5KKZB

Rhodobacter sphaeroides bc1 with famoxadone
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 64
structure length 256
sequence length 256
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5kkzB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 5kkzB02
3HQ9A 1QL3A 4YE1A 1CYCA 4FA4A 2B11B 2AXTV 1CC5A 1YTCA 2OZ1A 1CHJA 1YEAA 1YCCA 2C8SA 1GJQA 1C75A 3NWVA 4AANA 4P4QB 4AX3A 1MG3D 3O20A 2GB8B 4AALA 3H1ID 2MHMA 3CX5D 1ZZHA 3GG2A 2LIRA 2OZ1B 351CA 4H0KA 1CRCA 2BGVX 5C0ZA 1HRCA 3SVWA 1QKSA 1BGYD 1IRVA 3ZIYA 3C2CA 5CIDB 1FI7A 2C1DB 4WQ8A 1FCDC 2BCNB 1NTZD 2N3YA 4XYDB 3PXWA 2DVHA 3GW6A 1H31A 5C9MA 1IQCA 1LC2A 3RN1A 4L3GA 1CEDA 1FJ0A 4QAOA 2QJPB 4EIDA 4FB1A 1NIRA 3O1YA 3L70D 1KV9A 1QYZA 3VRDA 3ZCFA 4EICA 4Q5PA 1HH7A 1KB9D 4U3FD 3HQ7A 5KLIB 5CIGB 4D6TD 1BL9A 1FI3A 2HV4A 1LS9A 3ZOYA 3CWBD 1QN2A 1F1FA 3DR0A 3ZOOA 3CYTI 1C52A 3L75D 3M97X 3VYMA 2GC7D 4LJIA 3SJLA 2I8FA 1SQVD 3VMAA 3TGUD 3ORVA 1CHHA 3H1KD 1HJ3A 3RLMA 1CRGA 1L0ND 1I6DA 2L4DA 1EZVD 1NTMD 1KB0A 1P84D 5CIFB 4GEDB 1CHIA 3O5CA 1GU2A 1CXAA 4JCGA 2XTSB 1OAEA 4O1QA 1L9JC 1WEJF 1EB7A 2JQRA 4UB6V 4KMGA 1H9XA 1CCHA 2YQBA 3RMZA 2JWAA 4RSZA 1HJ4A 4PD4D 3PTZA 1NNOA 3NBSA 1I5TA 4NFGB 1J3SA 1GKSA 3WU2V 1FI9A 5DJQC 2BCCD 5CICB 3H1HD 3PHLA 1OCDA 5GTIV 1BE3D 2N9JA 4FA1A 3L73D 4FANA 1YNRA 1SQXD 4L3HA 1CNOA 3A9FA 5B6QA 1CO6A 2YCCA 2RMZA 3CX5W 3KZIV 1CORA 1CYIA 1DW3A 1R0QA 2KS1A 1CIFA 4WQ7A 1RAQA 2PCBB 1I55A 1IRWA 1HROA 3VNWA 5KLVD 1CYJA 4V2KA 2B12B 2CE1A 2AI5A 1KX2A 5B5EV 5DFSA 1PPJD 1I54A 3FWLA 1CSUA 1DW0A 1FHBA 1H32A 2V08A 5E79V 1L9BC 5CIEB 3L72D 2FYUD 2C1VA 3TYIA 1W2LA 2CA3B 1AOFA 1CRHA 2PACA 2B10B 3CXHW 2MTAC 4WQEA 1H32B 1E8EA 1YFCA 1PP9D 4FAVA 1MZ4A 3MK7C 1H31B 3CXHD 1CIGA 2C1UA 1YIQA 5DF5A 4DY9A 5KKZB 1F1CA 4PWAA 3ZBMA 4EDFA 4WQ9A 1GQ1A 2FYNB 1WVEC 2LITA 1CRIA 1HJ5A 1A8CA 2JTIB 1RAPA 3MK7B 1AOQA 2A06D 3PXTA 1U75B 3A0HV 4MU8A 1DIIC 3ZOXA 1DW2A 1C2RA 3KHUA 3PRJA 1N90A 2N3BA 3TDKA 4A7PA 1CTZA 4EIEA 2Q3EA 2QJKB 1HZUA 2N9YB 4H0JA 2QG4A 3X39A 2AIUA 1DVVA 3DP5A 4EIFA 2YK3A 2CA4B 3L4MA 2N9IA 1M60A 1H9YA 4PW9B 1NMLA 155CA 1E29A 3DMIA 1S6VB 3L71D 1CIHA 2CE0A 2Y0EA 2Y0CA 5AURA 1N15A 1A2SA 2GIWA 4J20A 4AAOA 2ZZS1 1N9CA 3SXTA 2BLFB 1BCCD 5DJQB 4WQAA 1I6EA 3L4OA 3OCDA 3HQ6A 4XXLA 1CTJA 1CCRA 1JDLA 1SQPD 1C7MA 1HCMA 3JBTB 2FRCA 4L1QA 2L91A 5IY51 4WQDA 1LMSA 2K9JB 1GIWA 2C2CA 1SQQD 4PJ0V 1DW1A 1CTYA 1DIQC 1U74B 1AKKA 1C6OA 3OCDB 3CP5A 3WC8A 2C9XB 2QJYB 1KIBA 4RJTA 2DGEA 2C1DA 1AYGA 5TJHA 1E2RA 1H1OA 2RN0A 1A56A 451CA 3ZOWA 1K3GA 2ZOOA 1SQBD 1K3HA 1IO3A 1S5LV 1NU1D 3WUIA 2ZONG 1VYDA 1YEBA 5GTHV 1B7VA 2FWLA 1CSXA 2B4ZA 3O0RC 1CXCA 1N50A 4WQBA 3ITKA 3WFEC 4N0KA 3WFBC 2ZBOA 3TF5A 1CSVA 3CU4A 1KYOW 2GC4D 1DVHA 3PXSA 2N18C 5H2FV 1L0LD 2KNCB 2VHDA 1KX7A 1MG2D 1KYOD 2O3JA 1DT1A 5KAIV 3WFCC 1CSWA 1QL4A 1RZ6A 3SLEA 1I8PA 2PCCB 1H33A 3H1JD 2B0ZB 1CIEA 5KAFV 2N18B 5CYTR 2D0WA 3OA8A 1W5CT 1FOCA 5TISV 2Y0DA 1ZRTD 3A0BV 1M70A 4GYDA 1H33B 2BH5X 3BCCD 3OA8B 2YIUB 4IL6V 1I8OA 4Y5RA 4FA5A 5B66V 2ORLA 1YICA 4UB8V 2V07A 3H1LD 1IZL0 5EXQA 4AAMA 2IBZD 4O1WA 1LFMA 3PH2B 2EXVA 4K3IA 1NMIA 3HQ8A 2ZXYA 3SWSA 1C2NA 1M6ZA 3L74D 2CXBA 1LC1A 3PLNA 1ETPA 5CIBB 1COTA 1C6RA 3WFDC 1CRJA 3RN0A 5CIHB 1C6SA 4WQCA 1HZVA 1RZ5A 1GDVA 1NTKD 2BH4X 3NBTA 1CRYA 2D0SA 4FA9A 2BPBB
chains in the Genus database with same CATH superfamily
1IFMA 3EFFK 1Y9BA 1YHQP 1RHZB 4YE1A 5AW8B 3BASA 4IOIH 5AW0B 3U59A 4CPGA 1YTCA 1URQC 3GLMA 1C75A 3NWVA 4AANA 4P4QB 4AX3A 1MG3D 3LIDA 2GB8B 1DEBA 5AW6B 3MP7B 1ZZHA 1S5LH 3HE4A 351CA 4H0KA 4WY4A 3WU2E 5GTHH 4H13C 2FKWB 3C2CA 1FOSE 3HE5B 2ZXEB 1RE4A 2Z5HA 4GT1A 3SFDC 1SQQG 4XYDB 1OVRA 4ZMDA 1PGJA 1PGQA 1GL2A 4L3GA 1WRGA 3D0WA 3RBZA 4GIFA 1NIRA 2E75B 2QRXA 2I1KA 2QM7A 4N3YB 5TISH 3CMAP 4BRYA 5CIGB 1U7JA 1LS9A 3ZOYA 1QN2A 3HD7B 3PJSK 3DR0A 3ZOOA 1OXZA 1KILB 4I6MC 3WUTA 3BCCJ 1OW8A 1T3UA 1JB0J 3VMAA 5APWA 1CHHA 1L0NJ 1L0ND 3GHGA 2L4DA 1NTMJ 3CXHI 4EIJA 1NTMD 3M0DA 1FZCA 1K9MQ 1DIPA 2B87A 4U3FE 2ZT9C 2FXPA 3M91A 3CCSP 1EB7A 2DW3A 4KMGA 2H7HA 1CCHA 3MUDC 1PV3A 1U7MA 4GODA 4RSZA 1YBKA 4ZNCA 3V4QA 4PV1C 3WU2V 5DJQC 2IX7C 1SQVE 1KFNA 5AW5B 1BE3J 4L73A 1BE3D 2YMYA 4FANA 3H1LE 1GTWA 3H1LG 1LTGC 1OZHA 3A9FA 2IBZE 5B6QA 2YCCA 3A2AA 1CYIA 2WITA 1J2JB 1YI2P 1KTMA 2E75D 3G4SP 1I55A 3VNWA 3TYYA 2N9BA 4V2KA 3SFEC 1KX2A 2KB7P 4HYTB 5DFSA 1PPJD 1L2PA 1I54A 1CSUA 3I56P 4Y28J 2O1JA 3SWYA 1NTKG 1DW0A 3G71P 1KILD 1L4AC 2AEJA 4I1LA 3L73E 5APXA 1H32A 2V08A 2IPPA 4R4LA 4WBAA 2JWDA 5CIEB 1RQUA 2OYOA 1GL2C 1JOCA 2B10B 3CXHW 2MTAC 3H1IE 4WWIA 3FX0A 3H1IG 3CX5E 1IFIA 2FYNC 1FZEA 1PP9J 3AEBC 1PP9D 3P7KA 1MZ4A 2Y9ZA 1H31B 1S72P 3D71A 2XU6A 4DY9A 1F1CA 3ZBMA 4OGQB 1ZW0A 2R5BA 2LITA 1IO4A 1FOSF 4OH8B 2JTIB 1RAPA 3MK7B 3F5HA 1T2KC 2KOGA 2WSEJ 2QJKC 2KK7A 3PXTA 2KSJA 1DIIC 3JSVC 1GK6A 4DT0A 2HPCB 3Q1MA 2FXMA 1A02J 1NH4A 1S5LX 2KSEA 1FZCC 2N3BA 1X9VA 1T3JA 1JM0A 3L70E 1M7LA 3L70G 3O6QB 4UB6H 5KLVK 3C9IA 1SS1A 1LGHB 3C8VA 5H2FE 1N73B 1Y8AA 3SSUA 4D6TE 2R3CA 4D6TG 1VQ6P 3A7OA 1JMBA 3KYQA 2NPSA 3CWBG 1M1JB 3VN0A 2YK3A 2CA4B 1X22A 1S3JA 1K05A 2PP6A 2N9IA 3TNUB 3T97B 3L71J 4YXDC 3L71D 2Y0CA 3H1KG 1N15A 3LW5H 2GIWA 1P84E 3A0BE 2ZZS1 2M3EA 3CCJP 3V4WA 3HUSB 5M1BA 1I6EA 3JCUE 3L4OA 1SQPJ 2LXCB 1LTBC 1SQPD 1OX3A 4L1QA 2IBZI 1LMSA 3PP5A 1DIQC 5AVQB 3N7NA 2KS1B 4OGQD 2OYIB 1HJ0A 1H89A 2BCCG 2W6BA 1BSNA 2WSCH 2RH0A 3IN6A 1VQ4P 1SQXG 1H1OA 4YTPC 2W6AA 2C9LY 2HODA 2YXQB 1RE3A 1KV4A 2P1JA 3JC22 1ZMEC 1B7VA 1YTZT 5APQA 2C0WA 4N78D 3WFEC 1H0TA 3V2RA 3CU4A 5H2FV 2VHDA 2E76B 3A0HH 1YTZI 1MG2D 4KHXA 3L72E 1RF1A 2LXBA 2FYUE 4Z1MH 3CC2P 2PCCB 3USSA 1H33A 2YIUC 1USEA 4ZKUA 2KIKA 3CCQP 3RGUA 1FOCA 1LTJA 2R3SA 4IL6H 3HTKB 3D70A 2JO1A 2K88A 3A0BV 1M70A 3VMYA 3L35A 1SQQK 3RL0B 3OA8B 1AJYA 4Y5RA 3V2PA 2V07A 1OW6A 3L75G 4WB4A 4O1WA 3OW2O 3GMAA 1X8YA 5KTBA 2Q9IA 2ZXYA 3CCLP 3V6IA 2CXBA 1LC1A 3TGUG 2OTKE 1GW3A 3VYIA 2Z5IA 4JF7A 3M9HA 3WFDC 1CRJA 5CIHB 1BCCJ 4U7JA 4HB1A 4YXWH 1GDVA 2M5AB 3AE8C 2JJLA 3HQ9A 1P84I 1QL3A 3ZDMA 1NKZB 3VMXA 3R2PA 4FA4A 2JP3A 5BVZA 2OZ1A 1YEAA 2C9NY 1YCCA 2E76D 1GJQA 3O20A 4AALA 2E74C 2Q6QA 2HG5D 1WMKA 2HR3A 4PD4I 2WT7A 1QL2A 1CRCA 1HRCA 1HBWA 3SVWA 3G9RA 4NPFX 2E42A 3BATA 1BGYJ 1RE3C 2SPZA 3AEEC 1BGYD 1X0TA 5GTIE 4H0LC 2O1KA 2C1DB 4WQ8A 1ZR4A 2N1TB 3CXHH 2WSCJ 3FXEA 4WY4B 3RL0D 3KZIE 4YPCA 2N3YA 1EDIA 1U57A 3GW6A 4L76A 1Q86Q 5KLIC 3RK3B 1E5WA 1JY2N 4OGQC 5B5EE 3SWFA 3VRDA 4EICA 1SQBG 1HH7A 1KB9D 4I7ZB 3HQ7A 1TU3F 1NU1G 1H8AA 2HV4A 5BU8B 1NTKK 3RK2B 1FJKA 3L75D 2J5UA 4UB8H 3VYMA 2YO2A 1NVOA 3B5NB 2I8FA 3TGUD 2HYNA 4TLFA 3RLMA 2OARA 1L0LG 4I2LC 1PL5A 1KYOE 1M1JC 2CPSA 3O5CA 1GU2A 1CXAA 4JCGA 1NO4A 1DX7A 3CCVP 3H1JG 3H32A 1KMIZ 1JY3O 2AXCA 3WU2H 4KJMA 2YQBA 1JCCA 3MUDA 1HJ4A 1OWAA 1I5TA 4NFGB 2N1TD 3BCCE 1WT6A 3HUSC 4WY4D 1EC5A 5CICB 4NPDA 1RY3A 1M56D 5GTIV 4FA1A 1T6AA 1YNRA 1AV1A 3RK3D 1CO6A 1AVYA 3KZIV 4XE5B 1DW3A 3SWKA 1R5LA 3L74E 3I55P 1VPCA 1MFTA 3L74G 3G3ZA 5CCGD 1NAYA 1IFJA 1HROA 5KLVJ 3AE4C 5KLVD 1CYJA 4IL6X 3WMM0 2CE1A 1OVUA 3MIWA 2AI5A 1AFOA 5KJ7D 5B5EV 3IR9A 4K3AA 3RK2D 1S2EA 2ZXXA 3OJAB 1VQPP 1L4AA 3B5ND 2KLUA 1XTGB 4ZKPA 2GA1A 3E1IA 1LT9B 5APVA 4H44C 2CA3B 3MTUE 1AOFA 1CRHA 5AVZB 3S1KA 4WQEA 1H32B 2WSEH 4FAVA 4BWNA 3CXHD 3P8CE 2C1UA 1DD4A 2WPVB 1QLED 1JY3N 4PWAA 1FZGA 5AW2B 1VQKP 2XV5A 3EQ2A 1LTTC 1CRIA 1HJ5A 1A8CA 1PGOA 1NTZE 2P67A 2P2UA 2W8ZA 1SFCB 2A06D 1S5LE 1SQXK 4MU8A 4C7NA 2FBWC 2KYVA 1DW2A 5GTHE 2FXOA 1C2RA 5DJUB 1J1DB 2P10A 3TDKA 4A7PA 3K5BA 5EFWB 1SP4A 4EIEA 5C39A 5AW4B 2Q3EA 1HZUA 2R32A 2K37A 1FU1A 5BU5A 4U3FG 1VQ9P 1KYOI 4EOTA 1FC2C 1DVVA 5KAIE 1QX8A 3H6PA 1FDMA 1HH0A 1CZQA 2O01H 2WPSA 1M60A 1H9YA 1NMLA 1SQVG 3DMIA 2FYUK 1S6VB 4AYCA 2Q3IA 1KZUB 1NHLA 2CE0A 2Y0EA 2NPSB 5CJ0A 1LWUB 5TISE 3TK1A 1JMMA 1EZVE 3CD6P 1EZVG 1N7SB 1N9CA 3SXTA 2IBZG 1LTIC 3R4YA 4WQAA 1DEEG 1USDA 2FY8A 1ZV8A 5IY51 2K9JB 1SQQJ 2C2CA 3AECC 1SQQD 2P7JA 5AW1B 2XDJA 5APSA 1R5SA 3U1AA 5CBNA 1C6OA 2OTJP 3HD7D 1FBMA 3Q2YA 1NJIQ 4HKZH 3WC8A 3H1HE 3RL0g 3H1HG 1SFCD 3L71E 2QJYB 3HE5A 2QIWA 3L73G 1E2RA 3NFQA 1EDJA 2RN0A 2KZIA 1K3GA 1GDTA 4LGDE 1LJ2A 1IO3A 1S5LV 2AEFA 4C7RA 5GTHV 5AW7B 2KUBA 5CCGC 3ITKA 4N0KA 2ZBOA 4MN4C 1ZN5A 1KYOW 2GC4D 3IFMA 4I7ZC 5KJ7C 1GU5A 4XFJA 1OFCX 4Y99C 3RK2C 3M06A 4LLHA 2E43A 1H0TB 5KAIV 3WFCC 1CSWA 3SLEA 2NPSD 1KILA 1LP1B 3MD0A 1OW7A 3B5NC 1CIEA 1N7SD 2N18B 2D0WA 3BRTB 5AVSB 2PGDA 1HWTC 2OYHC 4RO0A 1RF1B 5TISV 2I8DA 4N78E 2V7QH 1HF9A 1H33B 2BH5X 3NXSA 2JEEA 1HGZA 1LTJB 4PD4H 1YICA 3H1LJ 2KP8A 3H1LD 3CCMP 5EXQA 3WUUA 1LNQA 2IBZD 3PH2B 4K3IA 1G1IA 3HQ8A 3SWSA 1M6ZA 1KQLA 1T8ZA 1ETPA 1FS0E 1M90Q 1SQBK 1COTA 2IZ0A 1C6RA 1NU1K 4WQCA 1CI6A 1PFIA 3L37A 2KZJA 1NTKJ 1NTKD 4PJ0H 4W7ZA 3NBTA 1QVGO 1CRYA 1EZVI 2O01J 2V4HA 2BPBB 1AA0A 1OVVA 1QGKB 1L0LK 1CC5A 2CPBA 1BDDA 4L74A 4HH2A 3VP9A 2R44A 1FDOA 4UB6E 3H1IJ 3H1ID 2MHMA 3GF7A 3CX5D 3GG2A 2LIRA 2OZ1B 5C0ZA 2QA4P 2XKMA 2G3AA 3QH9A 1URQB 1BCCE 1OMIA 1A02F 2NZ2A 1KD1Q 5CIDB 1YJWP 1FCDC 3VMZA 1EQ7A 1ZR2A 1JTHB 1KB9H 2E75C 3LIEA 3PXWA 1H31A 3B4SA 3NTNA 3CX5I 1IQCA 1LC2A 3RN1A 2FFDB 1FJ0A 4QAOA 2QJPB 4EIDA 2LKMA 5KAFH 3F89A 3HD7C 3L70J 3L70D 2IZ1A 1R8EA 1MUUA 2K9YA 1QYZA 3L72G 1KILC 2FYUG 2WSSH 1Q81Q 3ZCFA 3L4FA 4D6TJ 4D6TD 1PGPA 3CWBJ 2K1AA 3CWBD 4XA4A 5E79E 2HPCA 3CYTI 1Q82Q 5B66H 3CC4P 1NWQA 3O6QA 3G6EP 3H1KJ 4DCKA 1CSBA 3H1KD 1N73A 1HJ3A 1NKNA 2WPRA 2ZJSE 1JY2O 1KB0A 1P84D 2ZVOB 5CIFB 4GEDB 1CHIA 1QEXA 1QL1A 3W68A 1M1JA 1OAEA 2V7QJ 1BDCA 1L9JC 3T97A 1URQD 4UB6V 3OA7A 1LWUC 1H9XA 3RMZA 2E5YA 2JWAA 1SVFA 4PD4D 3PTZA 1ZRTE 5GTIH 3NBSA 4DOJA 1PIXA 1GKSA 1N2DC 1FI9A 2BCCJ 3A0HE 2BCCD 3HUSA 1NTZK 3PHLA 1OCDA 3KZIH 3AEGC 1SQXJ 1SQXD 2QE7H 2XNDH 2P58A 4ASVA 2YMKA 1MKMA 1ZP0C 3CX5W 1N7LA 3M9BA 2KS1A 4WQ7A 2M8RA 2OYIA 1IRWA 1FAVA 4LC1A 2B12B 2WMMA 3BRVB 1VQ5P 3S4RA 1MV8A 3FWLA 3ABVC 1AQTA 1FZBA 1FHBA 1KQGB 3HE4B 1SQVK 2IYPA 5E79V 4IFDK 3L72D 3L36A 2FYUD 1H88A 1JNMA 2A45G 3TYIA 1VL2A 1KC8Q 4EYYQ 1IK7A 1KYOH 3KDPB 1GW4A 3Q5RA 3I5CA 5KLVE 1YIJP 1KORA 4M3LA 1VQ8P 2ITAA 2H8PD 1W2EA 2IDBA 3D6YA 3MK7C 2QVAA 5DF5A 1K04A 1GL2B 1M1KQ 1JEKA 5KKZB 5CCHD 5AVUB 4IFFA 4EDFA 3OAKA 2FYNB 2YKPA 3L75J 1WVEC 1G2CA 2WWWA 1SLQA 3HTKA 1AOQA 2LR2A 1IJDB 3P32A 4BRYB 5APTA 3TGUJ 1N73C 3A0HV 1AQ5A 2HLOA 3KHUA 1IC2A 3PRJA 1N90A 3CMEP 1W5CE 2JKVA 1CTZA 3CXHE 2IYOA 1FE6A 2QJKB 3AEDC 2M0BA 3CCRP 2QM8A 2B88A 3M0AA 3GHGB 3UIAA 2N9YB 4H0JA 3FXDA 1FZCB 5AVTB 3WUVA 2AIUA 4EIFA 1RF0A 3VOPA 2MKVA 1AVOA 3L4MA 2B87B 3BCCG 4PW9B 2XZRA 155CA 1K8AQ 1E29A 2Z4EA 2M5AA 1L0NE 5AURA 1KQFB 1L0NG 3GF3A 1IZNB 1A2SA 1NTME 4L75A 4J20A 1NTMG 1NOHA 2VRSA 3CLQA 2OYIC 3OCDA 1CTJA 1CCRA 1JDLA 1N8RQ 1HCMA 3JBTB 4UB8E 2FRCA 4WQDA 1GIWA 1GL2D 5APYA 1FJPA 2R5DA 1CTYA 1S4XA 2XNXA 3AE3C 2L5GB 3M9QA 4JBZA 3D6ZA 2H88C 1YJ9P 4JPZB 2WVRA 1BE3E 1JUNA 1BE3G 4RJTA 2J58A 1RQVA 2DGEA 2C1DA 5TJHA 2W90A 2N1TA 4AQRD 451CA 3ZOWA 4K35A 4OVNF 2W27A 1SQBJ 3II6A 2ZOOA 1SQBD 1NU1J 2Y9YA 4OWFA 1NU1D 3WUIA 2ZONG 1VYDA 1T2KD 2FFDC 2E76C 2QJPC 1CSXA 3O0RC 2AXTE 2KNCA 1SQQE 2A45I 3Q3DA 1CXCA 1N50A 4WQBA 1NYHA 1Y47A 4W7YA 2GM4A 1PPJE 1PPJG 5CCGA 1QVFO 1M57D 1DVHA 5L8RJ 3PXSA 1L0LJ 3V5BA 5KAIH 1KILE 1L0LD 1HJBA 5KJ7A 2POHA 2B9BA 1KX7A 1IFDA 1KYOD 2QSIA 2G8YA 1NTZG 3AE2C 1QL4A 1RZ6A 3A3YB 3H1JJ 1YQ4C 3H1JD 3RL0C 1LT1A 3B5NA 5CYTR 1W5CT 2OYHA 1PP9E 1PP9G 2E5TA 4RKUJ 1UIIA 1S9KD 3BCCD 2YIUB 1K73Q 4FA5A 3W67A 4UB8V 5K5GB 1RF0C 1VF5B 1IZL0 4AAMA 3FGAD 1W2BO 1LFMA 3KPEA 5CCHC 2GUVA 1NMIA 3L74J 1IFPA 3L74D 3B71A 3KXDA 3PLNA 2I1JA 5AVWB 1E79H 4TT3H 1GK4A 1OIPA 4GDOA 2J59M 1KFMA 1RZ5A 2B89A 3CX5H 5AVRB 2BH4X 4FA9A 2D0SA 1MFZA 4GKGA 3CCEP 4IFMA 1CYCA 3PH0A 1CI6B 2B11B 2AXTV 3IAOA 1LTAC 3AE6C 1CHJA 2YO3A 1NGMB 2C8SA 1IK9A 2FYZA 1KQSO 3E7KA 4JYCA 3L71G 2N1TC 4WY4C 1VQOP 2BGVX 3P8CD 1QKSA 1JCDA 1LT9A 4KT0J 1IRVA 2M3BA 3ZIYA 1NTKE 1RE4C 1SQPE 1SQPG 1FI7A 3RK3C 2E74B 3VTPC 4EI2A 2Q5UA 2BCNB 5H2FH 1NTZJ 1NTZD 1J1EB 1MZ9A 2HODB 2DVHA 1YQ3C 1VF5D 5C9MA 4H0LB 5KKZC 2OQQA 1CEDA 3EFGA 4FB1A 3NMDA 3O1YA 2IFMA 3HD7A 1KV9A 3BVHA 1BSHA 4Q5PA 3Q5PA 4QMAA 1SFCA 4U3FJ 1Z56A 4U3FD 5KLIB 1P84H 3A0BH 1BL9A 1FI3A 2WSFH 1F1FA 3JCUH 1HTLC 4GOFA 1C52A 1YYCA 3TSIA 1LTSC 2H43A 3M97X 2GC7D 1EDKA 4LJIA 3SJLA 1SQVJ 3AE1C 1SQVD 3GHGC 3ORVA 1UIXA 1GMJA 4O9BA 5AVVB 3N4XA 1CRGA 1I6DA 3M0DC 1EZVD 1ZLLA 2WZ7A 2AEMA 1Q90D 2XTSB 4O1QA 1HUCA 2ZFCA 4C46A 1VDFA 2PFXA 2D2CB 1WEJF 3CPWO 3HRNA 2JQRA 3CWBE 5AVYB 2BEQD 1NAFA 1YITP 1LWUA 1Q7YQ 1HVVA 2HFED 3C1LA 1NNOA 2E74D 5APUA 1J3SA 1N7SA 2W83C 2OTLP 3H1HJ 1JO5A 3H1HD 2OGUA 3H1KE 2N9JA 3L73J 3L73D 5CJ4A 4DZOA 4L3HA 4H0LD 1IFNA 1CNOA 2K9JA 3FWNA 1GZLA 2RMZA 1CORA 3MZWB 1R0QA 2Q1KA 5CBOA 1CIFA 3O8ZA 1RAQA 2PCBB 3E1RA 2ZYAA 2BEZF 1ZOYC 2K3RA 4PD4E 1LT9C 1EXIA 2IFNA 1BCCG 2NRGA 4ASWA 2BCCE 5E79H 3V2QA 1HGVA 2WT7B 3S9OA 1GU4A 3CL3D 2UWJE 1SQXE 1L9BC 4H13B 1L0NK 1VQNP 2C1VA 1NTMK 4JYBA 2JDIH 4W80A 1W2LA 2PACA 3AEAC 3CCUP 1E8EA 1JY2P 1Q2NA 2YKOA 4PJ0E 1YFCA 3EWKA 2Q7CA 2ZAEB 4JQ0D 2D2CD 3V2NA 4H44B 1CIGA 1SFCC 3CI9A 1YIQA 1BGYE 1YJNP 1BGYG 5AW9B 4DJGA 1LP1A 4WQ9A 2PRRA 1GQ1A 3P8MC 5AVXB 1J1DC 3Q5SA 2KXPB 4GOEA 1X79B 2W6JH 2CK3H 1U75B 1N86A 3ZOXA 1VQLP 3AEFC 2KI7B 2H89C 1G2CB 1VF5C 2WSFJ 1M8OB 3AE5C 2YNYA 1KB9E 2ZYDA 3TNUA 3VP8A 2NPSC 2QG4A 2YKQA 3X39A 3DP5A 3L75E 1N7SC 1PZQA 5KAFE 3H32B 2BASA 3TGUE 2ZT9B 4H13D 1CIHA 2A45H 2GUSA 2YXRB 4AAOA 1FZFA 4PV1B 3IF4A 2BLFB 1BCCD 5DJQB 4IL6E 3U1CA 3KQGA 2QEXP 5B5EH 5B66E 4WVZA 3HQ6A 4XXLA 1C7MA 1FDIA 4H44D 1S1CX 2L91A 2QJYC 3MGNA 1XTCC 1EDLA 1ZXGA 2JR8A 4PJ0V 1DW1A 4RESB 3LW5J 1U74B 1AKKA 1D7MA 2ZYGA 3OCDB 5CHXA 1URQA 3CP5A 4NPEA 2C9XB 1KIBA 2WPQA 4B86A 1EXJA 1AYGA 2RKLA 3L72J 2FYUJ 1A56A 3RK3E 1JTHA 1J1EC 3QWOC 1VQMP 5AW3B 1K3HA 3AE9C 1L4AB 1DD3A 1YEBA 4N6JA 2FWLA 5KLVG 2B4ZA 2FFDA 3B8EB 3WFBC 3TF5A 1CSVA 3A5TA 2KLVA 1KN7A 1JY3P 1CW5A 1FZAA 2N18C 2ZVNB 2KNCB 1RF1C 2ZT9D 2O3JA 1DT1A 3MHVA 1I8PA 2WQYC 1SQBE 2B0ZB 3CC7P 5KAFV 1NU1E 3OA8A 3AE7C 4PV1D 1LTJC 5CMZA 4HJGH 4Y99B 2C0XA 1SQPK 2Y0DA 1ZRTD 3H25A 2MJZA 4GYDA 4C7NB 3RBXA 1VQ7P 4IL6V 1I8OA 5B66V 1L0LE 1G1JA 2ORLA 2D2CC 2OYHB 2PAJA 1GD2E 1KB9I 2A06E 2EXVA 5CCHA 2A06G 1C2NA 1RH5B 3H1JE 5DJTB 5CIBB 1DH3A 4AUWA 2O01N 3RN0A 1L4AD 1C6SA 4BXLA 1HZVA 4R4MA 1S9KE 2WTYA 2AXTH
chains in the Genus database with same CATH topology
3HQ9A 1QL3A 4YE1A 1CYCA 4FA4A 2B11B 2AXTV 1CC5A 1YTCA 2OZ1A 1CHJA 1YEAA 1YCCA 2C8SA 1GJQA 1C75A 3NWVA 4AANA 4P4QB 4AX3A 1MG3D 3O20A 2GB8B 4AALA 3H1ID 2MHMA 3CX5D 1ZZHA 3GG2A 2LIRA 2OZ1B 351CA 4H0KA 1CRCA 2BGVX 5C0ZA 1HRCA 3SVWA 1QKSA 1BGYD 1IRVA 3ZIYA 3C2CA 5CIDB 1FI7A 2C1DB 4WQ8A 1FCDC 2BCNB 1NTZD 2N3YA 4XYDB 3PXWA 2DVHA 3GW6A 1H31A 5C9MA 1IQCA 1LC2A 3RN1A 4L3GA 1CEDA 1FJ0A 4QAOA 2QJPB 4EIDA 4FB1A 1NIRA 3O1YA 3L70D 1KV9A 1QYZA 3VRDA 3ZCFA 4EICA 4Q5PA 1HH7A 1KB9D 4U3FD 3HQ7A 5KLIB 5CIGB 4D6TD 1BL9A 1FI3A 2HV4A 1LS9A 3ZOYA 3CWBD 1QN2A 1F1FA 3DR0A 3ZOOA 3CYTI 1C52A 3L75D 3M97X 3VYMA 2GC7D 4LJIA 3SJLA 2I8FA 1SQVD 3VMAA 3TGUD 3ORVA 1CHHA 3H1KD 1HJ3A 3RLMA 1CRGA 1L0ND 1I6DA 2L4DA 1EZVD 1NTMD 1KB0A 1P84D 5CIFB 4GEDB 1CHIA 3O5CA 1GU2A 1CXAA 4JCGA 2XTSB 1OAEA 4O1QA 1L9JC 1WEJF 1EB7A 2JQRA 4UB6V 4KMGA 1H9XA 1CCHA 2YQBA 3RMZA 2JWAA 4RSZA 1HJ4A 4PD4D 3PTZA 1NNOA 3NBSA 1I5TA 4NFGB 1J3SA 1GKSA 3WU2V 1FI9A 5DJQC 2BCCD 5CICB 3H1HD 3PHLA 1OCDA 5GTIV 1BE3D 2N9JA 4FA1A 3L73D 4FANA 1YNRA 1SQXD 4L3HA 1CNOA 3A9FA 5B6QA 1CO6A 2YCCA 2RMZA 3CX5W 3KZIV 1CORA 1CYIA 1DW3A 1R0QA 2KS1A 1CIFA 4WQ7A 1RAQA 2PCBB 1I55A 1IRWA 1HROA 3VNWA 5KLVD 1CYJA 4V2KA 2B12B 2CE1A 2AI5A 1KX2A 5B5EV 5DFSA 1PPJD 1I54A 3FWLA 1CSUA 1DW0A 1FHBA 1H32A 2V08A 5E79V 1L9BC 5CIEB 3L72D 2FYUD 2C1VA 3TYIA 1W2LA 2CA3B 1AOFA 1CRHA 2PACA 2B10B 3CXHW 2MTAC 4WQEA 1H32B 1E8EA 1YFCA 1PP9D 4FAVA 1MZ4A 3MK7C 1H31B 3CXHD 1CIGA 2C1UA 1YIQA 5DF5A 4DY9A 5KKZB 1F1CA 4PWAA 3ZBMA 4EDFA 4WQ9A 1GQ1A 2FYNB 1WVEC 2LITA 1CRIA 1HJ5A 1A8CA 2JTIB 1RAPA 3MK7B 1AOQA 2A06D 3PXTA 1U75B 3A0HV 4MU8A 1DIIC 3ZOXA 1DW2A 1C2RA 3KHUA 3PRJA 1N90A 2N3BA 3TDKA 4A7PA 1CTZA 4EIEA 2Q3EA 2QJKB 1HZUA 2N9YB 4H0JA 2QG4A 3X39A 2AIUA 1DVVA 3DP5A 4EIFA 2YK3A 2CA4B 3L4MA 2N9IA 1M60A 1H9YA 4PW9B 1NMLA 155CA 1E29A 3DMIA 1S6VB 3L71D 1CIHA 2CE0A 2Y0EA 2Y0CA 5AURA 1N15A 1A2SA 2GIWA 4J20A 4AAOA 2ZZS1 1N9CA 3SXTA 2BLFB 1BCCD 5DJQB 4WQAA 1I6EA 3L4OA 3OCDA 3HQ6A 4XXLA 1CTJA 1CCRA 1JDLA 1SQPD 1C7MA 1HCMA 3JBTB 2FRCA 4L1QA 2L91A 5IY51 4WQDA 1LMSA 2K9JB 1GIWA 2C2CA 1SQQD 4PJ0V 1DW1A 1CTYA 1DIQC 1U74B 1AKKA 1C6OA 3OCDB 3CP5A 3WC8A 2C9XB 2QJYB 1KIBA 4RJTA 2DGEA 2C1DA 1AYGA 5TJHA 1E2RA 1H1OA 2RN0A 1A56A 451CA 3ZOWA 1K3GA 2ZOOA 1SQBD 1K3HA 1IO3A 1S5LV 1NU1D 3WUIA 2ZONG 1VYDA 1YEBA 5GTHV 1B7VA 2FWLA 1CSXA 2B4ZA 3O0RC 1CXCA 1N50A 4WQBA 3ITKA 3WFEC 4N0KA 3WFBC 2ZBOA 3TF5A 1CSVA 3CU4A 1KYOW 2GC4D 1DVHA 3PXSA 2N18C 5H2FV 1L0LD 2KNCB 2VHDA 1KX7A 1MG2D 1KYOD 2O3JA 1DT1A 5KAIV 3WFCC 1CSWA 1QL4A 1RZ6A 3SLEA 1I8PA 2PCCB 1H33A 3H1JD 2B0ZB 1CIEA 5KAFV 2N18B 5CYTR 2D0WA 3OA8A 1W5CT 1FOCA 5TISV 2Y0DA 1ZRTD 3A0BV 1M70A 4GYDA 1H33B 2BH5X 3BCCD 3OA8B 2YIUB 4IL6V 1I8OA 4Y5RA 4FA5A 5B66V 2ORLA 1YICA 4UB8V 2V07A 3H1LD 1IZL0 5EXQA 4AAMA 2IBZD 4O1WA 1LFMA 3PH2B 2EXVA 4K3IA 1NMIA 3HQ8A 2ZXYA 3SWSA 1C2NA 1M6ZA 3L74D 2CXBA 1LC1A 3PLNA 1ETPA 5CIBB 1COTA 1C6RA 3WFDC 1CRJA 3RN0A 5CIHB 1C6SA 4WQCA 1HZVA 1RZ5A 1GDVA 1NTKD 2BH4X 3NBTA 1CRYA 2D0SA 4FA9A 2BPBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQ9 A;  1QL3 A;  4YE1 A;  1CYC A;  4FA4 A;  2B11 B;  2AXT V;  1CC5 A;  1YTC A;  2OZ1 A;  1CHJ A;  1YEA A;  1YCC A;  2C8S A;  1GJQ A;  1C75 A;  3NWV A;  4AAN A;  4P4Q B;  4AX3 A;  1MG3 D;  3O20 A;  2GB8 B;  4AAL A;  3H1I D;  2MHM A;  3CX5 D;  1ZZH A;  3GG2 A;  2LIR A;  2OZ1 B;  351C A;  4H0K A;  1CRC A;  2BGV X;  5C0Z A;  1HRC A;  3SVW A;  1QKS A;  1BGY D;  1IRV A;  3ZIY A;  3C2C A;  5CID B;  1FI7 A;  2C1D B;  4WQ8 A;  1FCD C;  2BCN B;  1NTZ D;  2N3Y A;  4XYD B;  3PXW A;  2DVH A;  3GW6 A;  1H31 A;  5C9M A;  1IQC A;  1LC2 A;  3RN1 A;  4L3G A;  1CED A;  1FJ0 A;  4QAO A;  2QJP B;  4EID A;  4FB1 A;  1NIR A;  3O1Y A;  3L70 D;  1KV9 A;  1QYZ A;  3VRD A;  3ZCF A;  4EIC A;  4Q5P A;  1HH7 A;  1KB9 D;  4U3F D;  3HQ7 A;  5KLI B;  5CIG B;  4D6T D;  1BL9 A;  1FI3 A;  2HV4 A;  1LS9 A;  3ZOY A;  3CWB D;  1QN2 A;  1F1F A;  3DR0 A;  3ZOO A;  3CYT I;  1C52 A;  3L75 D;  3M97 X;  3VYM A;  2GC7 D;  4LJI A;  3SJL A;  2I8F A;  1SQV D;  3VMA A;  3TGU D;  3ORV A;  1CHH A;  3H1K D;  1HJ3 A;  3RLM A;  1CRG A;  1L0N D;  1I6D A;  2L4D A;  1EZV D;  1NTM D;  1KB0 A;  1P84 D;  5CIF B;  4GED B;  1CHI A;  3O5C A;  1GU2 A;  1CXA A;  4JCG A;  2XTS B;  1OAE A;  4O1Q A;  1L9J C;  1WEJ F;  1EB7 A;  2JQR A;  4UB6 V;  4KMG A;  1H9X A;  1CCH A;  2YQB A;  3RMZ A;  2JWA A;  4RSZ A;  1HJ4 A;  4PD4 D;  3PTZ A;  1NNO A;  3NBS A;  1I5T A;  4NFG B;  1J3S A;  1GKS A;  3WU2 V;  1FI9 A;  5DJQ C;  2BCC D;  5CIC B;  3H1H D;  3PHL A;  1OCD A;  5GTI V;  1BE3 D;  2N9J A;  4FA1 A;  3L73 D;  4FAN A;  1YNR A;  1SQX D;  4L3H A;  1CNO A;  3A9F A;  5B6Q A;  1CO6 A;  2YCC A;  2RMZ A;  3CX5 W;  3KZI V;  1COR A;  1CYI A;  1DW3 A;  1R0Q A;  2KS1 A;  1CIF A;  4WQ7 A;  1RAQ A;  2PCB B;  1I55 A;  1IRW A;  1HRO A;  3VNW A;  5KLV D;  1CYJ A;  4V2K A;  2B12 B;  2CE1 A;  2AI5 A;  1KX2 A;  5B5E V;  5DFS A;  1PPJ D;  1I54 A;  3FWL A;  1CSU A;  1DW0 A;  1FHB A;  1H32 A;  2V08 A;  5E79 V;  1L9B C;  5CIE B;  3L72 D;  2FYU D;  2C1V A;  3TYI A;  1W2L A;  2CA3 B;  1AOF A;  1CRH A;  2PAC A;  2B10 B;  3CXH W;  2MTA C;  4WQE A;  1H32 B;  1E8E A;  1YFC A;  1PP9 D;  4FAV A;  1MZ4 A;  3MK7 C;  1H31 B;  3CXH D;  1CIG A;  2C1U A;  1YIQ A;  5DF5 A;  4DY9 A;  5KKZ B;  1F1C A;  4PWA A;  3ZBM A;  4EDF A;  4WQ9 A;  1GQ1 A;  2FYN B;  1WVE C;  2LIT A;  1CRI A;  1HJ5 A;  1A8C A;  2JTI B;  1RAP A;  3MK7 B;  1AOQ A;  2A06 D;  3PXT A;  1U75 B;  3A0H V;  4MU8 A;  1DII C;  3ZOX A;  1DW2 A;  1C2R A;  3KHU A;  3PRJ A;  1N90 A;  2N3B A;  3TDK A;  4A7P A;  1CTZ A;  4EIE A;  2Q3E A;  2QJK B;  1HZU A;  2N9Y B;  4H0J A;  2QG4 A;  3X39 A;  2AIU A;  1DVV A;  3DP5 A;  4EIF A;  2YK3 A;  2CA4 B;  3L4M A;  2N9I A;  1M60 A;  1H9Y A;  4PW9 B;  1NML A;  155C A;  1E29 A;  3DMI A;  1S6V B;  3L71 D;  1CIH A;  2CE0 A;  2Y0E A;  2Y0C A;  5AUR A;  1N15 A;  1A2S A;  2GIW A;  4J20 A;  4AAO A;  2ZZS 1;  1N9C A;  3SXT A;  2BLF B;  1BCC D;  5DJQ B;  4WQA A;  1I6E A;  3L4O A;  3OCD A;  3HQ6 A;  4XXL A;  1CTJ A;  1CCR A;  1JDL A;  1SQP D;  1C7M A;  1HCM A;  3JBT B;  2FRC A;  4L1Q A;  2L91 A;  5IY5 1;  4WQD A;  1LMS A;  2K9J B;  1GIW A;  2C2C A;  1SQQ D;  4PJ0 V;  1DW1 A;  1CTY A;  1DIQ C;  1U74 B;  1AKK A;  1C6O A;  3OCD B;  3CP5 A;  3WC8 A;  2C9X B;  2QJY B;  1KIB A;  4RJT A;  2DGE A;  2C1D A;  1AYG A;  5TJH A;  1E2R A;  1H1O A;  2RN0 A;  1A56 A;  451C A;  3ZOW A;  1K3G A;  2ZOO A;  1SQB D;  1K3H A;  1IO3 A;  1S5L V;  1NU1 D;  3WUI A;  2ZON G;  1VYD A;  1YEB A;  5GTH V;  1B7V A;  2FWL A;  1CSX A;  2B4Z A;  3O0R C;  1CXC A;  1N50 A;  4WQB A;  3ITK A;  3WFE C;  4N0K A;  3WFB C;  2ZBO A;  3TF5 A;  1CSV A;  3CU4 A;  1KYO W;  2GC4 D;  1DVH A;  3PXS A;  2N18 C;  5H2F V;  1L0L D;  2KNC B;  2VHD A;  1KX7 A;  1MG2 D;  1KYO D;  2O3J A;  1DT1 A;  5KAI V;  3WFC C;  1CSW A;  1QL4 A;  1RZ6 A;  3SLE A;  1I8P A;  2PCC B;  1H33 A;  3H1J D;  2B0Z B;  1CIE A;  5KAF V;  2N18 B;  5CYT R;  2D0W A;  3OA8 A;  1W5C T;  1FOC A;  5TIS V;  2Y0D A;  1ZRT D;  3A0B V;  1M70 A;  4GYD A;  1H33 B;  2BH5 X;  3BCC D;  3OA8 B;  2YIU B;  4IL6 V;  1I8O A;  4Y5R A;  4FA5 A;  5B66 V;  2ORL A;  1YIC A;  4UB8 V;  2V07 A;  3H1L D;  1IZL 0;  5EXQ A;  4AAM A;  2IBZ D;  4O1W A;  1LFM A;  3PH2 B;  2EXV A;  4K3I A;  1NMI A;  3HQ8 A;  2ZXY A;  3SWS A;  1C2N A;  1M6Z A;  3L74 D;  2CXB A;  1LC1 A;  3PLN A;  1ETP A;  5CIB B;  1COT A;  1C6R A;  3WFD C;  1CRJ A;  3RN0 A;  5CIH B;  1C6S A;  4WQC A;  1HZV A;  1RZ5 A;  1GDV A;  1NTK D;  2BH4 X;  3NBT A;  1CRY A;  2D0S A;  4FA9 A;  2BPB B; 
#chains in the Genus database with same CATH topology
 1IFM A;  3EFF K;  1Y9B A;  1YHQ P;  1RHZ B;  4YE1 A;  5AW8 B;  3BAS A;  4IOI H;  5AW0 B;  3U59 A;  4CPG A;  1YTC A;  1URQ C;  3GLM A;  1C75 A;  3NWV A;  4AAN A;  4P4Q B;  4AX3 A;  1MG3 D;  3LID A;  2GB8 B;  1DEB A;  5AW6 B;  3MP7 B;  1ZZH A;  1S5L H;  3HE4 A;  351C A;  4H0K A;  4WY4 A;  3WU2 E;  5GTH H;  4H13 C;  2FKW B;  3C2C A;  1FOS E;  3HE5 B;  2ZXE B;  1RE4 A;  2Z5H A;  4GT1 A;  3SFD C;  1SQQ G;  4XYD B;  1OVR A;  4ZMD A;  1PGJ A;  1PGQ A;  1GL2 A;  4L3G A;  1WRG A;  3D0W A;  3RBZ A;  4GIF A;  1NIR A;  2E75 B;  2QRX A;  2I1K A;  2QM7 A;  4N3Y B;  5TIS H;  3CMA P;  4BRY A;  5CIG B;  1U7J A;  1LS9 A;  3ZOY A;  1QN2 A;  3HD7 B;  3PJS K;  3DR0 A;  3ZOO A;  1OXZ A;  1KIL B;  4I6M C;  3WUT A;  3BCC J;  1OW8 A;  1T3U A;  1JB0 J;  3VMA A;  5APW A;  1CHH A;  1L0N J;  1L0N D;  3GHG A;  2L4D A;  1NTM J;  3CXH I;  4EIJ A;  1NTM D;  3M0D A;  1FZC A;  1K9M Q;  1DIP A;  2B87 A;  4U3F E;  2ZT9 C;  2FXP A;  3M91 A;  3CCS P;  1EB7 A;  2DW3 A;  4KMG A;  2H7H A;  1CCH A;  3MUD C;  1PV3 A;  1U7M A;  4GOD A;  4RSZ A;  1YBK A;  4ZNC A;  3V4Q A;  4PV1 C;  3WU2 V;  5DJQ C;  2IX7 C;  1SQV E;  1KFN A;  5AW5 B;  1BE3 J;  4L73 A;  1BE3 D;  2YMY A;  4FAN A;  3H1L E;  1GTW A;  3H1L G;  1LTG C;  1OZH A;  3A9F A;  2IBZ E;  5B6Q A;  2YCC A;  3A2A A;  1CYI A;  2WIT A;  1J2J B;  1YI2 P;  1KTM A;  2E75 D;  3G4S P;  1I55 A;  3VNW A;  3TYY A;  2N9B A;  4V2K A;  3SFE C;  1KX2 A;  2KB7 P;  4HYT B;  5DFS A;  1PPJ D;  1L2P A;  1I54 A;  1CSU A;  3I56 P;  4Y28 J;  2O1J A;  3SWY A;  1NTK G;  1DW0 A;  3G71 P;  1KIL D;  1L4A C;  2AEJ A;  4I1L A;  3L73 E;  5APX A;  1H32 A;  2V08 A;  2IPP A;  4R4L A;  4WBA A;  2JWD A;  5CIE B;  1RQU A;  2OYO A;  1GL2 C;  1JOC A;  2B10 B;  3CXH W;  2MTA C;  3H1I E;  4WWI A;  3FX0 A;  3H1I G;  3CX5 E;  1IFI A;  2FYN C;  1FZE A;  1PP9 J;  3AEB C;  1PP9 D;  3P7K A;  1MZ4 A;  2Y9Z A;  1H31 B;  1S72 P;  3D71 A;  2XU6 A;  4DY9 A;  1F1C A;  3ZBM A;  4OGQ B;  1ZW0 A;  2R5B A;  2LIT A;  1IO4 A;  1FOS F;  4OH8 B;  2JTI B;  1RAP A;  3MK7 B;  3F5H A;  1T2K C;  2KOG A;  2WSE J;  2QJK C;  2KK7 A;  3PXT A;  2KSJ A;  1DII C;  3JSV C;  1GK6 A;  4DT0 A;  2HPC B;  3Q1M A;  2FXM A;  1A02 J;  1NH4 A;  1S5L X;  2KSE A;  1FZC C;  2N3B A;  1X9V A;  1T3J A;  1JM0 A;  3L70 E;  1M7L A;  3L70 G;  3O6Q B;  4UB6 H;  5KLV K;  3C9I A;  1SS1 A;  1LGH B;  3C8V A;  5H2F E;  1N73 B;  1Y8A A;  3SSU A;  4D6T E;  2R3C A;  4D6T G;  1VQ6 P;  3A7O A;  1JMB A;  3KYQ A;  2NPS A;  3CWB G;  1M1J B;  3VN0 A;  2YK3 A;  2CA4 B;  1X22 A;  1S3J A;  1K05 A;  2PP6 A;  2N9I A;  3TNU B;  3T97 B;  3L71 J;  4YXD C;  3L71 D;  2Y0C A;  3H1K G;  1N15 A;  3LW5 H;  2GIW A;  1P84 E;  3A0B E;  2ZZS 1;  2M3E A;  3CCJ P;  3V4W A;  3HUS B;  5M1B A;  1I6E A;  3JCU E;  3L4O A;  1SQP J;  2LXC B;  1LTB C;  1SQP D;  1OX3 A;  4L1Q A;  2IBZ I;  1LMS A;  3PP5 A;  1DIQ C;  5AVQ B;  3N7N A;  2KS1 B;  4OGQ D;  2OYI B;  1HJ0 A;  1H89 A;  2BCC G;  2W6B A;  1BSN A;  2WSC H;  2RH0 A;  3IN6 A;  1VQ4 P;  1SQX G;  1H1O A;  4YTP C;  2W6A A;  2C9L Y;  2HOD A;  2YXQ B;  1RE3 A;  1KV4 A;  2P1J A;  3JC2 2;  1ZME C;  1B7V A;  1YTZ T;  5APQ A;  2C0W A;  4N78 D;  3WFE C;  1H0T A;  3V2R A;  3CU4 A;  5H2F V;  2VHD A;  2E76 B;  3A0H H;  1YTZ I;  1MG2 D;  4KHX A;  3L72 E;  1RF1 A;  2LXB A;  2FYU E;  4Z1M H;  3CC2 P;  2PCC B;  3USS A;  1H33 A;  2YIU C;  1USE A;  4ZKU A;  2KIK A;  3CCQ P;  3RGU A;  1FOC A;  1LTJ A;  2R3S A;  4IL6 H;  3HTK B;  3D70 A;  2JO1 A;  2K88 A;  3A0B V;  1M70 A;  3VMY A;  3L35 A;  1SQQ K;  3RL0 B;  3OA8 B;  1AJY A;  4Y5R A;  3V2P A;  2V07 A;  1OW6 A;  3L75 G;  4WB4 A;  4O1W A;  3OW2 O;  3GMA A;  1X8Y A;  5KTB A;  2Q9I A;  2ZXY A;  3CCL P;  3V6I A;  2CXB A;  1LC1 A;  3TGU G;  2OTK E;  1GW3 A;  3VYI A;  2Z5I A;  4JF7 A;  3M9H A;  3WFD C;  1CRJ A;  5CIH B;  1BCC J;  4U7J A;  4HB1 A;  4YXW H;  1GDV A;  2M5A B;  3AE8 C;  2JJL A;  3HQ9 A;  1P84 I;  1QL3 A;  3ZDM A;  1NKZ B;  3VMX A;  3R2P A;  4FA4 A;  2JP3 A;  5BVZ A;  2OZ1 A;  1YEA A;  2C9N Y;  1YCC A;  2E76 D;  1GJQ A;  3O20 A;  4AAL A;  2E74 C;  2Q6Q A;  2HG5 D;  1WMK A;  2HR3 A;  4PD4 I;  2WT7 A;  1QL2 A;  1CRC A;  1HRC A;  1HBW A;  3SVW A;  3G9R A;  4NPF X;  2E42 A;  3BAT A;  1BGY J;  1RE3 C;  2SPZ A;  3AEE C;  1BGY D;  1X0T A;  5GTI E;  4H0L C;  2O1K A;  2C1D B;  4WQ8 A;  1ZR4 A;  2N1T B;  3CXH H;  2WSC J;  3FXE A;  4WY4 B;  3RL0 D;  3KZI E;  4YPC A;  2N3Y A;  1EDI A;  1U57 A;  3GW6 A;  4L76 A;  1Q86 Q;  5KLI C;  3RK3 B;  1E5W A;  1JY2 N;  4OGQ C;  5B5E E;  3SWF A;  3VRD A;  4EIC A;  1SQB G;  1HH7 A;  1KB9 D;  4I7Z B;  3HQ7 A;  1TU3 F;  1NU1 G;  1H8A A;  2HV4 A;  5BU8 B;  1NTK K;  3RK2 B;  1FJK A;  3L75 D;  2J5U A;  4UB8 H;  3VYM A;  2YO2 A;  1NVO A;  3B5N B;  2I8F A;  3TGU D;  2HYN A;  4TLF A;  3RLM A;  2OAR A;  1L0L G;  4I2L C;  1PL5 A;  1KYO E;  1M1J C;  2CPS A;  3O5C A;  1GU2 A;  1CXA A;  4JCG A;  1NO4 A;  1DX7 A;  3CCV P;  3H1J G;  3H32 A;  1KMI Z;  1JY3 O;  2AXC A;  3WU2 H;  4KJM A;  2YQB A;  1JCC A;  3MUD A;  1HJ4 A;  1OWA A;  1I5T A;  4NFG B;  2N1T D;  3BCC E;  1WT6 A;  3HUS C;  4WY4 D;  1EC5 A;  5CIC B;  4NPD A;  1RY3 A;  1M56 D;  5GTI V;  4FA1 A;  1T6A A;  1YNR A;  1AV1 A;  3RK3 D;  1CO6 A;  1AVY A;  3KZI V;  4XE5 B;  1DW3 A;  3SWK A;  1R5L A;  3L74 E;  3I55 P;  1VPC A;  1MFT A;  3L74 G;  3G3Z A;  5CCG D;  1NAY A;  1IFJ A;  1HRO A;  5KLV J;  3AE4 C;  5KLV D;  1CYJ A;  4IL6 X;  3WMM 0;  2CE1 A;  1OVU A;  3MIW A;  2AI5 A;  1AFO A;  5KJ7 D;  5B5E V;  3IR9 A;  4K3A A;  3RK2 D;  1S2E A;  2ZXX A;  3OJA B;  1VQP P;  1L4A A;  3B5N D;  2KLU A;  1XTG B;  4ZKP A;  2GA1 A;  3E1I A;  1LT9 B;  5APV A;  4H44 C;  2CA3 B;  3MTU E;  1AOF A;  1CRH A;  5AVZ B;  3S1K A;  4WQE A;  1H32 B;  2WSE H;  4FAV A;  4BWN A;  3CXH D;  3P8C E;  2C1U A;  1DD4 A;  2WPV B;  1QLE D;  1JY3 N;  4PWA A;  1FZG A;  5AW2 B;  1VQK P;  2XV5 A;  3EQ2 A;  1LTT C;  1CRI A;  1HJ5 A;  1A8C A;  1PGO A;  1NTZ E;  2P67 A;  2P2U A;  2W8Z A;  1SFC B;  2A06 D;  1S5L E;  1SQX K;  4MU8 A;  4C7N A;  2FBW C;  2KYV A;  1DW2 A;  5GTH E;  2FXO A;  1C2R A;  5DJU B;  1J1D B;  2P10 A;  3TDK A;  4A7P A;  3K5B A;  5EFW B;  1SP4 A;  4EIE A;  5C39 A;  5AW4 B;  2Q3E A;  1HZU A;  2R32 A;  2K37 A;  1FU1 A;  5BU5 A;  4U3F G;  1VQ9 P;  1KYO I;  4EOT A;  1FC2 C;  1DVV A;  5KAI E;  1QX8 A;  3H6P A;  1FDM A;  1HH0 A;  1CZQ A;  2O01 H;  2WPS A;  1M60 A;  1H9Y A;  1NML A;  1SQV G;  3DMI A;  2FYU K;  1S6V B;  4AYC A;  2Q3I A;  1KZU B;  1NHL A;  2CE0 A;  2Y0E A;  2NPS B;  5CJ0 A;  1LWU B;  5TIS E;  3TK1 A;  1JMM A;  1EZV E;  3CD6 P;  1EZV G;  1N7S B;  1N9C A;  3SXT A;  2IBZ G;  1LTI C;  3R4Y A;  4WQA A;  1DEE G;  1USD A;  2FY8 A;  1ZV8 A;  5IY5 1;  2K9J B;  1SQQ J;  2C2C A;  3AEC C;  1SQQ D;  2P7J A;  5AW1 B;  2XDJ A;  5APS A;  1R5S A;  3U1A A;  5CBN A;  1C6O A;  2OTJ P;  3HD7 D;  1FBM A;  3Q2Y A;  1NJI Q;  4HKZ H;  3WC8 A;  3H1H E;  3RL0 g;  3H1H G;  1SFC D;  3L71 E;  2QJY B;  3HE5 A;  2QIW A;  3L73 G;  1E2R A;  3NFQ A;  1EDJ A;  2RN0 A;  2KZI A;  1K3G A;  1GDT A;  4LGD E;  1LJ2 A;  1IO3 A;  1S5L V;  2AEF A;  4C7R A;  5GTH V;  5AW7 B;  2KUB A;  5CCG C;  3ITK A;  4N0K A;  2ZBO A;  4MN4 C;  1ZN5 A;  1KYO W;  2GC4 D;  3IFM A;  4I7Z C;  5KJ7 C;  1GU5 A;  4XFJ A;  1OFC X;  4Y99 C;  3RK2 C;  3M06 A;  4LLH A;  2E43 A;  1H0T B;  5KAI V;  3WFC C;  1CSW A;  3SLE A;  2NPS D;  1KIL A;  1LP1 B;  3MD0 A;  1OW7 A;  3B5N C;  1CIE A;  1N7S D;  2N18 B;  2D0W A;  3BRT B;  5AVS B;  2PGD A;  1HWT C;  2OYH C;  4RO0 A;  1RF1 B;  5TIS V;  2I8D A;  4N78 E;  2V7Q H;  1HF9 A;  1H33 B;  2BH5 X;  3NXS A;  2JEE A;  1HGZ A;  1LTJ B;  4PD4 H;  1YIC A;  3H1L J;  2KP8 A;  3H1L D;  3CCM P;  5EXQ A;  3WUU A;  1LNQ A;  2IBZ D;  3PH2 B;  4K3I A;  1G1I A;  3HQ8 A;  3SWS A;  1M6Z A;  1KQL A;  1T8Z A;  1ETP A;  1FS0 E;  1M90 Q;  1SQB K;  1COT A;  2IZ0 A;  1C6R A;  1NU1 K;  4WQC A;  1CI6 A;  1PFI A;  3L37 A;  2KZJ A;  1NTK J;  1NTK D;  4PJ0 H;  4W7Z A;  3NBT A;  1QVG O;  1CRY A;  1EZV I;  2O01 J;  2V4H A;  2BPB B;  1AA0 A;  1OVV A;  1QGK B;  1L0L K;  1CC5 A;  2CPB A;  1BDD A;  4L74 A;  4HH2 A;  3VP9 A;  2R44 A;  1FDO A;  4UB6 E;  3H1I J;  3H1I D;  2MHM A;  3GF7 A;  3CX5 D;  3GG2 A;  2LIR A;  2OZ1 B;  5C0Z A;  2QA4 P;  2XKM A;  2G3A A;  3QH9 A;  1URQ B;  1BCC E;  1OMI A;  1A02 F;  2NZ2 A;  1KD1 Q;  5CID B;  1YJW P;  1FCD C;  3VMZ A;  1EQ7 A;  1ZR2 A;  1JTH B;  1KB9 H;  2E75 C;  3LIE A;  3PXW A;  1H31 A;  3B4S A;  3NTN A;  3CX5 I;  1IQC A;  1LC2 A;  3RN1 A;  2FFD B;  1FJ0 A;  4QAO A;  2QJP B;  4EID A;  2LKM A;  5KAF H;  3F89 A;  3HD7 C;  3L70 J;  3L70 D;  2IZ1 A;  1R8E A;  1MUU A;  2K9Y A;  1QYZ A;  3L72 G;  1KIL C;  2FYU G;  2WSS H;  1Q81 Q;  3ZCF A;  3L4F A;  4D6T J;  4D6T D;  1PGP A;  3CWB J;  2K1A A;  3CWB D;  4XA4 A;  5E79 E;  2HPC A;  3CYT I;  1Q82 Q;  5B66 H;  3CC4 P;  1NWQ A;  3O6Q A;  3G6E P;  3H1K J;  4DCK A;  1CSB A;  3H1K D;  1N73 A;  1HJ3 A;  1NKN A;  2WPR A;  2ZJS E;  1JY2 O;  1KB0 A;  1P84 D;  2ZVO B;  5CIF B;  4GED B;  1CHI A;  1QEX A;  1QL1 A;  3W68 A;  1M1J A;  1OAE A;  2V7Q J;  1BDC A;  1L9J C;  3T97 A;  1URQ D;  4UB6 V;  3OA7 A;  1LWU C;  1H9X A;  3RMZ A;  2E5Y A;  2JWA A;  1SVF A;  4PD4 D;  3PTZ A;  1ZRT E;  5GTI H;  3NBS A;  4DOJ A;  1PIX A;  1GKS A;  1N2D C;  1FI9 A;  2BCC J;  3A0H E;  2BCC D;  3HUS A;  1NTZ K;  3PHL A;  1OCD A;  3KZI H;  3AEG C;  1SQX J;  1SQX D;  2QE7 H;  2XND H;  2P58 A;  4ASV A;  2YMK A;  1MKM A;  1ZP0 C;  3CX5 W;  1N7L A;  3M9B A;  2KS1 A;  4WQ7 A;  2M8R A;  2OYI A;  1IRW A;  1FAV A;  4LC1 A;  2B12 B;  2WMM A;  3BRV B;  1VQ5 P;  3S4R A;  1MV8 A;  3FWL A;  3ABV C;  1AQT A;  1FZB A;  1FHB A;  1KQG B;  3HE4 B;  1SQV K;  2IYP A;  5E79 V;  4IFD K;  3L72 D;  3L36 A;  2FYU D;  1H88 A;  1JNM A;  2A45 G;  3TYI A;  1VL2 A;  1KC8 Q;  4EYY Q;  1IK7 A;  1KYO H;  3KDP B;  1GW4 A;  3Q5R A;  3I5C A;  5KLV E;  1YIJ P;  1KOR A;  4M3L A;  1VQ8 P;  2ITA A;  2H8P D;  1W2E A;  2IDB A;  3D6Y A;  3MK7 C;  2QVA A;  5DF5 A;  1K04 A;  1GL2 B;  1M1K Q;  1JEK A;  5KKZ B;  5CCH D;  5AVU B;  4IFF A;  4EDF A;  3OAK A;  2FYN B;  2YKP A;  3L75 J;  1WVE C;  1G2C A;  2WWW A;  1SLQ A;  3HTK A;  1AOQ A;  2LR2 A;  1IJD B;  3P32 A;  4BRY B;  5APT A;  3TGU J;  1N73 C;  3A0H V;  1AQ5 A;  2HLO A;  3KHU A;  1IC2 A;  3PRJ A;  1N90 A;  3CME P;  1W5C E;  2JKV A;  1CTZ A;  3CXH E;  2IYO A;  1FE6 A;  2QJK B;  3AED C;  2M0B A;  3CCR P;  2QM8 A;  2B88 A;  3M0A A;  3GHG B;  3UIA A;  2N9Y B;  4H0J A;  3FXD A;  1FZC B;  5AVT B;  3WUV A;  2AIU A;  4EIF A;  1RF0 A;  3VOP A;  2MKV A;  1AVO A;  3L4M A;  2B87 B;  3BCC G;  4PW9 B;  2XZR A;  155C A;  1K8A Q;  1E29 A;  2Z4E A;  2M5A A;  1L0N E;  5AUR A;  1KQF B;  1L0N G;  3GF3 A;  1IZN B;  1A2S A;  1NTM E;  4L75 A;  4J20 A;  1NTM G;  1NOH A;  2VRS A;  3CLQ A;  2OYI C;  3OCD A;  1CTJ A;  1CCR A;  1JDL A;  1N8R Q;  1HCM A;  3JBT B;  4UB8 E;  2FRC A;  4WQD A;  1GIW A;  1GL2 D;  5APY A;  1FJP A;  2R5D A;  1CTY A;  1S4X A;  2XNX A;  3AE3 C;  2L5G B;  3M9Q A;  4JBZ A;  3D6Z A;  2H88 C;  1YJ9 P;  4JPZ B;  2WVR A;  1BE3 E;  1JUN A;  1BE3 G;  4RJT A;  2J58 A;  1RQV A;  2DGE A;  2C1D A;  5TJH A;  2W90 A;  2N1T A;  4AQR D;  451C A;  3ZOW A;  4K35 A;  4OVN F;  2W27 A;  1SQB J;  3II6 A;  2ZOO A;  1SQB D;  1NU1 J;  2Y9Y A;  4OWF A;  1NU1 D;  3WUI A;  2ZON G;  1VYD A;  1T2K D;  2FFD C;  2E76 C;  2QJP C;  1CSX A;  3O0R C;  2AXT E;  2KNC A;  1SQQ E;  2A45 I;  3Q3D A;  1CXC A;  1N50 A;  4WQB A;  1NYH A;  1Y47 A;  4W7Y A;  2GM4 A;  1PPJ E;  1PPJ G;  5CCG A;  1QVF O;  1M57 D;  1DVH A;  5L8R J;  3PXS A;  1L0L J;  3V5B A;  5KAI H;  1KIL E;  1L0L D;  1HJB A;  5KJ7 A;  2POH A;  2B9B A;  1KX7 A;  1IFD A;  1KYO D;  2QSI A;  2G8Y A;  1NTZ G;  3AE2 C;  1QL4 A;  1RZ6 A;  3A3Y B;  3H1J J;  1YQ4 C;  3H1J D;  3RL0 C;  1LT1 A;  3B5N A;  5CYT R;  1W5C T;  2OYH A;  1PP9 E;  1PP9 G;  2E5T A;  4RKU J;  1UII A;  1S9K D;  3BCC D;  2YIU B;  1K73 Q;  4FA5 A;  3W67 A;  4UB8 V;  5K5G B;  1RF0 C;  1VF5 B;  1IZL 0;  4AAM A;  3FGA D;  1W2B O;  1LFM A;  3KPE A;  5CCH C;  2GUV A;  1NMI A;  3L74 J;  1IFP A;  3L74 D;  3B71 A;  3KXD A;  3PLN A;  2I1J A;  5AVW B;  1E79 H;  4TT3 H;  1GK4 A;  1OIP A;  4GDO A;  2J59 M;  1KFM A;  1RZ5 A;  2B89 A;  3CX5 H;  5AVR B;  2BH4 X;  4FA9 A;  2D0S A;  1MFZ A;  4GKG A;  3CCE P;  4IFM A;  1CYC A;  3PH0 A;  1CI6 B;  2B11 B;  2AXT V;  3IAO A;  1LTA C;  3AE6 C;  1CHJ A;  2YO3 A;  1NGM B;  2C8S A;  1IK9 A;  2FYZ A;  1KQS O;  3E7K A;  4JYC A;  3L71 G;  2N1T C;  4WY4 C;  1VQO P;  2BGV X;  3P8C D;  1QKS A;  1JCD A;  1LT9 A;  4KT0 J;  1IRV A;  2M3B A;  3ZIY A;  1NTK E;  1RE4 C;  1SQP E;  1SQP G;  1FI7 A;  3RK3 C;  2E74 B;  3VTP C;  4EI2 A;  2Q5U A;  2BCN B;  5H2F H;  1NTZ J;  1NTZ D;  1J1E B;  1MZ9 A;  2HOD B;  2DVH A;  1YQ3 C;  1VF5 D;  5C9M A;  4H0L B;  5KKZ C;  2OQQ A;  1CED A;  3EFG A;  4FB1 A;  3NMD A;  3O1Y A;  2IFM A;  3HD7 A;  1KV9 A;  3BVH A;  1BSH A;  4Q5P A;  3Q5P A;  4QMA A;  1SFC A;  4U3F J;  1Z56 A;  4U3F D;  5KLI B;  1P84 H;  3A0B H;  1BL9 A;  1FI3 A;  2WSF H;  1F1F A;  3JCU H;  1HTL C;  4GOF A;  1C52 A;  1YYC A;  3TSI A;  1LTS C;  2H43 A;  3M97 X;  2GC7 D;  1EDK A;  4LJI A;  3SJL A;  1SQV J;  3AE1 C;  1SQV D;  3GHG C;  3ORV A;  1UIX A;  1GMJ A;  4O9B A;  5AVV B;  3N4X A;  1CRG A;  1I6D A;  3M0D C;  1EZV D;  1ZLL A;  2WZ7 A;  2AEM A;  1Q90 D;  2XTS B;  4O1Q A;  1HUC A;  2ZFC A;  4C46 A;  1VDF A;  2PFX A;  2D2C B;  1WEJ F;  3CPW O;  3HRN A;  2JQR A;  3CWB E;  5AVY B;  2BEQ D;  1NAF A;  1YIT P;  1LWU A;  1Q7Y Q;  1HVV A;  2HFE D;  3C1L A;  1NNO A;  2E74 D;  5APU A;  1J3S A;  1N7S A;  2W83 C;  2OTL P;  3H1H J;  1JO5 A;  3H1H D;  2OGU A;  3H1K E;  2N9J A;  3L73 J;  3L73 D;  5CJ4 A;  4DZO A;  4L3H A;  4H0L D;  1IFN A;  1CNO A;  2K9J A;  3FWN A;  1GZL A;  2RMZ A;  1COR A;  3MZW B;  1R0Q A;  2Q1K A;  5CBO A;  1CIF A;  3O8Z A;  1RAQ A;  2PCB B;  3E1R A;  2ZYA A;  2BEZ F;  1ZOY C;  2K3R A;  4PD4 E;  1LT9 C;  1EXI A;  2IFN A;  1BCC G;  2NRG A;  4ASW A;  2BCC E;  5E79 H;  3V2Q A;  1HGV A;  2WT7 B;  3S9O A;  1GU4 A;  3CL3 D;  2UWJ E;  1SQX E;  1L9B C;  4H13 B;  1L0N K;  1VQN P;  2C1V A;  1NTM K;  4JYB A;  2JDI H;  4W80 A;  1W2L A;  2PAC A;  3AEA C;  3CCU P;  1E8E A;  1JY2 P;  1Q2N A;  2YKO A;  4PJ0 E;  1YFC A;  3EWK A;  2Q7C A;  2ZAE B;  4JQ0 D;  2D2C D;  3V2N A;  4H44 B;  1CIG A;  1SFC C;  3CI9 A;  1YIQ A;  1BGY E;  1YJN P;  1BGY G;  5AW9 B;  4DJG A;  1LP1 A;  4WQ9 A;  2PRR A;  1GQ1 A;  3P8M C;  5AVX B;  1J1D C;  3Q5S A;  2KXP B;  4GOE A;  1X79 B;  2W6J H;  2CK3 H;  1U75 B;  1N86 A;  3ZOX A;  1VQL P;  3AEF C;  2KI7 B;  2H89 C;  1G2C B;  1VF5 C;  2WSF J;  1M8O B;  3AE5 C;  2YNY A;  1KB9 E;  2ZYD A;  3TNU A;  3VP8 A;  2NPS C;  2QG4 A;  2YKQ A;  3X39 A;  3DP5 A;  3L75 E;  1N7S C;  1PZQ A;  5KAF E;  3H32 B;  2BAS A;  3TGU E;  2ZT9 B;  4H13 D;  1CIH A;  2A45 H;  2GUS A;  2YXR B;  4AAO A;  1FZF A;  4PV1 B;  3IF4 A;  2BLF B;  1BCC D;  5DJQ B;  4IL6 E;  3U1C A;  3KQG A;  2QEX P;  5B5E H;  5B66 E;  4WVZ A;  3HQ6 A;  4XXL A;  1C7M A;  1FDI A;  4H44 D;  1S1C X;  2L91 A;  2QJY C;  3MGN A;  1XTC C;  1EDL A;  1ZXG A;  2JR8 A;  4PJ0 V;  1DW1 A;  4RES B;  3LW5 J;  1U74 B;  1AKK A;  1D7M A;  2ZYG A;  3OCD B;  5CHX A;  1URQ A;  3CP5 A;  4NPE A;  2C9X B;  1KIB A;  2WPQ A;  4B86 A;  1EXJ A;  1AYG A;  2RKL A;  3L72 J;  2FYU J;  1A56 A;  3RK3 E;  1JTH A;  1J1E C;  3QWO C;  1VQM P;  5AW3 B;  1K3H A;  3AE9 C;  1L4A B;  1DD3 A;  1YEB A;  4N6J A;  2FWL A;  5KLV G;  2B4Z A;  2FFD A;  3B8E B;  3WFB C;  3TF5 A;  1CSV A;  3A5T A;  2KLV A;  1KN7 A;  1JY3 P;  1CW5 A;  1FZA A;  2N18 C;  2ZVN B;  2KNC B;  1RF1 C;  2ZT9 D;  2O3J A;  1DT1 A;  3MHV A;  1I8P A;  2WQY C;  1SQB E;  2B0Z B;  3CC7 P;  5KAF V;  1NU1 E;  3OA8 A;  3AE7 C;  4PV1 D;  1LTJ C;  5CMZ A;  4HJG H;  4Y99 B;  2C0X A;  1SQP K;  2Y0D A;  1ZRT D;  3H25 A;  2MJZ A;  4GYD A;  4C7N B;  3RBX A;  1VQ7 P;  4IL6 V;  1I8O A;  5B66 V;  1L0L E;  1G1J A;  2ORL A;  2D2C C;  2OYH B;  2PAJ A;  1GD2 E;  1KB9 I;  2A06 E;  2EXV A;  5CCH A;  2A06 G;  1C2N A;  1RH5 B;  3H1J E;  5DJT B;  5CIB B;  1DH3 A;  4AUW A;  2O01 N;  3RN0 A;  1L4A D;  1C6S A;  4BXL A;  1HZV A;  4R4M A;  1S9K E;  2WTY A;  2AXT H; 
#chains in the Genus database with same CATH homology
 3HQ9 A;  1QL3 A;  4YE1 A;  1CYC A;  4FA4 A;  2B11 B;  2AXT V;  1CC5 A;  1YTC A;  2OZ1 A;  1CHJ A;  1YEA A;  1YCC A;  2C8S A;  1GJQ A;  1C75 A;  3NWV A;  4AAN A;  4P4Q B;  4AX3 A;  1MG3 D;  3O20 A;  2GB8 B;  4AAL A;  3H1I D;  2MHM A;  3CX5 D;  1ZZH A;  3GG2 A;  2LIR A;  2OZ1 B;  351C A;  4H0K A;  1CRC A;  2BGV X;  5C0Z A;  1HRC A;  3SVW A;  1QKS A;  1BGY D;  1IRV A;  3ZIY A;  3C2C A;  5CID B;  1FI7 A;  2C1D B;  4WQ8 A;  1FCD C;  2BCN B;  1NTZ D;  2N3Y A;  4XYD B;  3PXW A;  2DVH A;  3GW6 A;  1H31 A;  5C9M A;  1IQC A;  1LC2 A;  3RN1 A;  4L3G A;  1CED A;  1FJ0 A;  4QAO A;  2QJP B;  4EID A;  4FB1 A;  1NIR A;  3O1Y A;  3L70 D;  1KV9 A;  1QYZ A;  3VRD A;  3ZCF A;  4EIC A;  4Q5P A;  1HH7 A;  1KB9 D;  4U3F D;  3HQ7 A;  5KLI B;  5CIG B;  4D6T D;  1BL9 A;  1FI3 A;  2HV4 A;  1LS9 A;  3ZOY A;  3CWB D;  1QN2 A;  1F1F A;  3DR0 A;  3ZOO A;  3CYT I;  1C52 A;  3L75 D;  3M97 X;  3VYM A;  2GC7 D;  4LJI A;  3SJL A;  2I8F A;  1SQV D;  3VMA A;  3TGU D;  3ORV A;  1CHH A;  3H1K D;  1HJ3 A;  3RLM A;  1CRG A;  1L0N D;  1I6D A;  2L4D A;  1EZV D;  1NTM D;  1KB0 A;  1P84 D;  5CIF B;  4GED B;  1CHI A;  3O5C A;  1GU2 A;  1CXA A;  4JCG A;  2XTS B;  1OAE A;  4O1Q A;  1L9J C;  1WEJ F;  1EB7 A;  2JQR A;  4UB6 V;  4KMG A;  1H9X A;  1CCH A;  2YQB A;  3RMZ A;  2JWA A;  4RSZ A;  1HJ4 A;  4PD4 D;  3PTZ A;  1NNO A;  3NBS A;  1I5T A;  4NFG B;  1J3S A;  1GKS A;  3WU2 V;  1FI9 A;  5DJQ C;  2BCC D;  5CIC B;  3H1H D;  3PHL A;  1OCD A;  5GTI V;  1BE3 D;  2N9J A;  4FA1 A;  3L73 D;  4FAN A;  1YNR A;  1SQX D;  4L3H A;  1CNO A;  3A9F A;  5B6Q A;  1CO6 A;  2YCC A;  2RMZ A;  3CX5 W;  3KZI V;  1COR A;  1CYI A;  1DW3 A;  1R0Q A;  2KS1 A;  1CIF A;  4WQ7 A;  1RAQ A;  2PCB B;  1I55 A;  1IRW A;  1HRO A;  3VNW A;  5KLV D;  1CYJ A;  4V2K A;  2B12 B;  2CE1 A;  2AI5 A;  1KX2 A;  5B5E V;  5DFS A;  1PPJ D;  1I54 A;  3FWL A;  1CSU A;  1DW0 A;  1FHB A;  1H32 A;  2V08 A;  5E79 V;  1L9B C;  5CIE B;  3L72 D;  2FYU D;  2C1V A;  3TYI A;  1W2L A;  2CA3 B;  1AOF A;  1CRH A;  2PAC A;  2B10 B;  3CXH W;  2MTA C;  4WQE A;  1H32 B;  1E8E A;  1YFC A;  1PP9 D;  4FAV A;  1MZ4 A;  3MK7 C;  1H31 B;  3CXH D;  1CIG A;  2C1U A;  1YIQ A;  5DF5 A;  4DY9 A;  5KKZ B;  1F1C A;  4PWA A;  3ZBM A;  4EDF A;  4WQ9 A;  1GQ1 A;  2FYN B;  1WVE C;  2LIT A;  1CRI A;  1HJ5 A;  1A8C A;  2JTI B;  1RAP A;  3MK7 B;  1AOQ A;  2A06 D;  3PXT A;  1U75 B;  3A0H V;  4MU8 A;  1DII C;  3ZOX A;  1DW2 A;  1C2R A;  3KHU A;  3PRJ A;  1N90 A;  2N3B A;  3TDK A;  4A7P A;  1CTZ A;  4EIE A;  2Q3E A;  2QJK B;  1HZU A;  2N9Y B;  4H0J A;  2QG4 A;  3X39 A;  2AIU A;  1DVV A;  3DP5 A;  4EIF A;  2YK3 A;  2CA4 B;  3L4M A;  2N9I A;  1M60 A;  1H9Y A;  4PW9 B;  1NML A;  155C A;  1E29 A;  3DMI A;  1S6V B;  3L71 D;  1CIH A;  2CE0 A;  2Y0E A;  2Y0C A;  5AUR A;  1N15 A;  1A2S A;  2GIW A;  4J20 A;  4AAO A;  2ZZS 1;  1N9C A;  3SXT A;  2BLF B;  1BCC D;  5DJQ B;  4WQA A;  1I6E A;  3L4O A;  3OCD A;  3HQ6 A;  4XXL A;  1CTJ A;  1CCR A;  1JDL A;  1SQP D;  1C7M A;  1HCM A;  3JBT B;  2FRC A;  4L1Q A;  2L91 A;  5IY5 1;  4WQD A;  1LMS A;  2K9J B;  1GIW A;  2C2C A;  1SQQ D;  4PJ0 V;  1DW1 A;  1CTY A;  1DIQ C;  1U74 B;  1AKK A;  1C6O A;  3OCD B;  3CP5 A;  3WC8 A;  2C9X B;  2QJY B;  1KIB A;  4RJT A;  2DGE A;  2C1D A;  1AYG A;  5TJH A;  1E2R A;  1H1O A;  2RN0 A;  1A56 A;  451C A;  3ZOW A;  1K3G A;  2ZOO A;  1SQB D;  1K3H A;  1IO3 A;  1S5L V;  1NU1 D;  3WUI A;  2ZON G;  1VYD A;  1YEB A;  5GTH V;  1B7V A;  2FWL A;  1CSX A;  2B4Z A;  3O0R C;  1CXC A;  1N50 A;  4WQB A;  3ITK A;  3WFE C;  4N0K A;  3WFB C;  2ZBO A;  3TF5 A;  1CSV A;  3CU4 A;  1KYO W;  2GC4 D;  1DVH A;  3PXS A;  2N18 C;  5H2F V;  1L0L D;  2KNC B;  2VHD A;  1KX7 A;  1MG2 D;  1KYO D;  2O3J A;  1DT1 A;  5KAI V;  3WFC C;  1CSW A;  1QL4 A;  1RZ6 A;  3SLE A;  1I8P A;  2PCC B;  1H33 A;  3H1J D;  2B0Z B;  1CIE A;  5KAF V;  2N18 B;  5CYT R;  2D0W A;  3OA8 A;  1W5C T;  1FOC A;  5TIS V;  2Y0D A;  1ZRT D;  3A0B V;  1M70 A;  4GYD A;  1H33 B;  2BH5 X;  3BCC D;  3OA8 B;  2YIU B;  4IL6 V;  1I8O A;  4Y5R A;  4FA5 A;  5B66 V;  2ORL A;  1YIC A;  4UB8 V;  2V07 A;  3H1L D;  1IZL 0;  5EXQ A;  4AAM A;  2IBZ D;  4O1W A;  1LFM A;  3PH2 B;  2EXV A;  4K3I A;  1NMI A;  3HQ8 A;  2ZXY A;  3SWS A;  1C2N A;  1M6Z A;  3L74 D;  2CXB A;  1LC1 A;  3PLN A;  1ETP A;  5CIB B;  1COT A;  1C6R A;  3WFD C;  1CRJ A;  3RN0 A;  5CIH B;  1C6S A;  4WQC A;  1HZV A;  1RZ5 A;  1GDV A;  1NTK D;  2BH4 X;  3NBT A;  1CRY A;  2D0S A;  4FA9 A;  2BPB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...