5KKZB

Rhodobacter sphaeroides bc1 with famoxadone
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Cytochrome b
total genus 64
structure length 256
sequence length 256
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5kkzB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 5kkzB02
1CHIA 1JDLA 1EB7A 2CA3B 3OCDB 1IQCA 4PWAA 3M97X 3DMIA 1CRHA 2MTAC 3A0HV 1OAEA 4FANA 5KKZB 1CIGA 1QL3A 1KX2A 2BCCD 1BGYD 4WQ9A 1MZ4A 3ZOOA 3L72D 3ZOXA 2PCCB 1KX7A 3HQ7A 1EZVD 1AKKA 2D0SA 2D0WA 2YK3A 3CXHD 1FCDC 1HZUA 1CCHA 3L71D 3KZIV 5CICB 2V07A 4L3HA 1DVHA 5C9MA 4D6TD 4KMGA 2B4ZA 5EXQA 2FYNB 2A06D 3RN0A 3CWBD 3OCDA 3A0BV 1KB0A 1DW1A 4L3GA 1C2RA 1IRVA 2RN0A 4PW9B 5DJQB 1SQPD 2N9JA 2QG4A 2OZ1A 4FB1A 2C1UA 2Y0CA 1YCCA 1CO6A 3SLEA 4DY9A 3HQ8A 2GB8B 1RZ5A 1GQ1A 4YE1A 3PTZA 1J3SA 1GKSA 3PLNA 1NMLA 1KYOD 2ORLA 3ZOYA 1KB9D 1COTA 1NTZD 1QKSA 2CE0A 5TISV 1FOCA 1SQQD 3H1HD 1RAQA 3VRDA 2Q3EA 5E79V 1HJ3A 1CXCA 1H9YA 1IZL0 2AI5A 2CE1A 1QL4A 4UB8V 1FI7A 5AURA 3WFCC 3MK7B 1N15A 1FHBA 5DFSA 2LITA 1YICA 1CNOA 1R0QA 4FA4A 1HROA 3DP5A 3ZCFA 3SWSA 4EIEA 2HV4A 4WQBA 1I54A 1F1FA 3SJLA 1MG2D 4JCGA 2IBZD 4AAOA 2GC4D 3PXTA 2BPBB 4AANA 1C75A 2Y0EA 2JTIB 3CX5D 3H1LD 1SQXD 4WQDA 3ZIYA 1CHJA 1YEBA 2GIWA 1DW0A 2C8SA 2QJPB 4RSZA 1S5LV 1H33A 4AX3A 1YNRA 2CXBA 5KLVD 4O1WA 1CIHA 4WQ7A 4FA5A 2EXVA 3TGUD 4MU8A 1CSUA 1I8PA 3KHUA 1FJ0A 3PH2B 5C0ZA 1HH7A 3NBTA 3FWLA 1A56A 1ETPA 1C6OA 1WVEC 3L73D 1CCRA 4V2KA 2N18C 1E29A 1CHHA 1KIBA 3H1ID 1HZVA 1M60A 3WUIA 1E8EA 3HQ6A 1W5CT 4QAOA 2ZOOA 2BH4X 2B11B 2OZ1B 3H1KD 3TYIA 3CU4A 2BGVX 3GW6A 5KAFV 2YIUB 5B66V 1A2SA 5CIFB 4J20A 1CIFA 1RZ6A 2B0ZB 2QJKB 3L4OA 1C6SA 2C1DB 5B6QA 4AAMA 3L74D 1LC2A 2FRCA 4EICA 1PPJD 2CA4B 4AALA 2XTSB 3CP5A 5CIGB 2ZXYA 3O20A 1AYGA 2QJYB 1LFMA 3O1YA 1CSWA 1GIWA 1HJ5A 2LIRA 1H31B 1BE3D 1H31A 2DVHA 3WU2V 1GDVA 5CYTR 1DT1A 4U3FD 2BH5X 1VYDA 4GEDB 4EIFA 3PHLA 1N50A 3DR0A 1I55A 4EIDA 4PD4D 1C7MA 4XYDB 1LS9A 1L9JC 2N18B 1U74B 5KAIV 1N9CA 1H1OA 1FI3A 1ZZHA 1CSVA 1CTZA 2BLFB 2I8FA 2K9JB 5KLIB 1AOFA 2GC7D 1L9BC 2FYUD 3OA8B 5DJQC 4A7PA 155CA 1I8OA 1L0LD 3L4MA 451CA 1W2LA 1NTMD 1YFCA 1FI9A 1CXAA 5TJHA 2O3JA 1LC1A 2N3BA 2N3YA 2C9XB 4FA9A 4GYDA 2YQBA 2B10B 4RJTA 3RMZA 3SXTA 1U75B 1C52A 1CIEA 1OCDA 2KNCB 1H9XA 5H2FV 1DIQC 1GU2A 1KV9A 3CX5W 4EDFA 5CIDB 1M70A 5CIBB 3C2CA 3L70D 1NNOA 1K3HA 1DVVA 1N90A 3MK7C 3VYMA 1CRCA 1CTYA 2L4DA 1CTJA 4P4QB 4PJ0V 3WFDC 1SQBD 3RLMA 5B5EV 1NU1D 4WQEA 3ORVA 3ITKA 4XXLA 5IY51 3X39A 1YIQA 4H0KA 1I5TA 1CYJA 3CYTI 3ZOWA 1AOQA 2JQRA 2FWLA 2VHDA 4UB6V 2AXTV 1C6RA 1DIIC 1F1CA 1HRCA 1PP9D 2JWAA 2AIUA 4H0JA 1DW2A 3RN1A 3WC8A 1C2NA 2YCCA 1B7VA 1CEDA 1IO3A 2ZZS1 1CRJA 3NWVA 3PXWA 1K3GA 2MHMA 1I6DA 3CXHW 5CIEB 4Q5PA 1HJ4A 1S6VB 1YEAA 1H32B 4K3IA 3ZBMA 2B12B 3VMAA 1H32A 1HCMA 5DF5A 3JBTB 2N9IA 4WQCA 4WQ8A 2RMZA 1CYCA 4L1QA 3OA8A 3VNWA 1RAPA 1DW3A 1QN2A 5GTIV 3TDKA 2PCBB 1KYOW 4N0KA 2Y0DA 1IRWA 1L0ND 3BCCD 1BL9A 1MG3D 1GJQA 3H1JD 1CYIA 4NFGB 1CRGA 3O5CA 1CRIA 3GG2A 1CC5A 2C1VA 2BCNB 1CORA 1H33B 1YTCA 3WFBC 5CIHB 2N9YB 1NIRA 4WQAA 3PRJA 2C2CA 3HQ9A 1QYZA 2DGEA 1NTKD 3A9FA 1M6ZA 4O1QA 4FAVA 5GTHV 1P84D 2ZONG 2L91A 1SQVD 3L75D 3PXSA 3NBSA 4LJIA 3WFEC 1A8CA 2V08A 2C1DA 2KS1A 1WEJF 3O0RC 3TF5A 4IL6V 1BCCD 3SVWA 4FA1A 1CRYA 1E2RA 1ZRTD 1CSXA 1NMIA 2PACA 2ZBOA 351CA 4Y5RA 1I6EA 1LMSA
chains in the Genus database with same CATH superfamily
2N1TC 5APSA 2CA3B 3L4FA 3OCDB 5CJ0A 3M97X 1L0NG 3A0HV 1P84I 1PL5A 1ZXGA 1N86A 4H0LD 1PIXA 5CJ4A 3OAKA 1QL3A 1SQBJ 2QM8A 1USDA 1MZ4A 1QX8A 1VPCA 2W83C 2PCCB 2I1KA 3Q2YA 3OJAB 1AKKA 4WY4D 4PD4I 1KILE 1ZLLA 2D0SA 1GL2A 4H44B 2IFNA 1PGPA 3FGAD 4I7ZC 1G1JA 5DJUB 2B4ZA 2FYNB 1DD3A 1OZHA 2A06D 2J58A 3CWBD 3H1IE 1W2EA 1IC2A 1KB0A 1C2RA 3Q5RA 1L4AB 2AEMA 1KQSO 1IK7A 2H8PD 3WMM0 1SQPD 1G2CA 4O9BA 4BWNA 1Q86Q 2OZ1A 3KDPB 4XE5B 1EQ7A 1NTKG 2C1UA 1MKMA 1NTKE 1YCCA 1LGHB 3HQ8A 2GB8B 4OGQD 1GQ1A 3GLMA 3PLNA 1JOCA 4L73A 1FZCA 1IZNB 1KB9D 1DD4A 1QKSA 2WVRA 1SQQD 3H1HD 4JF7A 1RAQA 2Q3EA 5AVXB 4OGQC 2M0BA 2ZAEB 1CXCA 1NTZJ 2CE1A 1KMIZ 1QL4A 1VQKP 3MK7B 1NTZG 2LITA 3VYIA 1YICA 4JBZA 1DIPA 1HROA 1FJPA 1U57A 2HV4A 1YQ3C 2ZJSE 4GOEA 4WQBA 3SJLA 1F1FA 1N73B 2JDIH 2ZXXA 1KB9I 4AANA 3MIWA 1CI6B 3L71J 1KYOE 3H1LD 3ZIYA 3B8EB 4WWIA 2IZ1A 2BEZF 3T97B 1YEBA 2GIWA 1BGYJ 1GK4A 2KYVA 1S5LV 3I5CA 2ZVOB 3LIEA 2OYHA 4L75A 1D7MA 3N7NA 1N7LA 3TGUD 1FZEA 2KLUA 3KHUA 1AV1A 1FJ0A 2E74C 3BCCE 4H13C 3VMXA 3NBTA 1A56A 1EXIA 3KQGA 1CCRA 2LXBA 2R5DA 3GHGC 1LT9C 1KIBA 1VQ6P 3WUIA 1R5LA 3CCQP 2H43A 1W5CT 1IJDB 2NPSA 3H1LG 3H1KD 1SQPK 2ZYGA 2I1JA 1R5SA 2QJPC 4U3FG 3A2AA 3LIDA 1A2SA 2R3SA 4H0LC 3RGUA 2WT7B 1CIFA 2Q9IA 3VOPA 1M90Q 4WBAA 3QWOC 1ZRTE 4AALA 2CA4B 3CP5A 2IDBA 4C46A 4MN4C 3RK3D 3HD7D 1RF0A 1BE3D 2WZ7A 2DVHA 5L8RJ 1OW6A 2B87B 1OX3A 1VYDA 1I55A 4EIDA 4PJ0E 5CCGA 2QA4P 1KB9H 1C7MA 1QGKB 4OWFA 3GHGB 2JEEA 1KQFB 1DEEG 3O8ZA 1N9CA 4EOTA 1TU3F 2QEXP 1ZZHA 1CSVA 1PPJE 5B66H 2I8FA 5KLIB 1H0TA 3S1KA 5DJQC 155CA 2IBZI 5APWA 5TISH 1NTMD 3C9IA 2R3CA 2WQYC 5TJHA 1GW4A 2O3JA 4ZKUA 2FFDB 5AW3B 2N3BA 4FA9A 2YQBA 2B10B 3RMZA 1C52A 2WTYA 2K9JA 1OCDA 1L4AA 1DIQC 1N73C 1GU2A 1HUCA 4EDFA 2QSIA 1BSHA 3C2CA 2E75D 1P84E 3GF7A 1NNOA 1LWUA 1DVVA 3U59A 1S9KE 3MK7C 4DOJA 3V4WA 3L72E 1CTYA 1HWTC 4H44D 1M56D 2ZT9D 2NPSB 4WQEA 3B5NC 3X39A 5KKZC 2XNXA 3L73E 1W5CE 1I5TA 1HRCA 1PP9D 2FYUJ 2B89A 2PFXA 1GD2E 4H0JA 1WT6A 1FZFA 1A02F 2LKMA 2ZZS1 3MUDA 1FC2C 1RHZB 4GDOA 3H32B 2MHMA 1Y8AA 4AUWA 4Y28J 2OYIA 1HJ4A 3T97A 4K3IA 3ZBMA 1H32A 3JBTB 3AE2C 2N9IA 1KILA 5CCGC 1YITP 4I6MC 1FU1A 3UIAA 1YIJP 1T2KD 2Z5IA 3D6YA 3N4XA 5KLVK 1YJNP 2E75C 4N0KA 1JTHB 1IRWA 3IFMA 1JEKA 5GTIE 2YMYA 1SFCB 1CRGA 2AEJA 2XU6A 1NH4A 3KYQA 5H2FH 2L5GB 1CRIA 1CI6A 1K04A 1CC5A 2C1VA 1CORA 3VTPC 2NRGA 3PRJA 2PP6A 1NTKD 1FE6A 3AE4C 3E1IA 3AE9C 1JO5A 2N1TB 1RF1C 1SQVD 2XKMA 5CMZA 1N7SC 1AVOA 3RBXA 1SQXK 1S5LX 4IL6H 1NTMG 4IL6V 1SQQE 3H1HE 4RO0A 4FA1A 1AA0A 1M1JB 1E2RA 2M5AB 2WPRA 2PACA 4ZKPA 1KD1Q 1I6EA 1LMSA 2RH0A 1YBKA 4N78E 1JDLA 3L70J 3CMAP 3K5BA 1IQCA 2MTAC 1OAEA 2FYZA 3M0DA 3CC2P 2ZT9B 1KX2A 2BCCD 3ZOXA 3I55P 3EFFK 1VF5B 1LTIC 5AW4B 3CXHD 1FCDC 3H1JJ 2Y9YA 1PZQA 4LGDE 1FDOA 2UWJE 3L71D 5AVRB 1URQB 1GL2D 2V07A 1GW3A 4KMGA 1LT1A 2OYHC 1L0LK 3TK1A 4TT3H 4LLHA 1L0LG 1NKNA 3S4RA 1RF1A 3IF4A 3OCDA 3HE5A 3A0BH 1IRVA 5AVZB 1LTAC 5KAIE 1LTSC 1S5LE 2RN0A 2M3EA 4FB1A 5AW1B 4BXLA 5APUA 1FAVA 2I8DA 1NTKK 3SLEA 2B88A 1ZN5A 4OVNF 3II6A 1ZR4A 3PTZA 1J3SA 4HJGH 3P8MC 1GKSA 3VMZA 3WUTA 1GL2C 1DH3A 1IFMA 3ZOYA 1NTZD 2FFDC 1JY3O 1HJ3A 1H9YA 2AI5A 2FYUK 4H0LB 3CPWO 1FI7A 5AURA 3V5BA 1LTBC 1N15A 5DFSA 1FZCB 2OTJP 3H1JG 3HUSB 1KTMA 3SWSA 5APXA 3CLQA 4HYTB 5BU5A 2G8YA 5KJ7D 3G71P 1EC5A 1N7SD 2JWDA 4JCGA 4JQ0D 3AECC 1PPJG 1YTZI 2WMMA 1BGYE 2BPBB 1SVFA 5APYA 1SQPG 3CX5D 1SQXD 4WQDA 1H88A 5AW2B 3AE5C 3L70G 2NZ2A 3FXDA 4RSZA 4WY4B 1SQVG 2P1JA 1H33A 4AX3A 2CXBA 5CCHC 2XZRA 1JM0A 4O1WA 1EDJA 4WQ7A 4FA5A 2EXVA 3MD0A 4GOFA 4QMAA 1QVFO 1HH7A 3A5TA 1C6OA 3BRVB 2N18C 1E29A 1GL2B 4W7ZA 1LWUC 4GODA 1M60A 3D6ZA 1E8EA 3CX5I 3JSVC 3HUSA 1OFCX 2E76D 2YNYA 4WY4C 2E5YA 1OXZA 1URQD 1S9KD 4U7JA 5KAFV 1SQVK 3L75E 4DZOA 3LW5J 2FBWC 4I2LC 2QJYC 1MFZA 5CIFB 4C7NA 1BCCJ 1FDMA 4OGQB 2B0ZB 2QJKB 3L4OA 1A02J 2GA1A 3L74D 1LC2A 3FWNA 1EDLA 2FRCA 1FBMA 4W7YA 5B5EH 3W68A 3NXSA 1AYGA 1LFMA 2VRSA 2FYUG 1CSWA 1GIWA 1FDIA 1NTMK 2YO2A 3WU2V 4KJMA 2HFED 1U7JA 1OWAA 4U3FD 3AE7C 4EIFA 1E5WA 2D2CC 3DR0A 1WRGA 2OYOA 3TNUB 3A3YB 4PD4D 2KI7B 3AEFC 1S3JA 5AVWB 1BGYG 1L9JC 1KILD 2H88C 3D0WA 3AE6C 2FYNC 5KAIV 3S9OA 2OTKE 2BASA 4I7ZB 4CPGA 1URQA 2YKOA 1L9BC 3GF3A 4A7PA 3RK2C 1W2LA 3O6QB 1KILC 1YTZT 1FI9A 1J2JB 4UB8H 4DT0A 2C9XB 2W6AA 1U75B 1IFNA 2C0WA 2D2CD 1CIEA 2KNCB 2QIWA 3NFQA 4HB1A 5KAFE 4L74A 1LTJC 3CX5W 5KJ7A 1M70A 5CIBB 1YI2P 3Q3DA 1H89A 4PV1C 1K3HA 4TLFA 1IFJA 3VYMA 5AW6B 1CRCA 1QEXA 1HJ0A 1L4AC 1AJYA 2Q7CA 1KB9E 1NTKJ 3TGUE 1SQBD 2AXTE 1HVVA 1J1EC 2Q5UA 1NU1D 2OTLP 5IY51 1KFNA 2R32A 1X0TA 1N7SA 4N78D 3MP7B 1YJWP 3WU2E 1X79B 2JQRA 2FWLA 4UB6V 3U1CA 1AQTA 1VL2A 1MZ9A 3RN1A 1C2NA 1J1EB 3L70E 1T8ZA 1IO3A 1CRJA 3PXWA 1K3GA 1RF1B 1YEAA 1RE3A 4NPFX 4PV1B 1MV8A 2B12B 5APQA 1HCMA 5KLVJ 4WQCA 1K73Q 2RMZA 3OA8A 1LTJB 3BCCJ 4BRYA 3G6EP 1QN2A 3RK3E 5GTIV 3TDKA 5KLVE 2KSEA 2PCBB 1KYOW 2IFMA 3BCCD 1UIXA 1BL9A 3H1JD 4UB6E 3B5NB 4NFGB 1GDTA 3P32A 2W6JH 1PFIA 2V4HA 1L0LJ 4KT0J 1KILB 1NHLA 3VP9A 3WFBC 3RK2B 1USEA 1NIRA 1FZBA 4DCKA 2V7QJ 3AE3C 2PRRA 4Z1MH 1K8AQ 3CWBJ 3HQ9A 2NPSD 3A9FA 2OQQA 3AEDC 3GMAA 2IBZE 2ZONG 3CCEP 1SQPJ 2E74D 2AEFA 5KAIH 1JY2O 2G3AA 2W90A 3O0RC 3TF5A 1OIPA 2D2CB 3RL0B 1EXJA 2MKVA 2XNDH 3CCSP 2Q3IA 4Y5RA 1LP1A 3V2NA 3VMYA 2J59M 4PWAA 1BSNA 3BCCG 5KKZB 3A0HH 2KB7P 1OMIA 2ZYAA 3L71G 1BCCG 3O6QA 1BGYD 4D6TG 3L72D 1KX7A 3F5HA 3HQ7A 2FFDA 2ZVNB 5APVA 1KZUB 1SQBK 2N1TA 3V2RA 2WWWA 2D0WA 2YK3A 2KK7A 3OA7A 1HZUA 1GZLA 1HH0A 4L3HA 1DVHA 5C9MA 1PGJA 2IYPA 4XA4A 4D6TD 1L0LE 2R44A 3C8VA 1KYOI 2E5TA 1EZVG 1LJ2A 1U7MA 1G1IA 1OW8A 1DW1A 3M9QA 1QL2A 4EIJA 3MZWB 3AEBC 5DJQB 3KXDA 3L75J 2N9JA 2ZYDA 5DJTB 2A45I 1RH5B 3RK2D 1CO6A 2KUBA 4RKUJ 3CWBG 3P7KA 4AQRD 3H1KJ 1KYOD 2KXPB 3H1LE 1LT9B 2ORLA 1COTA 2CE0A 1OW7A 5TISV 3Q5SA 4H13B 1BCCE 3VRDA 2E74B 5GTIH 4N6JA 5E79V 5E79H 1LP1B 2P58A 1IZL0 3I56P 2FYUE 4YPCA 5AW9B 3SWYA 2Y9ZA 5KTBA 3NTNA 1HJBA 4OH8B 1IK9A 1CNOA 1Q82Q 2KNCA 4FA4A 3DP5A 3ZCFA 3CMEP 3MUDC 3CXHH 5B66E 4Y99B 1ZMEC 1MG2D 1BE3J 2R5BA 4LC1A 3CCLP 2Y0EA 2K9YA 2XV5A 2JJLA 3IAOA 3SFDC 1EZVE 1EDKA 2QJPB 1NGMB 4PJ0H 3L75G 1JY3N 2A45H 1S5LH 4N3YB 1XTCC 3IN6A 4K3AA 3HE4A 1T3UA 2O1KA 3TNUA 1W2BO 3CC4P 4I1LA 4MU8A 2P67A 2MJZA 1CSUA 2BCCJ 5C0ZA 2KP8A 1L0NE 3RK3B 3FWLA 1ETPA 1WVEC 4ZNCA 2Q6QA 1OVRA 2JKVA 1JMMA 2K3RA 2OYHB 3CCVP 3HQ6A 5KJ7C 1VQNP 4QAOA 2BH4X 3L37A 2WITA 3CCRP 5KLVG 3A7OA 3CU4A 2FXOA 1SQQG 3H1HG 2BGVX 2YIUB 1SQVE 3HE5B 1VF5C 1SQQJ 1T6AA 3H1HJ 1CW5A 5CCHD 4J20A 2YMKA 1RZ6A 1C6SA 1H0TB 5B6QA 1KORA 4AAMA 2C0XA 2M3BA 5CBOA 2KSJA 2CPBA 2KZIA 4EYYQ 4EICA 3E7KA 4WB4A 1PPJD 1R8EA 5CIGB 3D71A 2ZXYA 2YXQB 2C9LY 3O20A 1JCCA 5AVVB 3O1YA 1HJ5A 2LIRA 1NTME 1HGZA 1S2EA 4DJGA 5CYTR 1DT1A 2LR2A 1YJ9P 5EFWB 1KQLA 4GEDB 1N50A 2ZFCA 1SP4A 3P8CD 2QM7A 4XYDB 4GIFA 1N7SB 3KPEA 1BE3G 1RE4A 2A06G 1P84H 2HODB 3Q5PA 1IFDA 1LT9A 1CTZA 2BLFB 3L71E 3F89A 1AOFA 4C7RA 1GMJA 2O01J 3U1AA 3L4MA 3CCMP 2N9BA 4UB6H 1NU1K 1ZW0A 1NU1G 3AEAC 2N3YA 1HGVA 1VQOP 1SFCC 2IYOA 2WSEH 1PP9J 1H9XA 5CBNA 3HRNA 5AVQB 1UIIA 3H1KG 1KV9A 3HD7B 1L2PA 3EWKA 4H44C 1M1JC 2FY8A 2L4DA 4PJ0V 1NTZE 1JNMA 5B5EV 1LTJA 3TGUG 1N73A 1VQPP 3ITKA 2WPSA 1Q90D 1ZOYC 4H0KA 1CYJA 1KC8Q 1EDIA 3CYTI 3RL0g 2OYIB 1AOQA 1X22A 4C7NB 1QLED 1HF9A 5AW0B 5B5EE 1C6RA 2J5UA 1DIIC 2A06E 2JWAA 2AIUA 1KFMA 1J1DC 1KYOH 2YCCA 1RF0C 1B7VA 2WPVB 3HE4B 3ABVC 3CI9A 2P10A 2E75B 2HPCB 5CIEB 3SWKA 1SQBG 2LXCB 1S6VB 3V2QA 1H32B 3VP8A 4ZMDA 4PD4H 4D6TJ 5DF5A 1T2KC 2H89C 3VNWA 3L73G 1AVYA 1S1CX 2Z5HA 1DW3A 4D6TE 1WMKA 1VDFA 3FXEA 1VQ5P 4JYBA 1MG3D 5M1BA 1CYIA 4U3FE 2YO3A 1JMBA 3GG2A 2H7HA 2M8RA 2XDJA 2BCNB 1H33B 5CIHB 4WQAA 3AEEC 4IL6E 1L4AD 5KLIC 2C2CA 1JCDA 1MFTA 3H1KE 1QVGO 3C1LA 1SLQA 1Y9BA 2W27A 1NYHA 5GTHH 5GTHV 2P7JA 2L91A 3PXSA 3NBSA 4LJIA 4WY4A 3WFEC 2NPSC 2QJKC 1A8CA 2C1DA 1HTLC 3G9RA 2K88A 1S4XA 3B4SA 4GT1A 1JY3P 3M0DC 5AW8B 1YQ4C 1BCCD 3SVWA 3CXHE 1CRYA 2P2UA 1JTHA 1M1JA 1ZRTD 1MUUA 1EZVI 3H1LJ 1ZR2A 351CA 3TYYA 2AXCA 1CHIA 1EB7A 5AW5B 1BE3E 3L73J 3DMIA 1CRHA 4FANA 5CCGD 1VQMP 1CIGA 3L35A 3LW5H 1Y47A 3AE8C 1LTTC 4WQ9A 3CX5H 3ZOOA 3L72G 3WUVA 1NO4A 3H25A 2DW3A 3NMDA 1J1DB 1EZVD 1SQBE 3BRTB 3A0HE 1FZAA 3BATA 1Z56A 4IL6X 3MHVA 2OYIC 1M57D 1CCHA 3KZIV 5CICB 3V2PA 3V4QA 1K05A 2N1TD 3H32A 5EXQA 3AE1C 3JCUH 1RY3A 5BU8B 3RN0A 2JO1A 5APTA 2HODA 3A0BV 4L3GA 2BCCE 3TSIA 2W8ZA 1FZCC 4PW9B 1SQVJ 2CK3H 3CXHI 2QG4A 3W67A 2OARA 3ZDMA 2Y0CA 1VQ4P 1RE3C 4DY9A 1SQXJ 2YXRB 5C39A 2KZJA 1FS0E 2HYNA 1RZ5A 4YE1A 2QRXA 1YHQP 2O1JA 2WSEJ 2WPQA 1NMLA 2QE7H 1N2DC 1HBWA 3CX5E 2OGUA 3BASA 3M0AA 3MGNA 3WUUA 2ITAA 3L72J 1FOCA 2M5AA 1S72P 1NVOA 1VF5D 4HH2A 1DEBA 4IFDK 3B5NA 5E79E 4UB8V 3R4YA 3WFCC 1FHBA 1RQUA 2YIUC 5AVUB 1R0QA 4EIEA 4BRYB 4WVZA 1NTMJ 4R4MA 1I54A 2PAJA 3P8CE 3CCJP 2IBZD 2E76B 4AAOA 2HLOA 2GC4D 3PXTA 1OVVA 1ZP0C 1C75A 1OVUA 3D70A 4AYCA 1URQC 1M8OB 1SQXG 2E43A 2JTIB 1X8YA 3RK3C 1VQLP 5GTHE 1CHJA 4IFFA 1DW0A 2C8SA 4W80A 3SWFA 2K1AA 3L74J 1IFIA 1YNRA 1M1KQ 2POHA 1NKZB 1VQ9P 5KLVD 5CCHA 1FZGA 1CIHA 4GKGA 1SS1A 3L74E 3H1JE 1I8PA 1CZQA 1SFCA 3JCUE 2CPSA 3PH2B 3M9BA 1L0NK 5AVYB 1JY2N 2KOGA 3L73D 4V2KA 3EFGA 2PGDA 1CHHA 2FXPA 3H1ID 3CWBE 2WT7A 1HZVA 1PV3A 1NU1J 1VQ8P 3CD6P 2ZOOA 2B11B 4K35A 2OZ1B 3BVHA 3H1IJ 4Y99C 1G2CB 3CC7P 3TYIA 1PP9E 1XTGB 1SQPE 1Q7YQ 3GW6A 4PD4E 2JP3A 5KAFH 5B66V 4JPZB 2GM4A 1NWQA 1YYCA 1ZV8A 3G3ZA 2E76C 2C1DB 2KIKA 1DX7A 3R2PA 1NAFA 4UB8E 3KZIH 3L36A 2HG5D 2SPZA 2XTSB 3PJSK 1Q2NA 1N8RQ 4H13D 2V7QH 1BDDA 1CSBA 2QJYB 3B71A 2A45G 1H31B 1PGQA 1H31A 4NPDA 3WU2H 3M06A 1GDVA 3G4SP 1GU4A 1T3JA 2BH5X 2BEQD 2YKQA 3PHLA 4ASVA 3RBZA 1JUNA 2O01H 1E79H 1LS9A 1LWUB 2N18B 1U74B 1M7LA 2GUSA 2WSFJ 1IFPA 1H1OA 3V6IA 1FI3A 3CCUP 2C9NY 3EQ2A 3PH0A 2IPPA 3OW2O 1PGOA 1AFOA 4KHXA 2IZ0A 3E1RA 2BCCG 2HR3A 2K9JB 2GC7D 2FYUD 3OA8B 1I8OA 1L0LD 451CA 5H2FE 1YFCA 1CXAA 1NU1E 2FKWB 3KZIE 1LC1A 4IFMA 4RJTA 4GYDA 4XFJA 1K9MQ 3SXTA 1KQGB 1Q81Q 3JC22 4U3FJ 5H2FV 2KLVA 1SFCD 3HTKA 2WSCH 2K37A 5CIDB 3HD7A 2YKPA 3Q1MA 3HUSC 3GHGA 3L70D 3H1IG 1N90A 4ASWA 3B5ND 1GU5A 1AQ5A 1RE4C 1CTJA 4P4QB 2WSSH 1NTZK 2GUVA 3WFDC 3RLMA 1JB0J 3ORVA 4XXLA 1YIQA 2JR8A 1GTWA 2Q1KA 1X9VA 1JY2P 3USSA 3SSUA 1KN7A 3ZOWA 4YTPC 2VHDA 3PP5A 2AXTV 3M91A 2AXTH 1F1CA 2B87A 1FJKA 4B86A 2O01N 1QL1A 2WSFH 1DW2A 3WC8A 4R4LA 4RESB 1CEDA 5AVTB 3AEGC 3NWVA 5AVSB 2RKLA 1I6DA 3CXHW 2ZXEB 2B9BA 4Q5PA 1FOSF 3VMAA 1VQ7P 1LTGC 3FX0A 5K5GB 1KV4A 4WQ8A 1CYCA 4L1QA 2IBZG 1BDCA 1RAPA 3SFEC 3IR9A 1L0NJ 5AW7B 5BVZA 3RL0D 5CHXA 1RQVA 2HPCA 3CL3D 1PP9G 2Y0DA 1L0ND 1NAYA 1IO4A 1NJIQ 1GJQA 4NPEA 3RL0C 3O5CA 4YXDC 5TISE 3MTUE 4JYCA 1GK6A 4IOIH 1YTCA 1NOHA 2N9YB 2W6BA 1FOSE 4EI2A 1LNQA 2Z4EA 2ZT9C 3VN0A 3HTKB 3L74G 3H6PA 1QYZA 2DGEA 2FXMA 3HD7C 1M6ZA 2QVAA 4O1QA 4FAVA 1P84D 4YXWH 4PV1D 3L75D 3QH9A 2E42A 2V08A 2KS1A 3A0BE 2KS1B 1WEJF 1SQXE 1SQQK 4L76A 2IX7C 1CSXA 2WSCJ 4HKZH 1H8AA 3TGUJ 1NMIA 3M9HA 2ZBOA 4M3LA
chains in the Genus database with same CATH topology
1CHIA 1JDLA 1EB7A 2CA3B 3OCDB 1IQCA 4PWAA 3M97X 3DMIA 1CRHA 2MTAC 3A0HV 1OAEA 4FANA 5KKZB 1CIGA 1QL3A 1KX2A 2BCCD 1BGYD 4WQ9A 1MZ4A 3ZOOA 3L72D 3ZOXA 2PCCB 1KX7A 3HQ7A 1EZVD 1AKKA 2D0SA 2D0WA 2YK3A 3CXHD 1FCDC 1HZUA 1CCHA 3L71D 3KZIV 5CICB 2V07A 4L3HA 1DVHA 5C9MA 4D6TD 4KMGA 2B4ZA 5EXQA 2FYNB 2A06D 3RN0A 3CWBD 3OCDA 3A0BV 1KB0A 1DW1A 4L3GA 1C2RA 1IRVA 2RN0A 4PW9B 5DJQB 1SQPD 2N9JA 2QG4A 2OZ1A 4FB1A 2C1UA 2Y0CA 1YCCA 1CO6A 3SLEA 4DY9A 3HQ8A 2GB8B 1RZ5A 1GQ1A 4YE1A 3PTZA 1J3SA 1GKSA 3PLNA 1NMLA 1KYOD 2ORLA 3ZOYA 1KB9D 1COTA 1NTZD 1QKSA 2CE0A 5TISV 1FOCA 1SQQD 3H1HD 1RAQA 3VRDA 2Q3EA 5E79V 1HJ3A 1CXCA 1H9YA 1IZL0 2AI5A 2CE1A 1QL4A 4UB8V 1FI7A 5AURA 3WFCC 3MK7B 1N15A 1FHBA 5DFSA 2LITA 1YICA 1CNOA 1R0QA 4FA4A 1HROA 3DP5A 3ZCFA 3SWSA 4EIEA 2HV4A 4WQBA 1I54A 1F1FA 3SJLA 1MG2D 4JCGA 2IBZD 4AAOA 2GC4D 3PXTA 2BPBB 4AANA 1C75A 2Y0EA 2JTIB 3CX5D 3H1LD 1SQXD 4WQDA 3ZIYA 1CHJA 1YEBA 2GIWA 1DW0A 2C8SA 2QJPB 4RSZA 1S5LV 1H33A 4AX3A 1YNRA 2CXBA 5KLVD 4O1WA 1CIHA 4WQ7A 4FA5A 2EXVA 3TGUD 4MU8A 1CSUA 1I8PA 3KHUA 1FJ0A 3PH2B 5C0ZA 1HH7A 3NBTA 3FWLA 1A56A 1ETPA 1C6OA 1WVEC 3L73D 1CCRA 4V2KA 2N18C 1E29A 1CHHA 1KIBA 3H1ID 1HZVA 1M60A 3WUIA 1E8EA 3HQ6A 1W5CT 4QAOA 2ZOOA 2BH4X 2B11B 2OZ1B 3H1KD 3TYIA 3CU4A 2BGVX 3GW6A 5KAFV 2YIUB 5B66V 1A2SA 5CIFB 4J20A 1CIFA 1RZ6A 2B0ZB 2QJKB 3L4OA 1C6SA 2C1DB 5B6QA 4AAMA 3L74D 1LC2A 2FRCA 4EICA 1PPJD 2CA4B 4AALA 2XTSB 3CP5A 5CIGB 2ZXYA 3O20A 1AYGA 2QJYB 1LFMA 3O1YA 1CSWA 1GIWA 1HJ5A 2LIRA 1H31B 1BE3D 1H31A 2DVHA 3WU2V 1GDVA 5CYTR 1DT1A 4U3FD 2BH5X 1VYDA 4GEDB 4EIFA 3PHLA 1N50A 3DR0A 1I55A 4EIDA 4PD4D 1C7MA 4XYDB 1LS9A 1L9JC 2N18B 1U74B 5KAIV 1N9CA 1H1OA 1FI3A 1ZZHA 1CSVA 1CTZA 2BLFB 2I8FA 2K9JB 5KLIB 1AOFA 2GC7D 1L9BC 2FYUD 3OA8B 5DJQC 4A7PA 155CA 1I8OA 1L0LD 3L4MA 451CA 1W2LA 1NTMD 1YFCA 1FI9A 1CXAA 5TJHA 2O3JA 1LC1A 2N3BA 2N3YA 2C9XB 4FA9A 4GYDA 2YQBA 2B10B 4RJTA 3RMZA 3SXTA 1U75B 1C52A 1CIEA 1OCDA 2KNCB 1H9XA 5H2FV 1DIQC 1GU2A 1KV9A 3CX5W 4EDFA 5CIDB 1M70A 5CIBB 3C2CA 3L70D 1NNOA 1K3HA 1DVVA 1N90A 3MK7C 3VYMA 1CRCA 1CTYA 2L4DA 1CTJA 4P4QB 4PJ0V 3WFDC 1SQBD 3RLMA 5B5EV 1NU1D 4WQEA 3ORVA 3ITKA 4XXLA 5IY51 3X39A 1YIQA 4H0KA 1I5TA 1CYJA 3CYTI 3ZOWA 1AOQA 2JQRA 2FWLA 2VHDA 4UB6V 2AXTV 1C6RA 1DIIC 1F1CA 1HRCA 1PP9D 2JWAA 2AIUA 4H0JA 1DW2A 3RN1A 3WC8A 1C2NA 2YCCA 1B7VA 1CEDA 1IO3A 2ZZS1 1CRJA 3NWVA 3PXWA 1K3GA 2MHMA 1I6DA 3CXHW 5CIEB 4Q5PA 1HJ4A 1S6VB 1YEAA 1H32B 4K3IA 3ZBMA 2B12B 3VMAA 1H32A 1HCMA 5DF5A 3JBTB 2N9IA 4WQCA 4WQ8A 2RMZA 1CYCA 4L1QA 3OA8A 3VNWA 1RAPA 1DW3A 1QN2A 5GTIV 3TDKA 2PCBB 1KYOW 4N0KA 2Y0DA 1IRWA 1L0ND 3BCCD 1BL9A 1MG3D 1GJQA 3H1JD 1CYIA 4NFGB 1CRGA 3O5CA 1CRIA 3GG2A 1CC5A 2C1VA 2BCNB 1CORA 1H33B 1YTCA 3WFBC 5CIHB 2N9YB 1NIRA 4WQAA 3PRJA 2C2CA 3HQ9A 1QYZA 2DGEA 1NTKD 3A9FA 1M6ZA 4O1QA 4FAVA 5GTHV 1P84D 2ZONG 2L91A 1SQVD 3L75D 3PXSA 3NBSA 4LJIA 3WFEC 1A8CA 2V08A 2C1DA 2KS1A 1WEJF 3O0RC 3TF5A 4IL6V 1BCCD 3SVWA 4FA1A 1CRYA 1E2RA 1ZRTD 1CSXA 1NMIA 2PACA 2ZBOA 351CA 4Y5RA 1I6EA 1LMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHI A;  1JDL A;  1EB7 A;  2CA3 B;  3OCD B;  1IQC A;  4PWA A;  3M97 X;  3DMI A;  1CRH A;  2MTA C;  3A0H V;  1OAE A;  4FAN A;  5KKZ B;  1CIG A;  1QL3 A;  1KX2 A;  2BCC D;  1BGY D;  4WQ9 A;  1MZ4 A;  3ZOO A;  3L72 D;  3ZOX A;  2PCC B;  1KX7 A;  3HQ7 A;  1EZV D;  1AKK A;  2D0S A;  2D0W A;  2YK3 A;  3CXH D;  1FCD C;  1HZU A;  1CCH A;  3L71 D;  3KZI V;  5CIC B;  2V07 A;  4L3H A;  1DVH A;  5C9M A;  4D6T D;  4KMG A;  2B4Z A;  5EXQ A;  2FYN B;  2A06 D;  3RN0 A;  3CWB D;  3OCD A;  3A0B V;  1KB0 A;  1DW1 A;  4L3G A;  1C2R A;  1IRV A;  2RN0 A;  4PW9 B;  5DJQ B;  1SQP D;  2N9J A;  2QG4 A;  2OZ1 A;  4FB1 A;  2C1U A;  2Y0C A;  1YCC A;  1CO6 A;  3SLE A;  4DY9 A;  3HQ8 A;  2GB8 B;  1RZ5 A;  1GQ1 A;  4YE1 A;  3PTZ A;  1J3S A;  1GKS A;  3PLN A;  1NML A;  1KYO D;  2ORL A;  3ZOY A;  1KB9 D;  1COT A;  1NTZ D;  1QKS A;  2CE0 A;  5TIS V;  1FOC A;  1SQQ D;  3H1H D;  1RAQ A;  3VRD A;  2Q3E A;  5E79 V;  1HJ3 A;  1CXC A;  1H9Y A;  1IZL 0;  2AI5 A;  2CE1 A;  1QL4 A;  4UB8 V;  1FI7 A;  5AUR A;  3WFC C;  3MK7 B;  1N15 A;  1FHB A;  5DFS A;  2LIT A;  1YIC A;  1CNO A;  1R0Q A;  4FA4 A;  1HRO A;  3DP5 A;  3ZCF A;  3SWS A;  4EIE A;  2HV4 A;  4WQB A;  1I54 A;  1F1F A;  3SJL A;  1MG2 D;  4JCG A;  2IBZ D;  4AAO A;  2GC4 D;  3PXT A;  2BPB B;  4AAN A;  1C75 A;  2Y0E A;  2JTI B;  3CX5 D;  3H1L D;  1SQX D;  4WQD A;  3ZIY A;  1CHJ A;  1YEB A;  2GIW A;  1DW0 A;  2C8S A;  2QJP B;  4RSZ A;  1S5L V;  1H33 A;  4AX3 A;  1YNR A;  2CXB A;  5KLV D;  4O1W A;  1CIH A;  4WQ7 A;  4FA5 A;  2EXV A;  3TGU D;  4MU8 A;  1CSU A;  1I8P A;  3KHU A;  1FJ0 A;  3PH2 B;  5C0Z A;  1HH7 A;  3NBT A;  3FWL A;  1A56 A;  1ETP A;  1C6O A;  1WVE C;  3L73 D;  1CCR A;  4V2K A;  2N18 C;  1E29 A;  1CHH A;  1KIB A;  3H1I D;  1HZV A;  1M60 A;  3WUI A;  1E8E A;  3HQ6 A;  1W5C T;  4QAO A;  2ZOO A;  2BH4 X;  2B11 B;  2OZ1 B;  3H1K D;  3TYI A;  3CU4 A;  2BGV X;  3GW6 A;  5KAF V;  2YIU B;  5B66 V;  1A2S A;  5CIF B;  4J20 A;  1CIF A;  1RZ6 A;  2B0Z B;  2QJK B;  3L4O A;  1C6S A;  2C1D B;  5B6Q A;  4AAM A;  3L74 D;  1LC2 A;  2FRC A;  4EIC A;  1PPJ D;  2CA4 B;  4AAL A;  2XTS B;  3CP5 A;  5CIG B;  2ZXY A;  3O20 A;  1AYG A;  2QJY B;  1LFM A;  3O1Y A;  1CSW A;  1GIW A;  1HJ5 A;  2LIR A;  1H31 B;  1BE3 D;  1H31 A;  2DVH A;  3WU2 V;  1GDV A;  5CYT R;  1DT1 A;  4U3F D;  2BH5 X;  1VYD A;  4GED B;  4EIF A;  3PHL A;  1N50 A;  3DR0 A;  1I55 A;  4EID A;  4PD4 D;  1C7M A;  4XYD B;  1LS9 A;  1L9J C;  2N18 B;  1U74 B;  5KAI V;  1N9C A;  1H1O A;  1FI3 A;  1ZZH A;  1CSV A;  1CTZ A;  2BLF B;  2I8F A;  2K9J B;  5KLI B;  1AOF A;  2GC7 D;  1L9B C;  2FYU D;  3OA8 B;  5DJQ C;  4A7P A;  155C A;  1I8O A;  1L0L D;  3L4M A;  451C A;  1W2L A;  1NTM D;  1YFC A;  1FI9 A;  1CXA A;  5TJH A;  2O3J A;  1LC1 A;  2N3B A;  2N3Y A;  2C9X B;  4FA9 A;  4GYD A;  2YQB A;  2B10 B;  4RJT A;  3RMZ A;  3SXT A;  1U75 B;  1C52 A;  1CIE A;  1OCD A;  2KNC B;  1H9X A;  5H2F V;  1DIQ C;  1GU2 A;  1KV9 A;  3CX5 W;  4EDF A;  5CID B;  1M70 A;  5CIB B;  3C2C A;  3L70 D;  1NNO A;  1K3H A;  1DVV A;  1N90 A;  3MK7 C;  3VYM A;  1CRC A;  1CTY A;  2L4D A;  1CTJ A;  4P4Q B;  4PJ0 V;  3WFD C;  1SQB D;  3RLM A;  5B5E V;  1NU1 D;  4WQE A;  3ORV A;  3ITK A;  4XXL A;  5IY5 1;  3X39 A;  1YIQ A;  4H0K A;  1I5T A;  1CYJ A;  3CYT I;  3ZOW A;  1AOQ A;  2JQR A;  2FWL A;  2VHD A;  4UB6 V;  2AXT V;  1C6R A;  1DII C;  1F1C A;  1HRC A;  1PP9 D;  2JWA A;  2AIU A;  4H0J A;  1DW2 A;  3RN1 A;  3WC8 A;  1C2N A;  2YCC A;  1B7V A;  1CED A;  1IO3 A;  2ZZS 1;  1CRJ A;  3NWV A;  3PXW A;  1K3G A;  2MHM A;  1I6D A;  3CXH W;  5CIE B;  4Q5P A;  1HJ4 A;  1S6V B;  1YEA A;  1H32 B;  4K3I A;  3ZBM A;  2B12 B;  3VMA A;  1H32 A;  1HCM A;  5DF5 A;  3JBT B;  2N9I A;  4WQC A;  4WQ8 A;  2RMZ A;  1CYC A;  4L1Q A;  3OA8 A;  3VNW A;  1RAP A;  1DW3 A;  1QN2 A;  5GTI V;  3TDK A;  2PCB B;  1KYO W;  4N0K A;  2Y0D A;  1IRW A;  1L0N D;  3BCC D;  1BL9 A;  1MG3 D;  1GJQ A;  3H1J D;  1CYI A;  4NFG B;  1CRG A;  3O5C A;  1CRI A;  3GG2 A;  1CC5 A;  2C1V A;  2BCN B;  1COR A;  1H33 B;  1YTC A;  3WFB C;  5CIH B;  2N9Y B;  1NIR A;  4WQA A;  3PRJ A;  2C2C A;  3HQ9 A;  1QYZ A;  2DGE A;  1NTK D;  3A9F A;  1M6Z A;  4O1Q A;  4FAV A;  5GTH V;  1P84 D;  2ZON G;  2L91 A;  1SQV D;  3L75 D;  3PXS A;  3NBS A;  4LJI A;  3WFE C;  1A8C A;  2V08 A;  2C1D A;  2KS1 A;  1WEJ F;  3O0R C;  3TF5 A;  4IL6 V;  1BCC D;  3SVW A;  4FA1 A;  1CRY A;  1E2R A;  1ZRT D;  1CSX A;  1NMI A;  2PAC A;  2ZBO A;  351C A;  4Y5R A;  1I6E A;  1LMS A; 
#chains in the Genus database with same CATH topology
 2N1T C;  5APS A;  2CA3 B;  3L4F A;  3OCD B;  5CJ0 A;  3M97 X;  1L0N G;  3A0H V;  1P84 I;  1PL5 A;  1ZXG A;  1N86 A;  4H0L D;  1PIX A;  5CJ4 A;  3OAK A;  1QL3 A;  1SQB J;  2QM8 A;  1USD A;  1MZ4 A;  1QX8 A;  1VPC A;  2W83 C;  2PCC B;  2I1K A;  3Q2Y A;  3OJA B;  1AKK A;  4WY4 D;  4PD4 I;  1KIL E;  1ZLL A;  2D0S A;  1GL2 A;  4H44 B;  2IFN A;  1PGP A;  3FGA D;  4I7Z C;  1G1J A;  5DJU B;  2B4Z A;  2FYN B;  1DD3 A;  1OZH A;  2A06 D;  2J58 A;  3CWB D;  3H1I E;  1W2E A;  1IC2 A;  1KB0 A;  1C2R A;  3Q5R A;  1L4A B;  2AEM A;  1KQS O;  1IK7 A;  2H8P D;  3WMM 0;  1SQP D;  1G2C A;  4O9B A;  4BWN A;  1Q86 Q;  2OZ1 A;  3KDP B;  4XE5 B;  1EQ7 A;  1NTK G;  2C1U A;  1MKM A;  1NTK E;  1YCC A;  1LGH B;  3HQ8 A;  2GB8 B;  4OGQ D;  1GQ1 A;  3GLM A;  3PLN A;  1JOC A;  4L73 A;  1FZC A;  1IZN B;  1KB9 D;  1DD4 A;  1QKS A;  2WVR A;  1SQQ D;  3H1H D;  4JF7 A;  1RAQ A;  2Q3E A;  5AVX B;  4OGQ C;  2M0B A;  2ZAE B;  1CXC A;  1NTZ J;  2CE1 A;  1KMI Z;  1QL4 A;  1VQK P;  3MK7 B;  1NTZ G;  2LIT A;  3VYI A;  1YIC A;  4JBZ A;  1DIP A;  1HRO A;  1FJP A;  1U57 A;  2HV4 A;  1YQ3 C;  2ZJS E;  4GOE A;  4WQB A;  3SJL A;  1F1F A;  1N73 B;  2JDI H;  2ZXX A;  1KB9 I;  4AAN A;  3MIW A;  1CI6 B;  3L71 J;  1KYO E;  3H1L D;  3ZIY A;  3B8E B;  4WWI A;  2IZ1 A;  2BEZ F;  3T97 B;  1YEB A;  2GIW A;  1BGY J;  1GK4 A;  2KYV A;  1S5L V;  3I5C A;  2ZVO B;  3LIE A;  2OYH A;  4L75 A;  1D7M A;  3N7N A;  1N7L A;  3TGU D;  1FZE A;  2KLU A;  3KHU A;  1AV1 A;  1FJ0 A;  2E74 C;  3BCC E;  4H13 C;  3VMX A;  3NBT A;  1A56 A;  1EXI A;  3KQG A;  1CCR A;  2LXB A;  2R5D A;  3GHG C;  1LT9 C;  1KIB A;  1VQ6 P;  3WUI A;  1R5L A;  3CCQ P;  2H43 A;  1W5C T;  1IJD B;  2NPS A;  3H1L G;  3H1K D;  1SQP K;  2ZYG A;  2I1J A;  1R5S A;  2QJP C;  4U3F G;  3A2A A;  3LID A;  1A2S A;  2R3S A;  4H0L C;  3RGU A;  2WT7 B;  1CIF A;  2Q9I A;  3VOP A;  1M90 Q;  4WBA A;  3QWO C;  1ZRT E;  4AAL A;  2CA4 B;  3CP5 A;  2IDB A;  4C46 A;  4MN4 C;  3RK3 D;  3HD7 D;  1RF0 A;  1BE3 D;  2WZ7 A;  2DVH A;  5L8R J;  1OW6 A;  2B87 B;  1OX3 A;  1VYD A;  1I55 A;  4EID A;  4PJ0 E;  5CCG A;  2QA4 P;  1KB9 H;  1C7M A;  1QGK B;  4OWF A;  3GHG B;  2JEE A;  1KQF B;  1DEE G;  3O8Z A;  1N9C A;  4EOT A;  1TU3 F;  2QEX P;  1ZZH A;  1CSV A;  1PPJ E;  5B66 H;  2I8F A;  5KLI B;  1H0T A;  3S1K A;  5DJQ C;  155C A;  2IBZ I;  5APW A;  5TIS H;  1NTM D;  3C9I A;  2R3C A;  2WQY C;  5TJH A;  1GW4 A;  2O3J A;  4ZKU A;  2FFD B;  5AW3 B;  2N3B A;  4FA9 A;  2YQB A;  2B10 B;  3RMZ A;  1C52 A;  2WTY A;  2K9J A;  1OCD A;  1L4A A;  1DIQ C;  1N73 C;  1GU2 A;  1HUC A;  4EDF A;  2QSI A;  1BSH A;  3C2C A;  2E75 D;  1P84 E;  3GF7 A;  1NNO A;  1LWU A;  1DVV A;  3U59 A;  1S9K E;  3MK7 C;  4DOJ A;  3V4W A;  3L72 E;  1CTY A;  1HWT C;  4H44 D;  1M56 D;  2ZT9 D;  2NPS B;  4WQE A;  3B5N C;  3X39 A;  5KKZ C;  2XNX A;  3L73 E;  1W5C E;  1I5T A;  1HRC A;  1PP9 D;  2FYU J;  2B89 A;  2PFX A;  1GD2 E;  4H0J A;  1WT6 A;  1FZF A;  1A02 F;  2LKM A;  2ZZS 1;  3MUD A;  1FC2 C;  1RHZ B;  4GDO A;  3H32 B;  2MHM A;  1Y8A A;  4AUW A;  4Y28 J;  2OYI A;  1HJ4 A;  3T97 A;  4K3I A;  3ZBM A;  1H32 A;  3JBT B;  3AE2 C;  2N9I A;  1KIL A;  5CCG C;  1YIT P;  4I6M C;  1FU1 A;  3UIA A;  1YIJ P;  1T2K D;  2Z5I A;  3D6Y A;  3N4X A;  5KLV K;  1YJN P;  2E75 C;  4N0K A;  1JTH B;  1IRW A;  3IFM A;  1JEK A;  5GTI E;  2YMY A;  1SFC B;  1CRG A;  2AEJ A;  2XU6 A;  1NH4 A;  3KYQ A;  5H2F H;  2L5G B;  1CRI A;  1CI6 A;  1K04 A;  1CC5 A;  2C1V A;  1COR A;  3VTP C;  2NRG A;  3PRJ A;  2PP6 A;  1NTK D;  1FE6 A;  3AE4 C;  3E1I A;  3AE9 C;  1JO5 A;  2N1T B;  1RF1 C;  1SQV D;  2XKM A;  5CMZ A;  1N7S C;  1AVO A;  3RBX A;  1SQX K;  1S5L X;  4IL6 H;  1NTM G;  4IL6 V;  1SQQ E;  3H1H E;  4RO0 A;  4FA1 A;  1AA0 A;  1M1J B;  1E2R A;  2M5A B;  2WPR A;  2PAC A;  4ZKP A;  1KD1 Q;  1I6E A;  1LMS A;  2RH0 A;  1YBK A;  4N78 E;  1JDL A;  3L70 J;  3CMA P;  3K5B A;  1IQC A;  2MTA C;  1OAE A;  2FYZ A;  3M0D A;  3CC2 P;  2ZT9 B;  1KX2 A;  2BCC D;  3ZOX A;  3I55 P;  3EFF K;  1VF5 B;  1LTI C;  5AW4 B;  3CXH D;  1FCD C;  3H1J J;  2Y9Y A;  1PZQ A;  4LGD E;  1FDO A;  2UWJ E;  3L71 D;  5AVR B;  1URQ B;  1GL2 D;  2V07 A;  1GW3 A;  4KMG A;  1LT1 A;  2OYH C;  1L0L K;  3TK1 A;  4TT3 H;  4LLH A;  1L0L G;  1NKN A;  3S4R A;  1RF1 A;  3IF4 A;  3OCD A;  3HE5 A;  3A0B H;  1IRV A;  5AVZ B;  1LTA C;  5KAI E;  1LTS C;  1S5L E;  2RN0 A;  2M3E A;  4FB1 A;  5AW1 B;  4BXL A;  5APU A;  1FAV A;  2I8D A;  1NTK K;  3SLE A;  2B88 A;  1ZN5 A;  4OVN F;  3II6 A;  1ZR4 A;  3PTZ A;  1J3S A;  4HJG H;  3P8M C;  1GKS A;  3VMZ A;  3WUT A;  1GL2 C;  1DH3 A;  1IFM A;  3ZOY A;  1NTZ D;  2FFD C;  1JY3 O;  1HJ3 A;  1H9Y A;  2AI5 A;  2FYU K;  4H0L B;  3CPW O;  1FI7 A;  5AUR A;  3V5B A;  1LTB C;  1N15 A;  5DFS A;  1FZC B;  2OTJ P;  3H1J G;  3HUS B;  1KTM A;  3SWS A;  5APX A;  3CLQ A;  4HYT B;  5BU5 A;  2G8Y A;  5KJ7 D;  3G71 P;  1EC5 A;  1N7S D;  2JWD A;  4JCG A;  4JQ0 D;  3AEC C;  1PPJ G;  1YTZ I;  2WMM A;  1BGY E;  2BPB B;  1SVF A;  5APY A;  1SQP G;  3CX5 D;  1SQX D;  4WQD A;  1H88 A;  5AW2 B;  3AE5 C;  3L70 G;  2NZ2 A;  3FXD A;  4RSZ A;  4WY4 B;  1SQV G;  2P1J A;  1H33 A;  4AX3 A;  2CXB A;  5CCH C;  2XZR A;  1JM0 A;  4O1W A;  1EDJ A;  4WQ7 A;  4FA5 A;  2EXV A;  3MD0 A;  4GOF A;  4QMA A;  1QVF O;  1HH7 A;  3A5T A;  1C6O A;  3BRV B;  2N18 C;  1E29 A;  1GL2 B;  4W7Z A;  1LWU C;  4GOD A;  1M60 A;  3D6Z A;  1E8E A;  3CX5 I;  3JSV C;  3HUS A;  1OFC X;  2E76 D;  2YNY A;  4WY4 C;  2E5Y A;  1OXZ A;  1URQ D;  1S9K D;  4U7J A;  5KAF V;  1SQV K;  3L75 E;  4DZO A;  3LW5 J;  2FBW C;  4I2L C;  2QJY C;  1MFZ A;  5CIF B;  4C7N A;  1BCC J;  1FDM A;  4OGQ B;  2B0Z B;  2QJK B;  3L4O A;  1A02 J;  2GA1 A;  3L74 D;  1LC2 A;  3FWN A;  1EDL A;  2FRC A;  1FBM A;  4W7Y A;  5B5E H;  3W68 A;  3NXS A;  1AYG A;  1LFM A;  2VRS A;  2FYU G;  1CSW A;  1GIW A;  1FDI A;  1NTM K;  2YO2 A;  3WU2 V;  4KJM A;  2HFE D;  1U7J A;  1OWA A;  4U3F D;  3AE7 C;  4EIF A;  1E5W A;  2D2C C;  3DR0 A;  1WRG A;  2OYO A;  3TNU B;  3A3Y B;  4PD4 D;  2KI7 B;  3AEF C;  1S3J A;  5AVW B;  1BGY G;  1L9J C;  1KIL D;  2H88 C;  3D0W A;  3AE6 C;  2FYN C;  5KAI V;  3S9O A;  2OTK E;  2BAS A;  4I7Z B;  4CPG A;  1URQ A;  2YKO A;  1L9B C;  3GF3 A;  4A7P A;  3RK2 C;  1W2L A;  3O6Q B;  1KIL C;  1YTZ T;  1FI9 A;  1J2J B;  4UB8 H;  4DT0 A;  2C9X B;  2W6A A;  1U75 B;  1IFN A;  2C0W A;  2D2C D;  1CIE A;  2KNC B;  2QIW A;  3NFQ A;  4HB1 A;  5KAF E;  4L74 A;  1LTJ C;  3CX5 W;  5KJ7 A;  1M70 A;  5CIB B;  1YI2 P;  3Q3D A;  1H89 A;  4PV1 C;  1K3H A;  4TLF A;  1IFJ A;  3VYM A;  5AW6 B;  1CRC A;  1QEX A;  1HJ0 A;  1L4A C;  1AJY A;  2Q7C A;  1KB9 E;  1NTK J;  3TGU E;  1SQB D;  2AXT E;  1HVV A;  1J1E C;  2Q5U A;  1NU1 D;  2OTL P;  5IY5 1;  1KFN A;  2R32 A;  1X0T A;  1N7S A;  4N78 D;  3MP7 B;  1YJW P;  3WU2 E;  1X79 B;  2JQR A;  2FWL A;  4UB6 V;  3U1C A;  1AQT A;  1VL2 A;  1MZ9 A;  3RN1 A;  1C2N A;  1J1E B;  3L70 E;  1T8Z A;  1IO3 A;  1CRJ A;  3PXW A;  1K3G A;  1RF1 B;  1YEA A;  1RE3 A;  4NPF X;  4PV1 B;  1MV8 A;  2B12 B;  5APQ A;  1HCM A;  5KLV J;  4WQC A;  1K73 Q;  2RMZ A;  3OA8 A;  1LTJ B;  3BCC J;  4BRY A;  3G6E P;  1QN2 A;  3RK3 E;  5GTI V;  3TDK A;  5KLV E;  2KSE A;  2PCB B;  1KYO W;  2IFM A;  3BCC D;  1UIX A;  1BL9 A;  3H1J D;  4UB6 E;  3B5N B;  4NFG B;  1GDT A;  3P32 A;  2W6J H;  1PFI A;  2V4H A;  1L0L J;  4KT0 J;  1KIL B;  1NHL A;  3VP9 A;  3WFB C;  3RK2 B;  1USE A;  1NIR A;  1FZB A;  4DCK A;  2V7Q J;  3AE3 C;  2PRR A;  4Z1M H;  1K8A Q;  3CWB J;  3HQ9 A;  2NPS D;  3A9F A;  2OQQ A;  3AED C;  3GMA A;  2IBZ E;  2ZON G;  3CCE P;  1SQP J;  2E74 D;  2AEF A;  5KAI H;  1JY2 O;  2G3A A;  2W90 A;  3O0R C;  3TF5 A;  1OIP A;  2D2C B;  3RL0 B;  1EXJ A;  2MKV A;  2XND H;  3CCS P;  2Q3I A;  4Y5R A;  1LP1 A;  3V2N A;  3VMY A;  2J59 M;  4PWA A;  1BSN A;  3BCC G;  5KKZ B;  3A0H H;  2KB7 P;  1OMI A;  2ZYA A;  3L71 G;  1BCC G;  3O6Q A;  1BGY D;  4D6T G;  3L72 D;  1KX7 A;  3F5H A;  3HQ7 A;  2FFD A;  2ZVN B;  5APV A;  1KZU B;  1SQB K;  2N1T A;  3V2R A;  2WWW A;  2D0W A;  2YK3 A;  2KK7 A;  3OA7 A;  1HZU A;  1GZL A;  1HH0 A;  4L3H A;  1DVH A;  5C9M A;  1PGJ A;  2IYP A;  4XA4 A;  4D6T D;  1L0L E;  2R44 A;  3C8V A;  1KYO I;  2E5T A;  1EZV G;  1LJ2 A;  1U7M A;  1G1I A;  1OW8 A;  1DW1 A;  3M9Q A;  1QL2 A;  4EIJ A;  3MZW B;  3AEB C;  5DJQ B;  3KXD A;  3L75 J;  2N9J A;  2ZYD A;  5DJT B;  2A45 I;  1RH5 B;  3RK2 D;  1CO6 A;  2KUB A;  4RKU J;  3CWB G;  3P7K A;  4AQR D;  3H1K J;  1KYO D;  2KXP B;  3H1L E;  1LT9 B;  2ORL A;  1COT A;  2CE0 A;  1OW7 A;  5TIS V;  3Q5S A;  4H13 B;  1BCC E;  3VRD A;  2E74 B;  5GTI H;  4N6J A;  5E79 V;  5E79 H;  1LP1 B;  2P58 A;  1IZL 0;  3I56 P;  2FYU E;  4YPC A;  5AW9 B;  3SWY A;  2Y9Z A;  5KTB A;  3NTN A;  1HJB A;  4OH8 B;  1IK9 A;  1CNO A;  1Q82 Q;  2KNC A;  4FA4 A;  3DP5 A;  3ZCF A;  3CME P;  3MUD C;  3CXH H;  5B66 E;  4Y99 B;  1ZME C;  1MG2 D;  1BE3 J;  2R5B A;  4LC1 A;  3CCL P;  2Y0E A;  2K9Y A;  2XV5 A;  2JJL A;  3IAO A;  3SFD C;  1EZV E;  1EDK A;  2QJP B;  1NGM B;  4PJ0 H;  3L75 G;  1JY3 N;  2A45 H;  1S5L H;  4N3Y B;  1XTC C;  3IN6 A;  4K3A A;  3HE4 A;  1T3U A;  2O1K A;  3TNU A;  1W2B O;  3CC4 P;  4I1L A;  4MU8 A;  2P67 A;  2MJZ A;  1CSU A;  2BCC J;  5C0Z A;  2KP8 A;  1L0N E;  3RK3 B;  3FWL A;  1ETP A;  1WVE C;  4ZNC A;  2Q6Q A;  1OVR A;  2JKV A;  1JMM A;  2K3R A;  2OYH B;  3CCV P;  3HQ6 A;  5KJ7 C;  1VQN P;  4QAO A;  2BH4 X;  3L37 A;  2WIT A;  3CCR P;  5KLV G;  3A7O A;  3CU4 A;  2FXO A;  1SQQ G;  3H1H G;  2BGV X;  2YIU B;  1SQV E;  3HE5 B;  1VF5 C;  1SQQ J;  1T6A A;  3H1H J;  1CW5 A;  5CCH D;  4J20 A;  2YMK A;  1RZ6 A;  1C6S A;  1H0T B;  5B6Q A;  1KOR A;  4AAM A;  2C0X A;  2M3B A;  5CBO A;  2KSJ A;  2CPB A;  2KZI A;  4EYY Q;  4EIC A;  3E7K A;  4WB4 A;  1PPJ D;  1R8E A;  5CIG B;  3D71 A;  2ZXY A;  2YXQ B;  2C9L Y;  3O20 A;  1JCC A;  5AVV B;  3O1Y A;  1HJ5 A;  2LIR A;  1NTM E;  1HGZ A;  1S2E A;  4DJG A;  5CYT R;  1DT1 A;  2LR2 A;  1YJ9 P;  5EFW B;  1KQL A;  4GED B;  1N50 A;  2ZFC A;  1SP4 A;  3P8C D;  2QM7 A;  4XYD B;  4GIF A;  1N7S B;  3KPE A;  1BE3 G;  1RE4 A;  2A06 G;  1P84 H;  2HOD B;  3Q5P A;  1IFD A;  1LT9 A;  1CTZ A;  2BLF B;  3L71 E;  3F89 A;  1AOF A;  4C7R A;  1GMJ A;  2O01 J;  3U1A A;  3L4M A;  3CCM P;  2N9B A;  4UB6 H;  1NU1 K;  1ZW0 A;  1NU1 G;  3AEA C;  2N3Y A;  1HGV A;  1VQO P;  1SFC C;  2IYO A;  2WSE H;  1PP9 J;  1H9X A;  5CBN A;  3HRN A;  5AVQ B;  1UII A;  3H1K G;  1KV9 A;  3HD7 B;  1L2P A;  3EWK A;  4H44 C;  1M1J C;  2FY8 A;  2L4D A;  4PJ0 V;  1NTZ E;  1JNM A;  5B5E V;  1LTJ A;  3TGU G;  1N73 A;  1VQP P;  3ITK A;  2WPS A;  1Q90 D;  1ZOY C;  4H0K A;  1CYJ A;  1KC8 Q;  1EDI A;  3CYT I;  3RL0 g;  2OYI B;  1AOQ A;  1X22 A;  4C7N B;  1QLE D;  1HF9 A;  5AW0 B;  5B5E E;  1C6R A;  2J5U A;  1DII C;  2A06 E;  2JWA A;  2AIU A;  1KFM A;  1J1D C;  1KYO H;  2YCC A;  1RF0 C;  1B7V A;  2WPV B;  3HE4 B;  3ABV C;  3CI9 A;  2P10 A;  2E75 B;  2HPC B;  5CIE B;  3SWK A;  1SQB G;  2LXC B;  1S6V B;  3V2Q A;  1H32 B;  3VP8 A;  4ZMD A;  4PD4 H;  4D6T J;  5DF5 A;  1T2K C;  2H89 C;  3VNW A;  3L73 G;  1AVY A;  1S1C X;  2Z5H A;  1DW3 A;  4D6T E;  1WMK A;  1VDF A;  3FXE A;  1VQ5 P;  4JYB A;  1MG3 D;  5M1B A;  1CYI A;  4U3F E;  2YO3 A;  1JMB A;  3GG2 A;  2H7H A;  2M8R A;  2XDJ A;  2BCN B;  1H33 B;  5CIH B;  4WQA A;  3AEE C;  4IL6 E;  1L4A D;  5KLI C;  2C2C A;  1JCD A;  1MFT A;  3H1K E;  1QVG O;  3C1L A;  1SLQ A;  1Y9B A;  2W27 A;  1NYH A;  5GTH H;  5GTH V;  2P7J A;  2L91 A;  3PXS A;  3NBS A;  4LJI A;  4WY4 A;  3WFE C;  2NPS C;  2QJK C;  1A8C A;  2C1D A;  1HTL C;  3G9R A;  2K88 A;  1S4X A;  3B4S A;  4GT1 A;  1JY3 P;  3M0D C;  5AW8 B;  1YQ4 C;  1BCC D;  3SVW A;  3CXH E;  1CRY A;  2P2U A;  1JTH A;  1M1J A;  1ZRT D;  1MUU A;  1EZV I;  3H1L J;  1ZR2 A;  351C A;  3TYY A;  2AXC A;  1CHI A;  1EB7 A;  5AW5 B;  1BE3 E;  3L73 J;  3DMI A;  1CRH A;  4FAN A;  5CCG D;  1VQM P;  1CIG A;  3L35 A;  3LW5 H;  1Y47 A;  3AE8 C;  1LTT C;  4WQ9 A;  3CX5 H;  3ZOO A;  3L72 G;  3WUV A;  1NO4 A;  3H25 A;  2DW3 A;  3NMD A;  1J1D B;  1EZV D;  1SQB E;  3BRT B;  3A0H E;  1FZA A;  3BAT A;  1Z56 A;  4IL6 X;  3MHV A;  2OYI C;  1M57 D;  1CCH A;  3KZI V;  5CIC B;  3V2P A;  3V4Q A;  1K05 A;  2N1T D;  3H32 A;  5EXQ A;  3AE1 C;  3JCU H;  1RY3 A;  5BU8 B;  3RN0 A;  2JO1 A;  5APT A;  2HOD A;  3A0B V;  4L3G A;  2BCC E;  3TSI A;  2W8Z A;  1FZC C;  4PW9 B;  1SQV J;  2CK3 H;  3CXH I;  2QG4 A;  3W67 A;  2OAR A;  3ZDM A;  2Y0C A;  1VQ4 P;  1RE3 C;  4DY9 A;  1SQX J;  2YXR B;  5C39 A;  2KZJ A;  1FS0 E;  2HYN A;  1RZ5 A;  4YE1 A;  2QRX A;  1YHQ P;  2O1J A;  2WSE J;  2WPQ A;  1NML A;  2QE7 H;  1N2D C;  1HBW A;  3CX5 E;  2OGU A;  3BAS A;  3M0A A;  3MGN A;  3WUU A;  2ITA A;  3L72 J;  1FOC A;  2M5A A;  1S72 P;  1NVO A;  1VF5 D;  4HH2 A;  1DEB A;  4IFD K;  3B5N A;  5E79 E;  4UB8 V;  3R4Y A;  3WFC C;  1FHB A;  1RQU A;  2YIU C;  5AVU B;  1R0Q A;  4EIE A;  4BRY B;  4WVZ A;  1NTM J;  4R4M A;  1I54 A;  2PAJ A;  3P8C E;  3CCJ P;  2IBZ D;  2E76 B;  4AAO A;  2HLO A;  2GC4 D;  3PXT A;  1OVV A;  1ZP0 C;  1C75 A;  1OVU A;  3D70 A;  4AYC A;  1URQ C;  1M8O B;  1SQX G;  2E43 A;  2JTI B;  1X8Y A;  3RK3 C;  1VQL P;  5GTH E;  1CHJ A;  4IFF A;  1DW0 A;  2C8S A;  4W80 A;  3SWF A;  2K1A A;  3L74 J;  1IFI A;  1YNR A;  1M1K Q;  2POH A;  1NKZ B;  1VQ9 P;  5KLV D;  5CCH A;  1FZG A;  1CIH A;  4GKG A;  1SS1 A;  3L74 E;  3H1J E;  1I8P A;  1CZQ A;  1SFC A;  3JCU E;  2CPS A;  3PH2 B;  3M9B A;  1L0N K;  5AVY B;  1JY2 N;  2KOG A;  3L73 D;  4V2K A;  3EFG A;  2PGD A;  1CHH A;  2FXP A;  3H1I D;  3CWB E;  2WT7 A;  1HZV A;  1PV3 A;  1NU1 J;  1VQ8 P;  3CD6 P;  2ZOO A;  2B11 B;  4K35 A;  2OZ1 B;  3BVH A;  3H1I J;  4Y99 C;  1G2C B;  3CC7 P;  3TYI A;  1PP9 E;  1XTG B;  1SQP E;  1Q7Y Q;  3GW6 A;  4PD4 E;  2JP3 A;  5KAF H;  5B66 V;  4JPZ B;  2GM4 A;  1NWQ A;  1YYC A;  1ZV8 A;  3G3Z A;  2E76 C;  2C1D B;  2KIK A;  1DX7 A;  3R2P A;  1NAF A;  4UB8 E;  3KZI H;  3L36 A;  2HG5 D;  2SPZ A;  2XTS B;  3PJS K;  1Q2N A;  1N8R Q;  4H13 D;  2V7Q H;  1BDD A;  1CSB A;  2QJY B;  3B71 A;  2A45 G;  1H31 B;  1PGQ A;  1H31 A;  4NPD A;  3WU2 H;  3M06 A;  1GDV A;  3G4S P;  1GU4 A;  1T3J A;  2BH5 X;  2BEQ D;  2YKQ A;  3PHL A;  4ASV A;  3RBZ A;  1JUN A;  2O01 H;  1E79 H;  1LS9 A;  1LWU B;  2N18 B;  1U74 B;  1M7L A;  2GUS A;  2WSF J;  1IFP A;  1H1O A;  3V6I A;  1FI3 A;  3CCU P;  2C9N Y;  3EQ2 A;  3PH0 A;  2IPP A;  3OW2 O;  1PGO A;  1AFO A;  4KHX A;  2IZ0 A;  3E1R A;  2BCC G;  2HR3 A;  2K9J B;  2GC7 D;  2FYU D;  3OA8 B;  1I8O A;  1L0L D;  451C A;  5H2F E;  1YFC A;  1CXA A;  1NU1 E;  2FKW B;  3KZI E;  1LC1 A;  4IFM A;  4RJT A;  4GYD A;  4XFJ A;  1K9M Q;  3SXT A;  1KQG B;  1Q81 Q;  3JC2 2;  4U3F J;  5H2F V;  2KLV A;  1SFC D;  3HTK A;  2WSC H;  2K37 A;  5CID B;  3HD7 A;  2YKP A;  3Q1M A;  3HUS C;  3GHG A;  3L70 D;  3H1I G;  1N90 A;  4ASW A;  3B5N D;  1GU5 A;  1AQ5 A;  1RE4 C;  1CTJ A;  4P4Q B;  2WSS H;  1NTZ K;  2GUV A;  3WFD C;  3RLM A;  1JB0 J;  3ORV A;  4XXL A;  1YIQ A;  2JR8 A;  1GTW A;  2Q1K A;  1X9V A;  1JY2 P;  3USS A;  3SSU A;  1KN7 A;  3ZOW A;  4YTP C;  2VHD A;  3PP5 A;  2AXT V;  3M91 A;  2AXT H;  1F1C A;  2B87 A;  1FJK A;  4B86 A;  2O01 N;  1QL1 A;  2WSF H;  1DW2 A;  3WC8 A;  4R4L A;  4RES B;  1CED A;  5AVT B;  3AEG C;  3NWV A;  5AVS B;  2RKL A;  1I6D A;  3CXH W;  2ZXE B;  2B9B A;  4Q5P A;  1FOS F;  3VMA A;  1VQ7 P;  1LTG C;  3FX0 A;  5K5G B;  1KV4 A;  4WQ8 A;  1CYC A;  4L1Q A;  2IBZ G;  1BDC A;  1RAP A;  3SFE C;  3IR9 A;  1L0N J;  5AW7 B;  5BVZ A;  3RL0 D;  5CHX A;  1RQV A;  2HPC A;  3CL3 D;  1PP9 G;  2Y0D A;  1L0N D;  1NAY A;  1IO4 A;  1NJI Q;  1GJQ A;  4NPE A;  3RL0 C;  3O5C A;  4YXD C;  5TIS E;  3MTU E;  4JYC A;  1GK6 A;  4IOI H;  1YTC A;  1NOH A;  2N9Y B;  2W6B A;  1FOS E;  4EI2 A;  1LNQ A;  2Z4E A;  2ZT9 C;  3VN0 A;  3HTK B;  3L74 G;  3H6P A;  1QYZ A;  2DGE A;  2FXM A;  3HD7 C;  1M6Z A;  2QVA A;  4O1Q A;  4FAV A;  1P84 D;  4YXW H;  4PV1 D;  3L75 D;  3QH9 A;  2E42 A;  2V08 A;  2KS1 A;  3A0B E;  2KS1 B;  1WEJ F;  1SQX E;  1SQQ K;  4L76 A;  2IX7 C;  1CSX A;  2WSC J;  4HKZ H;  1H8A A;  3TGU J;  1NMI A;  3M9H A;  2ZBO A;  4M3L A; 
#chains in the Genus database with same CATH homology
 1CHI A;  1JDL A;  1EB7 A;  2CA3 B;  3OCD B;  1IQC A;  4PWA A;  3M97 X;  3DMI A;  1CRH A;  2MTA C;  3A0H V;  1OAE A;  4FAN A;  5KKZ B;  1CIG A;  1QL3 A;  1KX2 A;  2BCC D;  1BGY D;  4WQ9 A;  1MZ4 A;  3ZOO A;  3L72 D;  3ZOX A;  2PCC B;  1KX7 A;  3HQ7 A;  1EZV D;  1AKK A;  2D0S A;  2D0W A;  2YK3 A;  3CXH D;  1FCD C;  1HZU A;  1CCH A;  3L71 D;  3KZI V;  5CIC B;  2V07 A;  4L3H A;  1DVH A;  5C9M A;  4D6T D;  4KMG A;  2B4Z A;  5EXQ A;  2FYN B;  2A06 D;  3RN0 A;  3CWB D;  3OCD A;  3A0B V;  1KB0 A;  1DW1 A;  4L3G A;  1C2R A;  1IRV A;  2RN0 A;  4PW9 B;  5DJQ B;  1SQP D;  2N9J A;  2QG4 A;  2OZ1 A;  4FB1 A;  2C1U A;  2Y0C A;  1YCC A;  1CO6 A;  3SLE A;  4DY9 A;  3HQ8 A;  2GB8 B;  1RZ5 A;  1GQ1 A;  4YE1 A;  3PTZ A;  1J3S A;  1GKS A;  3PLN A;  1NML A;  1KYO D;  2ORL A;  3ZOY A;  1KB9 D;  1COT A;  1NTZ D;  1QKS A;  2CE0 A;  5TIS V;  1FOC A;  1SQQ D;  3H1H D;  1RAQ A;  3VRD A;  2Q3E A;  5E79 V;  1HJ3 A;  1CXC A;  1H9Y A;  1IZL 0;  2AI5 A;  2CE1 A;  1QL4 A;  4UB8 V;  1FI7 A;  5AUR A;  3WFC C;  3MK7 B;  1N15 A;  1FHB A;  5DFS A;  2LIT A;  1YIC A;  1CNO A;  1R0Q A;  4FA4 A;  1HRO A;  3DP5 A;  3ZCF A;  3SWS A;  4EIE A;  2HV4 A;  4WQB A;  1I54 A;  1F1F A;  3SJL A;  1MG2 D;  4JCG A;  2IBZ D;  4AAO A;  2GC4 D;  3PXT A;  2BPB B;  4AAN A;  1C75 A;  2Y0E A;  2JTI B;  3CX5 D;  3H1L D;  1SQX D;  4WQD A;  3ZIY A;  1CHJ A;  1YEB A;  2GIW A;  1DW0 A;  2C8S A;  2QJP B;  4RSZ A;  1S5L V;  1H33 A;  4AX3 A;  1YNR A;  2CXB A;  5KLV D;  4O1W A;  1CIH A;  4WQ7 A;  4FA5 A;  2EXV A;  3TGU D;  4MU8 A;  1CSU A;  1I8P A;  3KHU A;  1FJ0 A;  3PH2 B;  5C0Z A;  1HH7 A;  3NBT A;  3FWL A;  1A56 A;  1ETP A;  1C6O A;  1WVE C;  3L73 D;  1CCR A;  4V2K A;  2N18 C;  1E29 A;  1CHH A;  1KIB A;  3H1I D;  1HZV A;  1M60 A;  3WUI A;  1E8E A;  3HQ6 A;  1W5C T;  4QAO A;  2ZOO A;  2BH4 X;  2B11 B;  2OZ1 B;  3H1K D;  3TYI A;  3CU4 A;  2BGV X;  3GW6 A;  5KAF V;  2YIU B;  5B66 V;  1A2S A;  5CIF B;  4J20 A;  1CIF A;  1RZ6 A;  2B0Z B;  2QJK B;  3L4O A;  1C6S A;  2C1D B;  5B6Q A;  4AAM A;  3L74 D;  1LC2 A;  2FRC A;  4EIC A;  1PPJ D;  2CA4 B;  4AAL A;  2XTS B;  3CP5 A;  5CIG B;  2ZXY A;  3O20 A;  1AYG A;  2QJY B;  1LFM A;  3O1Y A;  1CSW A;  1GIW A;  1HJ5 A;  2LIR A;  1H31 B;  1BE3 D;  1H31 A;  2DVH A;  3WU2 V;  1GDV A;  5CYT R;  1DT1 A;  4U3F D;  2BH5 X;  1VYD A;  4GED B;  4EIF A;  3PHL A;  1N50 A;  3DR0 A;  1I55 A;  4EID A;  4PD4 D;  1C7M A;  4XYD B;  1LS9 A;  1L9J C;  2N18 B;  1U74 B;  5KAI V;  1N9C A;  1H1O A;  1FI3 A;  1ZZH A;  1CSV A;  1CTZ A;  2BLF B;  2I8F A;  2K9J B;  5KLI B;  1AOF A;  2GC7 D;  1L9B C;  2FYU D;  3OA8 B;  5DJQ C;  4A7P A;  155C A;  1I8O A;  1L0L D;  3L4M A;  451C A;  1W2L A;  1NTM D;  1YFC A;  1FI9 A;  1CXA A;  5TJH A;  2O3J A;  1LC1 A;  2N3B A;  2N3Y A;  2C9X B;  4FA9 A;  4GYD A;  2YQB A;  2B10 B;  4RJT A;  3RMZ A;  3SXT A;  1U75 B;  1C52 A;  1CIE A;  1OCD A;  2KNC B;  1H9X A;  5H2F V;  1DIQ C;  1GU2 A;  1KV9 A;  3CX5 W;  4EDF A;  5CID B;  1M70 A;  5CIB B;  3C2C A;  3L70 D;  1NNO A;  1K3H A;  1DVV A;  1N90 A;  3MK7 C;  3VYM A;  1CRC A;  1CTY A;  2L4D A;  1CTJ A;  4P4Q B;  4PJ0 V;  3WFD C;  1SQB D;  3RLM A;  5B5E V;  1NU1 D;  4WQE A;  3ORV A;  3ITK A;  4XXL A;  5IY5 1;  3X39 A;  1YIQ A;  4H0K A;  1I5T A;  1CYJ A;  3CYT I;  3ZOW A;  1AOQ A;  2JQR A;  2FWL A;  2VHD A;  4UB6 V;  2AXT V;  1C6R A;  1DII C;  1F1C A;  1HRC A;  1PP9 D;  2JWA A;  2AIU A;  4H0J A;  1DW2 A;  3RN1 A;  3WC8 A;  1C2N A;  2YCC A;  1B7V A;  1CED A;  1IO3 A;  2ZZS 1;  1CRJ A;  3NWV A;  3PXW A;  1K3G A;  2MHM A;  1I6D A;  3CXH W;  5CIE B;  4Q5P A;  1HJ4 A;  1S6V B;  1YEA A;  1H32 B;  4K3I A;  3ZBM A;  2B12 B;  3VMA A;  1H32 A;  1HCM A;  5DF5 A;  3JBT B;  2N9I A;  4WQC A;  4WQ8 A;  2RMZ A;  1CYC A;  4L1Q A;  3OA8 A;  3VNW A;  1RAP A;  1DW3 A;  1QN2 A;  5GTI V;  3TDK A;  2PCB B;  1KYO W;  4N0K A;  2Y0D A;  1IRW A;  1L0N D;  3BCC D;  1BL9 A;  1MG3 D;  1GJQ A;  3H1J D;  1CYI A;  4NFG B;  1CRG A;  3O5C A;  1CRI A;  3GG2 A;  1CC5 A;  2C1V A;  2BCN B;  1COR A;  1H33 B;  1YTC A;  3WFB C;  5CIH B;  2N9Y B;  1NIR A;  4WQA A;  3PRJ A;  2C2C A;  3HQ9 A;  1QYZ A;  2DGE A;  1NTK D;  3A9F A;  1M6Z A;  4O1Q A;  4FAV A;  5GTH V;  1P84 D;  2ZON G;  2L91 A;  1SQV D;  3L75 D;  3PXS A;  3NBS A;  4LJI A;  3WFE C;  1A8C A;  2V08 A;  2C1D A;  2KS1 A;  1WEJ F;  3O0R C;  3TF5 A;  4IL6 V;  1BCC D;  3SVW A;  4FA1 A;  1CRY A;  1E2R A;  1ZRT D;  1CSX A;  1NMI A;  2PAC A;  2ZBO A;  351C A;  4Y5R A;  1I6E A;  1LMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...