1BCCD

Cytochrome bc1 complex from chicken
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGPLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSVREGLYFNPYFPGQAIGMAPPIYNDVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLVPLVYYMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 59
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1bccD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1bccD01
2PCCB 1DT1A 1CHJA 2ZZS1 1LC1A 3HQ8A 2OZ1B 3HQ6A 2D0WA 1LFMA 4PWAA 3NWVA 1FI9A 4AAOA 1KYOW 1K3HA 3PXTA 1CEDA 1C52A 1CHIA 1KX2A 2ZOOA 1YEBA 3L75D 1DVHA 1I8OA 3CP5A 2ZXYA 1H32B 1CCHA 2HV4A 1WVEC 1KIBA 4H0KA 1IZL0 1IQCA 3RN1A 2RN0A 2C1UA 4K3IA 1EB7A 1CORA 1QL4A 2N9JA 2BCNB 1FOCA 1KX7A 2XTSB 2V08A 1NMLA 1C6SA 3VMAA 1YNRA 1LMSA 2IBZD 3CU4A 3ITKA 1H9XA 3TGUD 2MTAC 1CIEA 1H33A 1CRHA 3HQ9A 1NTZD 2FWLA 1CRJA 1SQQD 2B4ZA 4O1QA 3WFDC 1CHHA 3A0BV 4KMGA 1M6ZA 3OCDB 2K9JB 5AURA 3WUIA 5CIEB 1HJ4A 4WQAA 4P4QB 1SQPD 5TISV 1IRVA 2PACA 1LC2A 1CRGA 5CIFB 1MG3D 2BGVX 3DMIA 1SQBD 1M60A 1YEAA 2OZ1A 3H1HD 1HZUA 3ZBMA 2YK3A 1KYOD 2B11B 2CE0A 1N15A 3WFCC 3CWBD 1S5LV 2DVHA 4FAVA 1ZZHA 1NNOA 3RMZA 1H32A 3GG2A 1N9CA 1H31A 2JTIB 3ORVA 4JCGA 4FB1A 4V2KA 1CNOA 2ORLA 5DFSA 1CXCA 5CYTR 3VRDA 2Y0DA 3ZCFA 1CRIA 1HJ5A 1NTKD 1SQVD 1CO6A 1NIRA 1CXAA 1M70A 1DVVA 2B10B 3SJLA 3SXTA 5CIDB 1U74B 3H1KD 4L1QA 2YIUB 2B0ZB 3PXSA 2ZONG 3L4OA 4WQ9A 3H1ID 1CIHA 3RLMA 1MG2D 5CIBB 4UB6V 1C6RA 1FI7A 155CA 4Q5PA 4XXLA 1I54A 3CX5D 1DW1A 4PW9B 1RAPA 3A9FA 351CA 1NMIA 1F1CA 3M97X 4LJIA 1CIGA 2CE1A 3TYIA 1IRWA 1QL3A 1OCDA 1NU1D 3L71D 3HQ7A 3H1JD 1HZVA 451CA 1GDVA 3SVWA 2N18B 1EZVD 4AANA 3ZIYA 3A0HV 1CTYA 4FA1A 1C6OA 5GTHV 1L9BC 4EIEA 1ZRTD 5CICB 1FJ0A 1PPJD 5KAIV 3C2CA 4D6TD 2DGEA 1H9YA 5C9MA 1YIQA 1CTJA 3O0RC 3PH2B 1HH7A 4AALA 1CSXA 1FI3A 5EXQA 4EICA 1C7MA 1QKSA 1HCMA 4UB8V 4FA9A 1FCDC 1L0ND 4EIFA 1CSUA 1I6EA 2GIWA 2AIUA 1YFCA 1PP9D 4QAOA 2A06D 1H33B 2QJYB 1S6VB 1GQ1A 1SQXD 2CA3B 2Q3EA 3PXWA 2CXBA 2KNCB 5B6QA 2D0SA 2FYNB 2C1DA 3CX5W 4MU8A 1RZ5A 3WU2V 1KB9D 2BCCD 4NFGB 2AI5A 2JWAA 4A7PA 1YCCA 3RN0A 1CYIA 1CCRA 3O5CA 1CYJA 4J20A 1VYDA 1R0QA 4PJ0V 5GTIV 2B12B 4O1WA 3PRJA 4PD4D 3PHLA 5C0ZA 1OAEA 2YCCA 3ZOYA 1AOFA 1AKKA 3ZOOA 1C2RA 3DR0A 5E79V 3OA8B 1GU2A 1IO3A 4WQCA 4DY9A 3FWLA 2YQBA 1NTMD 1CC5A 4FA5A 2I8FA 1HROA 1DW2A 3SLEA 4EDFA 4H0JA 4IL6V 4Y5RA 2QG4A 3JBTB 3O20A 3H1LD 2Y0EA 3KZIV 4YE1A 1DW0A 3OCDA 2LITA 3WFBC 2L4DA 2N18C 1CYCA 1ETPA 1BE3D 3CXHD 2GC4D 2BLFB 1KB0A 1K3GA 2FYUD 1RAQA 4WQEA 2JQRA 1LS9A 1A2SA 1P84D 3VYMA 2RMZA 3DP5A 3CYTI 1E8EA 5KLVD 1A8CA 3L70D 5B5EV 3BCCD 4N0KA 2AXTV 1GIWA 3ZOWA 5DF5A 1W2LA 1AOQA 1DIIC 1DW3A 1B7VA 1KV9A 2O3JA 1A56A 1GJQA 4RSZA 4L3GA 3VNWA 2KS1A 2MHMA 1I5TA 2QJPB 1N90A 3L74D 2GC7D 2C1VA 2C1DB 4GYDA 4WQ8A 2C8SA 3OA8A 3SWSA 1I6DA 2QJKB 1E29A 2ZBOA 5KLIB 1BGYD 1HRCA 2L91A 3L72D 4WQBA 2N3BA 1DIQC 1COTA 1MZ4A 3CXHW 4XYDB 4U3FD 1AYGA 5B66V 3KHUA 1BL9A 1BCCD 1YICA 1I55A 3L4MA 3WFEC 1C2NA 1RZ6A 1CSVA 3PTZA 3ZOXA 3WC8A 3TDKA 5KAFV 3MK7C 2Y0CA 1QN2A 4AAMA 1YTCA 1WEJF 1W5CT 3NBTA 3GW6A 4FA4A 2GB8B 1HJ3A 1CSWA 1CRCA 4WQ7A 1C75A 2EXVA 1H1OA 1JDLA 2C2CA 1E2RA 2PCBB 2BPBB 4RJTA 3MK7B 4EIDA 1I8PA 2BH4X 4L3HA 3PLNA 1N50A 1GKSA 2CA4B 4FANA 1CIFA 1CTZA 2LIRA 1FHBA 4GEDB 5DJQC 2FRCA 5CIGB 3O1YA 3L73D 2V07A 3X39A 4WQDA 5CIHB 3NBSA 5IY51 1F1FA 1QYZA 2C9XB 2N9IA 5DJQB 2VHDA 5KKZB 3TF5A 1H31B 1CRYA 2N9YB 1L9JC 4AX3A 1U75B 2BH5X 5H2FV 2N3YA 5TJHA 1J3SA 1L0LD
chains in the Genus database with same CATH superfamily
2PCCB 1DT1A 2FFDA 2LXCB 1MZ9A 1PGPA 1LC1A 2IBZE 1YJNP 1LFMA 4PWAA 1KILC 1SQBE 2W6JH 4AAOA 1KYOW 1K3HA 1CEDA 1C52A 2OYHB 2WPQA 2KUBA 2ZXYA 3AE5C 3H25A 1FJKA 1JUNA 4H0KA 4HJGH 3MTUE 2VRSA 3A0BH 5KKZC 1J1DC 3AECC 4H13C 4K3IA 1QL4A 5CHXA 2QJYC 3E1RA 3Q1MA 4H0LC 1KX7A 1NMLA 2IBZD 3CU4A 3HTKB 2N1TB 1PIXA 1H33A 1OW8A 1OVVA 2J58A 3D71A 3WFDC 1HVVA 1FDMA 5AURA 3AEAC 1M7LA 4WQAA 1MKMA 5TISV 1LC2A 1QGKB 3RK2D 3E7KA 1AA0A 1VQLP 3GHGB 2BGVX 1FZFA 1S72P 2W27A 1K9MQ 3NTNA 3CCSP 2CE0A 3CWBD 5AW4B 1L0LE 1ZZHA 1NNOA 3RMZA 1CZQA 3L35A 3JCUH 1NTZJ 1JCCA 1H8AA 3ORVA 2D2CC 3KYQA 3BRVB 1CNOA 3RGUA 2ORLA 3H1JG 5CYTR 5AVSB 3ZCFA 2NZ2A 1JM0A 1NIRA 3HD7B 3SXTA 1ZOYC 5CIDB 1SQXE 3D6ZA 3H1KD 1PL5A 1BCCG 1FBMA 2W6BA 2AEFA 2Y9YA 3U59A 4JQ0D 5CCHA 1HJBA 4WQ9A 1S3JA 1MG2D 1RF1A 4UB6V 3HD7C 3AE3C 1N7SB 3LIEA 4DZOA 3NFQA 1LP1B 1NGMB 4ASVA 1AJYA 2G3AA 2BCCG 3M97X 5KJ7D 4XE5B 1GL2C 1VF5B 2NPSD 1FZAA 1KYOE 2CE1A 1KB9E 2BCCE 1FZCA 1X9VA 3B5NC 3L4FA 3G71P 1HZVA 1VQNP 1GDVA 4AQRD 3A0BE 4AANA 3ZIYA 1FJPA 4FA1A 4ZKUA 5GTHV 3G9RA 1L0NJ 1KZUB 3V4QA 1FJ0A 1PPJD 1SQVE 2DW3A 4D6TD 2A06G 1H9YA 2N1TD 1KD1Q 3O0RC 1IFIA 1JY3N 4L75A 3GF7A 3NXSA 3P8CE 3LW5H 2R44A 1FI3A 1HGZA 4EICA 3D6YA 1QKSA 1HCMA 3CL3D 3W68A 3H1JE 1IK9A 1I6EA 2GIWA 1PP9D 5AVUB 1L4AC 5GTIH 1SQQJ 1GQ1A 4H13B 1NTZG 1LT9C 1LWUB 2QSIA 3LIDA 2FYNB 2C1DA 2FXMA 2WTYA 1SQXK 1CYIA 2IBZI 4W7ZA 1KQFB 3V2RA 1Q7YQ 1CCRA 1R0QA 4PJ0V 5KTBA 2JP3A 1ZMEC 1E79H 3AE1C 4H44C 3KZIH 1OAEA 2AXTE 1C2RA 3AEFC 3EWKA 5B5EE 1KN7A 3VYIA 5E79V 1BDCA 1SQQE 1QEXA 1SFCD 1GW3A 3FWLA 2YQBA 1NTMD 2I8FA 1FDOA 4UB8H 2FFDC 2GUVA 3KZIV 1ZN5A 3WFBC 2L4DA 2QVAA 3L75J 1EXIA 3L74J 1SQVK 3CXHD 1S5LX 2M3EA 1NJIQ 2BLFB 1KB0A 1PP9J 2JQRA 1LS9A 1A2SA 1P84D 1VF5C 2GUSA 1NU1G 3VMXA 3AEEC 2WPVB 1A8CA 4YXWH 2GM4A 3M06A 3BCCD 1IFMA 2FYUG 3SSUA 1FZGA 1L4AA 1B7VA 2OYHC 1Y9BA 5EFWB 5CJ4A 2QJPB 2GC7D 1GU5A 3BRTB 3C9IA 1BE3E 2C8SA 1I6DA 3WU2E 3MP7B 3TYYA 2R3CA 5CCGA 3RL0C 2ZBOA 1HRCA 3H32B 3S4RA 5AW9B 4WQBA 1NWQA 1COTA 4XA4A 1Y8AA 2V7QH 2OYIA 2XU6A 1BL9A 5AW1B 4GT1A 4Y28J 1RHZB 3L4MA 2A45H 1M1JA 1X22A 4N78E 2HLOA 1EDIA 3PTZA 1GU4A 3WC8A 3PJSK 2WT7B 2PP6A 3SWKA 3CD6P 2R3SA 2K1AA 1YTCA 4FA4A 2AXTH 1HJ3A 1HTLC 4RO0A 1KYOI 1C75A 2EXVA 1KB9I 3CXHE 1H1OA 1CW5A 1JDLA 2C2CA 3L73G 1S5LH 2J5UA 2YKOA 4WY4D 1YHQP 4EIDA 1D7MA 5DJTB 5KLVJ 1M8OB 3HRNA 3PLNA 1GKSA 3L70E 2IX7C 2NPSA 3PH0A 2LIRA 3O6QB 3L73J 4IFFA 2FRCA 1Q2NA 2OTKE 2ITAA 4PD4I 2V07A 3X39A 2QM8A 4I6MC 3P32A 3TNUB 5GTIE 4WY4A 1VDFA 4U3FE 1QYZA 3WUVA 2E76C 3H1JJ 1HBWA 2MKVA 2KXPB 3W67A 2ZXXA 2N9YB 1L9JC 5H2FV 2N3YA 1J3SA 2KNCA 1DD4A 3NWVA 5AW5B 3PXTA 3L75D 4HB1A 3L73E 3H1LG 1GTWA 2HV4A 1JY2P 1KILD 1HUCA 2Z5IA 2ZYAA 2E74C 3H1KE 1IQCA 2CK3H 5AW7B 1EB7A 2N9JA 3FXEA 3G4SP 1Q86Q 2BEZF 2BCNB 1FOCA 3WUUA 4WY4C 4L76A 1VQ7P 1C6SA 3VMAA 1YNRA 3V2QA 1H9XA 3TGUD 3MIWA 4OVNF 2HR3A 3A0HE 1CRHA 4Y99C 2FWLA 1CRJA 1EZVI 4IOIH 4DJGA 4OWFA 1L4AD 1FOSF 5H2FH 3QWOC 1JOCA 3M9QA 2K88A 1YIJP 2IPPA 3CCLP 3RK3B 3GF3A 1PGOA 3CXHH 4HYTB 5CMZA 1Q90D 5KAFE 5AW0B 2R5DA 4NPDA 2N1TA 1EC5A 3DMIA 1M60A 3I55P 2OZ1A 3IFMA 3GHGA 2E75D 2YKPA 1GK4A 1LTBC 2KYVA 1RE4C 1OW6A 1KYOD 3CCVP 2DVHA 3L71E 1L4AB 5APTA 1A02F 1FS0E 1YBKA 1N9CA 3M91A 3U1AA 5L8RJ 4KJMA 3CC4P 4FB1A 1QL2A 1R5SA 3BCCE 1CXCA 3VRDA 2Y0DA 1CRIA 1SQPJ 4EOTA 2FFDB 1LTIC 4BRYA 4RKUJ 1M70A 2B10B 1J2JB 4JBZA 1HF9A 2YIUB 4OGQD 3WU2H 2H89C 2Q9IA 1N73B 3V6IA 3M9BA 4OGQB 2O1KA 1TU3F 3H1ID 1CIHA 3RLMA 1SVFA 4I7ZB 1IFPA 3L37A 155CA 1IJDB 4XXLA 2KK7A 1LTJB 1I54A 1FAVA 2A06E 2WT7A 3CX5D 2FYZA 1RAPA 2G8YA 2I1KA 1LGHB 1XTGB 1RQVA 1IRWA 1OCDA 1K04A 2IZ1A 451CA 1OW7A 3SVWA 1WT6A 1YJWP 4ZMDA 1GL2D 1CTYA 2E5YA 1C6OA 1LTSC 1N2DC 1HH0A 5CICB 2K37A 2M5AA 2DGEA 3SFEC 5C9MA 1KQSO 1L0NK 3FWNA 3V2NA 3JSVC 4AALA 2C9NY 1CSXA 1C7MA 2WWWA 1OX3A 1NVOA 3H1IE 3IR9A 3T97A 3FXDA 1CSUA 4PD4E 2HFED 2A06D 1H0TA 3Q2YA 1GMJA 1PPJG 4B86A 1UIXA 2KNCB 5B6QA 2LXBA 3WU2V 2I8DA 1FE6A 1T2KD 1OMIA 2AI5A 3II6A 1NTKK 1CYJA 1VL2A 1AV1A 1VQ4P 2YO2A 3V4WA 1S9KD 2A45G 3MHVA 2KP8A 4YXDC 3PRJA 1M56D 1R8EA 3PHLA 1QVGO 1BGYJ 3AE2C 2LKMA 2E5TA 1R5LA 1KQLA 5K5GB 2Q5UA 2RH0A 3EQ2A 1RE3C 1LTJC 3LW5J 2E76B 2R32A 2XKMA 5CCHD 5AVXB 1CC5A 3CI9A 1IZNB 1EDKA 1M57D 3L75G 3C1LA 1LP1A 4H0JA 2BCCJ 2YO3A 3JBTB 1ZP0C 2H7HA 2B88A 5APXA 4YE1A 1X8YA 4D6TG 2OQQA 2WQYC 4PV1B 1DW0A 1S4XA 4K35A 4N3YB 2LITA 5AVWB 3H1HG 1IO4A 5AVYB 1FC2C 1IFNA 1LJ2A 2HODA 1RAQA 3Q5SA 3R2PA 3MUDC 5E79E 1GDTA 2QEXP 2O01J 2WSSH 1E8EA 2Z5HA 1GL2A 2QRXA 5B5EV 2JKVA 4N0KA 5CBNA 2AXTV 3T97B 1YITP 1W2LA 1AOQA 1X0TA 2IFNA 2JR8A 2LR2A 1VF5D 2E43A 3BVHA 2I1JA 4NPEA 4RSZA 4L3GA 1I5TA 1N90A 2C1VA 3VN0A 1ZW0A 1Q82Q 2AEJA 2C1DB 3EFGA 4GYDA 1N7SA 1SFCB 3OA8A 3AEDC 1LT9B 2YNYA 1NTKG 4PV1C 4HH2A 1FDIA 1BGYD 1W5CE 2IFMA 1NTKE 1VQKP 2WSFH 2Q7CA 2H88C 3HE4B 5APWA 1MZ4A 3CXHW 1AYGA 4JF7A 1EDJA 4C46A 1I55A 3WFEC 1PGQA 4WY4B 1T6AA 1BSHA 2E42A 2SPZA 2Q3IA 1MV8A 3B71A 3ZOXA 2W6AA 5KAFV 1RY3A 2Y0CA 4AAMA 5B5EH 3V5BA 2W8ZA 4BXLA 1ZXGA 3CC2P 1BCCJ 3BCCJ 1NTKJ 1E2RA 4TLFA 2BPBB 4YPCA 2Q1KA 4ZNCA 3MK7B 3AEBC 2M5AB 4JYBA 1I8PA 1G1JA 2BH4X 4L3HA 2B87A 1EZVG 1N50A 1NAYA 3A0HH 3M0AA 3HTKA 2FKWB 2K9JA 1JNMA 1BGYE 1FHBA 1PP9E 2WVRA 1N7SD 2WZ7A 3RK3C 1FZEA 4H13D 1RH5B 1F1FA 2C9XB 3S1KA 1N73A 1H31B 4R4LA 4UB6E 3L70G 1CRYA 3KQGA 2BH5X 2JWDA 1RQUA 1L0LD 1FZCC 2P67A 1L0NG 3EFFK 3BATA 2QIWA 3HQ8A 2OZ1B 2D0WA 2OTLP 1FI9A 5KAIH 1CHIA 2ZOOA 3KPEA 4LC1A 3CP5A 2M8RA 3IAOA 5KLVK 3C8VA 2WSCH 1KFMA 1KIBA 1IZL0 3A3YB 2HG5D 3RN1A 1DEBA 2HPCA 2O01H 3KXDA 3RK3D 2ZVOB 2C1UA 1M1JC 4GKGA 1IC2A 1N7LA 4U3FJ 2XTSB 3P7KA 1N8RQ 1LMSA 4Y99B 5AVVB 4NPFX 2K9YA 2QJKC 1M1JB 4JPZB 1SQPK 2Q6QA 4QMAA 3CMEP 5TISE 4HKZH 1CHHA 3S9OA 1G2CA 5CIEB 1HJ4A 3I56P 3IN6A 3Q5PA 1IRVA 5APUA 3SFDC 4CPGA 5CIFB 2NPSC 2HODB 1MG3D 4W7YA 1SQBD 3H6PA 2QA4P 1J1DB 3D70A 3HD7D 1JY2N 2B11B 1GZLA 1N15A 3M0DC 4GIFA 3VTPC 3CCJP 4H0LD 4FAVA 3PP5A 1NU1E 3GHGC 4LGDE 2P2UA 3MD0A 1NTZE 1H32A 2WSEJ 4DT0A 1YQ3C 2JTIB 4JCGA 1LWUC 5DFSA 1ZRTE 1H88A 1HJ5A 2A45I 1CI6B 1NTKD 3CPWO 2ZVNB 1CXAA 5BU8B 1A02J 5AW2B 1KMIZ 1EQ7A 4L1QA 2B0ZB 1MUUA 2PRRA 4GDOA 2JEEA 3PXSA 4IFMA 2ZONG 1X79B 3RBZA 2AXCA 1C6RA 1FI7A 4AUWA 3H1IJ 3M9HA 1L0LG 2ZYGA 4PW9B 3A9FA 1NH4A 1NAFA 2D2CB 351CA 1OVUA 1JB0J 2O1JA 1NMIA 1F1CA 1YTZT 2CPSA 4OH8B 2OYHA 1CIGA 3TYIA 2R5BA 2XNXA 3CWBE 1JTHA 1SQVG 1S1CX 1NU1D 3SWFA 1SQPE 3H1JD 3JCUE 2N18B 2C0XA 4L74A 3BCCG 2YMKA 1EZVD 2JDIH 4RESB 5BVZA 1DH3A 3A0HV 1DD3A 3D0WA 1CSBA 3TNUA 1SQXJ 1ZRTD 4ASWA 3KDPB 3C2CA 1BSNA 5KLIC 4C7RA 2D2CD 1CTJA 3PH2B 4U7JA 1HH7A 3VMYA 4D6TJ 1OFCX 5EXQA 2OYOA 1KTMA 3RL0B 1L0LK 1NU1K 1USDA 4FA9A 1FCDC 1L0ND 4EIFA 1YI2P 4JYCA 2BASA 1YFCA 1LT1A 1JY2O 4QAOA 5AVRB 1SP4A 2QJPC 2QJYB 1S6VB 3CX5E 2V7QJ 1SQXD 2CA3B 3CCEP 2Q3EA 3PXWA 1Y47A 1LTTC 3CC7P 1SQXG 1OVRA 2QE7H 3WUTA 1RZ5A 1KB9D 2BCCD 1H89A 1KILB 1VQMP 2JWAA 1SQPG 1KC8Q 1YCCA 1N86A 4DCKA 1KB9H 1MFZA 5KAFH 4J20A 1VYDA 1SQVJ 3B5NB 1H0TB 1GW4A 1FZCB 5GTIV 2IDBA 4O1WA 3WMM0 1PZQA 4PD4D 1GL2B 5CCHC 4EYYQ 3ZOYA 2N9BA 1AOFA 1NTMK 1AKKA 2UWJE 2KSEA 2OYIC 3L71J 3AE9C 2NPSB 3A5TA 3OA8B 1LT9A 1GU2A 1IO3A 2B87B 4WQCA 4DY9A 1EZVE 4FA5A 1DW2A 2WPSA 4Z1MH 3R4YA 4Y5RA 2QG4A 2Y0EA 1KQGB 2FY8A 3GLMA 1KILA 1JY3P 3OCDA 1T3JA 3TK1A 4GOEA 2N18C 1URQC 1CYCA 4H44B 1KV4A 2GC4D 2H8PD 1VPCA 1NKNA 2FYUD 3MGNA 3VYMA 2J59M 3MZWB 1HJ0A 3M0DA 2YMYA 5KLVD 1RF0C 3I5CA 2ZFCA 3ZOWA 5DF5A 4WB4A 1DIIC 5KLVG 1KV9A 2O3JA 1A56A 3QH9A 2ZYDA 2KS1A 2MHMA 3OJAB 4I2LC 1OZHA 1W2EA 3SWYA 2C0WA 4M3LA 3HE5B 1BE3J 1E29A 2KOGA 1KORA 3L72D 2ZXEB 1KFNA 2N3BA 1DIQC 2FBWC 4N6JA 4BWNA 4U3FD 3BASA 3HE4A 1P84H 1YICA 4WVZA 2XZRA 1NTME 4UB8E 2H43A 5AVTB 2WSCJ 1RZ6A 1SQQK 1ZLLA 3TDKA 1BGYG 3Q3DA 2IZ0A 1HWTC 2P10A 3MK7C 3RK3E 1QN2A 3A7OA 1WEJF 1W5CT 1RF1B 2P1JA 2ZT9C 1U7JA 1WRGA 5KAIE 3KZIE 4WQ7A 1PGJA 2KB7P 2JO1A 3RL0D 5AVQB 2MJZA 1YTZI 3L72J 1QX8A 1IK7A 4N78D 4FANA 1CTZA 4BRYB 4EI2A 1YQ4C 2FXOA 5AW8B 1GD2E 1Z56A 5DJQC 4YTPC 4KHXA 5CIGB 3B8EB 1VQ5P 4D6TE 4WQDA 1PP9G 5AW6B 5IY51 3K5BA 1N73C 2N9IA 2VHDA 5KKZB 3USSA 1U75B 2C9LY 5TJHA 3OA7A 2E75C 1OWAA 1CHJA 5APQA 1T3UA 1YJ9P 2WSEH 1JCDA 4PJ0H 2ZZS1 5KJ7C 3VOPA 3HQ6A 2YXQB 1IFJA 1KX2A 1YEBA 1DVHA 5AVZB 1URQB 1I8OA 2ZAEB 1NTMG 1H32B 1LTGC 1CCHA 3AE6C 1WVEC 3RL0g 3HD7A 3CLQA 2RN0A 1SQBG 3H1KJ 1RE3A 1P84I 4IFDK 1CORA 2BEQD 2WITA 1LTAC 1VQ8P 2V08A 2KSJA 3OAKA 3U1CA 1MFTA 3ITKA 2GA1A 2MTAC 4I1LA 5H2FE 4PV1D 2PGDA 2FYUJ 3F89A 3A2AA 1CIEA 3HQ9A 1NTZD 2HPCB 1SQQD 2B4ZA 4O1QA 3RK2C 3VMZA 3A0BV 4KMGA 3CCQP 1M6ZA 3OCDB 2K9JB 3CCUP 3WUIA 3CWBJ 2L5GB 2FYUE 3CCRP 1SQQG 4P4QB 1SQPD 1URQA 2PACA 4GOFA 1CRGA 2E76D 4KT0J 1YEAA 1W2BO 5M1BA 3H1HD 1HZUA 3ZBMA 2YK3A 4WBAA 4LLHA 1U7MA 1PFIA 3WFCC 1S5LV 1GK6A 1RF1C 1K73Q 4DOJA 3GG2A 2QM7A 1K05A 2Z4EA 1H31A 1NYHA 3H1LJ 4V2KA 1DIPA 2OARA 2E74D 2B9BA 2KZIA 1QL1A 1XTCC 3H1HJ 3HE5A 1SQVD 2JJLA 1CO6A 3Q5RA 1DVVA 2E75B 3SJLA 3CWBG 4I7ZC 1LNQA 3HUSC 1U74B 3P8CD 3G6EP 2P7JA 3L74E 1AQ5A 2M0BA 5DJUB 3L4OA 5CIBB 1EXJA 4Q5PA 3L74G 1DX7A 3L36A 1URQD 1ZR2A 2E74B 1DW1A 1T2KC 1JY3O 3H1KG 1VQ6P 5APSA 1BCCE 5E79H 4LJIA 5KJ7A 2WPRA 1QL3A 1NOHA 3L71D 3HQ7A 3B5NA 2FYNC 2CPBA 2FXPA 2KLVA 2P58A 1S9KE 3HUSA 2FYUK 1L9BC 4EIEA 4L73A 1IFDA 3CXHI 5KAIV 1M90Q 1YIQA 2KS1B 2XV5A 2ZJSE 1SFCA 4PJ0E 4U3FG 1VQOP 2HYNA 4C7NB 2NRGA 2YIUC 3E1IA 5CBOA 4UB8V 3CX5I 1RE4A 3H1LE 2AIUA 2YXRB 1AVOA 1AQTA 1H33B 3O6QA 4EIJA 1NHLA 2CXBA 1QVFO 1UIIA 2D0SA 1SS1A 4W80A 1SQBJ 2O01N 3CX5W 4MU8A 4H0LB 1E5WA 1KILE 2ZT9D 4NFGB 1EDLA 4A7PA 3P8MC 3RN0A 1J1EB 2KZJA 3O5CA 1NTMJ 2B12B 1BDDA 2IYPA 2KIKA 2KLUA 5C0ZA 2YCCA 3ZOOA 2M3BA 1J1EC 3H32A 3DR0A 3ZDMA 1AVYA 1FOSE 1NU1J 1FZBA 1P84E 2K3RA 1G1IA 1HROA 3SLEA 3F5HA 4EDFA 4UB6H 1SLQA 2IBZG 1WMKA 4IL6V 4K3AA 1HGVA 3O20A 1ZV8A 3H1LD 2YKQA 2PFXA 3HUSB 3FX0A 1PV3A 4IL6X 5BU5A 3N4XA 1YYCA 4TT3H 5APVA 1ETPA 1BE3D 3RBXA 3VP9A 1L0NE 1K3GA 3OW2O 4WQEA 2XDJA 2RMZA 1KYOH 2RKLA 3L72E 3L71G 3O8ZA 3DP5A 4O9BA 3CYTI 1CI6A 1LTJA 1RF0A 3MUDA 3AE7C 5B66E 5GTHE 3L70D 5GTHH 4IL6H 1GIWA 1VQ9P 3B5ND 3VP8A 1OIPA 1DW3A 3TSIA 3TGUG 1GJQA 5B66H 2POHA 3VNWA 3L74D 1N7SC 4R4MA 1QLED 1M1KQ 3G3ZA 3NMDA 4WQ8A 3SWSA 1T8ZA 1U57A 3AE4C 2QJKB 2W83C 2XNDH 1SQBK 2N1TC 2W90A 5CCGC 5C39A 5KLIB 2L91A 4PD4H 4XFJA 3TGUJ 5KLVE 3RK2B 1JMMA 2V4HA 4ZKPA 3L70J 3IF4A 2OYIB 1ZR4A 4XYDB 1JTHB 1G2CB 5B66V 4AYCA 3KHUA 2B89A 1BCCD 1S5LE 3V2PA 1L2PA 1NO4A 1Q81Q 1JO5A 1C2NA 3B4SA 2PAJA 1CSVA 1K8AQ 1DEEG 3CMAP 2AEMA 4WWIA 1NKZB 2WSFJ 2Y9ZA 1LWUA 3L72G 3NBTA 3GW6A 2GB8B 2KI7B 1CSWA 1CRCA 3UIAA 3N7NA 5APYA 3GMAA 3ABVC 4IL6E 3CCMP 3TGUE 2PCBB 5CCGD 2ZT9B 2WMMA 4RJTA 2OTJP 4H44D 5AW3B 3JC22 3H1IG 5CJ0A 2CA4B 5TISH 2OGUA 1CIFA 4C7NA 1SFCC 4OGQC 1VQPP 3L75E 4GODA 4GEDB 1FU1A 1PPJE 1BE3G 1USEA 3O1YA 2IYOA 3CX5H 3L73D 3AE8C 4MN4C 1AFOA 5CIHB 1OXZA 3NBSA 1JEKA 1S2EA 1NTZK 1L0LJ 3FGAD 3H1HE 5DJQB 3TF5A 3AEGC 4AX3A 1JMBA
chains in the Genus database with same CATH topology
2PCCB 1DT1A 1CHJA 2ZZS1 1LC1A 3HQ8A 2OZ1B 3HQ6A 2D0WA 1LFMA 4PWAA 3NWVA 1FI9A 4AAOA 1KYOW 1K3HA 3PXTA 1CEDA 1C52A 1CHIA 1KX2A 2ZOOA 1YEBA 3L75D 1DVHA 1I8OA 3CP5A 2ZXYA 1H32B 1CCHA 2HV4A 1WVEC 1KIBA 4H0KA 1IZL0 1IQCA 3RN1A 2RN0A 2C1UA 4K3IA 1EB7A 1CORA 1QL4A 2N9JA 2BCNB 1FOCA 1KX7A 2XTSB 2V08A 1NMLA 1C6SA 3VMAA 1YNRA 1LMSA 2IBZD 3CU4A 3ITKA 1H9XA 3TGUD 2MTAC 1CIEA 1H33A 1CRHA 3HQ9A 1NTZD 2FWLA 1CRJA 1SQQD 2B4ZA 4O1QA 3WFDC 1CHHA 3A0BV 4KMGA 1M6ZA 3OCDB 2K9JB 5AURA 3WUIA 5CIEB 1HJ4A 4WQAA 4P4QB 1SQPD 5TISV 1IRVA 2PACA 1LC2A 1CRGA 5CIFB 1MG3D 2BGVX 3DMIA 1SQBD 1M60A 1YEAA 2OZ1A 3H1HD 1HZUA 3ZBMA 2YK3A 1KYOD 2B11B 2CE0A 1N15A 3WFCC 3CWBD 1S5LV 2DVHA 4FAVA 1ZZHA 1NNOA 3RMZA 1H32A 3GG2A 1N9CA 1H31A 2JTIB 3ORVA 4JCGA 4FB1A 4V2KA 1CNOA 2ORLA 5DFSA 1CXCA 5CYTR 3VRDA 2Y0DA 3ZCFA 1CRIA 1HJ5A 1NTKD 1SQVD 1CO6A 1NIRA 1CXAA 1M70A 1DVVA 2B10B 3SJLA 3SXTA 5CIDB 1U74B 3H1KD 4L1QA 2YIUB 2B0ZB 3PXSA 2ZONG 3L4OA 4WQ9A 3H1ID 1CIHA 3RLMA 1MG2D 5CIBB 4UB6V 1C6RA 1FI7A 155CA 4Q5PA 4XXLA 1I54A 3CX5D 1DW1A 4PW9B 1RAPA 3A9FA 351CA 1NMIA 1F1CA 3M97X 4LJIA 1CIGA 2CE1A 3TYIA 1IRWA 1QL3A 1OCDA 1NU1D 3L71D 3HQ7A 3H1JD 1HZVA 451CA 1GDVA 3SVWA 2N18B 1EZVD 4AANA 3ZIYA 3A0HV 1CTYA 4FA1A 1C6OA 5GTHV 1L9BC 4EIEA 1ZRTD 5CICB 1FJ0A 1PPJD 5KAIV 3C2CA 4D6TD 2DGEA 1H9YA 5C9MA 1YIQA 1CTJA 3O0RC 3PH2B 1HH7A 4AALA 1CSXA 1FI3A 5EXQA 4EICA 1C7MA 1QKSA 1HCMA 4UB8V 4FA9A 1FCDC 1L0ND 4EIFA 1CSUA 1I6EA 2GIWA 2AIUA 1YFCA 1PP9D 4QAOA 2A06D 1H33B 2QJYB 1S6VB 1GQ1A 1SQXD 2CA3B 2Q3EA 3PXWA 2CXBA 2KNCB 5B6QA 2D0SA 2FYNB 2C1DA 3CX5W 4MU8A 1RZ5A 3WU2V 1KB9D 2BCCD 4NFGB 2AI5A 2JWAA 4A7PA 1YCCA 3RN0A 1CYIA 1CCRA 3O5CA 1CYJA 4J20A 1VYDA 1R0QA 4PJ0V 5GTIV 2B12B 4O1WA 3PRJA 4PD4D 3PHLA 5C0ZA 1OAEA 2YCCA 3ZOYA 1AOFA 1AKKA 3ZOOA 1C2RA 3DR0A 5E79V 3OA8B 1GU2A 1IO3A 4WQCA 4DY9A 3FWLA 2YQBA 1NTMD 1CC5A 4FA5A 2I8FA 1HROA 1DW2A 3SLEA 4EDFA 4H0JA 4IL6V 4Y5RA 2QG4A 3JBTB 3O20A 3H1LD 2Y0EA 3KZIV 4YE1A 1DW0A 3OCDA 2LITA 3WFBC 2L4DA 2N18C 1CYCA 1ETPA 1BE3D 3CXHD 2GC4D 2BLFB 1KB0A 1K3GA 2FYUD 1RAQA 4WQEA 2JQRA 1LS9A 1A2SA 1P84D 3VYMA 2RMZA 3DP5A 3CYTI 1E8EA 5KLVD 1A8CA 3L70D 5B5EV 3BCCD 4N0KA 2AXTV 1GIWA 3ZOWA 5DF5A 1W2LA 1AOQA 1DIIC 1DW3A 1B7VA 1KV9A 2O3JA 1A56A 1GJQA 4RSZA 4L3GA 3VNWA 2KS1A 2MHMA 1I5TA 2QJPB 1N90A 3L74D 2GC7D 2C1VA 2C1DB 4GYDA 4WQ8A 2C8SA 3OA8A 3SWSA 1I6DA 2QJKB 1E29A 2ZBOA 5KLIB 1BGYD 1HRCA 2L91A 3L72D 4WQBA 2N3BA 1DIQC 1COTA 1MZ4A 3CXHW 4XYDB 4U3FD 1AYGA 5B66V 3KHUA 1BL9A 1BCCD 1YICA 1I55A 3L4MA 3WFEC 1C2NA 1RZ6A 1CSVA 3PTZA 3ZOXA 3WC8A 3TDKA 5KAFV 3MK7C 2Y0CA 1QN2A 4AAMA 1YTCA 1WEJF 1W5CT 3NBTA 3GW6A 4FA4A 2GB8B 1HJ3A 1CSWA 1CRCA 4WQ7A 1C75A 2EXVA 1H1OA 1JDLA 2C2CA 1E2RA 2PCBB 2BPBB 4RJTA 3MK7B 4EIDA 1I8PA 2BH4X 4L3HA 3PLNA 1N50A 1GKSA 2CA4B 4FANA 1CIFA 1CTZA 2LIRA 1FHBA 4GEDB 5DJQC 2FRCA 5CIGB 3O1YA 3L73D 2V07A 3X39A 4WQDA 5CIHB 3NBSA 5IY51 1F1FA 1QYZA 2C9XB 2N9IA 5DJQB 2VHDA 5KKZB 3TF5A 1H31B 1CRYA 2N9YB 1L9JC 4AX3A 1U75B 2BH5X 5H2FV 2N3YA 5TJHA 1J3SA 1L0LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PCC B;  1DT1 A;  1CHJ A;  2ZZS 1;  1LC1 A;  3HQ8 A;  2OZ1 B;  3HQ6 A;  2D0W A;  1LFM A;  4PWA A;  3NWV A;  1FI9 A;  4AAO A;  1KYO W;  1K3H A;  3PXT A;  1CED A;  1C52 A;  1CHI A;  1KX2 A;  2ZOO A;  1YEB A;  3L75 D;  1DVH A;  1I8O A;  3CP5 A;  2ZXY A;  1H32 B;  1CCH A;  2HV4 A;  1WVE C;  1KIB A;  4H0K A;  1IZL 0;  1IQC A;  3RN1 A;  2RN0 A;  2C1U A;  4K3I A;  1EB7 A;  1COR A;  1QL4 A;  2N9J A;  2BCN B;  1FOC A;  1KX7 A;  2XTS B;  2V08 A;  1NML A;  1C6S A;  3VMA A;  1YNR A;  1LMS A;  2IBZ D;  3CU4 A;  3ITK A;  1H9X A;  3TGU D;  2MTA C;  1CIE A;  1H33 A;  1CRH A;  3HQ9 A;  1NTZ D;  2FWL A;  1CRJ A;  1SQQ D;  2B4Z A;  4O1Q A;  3WFD C;  1CHH A;  3A0B V;  4KMG A;  1M6Z A;  3OCD B;  2K9J B;  5AUR A;  3WUI A;  5CIE B;  1HJ4 A;  4WQA A;  4P4Q B;  1SQP D;  5TIS V;  1IRV A;  2PAC A;  1LC2 A;  1CRG A;  5CIF B;  1MG3 D;  2BGV X;  3DMI A;  1SQB D;  1M60 A;  1YEA A;  2OZ1 A;  3H1H D;  1HZU A;  3ZBM A;  2YK3 A;  1KYO D;  2B11 B;  2CE0 A;  1N15 A;  3WFC C;  3CWB D;  1S5L V;  2DVH A;  4FAV A;  1ZZH A;  1NNO A;  3RMZ A;  1H32 A;  3GG2 A;  1N9C A;  1H31 A;  2JTI B;  3ORV A;  4JCG A;  4FB1 A;  4V2K A;  1CNO A;  2ORL A;  5DFS A;  1CXC A;  5CYT R;  3VRD A;  2Y0D A;  3ZCF A;  1CRI A;  1HJ5 A;  1NTK D;  1SQV D;  1CO6 A;  1NIR A;  1CXA A;  1M70 A;  1DVV A;  2B10 B;  3SJL A;  3SXT A;  5CID B;  1U74 B;  3H1K D;  4L1Q A;  2YIU B;  2B0Z B;  3PXS A;  2ZON G;  3L4O A;  4WQ9 A;  3H1I D;  1CIH A;  3RLM A;  1MG2 D;  5CIB B;  4UB6 V;  1C6R A;  1FI7 A;  155C A;  4Q5P A;  4XXL A;  1I54 A;  3CX5 D;  1DW1 A;  4PW9 B;  1RAP A;  3A9F A;  351C A;  1NMI A;  1F1C A;  3M97 X;  4LJI A;  1CIG A;  2CE1 A;  3TYI A;  1IRW A;  1QL3 A;  1OCD A;  1NU1 D;  3L71 D;  3HQ7 A;  3H1J D;  1HZV A;  451C A;  1GDV A;  3SVW A;  2N18 B;  1EZV D;  4AAN A;  3ZIY A;  3A0H V;  1CTY A;  4FA1 A;  1C6O A;  5GTH V;  1L9B C;  4EIE A;  1ZRT D;  5CIC B;  1FJ0 A;  1PPJ D;  5KAI V;  3C2C A;  4D6T D;  2DGE A;  1H9Y A;  5C9M A;  1YIQ A;  1CTJ A;  3O0R C;  3PH2 B;  1HH7 A;  4AAL A;  1CSX A;  1FI3 A;  5EXQ A;  4EIC A;  1C7M A;  1QKS A;  1HCM A;  4UB8 V;  4FA9 A;  1FCD C;  1L0N D;  4EIF A;  1CSU A;  1I6E A;  2GIW A;  2AIU A;  1YFC A;  1PP9 D;  4QAO A;  2A06 D;  1H33 B;  2QJY B;  1S6V B;  1GQ1 A;  1SQX D;  2CA3 B;  2Q3E A;  3PXW A;  2CXB A;  2KNC B;  5B6Q A;  2D0S A;  2FYN B;  2C1D A;  3CX5 W;  4MU8 A;  1RZ5 A;  3WU2 V;  1KB9 D;  2BCC D;  4NFG B;  2AI5 A;  2JWA A;  4A7P A;  1YCC A;  3RN0 A;  1CYI A;  1CCR A;  3O5C A;  1CYJ A;  4J20 A;  1VYD A;  1R0Q A;  4PJ0 V;  5GTI V;  2B12 B;  4O1W A;  3PRJ A;  4PD4 D;  3PHL A;  5C0Z A;  1OAE A;  2YCC A;  3ZOY A;  1AOF A;  1AKK A;  3ZOO A;  1C2R A;  3DR0 A;  5E79 V;  3OA8 B;  1GU2 A;  1IO3 A;  4WQC A;  4DY9 A;  3FWL A;  2YQB A;  1NTM D;  1CC5 A;  4FA5 A;  2I8F A;  1HRO A;  1DW2 A;  3SLE A;  4EDF A;  4H0J A;  4IL6 V;  4Y5R A;  2QG4 A;  3JBT B;  3O20 A;  3H1L D;  2Y0E A;  3KZI V;  4YE1 A;  1DW0 A;  3OCD A;  2LIT A;  3WFB C;  2L4D A;  2N18 C;  1CYC A;  1ETP A;  1BE3 D;  3CXH D;  2GC4 D;  2BLF B;  1KB0 A;  1K3G A;  2FYU D;  1RAQ A;  4WQE A;  2JQR A;  1LS9 A;  1A2S A;  1P84 D;  3VYM A;  2RMZ A;  3DP5 A;  3CYT I;  1E8E A;  5KLV D;  1A8C A;  3L70 D;  5B5E V;  3BCC D;  4N0K A;  2AXT V;  1GIW A;  3ZOW A;  5DF5 A;  1W2L A;  1AOQ A;  1DII C;  1DW3 A;  1B7V A;  1KV9 A;  2O3J A;  1A56 A;  1GJQ A;  4RSZ A;  4L3G A;  3VNW A;  2KS1 A;  2MHM A;  1I5T A;  2QJP B;  1N90 A;  3L74 D;  2GC7 D;  2C1V A;  2C1D B;  4GYD A;  4WQ8 A;  2C8S A;  3OA8 A;  3SWS A;  1I6D A;  2QJK B;  1E29 A;  2ZBO A;  5KLI B;  1BGY D;  1HRC A;  2L91 A;  3L72 D;  4WQB A;  2N3B A;  1DIQ C;  1COT A;  1MZ4 A;  3CXH W;  4XYD B;  4U3F D;  1AYG A;  5B66 V;  3KHU A;  1BL9 A;  1BCC D;  1YIC A;  1I55 A;  3L4M A;  3WFE C;  1C2N A;  1RZ6 A;  1CSV A;  3PTZ A;  3ZOX A;  3WC8 A;  3TDK A;  5KAF V;  3MK7 C;  2Y0C A;  1QN2 A;  4AAM A;  1YTC A;  1WEJ F;  1W5C T;  3NBT A;  3GW6 A;  4FA4 A;  2GB8 B;  1HJ3 A;  1CSW A;  1CRC A;  4WQ7 A;  1C75 A;  2EXV A;  1H1O A;  1JDL A;  2C2C A;  1E2R A;  2PCB B;  2BPB B;  4RJT A;  3MK7 B;  4EID A;  1I8P A;  2BH4 X;  4L3H A;  3PLN A;  1N50 A;  1GKS A;  2CA4 B;  4FAN A;  1CIF A;  1CTZ A;  2LIR A;  1FHB A;  4GED B;  5DJQ C;  2FRC A;  5CIG B;  3O1Y A;  3L73 D;  2V07 A;  3X39 A;  4WQD A;  5CIH B;  3NBS A;  5IY5 1;  1F1F A;  1QYZ A;  2C9X B;  2N9I A;  5DJQ B;  2VHD A;  5KKZ B;  3TF5 A;  1H31 B;  1CRY A;  2N9Y B;  1L9J C;  4AX3 A;  1U75 B;  2BH5 X;  5H2F V;  2N3Y A;  5TJH A;  1J3S A;  1L0L D; 
#chains in the Genus database with same CATH topology
 2PCC B;  1DT1 A;  2FFD A;  2LXC B;  1MZ9 A;  1PGP A;  1LC1 A;  2IBZ E;  1YJN P;  1LFM A;  4PWA A;  1KIL C;  1SQB E;  2W6J H;  4AAO A;  1KYO W;  1K3H A;  1CED A;  1C52 A;  2OYH B;  2WPQ A;  2KUB A;  2ZXY A;  3AE5 C;  3H25 A;  1FJK A;  1JUN A;  4H0K A;  4HJG H;  3MTU E;  2VRS A;  3A0B H;  5KKZ C;  1J1D C;  3AEC C;  4H13 C;  4K3I A;  1QL4 A;  5CHX A;  2QJY C;  3E1R A;  3Q1M A;  4H0L C;  1KX7 A;  1NML A;  2IBZ D;  3CU4 A;  3HTK B;  2N1T B;  1PIX A;  1H33 A;  1OW8 A;  1OVV A;  2J58 A;  3D71 A;  3WFD C;  1HVV A;  1FDM A;  5AUR A;  3AEA C;  1M7L A;  4WQA A;  1MKM A;  5TIS V;  1LC2 A;  1QGK B;  3RK2 D;  3E7K A;  1AA0 A;  1VQL P;  3GHG B;  2BGV X;  1FZF A;  1S72 P;  2W27 A;  1K9M Q;  3NTN A;  3CCS P;  2CE0 A;  3CWB D;  5AW4 B;  1L0L E;  1ZZH A;  1NNO A;  3RMZ A;  1CZQ A;  3L35 A;  3JCU H;  1NTZ J;  1JCC A;  1H8A A;  3ORV A;  2D2C C;  3KYQ A;  3BRV B;  1CNO A;  3RGU A;  2ORL A;  3H1J G;  5CYT R;  5AVS B;  3ZCF A;  2NZ2 A;  1JM0 A;  1NIR A;  3HD7 B;  3SXT A;  1ZOY C;  5CID B;  1SQX E;  3D6Z A;  3H1K D;  1PL5 A;  1BCC G;  1FBM A;  2W6B A;  2AEF A;  2Y9Y A;  3U59 A;  4JQ0 D;  5CCH A;  1HJB A;  4WQ9 A;  1S3J A;  1MG2 D;  1RF1 A;  4UB6 V;  3HD7 C;  3AE3 C;  1N7S B;  3LIE A;  4DZO A;  3NFQ A;  1LP1 B;  1NGM B;  4ASV A;  1AJY A;  2G3A A;  2BCC G;  3M97 X;  5KJ7 D;  4XE5 B;  1GL2 C;  1VF5 B;  2NPS D;  1FZA A;  1KYO E;  2CE1 A;  1KB9 E;  2BCC E;  1FZC A;  1X9V A;  3B5N C;  3L4F A;  3G71 P;  1HZV A;  1VQN P;  1GDV A;  4AQR D;  3A0B E;  4AAN A;  3ZIY A;  1FJP A;  4FA1 A;  4ZKU A;  5GTH V;  3G9R A;  1L0N J;  1KZU B;  3V4Q A;  1FJ0 A;  1PPJ D;  1SQV E;  2DW3 A;  4D6T D;  2A06 G;  1H9Y A;  2N1T D;  1KD1 Q;  3O0R C;  1IFI A;  1JY3 N;  4L75 A;  3GF7 A;  3NXS A;  3P8C E;  3LW5 H;  2R44 A;  1FI3 A;  1HGZ A;  4EIC A;  3D6Y A;  1QKS A;  1HCM A;  3CL3 D;  3W68 A;  3H1J E;  1IK9 A;  1I6E A;  2GIW A;  1PP9 D;  5AVU B;  1L4A C;  5GTI H;  1SQQ J;  1GQ1 A;  4H13 B;  1NTZ G;  1LT9 C;  1LWU B;  2QSI A;  3LID A;  2FYN B;  2C1D A;  2FXM A;  2WTY A;  1SQX K;  1CYI A;  2IBZ I;  4W7Z A;  1KQF B;  3V2R A;  1Q7Y Q;  1CCR A;  1R0Q A;  4PJ0 V;  5KTB A;  2JP3 A;  1ZME C;  1E79 H;  3AE1 C;  4H44 C;  3KZI H;  1OAE A;  2AXT E;  1C2R A;  3AEF C;  3EWK A;  5B5E E;  1KN7 A;  3VYI A;  5E79 V;  1BDC A;  1SQQ E;  1QEX A;  1SFC D;  1GW3 A;  3FWL A;  2YQB A;  1NTM D;  2I8F A;  1FDO A;  4UB8 H;  2FFD C;  2GUV A;  3KZI V;  1ZN5 A;  3WFB C;  2L4D A;  2QVA A;  3L75 J;  1EXI A;  3L74 J;  1SQV K;  3CXH D;  1S5L X;  2M3E A;  1NJI Q;  2BLF B;  1KB0 A;  1PP9 J;  2JQR A;  1LS9 A;  1A2S A;  1P84 D;  1VF5 C;  2GUS A;  1NU1 G;  3VMX A;  3AEE C;  2WPV B;  1A8C A;  4YXW H;  2GM4 A;  3M06 A;  3BCC D;  1IFM A;  2FYU G;  3SSU A;  1FZG A;  1L4A A;  1B7V A;  2OYH C;  1Y9B A;  5EFW B;  5CJ4 A;  2QJP B;  2GC7 D;  1GU5 A;  3BRT B;  3C9I A;  1BE3 E;  2C8S A;  1I6D A;  3WU2 E;  3MP7 B;  3TYY A;  2R3C A;  5CCG A;  3RL0 C;  2ZBO A;  1HRC A;  3H32 B;  3S4R A;  5AW9 B;  4WQB A;  1NWQ A;  1COT A;  4XA4 A;  1Y8A A;  2V7Q H;  2OYI A;  2XU6 A;  1BL9 A;  5AW1 B;  4GT1 A;  4Y28 J;  1RHZ B;  3L4M A;  2A45 H;  1M1J A;  1X22 A;  4N78 E;  2HLO A;  1EDI A;  3PTZ A;  1GU4 A;  3WC8 A;  3PJS K;  2WT7 B;  2PP6 A;  3SWK A;  3CD6 P;  2R3S A;  2K1A A;  1YTC A;  4FA4 A;  2AXT H;  1HJ3 A;  1HTL C;  4RO0 A;  1KYO I;  1C75 A;  2EXV A;  1KB9 I;  3CXH E;  1H1O A;  1CW5 A;  1JDL A;  2C2C A;  3L73 G;  1S5L H;  2J5U A;  2YKO A;  4WY4 D;  1YHQ P;  4EID A;  1D7M A;  5DJT B;  5KLV J;  1M8O B;  3HRN A;  3PLN A;  1GKS A;  3L70 E;  2IX7 C;  2NPS A;  3PH0 A;  2LIR A;  3O6Q B;  3L73 J;  4IFF A;  2FRC A;  1Q2N A;  2OTK E;  2ITA A;  4PD4 I;  2V07 A;  3X39 A;  2QM8 A;  4I6M C;  3P32 A;  3TNU B;  5GTI E;  4WY4 A;  1VDF A;  4U3F E;  1QYZ A;  3WUV A;  2E76 C;  3H1J J;  1HBW A;  2MKV A;  2KXP B;  3W67 A;  2ZXX A;  2N9Y B;  1L9J C;  5H2F V;  2N3Y A;  1J3S A;  2KNC A;  1DD4 A;  3NWV A;  5AW5 B;  3PXT A;  3L75 D;  4HB1 A;  3L73 E;  3H1L G;  1GTW A;  2HV4 A;  1JY2 P;  1KIL D;  1HUC A;  2Z5I A;  2ZYA A;  2E74 C;  3H1K E;  1IQC A;  2CK3 H;  5AW7 B;  1EB7 A;  2N9J A;  3FXE A;  3G4S P;  1Q86 Q;  2BEZ F;  2BCN B;  1FOC A;  3WUU A;  4WY4 C;  4L76 A;  1VQ7 P;  1C6S A;  3VMA A;  1YNR A;  3V2Q A;  1H9X A;  3TGU D;  3MIW A;  4OVN F;  2HR3 A;  3A0H E;  1CRH A;  4Y99 C;  2FWL A;  1CRJ A;  1EZV I;  4IOI H;  4DJG A;  4OWF A;  1L4A D;  1FOS F;  5H2F H;  3QWO C;  1JOC A;  3M9Q A;  2K88 A;  1YIJ P;  2IPP A;  3CCL P;  3RK3 B;  3GF3 A;  1PGO A;  3CXH H;  4HYT B;  5CMZ A;  1Q90 D;  5KAF E;  5AW0 B;  2R5D A;  4NPD A;  2N1T A;  1EC5 A;  3DMI A;  1M60 A;  3I55 P;  2OZ1 A;  3IFM A;  3GHG A;  2E75 D;  2YKP A;  1GK4 A;  1LTB C;  2KYV A;  1RE4 C;  1OW6 A;  1KYO D;  3CCV P;  2DVH A;  3L71 E;  1L4A B;  5APT A;  1A02 F;  1FS0 E;  1YBK A;  1N9C A;  3M91 A;  3U1A A;  5L8R J;  4KJM A;  3CC4 P;  4FB1 A;  1QL2 A;  1R5S A;  3BCC E;  1CXC A;  3VRD A;  2Y0D A;  1CRI A;  1SQP J;  4EOT A;  2FFD B;  1LTI C;  4BRY A;  4RKU J;  1M70 A;  2B10 B;  1J2J B;  4JBZ A;  1HF9 A;  2YIU B;  4OGQ D;  3WU2 H;  2H89 C;  2Q9I A;  1N73 B;  3V6I A;  3M9B A;  4OGQ B;  2O1K A;  1TU3 F;  3H1I D;  1CIH A;  3RLM A;  1SVF A;  4I7Z B;  1IFP A;  3L37 A;  155C A;  1IJD B;  4XXL A;  2KK7 A;  1LTJ B;  1I54 A;  1FAV A;  2A06 E;  2WT7 A;  3CX5 D;  2FYZ A;  1RAP A;  2G8Y A;  2I1K A;  1LGH B;  1XTG B;  1RQV A;  1IRW A;  1OCD A;  1K04 A;  2IZ1 A;  451C A;  1OW7 A;  3SVW A;  1WT6 A;  1YJW P;  4ZMD A;  1GL2 D;  1CTY A;  2E5Y A;  1C6O A;  1LTS C;  1N2D C;  1HH0 A;  5CIC B;  2K37 A;  2M5A A;  2DGE A;  3SFE C;  5C9M A;  1KQS O;  1L0N K;  3FWN A;  3V2N A;  3JSV C;  4AAL A;  2C9N Y;  1CSX A;  1C7M A;  2WWW A;  1OX3 A;  1NVO A;  3H1I E;  3IR9 A;  3T97 A;  3FXD A;  1CSU A;  4PD4 E;  2HFE D;  2A06 D;  1H0T A;  3Q2Y A;  1GMJ A;  1PPJ G;  4B86 A;  1UIX A;  2KNC B;  5B6Q A;  2LXB A;  3WU2 V;  2I8D A;  1FE6 A;  1T2K D;  1OMI A;  2AI5 A;  3II6 A;  1NTK K;  1CYJ A;  1VL2 A;  1AV1 A;  1VQ4 P;  2YO2 A;  3V4W A;  1S9K D;  2A45 G;  3MHV A;  2KP8 A;  4YXD C;  3PRJ A;  1M56 D;  1R8E A;  3PHL A;  1QVG O;  1BGY J;  3AE2 C;  2LKM A;  2E5T A;  1R5L A;  1KQL A;  5K5G B;  2Q5U A;  2RH0 A;  3EQ2 A;  1RE3 C;  1LTJ C;  3LW5 J;  2E76 B;  2R32 A;  2XKM A;  5CCH D;  5AVX B;  1CC5 A;  3CI9 A;  1IZN B;  1EDK A;  1M57 D;  3L75 G;  3C1L A;  1LP1 A;  4H0J A;  2BCC J;  2YO3 A;  3JBT B;  1ZP0 C;  2H7H A;  2B88 A;  5APX A;  4YE1 A;  1X8Y A;  4D6T G;  2OQQ A;  2WQY C;  4PV1 B;  1DW0 A;  1S4X A;  4K35 A;  4N3Y B;  2LIT A;  5AVW B;  3H1H G;  1IO4 A;  5AVY B;  1FC2 C;  1IFN A;  1LJ2 A;  2HOD A;  1RAQ A;  3Q5S A;  3R2P A;  3MUD C;  5E79 E;  1GDT A;  2QEX P;  2O01 J;  2WSS H;  1E8E A;  2Z5H A;  1GL2 A;  2QRX A;  5B5E V;  2JKV A;  4N0K A;  5CBN A;  2AXT V;  3T97 B;  1YIT P;  1W2L A;  1AOQ A;  1X0T A;  2IFN A;  2JR8 A;  2LR2 A;  1VF5 D;  2E43 A;  3BVH A;  2I1J A;  4NPE A;  4RSZ A;  4L3G A;  1I5T A;  1N90 A;  2C1V A;  3VN0 A;  1ZW0 A;  1Q82 Q;  2AEJ A;  2C1D B;  3EFG A;  4GYD A;  1N7S A;  1SFC B;  3OA8 A;  3AED C;  1LT9 B;  2YNY A;  1NTK G;  4PV1 C;  4HH2 A;  1FDI A;  1BGY D;  1W5C E;  2IFM A;  1NTK E;  1VQK P;  2WSF H;  2Q7C A;  2H88 C;  3HE4 B;  5APW A;  1MZ4 A;  3CXH W;  1AYG A;  4JF7 A;  1EDJ A;  4C46 A;  1I55 A;  3WFE C;  1PGQ A;  4WY4 B;  1T6A A;  1BSH A;  2E42 A;  2SPZ A;  2Q3I A;  1MV8 A;  3B71 A;  3ZOX A;  2W6A A;  5KAF V;  1RY3 A;  2Y0C A;  4AAM A;  5B5E H;  3V5B A;  2W8Z A;  4BXL A;  1ZXG A;  3CC2 P;  1BCC J;  3BCC J;  1NTK J;  1E2R A;  4TLF A;  2BPB B;  4YPC A;  2Q1K A;  4ZNC A;  3MK7 B;  3AEB C;  2M5A B;  4JYB A;  1I8P A;  1G1J A;  2BH4 X;  4L3H A;  2B87 A;  1EZV G;  1N50 A;  1NAY A;  3A0H H;  3M0A A;  3HTK A;  2FKW B;  2K9J A;  1JNM A;  1BGY E;  1FHB A;  1PP9 E;  2WVR A;  1N7S D;  2WZ7 A;  3RK3 C;  1FZE A;  4H13 D;  1RH5 B;  1F1F A;  2C9X B;  3S1K A;  1N73 A;  1H31 B;  4R4L A;  4UB6 E;  3L70 G;  1CRY A;  3KQG A;  2BH5 X;  2JWD A;  1RQU A;  1L0L D;  1FZC C;  2P67 A;  1L0N G;  3EFF K;  3BAT A;  2QIW A;  3HQ8 A;  2OZ1 B;  2D0W A;  2OTL P;  1FI9 A;  5KAI H;  1CHI A;  2ZOO A;  3KPE A;  4LC1 A;  3CP5 A;  2M8R A;  3IAO A;  5KLV K;  3C8V A;  2WSC H;  1KFM A;  1KIB A;  1IZL 0;  3A3Y B;  2HG5 D;  3RN1 A;  1DEB A;  2HPC A;  2O01 H;  3KXD A;  3RK3 D;  2ZVO B;  2C1U A;  1M1J C;  4GKG A;  1IC2 A;  1N7L A;  4U3F J;  2XTS B;  3P7K A;  1N8R Q;  1LMS A;  4Y99 B;  5AVV B;  4NPF X;  2K9Y A;  2QJK C;  1M1J B;  4JPZ B;  1SQP K;  2Q6Q A;  4QMA A;  3CME P;  5TIS E;  4HKZ H;  1CHH A;  3S9O A;  1G2C A;  5CIE B;  1HJ4 A;  3I56 P;  3IN6 A;  3Q5P A;  1IRV A;  5APU A;  3SFD C;  4CPG A;  5CIF B;  2NPS C;  2HOD B;  1MG3 D;  4W7Y A;  1SQB D;  3H6P A;  2QA4 P;  1J1D B;  3D70 A;  3HD7 D;  1JY2 N;  2B11 B;  1GZL A;  1N15 A;  3M0D C;  4GIF A;  3VTP C;  3CCJ P;  4H0L D;  4FAV A;  3PP5 A;  1NU1 E;  3GHG C;  4LGD E;  2P2U A;  3MD0 A;  1NTZ E;  1H32 A;  2WSE J;  4DT0 A;  1YQ3 C;  2JTI B;  4JCG A;  1LWU C;  5DFS A;  1ZRT E;  1H88 A;  1HJ5 A;  2A45 I;  1CI6 B;  1NTK D;  3CPW O;  2ZVN B;  1CXA A;  5BU8 B;  1A02 J;  5AW2 B;  1KMI Z;  1EQ7 A;  4L1Q A;  2B0Z B;  1MUU A;  2PRR A;  4GDO A;  2JEE A;  3PXS A;  4IFM A;  2ZON G;  1X79 B;  3RBZ A;  2AXC A;  1C6R A;  1FI7 A;  4AUW A;  3H1I J;  3M9H A;  1L0L G;  2ZYG A;  4PW9 B;  3A9F A;  1NH4 A;  1NAF A;  2D2C B;  351C A;  1OVU A;  1JB0 J;  2O1J A;  1NMI A;  1F1C A;  1YTZ T;  2CPS A;  4OH8 B;  2OYH A;  1CIG A;  3TYI A;  2R5B A;  2XNX A;  3CWB E;  1JTH A;  1SQV G;  1S1C X;  1NU1 D;  3SWF A;  1SQP E;  3H1J D;  3JCU E;  2N18 B;  2C0X A;  4L74 A;  3BCC G;  2YMK A;  1EZV D;  2JDI H;  4RES B;  5BVZ A;  1DH3 A;  3A0H V;  1DD3 A;  3D0W A;  1CSB A;  3TNU A;  1SQX J;  1ZRT D;  4ASW A;  3KDP B;  3C2C A;  1BSN A;  5KLI C;  4C7R A;  2D2C D;  1CTJ A;  3PH2 B;  4U7J A;  1HH7 A;  3VMY A;  4D6T J;  1OFC X;  5EXQ A;  2OYO A;  1KTM A;  3RL0 B;  1L0L K;  1NU1 K;  1USD A;  4FA9 A;  1FCD C;  1L0N D;  4EIF A;  1YI2 P;  4JYC A;  2BAS A;  1YFC A;  1LT1 A;  1JY2 O;  4QAO A;  5AVR B;  1SP4 A;  2QJP C;  2QJY B;  1S6V B;  3CX5 E;  2V7Q J;  1SQX D;  2CA3 B;  3CCE P;  2Q3E A;  3PXW A;  1Y47 A;  1LTT C;  3CC7 P;  1SQX G;  1OVR A;  2QE7 H;  3WUT A;  1RZ5 A;  1KB9 D;  2BCC D;  1H89 A;  1KIL B;  1VQM P;  2JWA A;  1SQP G;  1KC8 Q;  1YCC A;  1N86 A;  4DCK A;  1KB9 H;  1MFZ A;  5KAF H;  4J20 A;  1VYD A;  1SQV J;  3B5N B;  1H0T B;  1GW4 A;  1FZC B;  5GTI V;  2IDB A;  4O1W A;  3WMM 0;  1PZQ A;  4PD4 D;  1GL2 B;  5CCH C;  4EYY Q;  3ZOY A;  2N9B A;  1AOF A;  1NTM K;  1AKK A;  2UWJ E;  2KSE A;  2OYI C;  3L71 J;  3AE9 C;  2NPS B;  3A5T A;  3OA8 B;  1LT9 A;  1GU2 A;  1IO3 A;  2B87 B;  4WQC A;  4DY9 A;  1EZV E;  4FA5 A;  1DW2 A;  2WPS A;  4Z1M H;  3R4Y A;  4Y5R A;  2QG4 A;  2Y0E A;  1KQG B;  2FY8 A;  3GLM A;  1KIL A;  1JY3 P;  3OCD A;  1T3J A;  3TK1 A;  4GOE A;  2N18 C;  1URQ C;  1CYC A;  4H44 B;  1KV4 A;  2GC4 D;  2H8P D;  1VPC A;  1NKN A;  2FYU D;  3MGN A;  3VYM A;  2J59 M;  3MZW B;  1HJ0 A;  3M0D A;  2YMY A;  5KLV D;  1RF0 C;  3I5C A;  2ZFC A;  3ZOW A;  5DF5 A;  4WB4 A;  1DII C;  5KLV G;  1KV9 A;  2O3J A;  1A56 A;  3QH9 A;  2ZYD A;  2KS1 A;  2MHM A;  3OJA B;  4I2L C;  1OZH A;  1W2E A;  3SWY A;  2C0W A;  4M3L A;  3HE5 B;  1BE3 J;  1E29 A;  2KOG A;  1KOR A;  3L72 D;  2ZXE B;  1KFN A;  2N3B A;  1DIQ C;  2FBW C;  4N6J A;  4BWN A;  4U3F D;  3BAS A;  3HE4 A;  1P84 H;  1YIC A;  4WVZ A;  2XZR A;  1NTM E;  4UB8 E;  2H43 A;  5AVT B;  2WSC J;  1RZ6 A;  1SQQ K;  1ZLL A;  3TDK A;  1BGY G;  3Q3D A;  2IZ0 A;  1HWT C;  2P10 A;  3MK7 C;  3RK3 E;  1QN2 A;  3A7O A;  1WEJ F;  1W5C T;  1RF1 B;  2P1J A;  2ZT9 C;  1U7J A;  1WRG A;  5KAI E;  3KZI E;  4WQ7 A;  1PGJ A;  2KB7 P;  2JO1 A;  3RL0 D;  5AVQ B;  2MJZ A;  1YTZ I;  3L72 J;  1QX8 A;  1IK7 A;  4N78 D;  4FAN A;  1CTZ A;  4BRY B;  4EI2 A;  1YQ4 C;  2FXO A;  5AW8 B;  1GD2 E;  1Z56 A;  5DJQ C;  4YTP C;  4KHX A;  5CIG B;  3B8E B;  1VQ5 P;  4D6T E;  4WQD A;  1PP9 G;  5AW6 B;  5IY5 1;  3K5B A;  1N73 C;  2N9I A;  2VHD A;  5KKZ B;  3USS A;  1U75 B;  2C9L Y;  5TJH A;  3OA7 A;  2E75 C;  1OWA A;  1CHJ A;  5APQ A;  1T3U A;  1YJ9 P;  2WSE H;  1JCD A;  4PJ0 H;  2ZZS 1;  5KJ7 C;  3VOP A;  3HQ6 A;  2YXQ B;  1IFJ A;  1KX2 A;  1YEB A;  1DVH A;  5AVZ B;  1URQ B;  1I8O A;  2ZAE B;  1NTM G;  1H32 B;  1LTG C;  1CCH A;  3AE6 C;  1WVE C;  3RL0 g;  3HD7 A;  3CLQ A;  2RN0 A;  1SQB G;  3H1K J;  1RE3 A;  1P84 I;  4IFD K;  1COR A;  2BEQ D;  2WIT A;  1LTA C;  1VQ8 P;  2V08 A;  2KSJ A;  3OAK A;  3U1C A;  1MFT A;  3ITK A;  2GA1 A;  2MTA C;  4I1L A;  5H2F E;  4PV1 D;  2PGD A;  2FYU J;  3F89 A;  3A2A A;  1CIE A;  3HQ9 A;  1NTZ D;  2HPC B;  1SQQ D;  2B4Z A;  4O1Q A;  3RK2 C;  3VMZ A;  3A0B V;  4KMG A;  3CCQ P;  1M6Z A;  3OCD B;  2K9J B;  3CCU P;  3WUI A;  3CWB J;  2L5G B;  2FYU E;  3CCR P;  1SQQ G;  4P4Q B;  1SQP D;  1URQ A;  2PAC A;  4GOF A;  1CRG A;  2E76 D;  4KT0 J;  1YEA A;  1W2B O;  5M1B A;  3H1H D;  1HZU A;  3ZBM A;  2YK3 A;  4WBA A;  4LLH A;  1U7M A;  1PFI A;  3WFC C;  1S5L V;  1GK6 A;  1RF1 C;  1K73 Q;  4DOJ A;  3GG2 A;  2QM7 A;  1K05 A;  2Z4E A;  1H31 A;  1NYH A;  3H1L J;  4V2K A;  1DIP A;  2OAR A;  2E74 D;  2B9B A;  2KZI A;  1QL1 A;  1XTC C;  3H1H J;  3HE5 A;  1SQV D;  2JJL A;  1CO6 A;  3Q5R A;  1DVV A;  2E75 B;  3SJL A;  3CWB G;  4I7Z C;  1LNQ A;  3HUS C;  1U74 B;  3P8C D;  3G6E P;  2P7J A;  3L74 E;  1AQ5 A;  2M0B A;  5DJU B;  3L4O A;  5CIB B;  1EXJ A;  4Q5P A;  3L74 G;  1DX7 A;  3L36 A;  1URQ D;  1ZR2 A;  2E74 B;  1DW1 A;  1T2K C;  1JY3 O;  3H1K G;  1VQ6 P;  5APS A;  1BCC E;  5E79 H;  4LJI A;  5KJ7 A;  2WPR A;  1QL3 A;  1NOH A;  3L71 D;  3HQ7 A;  3B5N A;  2FYN C;  2CPB A;  2FXP A;  2KLV A;  2P58 A;  1S9K E;  3HUS A;  2FYU K;  1L9B C;  4EIE A;  4L73 A;  1IFD A;  3CXH I;  5KAI V;  1M90 Q;  1YIQ A;  2KS1 B;  2XV5 A;  2ZJS E;  1SFC A;  4PJ0 E;  4U3F G;  1VQO P;  2HYN A;  4C7N B;  2NRG A;  2YIU C;  3E1I A;  5CBO A;  4UB8 V;  3CX5 I;  1RE4 A;  3H1L E;  2AIU A;  2YXR B;  1AVO A;  1AQT A;  1H33 B;  3O6Q A;  4EIJ A;  1NHL A;  2CXB A;  1QVF O;  1UII A;  2D0S A;  1SS1 A;  4W80 A;  1SQB J;  2O01 N;  3CX5 W;  4MU8 A;  4H0L B;  1E5W A;  1KIL E;  2ZT9 D;  4NFG B;  1EDL A;  4A7P A;  3P8M C;  3RN0 A;  1J1E B;  2KZJ A;  3O5C A;  1NTM J;  2B12 B;  1BDD A;  2IYP A;  2KIK A;  2KLU A;  5C0Z A;  2YCC A;  3ZOO A;  2M3B A;  1J1E C;  3H32 A;  3DR0 A;  3ZDM A;  1AVY A;  1FOS E;  1NU1 J;  1FZB A;  1P84 E;  2K3R A;  1G1I A;  1HRO A;  3SLE A;  3F5H A;  4EDF A;  4UB6 H;  1SLQ A;  2IBZ G;  1WMK A;  4IL6 V;  4K3A A;  1HGV A;  3O20 A;  1ZV8 A;  3H1L D;  2YKQ A;  2PFX A;  3HUS B;  3FX0 A;  1PV3 A;  4IL6 X;  5BU5 A;  3N4X A;  1YYC A;  4TT3 H;  5APV A;  1ETP A;  1BE3 D;  3RBX A;  3VP9 A;  1L0N E;  1K3G A;  3OW2 O;  4WQE A;  2XDJ A;  2RMZ A;  1KYO H;  2RKL A;  3L72 E;  3L71 G;  3O8Z A;  3DP5 A;  4O9B A;  3CYT I;  1CI6 A;  1LTJ A;  1RF0 A;  3MUD A;  3AE7 C;  5B66 E;  5GTH E;  3L70 D;  5GTH H;  4IL6 H;  1GIW A;  1VQ9 P;  3B5N D;  3VP8 A;  1OIP A;  1DW3 A;  3TSI A;  3TGU G;  1GJQ A;  5B66 H;  2POH A;  3VNW A;  3L74 D;  1N7S C;  4R4M A;  1QLE D;  1M1K Q;  3G3Z A;  3NMD A;  4WQ8 A;  3SWS A;  1T8Z A;  1U57 A;  3AE4 C;  2QJK B;  2W83 C;  2XND H;  1SQB K;  2N1T C;  2W90 A;  5CCG C;  5C39 A;  5KLI B;  2L91 A;  4PD4 H;  4XFJ A;  3TGU J;  5KLV E;  3RK2 B;  1JMM A;  2V4H A;  4ZKP A;  3L70 J;  3IF4 A;  2OYI B;  1ZR4 A;  4XYD B;  1JTH B;  1G2C B;  5B66 V;  4AYC A;  3KHU A;  2B89 A;  1BCC D;  1S5L E;  3V2P A;  1L2P A;  1NO4 A;  1Q81 Q;  1JO5 A;  1C2N A;  3B4S A;  2PAJ A;  1CSV A;  1K8A Q;  1DEE G;  3CMA P;  2AEM A;  4WWI A;  1NKZ B;  2WSF J;  2Y9Z A;  1LWU A;  3L72 G;  3NBT A;  3GW6 A;  2GB8 B;  2KI7 B;  1CSW A;  1CRC A;  3UIA A;  3N7N A;  5APY A;  3GMA A;  3ABV C;  4IL6 E;  3CCM P;  3TGU E;  2PCB B;  5CCG D;  2ZT9 B;  2WMM A;  4RJT A;  2OTJ P;  4H44 D;  5AW3 B;  3JC2 2;  3H1I G;  5CJ0 A;  2CA4 B;  5TIS H;  2OGU A;  1CIF A;  4C7N A;  1SFC C;  4OGQ C;  1VQP P;  3L75 E;  4GOD A;  4GED B;  1FU1 A;  1PPJ E;  1BE3 G;  1USE A;  3O1Y A;  2IYO A;  3CX5 H;  3L73 D;  3AE8 C;  4MN4 C;  1AFO A;  5CIH B;  1OXZ A;  3NBS A;  1JEK A;  1S2E A;  1NTZ K;  1L0L J;  3FGA D;  3H1H E;  5DJQ B;  3TF5 A;  3AEG C;  4AX3 A;  1JMB A; 
#chains in the Genus database with same CATH homology
 2PCC B;  1DT1 A;  1CHJ A;  2ZZS 1;  1LC1 A;  3HQ8 A;  2OZ1 B;  3HQ6 A;  2D0W A;  1LFM A;  4PWA A;  3NWV A;  1FI9 A;  4AAO A;  1KYO W;  1K3H A;  3PXT A;  1CED A;  1C52 A;  1CHI A;  1KX2 A;  2ZOO A;  1YEB A;  3L75 D;  1DVH A;  1I8O A;  3CP5 A;  2ZXY A;  1H32 B;  1CCH A;  2HV4 A;  1WVE C;  1KIB A;  4H0K A;  1IZL 0;  1IQC A;  3RN1 A;  2RN0 A;  2C1U A;  4K3I A;  1EB7 A;  1COR A;  1QL4 A;  2N9J A;  2BCN B;  1FOC A;  1KX7 A;  2XTS B;  2V08 A;  1NML A;  1C6S A;  3VMA A;  1YNR A;  1LMS A;  2IBZ D;  3CU4 A;  3ITK A;  1H9X A;  3TGU D;  2MTA C;  1CIE A;  1H33 A;  1CRH A;  3HQ9 A;  1NTZ D;  2FWL A;  1CRJ A;  1SQQ D;  2B4Z A;  4O1Q A;  3WFD C;  1CHH A;  3A0B V;  4KMG A;  1M6Z A;  3OCD B;  2K9J B;  5AUR A;  3WUI A;  5CIE B;  1HJ4 A;  4WQA A;  4P4Q B;  1SQP D;  5TIS V;  1IRV A;  2PAC A;  1LC2 A;  1CRG A;  5CIF B;  1MG3 D;  2BGV X;  3DMI A;  1SQB D;  1M60 A;  1YEA A;  2OZ1 A;  3H1H D;  1HZU A;  3ZBM A;  2YK3 A;  1KYO D;  2B11 B;  2CE0 A;  1N15 A;  3WFC C;  3CWB D;  1S5L V;  2DVH A;  4FAV A;  1ZZH A;  1NNO A;  3RMZ A;  1H32 A;  3GG2 A;  1N9C A;  1H31 A;  2JTI B;  3ORV A;  4JCG A;  4FB1 A;  4V2K A;  1CNO A;  2ORL A;  5DFS A;  1CXC A;  5CYT R;  3VRD A;  2Y0D A;  3ZCF A;  1CRI A;  1HJ5 A;  1NTK D;  1SQV D;  1CO6 A;  1NIR A;  1CXA A;  1M70 A;  1DVV A;  2B10 B;  3SJL A;  3SXT A;  5CID B;  1U74 B;  3H1K D;  4L1Q A;  2YIU B;  2B0Z B;  3PXS A;  2ZON G;  3L4O A;  4WQ9 A;  3H1I D;  1CIH A;  3RLM A;  1MG2 D;  5CIB B;  4UB6 V;  1C6R A;  1FI7 A;  155C A;  4Q5P A;  4XXL A;  1I54 A;  3CX5 D;  1DW1 A;  4PW9 B;  1RAP A;  3A9F A;  351C A;  1NMI A;  1F1C A;  3M97 X;  4LJI A;  1CIG A;  2CE1 A;  3TYI A;  1IRW A;  1QL3 A;  1OCD A;  1NU1 D;  3L71 D;  3HQ7 A;  3H1J D;  1HZV A;  451C A;  1GDV A;  3SVW A;  2N18 B;  1EZV D;  4AAN A;  3ZIY A;  3A0H V;  1CTY A;  4FA1 A;  1C6O A;  5GTH V;  1L9B C;  4EIE A;  1ZRT D;  5CIC B;  1FJ0 A;  1PPJ D;  5KAI V;  3C2C A;  4D6T D;  2DGE A;  1H9Y A;  5C9M A;  1YIQ A;  1CTJ A;  3O0R C;  3PH2 B;  1HH7 A;  4AAL A;  1CSX A;  1FI3 A;  5EXQ A;  4EIC A;  1C7M A;  1QKS A;  1HCM A;  4UB8 V;  4FA9 A;  1FCD C;  1L0N D;  4EIF A;  1CSU A;  1I6E A;  2GIW A;  2AIU A;  1YFC A;  1PP9 D;  4QAO A;  2A06 D;  1H33 B;  2QJY B;  1S6V B;  1GQ1 A;  1SQX D;  2CA3 B;  2Q3E A;  3PXW A;  2CXB A;  2KNC B;  5B6Q A;  2D0S A;  2FYN B;  2C1D A;  3CX5 W;  4MU8 A;  1RZ5 A;  3WU2 V;  1KB9 D;  2BCC D;  4NFG B;  2AI5 A;  2JWA A;  4A7P A;  1YCC A;  3RN0 A;  1CYI A;  1CCR A;  3O5C A;  1CYJ A;  4J20 A;  1VYD A;  1R0Q A;  4PJ0 V;  5GTI V;  2B12 B;  4O1W A;  3PRJ A;  4PD4 D;  3PHL A;  5C0Z A;  1OAE A;  2YCC A;  3ZOY A;  1AOF A;  1AKK A;  3ZOO A;  1C2R A;  3DR0 A;  5E79 V;  3OA8 B;  1GU2 A;  1IO3 A;  4WQC A;  4DY9 A;  3FWL A;  2YQB A;  1NTM D;  1CC5 A;  4FA5 A;  2I8F A;  1HRO A;  1DW2 A;  3SLE A;  4EDF A;  4H0J A;  4IL6 V;  4Y5R A;  2QG4 A;  3JBT B;  3O20 A;  3H1L D;  2Y0E A;  3KZI V;  4YE1 A;  1DW0 A;  3OCD A;  2LIT A;  3WFB C;  2L4D A;  2N18 C;  1CYC A;  1ETP A;  1BE3 D;  3CXH D;  2GC4 D;  2BLF B;  1KB0 A;  1K3G A;  2FYU D;  1RAQ A;  4WQE A;  2JQR A;  1LS9 A;  1A2S A;  1P84 D;  3VYM A;  2RMZ A;  3DP5 A;  3CYT I;  1E8E A;  5KLV D;  1A8C A;  3L70 D;  5B5E V;  3BCC D;  4N0K A;  2AXT V;  1GIW A;  3ZOW A;  5DF5 A;  1W2L A;  1AOQ A;  1DII C;  1DW3 A;  1B7V A;  1KV9 A;  2O3J A;  1A56 A;  1GJQ A;  4RSZ A;  4L3G A;  3VNW A;  2KS1 A;  2MHM A;  1I5T A;  2QJP B;  1N90 A;  3L74 D;  2GC7 D;  2C1V A;  2C1D B;  4GYD A;  4WQ8 A;  2C8S A;  3OA8 A;  3SWS A;  1I6D A;  2QJK B;  1E29 A;  2ZBO A;  5KLI B;  1BGY D;  1HRC A;  2L91 A;  3L72 D;  4WQB A;  2N3B A;  1DIQ C;  1COT A;  1MZ4 A;  3CXH W;  4XYD B;  4U3F D;  1AYG A;  5B66 V;  3KHU A;  1BL9 A;  1BCC D;  1YIC A;  1I55 A;  3L4M A;  3WFE C;  1C2N A;  1RZ6 A;  1CSV A;  3PTZ A;  3ZOX A;  3WC8 A;  3TDK A;  5KAF V;  3MK7 C;  2Y0C A;  1QN2 A;  4AAM A;  1YTC A;  1WEJ F;  1W5C T;  3NBT A;  3GW6 A;  4FA4 A;  2GB8 B;  1HJ3 A;  1CSW A;  1CRC A;  4WQ7 A;  1C75 A;  2EXV A;  1H1O A;  1JDL A;  2C2C A;  1E2R A;  2PCB B;  2BPB B;  4RJT A;  3MK7 B;  4EID A;  1I8P A;  2BH4 X;  4L3H A;  3PLN A;  1N50 A;  1GKS A;  2CA4 B;  4FAN A;  1CIF A;  1CTZ A;  2LIR A;  1FHB A;  4GED B;  5DJQ C;  2FRC A;  5CIG B;  3O1Y A;  3L73 D;  2V07 A;  3X39 A;  4WQD A;  5CIH B;  3NBS A;  5IY5 1;  1F1F A;  1QYZ A;  2C9X B;  2N9I A;  5DJQ B;  2VHD A;  5KKZ B;  3TF5 A;  1H31 B;  1CRY A;  2N9Y B;  1L9J C;  4AX3 A;  1U75 B;  2BH5 X;  5H2F V;  2N3Y A;  5TJH A;  1J3S A;  1L0L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...