5KKZB

Rhodobacter sphaeroides bc1 with famoxadone
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
256
structure length
256
Chain Sequence
b'AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 64
structure length 256
sequence length 256
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5kkzB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 5kkzB02
1K3GA 3RN0A 1EB7A 1KYOW 2ZXYA 5DFSA 1K3HA 2N18C 3GW6A 2CE0A 2FYNB 351CA 3HQ6A 2AXTV 1F1CA 1IRVA 4GYDA 3MK7C 1I8PA 1GKSA 2RMZA 1KV9A 1LS9A 2CA4B 5E79V 3BCCD 2GB8B 1HJ5A 4Q5PA 1RZ5A 1CSVA 1YCCA 1CRIA 1QL4A 4LJIA 2B4ZA 1LMSA 2MTAC 2CXBA 2YK3A 1CSWA 2JQRA 5DJQC 3HQ7A 1MZ4A 3TF5A 2ZBOA 3HQ8A 1P84D 2D0WA 3PLNA 3PTZA 5IY51 1M70A 2Y0DA 2B11B 2C9XB 3NWVA 1CHHA 1F1FA 1IO3A 3ZOOA 1RZ6A 1S6VB 3NBTA 1SQXD 1ZZHA 2N18B 1CORA 1IRWA 5GTIV 1MG2D 4V2KA 5C9MA 1S5LV 2B0ZB 1L0LD 1H33B 2Q3EA 3DR0A 1BCCD 1CCHA 3ZOXA 2CE1A 2GC4D 5CIGB 4FA1A 4AX3A 1CTJA 1LFMA 4FB1A 2YQBA 2BPBB 2FYUD 4FA5A 1YEAA 1CSUA 3PHLA 1CCRA 1NMLA 1NU1D 1OCDA 4H0JA 1FI3A 1DIQC 1FHBA 4WQ7A 5TJHA 2V07A 3H1KD 4RJTA 1N15A 2YIUB 4O1WA 2LIRA 2O3JA 1HRCA 3OCDB 1CNOA 3O20A 1B7VA 2FWLA 2QJPB 1CO6A 3H1HD 3WFEC 2Y0EA 2QJYB 1NNOA 1PPJD 2K9JB 4AAOA 4P4QB 1CSXA 1FJ0A 1YFCA 3KHUA 1CYIA 5TISV 3SWSA 4EIDA 1H32A 1BGYD 1H32B 1E8EA 1I8OA 1AOFA 1AYGA 1DVVA 1CIHA 5B5EV 1KX2A 1N50A 3L74D 1RAQA 1AOQA 1QKSA 4WQBA 1E29A 3L72D 1YIQA 1E2RA 2DGEA 1BL9A 1NIRA 3RMZA 3ZIYA 1L9BC 1VYDA 1DVHA 2N3BA 1A2SA 1BE3D 1YICA 5B6QA 4PJ0V 1H9YA 2KNCB 3TDKA 2L91A 5C0ZA 1QL3A 3WFCC 3PRJA 4FA9A 1CRYA 3VMAA 1C6SA 1N90A 3A0HV 4DY9A 3ZCFA 1OAEA 1CIGA 3FWLA 4WQCA 1DW1A 1EZVD 1L0ND 4EIFA 2I8FA 1J3SA 3M97X 3A9FA 2N9JA 1GU2A 1YTCA 1CTZA 5AURA 3L4MA 3CYTI 1FI7A 3H1LD 2C1VA 3HQ9A 3CU4A 1H33A 5GTHV 3SLEA 3GG2A 2GIWA 3O1YA 4U3FD 3TGUD 3MK7B 1M60A 3DP5A 1KX7A 3PXTA 1JDLA 2QJKB 5CIHB 2ZZS1 5CYTR 3VNWA 1C7MA 1CRCA 2ZOOA 4H0KA 2EXVA 5DJQB 1HZVA 3O0RC 4J20A 3SXTA 3SVWA 4WQEA 1H1OA 1FCDC 2GC7D 1C2NA 1NTZD 4L3HA 3CXHW 3CWBD 5DF5A 3SJLA 1FI9A 5CIBB 2N3YA 4K3IA 3WFBC 2KS1A 3OCDA 1W2LA 1GIWA 1HJ3A 2C2CA 4WQDA 4YE1A 2LITA 1I55A 3VYMA 4L1QA 1MG3D 1M6ZA 4XXLA 1W5CT 4FA4A 4EDFA 2OZ1B 1CRJA 4AANA 1WVEC 3WFDC 1PP9D 4L3GA 3OA8B 5EXQA 3DMIA 2BGVX 4FANA 2AI5A 3VRDA 3JBTB 4PW9B 2N9YB 5KKZB 4Y5RA 3O5CA 1R0QA 2ORLA 3H1ID 3L73D 4QAOA 3ITKA 1H31B 1CYJA 5KLVD 2RN0A 3L71D 4WQAA 4AAMA 1U75B 1C75A 2C1DA 1RAPA 1H9XA 1KB0A 2C1DB 1FOCA 2B10B 1IQCA 1GJQA 1WEJF 1CHJA 1GQ1A 1C2RA 3PH2B 2XTSB 2PCCB 2BH5X 5CICB 4EICA 3PXWA 3H1JD 2V08A 4FAVA 3L4OA 2BCCD 1NTMD 4PWAA 2FRCA 1HCMA 1KIBA 1HJ4A 2A06D 1A56A 1C52A 1A8CA 4JCGA 1LC1A 2BCNB 1DW2A 1CRHA 1CRGA 2JWAA 1C6RA 1I54A 2BLFB 1AKKA 1SQPD 3L75D 1CXCA 4WQ8A 2PACA 1NTKD 2C8SA 1CC5A 3CXHD 3PXSA 3RN1A 3CP5A 1QN2A 5KAIV 4XYDB 4N0KA 5KAFV 4NFGB 4D6TD 2CA3B 5H2FV 1CEDA 2ZONG 1CIEA 1DW3A 4IL6V 2VHDA 3ZOYA 4MU8A 1DT1A 1NMIA 1I6EA 1IZL0 3KZIV 5CIEB 1YEBA 3WUIA 1SQQD 1SQVD 1COTA 2C1UA 3TYIA 4EIEA 2PCBB 2B12B 3CX5D 5KLIB 4GEDB 1ETPA 2BH4X 2D0SA 2MHMA 1I6DA 4PD4D 3RLMA 3ZOWA 1N9CA 5CIFB 451CA 2QG4A 1CTYA 2L4DA 2OZ1A 3CX5W 155CA 1HH7A 3X39A 4O1QA 3ORVA 1CHIA 4UB8V 1ZRTD 3C2CA 3OA8A 4KMGA 1HZUA 1LC2A 1HROA 2HV4A 2JTIB 4AALA 3NBSA 5B66V 4A7PA 1DW0A 2IBZD 2Y0CA 1I5TA 1GDVA 1C6OA 1CIFA 1KYOD 5CIDB 3A0BV 1KB9D 1L9JC 1U74B 4UB6V 4WQ9A 4RSZA 1CXAA 1SQBD 1CYCA 3ZBMA 1DIIC 1QYZA 3L70D 3WC8A 1H31A 2N9IA 1YNRA 2DVHA 3WU2V 2AIUA 2YCCA
chains in the Genus database with same CATH superfamily
1G2CA 3L74E 1K05A 2E75D 2C0XA 1NTMG 1L4AC 3L72E 1VPCA 4H13C 3AEFC 2A06G 1U7MA 2YXQB 3N4XA 2FYNB 3HQ6A 2AXTV 1EQ7A 3SWFA 1LWUC 1KV9A 1A02F 1HWTC 3CCSP 3L75G 2KZIA 1AQ5A 1QL4A 4LJIA 4IL6E 2B4ZA 1GK6A 1LMSA 1G1IA 2MTAC 4GIFA 3V2PA 4YTPC 4B86A 1RQVA 2KXPB 2B87A 1N86A 2FXOA 2WQYC 1MZ4A 1VQ9P 1P84D 1EZVE 3LIEA 3WU2H 1M70A 1S4XA 2B11B 3NWVA 3F5HA 1F1FA 2FXMA 1IO3A 3ZOOA 3NBTA 2M5AB 3H1LE 2UWJE 1SQQG 1NOHA 4H0LC 1IK7A 5APSA 4U3FE 2Q1KA 1MG2D 4R4LA 4V2KA 1Y9BA 2WSEJ 2CK3H 3A3YB 1L0LD 5AW7B 1H33B 2I1KA 1BCCD 1CCHA 2JDIH 2V7QJ 1EDLA 2GC4D 4L73A 4AX3A 3GMAA 3M9QA 3RBZA 2OYIB 5AVWB 2M3EA 1LTJC 1AFOA 1YBKA 1YTZT 2WT7A 1N7LA 1D7MA 1PV3A 3C1LA 2ITAA 2M0BA 1YQ4C 1FDOA 2JR8A 2FYUD 4FA5A 1LNQA 1YEAA 3LIDA 1CSUA 3Q5RA 2FKWB 2GUSA 1OFCX 1N15A 3L70G 1GU5A 2V7QH 3OCDB 1M57D 2AXTE 1JY2P 1VQLP 4GOEA 3ABVC 3CPWO 4LLHA 2QJPB 1CO6A 1FZFA 2VRSA 2Y0EA 1FZCB 1NNOA 1RE3C 3HD7A 4P4QB 1FJ0A 3BRTB 5TISV 3SWSA 1RF1C 1H32A 1URQA 4HB1A 1BGYD 1KTMA 2B9BA 1AYGA 1USDA 1RAQA 1AOQA 2IBZI 1QKSA 3H1KJ 5DJTB 4W7ZA 2OYHB 3GF7A 2ZYGA 1RE4C 1QL2A 1SQPG 3CCRP 5B66H 1YICA 2Z5IA 1OVVA 2KNCB 5AVZB 5CJ0A 3PRJA 3VMAA 4WY4D 1FOSE 3M0AA 1N90A 3A0HV 2O01J 4DY9A 3AEGC 2GA1A 1NTME 1KILC 1L0LG 2ZYAA 3CCUP 3FWLA 1DW1A 1BCCG 1M1JC 1KQFB 2A06E 1FE6A 1L4AA 1CI6A 4I7ZC 3AE9C 4IL6X 3L36A 1GU2A 1CTZA 3S1KA 3IAOA 1FI7A 1BDCA 3HQ9A 2HLOA 1L0LK 5CCHD 3L75E 1LWUA 3SLEA 3TGUD 2FYUG 5E79H 1BE3J 4N78E 3C9IA 5CYTR 1C7MA 3R4YA 1CRCA 5C39A 2FYUK 2D2CC 5TISE 1VQ6P 3L4FA 1H1OA 1FJKA 1MZ9A 1FCDC 1C2NA 1NTZD 1SQQE 3CWBD 3CCVP 3H32A 5CJ4A 3VYIA 3Q3DA 5KKZC 2KS1A 2OTJP 1PIXA 1GIWA 1HJ3A 1VQPP 2XV5A 1KQLA 1BGYG 3MIWA 5AVVB 1I55A 2A45I 1MV8A 4PV1C 4WY4B 3HE5B 1ZP0C 5AW0B 3MD0A 1LTJA 3A2AA 1QEXA 3RK3D 4EDFA 2OZ1B 3MZWB 5AW6B 3G9RA 4TLFA 5CMZA 5EXQA 4W7YA 3A0HE 2BGVX 1KYOE 1KFMA 1KB9E 3AE2C 3L70E 4DCKA 3M06A 2N9YB 2WITA 3F89A 5DJUB 3EQ2A 2E42A 3ITKA 5KLVD 1T2KD 1G2CB 2YKOA 3AECC 4ZKPA 1H9XA 4Y99C 2B10B 1GJQA 2GM4A 2Q9IA 1RF1A 3M9HA 3AE1C 2R3SA 3TGUG 1MFZA 4EICA 3PXWA 4WBAA 1MFTA 4PWAA 1AQTA 1KIBA 1HJ4A 3CX5H 3CCQP 3WMM0 3CMEP 1IJDB 1A8CA 1W2EA 1P84E 2BCNB 2I8DA 5AW4B 5KLIC 2B87B 2AEFA 3H1IJ 1RE4A 1CRHA 1KMIZ 2YXRB 3MTUE 5AVXB 3RK3B 1CXCA 3QH9A 4WQ8A 1H89A 3HD7D 4IFDK 1NTZG 1NTKD 3MUDC 3CWBG 3G3ZA 1FDIA 2ZJSE 1URQD 3CP5A 2YNYA 3A5TA 4GT1A 5KAIV 3K5BA 2WSCJ 5KAFV 1L0LE 4D6TD 3LW5H 1BCCE 3VP8A 3IN6A 1LT1A 1KILA 1NTZK 4XE5B 1CEDA 2MJZA 2P1JA 4UB8E 1DW3A 1M1JA 2BCCJ 1JM0A 1NMIA 3KYQA 3KZIV 2JWDA 5CIEB 1ZXGA 4M3LA 5BU5A 2B88A 3B4SA 3BRVB 3TYIA 1IFMA 3OJAB 2B12B 2FYUE 3A0BE 2WT7B 1ETPA 3CLQA 3JCUH 4PD4D 1WRGA 3BASA 1SQXJ 2QG4A 2YMKA 1YIJP 3RL0C 3NXSA 5CHXA 3BATA 3X39A 4O9BA 2C0WA 3D71A 3ORVA 5KAIH 1ZRTD 5KAFH 3C2CA 1IZNB 1LC2A 1L4AD 4H13D 1HROA 2JTIB 1FDMA 1I5TA 4ASVA 3CI9A 1SQVJ 1RF0C 3P8CD 1U74B 3HD7B 1Q82Q 1CXAA 1QYZA 1BGYE 2RKLA 3WC8A 5KLVK 5M1BA 2ZYDA 1OVRA 1JMMA 1URQB 4L75A 3FXEA 1VDFA 2LKMA 5L8RJ 3EFFK 4JBZA 1K3HA 2R5BA 2N18C 351CA 1JEKA 1PGPA 4H44B 1UIXA 3M91A 2HFED 2RMZA 4OWFA 2XKMA 2CA4B 2KK7A 2GB8B 4Q5PA 4H0LD 1YCCA 2QJKC 1T2KC 2KLUA 2CXBA 1AA0A 3KZIE 2YK3A 1SQBJ 2XU6A 2JQRA 1SFCD 3TF5A 2ZBOA 4D6TG 1JUNA 2D0WA 3D6ZA 2XZRA 1Q81Q 2QRXA 1NTKK 3M0DA 3PTZA 1BDDA 1WMKA 1KV4A 2C9XB 5AVSB 3O8ZA 1S6VB 1VQKP 1ZZHA 2WWWA 1DD3A 1H0TB 2IPPA 5GTIV 2WSSH 3TGUE 2G3AA 1S5LV 2B0ZB 1J1DC 1K73Q 2Q3EA 2KB7P 2CPSA 3CXHE 3CMAP 3I56P 1JCDA 3I55P 1LFMA 4FB1A 2H88C 1GL2C 3AE4C 2YQBA 2LR2A 3SFDC 2JO1A 1KZUB 1NTZE 2O1KA 3CWBE 4ASWA 1L0NJ 3MUDA 4I2LC 4LGDE 1DIQC 1FHBA 2WSFJ 2H8PD 2P67A 5TJHA 3H1KD 3CCMP 3H32B 4RJTA 2GUVA 3CX5I 1HRCA 2N1TC 1CNOA 1LTTC 3AEBC 3W67A 3E7KA 4IL6H 2K9JA 3HTKB 3WFEC 4K35A 2HODB 2ZVNB 4AAOA 1FC2C 4EIDA 3U59A 1T3JA 3N7NA 2W27A 1CIHA 5AVUB 1AVYA 2WSFH 5B5EV 1N50A 2E74B 2NPSC 1JY3P 2CPBA 1YIQA 3IR9A 1DEEG 1KILD 1BSHA 2P58A 5KLVE 3RMZA 1PGJA 5GTIE 3VN0A 1DVHA 1S5LE 3H1HJ 1VL2A 1BE3D 1JMBA 1LGHB 2OARA 1H9YA 1RF0A 3TNUA 2A45H 2HR3A 4FA9A 5BU8B 3KDPB 4L76A 1GZLA 1C6SA 1KFNA 3GHGC 1CIGA 3P7KA 4WQCA 1S2EA 3NMDA 1XTCC 1J3SA 2N9JA 1YTCA 2D2CD 1YHQP 2C1VA 3CU4A 2AXTH 3FX0A 2IX7C 3O1YA 1NTKE 3MK7B 4BRYB 1E79H 1SFCC 3DP5A 3PXTA 3S9OA 1KORA 1X0TA 2Y9ZA 3VNWA 4D6TE 2ZOOA 3H1KG 2E75B 5DJQB 1KQSO 4PV1D 3O0RC 3SVWA 2H7HA 1S9KD 2GC7D 1NTMJ 2E76D 2HYNA 4C7NA 5EFWB 3FGAD 1M1JB 5DF5A 3B5NC 3WUTA 3SJLA 1FI9A 1YJ9P 5B5EE 3V6IA 1DIPA 4PD4E 1T6AA 1FZEA 3L75J 2LITA 2ZT9C 1MKMA 1M8OB 2J59M 1MG3D 1HGZA 2YKPA 4XXLA 1GK4A 1GL2A 1ZRTE 1T8ZA 1YITP 1CRJA 1IFPA 3V2NA 1RQUA 3L37A 3OW2O 1PP9D 1QGKB 3SWYA 1H8AA 3ZDMA 3VMZA 4QMAA 4FANA 1Z56A 2AI5A 2YO2A 3JBTB 1BE3G 1NKZB 3P8CE 1SQQJ 1KN7A 2POHA 4W80A 5KKZB 4Y5RA 1IC2A 3TSIA 2FFDC 3T97A 1R0QA 3H1ID 2N1TA 3P8MC 3L71D 1M1KQ 2C1DA 4ZNCA 1RAPA 4PV1B 1IQCA 2IZ1A 1CHJA 1RHZB 2PFXA 1IO4A 1C2RA 2IYOA 5TISH 1IK9A 2QM7A 2XTSB 1SLQA 1JY2O 1S5LX 3L4OA 2BCCD 1N2DC 5H2FE 3V2RA 2NPSA 3V2QA 3SFEC 1A56A 3L35A 1TU3F 1LTAC 1GDTA 2QA4P 1LC1A 5K5GB 4KT0J 4ZKUA 1HVVA 3L70J 2BEQD 1DW2A 5AW5B 3L73J 3VOPA 2P7JA 5APVA 1I54A 1AKKA 2C8SA 1EZVI 1SS1A 2JKVA 3CXHD 2O1JA 3PXSA 3RN1A 5CBNA 2KLVA 4N0KA 1YTZI 4DOJA 3GHGA 5APTA 3H1JJ 1CIEA 3A0HH 2QEXP 1X9VA 1QVFO 2HPCA 1HF9A 1KYOH 2VHDA 5CBOA 1CW5A 1EDJA 3RL0D 1KB9H 1OW8A 1HJBA 2KI7B 3WUIA 2W90A 4DJGA 2H43A 1HUCA 1ZR4A 2KIKA 2PAJA 1SQVD 1Q2NA 1EC5A 3TK1A 2PCBB 5AVQB 4HJGH 5KLIB 4GEDB 2BH4X 1PP9G 1SFCA 2KOGA 1SQPJ 3V4QA 4XFJA 1YQ3C 5CIFB 3PJSK 2OYOA 2JJLA 3H1KE 2L4DA 3I5CA 2E76C 4WVZA 1H88A 3CX5W 1X8YA 2OYHC 1NWQA 4UB8V 2K3RA 3EFGA 1HZUA 3HUSC 2KP8A 2HV4A 3L71G 4C7RA 1DW0A 2IBZD 3B5NA 3NTNA 1CIFA 2AEJA 1P84H 1NVOA 1JY2N 3A0BV 4UB6V 2K1AA 1SQBD 3V5BA 1DIIC 3VP9A 1H31A 3G4SP 2JP3A 2DVHA 3M0DC 3D70A 3RN0A 1EB7A 2ZXYA 3RBXA 1OX3A 3USSA 2ZFCA 1KILE 3GW6A 2FBWC 2OQQA 3WUUA 1N7SC 3FWNA 1VQOP 3CCLP 5AVYB 3VMYA 4GYDA 4UB8H 1I8PA 2FY8A 1BE3E 3BCCD 1J1EC 2K37A 3LW5J 1HJ5A 1Q7YQ 1CSVA 1R5SA 2P2UA 2FFDA 3A0BH 3HQ7A 4DZOA 1NGMB 3TNUB 3HQ8A 3PLNA 2Y0DA 1CHHA 1SQXK 1RZ6A 1GL2D 2NZ2A 2XDJA 1USEA 2N18B 1CORA 2G8YA 2C9NY 1SQVG 4OH8B 3AE5C 1IRWA 4IFMA 2LXCB 1DH3A 4KJMA 3DR0A 3RK2C 2CE1A 1NAFA 1YI2P 2B89A 1SQVK 4OVNF 2N1TD 1PGOA 1S9KE 4C46A 4CPGA 1X22A 3FXDA 4UB6E 1Q86Q 2BASA 3CCEP 2IBZG 4Y28J 3PHLA 1CCRA 1NMLA 1OCDA 4H0JA 4C7NB 1FI3A 5AVRB 1FZBA 4WQ7A 2HG5D 2V07A 2WPQA 4GOFA 2YIUB 1HH0A 2O3JA 3TGUJ 3EWKA 2NPSD 3HE4A 3W68A 1J1DB 5KLVG 1B7VA 2FWLA 1L2PA 1PFIA 2YMYA 3H1HD 1XTGB 2QJYB 1NJIQ 3KZIH 1PPJD 1SQBK 1CSXA 4OGQC 1PP9E 1QL1A 1CYIA 3KHUA 1GL2B 3O6QA 1JTHA 3SWKA 1H32B 4Z1MH 1I8OA 1DVVA 2IFNA 4AUWA 3BCCG 1NU1J 2R32A 3IFMA 1LJ2A 2R5DA 4WQBA 1LTIC 1E2RA 1KYOI 2OYHA 3H1IE 1PGQA 2Q6QA 1KB9I 1BL9A 3HUSA 3ZIYA 2QE7H 3L71E 3CXHH 3T97B 1N73C 1NTKG 3CD6P 2KNCA 3WUVA 2Q7CA 5B6QA 4PJ0V 5KJ7C 5APXA 1QL3A 3WFCC 4EYYQ 1NYHA 1HJ0A 1VF5C 2BCCE 3ZCFA 5CCGC 1OAEA 1L0NK 1AJYA 3L74J 2MKVA 2I8FA 3GLMA 3M97X 3CCJP 1L4AB 1CI6B 2W83C 3L72J 4H13B 1N7SA 2ZAEB 5AURA 2IZ0A 3CYTI 1FZAA 1ZV8A 5GTHV 1IFDA 1VQNP 1ZLLA 2YO3A 1P84I 3B5ND 1RH5B 1DX7A 1ZW0A 1LWUB 1M60A 1KX7A 1LT9C 1KD1Q 1JDLA 5CIHB 2ZZS1 1JB0J 2RH0A 3SSUA 4H0KA 3VMXA 3JSVC 2ZT9D 3CL3D 4WQEA 2FXPA 4RESB 2N9BA 3GHGB 4L3HA 2HPCB 3H1HG 1SQVE 1W5CE 1ZR2A 1PPJG 5CIBB 2N3YA 4K3IA 3WFBC 3H1LJ 3G71P 1Y8AA 1W2LA 4H0LB 3OAKA 2KS1B 5GTIH 4U3FJ 1S5LH 1SFCB 2JEEA 4U7JA 2E43A 4L1QA 1KQGB 1W5CT 4FA4A 4H44C 4TT3H 1Q90D 1LTJB 1YJWP 4PJ0E 1QVGO 1IFNA 3B71A 4AANA 1WVEC 5AW3B 2M8RA 1QLED 4L3GA 2IBZE 4JQ0D 3DMIA 3VRDA 3P32A 2OGUA 2Q5UA 1OZHA 1SQBE 4PW9B 3O5CA 2KSJA 2ORLA 3L73D 4QAOA 3AE7C 1R8EA 2LXBA 1H31B 1CYJA 5GTHE 2RN0A 5APWA 1U75B 1C75A 2J5UA 2K9YA 5KTBA 1N8RQ 2ZT9B 3Q5SA 1OW7A 3HRNA 1WEJF 3CC2P 2PP6A 1RF1B 3BCCE 3V4WA 1GU4A 1NTMK 3H1JD 2FRCA 1HCMA 5B5EH 2FYZA 2WTYA 4JCGA 1K9MQ 4PD4H 2I1JA 3TYYA 1DD4A 2FFDB 3BVHA 1CRGA 2JWAA 1N73A 5BVZA 1L0NE 1C6RA 2BLFB 1SQPD 1PL5A 2PACA 1CSBA 3D0WA 5KJ7A 1KC8Q 1JY3O 2OTLP 1ZN5A 4XYDB 1JCCA 2CA3B 1YJNP 5CCGA 5H2FV 1VQ5P 4BXLA 1KILB 4R4MA 4MU8A 1I6EA 1HTLC 1SQQK 3H6PA 2IYPA 4I7ZB 1VQ4P 1EDIA 1YEBA 3CXHI 4EOTA 2KYVA 1RY3A 3CX5D 2QM8A 1EXJA 3E1IA 1K8AQ 2D0SA 2MHMA 2R3CA 3RLMA 1GW3A 3ZOWA 3WU2E 2E74C 1ZOYC 1LT9A 2WZ7A 1CTYA 1M56D 3QWOC 2FYNC 155CA 1HH7A 2WSEH 4O1QA 1LTSC 2AXCA 3OA8A 4KMGA 1OWAA 2ZXXA 3L73G 1UIIA 1A02J 3H1HE 5H2FH 2D2CB 3NBSA 3VTPC 5B66V 3HE4B 1PPJE 1DEBA 1N7SD 2Y0CA 1OXZA 1GDVA 4WQ9A 4JF7A 1CYCA 3ZBMA 2AIUA 2YCCA 3O6QB 1K3GA 1JTHB 3KPEA 1NHLA 1EDKA 3H1JG 4DT0A 1KYOW 5DFSA 2PRRA 2BEZF 2CE0A 2E76B 2XNDH 2WPRA 1JO5A 1F1CA 1PZQA 1IRVA 3M9BA 3MK7C 1GKSA 1S1CX 2YKQA 2Z5HA 1JY3N 3HUSB 1LS9A 5E79V 1RZ5A 2W6AA 1U57A 1CRIA 2OYIC 1SP4A 1GW4A 2K88A 2Q3IA 5AVTB 2E75C 1CSWA 3NFQA 5DJQC 1FJPA 3RK2D 1SQPK 4I6MC 1YYCA 2WVRA 5IY51 3G6EP 3PH0A 4RO0A 1VQ8P 2E5TA 1H0TA 1SQXD 4Y99B 3U1AA 3R2PA 1N7SB 5C9MA 1NH4A 4YPCA 5APQA 4N6JA 3ZOXA 2QJPC 4K3AA 1FZCC 5CIGB 1J1EB 4FA1A 5B66E 1CTJA 3MGNA 3JC22 2O01H 4I1LA 1LP1A 4NPFX 2QIWA 3KXDA 1E5WA 4GODA 2BPBB 3PP5A 4OGQD 1VQMP 1NU1D 1QX8A 2W8ZA 4IOIH 4JYBA 1M7LA 4YXWH 4O1WA 1L0LJ 2LIRA 3H1IG 3Q2YA 1BCCJ 4WWIA 3HTKA 3O20A 2W6JH 4PD4I 3RK2B 2HODA 4WB4A 5E79E 1MUUA 2IFMA 2K9JB 2V4HA 1YFCA 1NO4A 2XNXA 2J58A 4GDOA 2FYUJ 1E8EA 1AOFA 5KJ7D 2BCCG 2WPSA 1KX2A 3L74D 2L5GB 1VF5D 1E29A 3L72D 2DGEA 1G1JA 3RL0B 5CCGD 3L73E 1NIRA 4HKZH 2NRGA 4XA4A 2AEMA 1L9BC 1VYDA 4AQRD 2N3BA 1A2SA 1RE3A 1GD2E 3S4RA 1J2JB 4AYCA 1SQXG 3TDKA 2L91A 1IFJA 5C0ZA 1GMJA 4OGQB 1S72P 1CRYA 4UB6H 1PP9J 4N3YB 3H1JE 3CC4P 1BGYJ 3E1RA 3MHVA 1EZVD 2M5AA 1L0ND 4EIFA 1LTBC 2KSEA 3A9FA 1HGVA 3RL0g 2DW3A 5AW1B 3L4MA 1W2BO 3H1LD 1FBMA 4L74A 3KQGA 4LC1A 1H33A 4BRYA 2E5YA 1SQPE 2ZVOB 2GIWA 3GG2A 4U3FD 3L71J 4WY4C 1N73B 2IDBA 2KZJA 3D6YA 2OYIA 3Q1MA 4ZMDA 4JPZB 2QJKB 1NU1G 2W6BA 3C8VA 3Q5PA 2SPZA 4HH2A 2EXVA 1SVFA 1HZVA 1OMIA 1M90Q 4J20A 3SXTA 1VF5B 5AW8B 1NU1K 4H44D 5CCHC 3CXHW 3B8EB 3CX5E 1BSNA 4RKUJ 1S3JA 1R5LA 3OCDA 4MN4C 1SQBG 2C2CA 1AVOA 4JYCA 4WQDA 4YE1A 3IF4A 1FZCA 3GF3A 3VYMA 3L74G 4KHXA 2QSIA 2WSCH 1LT9B 1VQ7P 1M6ZA 2KUBA 1AV1A 4HYTB 3L72G 3AE8C 2M3BA 2R44A 2Z4EA 3WFDC 3OA8B 1NTZJ 4EI2A 3U1CA 3CWBJ 1OVUA 5AW9B 1IFIA 3AE6C 5APYA 1JNMA 3AEDC 3RGUA 3RK3C 1JOCA 3H25A 2N1TB 4WQAA 4AAMA 3JCUE 1EZVG 1L0NG 1KB0A 2C1DB 1U7JA 1NKNA 1FOCA 1ZMEC 4EIJA 1GQ1A 2ZXEB 3H1LG 3PH2B 1GTWA 3CC7P 5KAIE 3AE3C 3AEAC 5KAFE 4U3FG 2PCCB 2BH5X 5CICB 4FAVA 2V08A 1NTMD 2A06D 3A7OA 1C52A 2NPSB 1HBWA 4GKGA 2OTKE 3UIAA 5KLVJ 2C9LY 2WPVB 2A45G 3L75D 1WT6A 1FZGA 1X79B 1SQXE 1FAVA 1FU1A 1CC5A 2O01N 4N78D 1LTGC 1T3UA 4PJ0H 1QN2A 2YIUC 4NFGB 2QVAA 2E74D 2ZONG 3BCCJ 4IL6V 2PGDA 3ZOYA 1DT1A 2QJYC 1IZL0 4IFFA 1SQQD 3HD7C 1COTA 2C1UA 1OW6A 3OA7A 4BWNA 4EIEA 2WMMA 3AEEC 5AW2B 1LP1B 2P10A 1URQC 5GTHH 1CZQA 1I6DA 1EXIA 5APUA 4WY4A 1NTKJ 1N9CA 1NU1E 3HE5A 451CA 1OIPA 1NAYA 1Y47A 2OZ1A 2H89C 4D6TJ 1FS0E 1CHIA 1FOSF 4AALA 5CCHA 4A7PA 4NPDA 1C6OA 3RK3E 2Y9YA 1KYOD 3B5NB 5CIDB 4YXDC 1KB9D 1L9JC 4NPEA 3II6A 3MP7B 4RSZA 1K04A 3L70D 2N9IA 1YNRA 3WU2V
chains in the Genus database with same CATH topology
1K3GA 3RN0A 1EB7A 1KYOW 2ZXYA 5DFSA 1K3HA 2N18C 3GW6A 2CE0A 2FYNB 351CA 3HQ6A 2AXTV 1F1CA 1IRVA 4GYDA 3MK7C 1I8PA 1GKSA 2RMZA 1KV9A 1LS9A 2CA4B 5E79V 3BCCD 2GB8B 1HJ5A 4Q5PA 1RZ5A 1CSVA 1YCCA 1CRIA 1QL4A 4LJIA 2B4ZA 1LMSA 2MTAC 2CXBA 2YK3A 1CSWA 2JQRA 5DJQC 3HQ7A 1MZ4A 3TF5A 2ZBOA 3HQ8A 1P84D 2D0WA 3PLNA 3PTZA 5IY51 1M70A 2Y0DA 2B11B 2C9XB 3NWVA 1CHHA 1F1FA 1IO3A 3ZOOA 1RZ6A 1S6VB 3NBTA 1SQXD 1ZZHA 2N18B 1CORA 1IRWA 5GTIV 1MG2D 4V2KA 5C9MA 1S5LV 2B0ZB 1L0LD 1H33B 2Q3EA 3DR0A 1BCCD 1CCHA 3ZOXA 2CE1A 2GC4D 5CIGB 4FA1A 4AX3A 1CTJA 1LFMA 4FB1A 2YQBA 2BPBB 2FYUD 4FA5A 1YEAA 1CSUA 3PHLA 1CCRA 1NMLA 1NU1D 1OCDA 4H0JA 1FI3A 1DIQC 1FHBA 4WQ7A 5TJHA 2V07A 3H1KD 4RJTA 1N15A 2YIUB 4O1WA 2LIRA 2O3JA 1HRCA 3OCDB 1CNOA 3O20A 1B7VA 2FWLA 2QJPB 1CO6A 3H1HD 3WFEC 2Y0EA 2QJYB 1NNOA 1PPJD 2K9JB 4AAOA 4P4QB 1CSXA 1FJ0A 1YFCA 3KHUA 1CYIA 5TISV 3SWSA 4EIDA 1H32A 1BGYD 1H32B 1E8EA 1I8OA 1AOFA 1AYGA 1DVVA 1CIHA 5B5EV 1KX2A 1N50A 3L74D 1RAQA 1AOQA 1QKSA 4WQBA 1E29A 3L72D 1YIQA 1E2RA 2DGEA 1BL9A 1NIRA 3RMZA 3ZIYA 1L9BC 1VYDA 1DVHA 2N3BA 1A2SA 1BE3D 1YICA 5B6QA 4PJ0V 1H9YA 2KNCB 3TDKA 2L91A 5C0ZA 1QL3A 3WFCC 3PRJA 4FA9A 1CRYA 3VMAA 1C6SA 1N90A 3A0HV 4DY9A 3ZCFA 1OAEA 1CIGA 3FWLA 4WQCA 1DW1A 1EZVD 1L0ND 4EIFA 2I8FA 1J3SA 3M97X 3A9FA 2N9JA 1GU2A 1YTCA 1CTZA 5AURA 3L4MA 3CYTI 1FI7A 3H1LD 2C1VA 3HQ9A 3CU4A 1H33A 5GTHV 3SLEA 3GG2A 2GIWA 3O1YA 4U3FD 3TGUD 3MK7B 1M60A 3DP5A 1KX7A 3PXTA 1JDLA 2QJKB 5CIHB 2ZZS1 5CYTR 3VNWA 1C7MA 1CRCA 2ZOOA 4H0KA 2EXVA 5DJQB 1HZVA 3O0RC 4J20A 3SXTA 3SVWA 4WQEA 1H1OA 1FCDC 2GC7D 1C2NA 1NTZD 4L3HA 3CXHW 3CWBD 5DF5A 3SJLA 1FI9A 5CIBB 2N3YA 4K3IA 3WFBC 2KS1A 3OCDA 1W2LA 1GIWA 1HJ3A 2C2CA 4WQDA 4YE1A 2LITA 1I55A 3VYMA 4L1QA 1MG3D 1M6ZA 4XXLA 1W5CT 4FA4A 4EDFA 2OZ1B 1CRJA 4AANA 1WVEC 3WFDC 1PP9D 4L3GA 3OA8B 5EXQA 3DMIA 2BGVX 4FANA 2AI5A 3VRDA 3JBTB 4PW9B 2N9YB 5KKZB 4Y5RA 3O5CA 1R0QA 2ORLA 3H1ID 3L73D 4QAOA 3ITKA 1H31B 1CYJA 5KLVD 2RN0A 3L71D 4WQAA 4AAMA 1U75B 1C75A 2C1DA 1RAPA 1H9XA 1KB0A 2C1DB 1FOCA 2B10B 1IQCA 1GJQA 1WEJF 1CHJA 1GQ1A 1C2RA 3PH2B 2XTSB 2PCCB 2BH5X 5CICB 4EICA 3PXWA 3H1JD 2V08A 4FAVA 3L4OA 2BCCD 1NTMD 4PWAA 2FRCA 1HCMA 1KIBA 1HJ4A 2A06D 1A56A 1C52A 1A8CA 4JCGA 1LC1A 2BCNB 1DW2A 1CRHA 1CRGA 2JWAA 1C6RA 1I54A 2BLFB 1AKKA 1SQPD 3L75D 1CXCA 4WQ8A 2PACA 1NTKD 2C8SA 1CC5A 3CXHD 3PXSA 3RN1A 3CP5A 1QN2A 5KAIV 4XYDB 4N0KA 5KAFV 4NFGB 4D6TD 2CA3B 5H2FV 1CEDA 2ZONG 1CIEA 1DW3A 4IL6V 2VHDA 3ZOYA 4MU8A 1DT1A 1NMIA 1I6EA 1IZL0 3KZIV 5CIEB 1YEBA 3WUIA 1SQQD 1SQVD 1COTA 2C1UA 3TYIA 4EIEA 2PCBB 2B12B 3CX5D 5KLIB 4GEDB 1ETPA 2BH4X 2D0SA 2MHMA 1I6DA 4PD4D 3RLMA 3ZOWA 1N9CA 5CIFB 451CA 2QG4A 1CTYA 2L4DA 2OZ1A 3CX5W 155CA 1HH7A 3X39A 4O1QA 3ORVA 1CHIA 4UB8V 1ZRTD 3C2CA 3OA8A 4KMGA 1HZUA 1LC2A 1HROA 2HV4A 2JTIB 4AALA 3NBSA 5B66V 4A7PA 1DW0A 2IBZD 2Y0CA 1I5TA 1GDVA 1C6OA 1CIFA 1KYOD 5CIDB 3A0BV 1KB9D 1L9JC 1U74B 4UB6V 4WQ9A 4RSZA 1CXAA 1SQBD 1CYCA 3ZBMA 1DIIC 1QYZA 3L70D 3WC8A 1H31A 2N9IA 1YNRA 2DVHA 3WU2V 2AIUA 2YCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3G A;  3RN0 A;  1EB7 A;  1KYO W;  2ZXY A;  5DFS A;  1K3H A;  2N18 C;  3GW6 A;  2CE0 A;  2FYN B;  351C A;  3HQ6 A;  2AXT V;  1F1C A;  1IRV A;  4GYD A;  3MK7 C;  1I8P A;  1GKS A;  2RMZ A;  1KV9 A;  1LS9 A;  2CA4 B;  5E79 V;  3BCC D;  2GB8 B;  1HJ5 A;  4Q5P A;  1RZ5 A;  1CSV A;  1YCC A;  1CRI A;  1QL4 A;  4LJI A;  2B4Z A;  1LMS A;  2MTA C;  2CXB A;  2YK3 A;  1CSW A;  2JQR A;  5DJQ C;  3HQ7 A;  1MZ4 A;  3TF5 A;  2ZBO A;  3HQ8 A;  1P84 D;  2D0W A;  3PLN A;  3PTZ A;  5IY5 1;  1M70 A;  2Y0D A;  2B11 B;  2C9X B;  3NWV A;  1CHH A;  1F1F A;  1IO3 A;  3ZOO A;  1RZ6 A;  1S6V B;  3NBT A;  1SQX D;  1ZZH A;  2N18 B;  1COR A;  1IRW A;  5GTI V;  1MG2 D;  4V2K A;  5C9M A;  1S5L V;  2B0Z B;  1L0L D;  1H33 B;  2Q3E A;  3DR0 A;  1BCC D;  1CCH A;  3ZOX A;  2CE1 A;  2GC4 D;  5CIG B;  4FA1 A;  4AX3 A;  1CTJ A;  1LFM A;  4FB1 A;  2YQB A;  2BPB B;  2FYU D;  4FA5 A;  1YEA A;  1CSU A;  3PHL A;  1CCR A;  1NML A;  1NU1 D;  1OCD A;  4H0J A;  1FI3 A;  1DIQ C;  1FHB A;  4WQ7 A;  5TJH A;  2V07 A;  3H1K D;  4RJT A;  1N15 A;  2YIU B;  4O1W A;  2LIR A;  2O3J A;  1HRC A;  3OCD B;  1CNO A;  3O20 A;  1B7V A;  2FWL A;  2QJP B;  1CO6 A;  3H1H D;  3WFE C;  2Y0E A;  2QJY B;  1NNO A;  1PPJ D;  2K9J B;  4AAO A;  4P4Q B;  1CSX A;  1FJ0 A;  1YFC A;  3KHU A;  1CYI A;  5TIS V;  3SWS A;  4EID A;  1H32 A;  1BGY D;  1H32 B;  1E8E A;  1I8O A;  1AOF A;  1AYG A;  1DVV A;  1CIH A;  5B5E V;  1KX2 A;  1N50 A;  3L74 D;  1RAQ A;  1AOQ A;  1QKS A;  4WQB A;  1E29 A;  3L72 D;  1YIQ A;  1E2R A;  2DGE A;  1BL9 A;  1NIR A;  3RMZ A;  3ZIY A;  1L9B C;  1VYD A;  1DVH A;  2N3B A;  1A2S A;  1BE3 D;  1YIC A;  5B6Q A;  4PJ0 V;  1H9Y A;  2KNC B;  3TDK A;  2L91 A;  5C0Z A;  1QL3 A;  3WFC C;  3PRJ A;  4FA9 A;  1CRY A;  3VMA A;  1C6S A;  1N90 A;  3A0H V;  4DY9 A;  3ZCF A;  1OAE A;  1CIG A;  3FWL A;  4WQC A;  1DW1 A;  1EZV D;  1L0N D;  4EIF A;  2I8F A;  1J3S A;  3M97 X;  3A9F A;  2N9J A;  1GU2 A;  1YTC A;  1CTZ A;  5AUR A;  3L4M A;  3CYT I;  1FI7 A;  3H1L D;  2C1V A;  3HQ9 A;  3CU4 A;  1H33 A;  5GTH V;  3SLE A;  3GG2 A;  2GIW A;  3O1Y A;  4U3F D;  3TGU D;  3MK7 B;  1M60 A;  3DP5 A;  1KX7 A;  3PXT A;  1JDL A;  2QJK B;  5CIH B;  2ZZS 1;  5CYT R;  3VNW A;  1C7M A;  1CRC A;  2ZOO A;  4H0K A;  2EXV A;  5DJQ B;  1HZV A;  3O0R C;  4J20 A;  3SXT A;  3SVW A;  4WQE A;  1H1O A;  1FCD C;  2GC7 D;  1C2N A;  1NTZ D;  4L3H A;  3CXH W;  3CWB D;  5DF5 A;  3SJL A;  1FI9 A;  5CIB B;  2N3Y A;  4K3I A;  3WFB C;  2KS1 A;  3OCD A;  1W2L A;  1GIW A;  1HJ3 A;  2C2C A;  4WQD A;  4YE1 A;  2LIT A;  1I55 A;  3VYM A;  4L1Q A;  1MG3 D;  1M6Z A;  4XXL A;  1W5C T;  4FA4 A;  4EDF A;  2OZ1 B;  1CRJ A;  4AAN A;  1WVE C;  3WFD C;  1PP9 D;  4L3G A;  3OA8 B;  5EXQ A;  3DMI A;  2BGV X;  4FAN A;  2AI5 A;  3VRD A;  3JBT B;  4PW9 B;  2N9Y B;  5KKZ B;  4Y5R A;  3O5C A;  1R0Q A;  2ORL A;  3H1I D;  3L73 D;  4QAO A;  3ITK A;  1H31 B;  1CYJ A;  5KLV D;  2RN0 A;  3L71 D;  4WQA A;  4AAM A;  1U75 B;  1C75 A;  2C1D A;  1RAP A;  1H9X A;  1KB0 A;  2C1D B;  1FOC A;  2B10 B;  1IQC A;  1GJQ A;  1WEJ F;  1CHJ A;  1GQ1 A;  1C2R A;  3PH2 B;  2XTS B;  2PCC B;  2BH5 X;  5CIC B;  4EIC A;  3PXW A;  3H1J D;  2V08 A;  4FAV A;  3L4O A;  2BCC D;  1NTM D;  4PWA A;  2FRC A;  1HCM A;  1KIB A;  1HJ4 A;  2A06 D;  1A56 A;  1C52 A;  1A8C A;  4JCG A;  1LC1 A;  2BCN B;  1DW2 A;  1CRH A;  1CRG A;  2JWA A;  1C6R A;  1I54 A;  2BLF B;  1AKK A;  1SQP D;  3L75 D;  1CXC A;  4WQ8 A;  2PAC A;  1NTK D;  2C8S A;  1CC5 A;  3CXH D;  3PXS A;  3RN1 A;  3CP5 A;  1QN2 A;  5KAI V;  4XYD B;  4N0K A;  5KAF V;  4NFG B;  4D6T D;  2CA3 B;  5H2F V;  1CED A;  2ZON G;  1CIE A;  1DW3 A;  4IL6 V;  2VHD A;  3ZOY A;  4MU8 A;  1DT1 A;  1NMI A;  1I6E A;  1IZL 0;  3KZI V;  5CIE B;  1YEB A;  3WUI A;  1SQQ D;  1SQV D;  1COT A;  2C1U A;  3TYI A;  4EIE A;  2PCB B;  2B12 B;  3CX5 D;  5KLI B;  4GED B;  1ETP A;  2BH4 X;  2D0S A;  2MHM A;  1I6D A;  4PD4 D;  3RLM A;  3ZOW A;  1N9C A;  5CIF B;  451C A;  2QG4 A;  1CTY A;  2L4D A;  2OZ1 A;  3CX5 W;  155C A;  1HH7 A;  3X39 A;  4O1Q A;  3ORV A;  1CHI A;  4UB8 V;  1ZRT D;  3C2C A;  3OA8 A;  4KMG A;  1HZU A;  1LC2 A;  1HRO A;  2HV4 A;  2JTI B;  4AAL A;  3NBS A;  5B66 V;  4A7P A;  1DW0 A;  2IBZ D;  2Y0C A;  1I5T A;  1GDV A;  1C6O A;  1CIF A;  1KYO D;  5CID B;  3A0B V;  1KB9 D;  1L9J C;  1U74 B;  4UB6 V;  4WQ9 A;  4RSZ A;  1CXA A;  1SQB D;  1CYC A;  3ZBM A;  1DII C;  1QYZ A;  3L70 D;  3WC8 A;  1H31 A;  2N9I A;  1YNR A;  2DVH A;  3WU2 V;  2AIU A;  2YCC A; 
#chains in the Genus database with same CATH topology
 1G2C A;  3L74 E;  1K05 A;  2E75 D;  2C0X A;  1NTM G;  1L4A C;  3L72 E;  1VPC A;  4H13 C;  3AEF C;  2A06 G;  1U7M A;  2YXQ B;  3N4X A;  2FYN B;  3HQ6 A;  2AXT V;  1EQ7 A;  3SWF A;  1LWU C;  1KV9 A;  1A02 F;  1HWT C;  3CCS P;  3L75 G;  2KZI A;  1AQ5 A;  1QL4 A;  4LJI A;  4IL6 E;  2B4Z A;  1GK6 A;  1LMS A;  1G1I A;  2MTA C;  4GIF A;  3V2P A;  4YTP C;  4B86 A;  1RQV A;  2KXP B;  2B87 A;  1N86 A;  2FXO A;  2WQY C;  1MZ4 A;  1VQ9 P;  1P84 D;  1EZV E;  3LIE A;  3WU2 H;  1M70 A;  1S4X A;  2B11 B;  3NWV A;  3F5H A;  1F1F A;  2FXM A;  1IO3 A;  3ZOO A;  3NBT A;  2M5A B;  3H1L E;  2UWJ E;  1SQQ G;  1NOH A;  4H0L C;  1IK7 A;  5APS A;  4U3F E;  2Q1K A;  1MG2 D;  4R4L A;  4V2K A;  1Y9B A;  2WSE J;  2CK3 H;  3A3Y B;  1L0L D;  5AW7 B;  1H33 B;  2I1K A;  1BCC D;  1CCH A;  2JDI H;  2V7Q J;  1EDL A;  2GC4 D;  4L73 A;  4AX3 A;  3GMA A;  3M9Q A;  3RBZ A;  2OYI B;  5AVW B;  2M3E A;  1LTJ C;  1AFO A;  1YBK A;  1YTZ T;  2WT7 A;  1N7L A;  1D7M A;  1PV3 A;  3C1L A;  2ITA A;  2M0B A;  1YQ4 C;  1FDO A;  2JR8 A;  2FYU D;  4FA5 A;  1LNQ A;  1YEA A;  3LID A;  1CSU A;  3Q5R A;  2FKW B;  2GUS A;  1OFC X;  1N15 A;  3L70 G;  1GU5 A;  2V7Q H;  3OCD B;  1M57 D;  2AXT E;  1JY2 P;  1VQL P;  4GOE A;  3ABV C;  3CPW O;  4LLH A;  2QJP B;  1CO6 A;  1FZF A;  2VRS A;  2Y0E A;  1FZC B;  1NNO A;  1RE3 C;  3HD7 A;  4P4Q B;  1FJ0 A;  3BRT B;  5TIS V;  3SWS A;  1RF1 C;  1H32 A;  1URQ A;  4HB1 A;  1BGY D;  1KTM A;  2B9B A;  1AYG A;  1USD A;  1RAQ A;  1AOQ A;  2IBZ I;  1QKS A;  3H1K J;  5DJT B;  4W7Z A;  2OYH B;  3GF7 A;  2ZYG A;  1RE4 C;  1QL2 A;  1SQP G;  3CCR P;  5B66 H;  1YIC A;  2Z5I A;  1OVV A;  2KNC B;  5AVZ B;  5CJ0 A;  3PRJ A;  3VMA A;  4WY4 D;  1FOS E;  3M0A A;  1N90 A;  3A0H V;  2O01 J;  4DY9 A;  3AEG C;  2GA1 A;  1NTM E;  1KIL C;  1L0L G;  2ZYA A;  3CCU P;  3FWL A;  1DW1 A;  1BCC G;  1M1J C;  1KQF B;  2A06 E;  1FE6 A;  1L4A A;  1CI6 A;  4I7Z C;  3AE9 C;  4IL6 X;  3L36 A;  1GU2 A;  1CTZ A;  3S1K A;  3IAO A;  1FI7 A;  1BDC A;  3HQ9 A;  2HLO A;  1L0L K;  5CCH D;  3L75 E;  1LWU A;  3SLE A;  3TGU D;  2FYU G;  5E79 H;  1BE3 J;  4N78 E;  3C9I A;  5CYT R;  1C7M A;  3R4Y A;  1CRC A;  5C39 A;  2FYU K;  2D2C C;  5TIS E;  1VQ6 P;  3L4F A;  1H1O A;  1FJK A;  1MZ9 A;  1FCD C;  1C2N A;  1NTZ D;  1SQQ E;  3CWB D;  3CCV P;  3H32 A;  5CJ4 A;  3VYI A;  3Q3D A;  5KKZ C;  2KS1 A;  2OTJ P;  1PIX A;  1GIW A;  1HJ3 A;  1VQP P;  2XV5 A;  1KQL A;  1BGY G;  3MIW A;  5AVV B;  1I55 A;  2A45 I;  1MV8 A;  4PV1 C;  4WY4 B;  3HE5 B;  1ZP0 C;  5AW0 B;  3MD0 A;  1LTJ A;  3A2A A;  1QEX A;  3RK3 D;  4EDF A;  2OZ1 B;  3MZW B;  5AW6 B;  3G9R A;  4TLF A;  5CMZ A;  5EXQ A;  4W7Y A;  3A0H E;  2BGV X;  1KYO E;  1KFM A;  1KB9 E;  3AE2 C;  3L70 E;  4DCK A;  3M06 A;  2N9Y B;  2WIT A;  3F89 A;  5DJU B;  3EQ2 A;  2E42 A;  3ITK A;  5KLV D;  1T2K D;  1G2C B;  2YKO A;  3AEC C;  4ZKP A;  1H9X A;  4Y99 C;  2B10 B;  1GJQ A;  2GM4 A;  2Q9I A;  1RF1 A;  3M9H A;  3AE1 C;  2R3S A;  3TGU G;  1MFZ A;  4EIC A;  3PXW A;  4WBA A;  1MFT A;  4PWA A;  1AQT A;  1KIB A;  1HJ4 A;  3CX5 H;  3CCQ P;  3WMM 0;  3CME P;  1IJD B;  1A8C A;  1W2E A;  1P84 E;  2BCN B;  2I8D A;  5AW4 B;  5KLI C;  2B87 B;  2AEF A;  3H1I J;  1RE4 A;  1CRH A;  1KMI Z;  2YXR B;  3MTU E;  5AVX B;  3RK3 B;  1CXC A;  3QH9 A;  4WQ8 A;  1H89 A;  3HD7 D;  4IFD K;  1NTZ G;  1NTK D;  3MUD C;  3CWB G;  3G3Z A;  1FDI A;  2ZJS E;  1URQ D;  3CP5 A;  2YNY A;  3A5T A;  4GT1 A;  5KAI V;  3K5B A;  2WSC J;  5KAF V;  1L0L E;  4D6T D;  3LW5 H;  1BCC E;  3VP8 A;  3IN6 A;  1LT1 A;  1KIL A;  1NTZ K;  4XE5 B;  1CED A;  2MJZ A;  2P1J A;  4UB8 E;  1DW3 A;  1M1J A;  2BCC J;  1JM0 A;  1NMI A;  3KYQ A;  3KZI V;  2JWD A;  5CIE B;  1ZXG A;  4M3L A;  5BU5 A;  2B88 A;  3B4S A;  3BRV B;  3TYI A;  1IFM A;  3OJA B;  2B12 B;  2FYU E;  3A0B E;  2WT7 B;  1ETP A;  3CLQ A;  3JCU H;  4PD4 D;  1WRG A;  3BAS A;  1SQX J;  2QG4 A;  2YMK A;  1YIJ P;  3RL0 C;  3NXS A;  5CHX A;  3BAT A;  3X39 A;  4O9B A;  2C0W A;  3D71 A;  3ORV A;  5KAI H;  1ZRT D;  5KAF H;  3C2C A;  1IZN B;  1LC2 A;  1L4A D;  4H13 D;  1HRO A;  2JTI B;  1FDM A;  1I5T A;  4ASV A;  3CI9 A;  1SQV J;  1RF0 C;  3P8C D;  1U74 B;  3HD7 B;  1Q82 Q;  1CXA A;  1QYZ A;  1BGY E;  2RKL A;  3WC8 A;  5KLV K;  5M1B A;  2ZYD A;  1OVR A;  1JMM A;  1URQ B;  4L75 A;  3FXE A;  1VDF A;  2LKM A;  5L8R J;  3EFF K;  4JBZ A;  1K3H A;  2R5B A;  2N18 C;  351C A;  1JEK A;  1PGP A;  4H44 B;  1UIX A;  3M91 A;  2HFE D;  2RMZ A;  4OWF A;  2XKM A;  2CA4 B;  2KK7 A;  2GB8 B;  4Q5P A;  4H0L D;  1YCC A;  2QJK C;  1T2K C;  2KLU A;  2CXB A;  1AA0 A;  3KZI E;  2YK3 A;  1SQB J;  2XU6 A;  2JQR A;  1SFC D;  3TF5 A;  2ZBO A;  4D6T G;  1JUN A;  2D0W A;  3D6Z A;  2XZR A;  1Q81 Q;  2QRX A;  1NTK K;  3M0D A;  3PTZ A;  1BDD A;  1WMK A;  1KV4 A;  2C9X B;  5AVS B;  3O8Z A;  1S6V B;  1VQK P;  1ZZH A;  2WWW A;  1DD3 A;  1H0T B;  2IPP A;  5GTI V;  2WSS H;  3TGU E;  2G3A A;  1S5L V;  2B0Z B;  1J1D C;  1K73 Q;  2Q3E A;  2KB7 P;  2CPS A;  3CXH E;  3CMA P;  3I56 P;  1JCD A;  3I55 P;  1LFM A;  4FB1 A;  2H88 C;  1GL2 C;  3AE4 C;  2YQB A;  2LR2 A;  3SFD C;  2JO1 A;  1KZU B;  1NTZ E;  2O1K A;  3CWB E;  4ASW A;  1L0N J;  3MUD A;  4I2L C;  4LGD E;  1DIQ C;  1FHB A;  2WSF J;  2H8P D;  2P67 A;  5TJH A;  3H1K D;  3CCM P;  3H32 B;  4RJT A;  2GUV A;  3CX5 I;  1HRC A;  2N1T C;  1CNO A;  1LTT C;  3AEB C;  3W67 A;  3E7K A;  4IL6 H;  2K9J A;  3HTK B;  3WFE C;  4K35 A;  2HOD B;  2ZVN B;  4AAO A;  1FC2 C;  4EID A;  3U59 A;  1T3J A;  3N7N A;  2W27 A;  1CIH A;  5AVU B;  1AVY A;  2WSF H;  5B5E V;  1N50 A;  2E74 B;  2NPS C;  1JY3 P;  2CPB A;  1YIQ A;  3IR9 A;  1DEE G;  1KIL D;  1BSH A;  2P58 A;  5KLV E;  3RMZ A;  1PGJ A;  5GTI E;  3VN0 A;  1DVH A;  1S5L E;  3H1H J;  1VL2 A;  1BE3 D;  1JMB A;  1LGH B;  2OAR A;  1H9Y A;  1RF0 A;  3TNU A;  2A45 H;  2HR3 A;  4FA9 A;  5BU8 B;  3KDP B;  4L76 A;  1GZL A;  1C6S A;  1KFN A;  3GHG C;  1CIG A;  3P7K A;  4WQC A;  1S2E A;  3NMD A;  1XTC C;  1J3S A;  2N9J A;  1YTC A;  2D2C D;  1YHQ P;  2C1V A;  3CU4 A;  2AXT H;  3FX0 A;  2IX7 C;  3O1Y A;  1NTK E;  3MK7 B;  4BRY B;  1E79 H;  1SFC C;  3DP5 A;  3PXT A;  3S9O A;  1KOR A;  1X0T A;  2Y9Z A;  3VNW A;  4D6T E;  2ZOO A;  3H1K G;  2E75 B;  5DJQ B;  1KQS O;  4PV1 D;  3O0R C;  3SVW A;  2H7H A;  1S9K D;  2GC7 D;  1NTM J;  2E76 D;  2HYN A;  4C7N A;  5EFW B;  3FGA D;  1M1J B;  5DF5 A;  3B5N C;  3WUT A;  3SJL A;  1FI9 A;  1YJ9 P;  5B5E E;  3V6I A;  1DIP A;  4PD4 E;  1T6A A;  1FZE A;  3L75 J;  2LIT A;  2ZT9 C;  1MKM A;  1M8O B;  2J59 M;  1MG3 D;  1HGZ A;  2YKP A;  4XXL A;  1GK4 A;  1GL2 A;  1ZRT E;  1T8Z A;  1YIT P;  1CRJ A;  1IFP A;  3V2N A;  1RQU A;  3L37 A;  3OW2 O;  1PP9 D;  1QGK B;  3SWY A;  1H8A A;  3ZDM A;  3VMZ A;  4QMA A;  4FAN A;  1Z56 A;  2AI5 A;  2YO2 A;  3JBT B;  1BE3 G;  1NKZ B;  3P8C E;  1SQQ J;  1KN7 A;  2POH A;  4W80 A;  5KKZ B;  4Y5R A;  1IC2 A;  3TSI A;  2FFD C;  3T97 A;  1R0Q A;  3H1I D;  2N1T A;  3P8M C;  3L71 D;  1M1K Q;  2C1D A;  4ZNC A;  1RAP A;  4PV1 B;  1IQC A;  2IZ1 A;  1CHJ A;  1RHZ B;  2PFX A;  1IO4 A;  1C2R A;  2IYO A;  5TIS H;  1IK9 A;  2QM7 A;  2XTS B;  1SLQ A;  1JY2 O;  1S5L X;  3L4O A;  2BCC D;  1N2D C;  5H2F E;  3V2R A;  2NPS A;  3V2Q A;  3SFE C;  1A56 A;  3L35 A;  1TU3 F;  1LTA C;  1GDT A;  2QA4 P;  1LC1 A;  5K5G B;  4KT0 J;  4ZKU A;  1HVV A;  3L70 J;  2BEQ D;  1DW2 A;  5AW5 B;  3L73 J;  3VOP A;  2P7J A;  5APV A;  1I54 A;  1AKK A;  2C8S A;  1EZV I;  1SS1 A;  2JKV A;  3CXH D;  2O1J A;  3PXS A;  3RN1 A;  5CBN A;  2KLV A;  4N0K A;  1YTZ I;  4DOJ A;  3GHG A;  5APT A;  3H1J J;  1CIE A;  3A0H H;  2QEX P;  1X9V A;  1QVF O;  2HPC A;  1HF9 A;  1KYO H;  2VHD A;  5CBO A;  1CW5 A;  1EDJ A;  3RL0 D;  1KB9 H;  1OW8 A;  1HJB A;  2KI7 B;  3WUI A;  2W90 A;  4DJG A;  2H43 A;  1HUC A;  1ZR4 A;  2KIK A;  2PAJ A;  1SQV D;  1Q2N A;  1EC5 A;  3TK1 A;  2PCB B;  5AVQ B;  4HJG H;  5KLI B;  4GED B;  2BH4 X;  1PP9 G;  1SFC A;  2KOG A;  1SQP J;  3V4Q A;  4XFJ A;  1YQ3 C;  5CIF B;  3PJS K;  2OYO A;  2JJL A;  3H1K E;  2L4D A;  3I5C A;  2E76 C;  4WVZ A;  1H88 A;  3CX5 W;  1X8Y A;  2OYH C;  1NWQ A;  4UB8 V;  2K3R A;  3EFG A;  1HZU A;  3HUS C;  2KP8 A;  2HV4 A;  3L71 G;  4C7R A;  1DW0 A;  2IBZ D;  3B5N A;  3NTN A;  1CIF A;  2AEJ A;  1P84 H;  1NVO A;  1JY2 N;  3A0B V;  4UB6 V;  2K1A A;  1SQB D;  3V5B A;  1DII C;  3VP9 A;  1H31 A;  3G4S P;  2JP3 A;  2DVH A;  3M0D C;  3D70 A;  3RN0 A;  1EB7 A;  2ZXY A;  3RBX A;  1OX3 A;  3USS A;  2ZFC A;  1KIL E;  3GW6 A;  2FBW C;  2OQQ A;  3WUU A;  1N7S C;  3FWN A;  1VQO P;  3CCL P;  5AVY B;  3VMY A;  4GYD A;  4UB8 H;  1I8P A;  2FY8 A;  1BE3 E;  3BCC D;  1J1E C;  2K37 A;  3LW5 J;  1HJ5 A;  1Q7Y Q;  1CSV A;  1R5S A;  2P2U A;  2FFD A;  3A0B H;  3HQ7 A;  4DZO A;  1NGM B;  3TNU B;  3HQ8 A;  3PLN A;  2Y0D A;  1CHH A;  1SQX K;  1RZ6 A;  1GL2 D;  2NZ2 A;  2XDJ A;  1USE A;  2N18 B;  1COR A;  2G8Y A;  2C9N Y;  1SQV G;  4OH8 B;  3AE5 C;  1IRW A;  4IFM A;  2LXC B;  1DH3 A;  4KJM A;  3DR0 A;  3RK2 C;  2CE1 A;  1NAF A;  1YI2 P;  2B89 A;  1SQV K;  4OVN F;  2N1T D;  1PGO A;  1S9K E;  4C46 A;  4CPG A;  1X22 A;  3FXD A;  4UB6 E;  1Q86 Q;  2BAS A;  3CCE P;  2IBZ G;  4Y28 J;  3PHL A;  1CCR A;  1NML A;  1OCD A;  4H0J A;  4C7N B;  1FI3 A;  5AVR B;  1FZB A;  4WQ7 A;  2HG5 D;  2V07 A;  2WPQ A;  4GOF A;  2YIU B;  1HH0 A;  2O3J A;  3TGU J;  3EWK A;  2NPS D;  3HE4 A;  3W68 A;  1J1D B;  5KLV G;  1B7V A;  2FWL A;  1L2P A;  1PFI A;  2YMY A;  3H1H D;  1XTG B;  2QJY B;  1NJI Q;  3KZI H;  1PPJ D;  1SQB K;  1CSX A;  4OGQ C;  1PP9 E;  1QL1 A;  1CYI A;  3KHU A;  1GL2 B;  3O6Q A;  1JTH A;  3SWK A;  1H32 B;  4Z1M H;  1I8O A;  1DVV A;  2IFN A;  4AUW A;  3BCC G;  1NU1 J;  2R32 A;  3IFM A;  1LJ2 A;  2R5D A;  4WQB A;  1LTI C;  1E2R A;  1KYO I;  2OYH A;  3H1I E;  1PGQ A;  2Q6Q A;  1KB9 I;  1BL9 A;  3HUS A;  3ZIY A;  2QE7 H;  3L71 E;  3CXH H;  3T97 B;  1N73 C;  1NTK G;  3CD6 P;  2KNC A;  3WUV A;  2Q7C A;  5B6Q A;  4PJ0 V;  5KJ7 C;  5APX A;  1QL3 A;  3WFC C;  4EYY Q;  1NYH A;  1HJ0 A;  1VF5 C;  2BCC E;  3ZCF A;  5CCG C;  1OAE A;  1L0N K;  1AJY A;  3L74 J;  2MKV A;  2I8F A;  3GLM A;  3M97 X;  3CCJ P;  1L4A B;  1CI6 B;  2W83 C;  3L72 J;  4H13 B;  1N7S A;  2ZAE B;  5AUR A;  2IZ0 A;  3CYT I;  1FZA A;  1ZV8 A;  5GTH V;  1IFD A;  1VQN P;  1ZLL A;  2YO3 A;  1P84 I;  3B5N D;  1RH5 B;  1DX7 A;  1ZW0 A;  1LWU B;  1M60 A;  1KX7 A;  1LT9 C;  1KD1 Q;  1JDL A;  5CIH B;  2ZZS 1;  1JB0 J;  2RH0 A;  3SSU A;  4H0K A;  3VMX A;  3JSV C;  2ZT9 D;  3CL3 D;  4WQE A;  2FXP A;  4RES B;  2N9B A;  3GHG B;  4L3H A;  2HPC B;  3H1H G;  1SQV E;  1W5C E;  1ZR2 A;  1PPJ G;  5CIB B;  2N3Y A;  4K3I A;  3WFB C;  3H1L J;  3G71 P;  1Y8A A;  1W2L A;  4H0L B;  3OAK A;  2KS1 B;  5GTI H;  4U3F J;  1S5L H;  1SFC B;  2JEE A;  4U7J A;  2E43 A;  4L1Q A;  1KQG B;  1W5C T;  4FA4 A;  4H44 C;  4TT3 H;  1Q90 D;  1LTJ B;  1YJW P;  4PJ0 E;  1QVG O;  1IFN A;  3B71 A;  4AAN A;  1WVE C;  5AW3 B;  2M8R A;  1QLE D;  4L3G A;  2IBZ E;  4JQ0 D;  3DMI A;  3VRD A;  3P32 A;  2OGU A;  2Q5U A;  1OZH A;  1SQB E;  4PW9 B;  3O5C A;  2KSJ A;  2ORL A;  3L73 D;  4QAO A;  3AE7 C;  1R8E A;  2LXB A;  1H31 B;  1CYJ A;  5GTH E;  2RN0 A;  5APW A;  1U75 B;  1C75 A;  2J5U A;  2K9Y A;  5KTB A;  1N8R Q;  2ZT9 B;  3Q5S A;  1OW7 A;  3HRN A;  1WEJ F;  3CC2 P;  2PP6 A;  1RF1 B;  3BCC E;  3V4W A;  1GU4 A;  1NTM K;  3H1J D;  2FRC A;  1HCM A;  5B5E H;  2FYZ A;  2WTY A;  4JCG A;  1K9M Q;  4PD4 H;  2I1J A;  3TYY A;  1DD4 A;  2FFD B;  3BVH A;  1CRG A;  2JWA A;  1N73 A;  5BVZ A;  1L0N E;  1C6R A;  2BLF B;  1SQP D;  1PL5 A;  2PAC A;  1CSB A;  3D0W A;  5KJ7 A;  1KC8 Q;  1JY3 O;  2OTL P;  1ZN5 A;  4XYD B;  1JCC A;  2CA3 B;  1YJN P;  5CCG A;  5H2F V;  1VQ5 P;  4BXL A;  1KIL B;  4R4M A;  4MU8 A;  1I6E A;  1HTL C;  1SQQ K;  3H6P A;  2IYP A;  4I7Z B;  1VQ4 P;  1EDI A;  1YEB A;  3CXH I;  4EOT A;  2KYV A;  1RY3 A;  3CX5 D;  2QM8 A;  1EXJ A;  3E1I A;  1K8A Q;  2D0S A;  2MHM A;  2R3C A;  3RLM A;  1GW3 A;  3ZOW A;  3WU2 E;  2E74 C;  1ZOY C;  1LT9 A;  2WZ7 A;  1CTY A;  1M56 D;  3QWO C;  2FYN C;  155C A;  1HH7 A;  2WSE H;  4O1Q A;  1LTS C;  2AXC A;  3OA8 A;  4KMG A;  1OWA A;  2ZXX A;  3L73 G;  1UII A;  1A02 J;  3H1H E;  5H2F H;  2D2C B;  3NBS A;  3VTP C;  5B66 V;  3HE4 B;  1PPJ E;  1DEB A;  1N7S D;  2Y0C A;  1OXZ A;  1GDV A;  4WQ9 A;  4JF7 A;  1CYC A;  3ZBM A;  2AIU A;  2YCC A;  3O6Q B;  1K3G A;  1JTH B;  3KPE A;  1NHL A;  1EDK A;  3H1J G;  4DT0 A;  1KYO W;  5DFS A;  2PRR A;  2BEZ F;  2CE0 A;  2E76 B;  2XND H;  2WPR A;  1JO5 A;  1F1C A;  1PZQ A;  1IRV A;  3M9B A;  3MK7 C;  1GKS A;  1S1C X;  2YKQ A;  2Z5H A;  1JY3 N;  3HUS B;  1LS9 A;  5E79 V;  1RZ5 A;  2W6A A;  1U57 A;  1CRI A;  2OYI C;  1SP4 A;  1GW4 A;  2K88 A;  2Q3I A;  5AVT B;  2E75 C;  1CSW A;  3NFQ A;  5DJQ C;  1FJP A;  3RK2 D;  1SQP K;  4I6M C;  1YYC A;  2WVR A;  5IY5 1;  3G6E P;  3PH0 A;  4RO0 A;  1VQ8 P;  2E5T A;  1H0T A;  1SQX D;  4Y99 B;  3U1A A;  3R2P A;  1N7S B;  5C9M A;  1NH4 A;  4YPC A;  5APQ A;  4N6J A;  3ZOX A;  2QJP C;  4K3A A;  1FZC C;  5CIG B;  1J1E B;  4FA1 A;  5B66 E;  1CTJ A;  3MGN A;  3JC2 2;  2O01 H;  4I1L A;  1LP1 A;  4NPF X;  2QIW A;  3KXD A;  1E5W A;  4GOD A;  2BPB B;  3PP5 A;  4OGQ D;  1VQM P;  1NU1 D;  1QX8 A;  2W8Z A;  4IOI H;  4JYB A;  1M7L A;  4YXW H;  4O1W A;  1L0L J;  2LIR A;  3H1I G;  3Q2Y A;  1BCC J;  4WWI A;  3HTK A;  3O20 A;  2W6J H;  4PD4 I;  3RK2 B;  2HOD A;  4WB4 A;  5E79 E;  1MUU A;  2IFM A;  2K9J B;  2V4H A;  1YFC A;  1NO4 A;  2XNX A;  2J58 A;  4GDO A;  2FYU J;  1E8E A;  1AOF A;  5KJ7 D;  2BCC G;  2WPS A;  1KX2 A;  3L74 D;  2L5G B;  1VF5 D;  1E29 A;  3L72 D;  2DGE A;  1G1J A;  3RL0 B;  5CCG D;  3L73 E;  1NIR A;  4HKZ H;  2NRG A;  4XA4 A;  2AEM A;  1L9B C;  1VYD A;  4AQR D;  2N3B A;  1A2S A;  1RE3 A;  1GD2 E;  3S4R A;  1J2J B;  4AYC A;  1SQX G;  3TDK A;  2L91 A;  1IFJ A;  5C0Z A;  1GMJ A;  4OGQ B;  1S72 P;  1CRY A;  4UB6 H;  1PP9 J;  4N3Y B;  3H1J E;  3CC4 P;  1BGY J;  3E1R A;  3MHV A;  1EZV D;  2M5A A;  1L0N D;  4EIF A;  1LTB C;  2KSE A;  3A9F A;  1HGV A;  3RL0 g;  2DW3 A;  5AW1 B;  3L4M A;  1W2B O;  3H1L D;  1FBM A;  4L74 A;  3KQG A;  4LC1 A;  1H33 A;  4BRY A;  2E5Y A;  1SQP E;  2ZVO B;  2GIW A;  3GG2 A;  4U3F D;  3L71 J;  4WY4 C;  1N73 B;  2IDB A;  2KZJ A;  3D6Y A;  2OYI A;  3Q1M A;  4ZMD A;  4JPZ B;  2QJK B;  1NU1 G;  2W6B A;  3C8V A;  3Q5P A;  2SPZ A;  4HH2 A;  2EXV A;  1SVF A;  1HZV A;  1OMI A;  1M90 Q;  4J20 A;  3SXT A;  1VF5 B;  5AW8 B;  1NU1 K;  4H44 D;  5CCH C;  3CXH W;  3B8E B;  3CX5 E;  1BSN A;  4RKU J;  1S3J A;  1R5L A;  3OCD A;  4MN4 C;  1SQB G;  2C2C A;  1AVO A;  4JYC A;  4WQD A;  4YE1 A;  3IF4 A;  1FZC A;  3GF3 A;  3VYM A;  3L74 G;  4KHX A;  2QSI A;  2WSC H;  1LT9 B;  1VQ7 P;  1M6Z A;  2KUB A;  1AV1 A;  4HYT B;  3L72 G;  3AE8 C;  2M3B A;  2R44 A;  2Z4E A;  3WFD C;  3OA8 B;  1NTZ J;  4EI2 A;  3U1C A;  3CWB J;  1OVU A;  5AW9 B;  1IFI A;  3AE6 C;  5APY A;  1JNM A;  3AED C;  3RGU A;  3RK3 C;  1JOC A;  3H25 A;  2N1T B;  4WQA A;  4AAM A;  3JCU E;  1EZV G;  1L0N G;  1KB0 A;  2C1D B;  1U7J A;  1NKN A;  1FOC A;  1ZME C;  4EIJ A;  1GQ1 A;  2ZXE B;  3H1L G;  3PH2 B;  1GTW A;  3CC7 P;  5KAI E;  3AE3 C;  3AEA C;  5KAF E;  4U3F G;  2PCC B;  2BH5 X;  5CIC B;  4FAV A;  2V08 A;  1NTM D;  2A06 D;  3A7O A;  1C52 A;  2NPS B;  1HBW A;  4GKG A;  2OTK E;  3UIA A;  5KLV J;  2C9L Y;  2WPV B;  2A45 G;  3L75 D;  1WT6 A;  1FZG A;  1X79 B;  1SQX E;  1FAV A;  1FU1 A;  1CC5 A;  2O01 N;  4N78 D;  1LTG C;  1T3U A;  4PJ0 H;  1QN2 A;  2YIU C;  4NFG B;  2QVA A;  2E74 D;  2ZON G;  3BCC J;  4IL6 V;  2PGD A;  3ZOY A;  1DT1 A;  2QJY C;  1IZL 0;  4IFF A;  1SQQ D;  3HD7 C;  1COT A;  2C1U A;  1OW6 A;  3OA7 A;  4BWN A;  4EIE A;  2WMM A;  3AEE C;  5AW2 B;  1LP1 B;  2P10 A;  1URQ C;  5GTH H;  1CZQ A;  1I6D A;  1EXI A;  5APU A;  4WY4 A;  1NTK J;  1N9C A;  1NU1 E;  3HE5 A;  451C A;  1OIP A;  1NAY A;  1Y47 A;  2OZ1 A;  2H89 C;  4D6T J;  1FS0 E;  1CHI A;  1FOS F;  4AAL A;  5CCH A;  4A7P A;  4NPD A;  1C6O A;  3RK3 E;  2Y9Y A;  1KYO D;  3B5N B;  5CID B;  4YXD C;  1KB9 D;  1L9J C;  4NPE A;  3II6 A;  3MP7 B;  4RSZ A;  1K04 A;  3L70 D;  2N9I A;  1YNR A;  3WU2 V; 
#chains in the Genus database with same CATH homology
 1K3G A;  3RN0 A;  1EB7 A;  1KYO W;  2ZXY A;  5DFS A;  1K3H A;  2N18 C;  3GW6 A;  2CE0 A;  2FYN B;  351C A;  3HQ6 A;  2AXT V;  1F1C A;  1IRV A;  4GYD A;  3MK7 C;  1I8P A;  1GKS A;  2RMZ A;  1KV9 A;  1LS9 A;  2CA4 B;  5E79 V;  3BCC D;  2GB8 B;  1HJ5 A;  4Q5P A;  1RZ5 A;  1CSV A;  1YCC A;  1CRI A;  1QL4 A;  4LJI A;  2B4Z A;  1LMS A;  2MTA C;  2CXB A;  2YK3 A;  1CSW A;  2JQR A;  5DJQ C;  3HQ7 A;  1MZ4 A;  3TF5 A;  2ZBO A;  3HQ8 A;  1P84 D;  2D0W A;  3PLN A;  3PTZ A;  5IY5 1;  1M70 A;  2Y0D A;  2B11 B;  2C9X B;  3NWV A;  1CHH A;  1F1F A;  1IO3 A;  3ZOO A;  1RZ6 A;  1S6V B;  3NBT A;  1SQX D;  1ZZH A;  2N18 B;  1COR A;  1IRW A;  5GTI V;  1MG2 D;  4V2K A;  5C9M A;  1S5L V;  2B0Z B;  1L0L D;  1H33 B;  2Q3E A;  3DR0 A;  1BCC D;  1CCH A;  3ZOX A;  2CE1 A;  2GC4 D;  5CIG B;  4FA1 A;  4AX3 A;  1CTJ A;  1LFM A;  4FB1 A;  2YQB A;  2BPB B;  2FYU D;  4FA5 A;  1YEA A;  1CSU A;  3PHL A;  1CCR A;  1NML A;  1NU1 D;  1OCD A;  4H0J A;  1FI3 A;  1DIQ C;  1FHB A;  4WQ7 A;  5TJH A;  2V07 A;  3H1K D;  4RJT A;  1N15 A;  2YIU B;  4O1W A;  2LIR A;  2O3J A;  1HRC A;  3OCD B;  1CNO A;  3O20 A;  1B7V A;  2FWL A;  2QJP B;  1CO6 A;  3H1H D;  3WFE C;  2Y0E A;  2QJY B;  1NNO A;  1PPJ D;  2K9J B;  4AAO A;  4P4Q B;  1CSX A;  1FJ0 A;  1YFC A;  3KHU A;  1CYI A;  5TIS V;  3SWS A;  4EID A;  1H32 A;  1BGY D;  1H32 B;  1E8E A;  1I8O A;  1AOF A;  1AYG A;  1DVV A;  1CIH A;  5B5E V;  1KX2 A;  1N50 A;  3L74 D;  1RAQ A;  1AOQ A;  1QKS A;  4WQB A;  1E29 A;  3L72 D;  1YIQ A;  1E2R A;  2DGE A;  1BL9 A;  1NIR A;  3RMZ A;  3ZIY A;  1L9B C;  1VYD A;  1DVH A;  2N3B A;  1A2S A;  1BE3 D;  1YIC A;  5B6Q A;  4PJ0 V;  1H9Y A;  2KNC B;  3TDK A;  2L91 A;  5C0Z A;  1QL3 A;  3WFC C;  3PRJ A;  4FA9 A;  1CRY A;  3VMA A;  1C6S A;  1N90 A;  3A0H V;  4DY9 A;  3ZCF A;  1OAE A;  1CIG A;  3FWL A;  4WQC A;  1DW1 A;  1EZV D;  1L0N D;  4EIF A;  2I8F A;  1J3S A;  3M97 X;  3A9F A;  2N9J A;  1GU2 A;  1YTC A;  1CTZ A;  5AUR A;  3L4M A;  3CYT I;  1FI7 A;  3H1L D;  2C1V A;  3HQ9 A;  3CU4 A;  1H33 A;  5GTH V;  3SLE A;  3GG2 A;  2GIW A;  3O1Y A;  4U3F D;  3TGU D;  3MK7 B;  1M60 A;  3DP5 A;  1KX7 A;  3PXT A;  1JDL A;  2QJK B;  5CIH B;  2ZZS 1;  5CYT R;  3VNW A;  1C7M A;  1CRC A;  2ZOO A;  4H0K A;  2EXV A;  5DJQ B;  1HZV A;  3O0R C;  4J20 A;  3SXT A;  3SVW A;  4WQE A;  1H1O A;  1FCD C;  2GC7 D;  1C2N A;  1NTZ D;  4L3H A;  3CXH W;  3CWB D;  5DF5 A;  3SJL A;  1FI9 A;  5CIB B;  2N3Y A;  4K3I A;  3WFB C;  2KS1 A;  3OCD A;  1W2L A;  1GIW A;  1HJ3 A;  2C2C A;  4WQD A;  4YE1 A;  2LIT A;  1I55 A;  3VYM A;  4L1Q A;  1MG3 D;  1M6Z A;  4XXL A;  1W5C T;  4FA4 A;  4EDF A;  2OZ1 B;  1CRJ A;  4AAN A;  1WVE C;  3WFD C;  1PP9 D;  4L3G A;  3OA8 B;  5EXQ A;  3DMI A;  2BGV X;  4FAN A;  2AI5 A;  3VRD A;  3JBT B;  4PW9 B;  2N9Y B;  5KKZ B;  4Y5R A;  3O5C A;  1R0Q A;  2ORL A;  3H1I D;  3L73 D;  4QAO A;  3ITK A;  1H31 B;  1CYJ A;  5KLV D;  2RN0 A;  3L71 D;  4WQA A;  4AAM A;  1U75 B;  1C75 A;  2C1D A;  1RAP A;  1H9X A;  1KB0 A;  2C1D B;  1FOC A;  2B10 B;  1IQC A;  1GJQ A;  1WEJ F;  1CHJ A;  1GQ1 A;  1C2R A;  3PH2 B;  2XTS B;  2PCC B;  2BH5 X;  5CIC B;  4EIC A;  3PXW A;  3H1J D;  2V08 A;  4FAV A;  3L4O A;  2BCC D;  1NTM D;  4PWA A;  2FRC A;  1HCM A;  1KIB A;  1HJ4 A;  2A06 D;  1A56 A;  1C52 A;  1A8C A;  4JCG A;  1LC1 A;  2BCN B;  1DW2 A;  1CRH A;  1CRG A;  2JWA A;  1C6R A;  1I54 A;  2BLF B;  1AKK A;  1SQP D;  3L75 D;  1CXC A;  4WQ8 A;  2PAC A;  1NTK D;  2C8S A;  1CC5 A;  3CXH D;  3PXS A;  3RN1 A;  3CP5 A;  1QN2 A;  5KAI V;  4XYD B;  4N0K A;  5KAF V;  4NFG B;  4D6T D;  2CA3 B;  5H2F V;  1CED A;  2ZON G;  1CIE A;  1DW3 A;  4IL6 V;  2VHD A;  3ZOY A;  4MU8 A;  1DT1 A;  1NMI A;  1I6E A;  1IZL 0;  3KZI V;  5CIE B;  1YEB A;  3WUI A;  1SQQ D;  1SQV D;  1COT A;  2C1U A;  3TYI A;  4EIE A;  2PCB B;  2B12 B;  3CX5 D;  5KLI B;  4GED B;  1ETP A;  2BH4 X;  2D0S A;  2MHM A;  1I6D A;  4PD4 D;  3RLM A;  3ZOW A;  1N9C A;  5CIF B;  451C A;  2QG4 A;  1CTY A;  2L4D A;  2OZ1 A;  3CX5 W;  155C A;  1HH7 A;  3X39 A;  4O1Q A;  3ORV A;  1CHI A;  4UB8 V;  1ZRT D;  3C2C A;  3OA8 A;  4KMG A;  1HZU A;  1LC2 A;  1HRO A;  2HV4 A;  2JTI B;  4AAL A;  3NBS A;  5B66 V;  4A7P A;  1DW0 A;  2IBZ D;  2Y0C A;  1I5T A;  1GDV A;  1C6O A;  1CIF A;  1KYO D;  5CID B;  3A0B V;  1KB9 D;  1L9J C;  1U74 B;  4UB6 V;  4WQ9 A;  4RSZ A;  1CXA A;  1SQB D;  1CYC A;  3ZBM A;  1DII C;  1QYZ A;  3L70 D;  3WC8 A;  1H31 A;  2N9I A;  1YNR A;  2DVH A;  3WU2 V;  2AIU A;  2YCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...