3ZBMA

Structure of m92a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
455
structure length
455
Chain Sequence
b'LPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKAPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
total genus 148
structure length 455
sequence length 455
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2012-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3zbmA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zbmA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zbmA02
3OMAB 1EB7A 4HCIA 4DP2X 5I6KA 3AY2A 4DP9X 2CBPA 1CTYA 1KV9A 5CIBB 2IDFA 4F2FA 1NIBA 1N50A 2A06D 2UXFA 3DKHA 1CUOA 3UAEA 3X1NA 2FNWA 3AG4B 3N55A 3GXUB 4FA5A 5I6MA 5E9NA 1HJ3A 1MZZA 2IDTA 1A4AA 4NERA 3ZOWA 3FYIB 1PZAA 3CP5A 2D0WA 3H1LD 1PCSA 3ZX1A 4XXLA 2NRDA 4FB1A 1RAQA 3IN0A 3FQ2A 1M60A 1DW3A 2PPFA 2AXTV 4JHUA 1KCBA 3OMIB 4JHVA 1DT1A 3H1ID 2XX1A 2IWFA 4GEDB 1X9UA 1HRCA 4TXVB 3WI9A 1CHJA 3PAVA 4EIEA 2FQFA 3QJVB 2P80A 2UXVA 5CIGB 5B5EV 2B3IA 3IEAA 1IZL0 1R1CA 2VM3A 4W1TA 4FA7B 3X2QB 1J9TA 4N4YB 1F1CA 1NPJA 3EH5B 4H0JA 1TEGA 2BP0A 1B3IA 3FSWA 2VSMB 2XV2A 1SHWA 3PXTA 4BWTA 4BXVA 2C1DA 1E5ZA 4DP7X 1XMEB 4E9WA 1RZ6A 1CCRA 1L9SA 2BZCA 2WO3B 4YSQA 2BO0A 3L4OA 1KYOW 3L4MA 1JZEA 2PPEA 2PPDA 2GSMB 1ZDQA 5F7BA 4G7RB 1MDAA 3PH2B 4L3HA 4EIFA 2OJ1A 2JFCA 5CYTR 4FANA 2C2CA 1BE3D 3QJRB 1KDIA 2YAOA 4KNSA 1WA2X 1AOQA 5KAIV 3NJKA 5D4HA 1OOWA 5D4JA 5IY5B 3FU8A 5CICB 1JXDA 1CSUA 3H1JD 1NZRA 1V55B 1VLXA 2XU9A 1SNRA 1ADWA 3X1FA 5LDUA 4WQDA 1DW0A 1ASQA 3ABMB 3QJTB 1NTZD 1OE3A 3NJMA 4YE1A 1A2SA 2HX8A 1L0ND 4KNTA 1NIAA 1BYOA 1WS7A 2RACA 5AZUA 5GTHV 3NJJA 4E9TA 3FSVA 1E29A 1L9OA 1KB0A 3WIAA 3ZOYA 2GB8B 1JXGA 1ZIAA 4MFHA 1NTDA 1FI9A 2YK3A 3T71A 2C8SA 4AX3A 3PCYA 1JOIA 2EILB 4L3GA 4A68A 1XB6A 1CHHA 4L1QA 2UXGA 5I5IA 3RMZA 4CSPA 4WQ7A 1CSWA 1OAEA 4YSUA 1GSKA 3CWBD 1C75A 1J9QA 1WEJF 1NU1D 3HEIB 1CRGA 4KO6A 4A2FA 4AKQA 3SQRA 2QDWA 1CO6A 3TA4D 2VW6A 1GS6X 4HHWA 1NMLA 2PCCB 2EINB 2FJSA 2IAAC 4KO7A 4NAJA 4YSDA 4GP5B 4UB6V 5C9MA 1HFUA 2PCYA 1CIEA 3WU2V 1QL3A 3ZIYA 3UACA 3NT0A 4GY4A 1XB8A 3CYTI 2ZOOA 1ZZHA 1E30A 1GYCA 2XX0A 4WQ9A 2B08A 1CTJA 1GS7A 4V2KA 4YVNA 1ILUA 3HQ8A 3T6VA 2GC7C 3S8FB 2FT6A 1V54B 1NPNA 1YIQA 2MRYA 1H33B 1W2LA 1KX7A 1DW1A 4EIDA 1L9PA 3AG3B 3NP3A 4G72B 4M4RB 1AZCA 3FSAA 3RN0A 3C2CA 1OF0A 3BQVA 3GDCA 3GYRA 1NIDA 1MZ4A 4KO5A 2BW4A 3CDZB 3X1GA 2VHDA 2JXMA 1YNRA 2L4DA 3DTUB 4P4QB 2P80D 2BPBB 4KO9A 2GIMA 2PP9A 3NWVA 2EIMB 2GI0A 2VSKB 2QPDB 1L9BC 2YIUB 1CC3A 2IWKA 1S6VB 1FI7A 1WA1X 5AKRA 3OA8B 3UAAA 1NTKD 4A2HA 1AOZA 2YAFA 1CXCA 2I8FA 1C7MA 3TGUD 1P84D 2FQGA 1M9WA 4A66A 3ZBMA 1A4BA 6PAZA 5EXQA 5C0ZA 1CEDA 3VYMA 3NBSA 1JZFA 2IDSA 2XXGA 1ET5A 1FA4A 1MG3C 4JKNA 1AKKA 3CZUB 3DR0A 4HIPA 1RZ5A 2PLTA 1R0QA 4E9YA 4AANA 3QJSB 1A4CA 3FQ1A 1LMSA 1DIQC 2CXBA 1C6SA 1ASOA 1IBZA 2LITA 1SQVD 2XLLA 2YAEA 3S8GB 1COTA 5I28A 1M57B 1NWPA 1AZNA 2XVBA 3NJHA 4YSOA 1UATA 5PCYA 1MG2D 4GYDA 1PNCA 2YAQA 4BK5C 3L74D 2CA4B 1J3SA 2H47C 3FPYA 4UAHA 4FA4A 4RH4A 4YVUA 5EHFA 3ORVA 2BCNB 2N9IA 1BQ5A 3WNIA 4P5RA 2BH4X 1A8CA 1PLAA 1GJQA 3KZIV 1SQQD 1H33A 1PPJD 2YCCA 1AYGA 5B66V 5DF5A 3C75A 1NMIA 3ZCFA 1K3GA 2I7SA 2YAMA 3CX5D 4Q8BA 1PZBA 3CDZA 1KCWA 4HCFA 5KKZB 1ZDSA 2YXVA 3U25A 4A67A 1N90A 1ZRTD 1JZHA 2N3YA 3QPKA 3ASOB 1DW2A 2OZ1B 1NINA 1IRWA 4BWUA 4GYBA 5I26A 2D0SA 2PPCA 2R7EA 3H1HD 3M97X 2HXAA 2XV0A 2ZXWB 3HQ9A 1CRJA 2GBAA 3NJFA 2BGVX 4PD4D 1CRYA 1E65A 1I8PA 2PP8A 3X1EA 3JTBA 3X1BA 1TKWA 1LS9A 1WAEA 3HB3B 3EH3B 3OCDB 1TEFA 1AZBA 4UF7C 1RZPA 2N3BA 1CIHA 5E79V 1RCYA 1SF3A 1ZIBA 1SQBD 3NSYA 4DPAX 4YSEA 1CURA 1GY2A 2BW5A 2CUAA 2JKWA 5I6OA 3CU4A 4WQ8A 4WQBA 2ZONA 3H4HA 2ORLA 3HQ6A 4LJIA 2N9JA 2QJYB 1M56B 4GP4B 4KOBA 4YSTA 3V9CA 4CSZA 2PCBB 1CYJA 4AAOA 1LC2A 155CA 1CYWA 2HX9A 2FTAA 1PP9D 2B11B 1E67A 1C2RA 3S3BB 3CVDA 2C9XB 1GDVA 2ZZS1 4AKPA 4H0KA 1JZIA 2HV4A 3L72D 3PPSA 3PXWA 5TK4A 2UXTA 2IDQA 3ASNB 1CXAA 1NIRA 4QKTA 1JVOA 2B4ZA 1AG6A 1HH7A 4Q5PA 1JZJA 5I6LA 4FAVA 1OCCB 1PAZA 4K9JA 2FWLB 2J55A 2HX7A 3OQRA 1H32B 3NP4A 4WKXA 2BP8B 1BL9A 1BXVA 2V07A 1V10A 3CG8A 4F2EA 1B7VA 1H31B 2JTIB 4QAOA 2E86A 2XWZA 4KOCA 5ANHA 5TK2A 1AACA 1C6OA 1VYDA 2OZ1A 1SDDB 2YXWA 3D12B 1SFHA 4QLWA 1YCCA 3CVCA 2BLFB 1AAJA 1RKRA 1RZQA 1ET7A 1GKSA 1IUZA 1DZ0A 1PZCA 2W8CA 3WFDC 2ZWNA 2FQEA 3L70D 3ZOOA 2C1UA 3BCCD 1AZUA 1PLCA 3FPXA 3MBWB 2H3XC 3OCDA 1T5KA 3WFEC 1FHBA 2XUWA 2BH5X 1KV7A 1KYOD 1KX2A 3FYEB 1HROA 3PLYA 2AI5A 1JVLA 1H9YA 5CIDB 2GB2A 4ENZA 1I55A 2IWEA 3VNWA 2I85A 4WTQA 3T6XA 5GTIV 3SWSA 2QPEB 1AIZA 1SFDA 4X4KA 1GY1A 2QDVA 4N0KA 1AOFA 2PPAA 5IY51 2DYSB 3JBTB 4KMGA 2N18C 3CVBA 5DFSA 2I7OA 3S3CB 4YSCA 2CE0A 3UABA 4WQCA 1L9JC 3A9FA 3RN1A 3WKQA 4G70B 1YEAA 6PCYA 1J9SA 2FWLA 1NIEA 1FWXA 1L9RA 2GC4C 1H32A 1J5CA 2VMJA 1W6WA 4K3IA 1C2NA 1CC5A 2BP8A 5B1KA 1BXAA 1H31A 1AANA 4DP0X 4DP5X 1LC1A 1U74B 1SDDA 8PAZA 3WFCC 1BCCD 3TBBA 1A8ZA 3AG1B 2Q5BA 3O20A 1BEXA 1F56A 1CRCA 1YICA 2UX6A 5B1JC 1ETPA 2X87A 3T6ZA 5B6QA 1NNOA 1TU2A 2FT7A 3MK7C 1HZVA 3FSZA 2GC7D 3SJLA 1GR7A 1OCRB 2N18B 3PXSA 3IBOA 2B10B 3L73D 4RSZA 1WS8A 4UB8V 4F7KA 2MTAC 3NBTA 1EZVD 1QL4A 3SBQA 1F1FA 1CIFA 3L75D 4D6TD 2VW4A 3WUIA 4DY9A 1NTMD 3ZDWA 5A7EA 5TISV 4J20A 1A3ZA 3NYKA 3WNJA 5KLIB 4A2GA 2DV6A 4YSSA 2JQRA 3WG7B 4G71B 4O1QA 4G7QB 1AG0A 2CALA 3UGEA 2PCFA 3DIVA 1IC0A 1E8EA 4G7SB 1SQPD 1YTCA 1N68A 3NSCA 7PAZA 1H1OA 1QYZA 5I6PA 2CE1A 1BXUA 4Q89A 1GIWA 2BHFA 1KDJA 3MK7B 1OV8A 1N15A 1FCDC 3ZOXA 1MG3D 3ABGA 1E2RA 4DP4X 3HQ7A 4PW9B 2AANA 2VN3A 3CXHD 1ZPUA 2AZAA 2Y1AA 3EF4A 2X88A 1BAWA 1X9RA 2UX7A 4BXSV 5H2FV 2EIJB 3ERXA 4YSRA 4E9VA 1IRVA 4PAZA 4AALA 1N9CA 4Y5RA 1RAPA 2OV0A 2HZHA 3OA8A 1BGYD 1GU2A 1DVVA 4O1WA 1ILSA 2BCCD 4IL6V 3O5CA 3SBRA 4PWAA 2BZ7A 5I6NA 1JZGA 2YAPA 2B0ZB 3NSFA 1BYPA 1CSXA 2AIUA 2QJKB 3PAUA 3QJQB 3RYMA 1CCHA 1CRIA 3FT0A 1WVEC 3H4FA 4YSAA 5DJQC 2QT6A 2IBZD 2AVFA 1LFMA 2AZUA 3L71D 4WQAA 1JERA 3N2JA 4A2EA 4E9QA 4PCYA 4U3FD 3S3DB 4DP8X 2XXFA 9PCYA 1W5CT 1L9TA 2VM4A 3OD3A 1YLBB 1KB9D 2ZXYA 1CTZA 1I6EA 1BQKA 3QQXA 5FC9A 1HZUA 2VW7A 1IKOP 1IBYA 4FA1A 2IH9A 4HALA 1SHXA 2BWDA 5B1JA 4BDVB 2J5WA 2DGEA 2FQDA 1I5TA 2CAKA 3L45A 4DP6X 4EICA 1J5DA 2HRGA 4E9XA 1S5LV 3WFBC 2FYNB 1YFCA 2Q9OA 2DY2A 2DWTA 4L0PB 4A2DA 2MTAA 1DIIC 1NIFA 1I53A 5DJQB 2W88A 1CYIA 4HZ1A 3KW8A 4E9RA 3FU7B 3SVWA 3ABKB 1CHIA 2TSAA 4GP8B 3G5WA 4UANA 1FOCA 3PAZA 1OCDA 3ABLB 1AR1B 3A0BV 1HAWA 1HCMA 2WO2B 4DP1X 2HLEB 7PCYA 451CA 1NWOA 4HAKA 3RLMA 2J57A 3UADA 1L9QA 3OM3B 4P5SA 2EXVA 2HRHA 3O0RC 1KBWA 3SBPA 4FAAB 1ASPA 1OE2A 1XB3A 1SF5A 2B12B 1ET8A 2IDUA 4XYDB 1KYAA 1DVHA 4E9SA 3IE9A 1OE1A 1HJ4A 4GXFA 2GIWA 3H56A 3V9EA 3DP5A 1AS8A 2EIKB 3PXLA 4WQEA 1J9RA 1L0LD 1URIA 2AFNA 3T9WA 1I54A 1C6RA 2ZBOA 5CIEB 1OCOB 5B7FA 1A65A 1JDLA 2CCWA 5I5JA 3FU9A 3H1KD 4PJ0V 5AFAA 1EHKB 3EH4B 3KW7A 1GQ1A 1W8EA 3NSDA 4YSPA 3VRDA 3NJNA 1NICA 5CIHB 1KGYE 3T6WA 4BDVA 5CIFB 3TYIA 2J56A 2DYRB 1KIBA 1QLEB 4NB7A 1SJMA 1CYCA 3IN2A 1FJ0A 2XYBA 3WKPA 1CRHA 4M3HA 2H5UA 4KNUA 2GHZA 3JT2A 3QJUB 4HHGA 1BQRA 5AURA 3TBCA 1GW0A 5D4IA 3TASA 1CSVA 3BVDB 3MX0B 1ID2A 2YQBA 5B1AB 1CNOA 2DVHA 4MU8A 1YEBA 2V08A 2CJ3A 3FU7A 3NJGA 351CA 3NJIA 4DPCX 2MHMA 4JCGA 1ETJA 1KBVA 2N0MA 3FS9A 2QJPB 2ZONG 1MZYA 2LLNA 3TU6A 4DPBX 1PNDA 1AQ8A 1QKSA 3SXTA 1E5YA 1SQXD 1N70A 4AI7A 2PP7A 3A0HV 1CYXA 4AAMA 1PMYA 3NJLA 2FRCA 4AKOA 4YL4A 2DWSA 2A3TA 2GC4D 5KAFV 4FA9A 3CX5W 1NDTA 1WA0X 1GS8A 2IH8A 1FI3A 3CXHW 1DYZA 3AZUA 5B1BB 1HJ5A 1M70A 1IO3A 1PLBA 4ZK8A 4NFGB 2XTSB 4AZUA 4BWWA 1C52A 1A56A 2R7EB 1IQCA 1CORA 1MG2C 2Y69B 1K3HA 1PF3A 1CIGA 2BWIA 2LIRA 3O1YA 5B7EA 1AS7A 2PACA 1QNIA 2BP0B 2FT8A 3EHBB 4EF3A 1AS6A 1U75B 5F7AA 1OCZB 1I6DA 2YARA 2C1DB 3FQYA 1ZV2A 1H9XA 2OCCB 3AG2B 3OMNB 3WC8A 4W9ZA 2XV3A 5B3SB 1JXFA 4N8UA 2FYUD 2YAHA 5PAZA 1AZRA 2TSBA 1HAUA 3DMIA 1QN2A 5I5MA 1I8OA 1W6LA 3AW5A 2C1VA 1FFTB 5KLVD 3X39A 2WSDA 1EZLA 1PY0A 5B7MA 3SLEA 1M6ZA 2CA3B 1QHQA 4HCGA
chains in the Genus database with same CATH superfamily
3AACA 5GZNC 3DROB 3HHRB 1KV9A 5CIBB 1DHKA 3FFDA 4FHBD 4HS6A 3MNMA 3D34A 4N2AA 5C0FA 3IDGA 3ILQD 1NGXB 1LD9A 4PIBA 1TYJA 2OP4H 2R0ZH 3Q0HA 1HNFA 1AQKL 1DLHA 3MNZB 5J0BA 1HXMA 4LLQB 3S48A 4WFEE 3HBPA 1KCBA 4YXKL 4CVXB 1AOHA 3MLPA 3QFJA 4AXWA 3H1ID 3PWPA 4Q9RH 5GS1C 4NX0A 3QUZC 3ECWA 3WI9A 1HSAB 4GMTH 32C2A 2OR9H 1KGIA 1E7VA 3GRGA 4H25B 4PGJA 5B5EV 4FA7B 1R1CA 1ONQB 1NCDL 3VFMA 3L2LA 4U7KA 2O61B 4QRPE 1GSMA 3LRMA 1NEZA 1DBAH 3FCUB 4XWGL 4XI5D 2MQ3A 3BQUD 2WO3B 4TRPH 4GG6F 3TJPA 2P49B 2QJDA 4KX8A 2FX8L 4AVHA 2AQRA 3MRJB 5CBAB 3LN4A 4FZEH 4Y0GA 4BHUI 1OZTG 4MS6A 3HMXH 3P4NB 2VN4A 2AEQH 3P54A 2QADC 3ZHLA 3UMNA 5F89A 4FA6A 5HP5A 3QJRB 5AKSA 2CNYA 3OKDA 1OGAB 1JPFA 1CFBA 1AR1D 1HH9A 4I8DA 5DHXB 4JDTL 4M7JH 4UAOC 2R69H 3MV9E 1VLXA 4U6TA 1SNRA 3PJSB 2EADA 1KELL 2V5TA 1HCZA 3PNWA 4NM4H 5DD5L 4I0KA 1OE3A 1S7VA 4OQTA 3OKEA 4YZFE 3J07A 4YDLB 1NIAA 2DQDL 2WB7A 3AT9A 3QAZC 1H5BA 4NXKA 2K6YA 1T3FB 2JXMB 3VGBA 1K8DB 4JQIA 3QI9D 2E9JA 5E8OA 4OJYA 1VPOH 3IPBA 2R4RL 4E9LA 3PGFH 1JZDC 5F9WC 2VR8A 1VFMA 1M6UA 3FQWA 1G7QB 4HZLA 1JOIA 3D09A 1LE5A 4ZJ9A 2G5BA 4XN7A 3P11L 1KNOA 2J1WA 4OJFH 1NU1D 4CGTA 2XNAB 1NMLA 1LWJA 4ES9A 4KJYB 5JDSB 1B4LA 5E00A 2R2EA 5C9MA 3U2SB 4Q2ZB 1T21A 2EDTA 3BMVA 5C09E 4DKTA 4R96A 2ZCZA 3ZOAA 2OCJA 3EYOB 1VEMA 1S2EA 1YZZA 2XBZA 3SDCB 3I50H 4B50A 4ELMF 4LT7A 2XZCL 4Z7OB 5CUSL 2RR3A 3HQ8A 2GUOB 3QXUA 4XOBA 2DQFA 3MJ9A 3O3EA 5DHEA 3QFJD 3PWPD 5DI8A 2R29L 5DRNB 2QQNL 2RFXB 5E08H 1XGQB 3MV7B 2JIXD 5SX4H 5L9DL 1QSFA 4QRAA 1T22A 4LPUA 4FG2A 4UIKL 1S6VB 3KBEA 4DWHA 1WA1X 4CC0A 1KCUL 1L4IA 1XGRB 1DLFL 4TQEH 4M5ZL 4KQ3H 1UEYA 1X5YA 1VA9A 4GKSA 1E5UI 5FYKD 6PAZA 5EXQA 4JKKA 2HA1A 3FT3A 1PVHA 3RVVC 3TV3L 1DVFA 1MG3C 2JI3A 2QQQA 1SGKA 4ZFOL 3NIGE 1KB5L 1ZLWK 5TQ2H 1WZKA 3GDBA 3OWRA 4FXGC 4WHYG 4Z7VB 3UTQA 2HVKA 3HFML 1V3MA 1AJ7H 1JJUA 3GHEH 1BPLB 2YD8A 1QVOA 1GJIA 1OLLA 3VTTA 2XVGA 4RRPA 1T04A 5D1QE 4HGWA 1E28A 4ZTPL 1E9QA 3U9PH 4KQ0A 2GKIA 1HHGB 2GJPA 1CXHA 4MAUL 3ZCFA 2VITB 4BSWB 3OAWA 3WNMA 1MKFA 3U9WA 4J8RB 4ZMQA 5IEKA 5D1XC 4A67A 5C0BA 2Y9RT 3IMTA 1PIFA 1U8OA 5E70A 1GGBH 2R0WH 3EOAB 4LCYA 3QSKB 1O6TA 5BQ7B 1CRJA 1GL4B 4FXLA 1XBRA 5C07D 3AY4A 3BGMA 1LILA 5CINH 5TDPB 1IKNA 1D9KC 5EORH 5E2TH 1QSEE 1KIQA 3US0A 2XA3A 3WTUA 5IJKC 3GZOA 1SY6A 3PPEA 1GGIH 4WQ8A 4WQBA 4LJIA 3O6FC 2FUQA 2N7SA 4LK4A 3H55A 5IVXB 2D31B 4AAOA 1PSKL 5DMIH 5TE7L 3FFCA 4HGKC 5GS2H 1RZJC 1BJ1J 3CVDA 1CPUA 4Q9BA 4ZTEA 3KG5A 4WFGE 1XD0A 3UBXI 2ADIA 3QHZL 3VFOA 2CGZA 5FLUA 4ZAKB 3ZKXC 5I6LA 4KX9A 1CIUA 4JFQB 1A0QH 1QSFD 1BL9A 5EUOA 4C54A 4F2EA 4CRPA 5T5FA 4TTGA 1GKOA 1AACA 4I13B 4M62H 2F7OA 3X3GH 2E7LA 1WBZB 3N42B 1HSBA 1S7XB 2GAZA 2CUIA 3BOVA 3JWNH 4PVMA 1L9NA 4W4OA 2OMNA 3WKNA 1I1AC 12E8H 4GAYA 3NABL 4JY5H 2YPVA 4PJAF 4I7ZC 4BUQA 2JQMA 3NSXA 3RL2B 1DVFD 2NT0A 2WUBL 3S7GA 3CTTA 5HI4D 2G2RB 3QR0A 5I9QC 3LH2H 5ABDE 3ZR6A 5KYYB 1W0WB 1HIML 3I6GB 2FB4L 1G7MA 3ECBA 3CWGA 4NNPH 1NCIA 1NFKA 1N0LA 4DPRA 3VNWA 5F9OH 4E41A 2QPEB 5JPMB 1UB6B 4JN2B 4AG4L 1I9JL 1AGCA 2QL1A 4JHZA 1FV1B 3IKKA 4FG4A 3RVXC 4C47A 5AVSB 2BXZA 3P3RA 3IYLW 4NKMA 2N18C 4JRFA 5JLZA 5K1JA 1JS4A 4TUUA 4YFLF 2P4AB 4UQ9A 1VRSA 1ZVSA 4TVPE 5FFOA 4XPGL 2P8PB 5DQJB 3I6KB 5C0BD 5FOJA 1NAMA 5ITBH 2BINA 4N2IA 1E8YA 4OLZL 4PJHB 3X3FL 3GHPA 3GSUB 4NNXB 8PAZA 4KKPA 3LV3B 4P2RB 3GO1L 4MVBC 1ETZA 3KPSB 1D6EB 2ZXGA 1BEXA 3I2CL 3MOBL 4UUJB 4JRXA 5AW3B 1ZCRA 3WJLC 1RFDL 1A6AB 1YJDH 1HI6B 3QZPA 2TRHA 5JYMA 1FZMA 1P1ZA 3L73D 2WWNA 4OV6F 4PBXA 3VFTA 1EZVX 4N6RB 3TFKD 2W60B 1YEDB 3FFCD 3WUIA 3GMMA 4L4VB 1NFDF 3NYKA 5IGXL 3GT6A 5GXBB 3F83A 2JQRA 2I5YH 5C0AE 3TJHD 5I1CH 3TF7C 3G7TA 2AJVL 3PJNA 4G7QB 2JWYA 1CLYH 5L4FA 3ULUF 1A4JA 4TLUA 4P2OB 2NMSA 5GRYA 2IH3B 4O9HH 5T5NF 1KLUB 3ZO9A 1H3TA 3CAFA 2BHFA 4MSWA 2LV4A 2VLKA 5EO9B 2Y1AA 1ZPUA 2Q86B 4D8PA 3MNWB 1SXZA 4ZO9A 4EUPG 4P2YA 4DK6A 2GK0A 2PWGA 3E6HB 4H2CA 4WWID 4PAZA 4YSRA 1TIUA 2WVVA 4JQXC 1R19A 1K8IB 3NFSL 1C1EH 4WKZA 2WZ0A 1XTMA 3F7QA 1UM5L 2EXSA 1Q0XH 1OCWL 2BZ7A 4MMZA 4P48A 3O9WC 4OVUA 4Z7IA 5DVLA 3MLWL 5EEWA 2GCYB 5E2WL 5IBUG 4HJ0C 4IJTA 1FN4B 4M61A 4LSQH 7FABL 5JW4M 4EDWL 5A3IC 1PW3A 1X4ZA 4E41D 2IBZX 5CJXA 2CO2A 1DSWA 3BUYA 4NQXA 2P8MB 1LEKA 1EMTH 2VR6A 4WQAA 2VDLB 3DJSA 4LVOC 1ES0B 5HDBF 4ZX3A 1P0SE 4ONGL 2B1OA 2XA8L 3IJSB 5BUGA 1FJ1A 1BQKA 2Y5TA 3QQXA 4L29B 2CHZA 5ADPH 2VXUL 2J8UA 4XHJD 1PZ3A 2ETWA 3F12A 4KDWA 4M7ZC 1BZ7B 1EDYA 2BMKA 3QPQC 2C4XA 2V3FA 1JF1A 4YHLH 4V2CB 3WFBC 4BFBD 1UA6L 4OLEA 3B34A 3HI5H 2Y6SD 1AY1H 1OSPH 1P69B 4IOFD 4R7XA 5IB3B 1QABA 4NRXA 4JRXD 2BOCB 2X3BA 3ABKB 2TSAA 1SDAB 4L3FA 4EXPX 5DK2A 4YR6B 4N0CD 2WO2B 4XN8A 1U58B 1IFGA 2HJKB 2PXYB 4FLQA 4TUJA 3RFRA 2FBJL 4P9ML 5CJQH 2JKNA 2A38A 1BOYA 3QE5A 3BLPX 1XB3A 1ET8A 4PW3A 1P2CB 2GIWA 4LLUA 4ONFH 1EA9C 1LLAA 1NBVH 3GXTA 1D6VH 3CIAA 4U1IB 4XGZB 3TWYA 2AFNA 5D1XA 5CIEB 4EOWL 1J8HA 1SXCA 2KZ1B 4KPHH 4KAQL 4G6KL 1RURL 2VLKD 4ZX5A 2C3GA 4U1SA 1T1ZB 3EADA 5IB5A 4BDVA 4WRLA 5F9JB 1DVZA 4IEFB 2J56A 2KLSA 2PYEA 3STLA 5L6YL 2JV6A 3EJYC 3V0VB 1OZUA 5AD0A 2AAAA 4C4BA 3ARDB 4H0HB 4YDIL 5IJKA 4MJ5B 5B1AB 2FJGA 3I6SA 3TO2A 5GGSB 5FM8A 2ZOKA 3HNVL 3MCLH 4JPWH 3D8MA 5HHME 2MHMA 3TBWA 5D2LA 5JR1H 1B2WL 5CN2A 4PHXA 3GRWL 1SHSA 4YNYB 1YC7A 1F90H 4C83A 2FJUB 1RPQA 3D2UD 2DWYA 3OKOB 4YL4A 5DGRA 4YMPA 2APFA 5EZPA 4FA9A 3DSNA 1NAKH 1Z3RA 1JDDA 4GRWE 4HF5L 4ANUA 4WI8A 5E2VH 1RJYB 4XE5B 5I8EA 2D7NA 1CDYA 4PRHD 3KXFE 1P6WA 1JDCA 5BRZA 5EF3A 1FYTB 1MG2C 3U83A 1PF3A 4D3CL 4KI5E 2PWHA 4KGJA 3AAZB 5IT2L 3VD9A 3OJMB 4DAGH 3UBXG 5CJ5A 5D5MB 4Y2OA 2ITCB 3QW9A 25C8H 3O2VH 5IVZA 3ZN6A 3SQBB 2AW2A 2B2XL 3NACL 4XCYA 1F3DH 4Q4EA 4LOUC 2YMOA 5AW0B 4M6MH 1I9RL 1A6UL 5E5UB 3O2WL 4DKEL 2NQCA 3QPXH 2IDFA 1NIBA 2R0LL 4MNQE 3E9TA 1UADC 1LQSR 3ZE0E 1DQDL 4XBPA 3SDYL 5IMMB 1M2VB 3WNLA 5J13C 3SKUD 1U6AL 3DOSB 2ALWA 1J5OH 3WAKA 4QHLB 3RKPA 1CZ8H 1U3JA 4F58L 1U8KB 5LNEA 1TQCC 1KXVA 2HJLB 3E7JA 3HPJB 1NKRA 2DWEA 1N64L 4J6RH 4DKDC 3EO0A 3U2IA 1J8HD 3C8HA 1R5VA 3QEHA 1IEBA 2VM3A 3MFFA 4DO6A 5SWZE 1I85A 2WQSA 3AU0A 1SQ2N 3IAPA 3WFZA 3BX7C 3B3BA 1L7IL 4K23L 5IMOA 2VSMB 2PYED 4P5TA 3QCVL 4DP7X 1OB1A 3GMRB 3MAWA 1P6AB 4NN5B 3EFFA 2BVOB 3CV5A 5I30H 2EXYD 4G6ML 5LUMA 5D70H 5JYLA 2DICA 2X44D 3OB0H 4JPSA 1ZDQA 4Y4FA 4LCUB 1F5WA 4V11A 5D2NE 1IILE 4L3HA 1M71B 4J6IA 3LHPL 4L37A 1U8LA 1UQSA 3RTQA 1NDGA 4Q6IA 3NJKA 3OBAA 4POZC 3H1JD 4QHKI 4IS6B 4R5VA 3ARBA 1IFRA 3DWTA 5FYLD 2OFQA 1S7TA 1DQMH 1TJGH 2IG2H 4MNGB 3CFUA 2F53B 3GHBL 5L2KB 2RACA 3MRNA 1V27A 3PP3K 2ITDB 3NTCL 3MBXL 5KVFH 1OWRM 1G6RL 3SDDA 5BRZD 1IEHA 3ZOYA 2GB8B 3NFPA 4R26H 5LCVA 4XVTH 1XR8A 1X7TA 4PLJD 1YPZE 1N2RB 3BYTA 1OEZW 4OLYH 2UWEB 3HC3L 4JPVH 4M1GL 4CSPA 3SE8L 1PY9A 3BRGC 2HUEA 2DBLH 3S35L 5B3JF 4M1CD 2JCWA 2DAVA 3O9WA 2IGTA 5DEZA 2PCCB 1H8LA 1T7VA 4N0UB 4PQXA 3R18A 2X4QA 1MFEH 4DT2A 5ACZA 1NEPA 3CLFH 4BSVA 5CEYA 3C6LB 5DA4A 1HYRC 2SEBB 4OZGE 2X1PA 1GMEA 2NYKA 5ETUB 4WQ9A 1CTJA 1N5AB 2LAGB 3RVUD 1KYOJ 1KC5L 3QQ9D 4G72B 4EIDA 1IAMA 2HKHH 5EU3B 3W57A 3CZFB 2IADA 4DGIL 1TJHL 2ZUYA 3RNQB 3TBYA 1FL3A 1WE5A 2NOYA 4P5KA 4ZUUB 3KLLA 2BVTA 4JG1L 3QWQB 4AW4A 3LN5B 1CC3A 2MIZA 3CFTA 5HD8C 1VERA 1FI7A 3TXAA 1F6LL 5CSBA 1FFNA 5EBLA 4P5TD 4A1RA 1P84D 2EIBA 2BVQA 4X99A 4HH9B 1M9WA 1I9IH 5KYNA 3BIBX 4N9GB 1ZA6A 5E8EA 5F88A 1LK3H 3H2WA 1URZA 3D18B 5I1EL 2AITA 2YRLA 4Y4FD 2X6AA 1H6UA 2VRAA 3BP7A 1NUFA 4AV0A 2WNGA 4NJ9L 1I8KA 3O8XC 3RTQD 2G3MA 5HYEA 2OQJB 1SQVD 1NWPA 3WENA 3UZEC 3UX9B 5DS8B 3HB3C 3ARBD 1LO3H 3P1VA 2VC2B 1J0ZA 3TBTA 1KJ2L 4ZUVA 1J5IA 4D9RE 2N9IA 2VMFA 4OM1H 4QXTA 5JXEC 1A8CA 1V8HA 3UTZB 1ZY9A 1PPJD 3WIFA 1EUTA 2XWBA 4B60A 1BHGA 3SDDD 4KFMA 1MCRA 2YGNA 3NGBB 4XBMA 3U7WL 2P5PA 1ZDSA 1OGSA 4Y5VA 3NN8B 4L2LA 4XPFH 1ZRTD 3L9EA 4KZEL 3ASOB 1NINA 1YYLL 3D51A 1RLBA 4ODSL 1UWEH 2C3XA 1NFIA 3MLVH 4ZYKB 1U93A 5AZ2L 3TN0A 5J1TC 1TKWA 3ESPA 4JHAL 4NUJB 2FATH 2X6BA 1AZBA 3A0OA 4YK4C 5IW1B 4MD5B 2WO4A 2VXSH 5JHLL 3GBDA 3VQ1C 1BD2A 2HAZA 2YZ8A 3JWNG 1CURA 4KK5D 1FZKB 2BW5A 4XAKD 5A1AA 4WEBH 4OZHE 2UY7B 2OMTA 2WINB 5EF1A 1CFSB 3V0EA 3UOAB 4QIRA 3O3AB 5BO0D 4R4FH 2YPKB 1T7XA 4IGBA 2WBJC 3RUGA 3BEVB 3HC2A 4NQCE 1C2RA 1B2YA 3QDJE 1GDVA 3DIDA 3T08A 3MYZA 1CLCA 3NCJH 1ZS8B 1KIUA 4K8RH 3T3MF 4HHAA 4OFDA 1CICB 3ULSA 4FAVA 3E8UH 1VEOA 4IRSA 4FQHA 5J57B 1UUNA 5EBWB 5FGBA 3VFUB 3AU1A 5D9SB 4QLWA 3II3A 5HJGA 2A73A 3LQMA 1RKRA 1OP5K 2XZQH 1YECH 3KWTA 3U0TB 5CMAB 5KW9H 5KYXB 4XO3A 4F3FA 3CBKB 3VFWB 3HUJE 1T1WA 3PIQA 1TQTA 4HUXA 4NJAH 5I8OH 5EC2A 5KVGH 4L9LA 4OKVB 2BRRH 3MXWH 2ZNXA 2BSDA 5C0CB 1SEBB 4BCZA 4HJ1A 2FECL 2AI5A 4QJ3B 1BV8A 5IQ7L 3QISA 4G8AC 4GQZA 1TQWA 1WWBX 4TV3A 3ATAA 1DQLL 1P7QB 4N0KA 1G4MA 1KTBA 4UTAH 3MCYA 1DANU 3V4VH 3JBTB 1OM3H 2HLAB 2EZ0D 1WZ1L 2ZWYA 4NUGL 1QR1A 3QA3A 1MCWW 3WKQA 3ZRSA 4HKXA 3BN3B 5HVHC 3S36L 4Q0XH 1C5BL 2JKSA 4DQOL 4M1DH 3QNXB 4EBQL 4PMEA 4HT1L 4I1RA 5EOCL 1IE4A 3LRLA 4P2RD 5HHXH 1J0JA 4UT9H 3KPSD 3UTTA 2ZKMX 1E9OA 2E27H 3FQNA 1BCCD 4FE9A 3TN0D 4NC1E 4MJHA 1ZE3C 4S1QH 2G75B 2UX6A 4HKZA 2ZUQC 1MWAB 1BD2D 4O02B 4AQEA 3T1FA 3SJLA 3BFQG 1M7IB 4Z0BL 4C56A 1OP9A 3V6ZB 3IBOA 4W9HC 5AAWC 5GGTH 2K6ZA 3SO3B 4LVNC 3UIYA 4Z7WB 1IGML 3ARFC 4UT6L 5E1GA 4NRYB 1F1FA 4IGBD 3BPNC 2B9BA 3KBPA 5HVFB 2A77H 1GCYA 1MIMH 5TDOB 3D0LA 2TRYA 3P9LB 2H1XA 2NY2B 5K93A 5K9KA 4QXWA 3RZCC 1GZQB 1OOAA 5C08B 4XC3L 4XH2B 2M83A 2PR9A 3MXVH 1JF5A 1H1OA 4LSDA 3RX7A 3PL6C 4IRSD 5D7KD 5FUZL 1FCCA 1TZIB 4APXA 3MUGA 1RP9A 3HI6H 3L17A 1TPXB 1U8HB 1FCGA 2OULB 4QY8A 3ES6B 4LRNH 4P59H 5HDQH 4TQ8A 5HYIA 2XETA 3ERXA 4KC3B 2GFBB 4HK0A 4X7TA 4AALA 3CSFA 1ACYL 4U3CA 2E76C 1URLA 3TNNB 4NO3A 4A55A 1NGYB 4PWAA 3KYNB 4JKMA 4X5WB 4P4KC 4XCNB 3KLKA 3VWJC 1C5CH 3OGCA 4H4NA 3NSFA 3RIFK 1KPVB 1HCVA 1WTLA 1ZLEA 3CHSA 2AK1L 3LRHA 2AIUA 1YNTF 1U9KA 1YQVL 2OMYB 4MJIA 2Q3ZA 3P40A 4QR7A 4WO4B 3REVB 1HZHH 4WY7L 2QELA 3IDIB 3ZTNH 4EI6B 1IC5L 3AWGA 4YHYB 3RPIB 5IVOA 2NW2A 2P7TB 3GXDA 3ZL4L 1X5LA 4J5VA 4WNQA 3M88A 1AE6H 1L9TA 1MUJB 4ZZFA 3WS3A 5TE4H 1E6JH 4R7DB 4UM9B 2CIIB 4HS8L 3SKOB 4IK6A 5AYUL 4BKTC 2ZF9A 3ZVVA 4PFEA 4YGVB 3EJCA 4FGMA 1SN2A 3BH8B 4GB9A 4O5LH 4PJ6A 1YCSA 3BO8B 4X9BA 3UTTD 4JFTA 3WLWD 4QAWA 2VLLA 2W0PA 2DWTA 2J71A 3H9HB 4L0PB 5F9AC 1HNGA 5D96C 3EGDB 5LXVA 3CN4A 5BW7C 3SVWA 7CGTA 4F7EA 1SHMA 1JPTL 4AJWA 2XFXA 2PXYD 1U8PA 3MUUA 2X1WL 4UILH 4PGEA 4BGLA 1MCNA 1CXEA 3CFEB 2YO3A 4RDBA 5ANMB 3WGUB 3FRPB 5A16B 2UYLB 4U1NB 4PVNA 3MJ7B 2EQDA 5ESQA 1Q72L 5JXEA 3QJXA 3HG1B 3D07A 5L0QC 4X4MA 1KYAA 4J3OH 5HHPB 5E9DB 3GSQA 4D2NA 1Z5LB 2DM7A 1YEWA 1OAZL 4LOVA 4NIYE 3QRFM 1H0DA 4WWNA 2O5NA 1L5GA 1PZ2A 2BERA 3QXTA 1MCWM 1ZJBA 2DI7A 4PP1C 3H1KD 4PJ0V 4DN3L 2NNRA 5FPIA 3EJQA 5ALBL 5HPOA 1B9ZA 2CJTA 1NICA 2DKSA 5IIEA 5EH1A 3ARYA 4OSUL 3LKNA 2XPZA 1DJZA 3L16A 4TLSA 1ID5I 4LDLB 5IB2A 4RQQB 4AEHL 1NFDE 2VN5A 5HHQB 1GW0A 4M48L 3OAUL 1HCFX 2Y4SA 2VUKA 5BJTB 5CEZL 5FGRA 2Z7WA 3ULUE 5CIPH 3FU7A 4RSVA 1HXKA 2B4CC 2N0MA 3BUIA 2WBJA 2AKRA 4ZW3A 3DECA 4QTIL 5GQBA 4X4XB 4MJID 1R3HB 3TVMA 4HBCH 4G1EB 3WUWB 4AT6B 2E4TA 1RZGA 1M4KA 4RGNC 4E42A 4AKOA 3DTXB 3ARWA 1EZVY 2Y0SA 2AQTA 1TLKA 1QNZH 4PP2A 3AFLA 5B1BB 3VFGH 4ZK8A 2ZJSH 3FQTB 3MDJA 4BYHA 3RWCB 1EH9A 2AP2A 5EO0B 1WLHA 3K74B 3GBML 4L4TE 4YUEH 5EUKB 4J4PC 2C3HA 1CIGA 2BWIA 4JEGB 4RGOH 2NXZC 3KEDA 4KRPC 3UZVA 4MZRA 1KYOK 5IG7A 3FQYA 1IT9L 3AG2B 3HZVB 4QTHB 4OT1L 1ZVHA 3GJFB 1GVIA 3QIWC 4D9QE 1LXMA 3QORC 3ZMNA 1FFTB 3X39A 3NCMA 3U7YH 1X5HA 4X0KB 2CA3B 2MQGA 3IT8D 3QIBD 3ZUNC 3TM6A 3D08A 5HDBE 3OKMA 3HG0A 3VCLB 1DEDA 5ISZA 2MQCA 1O7DE 2DIAA 3DKHA 1CUOA 3X1NA 4YPGB 3SBWA 4OFYD 3SY0B 1HJ3A 3VXUB 1ZLVK 3DI3B 2PW2A 1I75A 1MIEH 2EEBA 2R1YA 2ZE0A 5BQDA 4ZRGA 1RK0A 5GRXG 4TKWA 4Y16B 5MENE 3IFPB 4NM8L 1A6ZA 3UPRA 4ZOCA 4HUCA 1ZANL 3UYRL 2A6DB 2CR6A 1NPUA 1MJUL 2IBZY 2CGRL 3HC0A 4BCYA 5JOPD 1HRCA 2A74C 2H32B 1EGJA 3T0EC 3V0IA 2OI9C 3ZTDC 3INUL 4A6YH 4M8VA 1NBYB 1UT9A 2ED9A 4GKOA 2QKIB 1NPJA 1KPUA 1E4XL 1H19A 3ABZA 5FB8A 1VFOA 1KFAH 3PP4L 1SHWA 2FDBP 3FTZA 5DMKA 1JGLH 2YQ3A 2FHFA 1EPFA 3QGVA 4YSQA 2YBRB 1U91A 3SZKC 4M8QB 1FH2A 1EX0A 1YMME 3BZEA 1WZLA 4JO3L 1BE3D 3SE6A 4G83A 3P02A 1IFHL 4RZCB 4AIXA 1JBJA 1FAIH 1UXWA 4MA7L 3TVMD 4YL9A 4AYGA 3RZCA 1U3NA 1ASQA 4UV4L 1JK8B 4PJFA 1MXGA 4PJ9A 1A2SA 4JFVA 1X5ZA 4G59C 5DD0L 1PGRB 3ZUCA 3MPCA 5F6HJ 1M05B 2H3NA 4WI9A 4IBTA 1L9OA 1KB0A 2CHXA 3CH8A 3ILPB 3QWOB 3L3JB 1RAMA 3QXVA 1PG7L 2OAAA 1BZ9B 3EBAA 4XR8C 4P3WA 1IBFA 2CO7B 1KBBA 3E3QC 3MRPB 3DYOA 4YO0A 3II1A 2HN7B 1BXXA 4EUPA 1OAEA 2KUTA 1C75A 1J9QA 1Z3GH 3C09C 3VWJA 4I0PA 4A2FA 3E9UA 1DL7L 4QRPB 3TA4D 1MCPL 1G94A 4YBLC 5GGVL 4OQ1A 3WO3B 4B5EA 2HT2D 1F58H 1G9HA 1KJMB 3C6LD 2YSTA 5ISZD 1MVUB 1EFXA 2NY0C 2H41A 3ASWA 4JDVA 4JZOB 5ELIA 5F1IB 4AQ8A 5J6GA 1S3RA 4WU5A 5TDNB 1P53A 1R4XA 2AJUL 3VD5A 1MF2L 4X6DF 3CVHH 3LNEA 4HIIA 4IU2B 4NQEE 5FECA 4BFEA 2VDOL 1XF1A 3RVTD 4F7MB 4JPIA 5D7JB 4OZ4B 4M4RB 5EOQL 4A2HA 3MV9B 4PLNC 1NCHA 1I8MB 2HPOA 5C6TL 5J56B 3T5WA 2H6UA 1H15A 2ZCHL 4J3UA 3EYQC 3K46A 2ZP0T 3F8UB 4U0RB 1RPKA 3G5XB 4TSCL 3EXJA 2J72A 1KEML 1TCRB 4WWKC 5CWSA 1SVZA 3G3LA 4PWHA 4OF7A 3FTVA 1AQDA 5FKPB 3ROLA 3CLWA 5DZ9A 5INCA 2XIIA 4JFZH 2LTQC 5FF6B 1E27A 1ZHKB 4ELKA 3HKZA 1CJYA 3TS8A 3K3QA 4KUCD 3B37A 5JQ6H 3DOIA 2Y06H 1FDLL 4DVRL 2HH0H 5GGVY 2PW1A 5HGHA 1XGPA 1LMSA 3PGDB 4ETQA 4Z3IA 3IXTB 5KVMC 2OK0H 4MD0A 4ZMOA 3GI8L 4ODVL 4BK5C 1ED3B 4LVHC 5DWUH 5C09B 1JHKL 2JCCF 4EDXB 2EDYA 2VTFA 4PJ9D 3FB7B 5DS2A 1L7TL 1GJQA 2P5WE 5FYJE 2YCCA 2J88H 3MLSL 4IRZL 1KG0A 4LP8A 3C5ZB 1K3GA 1LYQA 1DDHA 1HL8A 1VENA 2NLJB 3HRPA 3MV8A 1I8IA 3Q6GH 15C8L 5EZOL 1J12A 3ZE1F 2VR5A 2OZ1B 2V0AA 2J4WL 2HXAA 3KYKH 2P5EE 3IU3A 5T3XH 1EXGA 4PD4D 4GBXB 4RFNB 5EA0L 3D4YA 4OD3H 1RY7B 3KGSA 3SKJL 2FWOA 1QO3B 3MV11 4I0PD 1DFBL 3D7PA 4WF7A 2R56H 2Q8BL 1SQBD 1FNEA 1F4XL 1ZHLA 4QOKE 1JCVA 1QBAA 1BBJA 4H5SA 4JFOB 1EFXD 4MAYB 3DMMA 4NO0A 4N5UA 4XCCL 4CSZA 1EJOL 4XZUA 4X7SL 1YEGH 3WIHH 3C6SB 2VDML 3RL1A 2DQGL 2B0SL 4IRJB 3VB8A 3WN6A 1FZJA 4N2CA 3LZNA 3QO1B 4NCC2 1GHFH 2UXTA 3ME0B 2DQEL 2Y07H 4J4PA 4LL9A 5B3JE 2HMID 3WE1A 1FGVL 5D1QB 4G8FA 2OZ4L 4ISVB 4M93C 3VFPA 3E0GA 1OCCB 4ANXA 3W37A 1WFNA 2VDKH 3DX8A 4JFEE 1CR9L 3N9GL 2QVFB 3POCA 3K1DA 3MUZ1 2Z31A 4NO5A 3UBXA 1IAKB 3QORA 2PO6B 4XN5A 3CVCA 4CAGA 3HE7C 2ZP9A 4GI9A 4PB0H 2NY3B 5D7LA 1P4BL 2A9ML 3WFDC 5IJDC 1BVLB 1DN2A 3TX4A 5M95B 4LAJH 3OCDA 4RWHA 1KV7A 4FNQA 1AQKH 1QSEB 1CTNA 2OMXB 3HMXA 4X0NA 2ENYA 3A6CL 4YXKH 1SFDA 3ULUL 4EI0A 1YJDC 4J3TA 2PCFB 2D7TL 1XGUA 2A74A 5FGSA 3D0VA 1Q9KB 3CZSA 4QHMB 3IKCA 3CVBA 2YWZA 2R69A 3TT1L 2NUPB 4L3EA 2FJFB 4EVNA 3UABA 1NCDH 1RD6A 4KK8C 5J12C 3AXIA 2BXYA 2F8OA 3MV8D 4HEME 5FDWA 3IVKA 4MMXA 1FI8C 3TFKC 4XWGH 1C2NA 1CDCA 1WGVA 2F54A 2GVYA 5JORB 4DP0X 4DP5X 2FX8H 3FT2B 3O4LE 4OI9A 1F6AB 4U1LA 3TO4B 1N7ML 4OAWA 2EXTA 2ZXBA 3IBEA 1CDGA 2CLVA 4A2LA 1HZVA 4MCYA 3VI4E 5F3BB 4JDTH 4MB4A 1XIWC 3C8DA 4GO9A 1WS8A 4NO0D 3DMMD 5DD5H 1RZIA 1KELH 2CE6A 3ZDWA 4WGKA 2X1QA 4LHJB 2DQDH 4URTB 3ZTCC 5EIQA 1RXLA 4L48A 4I77L 4LVEA 4EPSA 1WZAA 1P4LA 4LQFL 4L8CA 4O1QA 1AG0A 1NL0L 2R4RH 4JO4L 3WD5L 1HKFA 1OQOA 3JVGC 2GJZB 3U0WL 3R0MA 1SUHA 2CDEB 3GMPA 1N68A 3QUXA 7PAZA 5I6PA 3L4TA 3CHPA 4Q89A 2OCFD 1CGXA 4U4BA 3P11H 1KXQA 4FJYA 2Z31D 1LL1A 3U36B 3BPLC 2Q7YB 1CWVA 4PJIE 1ACXA 3LZRA 4YDMA 5D7LD 1JWUB 4J3SA 4WV1C 2JJSA 2BNQA 2VLJA 4MDIA 3SYQA 1KENL 4O1WA 5KAQF 4G9DA 3MO1B 4NI6A 2X6MA 2JKXA 4Y4KB 3T3ME 1AKJB 1MNNA 1A47A 4JFFA 4J1UB 2XZCH 5CUSH 5B38B 3PHSA 4NO2B 3VMOA 1DTUA 4APQC 5TF0A 5DVNA 4AK2A 2R29H 4AC2A 3VGDA 5JA8B 1SXSA 2QQNH 3D39E 4UM9D 3DPBA 5GRWA 5L9DH 1MCKA 4ENED 3ARRA 4R0LC 1HHJB 2HTKD 4AM0B 5TH2B 5MI0C 4UIKH 2KC0A 4J3OG 5C0AB 5HYJA 1KCUH 1AGDB 1DLFH 2CBTA 2CPUA 2EDEA 4HALA 3F7LA 1C5DB 2DGEA 3EOBA 2UUDH 1X5FA 2F54D 2FUTA 5HDLA 4Z77A 2BVPA 3L45A 1IAIL 4HXBL 4U6YA 4AV5A 4EXKA 3TV3H 1RJLB 4G1MA 4HPOL 5AVYB 4A2DA 1KB5H 4HQQL 5H2BB 4AITA 2E6JA 5J1AA 3WEXB 2D0FA 4XXDB 4I2XE 3ARSA 5D1ZA 1XR9B 1B4RA 3HFMH 1PDKA 2NSMA 4JFXB 3FT4A 3CUPA 1P4IL 2XJKA 4NSKB 4UDTB 1PLGL 4ZTPH 3VW3H 4JRLA 5IKCB 3IDMA 4MAUH 3RDTC 3Q2CA 4F37K 2CK2A 2XN9A 5DJ6B 2CPCA 2G3ZA 4OUOA 3GTNA 4P3DB 1GZHA 1I54A 4Z7QF 3QUXD 2NNAA 3PGCA 4G6JL 2F5AH 2G4EA 1CFQB 4NS0A 4DCQB 1MI5E 1EAJA 4HWEL 4JG0L 4BKLB 2YD6A 3V0GA 2E9GA 2KZWA 2QPFA 5CIFB 3ZSTA 1U0QA 1XH2A 1QLEB 3DO7B 2BK8A 2XYCA 3IN2A 5CZXD 4FNUA 1TO4A 3FB8B 5IP4A 1DP0A 3TP4A 3JT2A 1YSOA 4I18A 2BNQD 2VLJD 5CCJA 3MX0B 1G0DA 4XPHL 1ZHBB 3T77A 3NJGA 1PSKH 5TE7H 2EEFA 4JFFD 4XB7A 1KPRB 5DSCB 1G87A 3HJ0A 4L8BB 4PI0A 5T3ZE 3PWVA 1E5YA 1ZHNB 5I66B 4Y5XB 5BRQA 1N10A 3K6OA 4KHXL 5SWQA 3K4AA 3UYPA 2UVEA 2W65B 3LY6A 3QHZH 2F9BT 3PQYA 4MLIA 3UL4A 2XWXA 1V05A 4OGZA 3R19A 5LGKA 3GS4A 3MRMA 1KYUA 1ZS2A 4WUUA 2Y69B 5HYJD 1IX2A 4PJ5D 4TMPA 3VXOA 1I6DA 2EC9T 1H9XA 3A6BL 2WQUA 3NABH 4B9CA 2ZD0A 5EUOF 4R3SA 3WO4B 2FWUA 2WUBH 4PRAA 1QN2A 5C71A 3OSVA 5KLVD 1PY0A 3IGAA 2VL5A 1M6ZA 1R3LA 2ZXDA 5D1ZD 1HIMH 2FB4H 5I6KA 4UV7L 2ZT9C 1AO7E 2UXFA 4Y1AE 2OMWA 1INQA 3MUY1 3STZA 4AG4H 5I6MA 1I9JH 3QQ4B 4NERA 5HHMB 3NIFF 1U8IB 2FJHB 4UI2A 2EUWA 4N8VG 3FN9A 4M00A 4QT5B 4FB1A 4WFHE 4ZQKB 1JYNA 4MXVF 5GGRY 2VABA 1G9ML 4XO9A 4EZJA 2XN9D 3OMIB 4K5MA 3QUKB 3WFBL 5GS2D 1ZSHA 5DHDA 4P46B 4XPGH 1DT1A 1OL0A 5IB4A 3KLDA 1P5UB 1VESA 5CN3A 2VQ1A 4GRWB 5E1IA 1T89C 1GYAA 4OLZH 3X3FH 3REWB 2WN3A 3S2AA 5KS9A 2RALA 4FEMA 3KXFB 2WW8A 1PZSA 2MMXA 1QQDA 2NY1D 3I2CH 2IFGA 3PXTA 4YDLC 1Y7VA 3F6LA 3V0AC 1RFDH 5TPWL 5EIIG 3M17A 3HHSA 1BEYL 4DESA 4PJ8A 5B8CB 1QR4A 2PPDA 3ULAB 3DETD 3GFUA 3BVNA 2PR4H 5K9JL 4Z18A 1WFTA 1J11A 4UWQB 2IQ9L 4M3JA 5IGXH 2BSSB 2XICA 2V6HA 3L8QA 3WN5B 3HIZA 1KCKA 3NCBB 5K39A 5INDB 4JM4L 2AJVH 2XU9A 3FMGL 4MNQB 3G6AA 1AI1L 3LS4L 4UNIA 3ZE0B 4CC4A 3PQYD 1KIPB 4UQDA 1BYOA 3NFNB 1QUNA 1XDTT 3LRSB 2OKMA 2ZG3A 3OPZL 4GS7B 4MWFA 4YEEA 1I7ZA 3SDCC 5CZKA 2ZYHA 3I02A 4FI8A 5FEBA 1S3KL 1ZTXL 1HDMA 3A47A 4N2MA 3IGUA 4WQ7A 3NFSH 2F1AA 3VXPA 5SWZB 3HEIB 4UIMA 5TGBA 1UM5H 2X7LB 3N6YA 1OCWH 2G9KA 3L5XL 4U6XA 3MLWH 4H26A 1QZ1A 5E2WH 2FJSA 2NUTB 3BZFA 7FABH 1HFUA 2ZWSA 1FPTL 1CIEA 3MR9B 4EDWH 2WP3T 1PX3A 2X0UA 4DKFL 3OJDB 4L8SA 3IDXL 5D2NB 2ZOLB 1OO2A 3MNVA 4FJZA 3RJDA 3TEUA 1PYWA 4FEIA 3EYUL 4G8IB 5BOPA 3VXTB 4ONGH 5ILTL 2XA8H 2YUVA 3D3VE 4QCIA 3T2QA 1G6VK 2CDGB 2H2PD 3FONA 2VH5L 2VXUH 4R9HA 1CDBA 3QO0B 3C5SB 1S4IA 1XEDA 4ZMPA 2GIMA 1NQBA 3GBEA 3WGVB 4BFOA 1GZPB 3ULVC 1UA6H 4JJ5B 3C2AL 2VKXA 3ZL2A 4YXLL 5HYSB 3OA8B 1AOZA 4KZDL 2NX5D 1IZJA 2P26A 4N1EA 5DJDB 4OCNC 3WL9A 4D0DB 1MFDL 1YPZB 2I9LB 5ICZA 5C0ZA 4PJ8D 1L0XA 2AV7B 4JHBA 3VXNA 4S2SA 4JKNA 2O6FA 4HGMA 3DR0A 1RZ5A 2FIKA 2YC1B 3UXFA 1AXTL 2FBJH 4P9MH 5EU5A 3EAKA 3RGVD 3HKFA 2MTPA 1COTA 3RDTA 4PRNA 3MRRB 2ADGB 4DEUA 3P9WB 3G04A 4RBPK 3IDJA 3OPUA 4O51A 2BCNB 4EOWH 1JFHA 4ZMLA 3L9YA 4OZGB 3VB9A 3C5ZD 3CVIL 1Y6MR 4KAQH 4G6KH 4KK5C 1RURH 2OL3L 4D7PA 1RU9L 3UERA 2YAMA 3F7PC 1R3JA 5L6YH 1SJEB 4KKCD 3BWUC 4JMXA 3UJIL 5KEZA 2GTZB 4GBXD 2DQCL 4YDIH 4XOCA 5KSBE 2XV0A 5J6HA 4K8RC 1AHKA 3GGWB 1L0QA 1I8PA 1KLGA 3BWAA 4ZAKC 3HNVH 4P23B 4NQSB 4PRDA 1B2WH 1G84A 1K2DA 4MAYD 4IIQA 3GRWH 1RUKL 4NP4L 4WZ9A 3H4HA 2GSIA 4KOBA 4L1HA 4GNKB 3CSTA 2V5YA 1CCZA 3WFHB 4HF5H 5MEPA 5MP6L 3NBNA 1PP9D 2B11B 2GHWB 1FVCB 3H6AA 1Z5HA 2ZUXA 4NUQA 4PGZA 1GYVA 1Z9SA 5C8JA 1NGXA 1DEEA 3QHFL 4NFBA 5DC2A 4TUKL 4K15A 4D3CH 1AZVA 2O6EA 3MVSA 4WWPA 5IT2H 4RISL 1VDGA 3OHXA 3BAJA 4XP1L 1RHFA 1JF6A 1BXVA 3CG8A 1KUMA 4QAOA 2B2XH 3NACH 3ZJAA 1VADA 3TYFA 1LTXA 1SDDB 2WN2A 3QULB 5DJAB 1XCWA 4KROD 1U8NA 4MKTA 4Y9GA 3HS8A 8FABA 1I9RH 1A6UH 4DKEH 3WIIL 3LPPA 3NEOA 2R0LH 5FWQA 1P4UA 4NKOA 1BIIB 1DQDH 1KJVA 3SDYH 3UMTA 2K8QA 1U6AH 3AUWB 1I8AA 5FX3A 1I7TA 4F58H 2IWEA 2D7OA 4K7PX 5LNGA 4OZHB 4X4KA 2C9UA 1JGEB 4BINA 4Z7OF 1SJXA 1ZVNA 1N64H 5K69A 1T89A 4NQCB 4HIHA 3QDJB 5D7IA 4LEXL 5I16A 3UYOD 1VFBA 2IALA 1L7IH 2DF3A 2NR6A 1B0GB 2EDWA 2XWTA 3BLKA 4K23H 4MBRA 3QCVH 2QGEA 1H32A 5HI3C 5C0JA 1FNFA 1U8QB 1QOKA 4G6MH 3EFOA 1HQRB 3K72B 3E2HB 3LPFA 4P2OC 4N87A 3M8OL 4DZBA 4JFWA 2JCCE 1CRCA 3LHPH 4NKDA 3K80A 5L7XL 4FCAA 1ZT7A 2FT7A 4JVPA 4OBSA 5KSAA 1NCUA 3TA3B 2ZPKL 3AQXA 5FYJU 1CO1A 3PXSA 4P5MA 1TT6A 5IHBA 3GSOB 2VDRL 2AXGB 2ZOTA 4OCYL 4ZS6C 2FZ3B 5EBGA 3HUJB 5F7HA 4LPWA 5JDSA 3MTRA 1UACL 1QLFB 4Z7VF 3VYPA 3GHBH 1A3ZA 3N41B 3FO9B 3EJJX 3INOA 3NTCH 3MBXH 5C2BL 3SPIA 4KKNA 3OGOE 2IQAA 4P04A 2XJLA 3BKCL 1SJVA 3F7VA 1E8EA 1NCWL 3CLEH 4QRBA 1KWKA 3KS0H 2XTLA 4WHTB 4HFUL 3GSNA 1YQ2A 3HC3H 4OFKA 1RK1B 4M1GH 3SE8H 4C57C 3S35H 1T6BX 2Q76A 2P52A 1RJZB 3P4LA 1EHNA 2G9HB 5J4MA 2R15A 3GUTB 2I26N 1EO7A 3NRFA 2OV0A 3FN0L 1BGYD 1AKJD 3FXIC 4Z7AA 4OIFA 1N4XL 5TF1L 3B7RL 5AQ0A 3KPMA 3L9BA 5JUEH 3IXAA 1I1YA 3BN9D 5E6SB 5FHBL 3CBRA 3TV8A 5E2UL 3AGWA 3VDBA 1XZ0A 1KC5H 4KKAD 2K1MA 3IWVA 4AYEC 3ZTEA 1DVXA 3OXSB 4DGIH 5F8QC 3SGKA 1JERA 1PX4A 3CU1A 4OLVL 1A7RL 4JG1H 3OD3A 2X4RA 3OZ9L 5CKGA 1YLBB 4PJEA 2NR6D 4AGLA 1HE7A 4PGDA 1NA8A 4QHKJ 1XH3B 2J5WA 2IH1B 4OUUA 1PFOA 4J3OC 5A2LH 2WYIA 5B4MD 5E94A 1JIBA 4Y1SA 5I1EH 2HWZL 2Y6TE 1AGFA 2AEOA 1F0LA 2ZX8A 5FKAA 2EVIA 1D5IL 1FHGA 4MRBA 3T2NL 2PTUA 1A1OA 2GQHA 2WKOA 2BSTA 4JRYA 1MHEB 4NJ9H 3IJHB 3KW8A 4JO8A 5KSAD 5HXMA 3UBHA 3PUCA 4ELDA 4JZJB 3BWSA 5KTEH 4Z5RA 4BQ6A 2R23B 3ML8A 1KJ2H 4NQDA 2AHIA 4PJBF 3QFJE 3LZLA 3PWPE 3ARDC 3JV4A 3VFNB 4KXZH 2E7MA 2OXHB 2B12B 3SDAB 1UJTA 2VDPL 1ODUA 5C2UB 1BW8A 2KHAA 3U7WH 4UQ2B 5FUOL 5J6SA 4B97A 4KZEH 3L3OA 4GOSA 2HFFB 3MRQB 5FYKE 1YYLH 1W16A 3MRBB 4NBZB 5C6PB 4ACTA 1XX9C 2CLZB 1CIDA 4DZ8A 3WDIA 2AQSA 5JDJA 3I3DA 3HW7A 3O81A 4R7NA 5AZ2H 3ZYOA 1OTUD 4JHAH 2Z9TA 1QLEH 2DLFL 3KCWA 1ZK5A 4PJHF 4E36A 4YE4L 5JHLH 2WXKA 3F04A 5EWIL 2EVJA 3KHOA 1KXTB 5D4IA 1HXYA 2F68X 5DQ9B 1CNOA 4N8PA 3WMPA 3BVWA 3DIFA 1MH5B 2V7HA 4DPCX 5EV7A 4JCGA 2X4TB 3RFZB 2N1KA 2D3VA 2VDNL 1E6OL 3I74A 3AS0A 3SXTA 1IO4C 4LLYB 4LPCA 1MHCB 3HS0A 1JWSB 2WLJA 4XT1C 1CGWA 1DFXA 1YN7B 3KNBB 4AH2B 1FVDB 1GS8A 5A2BA 5E5MB 3CXHW 1HJ5A 1X5JA 4H0LC 2FX9L 2WWOA 5AW6B 4BKSC 1A56A 2CUHA 2YEVB 5KVEL 4UTAA 5C07E 3D69B 4K3EL 1CGTA 2Z91A 2KPWA 2YSSB 1S78C 1U8CB 3MJGX 3V4VA 2BC4B 1T03L 2E46A 2KDGA 1TVHB 1MJJB 2VYRE 3NEXA 1UOVA 3FO0L 3OMNB 4IW4C 3BD4A 4OI8A 1AGEA 4TLTA 5CD3B 3S97C 4L8DB 5I5MA 3MGTB 1PPIA 1BPVA 4JRYD 4XMWA 4B9ZA 5KYWB 4H1LG 2IOOA 4UT9A 4RSZA 3CDCA 4F7CA 2XQBL 1VKXB 1NFDB 5KJ4A 1YYML 5B39B 3PWLB 5IQ7H 1REIA 2VL4A 4FXKA 4FLRA 5ADOL 2EUVA 1DQLH 4PCKA 2FD6L 3WUZA 5K9OB 1UM4H 1A4AA 3GMOA 4NN5C 4BIKA 3K4DA 3JTSA 3TBVA 1PCSA 2WTRB 5HGBB 4NUGH 2BVYA 1WZ1H 2F61A 5I0DA 1HINL 3Q5OA 1QSFE 3HBZA 4LLAA 2VAAB 3S36H 1DO6A 1C5BH 4DQOH 4JMNA 4EBQH 2VNCA 4HT1H 1WBYA 5EOCH 2Y3AA 2C1PB 3VRLF 4W1TA 2B1HH 1KBKA 2X12A 4ODBD 5EOTB 2A4ZA 3K6FA 4LPTA 4L4TB 2PTVA 4PRBB 4K0OA 4BWTA 5E8NB 1RZ6A 3S3PA 4HDIB 3AB0B 4ZUSA 2HT4C 2BM3A 4LSRL 4Z0BH 1ECZA 3PXJA 4Y4HA 5HVGB 2C9RA 4ZDHA 1HN1A 2WP3O 4G7RB 4FLOA 3NJXA 5JXAL 1IGMH 4FANA 4UT6H 5IFAL 2W9EL 4Z7QE 1W9XA 2ZAGA 2GITA 4DK3A 2Z93A 3FU8A 4PR5B 5HDBB 2K45A 2ZUTA 4AIEA 4HV8B 1CFVL 2R2HA 4XC3H 1N59B 1J8SA 3QJTB 3RWJA 3UAFA 1NDMA 5HJDA 3D2TA 3QAQA 1X5IA 4FFWC 5C0BE 1I4FA 3IWUA 1YY9C 3O6KL 2JLLA 4HUKB 1A6TA 2NDFA 5FUZH 1EUUA 3C6LC 1E29A 1JN6B 4PTTA 2X70B 1JXGA 5AUMB 1NTDA 4OFQA 1Q38A 2X40A 4XNQA 1VACA 4MA1B 3Q6FB 2B4CL 3X14B 1BVKB 4L1QA 1ACYH 4PRPA 5I5IA 4S1DC 3UGUA 3FZUD 3KGRA 4YDVB 4GJTB 3LEYH 5C0IA 5I19L 1WHOA 1X7SA 2QDWA 3P73A 4N86A 3FFCE 2UZIL 1CGYA 2E6QA 2DYPA 2C8NA 2AK1H 1YQVH 2YA1A 5CHNA 2WLHA 3V0JA 4WY7H 1R5IB 4U0QB 1IC5H 1YMMB 2BOCA 1I9EA 3V0FA 4AK1A 1MCJA 4KXZI 4X83A 1QG3A 3ZL4H 4G43B 4U3SB 1NBZA 3OR7A 4PLKD 1WV7T 2DIEA 3MI6A 5DRWB 5EUOE 1H33B 1KX7A 4HS8H 3UDWC 2EO1A 3FSAA 1ZMYA 4PWIA 3BAWA 4U1MA 5AYUH 1NC4A 1U4EA 2OW6A 3KL5A 3K71B 4PJXA 3B56A 4FYTA 4WUKL 3A67L 2GIYA 4HFWB 4TL5A 2PP9A 4OGQC 3NWVA 4HXAL 1RL1A 2VSKB 1K4CA 4U1IA 5DHYA 1L9BC 2HT3D 4FKHA 3GSWB 3BSZL 4ILDA 2YRZA 2QGCA 1YYCA 1R24B 5D5MF 1YA5A 2LLGA 1L3NA 1KT2A 3FT1A 4UTBA 2X05A 4MQ7B 3DJZA 3DOHA 4AEEA 4MCZB 2NTFB 3QXWA 1EHXA 1A9BA 2VN6A 4Y4HD 4BH8A 5EU6A 5FUCE 3D52A 4LMQE 4OTXL 3LQZA 4KDTC 4U6VL 4E41E 4GQQA 1IBBA 5EFIB 2CO4A 3TH2T 1HZLA 3TPUB 3EJPA 1Q72H 4GKZB 4A63A 2J73A 3IJYB 3KPQB 3VYNA 1TZGL 5CIPA 2PCPB 4GFTB 1DCEA 1XT5A 3O41A 4I3SL 3G5VB 1DVQA 1OAZH 1PZ5A 1XH1A 4LBAA 3IK2A 1M7UA 4PCSA 4YNYA 5D4QA 5CCHE 4DN3H 1A1NA 4X7CC 3C75A 3UBFA 4NQEB 5ALBH 1KEGL 4F8PA 3GTVA 4FCHA 3U4EA 1C12A 4OSUH 3BZ4B 3QPKA 4UQAA 2UV3A 4RVBA 1CD8A 1S7UA 3CSBA 4JRXE 5LN4A 1FE8L 4AEHH 5EZJA 2F8XC 1FG2A 4PRPD 4M48H 2NYYC 2FAUA 1T20B 3OAUH 4HUMB 4P23D 3TYGL 5IMLB 5CEZH 4X6FB 1USQA 2P45B 3AAZA 1CICC 1WCBB 3N3EA 4X9HA 4G8GA 2FECI 1Z9NA 4JDZA 2XBTA 3HMWL 2DYPD 4QTIH 5DRXB 2W95A 3QG6A 1Z0MA 2OJZL 5I6OA 2Y23A 1KGWA 3JV0A 3QQDB 5GGRB 4QKXB 2E6PA 3EFDL 1CYJA 4HP5A 2VZUA 4DEPB 2XWJA 3MLZL 3L4ZA 3UJJL 4NFDA 4OGYH 2YRPA 2C9XB 1T2JA 1SYSA 1J48A 1M53A 2VLKE 5F7EL 3GBMH 3OR6A 2N01B 3U9UB 3X12B 5JIIA 1Y18B 1D2PA 1PAZA 2FWLB 1IT9H 1B0RA 2BSCA 2DQIL 5DRZA 3L5HA 4OT1H 1J1OL 2P5WB 4RAUB 4PB9L 2OS7A 5CD5D 3VM5A 3UROR 3FHQA 1VIWA 4GG8B 1JPGA 2W59A 2CHNA 1NLDL 4OY9A 4A6YA 3MRKA 1A9EB 1DZ0A 4PJGA 5FYKL 1K4DA 3ZOOA 1C7TA 2C1UA 2P5EB 3MBWB 5EU6D 4ZFZB 4BCXA 4W9LC 2D0GA 1EAPA 4UQCA 1M42A 1BLNA 4I3GA 5I23A 1XZWA 1N6QL 1QI4A 2BVOA 2O6DA 3JBG7 3PHQA 2IPTL 3FQUB 4DFHA 4PRHE 3ZYZA 5IOPA 4NM8H 5AOKA 2OPCA 4QOKB 3RWDB 4N8VA 1ZANH 4UBDD 3UYRH 2QDVA 2AXJA 1MJUH 4UZUA 2XIBA 2CGRH 4YC2B 2J8UE 2UVFA 4IU3B 4K73A 1D5XB 3LXBA 3QDJD 1BZDA 3V8OA 4OQTL 3INUH 3SO3C 4HUUA 3QXDA 1ZGLP 1E4XH 1X5XA 4J23A 1BZ8A 3PP4H 4YGAB 4NQVB 5KUKA 2VIRB 4U31A 1JK9B 4GKNB 4WHCA 3VACA 4I5BA 2BY2A 5F7KC 2NY2C 3OB8A 5JNYA 3MLUL 1ML0A 3KLHD 4JFEB 4W6XB 5FS5A 2X28A 3E80A 1BOGB 5EIIA 2BLFA 3JZ7A 1CI5A 3V7AG 3O20A 4JO3H 3TBSB 3K8KA 5GSRA 2X87A 4G8GD 3VD7A 2UWEA 2QGDA 4JFSA 3CCHB 4AVJA 3TCXA 1UGKA 3D5OF 4JQVC 1IFHH 4NFCA 2V2TA 1TPXC 2UZXA 5AL0A 5DMJB 3MROA 3CXFA 4WNSA 4KUCF 2D2OA 4OGXL 4UV4H 3TZVB 3DHMA 4OJEH 2VW4A 2A6IA 1IC7L 5KYUB 1J8HE 2HVBA 5DD0H 3MBEB 4RAVB 2VZTA 3ALXA 4HX1B 3LSOA 3OKKB 5I1AB 3CVHA 2PYEE 4KH2A 4PJFF 4MXQD 1IC4L 1PG7H 2FBRA 5AKVA 1ZT1A 4WO4C 4KV5F 3SCMA 1R75A 3H8NA 5GSVB 1AIFB 3ABGA 4YHYC 4MA3A 2VN3A 2AQNA 3DUUB 4BZ2A 1OHZA 1BAWA 4XAWL 2R51A 3QZMA 2UX7A 1DL7H 2H0JA 4BXSV 1MCPH 4P99A 5GGVH 5BO1L 5D2LE 3EGXB 3HZ3A 2F1BA 4ZOAA 4E0RB 1CB4A 3HN5A 4OKDA 4WU7B 1B3JA 3PNRB 3CPLA 2EP6A 5D93B 4ZSOA 1VFUA 2K9UA 3B5GA 3P77A 4IL6V 4K71B 3O4LB 4R2GD 5DJXB 3PV6A 1XO8A 3KWXA 4XMTA 5IQ9B 1G4RA 5FYLE 3FH7A 2YAPA 3BH4A 4PJDA 3KWVA 1AXSB 4UYQA 1OXYA 5AW1B 3VTAA 2AJUH 5GZOC 1MF2H 4XVJL 3SKNA 3KPPB 3F5WA 2VDOH 3VI4B 4OCLC 5IOKA 3FB6A 1DE4B 1QSZA 4KJQD 5BRZE 5EOQH 4CADB 3AADB 2I9TA 5C6TH 4LSPL 5IZ7A 4K7PL 3SGJA 5EC1A 1G7PB 2XQYG 1WUZA 2VM4A 3HZMB 3QIUA 4TSCH 1KEMH 1KIRB 2VO5A 3MSPA 3WFDL 2B8OT 3IETB 4XTRC 4MZIA 4MDJA 3UTZA 1NM9A 4N5ED 3D06A 4Y5YB 4FQCL 5AYQA 1BG9A 1RIVL 5ITFA 3N0PB 3X11B 2YXMA 2DY2A 1U3HA 2MTAA 1FDLH 2DWDB 4DVRH 3FHEA 2NZ9D 3KD4A 4R7VA 1OIOA 2KZKA 2W07A 1YJDL 4P2QA 4PJIB 2WLLB 1UXLA 2WCGA 4CNIA 5DJ8B 1HAWA 5D6DC 5JW4Q 4YHNB 3GI8H 4ODVH 5CLXA 1QTPA 1TMQA 2AQPA 4NPYB 4WW2A 6FABL 1JHKH 2AMGA 3FOLB 3OAYH 3UADA 1DZBA 1ETA1 1TVDA 2R83A 1L7TH 2C9VA 5AWNL 1ASPA 2DEYX 4IRZH 3MLSH 2WINA 2I5YL 4XYDB 5D7SL 4QHNB 4JUTA 5E7FA 3WIHA 2YA0A 15C8H 2YPKA 5EZOH 4K7PY 5DS1A 1FIGL 1UWXH 2J4WH 2JJWA 3D39B 3VWKA 3B3IA 3OB0K 1OKEA 3SCMD 2BH0A 1YMHB 1SJHA 4U2YA 1IGYB 1T7YA 4GXUN 5EA0H 5EU4B 3S6CA 4PVLA 2X4NA 3SE4A 3SKJH 3TYIA 1KIBA 4GI6A 2APXA 5T5FL 5SV3A 3RNKA 1DFBH 4W70A 3ET9F 3HCVB 3T4AA 1FJ0A 2XYBA 1U92B 4Z7VE 4DFIA 2Y2TA 1QFUL 3IJ7A 5JPNA 2Q8BH 4P0DA 1DJXA 2YD0A 3QJUB 1F4XH 3BDYL 4JL2A 1FFPA 1NGWB 1SLUA 2JB6A 2O5YL 1HHHA 1H3PL 2DVHA 3P4MB 4FERA 2HLFD 2NZIA 2YPLA 2XHNA 3GEWB 4LLWB 4X7EC 4XCCH 1EJOH 2AQ1A 3B43A 3BIKB 4LF3B 4X7SH 3V95A 3K5SA 4PTUB 3G5ZA 2VDMH 5B21A 2ZONG 1HHIB 3O3UN 2H2SD 3CZKA 2DQGH 2B0SH 4I2XB 5KYXA 4AQ1B 4Z7WF 3IAQA 4FQXB 3EYVB 4XB3A 4O2EB 5JIHA 2FRCA 4OKVA 4YDJA 2YD3A 3U30B 2DWSA 4ODXA 5I28A 1FGVH 3S96B 1ESOA 5F3HB 2OZ4H 3M1BA 4FAAB 5C0CA 4S0SD 5JOFB 2PUQT 4NFGB 3GBLA 5DXWA 2X9YA 1E4XI 1Z5YD 2VWEE 1BFSA 1CR9H 3N9GH 3QIUD 4OGAC 2OW7A 3FTSA 4L05A 5F7FA 3BUQA 1OAQL 5ADPL 1VZHA 4EF3A 4ZMYA 4JM2B 4MS8C 1MW3A 3DUSA 1J1XL 3V6FB 1P4BH 5IWLC 2A9MH 4Y16C 3FO2B 1PCXA 5B3SB 3R7RA 1NAML 3LKRB 4PBWD 5PAZA 1MI5B 4NAMA 4GIPD 4XAKE 5EZIL 4ZXBA 1AY1L 3TIDA 1UZ8B 1U3HD 5DURB 1IGJB 4RIRB 4UMSA 4QI3A 1LEGB 3GXFA 4QD2E 3HNSL 4P2QD 3OMAB 4HCIA 2X3AA 2QKIC 2JQAA 4DP9X 1NJ9A 3RILA 5HPMA 4QRRA 2VISB 4MD4B 4KXBA 4HMEA 3A6CH 4LCWA 2BSRB 4ORGA 1I1CA 3N55A 3ULUH 2D7TH 1DDTA 2YEQA 2FRGP 4L5FL 1ND0B 3GIZL 5E6ZA 3TT1H 1M60A 3QEQA 4ICWA 1I31A 4OU3A 4Y9CA 3MGAA 1T66C 4N1CA 3DGDA 4IMLB 2D4DA 5DU7A 3P9LA 5M7QA 1GAFL 1R33A 2C3VB 1PAMA 2OBGA 2UXVA 2VN7A 3QJFB 4H88L 4Y2DA 3VWKD 4BUGA 4EO5A 1LGVA 1S7RA 4YHIA 1F1CA 1D5BB 2BP0A 1N7MH 3L5WA 3MOAL 3Q48A 2AJZB 2A2QT 4JY6A 4PJBE 5HGAB 4QRQA 1A1MA 5FGCE 1CCRA 2WD0A 1FIEA 3KVDD 4G42B 3WHXB 1UD2A 1UFUA 4GSQA 5BZWA 4HAFA 2N3JA 1MW0A 3QUMB 4BM7A 4HSQA 5ERWB 4XCEA 4PPTA 2YPLD 4A7TA 5AVRB 5FOBA 1SZNA 2GFBA 4AV4A 5KAIV 1SLXA 3BW9A 1TTBA 3A4DA 4JZNB 1SVCP 2W0FA 4I77H 4X5WA 1N8ZA 1H6TA 4LQFH 2QR0A 4Y1AB 1NL0H 4JO4H 3IMRA 3WD5H 2K7PA 3KR3L 3ABMB 5T1KB 3RWEB 3U0WH 3MLYL 5IHWA 3UZQA 4PI2A 4YE1A 4ETYA 1RZKH 4KNTA 4RA3A 2OMYA 2NY6D 2QPUA 4IBWA 1U42A 3EW3B 4WO4A 5FLVA 4P2RE 1HH6A 4KUZL 2W81C 3B9KD 3JTTA 3DVNA 3V52L 3WIAA 2R29A 2BRQA 1S9WA 1LO5B 2YEZA 5DJ2B 2KL6A 2YK3A 4YIQA 1JGDA 1WC7B 2DM3A 3MA7B 1HILB 2D03L 1BQHB 1BD2E 5D7JC 4HIJA 5J3HC 1KENH 1SMAA 3JV6B 4PGBA 5IF0B 4ZXBD 2YXFA 4HKBB 3NZ8B 1J05A 5DD6A 3DYMA 2ICWB 2VW6A 5EO1B 4EIGB 3DGGA 4U0RC 3BHBB 2IXQB 4ZFOA 3WU2V 4B27A 4JLRB 5CKAA 3Q01A 1KB5A 2P24B 2WNXA 4QRRD 5FM4A 3FBQA 3CDYA 3HZKA 4HUWB 4LCWD 3SD2A 1JWMA 5GGUA 1J0YA 3MRIA 4R4BA 4XMLL 1ILUA 3RURA 2FT6A 5D7KE 4LHUG 3QEQD 4TVUA 2NW3B 2MCG1 1H3WM 1OF0A 3HJEA 4WIQA 3D87B 1MZ4A 3CDZB 5IFJB 4ZQTA 2FR4A 1ERNA 1MY7A 3GIVA 1YNRA 1X9LA 4KWUA 1FFOB 3H0TA 4Y2DD 3VXSA 1IAIH 2GI0A 4HXBH 5EN2B 5IBLD 3CFDB 3EHBD 2E56A 4UOW0 1HL5A 4HPOH 3BRFA 1DJIA 4HQQH 4RNRB 5HTSA 1S9XB 3MU3A 4XXWC 1NCGA 2BIHA 4NENB 4U6HA 3NCEB 5I30L 3C5ZC 5FA3A 1QPPA 5I1DA 1DJGA 1LE9B 1DBKL 2X4PA 4UQBA 5HGDA 4GW4B 2PLTA 1P4IH 4NZTL 4GRMA 4RQQA 2WWKT 2YLKA 5HHOA 2OX5B 1PLGH 3VRLE 1JAEA 3ISYA 5I1IL 4GBXC 4RFNC 4YSOA 2QV2A 4G6AC 1QI3A 3MLXL 4YFLI 5T1MB 3L74D 3O45A 1TJGL 2CO3A 2IG2L 3FDWA 3QS2A 4ANVA 3L95A 4YVUA 4Z3HA 3BP4A 4G6JH 4HUVB 4QYOA 5DF5A 4HA1A 2EXWD 3O3BB 2RQEA 4JG0H 3L4XA 4HWEH 3RKDD 3UTTE 2EDMA 3D3VB 1ORSA 1NGZB 2ADYA 3LB6C 3B4NA 3QZLA 1N90A 5IHZB 1HQ4B 3BLBA 3DVGB 4IRJC 5FK9B 1TZHA 5GJSL 5I26A 2WWMD 4BQ8A 1P7KB 5EIVA 4XPHH 5D1QC 3R1GL 5F7NC 3DX6B 3L7FA 4KNQA 5BVJB 1PQZB 1NMBL 2WHVA 1CF1A 3K6DA 3QFDB 3NSYA 1ZLSL 1BFVL 3ZKMC 5C3IA 5E99L 3CXHJ 3Q8BA 4YZWA 3A4AA 1E5AA 4EN3B 3O0RL 1G43A 2PO6C 1F4YL 1S7WA 4KHXH 2PCBB 4ZFFA 2NY3C 1QLRA 4LKXA 4NAQA 155CA 2F0CA 3QDMA 5HY9A 1E67A 1X5GA 1K6QL 5CLZA 2FGWL 1N3NB 1FZOA 2CA4A 2C4FT 1MLBA 5F97E 4O00A 2A6JB 3K0WA 4HLJA 3VXUA 1TTCA 5F9DC 3C6EA 5CS7A 2JI1A 2HX7A 1XF4A 1U8MB 3A6BH 3NP4A 3VXSD 3H3KA 1UJ3B 4CUCA 4NZ8A 1WSST 2A6DA 2BNRA 3TIEB 3VRJA 1QA9B 2NZ1A 4U1JA 2EDDA 2DBJA 1YDPA 4PN6A 5FR3A 4F7TA 3IJEB 3LNGA 1PZCA 4UV7H 5E5RB 3TEWA 4Z78B 4WGVB 5KSBB 3BCCD 4H1LA 1VFAA 4MJIE 4KTEL 1JZ4A 1N26A 4R6UA 1G5GA 4YHZL 4NN7B 2BH5X 3WLBA 3PABA 3S37L 5DJZB 3QBTB 2OYLA 3L6FA 2EICA 5E8PB 4U3XA 3Q8FA 3TO4C 2JTDA 1G9MH 1LDSA 2ICEB 2X2JA 3FQ4A 4FFZL 1NEUA 3TEYA 1TTUA 4M29A 3WFBH 1AQHA 3ULVL 3NAAL 5F0MB 2PPAA 3QNYA 1P7HL 1TDQA 1UXMA 1Z2KA 5IEHA 4U2ZA 2GT9A 4KMGA 5LBGA 4AOFA 4EEEA 4CBZA 2F7IA 4RSYA 1EO8L 5BZDA 3CZLA 5BRPA 3J7HA 3TNMB 3RI5F 4R4NC 3NH7L 2IPKA 3V6BR 4F9PC 4ZMZA 1C9SA 5TPWH 3L4UA 5KS9F 3QWOA 1CXKA 1S8DB 2B15A 3TH4T 3WFCC 5DJCB 3G5YA 2I25N 3HN3A 5K9JH 3ATDA 3AREB 3O11A 2IQ9H 1TU2A 3NZHL 5E1AA 1IM3B 2J3SA 3OSKA 1EANA 4WEBL 3C60B 5E24E 4X4ME 4JM4H 3JWDC 4X7DC 3V55A 2VSDA 1D5ZA 2R2BA 4OZFH 5KJRL 5I76A 1OSZB 1AI1H 3LS4H 3L75D 3QDMD 2AI0L 5JOPE 3ETBF 1EHLL 4HOZA 5C0EB 2GY7B 3OPZH 4HJEA 3HE6B 1BWWA 4QF1B 4Y4KC 1T1XA 5CM1A 3KM2A 3QHTC 1S3KH 2V5MA 1KMGA 4KY2A 1GH7A 1ZTXH 4UB0L 1F13A 4UNVA 3MK7B 1A7PL 4ZG1A 4G8EB 2BNRD 3UEZA 1I8MA 4GW5B 2JJVA 2DDQL 2R1WA 3S34L 4KKRA 3L5XH 5DO2C 2A9BA 1ZWIA 4IKNA 1CQKA 5DDHA 3VX1A 4ZUTB 3QZWG 1FPTH 1H8OA 3F84A 3SB3A 3MLTB 5TQ0L 4F8TA 3L3GA 4DKFH 1KFGA 3IDXH 4C4KT 3A4FA 5FKPA 2MEJB 2JCCB 2N7BA 3N40F 3EYUH 5DCCA 2KI6A 3T65B 2Z8WC 5ILTH 3RYMA 2M26A 3RVWD 3DA0A 3V5DA 4YBQD 3MMEA 2VH5H 3FQXB 3S98A 3ZY7A 4XBGA 5F7MC 1OTSC 1UB5A 3VI3A 3IXTA 3FCSA 3BP6A 4HK3J 4H20L 4W9DC 4XN9A 5LLIC 2JJTA 2A9AA 1ED3A 3NESA 3V5KB 3ZZQA 2HG5A 5KBKA 5C0DB 3C2AH 4YXLH 1DQJB 3L3HA 5BPPA 4KZDH 2H8PB 3V6OA 3HAEH 3ZSSA 3HZYB 3RIAK 1BJ8A 4XXWA 1MFDH 3DV6A 4LLVB 2MCPL 4AYMC 4CJ1A 3BKYL 4EICA 4PW9A 1FO0B 1S5LV 3BQUB 1S5HA 2AXWA 4QWWD 2IAMA 5HDOA 5ISZE 3DURB 1EDQA 2C7FA 4UNUA 1AXTH 3SGEH 1DSFL 3NCCB 3C8KB 4NNYA 3UTOA 3ZE2F 3MV01 4GW1A 1OCDA 1AD0B 1AR1B 3DRQB 3ARZA 3P9MB 4TSBL 4GT0A 3UH8A 1Q94A 3SY6A 2YD4A 3RLMA