KBPA 3BN9D 3X13B 4YHYB 1PY4A 4B41A 2I5YL 1TENA 1OTUD 3QAQA 2F5AH 2IMNA 2HZHA 2VZOA 4MXVE 3AZUA 3WMQA 4RQQB 3CFMA 3JTSB 4Q9QH 4F7EA 4ANXA 4BXSV 3AT0A 4JM2C 5I6KA 4PGCB 4ONFL 1VGKB 1PLGH 3MOAH 4NQQA 4CJ1A 3ULSA 3EAKA 3ZDXF 5CIGB 4RZCA 4O58H 4L4TA 4ONOA 3TP4A 3IMTA 5D2NA 1F90H 3AWGA 3V55A 2JJTC 1NDMB 3QEQB 4F7CB 1HDMA 2PO6B 3EO9H 4UQ3B 3WKMH 1CVRA 4PGDA 4AVJA 2V5YA 4AIZB 4MCZA 1BZ7A 4KH2A 2VXQH 1A1NA 1JPTH 1MHHB 2BNRB 5IBLD 4O51A 4ZZFA 2QGBA 4G83A 1D7BA 4HEME 1CCRA 4MJIB 5JXAL 1WBZB 4ANWA 4Y5RA 4CL7A 1HH6A 4P46A 3WN5B 2VIRB 1DQKA 3H56A 2J5LC 2CJUH 1FFTB 5T1DL 5ID0B 4XVUC 2FD6L 3FMGL 5FEBA 3HZKA 1AGDB 5DJAB 1FV1A 5E2VH 4F20A 2WLLB 3LXAA 5ACLA 3EJSA 3OR6B 3QEGH 5DR5H 1N2RB 4F3FA 3GB7B 1BVKA 5BJTA 5IJKA 4L8SA 3L71D 1EMTL 5E4AA 4O2EA 3FULA 3G5ZB 3MHZA 2WTPA 1AXTH 1CMOA 3ABGA 4XC1L 4YDVA 3VFOB 2C7FA 3O6FC 4HFWB 3S3BB 4B53A 2JJSC 4XNDA 3GZQA 4U3HA 2V8MA 5T3ZD 3QZWA 2HVJB 4CN4A 2BCKB 3QYMA 1NOLA 4N2EA 1KFGA 3RVWD 2O5ZH 4LGSB 1X5XA 3PWJA 3B9KA 3GHEL 4U31A 4HU8A 4W9FC 1G7HA 4G6JL 3AS0A 3OGCB 4FMKA 1QWUA 3X1FA 4QGTA 1BXUA 4PY8J 3S3JA 2EXYD 4U1SB 2VC2L 4ZOAA 3U48A 1XGRA 5BOPA 4XPTH 2VR8A 4ZUWA 4BZ2H 5CBEB 3D4CA 4PJDE 2CE0A 4GIAA 1R4XA 5HD8C 4NO0A 4TULH 3CWBD 1AD9A 1SY6A 1RIVH 3DV4A 4AENA 3TV3L 2HSIA 4QRPB 1RZJH 4FFZH 2QADD 2ZE0A 3AW5A 4JFFA 4WI2A 1DVXA 4Z7WA 1U8QA 4N3UA 3RDTA 3NFNB 5DYOA 5KBLA 3ULUH 4E0RB 3GSVA 5T1KA 2HP4A 2XTJE 4ACPA 5L8LB 1BQ5A 3UC2A 1LEKA 4QJ4B 4PV9A 3LPWA 4XP6L 5ABDE 5IHZA 4U1JB 4I2XA 3AM8A 1AHWC 1A1MB 1XF2B 4YR6A 4L29A 5EULV 3NMEA 3M46A 1EFXB 1ADQA 1R5VB 3L81A 4TUKH 4G8GB 4AIEA 3U36B 3LKOA 4HDIA 2CG9X 3FSAA 4WSGA 4RGNE 5F7EH 3MGOB 2XG5B 1DDHA 3BOVA 4NYLA 4Z0BL 3T3PE 4G11A 1YY8B 4GB9A 5DD0L 3L75D 2I9LB 1ZLVH 1N19A 1BM3L 3IYLW 2Q7NA 5IUSA 4JQIH 5IMMA 4YEFA 4J7RA 4XMKL 5KS9B 3OWEA 3WHXA 4WDIA 2EJ1A 4X7DC 3UGEA 1ES0A 3H53A 4HPYL 4LPTA 1ZT4A 4FQQA 1A4JA 3CBKB 1QR1B 3ARUA 4G3YH 4QWWD 2XPZA 1RZ6A 2BCNB 3MACH 4NZTH 3QIUC 4N2AA 2DMHA 2X5PA 4LCWD 4MMYA 4OCMC 3SDDC 4APQC 3VD2A 4O2FB 4GXUN 3GS4A 3KEHA 3NJJA 5DFVC 3U7WH 4OD3H 3RY6A 1Z5LB 5LBSL 4MYPA 1RSYA 2Z8SA 2WZPD 1LEIA 4M93C 4FZ8L 1A4KA 2DLEA 4G42A 4GRLC 1RL1A 2FGZA 3NZ8A 4GI6A 1HROA 1KIUA 2WZ6A 5CP7A 2NNXA 2EE9A 3UYRL 4ZDHB 4A2EA 4KZCA 1OM3H 3CDGA 3S0PA 3BCCD 1CL7I 3QZLA 1MCJA 4AGPA 3C60D 2X9YA 3KBFA 5BVPH 3FQTB 3IVKA 2FBJL 2R7EA 4JRYA 3QXDB 2JWYA 4GBXD 4L1QA 4PB0L 1YEEH 4JPVL 3D0LB 5BW7C 1ORSB 2JJUA 2E27H 1ZLWK 1ZGLB 3IK2A 4QRRE 1ECYA 2AXFB 3HN5A 4R3SB 4Z7WF 2ZOOA 4G8IA 4WWKA 5ERWB 2OTUB 4QGYA 1XGQB 2H1XA 2JCWA 3LRKA 3MCYA 4TVPE 4NUQA 3W0WA 5GZOD 1VEPA 4D9QE 3BHBA 2XBTA 5J0BA 5HTSA 1Z0MA 2I07B 5KJRH 1J5OL 4KMQA 5L4FA 4AE1A 2LGNA 5E8PB 2EUZA 2DQEL 3ZLQC 2J1XA 3O81A 1PQZA 4BE5A 5C0BD 3ZOAA 1MH5A 2ZCZA 5EO9B 4UM9A 5IWLC 4YHOH 3U2SB 1F6LL 3AY2A 4C4UA 3JWOL 4NWTL 5AW0B 3P2DA 4ZXBC 1NFIB 1MJ7L 4KV5F 1AO7D 3MSPA 3O41B 4KJYB 4QNPF 5GSVB 2KPNA 3BW9B 4ZFOL 4OD1H 3ZYIA 4XP9L 3NTCL 5TD4A 1NPJA 3BSZL 1BHGA 1IX2A 1LWHA 2K6YA 3L3DA 4ICXA 2YK3A 4NN7C 3ULUC 3OKLB 4XPAH 1DQDL 4FQ2L 4HCRL 1OAXH 1J12A 5DS8B 1IQWH 3DSNA 3P0YL 4PY7A 2V2WA 1BGYD 4MB5A 4PG9A 3DIDA 3OZLA 4BKTC 3UTTB 3MRCA 3N41B 3TA3A 3PAVA 4ZUTA 4EI5B 2CU9A 1OAKL 3P9MB 1FO0B 3I84A 1A7BA 1BZOA 3IGFA 3K2IA 1XGTA 1AIFA 5B4MC 3BIAX 4YBQD 4YHIB 5AOIA 2VABA 5CD3B 4BUHA 4D8PB 1R75A 4XNYL 3B2VH 2CA3A 4XE5B 2F7OA 1Z7JA 5HI3C 1XH1A 1OSYA 2UXVA 4X4KA 4WI0B 2ZXGA 2YAQA 2J6EH 1L5GA 5F9OH 2OK0H 4Y4FD 5C08D 2OCCB 4Z5RB 1JZ5A 3K72A 4R5TA 1T2QH 2ZAIA 3IDYB 1KLUB 4X99A 1S5IH 3WFCH 2BW4A 3DXAB 1K8IB 4YH6A 5IUCA 4TUJB 2AQ2A 4HS8L 2BOBB 1H3XA 1NMAL 3AY4C 1MI5E 3T4AA 2FDBP 5DRXA 3WEOA 5IF0A 4G82A 3II2A 1S7SB 2GJZA 1CIUA 1A7RL 1DCLA 3L2LA 2P43B 3F5WB 1A47A 4HIEA 2TRHA 3T6VA 3UBXG 3V4UL 3V6OE 3GD1C 4QCIA 5B1JC 3OWRA 5CFHA 3GT6A 1GU2A 4IIQC 1B4JL 3P1VA 4N5EC 1RUAL 3T2NH 1MCEA 5BQ7A 1SLXA 4NRZA 3ELQA 2K6ZA 2YXWA 3E2HC 3V5KA 1K4CA 3NP4A 5D71L 2GQHA 2L3BA 1U3YA 4OTXH 5T3XE 3F62A 3GYRA 3P11L 3L3HA 4FI8A 2FEEL 2YLHA 5B39A 1YEKL 5A43C 1CYXA 3VFUA 1PNDA 2JK5B 3B6SB 4DN4L 1A7OL 1ZPLA 1S2EA 1VESA 2A73A 5I17B 4MS8D 2J4WL 2L4OA 4QHNA 5INCB 1OCOB 1FYHB 1UFGA 5IM7B 3UC0L 4UIKL 4A7QA 5HHMD 4AE0A 2WMPB 1IBGL 2C8NA 4OZHE 4L4VE 5C0FA 1CIHA 2GY7B 2I25N 5TF1L 3HZMB 4FXLA 4OZGE 2ZNXA 3UJTL 3SE9L 3EFOA 1OQXA 4NZFA 5E6UB 5HHXH 2WGNB 2VDPH 2OR8A 2Q6WA 1OPOA 4ZFZB 4XB3A 3DC0A 3QQ9C 4N24A 3L3IB 4M7ZB 5ALBH 1KJVB 1IAIM 5GISL 1CURA 1T1XB 5CHNA 1CGTA 2JI3A 1O6SA 5CICB 4YQXH 4RSZA 2FJGB 2Z8VC 4OIBA 5CD5D 4XODA 5I8OH 2RJMA 3QAZC 2YD8A 2ZSVB 3MV9E 5LG6A 1JZ8A 2W65A 4XN5A 5HJBA 3ALWA 1MW3A 1IEBA 1OF0A 3ZZ1A 2NNAA 4X9BA 1JGUH 3QJFB 5L2JB 1AD0A 1RMFH 1M2OA 2DIAA 3A6CH 4JX0A 3STBA 3BPOC 2OL3L 4J3OD 2OMTB 2HT3D 5ID1A 4FTDA 3VMNA 2AEQL 4N0RA 1F3DH 1E30A 2EXSA 1VPOL 4KPHH 5A3IC 2IVFC 3V4PL 4FNLL 2I32A 1N9PA 4DOHE 5DC2A 3IDNA 3CFCH 5EPMA 1TLMA 1M05B 1MHEB 1UWXK 2GITB 4OD2B 2BY3A 1XGUA 2OS7A 5ILTL 2GBTA 1LE9B 4YBLC 3BPNC 3RBSA 3D39D 2FBRA 1HHKA 1G6RH 3PWPA 2QADB 4U7MA 4LDCA 3O0RL 1G1YA 3B83A 4ZOEA 3OAUH 4UDTB 5HYFA 3DIVA 4XRCA 1BZDA 1PSKL 3K8LA 1JTPA 1H8NA 5FUOH 5KOMC 5K9QI 3BAXA 4BCZA 5MHSD 5I75B 4ZG1A 1DFXA 1BF2A 3E9TA 1D5IH 3QR0A 3VFTB 1WTGT 2YPVL 4PGBA 5HXMA 3N40P 1CIGA 1K3ZA 3QDMD 4YPGA 3S37L 1S9YA 3ZN6A 1UVQA 2E7MA 4MMZA 3RWGA 2JI1A 4OZFH 4FFYL 3UTPE 5CIHB 3WIFA 1BOYA 1MZZA 1JVOA 3WFDH 43C9B 2WYIA 4XX1G 1OB1A 4DEPB 1X7SA 4QOKE 4K5PA 4RIRB 2C3XA 4N9GB 1OOWA 2HLFD 3IWVA 12E8H 2BLFA 3S3PA 1AYRA 2ED7A 1NGXB 2ZBOA 2CDFB 4PJHA 4YIQB 2Q76A 2OMVB 5EO0B 4YFDB 3IMBA 2XYBA 4FCHA 2WSPA 3MRLA 1DBAL 5C7ZA 1C2RA 2QJPB 3ZKSD 5HGAB 2I7OA 3L9YA 2R51A 4R7DB 3U9UB 1ILUA 2GI0A 1TZGL 1J0YA 3H85A 5A6IA 4UIMB 1YMME 3VMPA 3IDMB 2NDGA 1QLFA 1JV5A 3GEFA 3EDDA 3LH9A 3BD5A 3QG7L 1H3VA 4L0YA 4B9JA 3HG3A 3QG6B 3RAJL 1BXXA 1ICTA 3L4XA 3C60B 5CXPA 3E8UH 3IS1X 1U3HA 2H32A 4QF1A 4H0LC 4GBXB 3IN2A 4YGVA 1A8CA 1KJ2A 3JV4A 3LD8B 1MLBA 2CWRA 1FH5H 4N2OA 4UILL 1DFBL 3TO2B 2WYZA 3QEUA 2X28A 4I0PD 2VB5A 3DTXA 2ERJB 1FYTB 3L4VA 2NY4B 4F24A 1TMCB 3O3BA 1UT9A 1QKZL 4DJMA 3CMOH 3MFGB 4IBYA 2ZAHA 3BUTA 2DEYX 3DUUB 3OKMA 2XKSA 1LWRA 1BFSA 3B37A 3HLAA 4PW3A 4Z7VE 4DGYL 4JO2L 3CH1A 3A21A 5CSGA 4FQIL 1EEQA 5F6HJ 3UAJD 4B5ZA 2WXGA 4L8DB 3O6LL 5ABZA 2RD0A 2NZ9C 4HGWB 1PZ5A 4P57B 3KR3L 3V6ZA 1IO4C 2C8SA 1ZT1B 3AREC 5A2KH 3HMWH 1I7TB 3NACH 1F18A 5GGSY 5ADOL 4PJ8C 1CRGA 1YMHA 5B7MA 1AO7B 5FLUA 2A6DA 3VA2C 4GAJL 2E56A 3OHMB 3AG2B 4ZBJA 1REIA 3QJUB 1B9KA 4NQEB 2Q87A 5FKAB 4W4OC 1VEMA 1L6ZA 3T0XA 1WSST 4PJHF 1ASQA 5BRQA 3G5WA 4LSSH 3S4SB 1E29A 1EZVD 1MWAA 4NUJB 1E27A 4ZD3L 4AZ8A 2CIKA 4XPFL 4HOZA 5F9JA 1X9UA 5E6ID 5E70A 1RURL 2A74B 4NOFA 1PZBA 1KEGH 5HHVH 3WDJA 3DX3A 2OX5B 3RU8L 1RY7B 3GDBA 3TJHC 2XI9A 3VNZA 1OGAA 4HUKB 2WO3B 1A4AA 1RZFL 2PR9A 1EEZB 2DTMH 4PJIE 4CA4A 4APXB 2IQAA 5MENE 2QGDA 1A6WL 1BV8A 1T83A 1XAKA 4OF6A 2Q9OA 2VN5A 4H2CA 4JUSA 4AITA 4L8BA 2PR4H 3QSKB 4NEHB 4AVIA 1E5UI 3CJJA 4PWHA 1NUNB 3V8CA 4XMXA 2CCLA 2BVOB 3S88H 1D2OA 1MCWM 4FQHA 1JZDC 1P84D 3N43B 3L73D 1GY2A 1JJUA 3BD4A 2F74B 1AQDB 4O02A 4IS6B 4LVEA 1LFMA 4NZJA 4PSRA 5E2UL 1CT8A 2DQCH 2LU4A 4LCYA 2QSCL 4QI3A 3QXWA 1J11A 1PYWB 2H6OA 2HA1A 1CR9L 3MLZL 1OSZA 3GMOA 2Z6FA 1I7UA 2GVYA 2IGFH 4JHBA 1UACH 4HMEA 5HYQB 3TBWA 2YQ2A 4NRXA 4OGAD 3L7FA 1M6OB 5E9DD 4MA1B 2Z1KA 3EGDB 4LKXA 5KYWB 1DJSA 3CN0A 1DE4A 1LQBC 2OMWA 3FCSB 4RDBA 2MHAA 1CSUA 4NFBA 1FPTL 2WQVA 4RWYH 2AQTA 4U1LA 1RCYA 4YSPA 4F15C 4R96B 2OCFD 3ARYA 4FQLH 2F1AA 2DQGH 5DD5H 3HE7B 1DQVA 3GSQA 1BBJB 1CDHA 5JNYA 5HHMB 5FF6B 1S7QA 2YZ1A 2EDLA 3VFNA 1TYRA 3E6HA 3FT2A 3VXSD 1ZT7A 1G1CA 3U30C 4PHZA 3KLAB 4WK0B 2XTJC 4R8WH 1Y7VA 1FQ9C 4KK5D 3X3GL 2AC0A 3CLEH 1EZSA 3MUGA 2X4OB 1TQSA 3RNQA 4JPQA 2D2OA 2FYYA 4HLZG 2K9UA 2YSTA 3LQMA 5KVDE 3QS3A 1JYVA 2DKUA 2HFFA 3KAAA 1OCDA 5HDBF 4BSWB 4MZ3A 3KPRD 4RGNC 5F1KC 5IFJB 3CC1A 4PJFB 4GAGH 4MMXB 4M43L 1N4XL 4ATTA 1D6EA 5IW1A 5TGBB 3VGBA 2I8FA 2B2XH 3VI4E 2MCAA 1GOFA 2JB6B 5J6HB 1FSKC 1V54B 3T1FA 1OAEA 1CD1A 2JQMA 3EYOA 4UUJA 4ELMA 3RE0A 3RJQB 3W39A 1GZPA 5F0LB 1WWCA 1J9TA 4QPEA 4FKKA 1PU0A 3NQIA 4NO5A 4AJ0A 5BXFA 1Q0XH 1I4FB 3VXMD 3D3VD 3AACA 2JCCE 1H9YA 1QKSA 1JDDA 2J71A 3PDDA 3Q6FA 4OCYH 4YSRA 3VACA 4LESA 2X4SA 2EXTA 3UCQA 4L2YA 3VXRE 1B2YA 2ITEA 4GXUM 3NH7H 5I5MA 5EFIB 1IQCA 1FNAA 3MRBB 5TJWK 3DX2A 3NIFF 5IB1A 4DP0X 2YCCA 3G5XB 2MCPL 2VW6A 4PRNA 4FA1A 2B0SL 4PJXE 3D39B 5FIEA 3U46B 3WDIA 2CQVA 4JY4A 5DLMH 3T65B 4QRRA 3N40F 4KI1A 2P5EA 4K94H 3MGTA 2QSVA 2ZXWB 1U8JB 4HP5A 4N2NA 1H3WM 5TFSH 4OCLC 1X6NA 4NPKA 3FCBA 4NP4H 5CGYC 5E2WH 3H1ID 1NICA 1DQML 4JFXA 1NCGA 5D9SA 1J05B 4IOIA 3BP4B 4XPBH 4NN6B 3QDMB 4NFCA 3CZKA 1L3WA 4YE4H 1F1AA 3C6LD 1E5BA 5EN3A 4DH2A 4LLAA 3ZTNL 5IJVB 5BRPA 4JZJB 3IF1A 4MQXC 2KZ1B 2YEVB 4EN3A 1CLZH 2CSPA 3OAZH 4M8QA 2HVKA 3W11D 3GLEA 2D4DA 5AW2B 4HD5A 5SWSE 4MD5B 5KVGE 1S7RB 2KUTA 3VI3E 4DKAA 1CRIA 1YQ2A 4OKVA 2X89A 5E1AB 1NBYB 2ZX8A 1QVOA 4WFGD 4S2SA 1KYUA 1HHGB 3T4YA 4ELMF 1AMXA 3EJYD 2VUKA 2FQGA 1A5FL 3QUMH 3KWTA 1NCWH 1R47A 1MREH 2DWYA 3LPOA 1C5CH 4XN8A 3ARDC 2UWEB 1EERB 1E43A 1CU4L 1CFBA 1FZOA 4X42A 3VD9A 3T09A 2P52A 1QFWL 4UB8V 1RUML 2GJ6B 5FWRA 1PKQE 4AK1A 2WAQA 1SXCA 2HT4D 4HHAB 3X12B 3IBOA 4QAOA 1SVZA 1RK7A 2FBOJ 1UKTA 4P06A 4EMZA 4FQCL 5D1ZD 1UJTA 2AK4A 4QJ3B 4WTZA 2ADGA 2UZIH 3KPSE 1CFVH 4IKJA 1UD4A 5JLZB 4MBRA 1E4KC 2B08A 1DBJH 1T04B 4I0PB 5MEPB 3VWKA 5EBWB 2JKIS 2WUBL 4GP4B 4HIIA 2D0FA 2K9FB 4UU9B 5KLVD 4FN0A 3V6OA 3KZ8A 15C8L 3EH4B 4KGJA 5DJXB 4JY6A 3L70D 1ZTXE 3P2TA 3WFBC 3SKOA 1Z9SB 2NY5H 4M5TA 4AXWB 1N10A 4JK0D 1XV8A 4JKLA 3EDKA 4BD4A 1IAMA 2V07A 5EUOB 1G84A 2CDEA 4X50A 5DEGA 1KB5L 4PSPA 4PBXA 1MFCL 1X4ZA 1BVZA 2W91A 1YDPB 1HJCA 3UYOD 5DJ2B 3SCMD 4OUUA 5D72H 4ODBD 5F89A 1GHFH 5E00A 4F57H 2FEJA 2X4NA 5GGRB 1XSOA 3HC0B 3QO1B 1MFAL 3WFHB 4OFVA 3ZKXB 4DKFH 2DWEA 1ZVSB 2V08A 2WWMD 4XVSL 3HZVB 3KD4A 4ELKA 1ND0B 2N3JA 5EIQA 3W2DL 3O2VH 5I1IL 2OW7A 3L5XL 1FZMA 4K94C 2ZOTA 2X1QA 3BXNB 2BFGA 4OR1A 4JDEB 1CBVH 5JW3L 4RZKA 4JHZA 4NDMB 2EDMA 1R33A 3NAAL 4UT9H 4UMGA 1U93B 2PYED 2YRPA 4PPTA 4PREB 5E6IB 1TUPA 2NSQA 4F5CA 3U4BL 1MCQA 3RNKB 1JRHH 2IADB 2YZ8A 4F8LA 4BE6A 4YJZL 4XBEH 2BFVH 3RL2B 2VH5H 2AKRA 2W0KA 4NO2A 4BWWA 2X3AA 5ABAA 3ZPDA 5JA9A 3QNFA 4G9FE 4AQEB 4PRHD 2F53D 5JHAA 5B38A 3G08A 3MRHA 1II4E 2AABL 3VDAA 3DJRA 1KBGL 2JTDA 3KL0A 3QI9D 4I3RH 5I1DB 5HGGS 1EANA 4FQ1H 3DHPA 4A2HA 4DP5X 4I18A 1MDAA 3I85A 4M7KH 5BUPA 3LEYL 4RDQG 3G5VA 2PCXA 5ISZE 3GHBH 4DWHA 2R29H 1URIA 4AYFA 3ATEA 1Z3RA 2B1HL 4Y4KD 3EADA 1HHIB 3OJ2C 2H6PB 5EC1B 3QPKA 5FYJH 3ZW3A 5DSCA 3MNZA 3VWJB 2EYRB 1HSBB 4OM1L 4XR8C 4G1EA 5MEQA 5JHLH 4DAGL 2VW4A 3HI1A 5CYTR 4I8DA 4Y5VC 3UTSA 5D7LE 1HXMA 2JH2A 3BH9A 5E9DB 5FYLH 2E59A 1P84J 2W9EH 4H25A 4F33B 4Z78A 1KFAL 1JZ4A 1OTSC 1CORA 1TU2A 3RKPA 1HJ3A 1FGNL 3UZVA 4EEEA 3KNBB 3LRSA 3MROA 4LSQL 1A6VH 3NSFA 3E0GA 3RGHA 3TNNA 2R2BA 1M60A 3D9AH 1CZ8L 2BSEA 2XG4A 5J5EA 3CFNA 3WNOA 4YSOA 3WO4B 1AZRA 4OLYL 2JELH 4G8EA 1MIML 1NC2A 3H7BB 4NKIH 1TZOA 3O2DL 4Y2OA 4G80B 3ZDZB 1NLDH 3UADA 4EN2A 5L6YH 4QHLA 2X4QB 5AW5B 3VXSB 1CSXA 4A68A 3S9DB 1CFMA 2F15A 4KK6C 1IGYA 5EU6D 3P73A 3HS9A 5CP3H 2ZOWA 3IKKA 2VOTA 3QPXL 3SY0B 4I48B 3TBTA 2FATL 3ATFA 2YEZA 3KPRB 3KYKH 1GH7A 1QD0A 4MD4B 2JLLA 1HYRC 1Z9LA 1IGJA 2JV6A 3BVNB 1S78C 2QQLL 9CGTA 3MJ9H 2AEOA 3RFZA 1BZQK 1BAFL 4MDRA 1MLCA 3T0WA 1HIML 2AJSL 3B43A 4P9HL 4ZJ9A 1I1AC 4KJQC 3VRJA 4H2AA 4KZDL 1F6FB 1XSJA 3BPCB 3CN2A 1IB5A 1E9OB 3QNXA 1EJFA 1Q9WB 2V5TA 3CDZB 3OMIB 4OFIA 4R0LB 3MRDB 4XVJL 5FYKE 1ZEAH 5CILH 3S35H 3SD2A 5IVNA 4GRMA 3VXMB 3D3VB 3DJZA 3SODB 3UTOA 3BSZA 1EDYA 5G5DB 4WFFD 5DI8A 1WEJH 4RFOH 4KKQA 5ANME 2KLSA 2P8LA 5TDNA 3S5YA 1FAIL 3U0WL 4P9MH 3O3DA 1JWSB 2AJXL 2DH2A 2W9DL 4A7SA 1DVFC 2F8OA 5DGRA 1SVBA 4RNRA 2XXFA 4KKAC 4XX1E 5CNHA 2AQRA 1JZ7A 4MX7B 2F2HA 5TQ2L 4G59C 1ZOXA 3VSUA 3BMVA 3C5JB 2HX8A 3LDBC 1RAQA 5KW9L 3H9YA 1MFDH 1U36A 3UAFA 4MJJA 1H8LA 2Y69B 5B3NA 1ZXQA 4U6VL 2ZXAA 1FL6B 4Z7IA 5C97A 3MRKB 1FOCA 3QS2A 1DZBA 3EFFA 5CSZA 3MVSA 1MEXH 1XH3B 3OX8A 4GAYB 1JV2A 3MRNA 1ITCA 1T0NB 4WV1C 4E41B 4IHOB 5C9JB 1QBBA 2P80D 5T1LD 3FS9A 3U4KA 2AI0L 3ARXA 3GJFH 2C9XA 2ZCHH 3QUKB 5L0QB 3RHWF 3ZUNC 3RHWK 3SPJA 1HCMA 3HRZB 4HKZB 1KOAA 1OARH 1NL0H 2HRGA 3BDYL 1CF8L 3SYPA 2UZYB 3FN0H 3C6LB 4JFDB 4JVWA 1R34A 1F2XK 3CK0L 3JWNH 2YK1H 1DQTA 1E4JA 2WTOA 3CHQA 2BSCA 5AW7B 2XQBL 4TRPL 3LH2L 4NQDD 4JS7A 2XOTA 2VRQA 1MUJA 4BELD 3TF7C 1YEGL 1Q9OB 4L37B 2M26A 2QPEB 4PEEA 4O1WA 4WTQA 4H8WL 2OYKA 1R0AL 3OL2A 1N68A 3UIZA 2IOMA 4UCFA 2WYHA 1ZLDA 5F88A 3AGVA 5D1XE 1J1XL 1X5GA 4IRSA 3SGKA 3BUIA 3MBEC 1F00I 2YBRB 5EUKA 4WEEA 4WUUA 1QHQA 4F58H 3ZL2A 3U9PL 4WIQA 4AG4H 3FQRA 1J1OH 5H37G 4MAYD 2QJKB 2D7OA 5T5FA 2PCFB 1QLEL 5DJCB 2WVSA 4OLZL 3BZEA 5IQ7L 5MENA 1NM9A 2B16A 5JHDE 1FGVH 1OW0A 2DQFB 1RIHH 4B9GA 3C6SA 4BDVB 2X6AA 4R2GD 3RTQA 2UYLB 3ARFD 5I76B 2OV0A 4PB9L 4WSJA 5D1ZB 5EBMA 2DQTH 2IH1B 4P3WA 4E9LA 5C07D 3F8UB 5FO2A 2C9UA 1PCXA 2VZUA 3N85H 4E9YA 2FQEA 4R26H 3O45B 3PJSB 3ZSTA 3PHQB 3ZL4H 1KN2H 1R5WA 2N56A 4BM7A 1KIPB 5KVEH 2ZOLB 1KB5B 5LGYA 2CLZA 4P5TD 1RZGA 2C3VB 4JVUA 1OAZL 1R3HB 3GIVB 3II3A 4IRJD 3P3YA 4NNXB 1A6ZA 5ECJE 3TBCA 2VLJD 3ISYA 1T2XA 2KMWA 5DMJB 2NYYD 4LVOC 1QYGL 3N1QC 4L3EE 3QZOA 1UCBH 1RZ8B 4XNXH 3KPLB 1PG7H 1UC6A 1QTPA 1U8HB 4LOEA 1NNOA 1KG0A 3L2NA 2AJUL 1G4RA 3IRPX 5GRUL 2OL3A 3K6DA 2Y22A 2ZCLH 3DVNB 4P23D 3CXHJ 1M3IA 4FB1A 3K2UH 3LKNB 4Q6IA 1DLFH 4U0QB 1BGXH 4EZMA 4M6OL 5F0JB 5GSRA 5EA0L 1E65A 3B3BA 4Y5XA 3ZBMA 2V33A 1DL7H 3GTVA 2HVBA 4LPXA 1HCYA 1F3RB 1RZIB 4PVLA 3WEBA 3DVGB 5IQMA 3TVMC 1PEZA 3RWDB 5FCUL 4LEXL 3SBRA 2GSIB 3S35X 4KI5D 3K6IA 2V7HB 1MRFL 5B1KA 5L2KE 3TPUB 5DQDL 1EO8H 4LEOB 4XP5H 5DGQA 2VHDA 3LXUX 2B15A 3BDBA 3WFEL 2XN2A 3FNKA 2ZXEB 4U1IB 3TIDA 4MNGE 1P6FA 3ORJA 3NJVA 1PX8A 3WENA 1AHKA 1TO4A 4ZAKB 2Z8RA 2NXZC 4NNPH 1ZANL 5F71A 1L4IA 2MQCA 2A6IB 3RIFF 4Q2ZB 2YPVA 4TSAL 3VH8B 5DVLA 3MYJA 1Q9LB 3RIFK 1WZ1H 2F7PA 1QRND 3B5HA 1E7UA 1TNNA 1DBBH 2OPCA 3MA9L 5CMAA 4EIFA 1XCXA 4H5SA 4PRHB 3BWZA 2DMGA 3L3GA 3VI4A 1BBDH 3VD4A 3TYGL 3DARA 2VDQL 2V17L 4GEIA 1YEFH 4FFYA 5HHNB 5KSAA 2OQJA 1HH7A 1AKJA 1HL8A 4RMTA 4U3XA 4KHXH 3E9UA 2DGEA 1MN4A 3D07A 5I8KL 3A4AA 2NQDA 2JF1A 2WZ0A 3VQMA 1C5BH 2XN9D 3QP3A 3UBHA 3S4SG 1XCWA 4EO5A 4MLIA 3ZGIA 4Y4KB 2BP8A 1WQVT 1F6AB 2YPKB 3PQYD 3MV8D 3EYSH 1KUMA 3CD4A 4FOMA 1LD9A 1MDTA 3QZNA 3DR0A 1GC1H 2BK8A 2HTLD 4ZQTA 4MNHB 5CJOL 4NM4H 5D7SL 4R83A 4AK2A 2R69A 1QSFD 5KBNC 2HKHH 4D0DA 1DVTA 3HPJB 1BVNT 2DQDH 1CGSH 5DMGC 3N1FC 2EVIA 3EJUA 2R1YA 1OL0A 3B5TA 2IAAC 4Y4HD 3EJQA 3MMEB 3BWAB 2V2XA 3QEQE 4JJ5A 2XIDA 1FJ1B 3DX9A 2ZYIA 4W68A 3Q8EA 4PV8B 4WEUD 3FRPB 4JR9L 2DJSA 4F7PB 3F7VB 3GGWB 3QUHA 4G7SB 2AQPA 1SY6H 4JCWA 4NHUA 2BNRE 4NPJA 2ILLA 1ZLWH 1VZIA 2BVPA 1I3RA 1BJMA 3D1MC 3DMMC 1U91B 4MJIE 2G9KA 1SUJA 4M48L 1LMSA 3SOBH 1NAMB 2VDLL 2ZONA 3OXRB 4TVSa 3K6SB 4LP5A 4P2RA 1YAZA 4QUOA 5D1QD 3DX7B 4ZS6C 3F7QA 5C0EB 3ESUF 5AAWA 1P4IL 2BNQD 3DX6A 3K74B 1SYSA 3GI9L 3GKZA 4N0YL 5GQBA 5I18H 3TZVB 4V2BA 1TG8A 2ENQA 3MLUL 4FQXA 5LCVL 3ZHDA 2C1UA 2QKIA 4LSRH 4PWJA 3QIWC 3UTQA 3EYFB 5B8CC 1ADQH 5KBDA 4MA7H 1UM5L 2ZICA 5HD8D 4V1DA 3LQAH 4BFKA 2B1AH 2QGEA 1OQOA 3X1NA 2HTKC 4JPKH 4CNIB 4E42B 4ZUVA 5F7FA 3KXFA 2VZSA 5AG9A 5LJYH 4I0KA 4ETQA 3EJTA 2F6AA 3V4LA 3QHZL 1KNOB 1BYPA 1KJMA 1SHSA 2GW5A 2GKIA 3OV6A 1CQKA 5GGTL 2Z8WC 1SQXD 1HL5A 2IWGA 1P9MC 3UBXI 4AVHA 5JMRA 4CVZB 2WOYA 5KSBB 2XV0A 3SPCA 3GC3A 4K3DH 3O3AA 5FYJU 1CICD 1XFPA 1H3PL 2DW5A 2E9WA 4WKXA 2GAZA 3WE6B 5D2NC 4HCGA 4JNXA 1AS8A 1DSFH 1GYVA 1S9WB 5IEHA 3FQXA 4EOWL 3DYMA 2BIMA 5GS0C 3VQLA 4R4FH 1MSPA 4BH8A 5ENWA 4ZNEE 5CZVH 1PG7X 3V0JA 4A2DA 4IRZL 4CVXB 1T7XA 1TLKA 4PJ9D 3L6FA 1GYUA 2IH3A 3ARWA 3EDJA 4URTB 4ADIA 5J6SA 1NCJA 1H9DA 4GW1B 4ORZC 3MBXL 2AV1A 2Y0SA 4QRPE 2CO7A 4N2KA 4XN4A 3DSFL 2OA9A 5D4HA 1ETA1 4Y2DA 3VXNA 2F5AL 2HG0A 2Y1VA 1NM4A 1QEXA 1I1RA 5BMFH 3OQRA 4E9SA 5C0JB 3I02B 4WHYH 4Q9QL 3NRFA 4I85A 3TN0C 3OHXA 4N2IA 1KYOW 2OYMA 4M1GH 4RA0C 5BV7H 3SDDD 2XWXA 2MSPA 1PLGL 3MOAL 2EDYA 4N2GA 5EIIA 4TNWF 2X3BA 4G8GE 2V3FA 3GMRB 3UZEC 4TNWK 1G7LA 1SQVD 4J3OG 4N90D 4O58L 4AQOA 1F90L 4K7PX 2OJEA 1G9MC 3NQKA 3OMAB 4G5ZH 3EO9L 3WKML 4CGTA 1ACXA 2DM4A 2Y5TA 1BLIA 3X39A 4IDLA 5E5MA 1GSMA 3DBSA 2C9RA 1JPTL 2LFEA 3W57A 5KS9E 4LSVH 3FU8A 4H1LB 4HJIA 4YDIH 2YOCA 1K8DB 4RGOH 3L9BA 3SDAC 2C1DA 4N0UB 3F12A 1OP4A 3NJHA 4NQDB 1HINH 2CJUL 2QV4A 4CU7A 3ZHLA 4P4KB 3NRPA 4M4RA 1F4XH 1JWMA 5I66B 2RCSH 3MLSL 3FTXA 5E2VL 4GMTH 1V27A 3QEGL 4UAOC 3Q1SH 5DR5L 2CNZA 1J0HA 2VN3A 1GKSA 2CUIA 4DKDC 1JPSH 2XX0A 4QYOB 4F2FA 1DQJA 1TF4A 5JXED 1UD6A 1BX2A 1AXTL 4BBWA 2V0AA 2XY2A 2XTSA 3JUZA 5HJ3A 1A6AA 1FCGA 2QHLA 5H8DA 2EH8H 3O4LD 2WW8A 3ZT5A 1UCTA 3UCRA 3VO0A 3C9NB 1CS6A 4MCMA 3AM8C 4R2GB 4DN3H 2O5ZL 4XOCA 1QQDA 4EVNA 1JMZA 1T6BX 3REVB 1NGPH 1ZWIB 1N0LB 2KL6A 1E3FA 1HKLH 1XEUA 3CFQA 5F96H 2D0HA 2W38A 1IL1B 3MJ7A 5JW4Q 4MTMA 4ORGB 5J3HC 1HEHC 5ISZA 1I6DA 1WZLA 5BOZG 3EO1A 1V8HA 4F2MB 1IM3D 2YAHA 2F8XC 4BZ2L 2HJKB 4GINA 3ULUD 3QISA 2IALB 2JLPA 3UO1H 5BZWB 2KC0A 4TULL 1DVUA 2VLJB 3EDFA 5JPNA 4L3FA 5DJZA 5CEXA 1RIVL 4Z7UB 3DUSB 4KJPC 1RZJL 2ICWI 3H3PH 4FFZL 4IBUA 4PIBA 3WY3A 3NK3A 2MH4A 2QJDA 1PG7W 5B4MD 3STZB 8FABB 2VDOB 3GJEA 4MDIA 4XAWH 5HI5C 4W6YB 3GXUB 5EV7A 5SWZD 2EXWD 4HHWA 4ZS7H 5KYXA 4HUXB 1E2RA 1U21A 3HS0C 1ORQA 5C0CA 1XF5B 1I9JH 1P69B 3V0DA 5JQIB 1IC4H 1JZJA 1NJ9B 2EE2A 2COVD 2TSAA 3ILDA 1P84K 4PJAA 1GPOL 4R84A 4U1KA 5FC9A 3HE6D 3MLTB 4QXUH 3FQYA 1LYQA 5F7EL 5I8CA 2XV3A 3BPLB 1SN5A 3TGXA 1CFTB 2EDDA 3H0TA 3SQOH 5EC2A 2H0PA 1U3JA 4W9LC 3D48R 4HUUA 2W80C 3W9EB 3G3LA 5EOTA 4KKCC 4JQIL 1ZS8A 2ESVA 5BV7C 1X5ZA 4JKNA 5J89A 2VDQB 5DJ8B 2ATPB 1NCAH 3L48A 4X8GA 4CU8A 4G72B 1G9HA 3RBGA 2XXGA 4JM2B 3I9PA 1RFDL 4G3YL 1S5HA 1AJ7L 5EEYA 1UUNA 4NZTL 3MACL 4PD4J 1M53A 1W16A 1ZA3B 3OAYK 3VJ6A 3KMDA 4R7LA 1D7DA 2WNGA 2FYUD 4LQFH 1BSIA 4ACTA 4UV7H 4Y19A 3U7WL 5KSUB 4OD3L 1FBIL 5KYYB 1NGQL 3T3MF 3B2DC 3U1QA 3LNDA 3PDOA 3DXAE 4HIHB 4NRYB 4E9VA 2ZOUA 5E5LA 1RJZA 2DMCA 4D9RE 2VLRD 2K7PA 3QHTC 5CLXA 2WBJA 1TKWA 3LKSB 3D05A 2XN9B 3ECBB 3H9HA 4YDKL 4DVBA 1A2SA 1XF1A 3WJJC 4LLQB 1OM3L 3PQYB 2ZG1A 1SFHA 2ZXQA 3MV8B 3UBFA 3GUTB 1U95A 2J5LB 5LBVA 1BG1A 5TTRA 4F9LA 2MPAH 4FEMA 3NVQA 4KBPA 3RWEA 4C83A 3UABA 1YEEL 2ZJSH 3UMTA 2UUDK 1F11A 2E27L 4LMQE 3PV6A 3PLYA 2HMIC 2LLNA 2YN3A 4TQEH 1DN0A 3CIQA 4OJFH 4F8NA 1OAQH 2W94A 4JLRA 4JHAH 3GRWA 1E8YA 1R3JB 4JFYA 3TA3C 2YAOA 3V0IA 1CRJA 2GTWB 2J6WA 2VDKB 2BSSA 3T8XA 1SLUA 3SE8H 1EAPA 4WAFA 2HN7B 3V0WH 3WXVH 1M7DB 3HN8A 4PG2A 3PL6C 3L8QA 2D3JA 5KJRL 3QUZA 3QUYA 1W6WA 2NNFA 4N87A 4PJAF 1ONQA 4K55A 4NSKB 1SDDA 2JKXA 2V8LA 4PP1D 4IMLB 4X8XA 4FNPA 5AD0B 4XWGH 3BVTA 4BCYA 4WI8A 4DZBA 5D1QB 5DDHB 4FRWA 1LO0H 3ERXA 1A6UH 4YHOL 5FAAA 1OKEA 3FB5A 4QRQA 5IQNA 1XTMA 4LCUB 1NEZA 4AI7A 4PRID 5FUCE 2E7HA 2BINA 2VSDA 5A3ID 3Q9QA 3T4AC 4P2QA 4OD1L 3KPTA 4BSVB 1GGUA 1YNTB 4MZ2A 5AEAA 1PX4A 3NZHH 3B56A 2ENYA 4XPAL 4RX4D 5CIDB 2V7NB 4UT6L 3RWIA 1OAXL 1IQWL 1WIOA 1XCTA 4QHUA 3WSQH 5T3ZE 2R0KH 3OJDB 5IMLA 4TNVF 1CXHA 2EIMB 2EDBA 4TNVK 2GSGB 4HKBA 3U9WA 2IH8A 3FO0H 1JN6A 4XO3A 3DHJA 2AEPH 2VAAA 2Z92A 5F8RC 2WAHA 2P24A 4HPOH 5HHOD 1O9WA 3S7GA 1YRKA 1BG9A 1T7ZA 1AHWB 3B2VL 2D0GA 3M1BA 4Z3HA 4YHPB 5ESVA 1HSAB 4AKOA 5I0YA 3CV5A 4OIIH 4H26B 3K0WA 3ARBC 4ZPVB 2F1EA 2OK0L 2J6EL 5F9OL 4IJ3B 5IROC 1CCZA 1SZNA 3QDAA 5DFWH 5FGBA 1T2QL 3R06A 5JHDA 2H4EA 3WFCL 1S5IL 1TETH 1FNGB 1OF2A 2CPCA 4P3DA 4FG6C 3BN3B 4TMPA 5DJ0A 2QTVA 4NKQB 2IAMC 4NQUA 1Y1UA 1KT2B 2BVQA 3KYMB 3BYTA 1U8NB 2EO1A 2BIOA 2JKSA 4XO5A 1HILA 4A7VA 3QEHB 3BUQA 5DHYA 2ICEC 4OFKA 1X7QB 3T2NL 2H32H 3NEOA 2E9GA 3V8OA 2AXGB 1ZS2A 5E6YA 3SDDB 3VFPA 4K9EC 1E8EA 1KJ2H 4XO4A 4PJEB 4MWFB 2WINB 4GSQA 4OTXL 3VFRA 1QBMH 5TQ0H 3CTTA 4M93B 4KKBC 3U0TB 2ITFA 5HYJA 2BC4B 2X1OA 2ICCA 4GRLB 1O9VA 1NU1D 2ZX9A 4HCIA 3D2UD 4KDTC 5LAXB 1MNUH 1XIWA 4WQOA 4WWNA 4X5WA 3HKZA 3LZOA 5HPMA 1OCWH 3QORC 1NIFA 4HFUH 4AVKA 5IFHH 2VR4A 3ELAT 1SQQD 2WNXA 3G5YB 4N3TA 3IJ7A 2V5MA 5LDSA 3EYQD 4WNQB 4PJ7B 3FC8A 3BKCH 3FONA 4PR5A 1IM9A 1XXDC 3QULA 1UGNA 3NCCB 1BIIB 1DVQA 4B9CA 3CXHK 1KZYA 1TTCA 3NSDA 2FWSA 3OB8A 4LCWE 5K93A 5HHXL 2VDPL 3OKDB 2IPUG 1HH9A 4HBQA 5D2LE 5I1KH 2NSMA 3FT4B 2IBGA 3PNWB 4MNGA 4M1DH 5I6NA 2X0VA 3SVWA 4WJ5A 1YFCA 5ALBL 2FWLA 2OMXB 1YY9D 2A0LD 5C09D 2MQ0A 4JAMA 3IMVA 3WEXB 5I8OL 2HYMA 2YD2A 4J5VA 3K0YA 4FEIA 2XVKA 5HVFB 3X14A 3O4LB 3T6QC 1XMEB 5HGBB 3SBWA 1SXBA 3QA3A 1KGCE 3NIDB 2EE3A 4TLTA 2NZ9D 1MWAH 451CA 5CUSL 3VG9C 5HSFA 5IMOB 2YLKA 3QCVH 1JGDB 5T5NG 4UOZA 4KAQH 2XFXB 1KJ3H 4AV4A 5I1AB 1ACCA 5KN5A 2G5BB 1DJWA 1JCVA 1TZIB 2FJFB 5J06A 1RMFL 2X6UA 3QVAA 4OLEA 4ZXBB 3H9ZA 3A6CL 2YMXH 2KZBA 3WY2A 4NZUH 3X13A 2ADYA 1WFIA 3ETBJ 1QEWB 5EF1A 1BEXA 3KYAA 1FYTE 1Z0NA 3P4OB 3BQUA 1BD2D 1KACB 3LPFA 4KPHL 3BMWA 3N44F 3D4ZA 3NCFB 4NN7B 5K9OB 1BPVA 3PXJA 4QT5B 1KN4H 2NX5D 2O6PA 3LB6C 3CFCL 3EFDL 5E5RB 2UZPA 3TIEB 1L9OA 4YHYC 1RHFA 5DEJA 5F3FA 1WCBA 3ZY7A 3BP6B 1AY1H 3E7JA 2VXTH 2DLGA 1VGKA 2QELA 4RSYA 2WPGA 1G6RL 5I6OA 4O02H 4X7FC 3ARVA 4GQZA 1MOEA 1WC7A 3LIUA 3CGTA 4AUUA 2C26A 5SWZB 4HGMA 1G0YR 4OF0A 4UQ3A 5H35B 5FUOL 2ZKXA 1K5NB 4AIZA 1SUHA 2LU5A 1AO7E 5E6SB 4DP6X 1D5IL 1MCNA 2BNRA 3M88A 4J28A 1XHHA 2PO6C 5FM4A 4YHKH 4HAKA 5BNXD 4NQEE 4FE9A 4MJIA 5ICYB 1WBZA 4BFFA 4AC4A 2VIRA 4C4BA 1S7UA 4DEUA 3F84A 3WN6A 4Z77B 3FFDB 3K2MC 3PREA 4ODWB 3NSYA 4W9CC 4FHKA 1AGDA 1FVDB 1U3HC 5DJAA 3WFDL 1CQYA 4QXTB 3WN5C 4RMQA 3OR6A 4C57C 2H8PA 4K8RH 4UQBA 4X0NA 1N2RA 3GB7A 4JN2B 5F7MC 4TVUA 3ROOB 3ZYZA 1KV7A 4IIQB 4FF9A 3L1EA 3QJZA 1FNEA 4FXKC 4BK5C 2R1WA 3TFKC 1W8EA 1E4XH 4HFWA 3E2HB 4HUWA 3ZT7A 2CHDA 5D70H 5C08E 4GRWB 2HVJA 4YHZH 2Q2LA 2BCKA 3PNRB 3BRDA 2YWZA 5DJ6B 1C9SA 1YUHA 4JPIA 4X6DB 2R2HB 5DVOA 3MQIA 2VLRB 2O61A 3TFBA 1GS7A 4N0CC 4HT1H 1NIBA 3TC9A 5IV2A 1QACA 2B14A 3HZYB 1TT6A 5C92A 3OGCA 2ZUUA 1VADA 4TNEA 4YHNA 1I8KB 3O1YA 2R4SH 1GAFH 1KXQA 2E5EA 1AXSB 5TH2B 3GSXA 1CUOA 4ZNEA 3OJVC 1E9PB 1EA9C 3NCJH 5CBEA 4LOFA 3VMOA 1DVHA 4GQ9L 3QRLA 1MW2A 5I28A 1FNFA 3L95B 1JP5A 1AGCB 1FH5L 1QFUL 3F64A 3I75A 4X7TB 5JO5B 1T0PB 2AGJH 4JG5A 3FCTB 3P4MB 4MQ7B 3SGJA 5D7JC 3CMOL 4TLKA 4OAWA 5CJXA 4NQTA 3QAZB 5IW3A 2A6KB 1ZVHA 3MX0B 1L9RA 1ZSDA 4EUPA 1E2WA 5KG9B 5CR8A 2VDMH 4HJ0C 4M7LH 1A1MA 5HHME 3ZL4L 2MQGA 3FXIC 1R5VA 1JHKH 1SJHB 4ONHB 4ISVB 3MJ8A 4G8GA 1MRCL 1ZJBA 4GW4B 4ZO8A 1P7QB 1KTLB 4QKTA 3VB8A 3MNVB 3LCYA 2JIXD 3T0DA 3MGOA 4HK3N 3QJXA 3HMWL 1ULVA 3NACL 2YD7A 3BPOB 3T8VA 4HWNA 3WC8A 2WQAA 3SBPA 4PRIB 2Q8AH 5LGJA 3BGMB 2CKNA 4WU7B 4TVPH 2CIIA 2WXFA 4LPVA 1D6VH 3FDWA 4PJFE 3ASWA 2EACA 1QA9A 4N86A 1ET5A 4C54A 2RQ8A 3HEIB 3FUDA 4HS6A 4BJLA 2IV9A 4LLMB 4BFJA 1J86A 3C5SB 4EF3A 4LSSL 1LO4H 4WF7A 3FRPG 3BPNB 4YBLB 3HR5A 5GRYA 1IGIL 2AJZB 5KEZA 1I1FB 2Z0UA 4O2FA 1J8SA 1NLBH 3I6GB 2BPBA 3IS0X 4JRXB 1KEGL 5HHVL 1TJGH 4UZGA 2GCYB 3WTUA 5HHOB 5IB4B 4AT6B 3RVVC 1IBZA 1AVAA 3EF7A 1B6DA 2E6QA 1VKXB 1T66C 3BESR 4PJCA 1OK8A 4YEEA 5DO2D 5TE4H 1RUKL 4ZDHA 4OV5B 2PR4L 4JMNA 1WE5A 3MV11 3O8XC 4JQVA 4NUMA 2WLHA 4ZSOB 1MWOA 5IESH 1QL3A 2EUWA 3S88L 4Z7NB 2DBLH 4YXKL 2YXFA 1BCIA 2ADFH 1JYWA 2ADIB 3D39E 2ZUWA 3D0LA 4XCEB 2IAND 4MSWB 3KLSA 1CFSB 3QFGA 1GCYA 2VL4A 3D18B 2NZIA 3GXMA 3IJEA 4JKPH 4R3SA 1C2NA 1R24B 2GK0A 1G4MA 3DVFA 4OGQC 1IVLA 4I7ZC 5ERWA 1CE1L 5F7BA 2BVYA 5IQ9B 2H1LM 1XGQA 3WEMA 2IGFL 5K1NA 1UACL 5MHSE 4TL4A 1OWRM 3HCVA 3T0EA 5LGKA 1EMTH 4MQTB 2OSLB 3GPEA 4GLRI 5E8PA 4RWYL 2OKMA 4IBSA 3SJVD 1OCCB 3QDME 3POHA 4LMQI 3SEPA 2A83B 2FWOB 3D2UB 4FQLL 2DQGL 5DD5L 5EO9A 3RGVC 2XICA 2XWTB 3ETTA 5E2TH 3U2SA 4B7IA 4UQIM 4DVRH 5KBKA 1P2CB 2DQHL 1UKQA 4M61B 1N0XL 1NFIA 5IVXA 3Q43A 3FTWA 3VD3A 3BW9A 1QUNA 3B9VA 1BZ9B 4R8WL 3TO4D 3DDGA 4QY8A 3CLEL 5CIPA 4E9RA 4ODSH 5T3XH 4Y5YA 3FT3B 4GQRA 3QNYB 5DS8A 1FL3A 5F3HA 4U2ZA 3FH5A 4LF3A 4WW1B 3ISWA 1GS6X 5EEUA 3UTTA 5IEKB 4N8VB 2N3BA 4EI5A 1OCRB 3F01A 4CW1B 4I9XA 5A2BA 3T04D 4GAGL 4FXGA 4KKZA 4YHIA 4NFGB 2WWOA 5CD3A 3UPRB 3QHFL 1U3NA 4P04A 5DRNA 2GJ6E 2B2XL 2QQKH 1NZRA 1JPFA 1YJDC 4PJCF 1SXAA 2XIBA 3WU1A 2NTFA 3H3KA 3VFVA 3PWNB 2YA2A 1CXLA 7FABL 3O9WA 3AREB 4H1LG 5LCVA 3L2MA 3MODH 5LAPA 1NMCC 4J12A 1Q0XL 3FQWB 3DXAA 1PZSA 2XPYA 4PWGA 4TUJA 1BQSA 2BOBA 4MJ5B 3AXLB 4OCYL 2PXYC 3PP3K 2M2DA 4PD4K 1XB3A 1S7SA 1LC2A 4Z0BH 3DIFA 5F70A 1PD0A 2A38A 1CLOH 2EYSB 1BD2B 3C5ZD 3LY6A 4YL9A 5F7UA 2QDVA 4PGJA 1JGEB 4ZFQA 1F3DJ 2NX5B 3JVGA 5H4YA 3FF8A 1I8PA 1AG0A 2DQIH 1OTUC 4HQQH 5H4ZA 5LWYH 2P5WD 1S4IA 1MAMH 3P3SA 4N0FB 5EUOE 1MJ8H 2C1VA 2OMUB 3BKYH 1LP9A 2OMZB 1A22B 1BMGA 1R5IB 2BRRH 4P0DA 3O6KH 1BQHB 1RULL 4JO4H 2D31B 2PACA 2L8AA 5DEZA 2VE6B 2J8OA 3S5ZA 4PCTA 5TFSL 3OBAA 1CXFA 4OZFB 5I0DA 3LN4A 2QV2A 1GXEA 3QIBA 4NP4L 2W8CA 5E2WL 2YJLA 4IU3A 4AQAB 4RMSA 5AW9B 5IVXF 2CBQA 2XQYA 1QMUA 1WPCA 1KGUA 2EECA 2DS4A 2DYPB 1JPGB 3QUXA 1KB9J 5IG7B 1MHCB 4JFSA 4XPBL 1ETZB 1NPUA 2ZP0T 4B9IA 3U0PB 1CFNB 4YE4L 5JW4R 5IBLC 2AJ3B 3GNML 1VHPA 1T21A 1U8KB 1S9XB 1FF5A 3JVFC 3QJVB 4PRAB 5GZNA 5EZJB 2EUVA 3NFPB 2W9LA 4UDUA 3X11A 4WJKB 1N5YH 3WIAA 1CLZL 4JPVH 4QRFA 4WHCA 4ZFZA 4Q14A 3HUJA 1ML0A 2GJJA 3L3IA 4NKOB 3W9DA 4IKKA 3TT3L 2FH8A 1DO5A 3VWKC 6PAZA 1JHTB 3IXTA 4PTUB 5AWNH 1OTSD 1Q9KB 3IDGB 3LZFL 4N20A 4A37A 3L72D 4M7ZC 5CU5A 4BFGA 1V3JA 4WI4A 1IT9H 1INEH 2AMUA 3WS6A 3QUML 1NCDH 1NCWL 3J07A 2VSMB 2B11B 1MREL 1QSEA 2EDXA 4G9DB 4LXFA 5MP6H 3UROR 1C5CL 5AB2A 4YC2B 2EIZB 5C6WH 4S1RH 1PNCA 2DQEH 3FHEA 3MO1B 5DTFA 2XWBA 3QNZB 3RVWC 4HJGA 3UXFA 3GXTA 1W72A 2QHRH 4Z8FH 2GYSA 2FH6A 3CVDA 2C4FU 2GTZB 4QYAA 2E6PA 2EXYC 4URKA 1X5MA 4W4NA 3DECA 4LPWA 5DK0B 5E9DE 2UZIL 1KSRA 1DEEB 3L1FA 1CFVL 1J88A 4EQ2A 1MKFA 4WW2A 3HB3D 2P49B 5ESQB 4J39A 1N8ZB 4HX1B 1LP9F 1DBJL