5KKZB

Rhodobacter sphaeroides bc1 with famoxadone
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 64
structure length 256
sequence length 256
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5kkzB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 5kkzB02
1MZ4A 4WQDA 4WQ7A 2L91A 3L72D 4RSZA 4Y5RA 1YCCA 3OA8A 2FWLA 1QL4A 4L3GA 5KAIV 1YFCA 2VHDA 1S6VB 3A9FA 3TYIA 1FI9A 2N9IA 4L1QA 3WFBC 3CXHW 5C9MA 5CIGB 2Y0DA 3MK7B 1CXCA 2N18B 1AKKA 3TDKA 2IBZD 3PXTA 5TJHA 3ZBMA 5H2FV 1E8EA 5CIEB 2KS1A 2DGEA 4NFGB 1A8CA 1CTJA 1DT1A 2AXTV 2JTIB 1QL3A 1RZ6A 4WQAA 1NTZD 1B7VA 3WFDC 4WQ9A 1DVHA 3OA8B 351CA 4H0KA 1CHIA 2BCNB 2PCBB 3RN1A 4MU8A 1YEBA 3RMZA 1CSWA 2GC4D 4FAVA 1P84D 4KMGA 2QJPB 4PW9B 1SQQD 3KHUA 1U74B 3CWBD 1M70A 1CIFA 1LC2A 1CTYA 1E2RA 2RN0A 1DIQC 1I6EA 2B0ZB 1SQVD 4UB8V 1I6DA 1FI7A 2YIUB 3O5CA 2CA4B 4FANA 1PPJD 3FWLA 1KB9D 2BGVX 3DMIA 1C7MA 4FA5A 1FOCA 1I8PA 1IRWA 1L0LD 2CE1A 1GKSA 4A7PA 4V2KA 4PJ0V 5DFSA 1CYJA 2Y0CA 5KLVD 2FYUD 1CIHA 4AX3A 3HQ6A 1OCDA 2AIUA 2BCCD 1AYGA 1OAEA 4O1QA 1JDLA 1VYDA 2CA3B 1E29A 2V08A 5C0ZA 3BCCD 3VMAA 1A56A 3PXSA 3CU4A 1IRVA 3CP5A 1FI3A 1H9XA 2BPBB 1F1FA 2B4ZA 1KX2A 1GDVA 2K9JB 3WFCC 1CIEA 1NMIA 3A0HV 1W5CT 3NBTA 1GQ1A 2C1UA 5CIFB 1QKSA 1MG3D 2B10B 1CRHA 2D0WA 4AANA 1COTA 5KLIB 2YQBA 3PLNA 3PHLA 4YE1A 3SLEA 1C2NA 4IL6V 2LIRA 2OZ1A 1I54A 4UB6V 2N3YA 1CHHA 1CYCA 1FJ0A 3L75D 2B12B 5EXQA 3L4MA 3VYMA 4QAOA 1IQCA 2N3BA 3ZIYA 1CEDA 2PACA 1H1OA 4LJIA 2C1DA 1CSXA 3ZOOA 1ZRTD 4AAOA 4EIDA 3A0BV 5TISV 1K3HA 2I8FA 1LS9A 2YCCA 5CYTR 2Y0EA 3ZOYA 3WU2V 2ZZS1 4AAMA 1H32A 2CE0A 4FA9A 2OZ1B 3WC8A 1LMSA 1DW2A 3L74D 3CYTI 1HJ3A 4AALA 2N9JA 5GTHV 1L9JC 4PD4D 2MTAC 1I5TA 1L9BC 1WVEC 1C6RA 4U3FD 1CRJA 1GU2A 1H33A 1YTCA 2ZOOA 2C1DB 1CRIA 2QJYB 2C2CA 1KX7A 2V07A 3GG2A 2HV4A 5DF5A 1NIRA 1HROA 2EXVA 3GW6A 3SXTA 1ZZHA 4RJTA 2O3JA 3H1JD 4Q5PA 2BH5X 3HQ8A 4O1WA 2BH4X 1FHBA 4EDFA 1EB7A 4WQ8A 1YIQA 1HRCA 1YNRA 1HJ5A 3OCDA 4FA4A 2CXBA 2D0SA 1NU1D 1NNOA 3VNWA 1CC5A 1FCDC 1N9CA 1QYZA 3ITKA 1AOQA 1HZVA 1CRGA 1H33B 1NTKD 1NTMD 1CSUA 2C1VA 2DVHA 3ZOXA 1GJQA 1KIBA 4WQCA 2JWAA 3O1YA 4PWAA 5B6QA 4EIEA 1EZVD 2C9XB 1CHJA 3WFEC 1KYOD 1HJ4A 1N50A 3L70D 2GC7D 2AI5A 3H1ID 3H1LD 1BGYD 1RAQA 4WQBA 4FA1A 1A2SA 1HH7A 1IZL0 3PRJA 1KV9A 5CIDB 1BCCD 1CIGA 4FB1A 1CCRA 2JQRA 4H0JA 3DP5A 5CIHB 1YEAA 1CCHA 3RLMA 1S5LV 1C6SA 2RMZA 1IO3A 1DW3A 1I8OA 3PXWA 3TF5A 3ZCFA 5IY51 3L4OA 2YK3A 1KB0A 1SQXD 4L3HA 155CA 1C2RA 5KKZB 3H1HD 1CXAA 1H9YA 1J3SA 4K3IA 1SQPD 2QG4A 5KAFV 1M6ZA 3SVWA 3CX5D 5CIBB 1CORA 3O0RC 1WEJF 1LFMA 1HZUA 1N15A 4P4QB 1GIWA 3O20A 4WQEA 3RN0A 3SJLA 1K3GA 3NBSA 2GB8B 1CRCA 1F1CA 2B11B 4GEDB 1LC1A 4EIFA 1RAPA 3SWSA 3TGUD 2KNCB 2PCCB 3X39A 4DY9A 1ETPA 1R0QA 1PP9D 1BE3D 1CO6A 1KYOW 1RZ5A 1L0ND 2QJKB 4JCGA 1MG2D 4D6TD 2LITA 2FRCA 1M60A 3L71D 3NWVA 451CA 1DVVA 2XTSB 2C8SA 5DJQC 3ZOWA 1CRYA 2BLFB 1CSVA 2ZXYA 1C52A 3C2CA 1H32B 1YICA 2A06D 2ZONG 1U75B 2L4DA 3CXHD 1HCMA 4XXLA 3M97X 3PH2B 1N90A 1AOFA 1W2LA 1I55A 1DW0A 3H1KD 5B5EV 1QN2A 2Q3EA 1C75A 3KZIV 1CNOA 5GTIV 2MHMA 1C6OA 1H31A 1SQBD 5B66V 4GYDA 5DJQB 2GIWA 5AURA 2ZBOA 1DW1A 4XYDB 3CX5W 4N0KA 1DIIC 3L73D 4EICA 1BL9A 3MK7C 2N18C 4J20A 1CYIA 2FYNB 3OCDB 3ORVA 3DR0A 3JBTB 3PTZA 3HQ7A 1CTZA 5CICB 3HQ9A 3WUIA 3VRDA 5E79V 1NMLA 2ORLA 2N9YB 1H31B
chains in the Genus database with same CATH superfamily
5AW6B 2OTLP 2C0XA 3L72D 2WSFJ 1GU5A 4Y5RA 2KOGA 2LXBA 1J2JB 1UIIA 4GODA 2IYPA 4RO0A 1IK7A 1XTCC 3OA8A 2E74B 1YFCA 2A45H 1S6VB 1FE6A 3TYIA 1KD1Q 3EFFK 4BRYB 1S5LX 2E74D 5C9MA 5CIGB 2Y0DA 3H1HE 2J5UA 3G4SP 3IF4A 1BSHA 3CX5E 2P10A 5H2FV 4N3YB 3LW5H 4GOEA 1HBWA 1DT1A 2AXTV 3G9RA 1QL3A 3CMAP 2Q6QA 3E7KA 1J1DC 1DVHA 4KT0J 3OA8B 2C9LY 5AVRB 1NHLA 4CPGA 2HFED 1MZ9A 3CXHH 4W7ZA 1URQC 2WQYC 2AXTE 4FAVA 1W2EA 3IFMA 3Q5SA 2FFDA 1SQQD 3L75G 1X9VA 1EC5A 3KHUA 2A06E 2HPCA 1M70A 1LC2A 1E2RA 2RN0A 2ZT9C 1I6EA 1FI7A 2YIUB 1AFOA 2OGUA 5CBNA 2W27A 2K37A 1HGVA 2K9JA 3B5NA 2JO1A 5AW0B 2HLOA 3MHVA 3DMIA 1OZHA 4DZOA 4V2KA 2W83C 2Y0CA 5AW5B 1DX7A 1AYGA 1LTJC 5KTBA 2FFDB 2HODA 1JDLA 2H89C 1EDKA 2CA3B 3KZIE 2HPCB 1LT9B 3RK3E 1SLQA 1GZLA 1NO4A 1IRVA 3CP5A 3CL3D 5BU5A 3TSIA 2K9JB 4DT0A 1SQVG 3B5NB 1W5CT 3NBTA 3F89A 1QKSA 1MG3D 2B10B 1CRHA 1CZQA 2D0WA 2WT7A 3CCEP 1EDJA 3MUDC 1KILE 4IL6V 4WY4A 2HODB 2OZ1A 2JDIH 5KLVG 2FYUG 1NU1G 2GUSA 2NPSA 1EXIA 1S9KE 3L4MA 2VRSA 3VYMA 2WSCJ 1IQCA 2M8RA 3EWKA 1UIXA 2IBZE 2C0WA 1NTKG 3HD7A 1KN7A 1LP1A 5H2FH 1AA0A 2PACA 4IL6E 1H1OA 1SQXJ 4LJIA 2ZJSE 1SQXK 2QJYC 3UIAA 4AAOA 2AXTH 4PD4I 1SP4A 1NTZE 3A0BH 5APTA 2OYIA 3WU2V 3M0DA 3H1LG 1A02F 1KQLA 4WY4B 2KZJA 2OZ1B 3WC8A 1LMSA 1ZV8A 1ZLLA 3CYTI 2NPSB 4AALA 2IYOA 2N9JA 4PD4D 3CC2P 4ASVA 1EQ7A 1P84E 1MFTA 2QM8A 1L9BC 1JTHA 2NZ2A 4H13C 2NPSD 4JQ0D 4JYBA 3HD7B 3WU2E 1LTSC 1LP1B 2V07A 3N4XA 5DF5A 3HD7D 1QL2A 3SXTA 3H1JD 2OYIB 1WMKA 2WPQA 1AQ5A 3HQ8A 3H1HG 3B8EB 1DD3A 2WPRA 4EDFA 1N7SC 1N8RQ 1GL2C 3NXSA 4WQ8A 2QRXA 1JMBA 3WMM0 1HRCA 1VQ5P 4OGQC 1SQVJ 1SQVK 1NOHA 4FA4A 2B87A 3A3YB 1CC5A 1EXJA 2Q9IA 4LC1A 1JTHB 3U59A 4XE5B 3ITKA 1M7LA 1CRGA 2KXPB 2YO2A 2D2CC 3VTPC 1LGHB 1NTMD 1CSUA 3ZOXA 1L0LJ 4EI2A 1L0LK 3Q5PA 2JWAA 1KFNA 4EIEA 1RQUA 2HG5D 3JSVC 2LR2A 5KLVJ 1EZVD 5KLVK 2FYUK 3P32A 1G2CA 2BCCJ 1HJ4A 5APUA 1USDA 2O1KA 1LTTC 1YJ9P 1OIPA 1KORA 2V4HA 1SFCB 2JR8A 1N86A 4C46A 5CIDB 1W2BO 2WVRA 4IL6H 2JQRA 4H0JA 2IFNA 4H44B 1SFCD 1RF1C 2OYHA 3L72J 3HTKB 1NYHA 1QLED 3VP8A 3TF5A 1JOCA 3ZCFA 4H44D 1G2CB 5IY51 4AQRD 3V4QA 2QJKC 4L3HA 3NFQA 4U7JA 1DH3A 1M57D 1H9YA 3KQGA 1J3SA 1ZRTE 2POHA 4K3IA 1P84H 1SQPD 2QG4A 1CORA 3AEAC 5KAFH 3H1IG 1PL5A 3WU2H 5EFWB 1GIWA 3O20A 1MFZA 3L74E 2AEJA 3G71P 2B9BA 3M0AA 2OYHB 3FWNA 1JMMA 1VQPP 5AW4B 1RAPA 1BE3D 2FXPA 4W7YA 2FRCA 3TK1A 451CA 3G6EP 4GKGA 5DJQC 2R32A 2CPSA 4N78D 3RK3C 1CRYA 4EOTA 1C52A 1PIXA 1Q2NA 5CCHC 1SQQJ 4U3FJ 1SQQK 2L4DA 3AE1C 3M97X 3HUSA 3PH2B 1AOFA 1QL1A 1U7JA 2R3SA 1KMIZ 5APVA 2WMMA 2XZRA 3MGNA 4YXDC 4GT1A 1QN2A 2Q3EA 5GTIV 2IZ1A 2MHMA 1PV3A 1C6OA 1KILC 2PGDA 1ZXGA 3EFGA 1VF5C 3Q3DA 2ZBOA 3USSA 1DW1A 4XYDB 3CX5W 1R8EA 1KYOE 2OTKE 4R4LA 4EICA 3HUSB 2KLVA 2N18C 4J20A 5APYA 1BGYE 3ORVA 3CC7P 5AVTB 2N9BA 1RQVA 3RK2B 4GOFA 1CTZA 2QIWA 1VQLP 3HQ9A 1BCCE 1E5WA 3H1KG 3V4WA 4PW9B 1MZ4A 2RKLA 4WQ7A 3B4SA 3H1IJ 3RK2D 1BDCA 4PV1B 4RSZA 3PH0A 1H88A 5AVXB 2JJLA 3MUDA 4PV1D 1SQBG 3V5BA 3WFBC 1VQ8P 3MK7B 1CXCA 2O01N 5KJ7D 4WB4A 2HR3A 1HGZA 1AKKA 3RL0C 1E8EA 5CIEB 2KS1A 4JBZA 2DGEA 1LNQA 1IFIA 4NFGB 4TT3H 1CTJA 1OFCX 2JTIB 3W67A 3WFDC 351CA 4H0KA 2PCBB 1PP9E 3AE9C 5CMZA 2AEFA 3RMZA 1L0NE 4D6TE 3G3ZA 3KDPB 3E1IA 2FKWB 2FY8A 3P8CD 2QJPB 3TGUJ 3OA7A 2IX7C 3M9HA 3AEGC 1U74B 2KS1B 3CXHE 2WTYA 1RF0C 1SQVD 4UB8V 3L71J 3H25A 3VMXA 1OW8A 3AEEC 3H6PA 3H1JJ 4FANA 2K9YA 2E42A 1YQ3C 4L73A 2BGVX 1LJ2A 3M91A 5GTIH 1I8PA 2CE1A 1L0LD 4PJ0V 1YTZI 3AE4C 5DFSA 3Q2YA 4UB8E 2JEEA 5AVYB 5KLVD 2FYUD 1CIHA 4AX3A 3H1KJ 2QSIA 2BCCD 3O8ZA 1OVUA 1E29A 3MTUE 5C0ZA 1CI6A 1A56A 1YJWP 3PXSA 4QMAA 1SQBJ 3GHGC 1DIPA 1SQBK 2WSCH 4PJ0E 2B88A 3CWBG 2N1TA 1M1KQ 1H9XA 2B4ZA 1KX2A 1J1EB 1CIEA 3A0HV 2C1UA 3L73J 4GIFA 2I1KA 1PPJG 3L72E 2Z5HA 2YQBA 3PLNA 2ZVNB 2PP6A 1C2NA 2Y9YA 2W6JH 1I54A 4UB6V 1CHHA 3A0HE 2B12B 1CI6B 4DJGA 3A2AA 4IFDK 1A02J 4QAOA 3ZIYA 3CX5I 3BCCG 2N1TB 2C9NY 5AVQB 2SPZA 2C1DA 2E43A 2N1TD 2ZFCA 3U1CA 4EIDA 3A0BV 1K3HA 1IFPA 1SQPJ 1LS9A 1SQPK 1AVYA 2CPBA 4AAMA 2O01J 1H32A 5H2FE 1L4AC 3I56P 3TNUA 1HJ3A 1L9JC 2MTAC 1BCCG 1I5TA 2IZ0A 3A0BE 1WVEC 4U3FD 4Y28J 4B86A 1YBKA 1CRJA 3FX0A 4NPDA 1BE3J 2M3BA 1H33A 2ZOOA 2C1DB 1CRIA 2J59M 1R5LA 5APSA 2C2CA 2E75B 4UB8H 1HROA 1OXZA 3GW6A 4GDOA 3EQ2A 1ZZHA 1OVVA 1VPCA 2LKMA 2BH5X 3SWYA 2BH4X 1IFDA 1FHBA 2E75D 1EB7A 2YKOA 1YIQA 3R4YA 3CWBJ 4K3AA 1YTZT 3C8VA 5KLIC 2A45G 4PJ0H 2CXBA 2D0SA 1NNOA 1KZUB 3VNWA 2FYZA 1FCDC 2Y9ZA 2KYVA 1HZVA 1KV4A 2BASA 1H33B 1NWQA 1RE3C 3AECC 2C1VA 2DVHA 1OW7A 3B71A 1GJQA 3O1YA 5B6QA 1YI2P 3CCRP 2KK7A 1VQ9P 3FGAD 2GC7D 3A0HH 3BCCJ 3H1ID 1T2KD 1HUCA 3TYYA 3SFEC 4DCKA 3B5ND 1Z56A 2WITA 3I5CA 1QGKB 1A2SA 1HH7A 1S2EA 2KB7P 3PRJA 1CIGA 3RGUA 3BRTB 1CCRA 3CC4P 3KXDA 4UB6H 4Y99C 1T6AA 1S5LV 4I7ZC 2G8YA 2KNCA 2IBZI 1EDLA 5KKZB 2P2UA 2E5TA 2WT7B 3L75J 1S5LE 5KAFV 4ZKUA 3L70G 5CIBB 2ZYDA 1WEJF 1LFMA 1HZUA 4LLHA 1N15A 4P4QB 1S1CX 4WQEA 1U57A 2PFXA 3AE6C 3RBXA 2GB8B 1CRCA 2KUBA 4WY4D 3O6QA 4PD4E 5CCGC 3TGUD 2KNCB 3AEBC 5KAFE 1IFJA 1R0QA 1FDOA 3S4RA 1CO6A 1KYOW 1JO5A 1M60A 3L71D 4IFFA 3ZOWA 2BLFB 2ZXYA 2BEZF 4WWIA 3H1JE 3SWFA 1NKZB 3OW2O 3ZDMA 1K04A 3MP7B 2W6AA 1FC2C 3M9BA 3Q5RA 2FYNC 1RF0A 1L2PA 1I55A 3HE5A 1GK4A 3H1KD 3O6QB 1QVGO 3HE4A 2JKVA 1CSBA 3M06A 1SQBD 1NTME 5B66V 4JYCA 2DW3A 5APWA 1FBMA 4GYDA 3CI9A 5AURA 2E74C 2FYUJ 1NU1J 2CK3H 1NU1K 2YNYA 1EZVE 1RE4C 2W6BA 5AW9B 4N0KA 3JCUH 3L73D 1X0TA 1LT1A 1BL9A 1MUUA 1NTKJ 1NTKK 3HE5B 2A06G 3GHGA 2B87B 5B66E 3PTZA 4C7RA 3C9IA 3HE4B 1NAFA 1FU1A 2WSSH 2OQQA 3R2PA 1PFIA 5E79V 3AEFC 5DJTB 3L70J 3KYQA 2L91A 3H1LJ 3LIDA 2QE7H 4H0LB 1S5LH 1VQMP 2XKMA 1YCCA 2FWLA 2E76B 2I1JA 5KAIV 2VHDA 4H0LD 5K5GB 3A9FA 4L1QA 3H32A 2KLUA 3NTNA 1OVRA 3CXHW 5E79E 2E76D 1ZR2A 1T3UA 4PD4H 3GHGB 1SQPE 3TDKA 3PXTA 5TJHA 5AW1B 2Q7CA 1QEXA 1A8CA 1JCDA 3H1HJ 5L8RJ 2YIUC 3VOPA 1B7VA 2J58A 3T97A 1KQFB 1FS0E 1CHIA 2BCNB 2HYNA 4MU8A 1BE3E 3H32B 1YEBA 4L74A 1GW3A 1URQA 2GC4D 4N78E 4KMGA 2FFDC 1YHQP 2KSJA 1ZOYC 1PGJA 1KB9I 4LGDE 2ZVOB 3CWBD 1LT9C 2BEQD 1I6DA 2IBZG 1FZEA 1IFMA 3T97B 2CA4B 1J1DB 1PPJD 3V2NA 3BASA 1HF9A 1KB9D 1NTZG 1C7MA 4FA5A 1FOCA 1VQNP 1GKSA 4A7PA 2WSFH 1URQB 1JY2P 1CYJA 1LWUC 5B66H 4O9BA 3HQ6A 5BU8B 1S72P 2AIUA 1OAEA 1LTJA 1URQD 2IFMA 3BCCD 3VMAA 5GTIE 2ZT9B 1RE3A 3CU4A 2YKQA 3AE7C 2XNDH 2BPBB 1YQ4C 2ZT9D 4EIJA 1GDVA 1OX3A 1Y9BA 1N73C 3WFCC 5E79H 3IR9A 4W80A 1HWTC 4AANA 2ZXEB 5KLIB 2G3AA 3PHLA 1USEA 3SLEA 3CCMP 3P7KA 1LTJB 1OW6A 2LIRA 5KAIH 2N3YA 1SQXE 1CYCA 1FJ0A 1Q86Q 2NPSC 1LTIC 3L75D 4JF7A 5EXQA 5APXA 5DJUB 2MKVA 2N3BA 2IDBA 4KJMA 1FDMA 2A45I 1FZCC 3HD7C 4WVZA 1NTMG 2YXRB 5AW7B 5AVUB 1CSXA 1HVVA 1EZVG 5AW8B 1MKMA 1D7MA 3SSUA 2OYIC 5TISH 3ZOYA 3I55P 2OTJP 1JCCA 1NJIQ 4FA9A 2KI7B 2ZXXA 2L5GB 1DW2A 1RH5B 1Q7YQ 4C7NA 2O1JA 1DEEG 5GTHH 5CCGA 2QVAA 3P8CE 1C6RA 4M3LA 4Z1MH 2R5BA 1KB9H 2QJYB 1KX7A 1PGOA 1SQVE 1S3JA 3HRNA 3GG2A 2HV4A 3VP9A 1NIRA 4TLFA 1GDTA 2QM7A 4RJTA 3V2QA 2PAJA 1N7SA 1GL2A 1R5SA 2GUVA 1L0LE 5AW2B 1T8ZA 1HJ5A 3OCDA 1NU1D 5KLVE 3F5HA 2FYUE 1SFCC 3L74G 1M1JC 2BCCE 4H13B 1QYZA 1AOQA 3FXDA 2V7QJ 3S1KA 2I8DA 3D6ZA 1NTKD 1PGQA 1HJBA 4H13D 2Z5IA 4YTPC 3NMDA 1H0TA 1CHJA 4HH2A 1N50A 1N7SB 3L70D 1GL2B 4BRYA 2AI5A 5C39A 3H1LD 1AJYA 1RAQA 3PJSK 4OGQB 4WQBA 1KTMA 1E79H 1IK9A 1N7SD 1GL2D 4FA1A 2R5DA 2YXQB 1IZL0 3GF7A 3CCSP 3AE8C 1KV9A 3GF3A 4OGQD 1FOSE 4FB1A 1NH4A 5CIHB 1CCHA 2D2CB 3AE2C 3RLMA 2OYHC 1W5CE 1RF1A 4HYTB 2RMZA 1IO3A 1JY2O 1YYCA 2H8PD 1DW3A 3L36A 4IL6X 2D2CD 1H0TB 4WBAA 2YK3A 1KB0A 1X79B 1Y47A 1C2RA 3BRVB 4UB6E 3H1HD 4XA4A 3L4FA 1CXAA 3RL0g 3CX5D 1QX8A 1BGYG 2R3CA 1YJNP 4RESB 4OH8B 1SVFA 3RN0A 3SJLA 1GK6A 4L75A 1RF1B 3WUVA 1F1CA 2B11B 4GEDB 2UWJE 1LC1A 3SWSA 4I1LA 3VMZA 2GM4A 1IFNA 1M56D 3D70A 3X39A 4KHXA 5AVWB 1SQQE 4ZNCA 1YITP 1ETPA 4U3FE 2YMYA 2QJKB 4JCGA 1MG2D 5AVVB 3IAOA 3L74J 2H88C 3NWVA 2C8SA 2FXMA 1SQXG 3VYIA 3C2CA 3OAKA 1GTWA 3SFDC 1H32B 1YICA 2A06D 5CCHA 4XXLA 3HUSC 3TNUB 1LT9A 2Z4EA 1N90A 5AVSB 2MJZA 1DW0A 1PGPA 5B5EV 3RK2C 2WZ7A 3KZIV 1CNOA 3IN6A 2P7JA 1KILA 4PV1C 3CPWO 5APQA 5DJQB 1PP9G 1DD4A 2GIWA 1LWUA 3RK3B 1L0NG 4D6TG 2W90A 5B5EE 5KJ7C 1IZNB 4EYYQ 3RK3D 4JPZB 1TU3F 3MK7C 3AEDC 1AV1A 3H1IE 1CYIA 1GD2E 2RH0A 1MV8A 5CCHD 3DR0A 1OWAA 1KQGB 3HQ7A 2OYOA 5CICB 4IOIH 3JCUE 1N73A 3WUIA 3II6A 2QEXP 4AUWA 2N9YB 2WSEJ 1IO4A 4WQDA 1KILB 1BGYJ 1JY2N 1NVOA 1DEBA 1RY3A 3V2RA 1VF5B 1LWUB 1QL4A 4L3GA 3CX5H 1KILD 1L0LG 2P58A 1KQSO 4I2LC 1BCCJ 1M8OB 1FI9A 2N9IA 1VF5D 4NPFX 1S9KD 2N18B 2BCCG 1JY3P 2QJPC 2IBZD 1FZBA 3SWKA 3ZBMA 1FZCA 2KIKA 2LXCB 1N73B 4BXLA 3K5BA 2P67A 1HH0A 1RZ6A 4WQAA 1P84I 1NTZD 2B89A 1FZFA 4I6MC 3L35A 1VQ6P 2GA1A 1G1JA 4WQ9A 3TGUE 3CCVP 3D71A 3L72G 3RN1A 3QH9A 1RHZB 3A7OA 4MN4C 2YO3A 1CSWA 3L71E 3C1LA 3MZWB 1P84D 1LTAC 3VN0A 2XV5A 2WWWA 4IFMA 3RL0B 1FZCB 3LW5J 1Q82Q 1PP9J 1CIFA 1CTYA 1L0NJ 4ZMDA 1DIQC 2B0ZB 1L0NK 4D6TJ 2ZYGA 4HKZH 1ZP0C 1JM0A 2FXOA 3RL0D 1Q81Q 3H1KE 3O5CA 2OARA 3CLQA 1J1EC 5B5EH 3FWLA 2PRRA 3KZIH 1IRWA 2KZIA 1SQBE 1H8AA 1WT6A 2K1AA 2XNXA 1OCDA 1EZVI 3WUTA 1H89A 1SFCA 4O1QA 1M1JA 2AXCA 2M5AA 2KSEA 2ZYAA 1VYDA 1JUNA 2V08A 2NRGA 3L73E 3KPEA 2XDJA 1SQQG 3HTKA 4U3FG 2N1TC 1FI3A 1PZQA 1F1FA 3MD0A 1VQOP 1WRGA 1NMIA 1GQ1A 5CIFB 3JC22 3CMEP 3CCLP 1COTA 3OJAB 2FBWC 4YE1A 1IJDB 2Q1KA 1M1JB 2M5AB 2WPSA 1G1IA 2W8ZA 2K3RA 1AQTA 3BATA 3V2PA 3A5TA 3CD6P 3QWOC 1FDIA 4DOJA 1HTLC 1CEDA 5KAIE 1X8YA 2P1JA 2H43A 1XTGB 3ABVC 3ZOOA 1ZRTD 1ZN5A 2E75C 3L37A 5TISV 1JEKA 2I8FA 5M1BA 2YCCA 5CYTR 3CCQP 2Y0EA 1FJKA 2ZZS1 1GW4A 2CE0A 3E1RA 3GLMA 1L4AA 3LIEA 3L74D 4R4MA 5CJ0A 3GMAA 1OMIA 5CHXA 1T3JA 5GTHV 1K05A 1VL2A 3AE5C 1HJ0A 1VDFA 5TISE 1NGMB 2V7QH 4L76A 1GU2A 1YTCA 3CWBE 2EXVA 1JY3O 5GTHE 1T2KC 1FZGA 2O3JA 4Q5PA 3V6IA 3B5NC 3RBZA 4O1WA 1PPJE 5BVZA 1FAVA 2JWDA 1CW5A 4OVNF 1KB9E 1L4AB 1YNRA 4ASWA 5AW3B 4YPCA 1IC2A 1L4AD 1KYOI 1LTBC 2ZAEB 1N9CA 2Q5UA 2AEMA 3BCCE 3TGUG 5CJ4A 3U1AA 1KIBA 4WQCA 2M3EA 1VQKP 4PWAA 1N7LA 2C9XB 3WFEC 1KYOD 3BVHA 3L71G 5KJ7A 5KKZC 1BGYD 3H1JG 3D6YA 2O01H 4WY4C 1BCCD 1AVOA 1LTGC 1X22A 1VQ4P 3DP5A 1ZW0A 1YEAA 3L75E 1Q90D 1QVFO 1C6SA 4XFJA 1I8OA 3PXWA 1K9MQ 4RKUJ 1YIJP 1M90Q 3L4OA 1EDIA 3CCJP 2QA4P 3AE3C 1VQ7P 1K8AQ 1SQXD 155CA 1NKNA 1NAYA 1M6ZA 3SVWA 3L73G 3M0DC 1JB0J 3O0RC 4HB1A 4YXWH 4ZKPA 1BSNA 2XU6A 1K3GA 2YKPA 3WUUA 2WPVB 3NBSA 3MIWA 4Y99B 4I7ZB 1NTZJ 5AVZB 1FOSF 1NTZK 4EIFA 2PCCB 4DY9A 2Q3IA 3VMYA 4AYCA 1PP9D 3D0WA 3CXHI 1RZ5A 1L0ND 4BWNA 4D6TD 2LITA 4OWFA 1Y8AA 1DVVA 2XTSB 1JY3N 3FXEA 2YMKA 1CSVA 1S4XA 1JNMA 2KP8A 2ZONG 1U75B 3CXHD 4HJGH 1N2DC 1HCMA 1SQPG 1W2LA 4NPEA 1K73Q 3W68A 4C7NB 5CBOA 3CCUP 4K35A 3M9QA 1NU1E 1KFMA 3PP5A 1C75A 1KYOH 4H44C 2WSEH 5CCGD 1H31A 1KC8Q 1ZR4A 1GMJA 1NTKE 3N7NA 4H0LC 1BE3G 2E76C 1RE4A 2R44A 3P8MC 1DIIC 3Q1MA 2K88A 2H7HA 2E5YA 3L70E 1SS1A 3H1LE 2IPPA 1U7MA 2FYNB 1NTMJ 1FJPA 1NTMK 3OCDB 1FZAA 3JBTB 1BDDA 2JP3A 3S9OA 2M0BA 4N6JA 3VRDA 2ITAA 1NMLA 2ORLA 1GU4A 1ZMEC 1H31B
chains in the Genus database with same CATH topology
1MZ4A 4WQDA 4WQ7A 2L91A 3L72D 4RSZA 4Y5RA 1YCCA 3OA8A 2FWLA 1QL4A 4L3GA 5KAIV 1YFCA 2VHDA 1S6VB 3A9FA 3TYIA 1FI9A 2N9IA 4L1QA 3WFBC 3CXHW 5C9MA 5CIGB 2Y0DA 3MK7B 1CXCA 2N18B 1AKKA 3TDKA 2IBZD 3PXTA 5TJHA 3ZBMA 5H2FV 1E8EA 5CIEB 2KS1A 2DGEA 4NFGB 1A8CA 1CTJA 1DT1A 2AXTV 2JTIB 1QL3A 1RZ6A 4WQAA 1NTZD 1B7VA 3WFDC 4WQ9A 1DVHA 3OA8B 351CA 4H0KA 1CHIA 2BCNB 2PCBB 3RN1A 4MU8A 1YEBA 3RMZA 1CSWA 2GC4D 4FAVA 1P84D 4KMGA 2QJPB 4PW9B 1SQQD 3KHUA 1U74B 3CWBD 1M70A 1CIFA 1LC2A 1CTYA 1E2RA 2RN0A 1DIQC 1I6EA 2B0ZB 1SQVD 4UB8V 1I6DA 1FI7A 2YIUB 3O5CA 2CA4B 4FANA 1PPJD 3FWLA 1KB9D 2BGVX 3DMIA 1C7MA 4FA5A 1FOCA 1I8PA 1IRWA 1L0LD 2CE1A 1GKSA 4A7PA 4V2KA 4PJ0V 5DFSA 1CYJA 2Y0CA 5KLVD 2FYUD 1CIHA 4AX3A 3HQ6A 1OCDA 2AIUA 2BCCD 1AYGA 1OAEA 4O1QA 1JDLA 1VYDA 2CA3B 1E29A 2V08A 5C0ZA 3BCCD 3VMAA 1A56A 3PXSA 3CU4A 1IRVA 3CP5A 1FI3A 1H9XA 2BPBB 1F1FA 2B4ZA 1KX2A 1GDVA 2K9JB 3WFCC 1CIEA 1NMIA 3A0HV 1W5CT 3NBTA 1GQ1A 2C1UA 5CIFB 1QKSA 1MG3D 2B10B 1CRHA 2D0WA 4AANA 1COTA 5KLIB 2YQBA 3PLNA 3PHLA 4YE1A 3SLEA 1C2NA 4IL6V 2LIRA 2OZ1A 1I54A 4UB6V 2N3YA 1CHHA 1CYCA 1FJ0A 3L75D 2B12B 5EXQA 3L4MA 3VYMA 4QAOA 1IQCA 2N3BA 3ZIYA 1CEDA 2PACA 1H1OA 4LJIA 2C1DA 1CSXA 3ZOOA 1ZRTD 4AAOA 4EIDA 3A0BV 5TISV 1K3HA 2I8FA 1LS9A 2YCCA 5CYTR 2Y0EA 3ZOYA 3WU2V 2ZZS1 4AAMA 1H32A 2CE0A 4FA9A 2OZ1B 3WC8A 1LMSA 1DW2A 3L74D 3CYTI 1HJ3A 4AALA 2N9JA 5GTHV 1L9JC 4PD4D 2MTAC 1I5TA 1L9BC 1WVEC 1C6RA 4U3FD 1CRJA 1GU2A 1H33A 1YTCA 2ZOOA 2C1DB 1CRIA 2QJYB 2C2CA 1KX7A 2V07A 3GG2A 2HV4A 5DF5A 1NIRA 1HROA 2EXVA 3GW6A 3SXTA 1ZZHA 4RJTA 2O3JA 3H1JD 4Q5PA 2BH5X 3HQ8A 4O1WA 2BH4X 1FHBA 4EDFA 1EB7A 4WQ8A 1YIQA 1HRCA 1YNRA 1HJ5A 3OCDA 4FA4A 2CXBA 2D0SA 1NU1D 1NNOA 3VNWA 1CC5A 1FCDC 1N9CA 1QYZA 3ITKA 1AOQA 1HZVA 1CRGA 1H33B 1NTKD 1NTMD 1CSUA 2C1VA 2DVHA 3ZOXA 1GJQA 1KIBA 4WQCA 2JWAA 3O1YA 4PWAA 5B6QA 4EIEA 1EZVD 2C9XB 1CHJA 3WFEC 1KYOD 1HJ4A 1N50A 3L70D 2GC7D 2AI5A 3H1ID 3H1LD 1BGYD 1RAQA 4WQBA 4FA1A 1A2SA 1HH7A 1IZL0 3PRJA 1KV9A 5CIDB 1BCCD 1CIGA 4FB1A 1CCRA 2JQRA 4H0JA 3DP5A 5CIHB 1YEAA 1CCHA 3RLMA 1S5LV 1C6SA 2RMZA 1IO3A 1DW3A 1I8OA 3PXWA 3TF5A 3ZCFA 5IY51 3L4OA 2YK3A 1KB0A 1SQXD 4L3HA 155CA 1C2RA 5KKZB 3H1HD 1CXAA 1H9YA 1J3SA 4K3IA 1SQPD 2QG4A 5KAFV 1M6ZA 3SVWA 3CX5D 5CIBB 1CORA 3O0RC 1WEJF 1LFMA 1HZUA 1N15A 4P4QB 1GIWA 3O20A 4WQEA 3RN0A 3SJLA 1K3GA 3NBSA 2GB8B 1CRCA 1F1CA 2B11B 4GEDB 1LC1A 4EIFA 1RAPA 3SWSA 3TGUD 2KNCB 2PCCB 3X39A 4DY9A 1ETPA 1R0QA 1PP9D 1BE3D 1CO6A 1KYOW 1RZ5A 1L0ND 2QJKB 4JCGA 1MG2D 4D6TD 2LITA 2FRCA 1M60A 3L71D 3NWVA 451CA 1DVVA 2XTSB 2C8SA 5DJQC 3ZOWA 1CRYA 2BLFB 1CSVA 2ZXYA 1C52A 3C2CA 1H32B 1YICA 2A06D 2ZONG 1U75B 2L4DA 3CXHD 1HCMA 4XXLA 3M97X 3PH2B 1N90A 1AOFA 1W2LA 1I55A 1DW0A 3H1KD 5B5EV 1QN2A 2Q3EA 1C75A 3KZIV 1CNOA 5GTIV 2MHMA 1C6OA 1H31A 1SQBD 5B66V 4GYDA 5DJQB 2GIWA 5AURA 2ZBOA 1DW1A 4XYDB 3CX5W 4N0KA 1DIIC 3L73D 4EICA 1BL9A 3MK7C 2N18C 4J20A 1CYIA 2FYNB 3OCDB 3ORVA 3DR0A 3JBTB 3PTZA 3HQ7A 1CTZA 5CICB 3HQ9A 3WUIA 3VRDA 5E79V 1NMLA 2ORLA 2N9YB 1H31B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZ4 A;  4WQD A;  4WQ7 A;  2L91 A;  3L72 D;  4RSZ A;  4Y5R A;  1YCC A;  3OA8 A;  2FWL A;  1QL4 A;  4L3G A;  5KAI V;  1YFC A;  2VHD A;  1S6V B;  3A9F A;  3TYI A;  1FI9 A;  2N9I A;  4L1Q A;  3WFB C;  3CXH W;  5C9M A;  5CIG B;  2Y0D A;  3MK7 B;  1CXC A;  2N18 B;  1AKK A;  3TDK A;  2IBZ D;  3PXT A;  5TJH A;  3ZBM A;  5H2F V;  1E8E A;  5CIE B;  2KS1 A;  2DGE A;  4NFG B;  1A8C A;  1CTJ A;  1DT1 A;  2AXT V;  2JTI B;  1QL3 A;  1RZ6 A;  4WQA A;  1NTZ D;  1B7V A;  3WFD C;  4WQ9 A;  1DVH A;  3OA8 B;  351C A;  4H0K A;  1CHI A;  2BCN B;  2PCB B;  3RN1 A;  4MU8 A;  1YEB A;  3RMZ A;  1CSW A;  2GC4 D;  4FAV A;  1P84 D;  4KMG A;  2QJP B;  4PW9 B;  1SQQ D;  3KHU A;  1U74 B;  3CWB D;  1M70 A;  1CIF A;  1LC2 A;  1CTY A;  1E2R A;  2RN0 A;  1DIQ C;  1I6E A;  2B0Z B;  1SQV D;  4UB8 V;  1I6D A;  1FI7 A;  2YIU B;  3O5C A;  2CA4 B;  4FAN A;  1PPJ D;  3FWL A;  1KB9 D;  2BGV X;  3DMI A;  1C7M A;  4FA5 A;  1FOC A;  1I8P A;  1IRW A;  1L0L D;  2CE1 A;  1GKS A;  4A7P A;  4V2K A;  4PJ0 V;  5DFS A;  1CYJ A;  2Y0C A;  5KLV D;  2FYU D;  1CIH A;  4AX3 A;  3HQ6 A;  1OCD A;  2AIU A;  2BCC D;  1AYG A;  1OAE A;  4O1Q A;  1JDL A;  1VYD A;  2CA3 B;  1E29 A;  2V08 A;  5C0Z A;  3BCC D;  3VMA A;  1A56 A;  3PXS A;  3CU4 A;  1IRV A;  3CP5 A;  1FI3 A;  1H9X A;  2BPB B;  1F1F A;  2B4Z A;  1KX2 A;  1GDV A;  2K9J B;  3WFC C;  1CIE A;  1NMI A;  3A0H V;  1W5C T;  3NBT A;  1GQ1 A;  2C1U A;  5CIF B;  1QKS A;  1MG3 D;  2B10 B;  1CRH A;  2D0W A;  4AAN A;  1COT A;  5KLI B;  2YQB A;  3PLN A;  3PHL A;  4YE1 A;  3SLE A;  1C2N A;  4IL6 V;  2LIR A;  2OZ1 A;  1I54 A;  4UB6 V;  2N3Y A;  1CHH A;  1CYC A;  1FJ0 A;  3L75 D;  2B12 B;  5EXQ A;  3L4M A;  3VYM A;  4QAO A;  1IQC A;  2N3B A;  3ZIY A;  1CED A;  2PAC A;  1H1O A;  4LJI A;  2C1D A;  1CSX A;  3ZOO A;  1ZRT D;  4AAO A;  4EID A;  3A0B V;  5TIS V;  1K3H A;  2I8F A;  1LS9 A;  2YCC A;  5CYT R;  2Y0E A;  3ZOY A;  3WU2 V;  2ZZS 1;  4AAM A;  1H32 A;  2CE0 A;  4FA9 A;  2OZ1 B;  3WC8 A;  1LMS A;  1DW2 A;  3L74 D;  3CYT I;  1HJ3 A;  4AAL A;  2N9J A;  5GTH V;  1L9J C;  4PD4 D;  2MTA C;  1I5T A;  1L9B C;  1WVE C;  1C6R A;  4U3F D;  1CRJ A;  1GU2 A;  1H33 A;  1YTC A;  2ZOO A;  2C1D B;  1CRI A;  2QJY B;  2C2C A;  1KX7 A;  2V07 A;  3GG2 A;  2HV4 A;  5DF5 A;  1NIR A;  1HRO A;  2EXV A;  3GW6 A;  3SXT A;  1ZZH A;  4RJT A;  2O3J A;  3H1J D;  4Q5P A;  2BH5 X;  3HQ8 A;  4O1W A;  2BH4 X;  1FHB A;  4EDF A;  1EB7 A;  4WQ8 A;  1YIQ A;  1HRC A;  1YNR A;  1HJ5 A;  3OCD A;  4FA4 A;  2CXB A;  2D0S A;  1NU1 D;  1NNO A;  3VNW A;  1CC5 A;  1FCD C;  1N9C A;  1QYZ A;  3ITK A;  1AOQ A;  1HZV A;  1CRG A;  1H33 B;  1NTK D;  1NTM D;  1CSU A;  2C1V A;  2DVH A;  3ZOX A;  1GJQ A;  1KIB A;  4WQC A;  2JWA A;  3O1Y A;  4PWA A;  5B6Q A;  4EIE A;  1EZV D;  2C9X B;  1CHJ A;  3WFE C;  1KYO D;  1HJ4 A;  1N50 A;  3L70 D;  2GC7 D;  2AI5 A;  3H1I D;  3H1L D;  1BGY D;  1RAQ A;  4WQB A;  4FA1 A;  1A2S A;  1HH7 A;  1IZL 0;  3PRJ A;  1KV9 A;  5CID B;  1BCC D;  1CIG A;  4FB1 A;  1CCR A;  2JQR A;  4H0J A;  3DP5 A;  5CIH B;  1YEA A;  1CCH A;  3RLM A;  1S5L V;  1C6S A;  2RMZ A;  1IO3 A;  1DW3 A;  1I8O A;  3PXW A;  3TF5 A;  3ZCF A;  5IY5 1;  3L4O A;  2YK3 A;  1KB0 A;  1SQX D;  4L3H A;  155C A;  1C2R A;  5KKZ B;  3H1H D;  1CXA A;  1H9Y A;  1J3S A;  4K3I A;  1SQP D;  2QG4 A;  5KAF V;  1M6Z A;  3SVW A;  3CX5 D;  5CIB B;  1COR A;  3O0R C;  1WEJ F;  1LFM A;  1HZU A;  1N15 A;  4P4Q B;  1GIW A;  3O20 A;  4WQE A;  3RN0 A;  3SJL A;  1K3G A;  3NBS A;  2GB8 B;  1CRC A;  1F1C A;  2B11 B;  4GED B;  1LC1 A;  4EIF A;  1RAP A;  3SWS A;  3TGU D;  2KNC B;  2PCC B;  3X39 A;  4DY9 A;  1ETP A;  1R0Q A;  1PP9 D;  1BE3 D;  1CO6 A;  1KYO W;  1RZ5 A;  1L0N D;  2QJK B;  4JCG A;  1MG2 D;  4D6T D;  2LIT A;  2FRC A;  1M60 A;  3L71 D;  3NWV A;  451C A;  1DVV A;  2XTS B;  2C8S A;  5DJQ C;  3ZOW A;  1CRY A;  2BLF B;  1CSV A;  2ZXY A;  1C52 A;  3C2C A;  1H32 B;  1YIC A;  2A06 D;  2ZON G;  1U75 B;  2L4D A;  3CXH D;  1HCM A;  4XXL A;  3M97 X;  3PH2 B;  1N90 A;  1AOF A;  1W2L A;  1I55 A;  1DW0 A;  3H1K D;  5B5E V;  1QN2 A;  2Q3E A;  1C75 A;  3KZI V;  1CNO A;  5GTI V;  2MHM A;  1C6O A;  1H31 A;  1SQB D;  5B66 V;  4GYD A;  5DJQ B;  2GIW A;  5AUR A;  2ZBO A;  1DW1 A;  4XYD B;  3CX5 W;  4N0K A;  1DII C;  3L73 D;  4EIC A;  1BL9 A;  3MK7 C;  2N18 C;  4J20 A;  1CYI A;  2FYN B;  3OCD B;  3ORV A;  3DR0 A;  3JBT B;  3PTZ A;  3HQ7 A;  1CTZ A;  5CIC B;  3HQ9 A;  3WUI A;  3VRD A;  5E79 V;  1NML A;  2ORL A;  2N9Y B;  1H31 B; 
#chains in the Genus database with same CATH topology
 5AW6 B;  2OTL P;  2C0X A;  3L72 D;  2WSF J;  1GU5 A;  4Y5R A;  2KOG A;  2LXB A;  1J2J B;  1UII A;  4GOD A;  2IYP A;  4RO0 A;  1IK7 A;  1XTC C;  3OA8 A;  2E74 B;  1YFC A;  2A45 H;  1S6V B;  1FE6 A;  3TYI A;  1KD1 Q;  3EFF K;  4BRY B;  1S5L X;  2E74 D;  5C9M A;  5CIG B;  2Y0D A;  3H1H E;  2J5U A;  3G4S P;  3IF4 A;  1BSH A;  3CX5 E;  2P10 A;  5H2F V;  4N3Y B;  3LW5 H;  4GOE A;  1HBW A;  1DT1 A;  2AXT V;  3G9R A;  1QL3 A;  3CMA P;  2Q6Q A;  3E7K A;  1J1D C;  1DVH A;  4KT0 J;  3OA8 B;  2C9L Y;  5AVR B;  1NHL A;  4CPG A;  2HFE D;  1MZ9 A;  3CXH H;  4W7Z A;  1URQ C;  2WQY C;  2AXT E;  4FAV A;  1W2E A;  3IFM A;  3Q5S A;  2FFD A;  1SQQ D;  3L75 G;  1X9V A;  1EC5 A;  3KHU A;  2A06 E;  2HPC A;  1M70 A;  1LC2 A;  1E2R A;  2RN0 A;  2ZT9 C;  1I6E A;  1FI7 A;  2YIU B;  1AFO A;  2OGU A;  5CBN A;  2W27 A;  2K37 A;  1HGV A;  2K9J A;  3B5N A;  2JO1 A;  5AW0 B;  2HLO A;  3MHV A;  3DMI A;  1OZH A;  4DZO A;  4V2K A;  2W83 C;  2Y0C A;  5AW5 B;  1DX7 A;  1AYG A;  1LTJ C;  5KTB A;  2FFD B;  2HOD A;  1JDL A;  2H89 C;  1EDK A;  2CA3 B;  3KZI E;  2HPC B;  1LT9 B;  3RK3 E;  1SLQ A;  1GZL A;  1NO4 A;  1IRV A;  3CP5 A;  3CL3 D;  5BU5 A;  3TSI A;  2K9J B;  4DT0 A;  1SQV G;  3B5N B;  1W5C T;  3NBT A;  3F89 A;  1QKS A;  1MG3 D;  2B10 B;  1CRH A;  1CZQ A;  2D0W A;  2WT7 A;  3CCE P;  1EDJ A;  3MUD C;  1KIL E;  4IL6 V;  4WY4 A;  2HOD B;  2OZ1 A;  2JDI H;  5KLV G;  2FYU G;  1NU1 G;  2GUS A;  2NPS A;  1EXI A;  1S9K E;  3L4M A;  2VRS A;  3VYM A;  2WSC J;  1IQC A;  2M8R A;  3EWK A;  1UIX A;  2IBZ E;  2C0W A;  1NTK G;  3HD7 A;  1KN7 A;  1LP1 A;  5H2F H;  1AA0 A;  2PAC A;  4IL6 E;  1H1O A;  1SQX J;  4LJI A;  2ZJS E;  1SQX K;  2QJY C;  3UIA A;  4AAO A;  2AXT H;  4PD4 I;  1SP4 A;  1NTZ E;  3A0B H;  5APT A;  2OYI A;  3WU2 V;  3M0D A;  3H1L G;  1A02 F;  1KQL A;  4WY4 B;  2KZJ A;  2OZ1 B;  3WC8 A;  1LMS A;  1ZV8 A;  1ZLL A;  3CYT I;  2NPS B;  4AAL A;  2IYO A;  2N9J A;  4PD4 D;  3CC2 P;  4ASV A;  1EQ7 A;  1P84 E;  1MFT A;  2QM8 A;  1L9B C;  1JTH A;  2NZ2 A;  4H13 C;  2NPS D;  4JQ0 D;  4JYB A;  3HD7 B;  3WU2 E;  1LTS C;  1LP1 B;  2V07 A;  3N4X A;  5DF5 A;  3HD7 D;  1QL2 A;  3SXT A;  3H1J D;  2OYI B;  1WMK A;  2WPQ A;  1AQ5 A;  3HQ8 A;  3H1H G;  3B8E B;  1DD3 A;  2WPR A;  4EDF A;  1N7S C;  1N8R Q;  1GL2 C;  3NXS A;  4WQ8 A;  2QRX A;  1JMB A;  3WMM 0;  1HRC A;  1VQ5 P;  4OGQ C;  1SQV J;  1SQV K;  1NOH A;  4FA4 A;  2B87 A;  3A3Y B;  1CC5 A;  1EXJ A;  2Q9I A;  4LC1 A;  1JTH B;  3U59 A;  4XE5 B;  3ITK A;  1M7L A;  1CRG A;  2KXP B;  2YO2 A;  2D2C C;  3VTP C;  1LGH B;  1NTM D;  1CSU A;  3ZOX A;  1L0L J;  4EI2 A;  1L0L K;  3Q5P A;  2JWA A;  1KFN A;  4EIE A;  1RQU A;  2HG5 D;  3JSV C;  2LR2 A;  5KLV J;  1EZV D;  5KLV K;  2FYU K;  3P32 A;  1G2C A;  2BCC J;  1HJ4 A;  5APU A;  1USD A;  2O1K A;  1LTT C;  1YJ9 P;  1OIP A;  1KOR A;  2V4H A;  1SFC B;  2JR8 A;  1N86 A;  4C46 A;  5CID B;  1W2B O;  2WVR A;  4IL6 H;  2JQR A;  4H0J A;  2IFN A;  4H44 B;  1SFC D;  1RF1 C;  2OYH A;  3L72 J;  3HTK B;  1NYH A;  1QLE D;  3VP8 A;  3TF5 A;  1JOC A;  3ZCF A;  4H44 D;  1G2C B;  5IY5 1;  4AQR D;  3V4Q A;  2QJK C;  4L3H A;  3NFQ A;  4U7J A;  1DH3 A;  1M57 D;  1H9Y A;  3KQG A;  1J3S A;  1ZRT E;  2POH A;  4K3I A;  1P84 H;  1SQP D;  2QG4 A;  1COR A;  3AEA C;  5KAF H;  3H1I G;  1PL5 A;  3WU2 H;  5EFW B;  1GIW A;  3O20 A;  1MFZ A;  3L74 E;  2AEJ A;  3G71 P;  2B9B A;  3M0A A;  2OYH B;  3FWN A;  1JMM A;  1VQP P;  5AW4 B;  1RAP A;  1BE3 D;  2FXP A;  4W7Y A;  2FRC A;  3TK1 A;  451C A;  3G6E P;  4GKG A;  5DJQ C;  2R32 A;  2CPS A;  4N78 D;  3RK3 C;  1CRY A;  4EOT A;  1C52 A;  1PIX A;  1Q2N A;  5CCH C;  1SQQ J;  4U3F J;  1SQQ K;  2L4D A;  3AE1 C;  3M97 X;  3HUS A;  3PH2 B;  1AOF A;  1QL1 A;  1U7J A;  2R3S A;  1KMI Z;  5APV A;  2WMM A;  2XZR A;  3MGN A;  4YXD C;  4GT1 A;  1QN2 A;  2Q3E A;  5GTI V;  2IZ1 A;  2MHM A;  1PV3 A;  1C6O A;  1KIL C;  2PGD A;  1ZXG A;  3EFG A;  1VF5 C;  3Q3D A;  2ZBO A;  3USS A;  1DW1 A;  4XYD B;  3CX5 W;  1R8E A;  1KYO E;  2OTK E;  4R4L A;  4EIC A;  3HUS B;  2KLV A;  2N18 C;  4J20 A;  5APY A;  1BGY E;  3ORV A;  3CC7 P;  5AVT B;  2N9B A;  1RQV A;  3RK2 B;  4GOF A;  1CTZ A;  2QIW A;  1VQL P;  3HQ9 A;  1BCC E;  1E5W A;  3H1K G;  3V4W A;  4PW9 B;  1MZ4 A;  2RKL A;  4WQ7 A;  3B4S A;  3H1I J;  3RK2 D;  1BDC A;  4PV1 B;  4RSZ A;  3PH0 A;  1H88 A;  5AVX B;  2JJL A;  3MUD A;  4PV1 D;  1SQB G;  3V5B A;  3WFB C;  1VQ8 P;  3MK7 B;  1CXC A;  2O01 N;  5KJ7 D;  4WB4 A;  2HR3 A;  1HGZ A;  1AKK A;  3RL0 C;  1E8E A;  5CIE B;  2KS1 A;  4JBZ A;  2DGE A;  1LNQ A;  1IFI A;  4NFG B;  4TT3 H;  1CTJ A;  1OFC X;  2JTI B;  3W67 A;  3WFD C;  351C A;  4H0K A;  2PCB B;  1PP9 E;  3AE9 C;  5CMZ A;  2AEF A;  3RMZ A;  1L0N E;  4D6T E;  3G3Z A;  3KDP B;  3E1I A;  2FKW B;  2FY8 A;  3P8C D;  2QJP B;  3TGU J;  3OA7 A;  2IX7 C;  3M9H A;  3AEG C;  1U74 B;  2KS1 B;  3CXH E;  2WTY A;  1RF0 C;  1SQV D;  4UB8 V;  3L71 J;  3H25 A;  3VMX A;  1OW8 A;  3AEE C;  3H6P A;  3H1J J;  4FAN A;  2K9Y A;  2E42 A;  1YQ3 C;  4L73 A;  2BGV X;  1LJ2 A;  3M91 A;  5GTI H;  1I8P A;  2CE1 A;  1L0L D;  4PJ0 V;  1YTZ I;  3AE4 C;  5DFS A;  3Q2Y A;  4UB8 E;  2JEE A;  5AVY B;  5KLV D;  2FYU D;  1CIH A;  4AX3 A;  3H1K J;  2QSI A;  2BCC D;  3O8Z A;  1OVU A;  1E29 A;  3MTU E;  5C0Z A;  1CI6 A;  1A56 A;  1YJW P;  3PXS A;  4QMA A;  1SQB J;  3GHG C;  1DIP A;  1SQB K;  2WSC H;  4PJ0 E;  2B88 A;  3CWB G;  2N1T A;  1M1K Q;  1H9X A;  2B4Z A;  1KX2 A;  1J1E B;  1CIE A;  3A0H V;  2C1U A;  3L73 J;  4GIF A;  2I1K A;  1PPJ G;  3L72 E;  2Z5H A;  2YQB A;  3PLN A;  2ZVN B;  2PP6 A;  1C2N A;  2Y9Y A;  2W6J H;  1I54 A;  4UB6 V;  1CHH A;  3A0H E;  2B12 B;  1CI6 B;  4DJG A;  3A2A A;  4IFD K;  1A02 J;  4QAO A;  3ZIY A;  3CX5 I;  3BCC G;  2N1T B;  2C9N Y;  5AVQ B;  2SPZ A;  2C1D A;  2E43 A;  2N1T D;  2ZFC A;  3U1C A;  4EID A;  3A0B V;  1K3H A;  1IFP A;  1SQP J;  1LS9 A;  1SQP K;  1AVY A;  2CPB A;  4AAM A;  2O01 J;  1H32 A;  5H2F E;  1L4A C;  3I56 P;  3TNU A;  1HJ3 A;  1L9J C;  2MTA C;  1BCC G;  1I5T A;  2IZ0 A;  3A0B E;  1WVE C;  4U3F D;  4Y28 J;  4B86 A;  1YBK A;  1CRJ A;  3FX0 A;  4NPD A;  1BE3 J;  2M3B A;  1H33 A;  2ZOO A;  2C1D B;  1CRI A;  2J59 M;  1R5L A;  5APS A;  2C2C A;  2E75 B;  4UB8 H;  1HRO A;  1OXZ A;  3GW6 A;  4GDO A;  3EQ2 A;  1ZZH A;  1OVV A;  1VPC A;  2LKM A;  2BH5 X;  3SWY A;  2BH4 X;  1IFD A;  1FHB A;  2E75 D;  1EB7 A;  2YKO A;  1YIQ A;  3R4Y A;  3CWB J;  4K3A A;  1YTZ T;  3C8V A;  5KLI C;  2A45 G;  4PJ0 H;  2CXB A;  2D0S A;  1NNO A;  1KZU B;  3VNW A;  2FYZ A;  1FCD C;  2Y9Z A;  2KYV A;  1HZV A;  1KV4 A;  2BAS A;  1H33 B;  1NWQ A;  1RE3 C;  3AEC C;  2C1V A;  2DVH A;  1OW7 A;  3B71 A;  1GJQ A;  3O1Y A;  5B6Q A;  1YI2 P;  3CCR P;  2KK7 A;  1VQ9 P;  3FGA D;  2GC7 D;  3A0H H;  3BCC J;  3H1I D;  1T2K D;  1HUC A;  3TYY A;  3SFE C;  4DCK A;  3B5N D;  1Z56 A;  2WIT A;  3I5C A;  1QGK B;  1A2S A;  1HH7 A;  1S2E A;  2KB7 P;  3PRJ A;  1CIG A;  3RGU A;  3BRT B;  1CCR A;  3CC4 P;  3KXD A;  4UB6 H;  4Y99 C;  1T6A A;  1S5L V;  4I7Z C;  2G8Y A;  2KNC A;  2IBZ I;  1EDL A;  5KKZ B;  2P2U A;  2E5T A;  2WT7 B;  3L75 J;  1S5L E;  5KAF V;  4ZKU A;  3L70 G;  5CIB B;  2ZYD A;  1WEJ F;  1LFM A;  1HZU A;  4LLH A;  1N15 A;  4P4Q B;  1S1C X;  4WQE A;  1U57 A;  2PFX A;  3AE6 C;  3RBX A;  2GB8 B;  1CRC A;  2KUB A;  4WY4 D;  3O6Q A;  4PD4 E;  5CCG C;  3TGU D;  2KNC B;  3AEB C;  5KAF E;  1IFJ A;  1R0Q A;  1FDO A;  3S4R A;  1CO6 A;  1KYO W;  1JO5 A;  1M60 A;  3L71 D;  4IFF A;  3ZOW A;  2BLF B;  2ZXY A;  2BEZ F;  4WWI A;  3H1J E;  3SWF A;  1NKZ B;  3OW2 O;  3ZDM A;  1K04 A;  3MP7 B;  2W6A A;  1FC2 C;  3M9B A;  3Q5R A;  2FYN C;  1RF0 A;  1L2P A;  1I55 A;  3HE5 A;  1GK4 A;  3H1K D;  3O6Q B;  1QVG O;  3HE4 A;  2JKV A;  1CSB A;  3M06 A;  1SQB D;  1NTM E;  5B66 V;  4JYC A;  2DW3 A;  5APW A;  1FBM A;  4GYD A;  3CI9 A;  5AUR A;  2E74 C;  2FYU J;  1NU1 J;  2CK3 H;  1NU1 K;  2YNY A;  1EZV E;  1RE4 C;  2W6B A;  5AW9 B;  4N0K A;  3JCU H;  3L73 D;  1X0T A;  1LT1 A;  1BL9 A;  1MUU A;  1NTK J;  1NTK K;  3HE5 B;  2A06 G;  3GHG A;  2B87 B;  5B66 E;  3PTZ A;  4C7R A;  3C9I A;  3HE4 B;  1NAF A;  1FU1 A;  2WSS H;  2OQQ A;  3R2P A;  1PFI A;  5E79 V;  3AEF C;  5DJT B;  3L70 J;  3KYQ A;  2L91 A;  3H1L J;  3LID A;  2QE7 H;  4H0L B;  1S5L H;  1VQM P;  2XKM A;  1YCC A;  2FWL A;  2E76 B;  2I1J A;  5KAI V;  2VHD A;  4H0L D;  5K5G B;  3A9F A;  4L1Q A;  3H32 A;  2KLU A;  3NTN A;  1OVR A;  3CXH W;  5E79 E;  2E76 D;  1ZR2 A;  1T3U A;  4PD4 H;  3GHG B;  1SQP E;  3TDK A;  3PXT A;  5TJH A;  5AW1 B;  2Q7C A;  1QEX A;  1A8C A;  1JCD A;  3H1H J;  5L8R J;  2YIU C;  3VOP A;  1B7V A;  2J58 A;  3T97 A;  1KQF B;  1FS0 E;  1CHI A;  2BCN B;  2HYN A;  4MU8 A;  1BE3 E;  3H32 B;  1YEB A;  4L74 A;  1GW3 A;  1URQ A;  2GC4 D;  4N78 E;  4KMG A;  2FFD C;  1YHQ P;  2KSJ A;  1ZOY C;  1PGJ A;  1KB9 I;  4LGD E;  2ZVO B;  3CWB D;  1LT9 C;  2BEQ D;  1I6D A;  2IBZ G;  1FZE A;  1IFM A;  3T97 B;  2CA4 B;  1J1D B;  1PPJ D;  3V2N A;  3BAS A;  1HF9 A;  1KB9 D;  1NTZ G;  1C7M A;  4FA5 A;  1FOC A;  1VQN P;  1GKS A;  4A7P A;  2WSF H;  1URQ B;  1JY2 P;  1CYJ A;  1LWU C;  5B66 H;  4O9B A;  3HQ6 A;  5BU8 B;  1S72 P;  2AIU A;  1OAE A;  1LTJ A;  1URQ D;  2IFM A;  3BCC D;  3VMA A;  5GTI E;  2ZT9 B;  1RE3 A;  3CU4 A;  2YKQ A;  3AE7 C;  2XND H;  2BPB B;  1YQ4 C;  2ZT9 D;  4EIJ A;  1GDV A;  1OX3 A;  1Y9B A;  1N73 C;  3WFC C;  5E79 H;  3IR9 A;  4W80 A;  1HWT C;  4AAN A;  2ZXE B;  5KLI B;  2G3A A;  3PHL A;  1USE A;  3SLE A;  3CCM P;  3P7K A;  1LTJ B;  1OW6 A;  2LIR A;  5KAI H;  2N3Y A;  1SQX E;  1CYC A;  1FJ0 A;  1Q86 Q;  2NPS C;  1LTI C;  3L75 D;  4JF7 A;  5EXQ A;  5APX A;  5DJU B;  2MKV A;  2N3B A;  2IDB A;  4KJM A;  1FDM A;  2A45 I;  1FZC C;  3HD7 C;  4WVZ A;  1NTM G;  2YXR B;  5AW7 B;  5AVU B;  1CSX A;  1HVV A;  1EZV G;  5AW8 B;  1MKM A;  1D7M A;  3SSU A;  2OYI C;  5TIS H;  3ZOY A;  3I55 P;  2OTJ P;  1JCC A;  1NJI Q;  4FA9 A;  2KI7 B;  2ZXX A;  2L5G B;  1DW2 A;  1RH5 B;  1Q7Y Q;  4C7N A;  2O1J A;  1DEE G;  5GTH H;  5CCG A;  2QVA A;  3P8C E;  1C6R A;  4M3L A;  4Z1M H;  2R5B A;  1KB9 H;  2QJY B;  1KX7 A;  1PGO A;  1SQV E;  1S3J A;  3HRN A;  3GG2 A;  2HV4 A;  3VP9 A;  1NIR A;  4TLF A;  1GDT A;  2QM7 A;  4RJT A;  3V2Q A;  2PAJ A;  1N7S A;  1GL2 A;  1R5S A;  2GUV A;  1L0L E;  5AW2 B;  1T8Z A;  1HJ5 A;  3OCD A;  1NU1 D;  5KLV E;  3F5H A;  2FYU E;  1SFC C;  3L74 G;  1M1J C;  2BCC E;  4H13 B;  1QYZ A;  1AOQ A;  3FXD A;  2V7Q J;  3S1K A;  2I8D A;  3D6Z A;  1NTK D;  1PGQ A;  1HJB A;  4H13 D;  2Z5I A;  4YTP C;  3NMD A;  1H0T A;  1CHJ A;  4HH2 A;  1N50 A;  1N7S B;  3L70 D;  1GL2 B;  4BRY A;  2AI5 A;  5C39 A;  3H1L D;  1AJY A;  1RAQ A;  3PJS K;  4OGQ B;  4WQB A;  1KTM A;  1E79 H;  1IK9 A;  1N7S D;  1GL2 D;  4FA1 A;  2R5D A;  2YXQ B;  1IZL 0;  3GF7 A;  3CCS P;  3AE8 C;  1KV9 A;  3GF3 A;  4OGQ D;  1FOS E;  4FB1 A;  1NH4 A;  5CIH B;  1CCH A;  2D2C B;  3AE2 C;  3RLM A;  2OYH C;  1W5C E;  1RF1 A;  4HYT B;  2RMZ A;  1IO3 A;  1JY2 O;  1YYC A;  2H8P D;  1DW3 A;  3L36 A;  4IL6 X;  2D2C D;  1H0T B;  4WBA A;  2YK3 A;  1KB0 A;  1X79 B;  1Y47 A;  1C2R A;  3BRV B;  4UB6 E;  3H1H D;  4XA4 A;  3L4F A;  1CXA A;  3RL0 g;  3CX5 D;  1QX8 A;  1BGY G;  2R3C A;  1YJN P;  4RES B;  4OH8 B;  1SVF A;  3RN0 A;  3SJL A;  1GK6 A;  4L75 A;  1RF1 B;  3WUV A;  1F1C A;  2B11 B;  4GED B;  2UWJ E;  1LC1 A;  3SWS A;  4I1L A;  3VMZ A;  2GM4 A;  1IFN A;  1M56 D;  3D70 A;  3X39 A;  4KHX A;  5AVW B;  1SQQ E;  4ZNC A;  1YIT P;  1ETP A;  4U3F E;  2YMY A;  2QJK B;  4JCG A;  1MG2 D;  5AVV B;  3IAO A;  3L74 J;  2H88 C;  3NWV A;  2C8S A;  2FXM A;  1SQX G;  3VYI A;  3C2C A;  3OAK A;  1GTW A;  3SFD C;  1H32 B;  1YIC A;  2A06 D;  5CCH A;  4XXL A;  3HUS C;  3TNU B;  1LT9 A;  2Z4E A;  1N90 A;  5AVS B;  2MJZ A;  1DW0 A;  1PGP A;  5B5E V;  3RK2 C;  2WZ7 A;  3KZI V;  1CNO A;  3IN6 A;  2P7J A;  1KIL A;  4PV1 C;  3CPW O;  5APQ A;  5DJQ B;  1PP9 G;  1DD4 A;  2GIW A;  1LWU A;  3RK3 B;  1L0N G;  4D6T G;  2W90 A;  5B5E E;  5KJ7 C;  1IZN B;  4EYY Q;  3RK3 D;  4JPZ B;  1TU3 F;  3MK7 C;  3AED C;  1AV1 A;  3H1I E;  1CYI A;  1GD2 E;  2RH0 A;  1MV8 A;  5CCH D;  3DR0 A;  1OWA A;  1KQG B;  3HQ7 A;  2OYO A;  5CIC B;  4IOI H;  3JCU E;  1N73 A;  3WUI A;  3II6 A;  2QEX P;  4AUW A;  2N9Y B;  2WSE J;  1IO4 A;  4WQD A;  1KIL B;  1BGY J;  1JY2 N;  1NVO A;  1DEB A;  1RY3 A;  3V2R A;  1VF5 B;  1LWU B;  1QL4 A;  4L3G A;  3CX5 H;  1KIL D;  1L0L G;  2P58 A;  1KQS O;  4I2L C;  1BCC J;  1M8O B;  1FI9 A;  2N9I A;  1VF5 D;  4NPF X;  1S9K D;  2N18 B;  2BCC G;  1JY3 P;  2QJP C;  2IBZ D;  1FZB A;  3SWK A;  3ZBM A;  1FZC A;  2KIK A;  2LXC B;  1N73 B;  4BXL A;  3K5B A;  2P67 A;  1HH0 A;  1RZ6 A;  4WQA A;  1P84 I;  1NTZ D;  2B89 A;  1FZF A;  4I6M C;  3L35 A;  1VQ6 P;  2GA1 A;  1G1J A;  4WQ9 A;  3TGU E;  3CCV P;  3D71 A;  3L72 G;  3RN1 A;  3QH9 A;  1RHZ B;  3A7O A;  4MN4 C;  2YO3 A;  1CSW A;  3L71 E;  3C1L A;  3MZW B;  1P84 D;  1LTA C;  3VN0 A;  2XV5 A;  2WWW A;  4IFM A;  3RL0 B;  1FZC B;  3LW5 J;  1Q82 Q;  1PP9 J;  1CIF A;  1CTY A;  1L0N J;  4ZMD A;  1DIQ C;  2B0Z B;  1L0N K;  4D6T J;  2ZYG A;  4HKZ H;  1ZP0 C;  1JM0 A;  2FXO A;  3RL0 D;  1Q81 Q;  3H1K E;  3O5C A;  2OAR A;  3CLQ A;  1J1E C;  5B5E H;  3FWL A;  2PRR A;  3KZI H;  1IRW A;  2KZI A;  1SQB E;  1H8A A;  1WT6 A;  2K1A A;  2XNX A;  1OCD A;  1EZV I;  3WUT A;  1H89 A;  1SFC A;  4O1Q A;  1M1J A;  2AXC A;  2M5A A;  2KSE A;  2ZYA A;  1VYD A;  1JUN A;  2V08 A;  2NRG A;  3L73 E;  3KPE A;  2XDJ A;  1SQQ G;  3HTK A;  4U3F G;  2N1T C;  1FI3 A;  1PZQ A;  1F1F A;  3MD0 A;  1VQO P;  1WRG A;  1NMI A;  1GQ1 A;  5CIF B;  3JC2 2;  3CME P;  3CCL P;  1COT A;  3OJA B;  2FBW C;  4YE1 A;  1IJD B;  2Q1K A;  1M1J B;  2M5A B;  2WPS A;  1G1I A;  2W8Z A;  2K3R A;  1AQT A;  3BAT A;  3V2P A;  3A5T A;  3CD6 P;  3QWO C;  1FDI A;  4DOJ A;  1HTL C;  1CED A;  5KAI E;  1X8Y A;  2P1J A;  2H43 A;  1XTG B;  3ABV C;  3ZOO A;  1ZRT D;  1ZN5 A;  2E75 C;  3L37 A;  5TIS V;  1JEK A;  2I8F A;  5M1B A;  2YCC A;  5CYT R;  3CCQ P;  2Y0E A;  1FJK A;  2ZZS 1;  1GW4 A;  2CE0 A;  3E1R A;  3GLM A;  1L4A A;  3LIE A;  3L74 D;  4R4M A;  5CJ0 A;  3GMA A;  1OMI A;  5CHX A;  1T3J A;  5GTH V;  1K05 A;  1VL2 A;  3AE5 C;  1HJ0 A;  1VDF A;  5TIS E;  1NGM B;  2V7Q H;  4L76 A;  1GU2 A;  1YTC A;  3CWB E;  2EXV A;  1JY3 O;  5GTH E;  1T2K C;  1FZG A;  2O3J A;  4Q5P A;  3V6I A;  3B5N C;  3RBZ A;  4O1W A;  1PPJ E;  5BVZ A;  1FAV A;  2JWD A;  1CW5 A;  4OVN F;  1KB9 E;  1L4A B;  1YNR A;  4ASW A;  5AW3 B;  4YPC A;  1IC2 A;  1L4A D;  1KYO I;  1LTB C;  2ZAE B;  1N9C A;  2Q5U A;  2AEM A;  3BCC E;  3TGU G;  5CJ4 A;  3U1A A;  1KIB A;  4WQC A;  2M3E A;  1VQK P;  4PWA A;  1N7L A;  2C9X B;  3WFE C;  1KYO D;  3BVH A;  3L71 G;  5KJ7 A;  5KKZ C;  1BGY D;  3H1J G;  3D6Y A;  2O01 H;  4WY4 C;  1BCC D;  1AVO A;  1LTG C;  1X22 A;  1VQ4 P;  3DP5 A;  1ZW0 A;  1YEA A;  3L75 E;  1Q90 D;  1QVF O;  1C6S A;  4XFJ A;  1I8O A;  3PXW A;  1K9M Q;  4RKU J;  1YIJ P;  1M90 Q;  3L4O A;  1EDI A;  3CCJ P;  2QA4 P;  3AE3 C;  1VQ7 P;  1K8A Q;  1SQX D;  155C A;  1NKN A;  1NAY A;  1M6Z A;  3SVW A;  3L73 G;  3M0D C;  1JB0 J;  3O0R C;  4HB1 A;  4YXW H;  4ZKP A;  1BSN A;  2XU6 A;  1K3G A;  2YKP A;  3WUU A;  2WPV B;  3NBS A;  3MIW A;  4Y99 B;  4I7Z B;  1NTZ J;  5AVZ B;  1FOS F;  1NTZ K;  4EIF A;  2PCC B;  4DY9 A;  2Q3I A;  3VMY A;  4AYC A;  1PP9 D;  3D0W A;  3CXH I;  1RZ5 A;  1L0N D;  4BWN A;  4D6T D;  2LIT A;  4OWF A;  1Y8A A;  1DVV A;  2XTS B;  1JY3 N;  3FXE A;  2YMK A;  1CSV A;  1S4X A;  1JNM A;  2KP8 A;  2ZON G;  1U75 B;  3CXH D;  4HJG H;  1N2D C;  1HCM A;  1SQP G;  1W2L A;  4NPE A;  1K73 Q;  3W68 A;  4C7N B;  5CBO A;  3CCU P;  4K35 A;  3M9Q A;  1NU1 E;  1KFM A;  3PP5 A;  1C75 A;  1KYO H;  4H44 C;  2WSE H;  5CCG D;  1H31 A;  1KC8 Q;  1ZR4 A;  1GMJ A;  1NTK E;  3N7N A;  4H0L C;  1BE3 G;  2E76 C;  1RE4 A;  2R44 A;  3P8M C;  1DII C;  3Q1M A;  2K88 A;  2H7H A;  2E5Y A;  3L70 E;  1SS1 A;  3H1L E;  2IPP A;  1U7M A;  2FYN B;  1NTM J;  1FJP A;  1NTM K;  3OCD B;  1FZA A;  3JBT B;  1BDD A;  2JP3 A;  3S9O A;  2M0B A;  4N6J A;  3VRD A;  2ITA A;  1NML A;  2ORL A;  1GU4 A;  1ZME C;  1H31 B; 
#chains in the Genus database with same CATH homology
 1MZ4 A;  4WQD A;  4WQ7 A;  2L91 A;  3L72 D;  4RSZ A;  4Y5R A;  1YCC A;  3OA8 A;  2FWL A;  1QL4 A;  4L3G A;  5KAI V;  1YFC A;  2VHD A;  1S6V B;  3A9F A;  3TYI A;  1FI9 A;  2N9I A;  4L1Q A;  3WFB C;  3CXH W;  5C9M A;  5CIG B;  2Y0D A;  3MK7 B;  1CXC A;  2N18 B;  1AKK A;  3TDK A;  2IBZ D;  3PXT A;  5TJH A;  3ZBM A;  5H2F V;  1E8E A;  5CIE B;  2KS1 A;  2DGE A;  4NFG B;  1A8C A;  1CTJ A;  1DT1 A;  2AXT V;  2JTI B;  1QL3 A;  1RZ6 A;  4WQA A;  1NTZ D;  1B7V A;  3WFD C;  4WQ9 A;  1DVH A;  3OA8 B;  351C A;  4H0K A;  1CHI A;  2BCN B;  2PCB B;  3RN1 A;  4MU8 A;  1YEB A;  3RMZ A;  1CSW A;  2GC4 D;  4FAV A;  1P84 D;  4KMG A;  2QJP B;  4PW9 B;  1SQQ D;  3KHU A;  1U74 B;  3CWB D;  1M70 A;  1CIF A;  1LC2 A;  1CTY A;  1E2R A;  2RN0 A;  1DIQ C;  1I6E A;  2B0Z B;  1SQV D;  4UB8 V;  1I6D A;  1FI7 A;  2YIU B;  3O5C A;  2CA4 B;  4FAN A;  1PPJ D;  3FWL A;  1KB9 D;  2BGV X;  3DMI A;  1C7M A;  4FA5 A;  1FOC A;  1I8P A;  1IRW A;  1L0L D;  2CE1 A;  1GKS A;  4A7P A;  4V2K A;  4PJ0 V;  5DFS A;  1CYJ A;  2Y0C A;  5KLV D;  2FYU D;  1CIH A;  4AX3 A;  3HQ6 A;  1OCD A;  2AIU A;  2BCC D;  1AYG A;  1OAE A;  4O1Q A;  1JDL A;  1VYD A;  2CA3 B;  1E29 A;  2V08 A;  5C0Z A;  3BCC D;  3VMA A;  1A56 A;  3PXS A;  3CU4 A;  1IRV A;  3CP5 A;  1FI3 A;  1H9X A;  2BPB B;  1F1F A;  2B4Z A;  1KX2 A;  1GDV A;  2K9J B;  3WFC C;  1CIE A;  1NMI A;  3A0H V;  1W5C T;  3NBT A;  1GQ1 A;  2C1U A;  5CIF B;  1QKS A;  1MG3 D;  2B10 B;  1CRH A;  2D0W A;  4AAN A;  1COT A;  5KLI B;  2YQB A;  3PLN A;  3PHL A;  4YE1 A;  3SLE A;  1C2N A;  4IL6 V;  2LIR A;  2OZ1 A;  1I54 A;  4UB6 V;  2N3Y A;  1CHH A;  1CYC A;  1FJ0 A;  3L75 D;  2B12 B;  5EXQ A;  3L4M A;  3VYM A;  4QAO A;  1IQC A;  2N3B A;  3ZIY A;  1CED A;  2PAC A;  1H1O A;  4LJI A;  2C1D A;  1CSX A;  3ZOO A;  1ZRT D;  4AAO A;  4EID A;  3A0B V;  5TIS V;  1K3H A;  2I8F A;  1LS9 A;  2YCC A;  5CYT R;  2Y0E A;  3ZOY A;  3WU2 V;  2ZZS 1;  4AAM A;  1H32 A;  2CE0 A;  4FA9 A;  2OZ1 B;  3WC8 A;  1LMS A;  1DW2 A;  3L74 D;  3CYT I;  1HJ3 A;  4AAL A;  2N9J A;  5GTH V;  1L9J C;  4PD4 D;  2MTA C;  1I5T A;  1L9B C;  1WVE C;  1C6R A;  4U3F D;  1CRJ A;  1GU2 A;  1H33 A;  1YTC A;  2ZOO A;  2C1D B;  1CRI A;  2QJY B;  2C2C A;  1KX7 A;  2V07 A;  3GG2 A;  2HV4 A;  5DF5 A;  1NIR A;  1HRO A;  2EXV A;  3GW6 A;  3SXT A;  1ZZH A;  4RJT A;  2O3J A;  3H1J D;  4Q5P A;  2BH5 X;  3HQ8 A;  4O1W A;  2BH4 X;  1FHB A;  4EDF A;  1EB7 A;  4WQ8 A;  1YIQ A;  1HRC A;  1YNR A;  1HJ5 A;  3OCD A;  4FA4 A;  2CXB A;  2D0S A;  1NU1 D;  1NNO A;  3VNW A;  1CC5 A;  1FCD C;  1N9C A;  1QYZ A;  3ITK A;  1AOQ A;  1HZV A;  1CRG A;  1H33 B;  1NTK D;  1NTM D;  1CSU A;  2C1V A;  2DVH A;  3ZOX A;  1GJQ A;  1KIB A;  4WQC A;  2JWA A;  3O1Y A;  4PWA A;  5B6Q A;  4EIE A;  1EZV D;  2C9X B;  1CHJ A;  3WFE C;  1KYO D;  1HJ4 A;  1N50 A;  3L70 D;  2GC7 D;  2AI5 A;  3H1I D;  3H1L D;  1BGY D;  1RAQ A;  4WQB A;  4FA1 A;  1A2S A;  1HH7 A;  1IZL 0;  3PRJ A;  1KV9 A;  5CID B;  1BCC D;  1CIG A;  4FB1 A;  1CCR A;  2JQR A;  4H0J A;  3DP5 A;  5CIH B;  1YEA A;  1CCH A;  3RLM A;  1S5L V;  1C6S A;  2RMZ A;  1IO3 A;  1DW3 A;  1I8O A;  3PXW A;  3TF5 A;  3ZCF A;  5IY5 1;  3L4O A;  2YK3 A;  1KB0 A;  1SQX D;  4L3H A;  155C A;  1C2R A;  5KKZ B;  3H1H D;  1CXA A;  1H9Y A;  1J3S A;  4K3I A;  1SQP D;  2QG4 A;  5KAF V;  1M6Z A;  3SVW A;  3CX5 D;  5CIB B;  1COR A;  3O0R C;  1WEJ F;  1LFM A;  1HZU A;  1N15 A;  4P4Q B;  1GIW A;  3O20 A;  4WQE A;  3RN0 A;  3SJL A;  1K3G A;  3NBS A;  2GB8 B;  1CRC A;  1F1C A;  2B11 B;  4GED B;  1LC1 A;  4EIF A;  1RAP A;  3SWS A;  3TGU D;  2KNC B;  2PCC B;  3X39 A;  4DY9 A;  1ETP A;  1R0Q A;  1PP9 D;  1BE3 D;  1CO6 A;  1KYO W;  1RZ5 A;  1L0N D;  2QJK B;  4JCG A;  1MG2 D;  4D6T D;  2LIT A;  2FRC A;  1M60 A;  3L71 D;  3NWV A;  451C A;  1DVV A;  2XTS B;  2C8S A;  5DJQ C;  3ZOW A;  1CRY A;  2BLF B;  1CSV A;  2ZXY A;  1C52 A;  3C2C A;  1H32 B;  1YIC A;  2A06 D;  2ZON G;  1U75 B;  2L4D A;  3CXH D;  1HCM A;  4XXL A;  3M97 X;  3PH2 B;  1N90 A;  1AOF A;  1W2L A;  1I55 A;  1DW0 A;  3H1K D;  5B5E V;  1QN2 A;  2Q3E A;  1C75 A;  3KZI V;  1CNO A;  5GTI V;  2MHM A;  1C6O A;  1H31 A;  1SQB D;  5B66 V;  4GYD A;  5DJQ B;  2GIW A;  5AUR A;  2ZBO A;  1DW1 A;  4XYD B;  3CX5 W;  4N0K A;  1DII C;  3L73 D;  4EIC A;  1BL9 A;  3MK7 C;  2N18 C;  4J20 A;  1CYI A;  2FYN B;  3OCD B;  3ORV A;  3DR0 A;  3JBT B;  3PTZ A;  3HQ7 A;  1CTZ A;  5CIC B;  3HQ9 A;  3WUI A;  3VRD A;  5E79 V;  1NML A;  2ORL A;  2N9Y B;  1H31 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...