1BCCD

Cytochrome bc1 complex from chicken
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGPLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSVREGLYFNPYFPGQAIGMAPPIYNDVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLVPLVYYMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 59
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1bccD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1bccD01
1HCMA 1FJ0A 1WEJF 5TJHA 3JBTB 3O20A 2D0SA 1B7VA 1SQXD 155CA 1E8EA 3BCCD 5CIBB 3L70D 4YE1A 3WFCC 4MU8A 2KS1A 3NWVA 2OZ1B 3VMAA 3RN1A 3CX5D 3GG2A 1VYDA 2BCNB 1KYOD 3H1JD 4EDFA 3O0RC 1CORA 1YEBA 4UB8V 2ZONG 5H2FV 1A8CA 2EXVA 3KZIV 2C2CA 1H9YA 4FA9A 1CTJA 1DW2A 1P84D 5KKZB 1LC1A 2AIUA 2N9YB 4XYDB 1M70A 3PXSA 4QAOA 4AAMA 3CU4A 1LMSA 5C9MA 4WQAA 2Y0DA 3O5CA 1FI7A 5GTHV 3GW6A 4EIFA 3DR0A 3NBTA 1CYIA 3SWSA 5EXQA 2N18B 2V08A 3L4OA 4O1WA 2C1DA 2DGEA 1C6RA 3H1LD 3OA8A 1U75B 1N9CA 1NIRA 3DMIA 1FI3A 3MK7B 3PLNA 4FB1A 2BLFB 1BE3D 3SVWA 2N9JA 3SXTA 1CIGA 1DVHA 2B10B 3L74D 3CYTI 1YIQA 1H1OA 1DVVA 1RZ5A 1HZUA 2MHMA 1AYGA 3M97X 1NNOA 5B66V 4Q5PA 3HQ6A 5B5EV 3VNWA 1N90A 2BH5X 2XTSB 1QYZA 1ETPA 1DW1A 3DP5A 3CP5A 4P4QB 1CO6A 2C1VA 1W2LA 1MG3D 1I6DA 1GQ1A 4A7PA 3X39A 1DIQC 2GC4D 1IRWA 4WQDA 3H1ID 1CIFA 4GYDA 3CX5W 1WVEC 1KX2A 1HJ3A 2VHDA 1M6ZA 1CHHA 5KAFV 1H32B 4NFGB 1CSWA 1HRCA 1C2RA 3O1YA 1HJ4A 1DIIC 5DJQB 4FANA 3ZCFA 1HJ5A 3RN0A 1CTYA 1I54A 1I8OA 3VRDA 1U74B 2AXTV 1KV9A 4KMGA 4K3IA 4L1QA 3RLMA 4WQCA 1CIHA 2CE0A 2B0ZB 4XXLA 4EICA 1DW3A 2N3YA 2L91A 1IQCA 1EZVD 1S5LV 1NMLA 3CXHD 1YCCA 5CIHB 3WUIA 1EB7A 2V07A 5KAIV 3WFEC 3OCDB 4J20A 1LS9A 1CRHA 1I8PA 2YCCA 5DFSA 1CRIA 4FA4A 3KHUA 1A2SA 3H1HD 3HQ7A 3TGUD 2JQRA 3PHLA 4GEDB 1S6VB 4FAVA 2ZOOA 4H0JA 3A0HV 2YIUB 2C1UA 2B12B 5GTIV 4AANA 1AKKA 1YTCA 2BPBB 1F1CA 5CICB 1LC2A 1RZ6A 1NTZD 2YK3A 1MG2D 4PWAA 1E29A 2N9IA 1YNRA 2RN0A 2DVHA 1CIEA 3A0BV 2B4ZA 1H32A 2FYNB 1KB0A 4RJTA 1COTA 2N18C 1RAQA 2GB8B 3FWLA 1DT1A 5CIEB 1ZRTD 5CIDB 1CYCA 1HZVA 351CA 3MK7C 1CCRA 2PACA 1A56A 1N15A 3A9FA 1SQQD 4EIDA 1KX7A 1C2NA 2GIWA 4U3FD 4FA1A 2OZ1A 1L0LD 5C0ZA 1NMIA 1GJQA 1HH7A 1BCCD 1DW0A 1E2RA 1AOQA 3ORVA 5TISV 2I8FA 1F1FA 1H33B 451CA 1SQBD 1FI9A 1YEAA 2C8SA 3OCDA 3ITKA 5E79V 3H1KD 4RSZA 1KYOW 3NBSA 3WC8A 5KLIB 1PPJD 2LITA 2B11B 2HV4A 3ZOWA 2JTIB 2QG4A 1IRVA 1QKSA 3PTZA 1JDLA 2FWLA 4V2KA 3OA8B 4EIEA 2CE1A 3PRJA 1K3GA 2C9XB 4WQ8A 2JWAA 2LIRA 1FCDC 5DJQC 4PW9B 3CWBD 1R0QA 1L9JC 1CSUA 4D6TD 4PD4D 1QL3A 1SQPD 5CIFB 1H9XA 1C7MA 2ZZS1 1CHJA 1CRGA 3TDKA 5B6QA 2N3BA 2AI5A 1NU1D 1CC5A 4PJ0V 2K9JB 3L72D 4O1QA 3ZOOA 3PXWA 2O3JA 4UB6V 1H31B 3SJLA 3ZBMA 1CRJA 3HQ9A 1CSXA 1H33A 1CSVA 2RMZA 1QN2A 1OAEA 1CRCA 4AAOA 2ZXYA 1K3HA 2YQBA 1CXAA 3WFBC 3HQ8A 2BH4X 1NTMD 4AX3A 2QJKB 1YICA 2KNCB 4N0KA 1GIWA 2FYUD 1GU2A 5CYTR 3ZOXA 5KLVD 2CA4B 3ZOYA 1CCHA 5DF5A 2PCBB 3WU2V 3PH2B 1HROA 4DY9A 1GKSA 3L4MA 2D0WA 2BCCD 1CTZA 1SQVD 1CNOA 2QJYB 5IY51 4H0KA 1IO3A 1FOCA 4L3HA 1L0ND 2Q3EA 3TF5A 4IL6V 3VYMA 1KIBA 2Y0EA 1I55A 1MZ4A 1J3SA 3L71D 3ZIYA 1ZZHA 1CEDA 2PCCB 2GC7D 1LFMA 1AOFA 4WQEA 1GDVA 1C75A 1CYJA 5CIGB 3TYIA 1IZL0 3L73D 3CXHW 2L4DA 1CHIA 1H31A 3L75D 4WQ9A 2ZBOA 1CRYA 1QL4A 3PXTA 1BGYD 2BGVX 1YFCA 3RMZA 1BL9A 1C6SA 1KB9D 4JCGA 2C1DB 4LJIA 3SLEA 1OCDA 2CA3B 5AURA 2FRCA 4FA5A 1C6OA 1CXCA 1I5TA 1C52A 1I6EA 2A06D 2CXBA 2ORLA 1N50A 1RAPA 3WFDC 1PP9D 4AALA 2IBZD 4WQBA 4Y5RA 1W5CT 4WQ7A 1FHBA 2Y0CA 3C2CA 2MTAC 1L9BC 2QJPB 1NTKD 4L3GA 1M60A
chains in the Genus database with same CATH superfamily
1HCMA 1WEJF 3O20A 2D0SA 1B7VA 1VQ4P 155CA 5APSA 3WU2E 1E8EA 1NJIQ 5CIBB 2WZ7A 1OFCX 1WRGA 4WB4A 3WFCC 3G9RA 1EZVG 4D6TG 3RN1A 3GG2A 3A7OA 2BCNB 1KYOD 3H1JD 2I8DA 1CORA 1YEBA 4ASWA 2ZONG 5H2FV 3L71J 1KV4A 3KZIV 1URQC 3CXHI 1CTJA 2ZYGA 2FFDC 1LC1A 3B5ND 2AIUA 2N9YB 4XYDB 2P1JA 3I5CA 3CU4A 1LMSA 5C9MA 5AW4B 5H2FH 1M1JA 2PGDA 3KZIH 5GTHV 3GW6A 4EIFA 3DR0A 5EXQA 2N18B 1YJWP 2M0BA 3H1LD 1PGPA 1T3JA 3H6PA 3L75E 1N9CA 3DMIA 3PLNA 3CCRP 1GZLA 1SQQK 2AEJA 3CCSP 1PP9J 2D2CD 5GTHH 3LW5J 4GKGA 2WSCH 1LTSC 1YIQA 1S9KD 1RZ5A 2KLUA 1AYGA 2MHMA 2HR3A 1JEKA 1URQA 1NTKE 1N90A 3H32B 2BH5X 4OGQD 4EIJA 4P4QB 3L71G 3CP5A 1SQXE 1KILD 2FFDA 2OYIB 3USSA 1I6DA 2QSIA 3BCCE 2N9BA 3L70E 2NPSB 4EOTA 4AYCA 3SFEC 2QE7H 4OWFA 1IFMA 5H2FE 1H88A 3KZIE 1CHHA 4NPFX 1HRCA 1LJ2A 3D71A 1P84E 1HGVA 3M06A 1DIIC 5DJQB 4FANA 1LWUC 5AVUB 1HJ5A 1JTHA 2OQQA 1U74B 3P32A 3C9IA 4H0LB 1PP9G 4K3IA 5AW1B 5GTHE 3RLMA 1AQTA 1OWAA 2CE0A 1VQNP 3GHGB 5K5GB 1ZV8A 2QJPC 3AE3C 1S5LV 3FXEA 1G1IA 5CIHB 4I6MC 3VMXA 1EB7A 2QIWA 3BRTB 2V07A 1FZBA 1BE3E 2WSFH 3HRNA 3WFEC 1PZQA 1LTIC 1CRHA 1N86A 2O1KA 3L74E 1JMBA 3B5NB 1M1KQ 2OYOA 2JQRA 4FAVA 1QL1A 1S5LH 3S4RA 2FXPA 2BEQD 1OVRA 2P58A 3V6IA 1YJNP 1N2DC 4BRYB 4AANA 1YTCA 1F1CA 2Q7CA 1RZ6A 5CJ4A 1NTZD 4DJGA 4PWAA 1YNRA 2XV5A 4DT0A 1QX8A 1KZUB 1CIEA 3AE2C 2W8ZA 1EXJA 1ZW0A 1H32A 2D2CB 1VQ9P 1QL2A 4RJTA 1RAQA 3GF7A 2G3AA 1HZVA 351CA 1CCRA 3RK2C 5CBNA 1FZCA 1N15A 3EFFK 1FE6A 3G3ZA 4EIDA 1KX7A 3D6YA 1G2CB 1QEXA 4U3FD 3LIEA 2OZ1A 1L0LD 5C0ZA 1GL2B 1HH7A 4OVNF 3G4SP 1E2RA 2E74D 3ORVA 4RESB 1HJ0A 1RY3A 2LXCB 2YKQA 2XNXA 1DX7A 2I8FA 1H33B 451CA 3GLMA 1SQBD 1KORA 1YEAA 2AEMA 1KFMA 3G6EP 1MZ9A 4GOFA 1S5LE 1EZVE 3WUVA 2W6BA 1HJBA 2XZRA 2QRXA 3PP5A 5KLIB 1UIXA 2Q5UA 1LTBC 2OYHC 3WUUA 3O8ZA 3TGUE 3CCQP 4HB1A 3U59A 4V2KA 2MKVA 3EFGA 1KFNA 1LNQA 3VP8A 4PV1C 1LT9C 2LIRA 5AW3B 1YHQP 4ZKUA 3MUDC 5DJUB 1NGMB 1W2EA 5KTBA 3CWBD 3AEEC 2XNDH 4PD4D 1SQPD 2IBZI 5CIFB 4WVZA 1GK4A 4K35A 3OJAB 1C7MA 1CRGA 3HUSB 5B6QA 3ABVC 1RF1B 4WY4D 1NU1D 1SFCD 3L72D 2H7HA 1PIXA 1BCCJ 4HH2A 1VQLP 2W6AA 1CRJA 1NO4A 3HQ9A 1QGKB 2OYHA 1YQ4C 3L36A 4IL6X 2ZXYA 2BH4X 4XFJA 2QJKB 1IFJA 2WPVB 5BU8B 5AW2B 3C8VA 2CA4B 1SP4A 2WT7A 4EYYQ 3V4QA 3PH2B 3M91A 3MUDA 1DD4A 2D0WA 1W5CE 2ZXXA 1PPJE 1NYHA 2HPCB 1N7SB 1SS1A 1FAVA 2KS1B 4H0KA 1IO3A 1FOCA 1NAYA 1FJPA 2M5AA 2Q3EA 3TF5A 3AEBC 2Y0EA 4AUWA 1I55A 3CD6P 3AECC 2VRSA 1T3UA 3AE1C 1ZZHA 1CEDA 2PCCB 1WT6A 1IFDA 5CJ0A 1GDVA 1BCCG 4KT0J 3AE9C 2K9JA 5APUA 4GODA 3L75D 3JSVC 1HH0A 1H8AA 1RQVA 2PRRA 1BL9A 1C6SA 1JOCA 1JO5A 2YMYA 2CA3B 5AURA 3HE4B 2FRCA 1IFNA 4FA5A 3RK3E 1C52A 2JO1A 1LTJB 1GMJA 2ORLA 1N50A 3I55P 4AALA 4WQBA 3CCMP 1W5CT 4WQ7A 2Y0CA 3C2CA 2KSJA 1FJKA 2WTYA 1NTKD 5APWA 4L3GA 5AVWB 1FJ0A 1YTZI 3A3YB 3O6QB 3TNUB 3JBTB 1SQXD 1SQVJ 3Q2YA 3B4SA 2YXRB 3BCCD 3L70D 2B88A 2ZAEB 3NWVA 2E43A 3L35A 4HKZH 2E76C 1L0NJ 3CCEP 1H0TA 1E79H 3O0RC 5L8RJ 3ZDMA 1AV1A 2WITA 1A8CA 2P67A 2H88C 2CPBA 1H9YA 3AEFC 4FA9A 1P84D 5KKZB 1KQGB 3RL0g 4QAOA 2A45I 2KK7A 3JCUE 3Q3DA 1BGYJ 3NBTA 1E5WA 2C1DA 2DGEA 3A2AA 3OA8A 3NTNA 1WMKA 1FI3A 2YO2A 4IFFA 1ZLLA 2P2UA 1BE3D 1L2PA 2N1TC 1J1DB 3KPEA 1DEBA 2R44A 1CIGA 2RKLA 1SQVG 3L74D 5M1BA 1OX3A 4H13B 1DVVA 1RH5B 2A06E 3M97X 1FZAA 2QJYC 5B66V 1VQKP 2HG5D 3RL0C 1L0NG 3S1KA 1J1EB 3VNWA 2KUBA 1KQSO 3VP9A 4Y99C 3CL3D 3DP5A 1DEEG 1CO6A 2M3BA 4N6JA 3M0AA 4A7PA 1DIQC 1IRWA 1RE4C 5B66H 2NPSD 5AVYB 3CCJP 1W2BO 1IK7A 4DOJA 4GYDA 3M9QA 3L37A 3CX5W 1WVEC 1K05A 2P10A 1EXIA 1KX2A 1HJ3A 2OYIC 3V2NA 1M1JC 1BGYG 4NFGB 2ITAA 3UIAA 1C2RA 4NPEA 1Q82Q 5CCGC 2BCCJ 4C46A 3VRDA 4YPCA 1EQ7A 2LKMA 2HLOA 4KMGA 4H0LD 2KZJA 4WQCA 4YXDC 4XXLA 3TK1A 1VQ8P 2L91A 3H25A 3SWYA 1EZVD 3FGAD 3CMEP 1NMLA 2WPQA 3HTKB 3VN0A 1KTMA 3OCDB 3PH0A 1RE4A 2YCCA 4Y28J 1QLED 3VOPA 4FA4A 3KHUA 1NTMK 3AE8C 3TGUD 3H32A 1G1JA 3T97B 2KB7P 3AEAC 5B66E 3L73J 4DZOA 4H0JA 3CXHH 3W67A 2OYIA 2KOGA 2C1UA 2JP3A 3QWOC 2NPSA 4W7ZA 3IAOA 2Z4EA 1AKKA 1R5SA 5KJ7A 3D0WA 4W7YA 2YK3A 1MG2D 1SQVK 2N9IA 3KDPB 5CCGA 1A02J 3U1CA 2G8YA 3HE5A 2W6JH 1P84I 1U7MA 1LTAC 2AEFA 3H1IE 2DVHA 2RN0A 1M57D 3GF3A 1BSNA 3A0BV 2FYNB 1L0NK 2BCCG 3CCLP 3FWLA 2I1JA 1Q81Q 5CIEB 3V4WA 1HWTC 3MK7C 2C9NY 1ZN5A 2Z5HA 2E42A 3A0BH 1C2NA 4OH8B 3GHGA 1GL2D 4L75A 2PAJA 1AOQA 2KLVA 2WPSA 5TISV 2K1AA 1F1FA 3Q1MA 4OGQC 4I7ZC 2K37A 3AE6C 3L73G 1CSBA 3CXHE 1KILC 2HODA 3B5NA 1PPJD 2GUVA 3HD7B 2LITA 3S9OA 2B11B 5TISH 4YXWH 1K73Q 4L74A 3H1HE 3K5BA 4Z1MH 2IDBA 5BVZA 1N7LA 3AE4C 2Q9IA 2V4HA 1KB9I 2J59M 3RBXA 2IBZG 5AVSB 1JUNA 1Z56A 4PW9B 1CI6B 2IYPA 1FS0E 1MUUA 3BASA 1T2KD 2ZT9D 3BRVB 1FZCC 1H9XA 3A0BE 2ZZS1 3MGNA 3TDKA 2QVAA 4XE5B 3BVHA 2OTLP 2AI5A 1CC5A 4PJ0V 3ZOOA 1AVOA 4U3FJ 2FFDB 1L0LJ 1H31B 1OIPA 1KILA 3KYQA 1SQQE 1CSXA 1KYOI 3RK3D 1H33A 1CSVA 1SQBJ 1QN2A 1OAEA 3VYIA 1OZHA 1CRCA 3MHVA 3CC2P 1K3HA 1CXAA 1GDTA 4PJ0H 4H44C 5TISE 1VQ7P 3NMDA 2ZJSE 2O01J 2KNCB 4N0KA 1YQ3C 2E75D 3IFMA 1YJ9P 1GIWA 3EQ2A 1Q90D 2YIUC 5CHXA 1JY2N 4CPGA 3H1KE 1OW6A 5DF5A 5CMZA 2PCBB 1HROA 1EDKA 3L4MA 4JPZB 4RO0A 2P7JA 2XDJA 1GU4A 1N7SD 1JCDA 3E1RA 2V7QJ 2Q1KA 4LGDE 2WSEJ 3RK2D 2Q3IA 3CLQA 2J58A 4L3HA 3VMYA 1YI2P 4I1LA 1KIBA 3CWBJ 5CCHD 1BSHA 4GOEA 1Y47A 3WMM0 1SQPJ 1GD2E 3ZIYA 1GK6A 3A5TA 4U3FG 1L0LG 5APTA 2Q6QA 3R4YA 4D6TE 1RF1A 1NU1J 5AW9B 3L72J 2E74C 3TYIA 1IZL0 3CXHW 5AVXB 1SQBG 3II6A 1CRYA 3PXTA 4PJ0E 1YFCA 3RMZA 2BASA 3SLEA 1LWUB 3CI9A 2OGUA 2E5TA 3M9HA 1X79B 3R2PA 5AVQB 1U57A 3MTUE 1C6OA 1I5TA 1OVVA 2A06D 2CXBA 1LGHB 3L4FA 4Y5RA 2B87B 2QJPB 2ZT9B 1JCCA 2JWDA 3P8CE 2WMMA 3CWBG 4YE1A 1LTTC 1FZEA 2KS1A 2OZ1B 3VMAA 2BCCE 2KIKA 2M8RA 1SQPG 3LW5H 2C0XA 4AQRD 1DD3A 3VTPC 3JC22 2IYOA 3RK3B 2EXVA 2YMKA 2A45G 1YBKA 1NU1G 1R5LA 3L72G 1MFTA 2QA4P 4WY4C 1SFCC 4BWNA 1DW2A 1NTZK 3E1IA 2WSSH 3L71E 2OTJP 3CX5H 2E75B 3PXSA 2ZFCA 1MFZA 3MZWB 5APYA 3BATA 1FI7A 1FU1A 5AW8B 1CYIA 3SWSA 2JDIH 5APVA 3L73E 1N73C 3M0DC 3SFDC 3OA7A 3RK2B 2FYZA 2BLFB 1MKMA 2WQYC 2N9JA 1S4XA 1L0LK 5GTIH 2B10B 2ZYAA 1GU5A 1PGOA 3CYTI 1NTKJ 1H1OA 4H13D 1HZUA 1SQBK 1AQ5A 1PP9E 4Q5PA 3HQ6A 2IBZE 1Y9BA 3BCCJ 2XTSB 1VF5C 1QYZA 4WY4A 1EC5A 1SFCA 1DW1A 1W2LA 3CCUP 1GQ1A 2IX7C 4GDOA 3X39A 1SVFA 3H1ID 3CX5E 1BDCA 1NHLA 1S5LX 1NTMJ 1LTGC 1M8OB 1N73A 1LT9B 3M0DA 3LIDA 2FYUJ 5KLVJ 1CSWA 2RH0A 1AFOA 3O1YA 4RKUJ 1HJ4A 3ZCFA 1CTYA 1I54A 1AA0A 2ZVNB 1SQPK 5AW7B 2AXTV 1KV9A 1RHZB 4L1QA 1L4AD 1CIHA 2B0ZB 1NU1K 1DW3A 1NTKG 2N3YA 3QH9A 1IQCA 3D70A 1VQ5P 3L74J 3CXHD 1SLQA 2AXTH 2KSEA 3BCCG 3F5HA 3WUIA 2JR8A 1KN7A 1MV8A 2WSEH 4PD4I 1I8PA 4R4LA 5DFSA 1CRIA 2ZVOB 3H1HD 3HQ7A 1RF0C 3RBZA 1OW7A 3I56P 2H8PD 2LXBA 2NZ2A 1VDFA 1YYCA 2B12B 1NTMG 2BPBB 1Q7YQ 3MP7B 2A45H 2FYUG 3V2PA 1LP1B 2YKOA 2CPSA 5KLVG 1ZR4A 1GW4A 4C7NB 1EDLA 4KJMA 3OW2O 2N18C 3Q5RA 1T6AA 5BU5A 1NH4A 1JNMA 2K9YA 5CIDB 3PJSK 1H89A 2O1JA 1CYCA 1NVOA 1KQLA 1JB0J 5AW0B 1SQQD 2SPZA 3CMAP 3L74G 2AXTE 4FA1A 3FX0A 3FXDA 3H1JJ 1DW0A 1X0TA 4JYBA 1RF0A 3HTKA 1JMMA 2ZXEB 4N78E 3OCDA 3ITKA 5E79V 2QEXP 3H1KD 1VL2A 3NBSA 3TGUJ 3WC8A 1PL5A 1OMIA 1JY3P 3HD7D 2HV4A 2NPSC 1HUCA 5KJ7C 4WBAA 3SWFA 1NTKK 2QG4A 5E79H 3GMAA 3OA8B 4EIEA 3C1LA 1SQXK 1K3GA 4WQ8A 1EDIA 3H1LJ 2JWAA 1L4AB 1RE3C 2IFNA 1D7MA 3EWKA 2H89C 5DJQC 2IZ1A 1L9JC 2E76B 1CSUA 4D6TD 1YTZT 1JY3N 4H0LC 2HFED 1IO4A 2LR2A 4LLHA 1URQD 2XKMA 3H1JG 3GHGC 3B71A 4O1QA 1ZRTE 2W90A 4UB6V 3SJLA 2FYUK 1KD1Q 5KLVK 1GW3A 2RMZA 5APXA 3U1AA 4U7JA 2FKWB 3TGUG 4AAOA 3B5NC 1BCCE 3WFBC 3HQ8A 5AVZB 4AX3A 1DH3A 4UB6H 1HBWA 4TLFA 3HD7A 5E79E 1RE3A 3P8CD 1VQMP 2N1TB 1K9MQ 3H1LG 3W68A 2IZ0A 2BCCD 2IFMA 3G71P 1P84H 2L5GB 2QJYB 2KZIA 5IY51 1DIPA 2D2CC 3RL0B 2GM4A 1S1CX 1OVUA 4IL6V 4JQ0D 3Q5PA 1XTCC 4Y99B 1CI6A 4XA4A 4GIFA 1MZ4A 3V5BA 1J3SA 3CCVP 3L71D 3D6ZA 4TT3H 2CK3H 1NWQA 4B86A 2GC7D 1LFMA 1AOFA 4WQEA 1CZQA 1GL2C 3OAKA 1CYJA 5CIGB 4IL6H 3L73D 2L4DA 1CHIA 1H31A 1IZNB 1M1JB 4WQ9A 2ZBOA 2R5DA 1PGJA 2YKPA 4L73A 4HJGH 4BRYA 4UB6E 3SWKA 4LJIA 1PPJG 2XU6A 1ZXGA 4O9BA 1NTZJ 1OCDA 4I2LC 1OXZA 5KLIC 4R4MA 3P7KA 3HE5B 1I6EA 2KNCA 3KXDA 2QM7A 1RAPA 1PP9D 2IBZD 1NTME 1L9BC 1KB9H 5TJHA 2WPRA 4ZKPA 4L76A 2FYUE 1KMIZ 5KLVE 1JY2P 1URQB 4MU8A 4JF7A 2K3RA 1G2CA 1JY2O 3CX5D 1VYDA 1T2KC 1SQVE 4EDFA 2ZT9C 1VQ6P 1GL2A 4UB8V 2HYNA 3HUSC 1EZVI 2C2CA 2B89A 2R5BA 1RF1C 1ZP0C 1L0NE 4IL6E 1HF9A 2HODB 4H44D 1M70A 1KYOH 4AAMA 3RK3C 4UB8H 3TSIA 4WQAA 2Y0DA 3O5CA 4NPDA 1EDJA 3M9BA 1HVVA 1S3JA 1NTZG 1JTHB 2V08A 3L4OA 1IJDB 3AEGC 4YTPC 2R32A 2QJKC 4O1WA 1C6RA 1LWUA 1U75B 2E75C 2GA1A 1JM0A 1NIRA 3MK7B 4GT1A 4FB1A 1IC2A 1BGYE 1Y8AA 3SVWA 1KB9E 1FDMA 3SXTA 3E7KA 1DVHA 2B87A 4C7RA 3IF4A 1N7SC 3V2RA 2W27A 2KYVA 1NNOA 5B5EV 3HUSA 1S2EA 4IFDK 4OGQB 4I7ZB 1ETPA 5AW6B 3Q5SA 2K88A 4BXLA 5CCHC 2C1VA 1YITP 1MG3D 1KILB 3FWNA 1FOSE 3IR9A 3VMZA 1YIJP 1ZOYC 2GC4D 2OTKE 1TU3F 4DCKA 1KC8Q 4WQDA 2UWJE 1CIFA 5B5EH 1FDOA 1KYOE 3H1JE 2ZYDA 1PV3A 4UB8E 5APQA 2VHDA 1M6ZA 2FBWC 5KAFV 4PV1D 2OARA 1H32B 5EFWB 1IFIA 1USEA 2Z5IA 3AEDC 3RN0A 1I8OA 2A06G 1NKZB 3MIWA 2HPCA 1FZCB 1FC2C 1M90Q 1N7SA 1AVYA 1LTJC 2KI7B 5KAFH 2WVRA 3NXSA 4EICA 1FZFA 4N78D 3H1LE 1YCCA 5CCHA 3V2QA 3B8EB 3AE5C 2R3SA 1PGQA 5KAIV 1XTGB 4J20A 1LS9A 4IOIH 3SSUA 2B9BA 1R8EA 1A2SA 1IK9A 2QM8A 1HGZA 4H44B 1S9KE 1Q2NA 3PHLA 4GEDB 1S6VB 2KP8A 2ZOOA 5B5EE 3A0HV 2FXOA 3L75J 1J2JB 3F89A 1BDDA 2JEEA 3CX5I 2YIUB 1UIIA 5KAIH 5GTIV 3H1IJ 1LC2A 5CICB 5AVVB 2BEZF 5KKZC 1KILE 2PFXA 4ZMDA 1E29A 2AXCA 3HE4A 4ASVA 3A0HH 1LT9A 2I1KA 1LTJA 1CW5A 3AE7C 2R3CA 2B4ZA 1M7LA 1QVFO 1KB0A 1X9VA 4IFMA 4LC1A 1COTA 2GB8B 1DT1A 1ZRTD 5KAFE 3O6QA 3TNUA 2YNYA 1SQXJ 2PACA 1A56A 1Q86Q 1J1DC 3A9FA 3L70J 2GIWA 1NKNA 1VF5D 1NMIA 1GJQA 1FZGA 1BCCD 2E74B 3N7NA 1USDA 4H13C 4EI2A 4KHXA 1NOHA 2H43A 3KQGA 1T8ZA 1FI9A 2OYHB 1J1EC 2C8SA 3CC4P 4M3LA 1FOSF 4MN4C 1LT1A 2C9LY 4RSZA 1KYOW 4WWIA 2PP6A 3L75G 3H1HJ 4QMAA 4JBZA 5KAIE 1VQPP 4PV1B 3H1IG 2WT7B 3ZOWA 3P8MC 2JTIB 4JYCA 4K3AA 1M56D 5AVRB 5C39A 1IRVA 1QKSA 2KXPB 2WSCJ 3JCUH 3PTZA 1JDLA 2FWLA 2CE1A 3A0HE 3PRJA 2C9XB 2NRGA 2O01H 1LP1A 2WWWA 5GTIE 1HTLC 5CBOA 1BE3J 1FCDC 2M5AB 4N3YB 4C7NA 1NTZE 2JKVA 1RQUA 3MD0A 1R0QA 1SQXG 2E76D 1QL3A 3RGUA 2JJLA 3L70G 1L4AC 3CPWO 2V7QH 1CHJA 2N3BA 1ZMEC 1SQQJ 4WY4B 1SFCB 2K9JB 2E5YA 3PXWA 5DJTB 2O3JA 2Y9ZA 2M3EA 1X8YA 5AW5B 4PD4H 2J5UA 3ZBMA 3CC7P 1ZR2A 3IN6A 2Y9YA 4U3FE 3H1HG 1L0LE 2FY8A 3H1KJ 2YQBA 1NAFA 4W80A 1NTMD 1YICA 1N73B 1SQBE 4HYTB 2FYUD 1GU2A 5CYTR 3ZOXA 5KLVD 4ZNCA 3ZOYA 1K8AQ 1CCHA 2N1TD 3WU2V 4DY9A 1GKSA 2DW3A 3N4XA 2IPPA 1CTZA 1SQVD 1CNOA 1BE3G 2WSFJ 2POHA 3NFQA 5AVTB 3TYYA 1L4AA 2FYNC 1A02F 1K04A 3RL0D 1L0ND 1H0TB 3WU2H 1VF5B 1AJYA 1U7JA 3VYMA 2W83C 4D6TJ 2MJZA 1N8RQ 1SQQG 2YXQB 3CWBE 1C75A 1QVGO 4PD4E 3WUTA 1SQPE 3T97A 1FDIA 1OW8A 1PFIA 1QL4A 3H1KG 1BGYD 2BGVX 1IFPA 1JY3O 1NU1E 3L72E 2C0WA 5KJ7D 1KB9D 4JCGA 2C1DB 2GUSA 1VPCA 1GTWA 1VQOP 2YO3A 3HD7C 5CCGD 1CXCA 1KQFB 3WFDC 1FBMA 1S72P 1FHBA 2N1TA 2MTAC 2O01N 2FXMA 1X22A 1M60A
chains in the Genus database with same CATH topology
1HCMA 1FJ0A 1WEJF 5TJHA 3JBTB 3O20A 2D0SA 1B7VA 1SQXD 155CA 1E8EA 3BCCD 5CIBB 3L70D 4YE1A 3WFCC 4MU8A 2KS1A 3NWVA 2OZ1B 3VMAA 3RN1A 3CX5D 3GG2A 1VYDA 2BCNB 1KYOD 3H1JD 4EDFA 3O0RC 1CORA 1YEBA 4UB8V 2ZONG 5H2FV 1A8CA 2EXVA 3KZIV 2C2CA 1H9YA 4FA9A 1CTJA 1DW2A 1P84D 5KKZB 1LC1A 2AIUA 2N9YB 4XYDB 1M70A 3PXSA 4QAOA 4AAMA 3CU4A 1LMSA 5C9MA 4WQAA 2Y0DA 3O5CA 1FI7A 5GTHV 3GW6A 4EIFA 3DR0A 3NBTA 1CYIA 3SWSA 5EXQA 2N18B 2V08A 3L4OA 4O1WA 2C1DA 2DGEA 1C6RA 3H1LD 3OA8A 1U75B 1N9CA 1NIRA 3DMIA 1FI3A 3MK7B 3PLNA 4FB1A 2BLFB 1BE3D 3SVWA 2N9JA 3SXTA 1CIGA 1DVHA 2B10B 3L74D 3CYTI 1YIQA 1H1OA 1DVVA 1RZ5A 1HZUA 2MHMA 1AYGA 3M97X 1NNOA 5B66V 4Q5PA 3HQ6A 5B5EV 3VNWA 1N90A 2BH5X 2XTSB 1QYZA 1ETPA 1DW1A 3DP5A 3CP5A 4P4QB 1CO6A 2C1VA 1W2LA 1MG3D 1I6DA 1GQ1A 4A7PA 3X39A 1DIQC 2GC4D 1IRWA 4WQDA 3H1ID 1CIFA 4GYDA 3CX5W 1WVEC 1KX2A 1HJ3A 2VHDA 1M6ZA 1CHHA 5KAFV 1H32B 4NFGB 1CSWA 1HRCA 1C2RA 3O1YA 1HJ4A 1DIIC 5DJQB 4FANA 3ZCFA 1HJ5A 3RN0A 1CTYA 1I54A 1I8OA 3VRDA 1U74B 2AXTV 1KV9A 4KMGA 4K3IA 4L1QA 3RLMA 4WQCA 1CIHA 2CE0A 2B0ZB 4XXLA 4EICA 1DW3A 2N3YA 2L91A 1IQCA 1EZVD 1S5LV 1NMLA 3CXHD 1YCCA 5CIHB 3WUIA 1EB7A 2V07A 5KAIV 3WFEC 3OCDB 4J20A 1LS9A 1CRHA 1I8PA 2YCCA 5DFSA 1CRIA 4FA4A 3KHUA 1A2SA 3H1HD 3HQ7A 3TGUD 2JQRA 3PHLA 4GEDB 1S6VB 4FAVA 2ZOOA 4H0JA 3A0HV 2YIUB 2C1UA 2B12B 5GTIV 4AANA 1AKKA 1YTCA 2BPBB 1F1CA 5CICB 1LC2A 1RZ6A 1NTZD 2YK3A 1MG2D 4PWAA 1E29A 2N9IA 1YNRA 2RN0A 2DVHA 1CIEA 3A0BV 2B4ZA 1H32A 2FYNB 1KB0A 4RJTA 1COTA 2N18C 1RAQA 2GB8B 3FWLA 1DT1A 5CIEB 1ZRTD 5CIDB 1CYCA 1HZVA 351CA 3MK7C 1CCRA 2PACA 1A56A 1N15A 3A9FA 1SQQD 4EIDA 1KX7A 1C2NA 2GIWA 4U3FD 4FA1A 2OZ1A 1L0LD 5C0ZA 1NMIA 1GJQA 1HH7A 1BCCD 1DW0A 1E2RA 1AOQA 3ORVA 5TISV 2I8FA 1F1FA 1H33B 451CA 1SQBD 1FI9A 1YEAA 2C8SA 3OCDA 3ITKA 5E79V 3H1KD 4RSZA 1KYOW 3NBSA 3WC8A 5KLIB 1PPJD 2LITA 2B11B 2HV4A 3ZOWA 2JTIB 2QG4A 1IRVA 1QKSA 3PTZA 1JDLA 2FWLA 4V2KA 3OA8B 4EIEA 2CE1A 3PRJA 1K3GA 2C9XB 4WQ8A 2JWAA 2LIRA 1FCDC 5DJQC 4PW9B 3CWBD 1R0QA 1L9JC 1CSUA 4D6TD 4PD4D 1QL3A 1SQPD 5CIFB 1H9XA 1C7MA 2ZZS1 1CHJA 1CRGA 3TDKA 5B6QA 2N3BA 2AI5A 1NU1D 1CC5A 4PJ0V 2K9JB 3L72D 4O1QA 3ZOOA 3PXWA 2O3JA 4UB6V 1H31B 3SJLA 3ZBMA 1CRJA 3HQ9A 1CSXA 1H33A 1CSVA 2RMZA 1QN2A 1OAEA 1CRCA 4AAOA 2ZXYA 1K3HA 2YQBA 1CXAA 3WFBC 3HQ8A 2BH4X 1NTMD 4AX3A 2QJKB 1YICA 2KNCB 4N0KA 1GIWA 2FYUD 1GU2A 5CYTR 3ZOXA 5KLVD 2CA4B 3ZOYA 1CCHA 5DF5A 2PCBB 3WU2V 3PH2B 1HROA 4DY9A 1GKSA 3L4MA 2D0WA 2BCCD 1CTZA 1SQVD 1CNOA 2QJYB 5IY51 4H0KA 1IO3A 1FOCA 4L3HA 1L0ND 2Q3EA 3TF5A 4IL6V 3VYMA 1KIBA 2Y0EA 1I55A 1MZ4A 1J3SA 3L71D 3ZIYA 1ZZHA 1CEDA 2PCCB 2GC7D 1LFMA 1AOFA 4WQEA 1GDVA 1C75A 1CYJA 5CIGB 3TYIA 1IZL0 3L73D 3CXHW 2L4DA 1CHIA 1H31A 3L75D 4WQ9A 2ZBOA 1CRYA 1QL4A 3PXTA 1BGYD 2BGVX 1YFCA 3RMZA 1BL9A 1C6SA 1KB9D 4JCGA 2C1DB 4LJIA 3SLEA 1OCDA 2CA3B 5AURA 2FRCA 4FA5A 1C6OA 1CXCA 1I5TA 1C52A 1I6EA 2A06D 2CXBA 2ORLA 1N50A 1RAPA 3WFDC 1PP9D 4AALA 2IBZD 4WQBA 4Y5RA 1W5CT 4WQ7A 1FHBA 2Y0CA 3C2CA 2MTAC 1L9BC 2QJPB 1NTKD 4L3GA 1M60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HCM A;  1FJ0 A;  1WEJ F;  5TJH A;  3JBT B;  3O20 A;  2D0S A;  1B7V A;  1SQX D;  155C A;  1E8E A;  3BCC D;  5CIB B;  3L70 D;  4YE1 A;  3WFC C;  4MU8 A;  2KS1 A;  3NWV A;  2OZ1 B;  3VMA A;  3RN1 A;  3CX5 D;  3GG2 A;  1VYD A;  2BCN B;  1KYO D;  3H1J D;  4EDF A;  3O0R C;  1COR A;  1YEB A;  4UB8 V;  2ZON G;  5H2F V;  1A8C A;  2EXV A;  3KZI V;  2C2C A;  1H9Y A;  4FA9 A;  1CTJ A;  1DW2 A;  1P84 D;  5KKZ B;  1LC1 A;  2AIU A;  2N9Y B;  4XYD B;  1M70 A;  3PXS A;  4QAO A;  4AAM A;  3CU4 A;  1LMS A;  5C9M A;  4WQA A;  2Y0D A;  3O5C A;  1FI7 A;  5GTH V;  3GW6 A;  4EIF A;  3DR0 A;  3NBT A;  1CYI A;  3SWS A;  5EXQ A;  2N18 B;  2V08 A;  3L4O A;  4O1W A;  2C1D A;  2DGE A;  1C6R A;  3H1L D;  3OA8 A;  1U75 B;  1N9C A;  1NIR A;  3DMI A;  1FI3 A;  3MK7 B;  3PLN A;  4FB1 A;  2BLF B;  1BE3 D;  3SVW A;  2N9J A;  3SXT A;  1CIG A;  1DVH A;  2B10 B;  3L74 D;  3CYT I;  1YIQ A;  1H1O A;  1DVV A;  1RZ5 A;  1HZU A;  2MHM A;  1AYG A;  3M97 X;  1NNO A;  5B66 V;  4Q5P A;  3HQ6 A;  5B5E V;  3VNW A;  1N90 A;  2BH5 X;  2XTS B;  1QYZ A;  1ETP A;  1DW1 A;  3DP5 A;  3CP5 A;  4P4Q B;  1CO6 A;  2C1V A;  1W2L A;  1MG3 D;  1I6D A;  1GQ1 A;  4A7P A;  3X39 A;  1DIQ C;  2GC4 D;  1IRW A;  4WQD A;  3H1I D;  1CIF A;  4GYD A;  3CX5 W;  1WVE C;  1KX2 A;  1HJ3 A;  2VHD A;  1M6Z A;  1CHH A;  5KAF V;  1H32 B;  4NFG B;  1CSW A;  1HRC A;  1C2R A;  3O1Y A;  1HJ4 A;  1DII C;  5DJQ B;  4FAN A;  3ZCF A;  1HJ5 A;  3RN0 A;  1CTY A;  1I54 A;  1I8O A;  3VRD A;  1U74 B;  2AXT V;  1KV9 A;  4KMG A;  4K3I A;  4L1Q A;  3RLM A;  4WQC A;  1CIH A;  2CE0 A;  2B0Z B;  4XXL A;  4EIC A;  1DW3 A;  2N3Y A;  2L91 A;  1IQC A;  1EZV D;  1S5L V;  1NML A;  3CXH D;  1YCC A;  5CIH B;  3WUI A;  1EB7 A;  2V07 A;  5KAI V;  3WFE C;  3OCD B;  4J20 A;  1LS9 A;  1CRH A;  1I8P A;  2YCC A;  5DFS A;  1CRI A;  4FA4 A;  3KHU A;  1A2S A;  3H1H D;  3HQ7 A;  3TGU D;  2JQR A;  3PHL A;  4GED B;  1S6V B;  4FAV A;  2ZOO A;  4H0J A;  3A0H V;  2YIU B;  2C1U A;  2B12 B;  5GTI V;  4AAN A;  1AKK A;  1YTC A;  2BPB B;  1F1C A;  5CIC B;  1LC2 A;  1RZ6 A;  1NTZ D;  2YK3 A;  1MG2 D;  4PWA A;  1E29 A;  2N9I A;  1YNR A;  2RN0 A;  2DVH A;  1CIE A;  3A0B V;  2B4Z A;  1H32 A;  2FYN B;  1KB0 A;  4RJT A;  1COT A;  2N18 C;  1RAQ A;  2GB8 B;  3FWL A;  1DT1 A;  5CIE B;  1ZRT D;  5CID B;  1CYC A;  1HZV A;  351C A;  3MK7 C;  1CCR A;  2PAC A;  1A56 A;  1N15 A;  3A9F A;  1SQQ D;  4EID A;  1KX7 A;  1C2N A;  2GIW A;  4U3F D;  4FA1 A;  2OZ1 A;  1L0L D;  5C0Z A;  1NMI A;  1GJQ A;  1HH7 A;  1BCC D;  1DW0 A;  1E2R A;  1AOQ A;  3ORV A;  5TIS V;  2I8F A;  1F1F A;  1H33 B;  451C A;  1SQB D;  1FI9 A;  1YEA A;  2C8S A;  3OCD A;  3ITK A;  5E79 V;  3H1K D;  4RSZ A;  1KYO W;  3NBS A;  3WC8 A;  5KLI B;  1PPJ D;  2LIT A;  2B11 B;  2HV4 A;  3ZOW A;  2JTI B;  2QG4 A;  1IRV A;  1QKS A;  3PTZ A;  1JDL A;  2FWL A;  4V2K A;  3OA8 B;  4EIE A;  2CE1 A;  3PRJ A;  1K3G A;  2C9X B;  4WQ8 A;  2JWA A;  2LIR A;  1FCD C;  5DJQ C;  4PW9 B;  3CWB D;  1R0Q A;  1L9J C;  1CSU A;  4D6T D;  4PD4 D;  1QL3 A;  1SQP D;  5CIF B;  1H9X A;  1C7M A;  2ZZS 1;  1CHJ A;  1CRG A;  3TDK A;  5B6Q A;  2N3B A;  2AI5 A;  1NU1 D;  1CC5 A;  4PJ0 V;  2K9J B;  3L72 D;  4O1Q A;  3ZOO A;  3PXW A;  2O3J A;  4UB6 V;  1H31 B;  3SJL A;  3ZBM A;  1CRJ A;  3HQ9 A;  1CSX A;  1H33 A;  1CSV A;  2RMZ A;  1QN2 A;  1OAE A;  1CRC A;  4AAO A;  2ZXY A;  1K3H A;  2YQB A;  1CXA A;  3WFB C;  3HQ8 A;  2BH4 X;  1NTM D;  4AX3 A;  2QJK B;  1YIC A;  2KNC B;  4N0K A;  1GIW A;  2FYU D;  1GU2 A;  5CYT R;  3ZOX A;  5KLV D;  2CA4 B;  3ZOY A;  1CCH A;  5DF5 A;  2PCB B;  3WU2 V;  3PH2 B;  1HRO A;  4DY9 A;  1GKS A;  3L4M A;  2D0W A;  2BCC D;  1CTZ A;  1SQV D;  1CNO A;  2QJY B;  5IY5 1;  4H0K A;  1IO3 A;  1FOC A;  4L3H A;  1L0N D;  2Q3E A;  3TF5 A;  4IL6 V;  3VYM A;  1KIB A;  2Y0E A;  1I55 A;  1MZ4 A;  1J3S A;  3L71 D;  3ZIY A;  1ZZH A;  1CED A;  2PCC B;  2GC7 D;  1LFM A;  1AOF A;  4WQE A;  1GDV A;  1C75 A;  1CYJ A;  5CIG B;  3TYI A;  1IZL 0;  3L73 D;  3CXH W;  2L4D A;  1CHI A;  1H31 A;  3L75 D;  4WQ9 A;  2ZBO A;  1CRY A;  1QL4 A;  3PXT A;  1BGY D;  2BGV X;  1YFC A;  3RMZ A;  1BL9 A;  1C6S A;  1KB9 D;  4JCG A;  2C1D B;  4LJI A;  3SLE A;  1OCD A;  2CA3 B;  5AUR A;  2FRC A;  4FA5 A;  1C6O A;  1CXC A;  1I5T A;  1C52 A;  1I6E A;  2A06 D;  2CXB A;  2ORL A;  1N50 A;  1RAP A;  3WFD C;  1PP9 D;  4AAL A;  2IBZ D;  4WQB A;  4Y5R A;  1W5C T;  4WQ7 A;  1FHB A;  2Y0C A;  3C2C A;  2MTA C;  1L9B C;  2QJP B;  1NTK D;  4L3G A;  1M60 A; 
#chains in the Genus database with same CATH topology
 1HCM A;  1WEJ F;  3O20 A;  2D0S A;  1B7V A;  1VQ4 P;  155C A;  5APS A;  3WU2 E;  1E8E A;  1NJI Q;  5CIB B;  2WZ7 A;  1OFC X;  1WRG A;  4WB4 A;  3WFC C;  3G9R A;  1EZV G;  4D6T G;  3RN1 A;  3GG2 A;  3A7O A;  2BCN B;  1KYO D;  3H1J D;  2I8D A;  1COR A;  1YEB A;  4ASW A;  2ZON G;  5H2F V;  3L71 J;  1KV4 A;  3KZI V;  1URQ C;  3CXH I;  1CTJ A;  2ZYG A;  2FFD C;  1LC1 A;  3B5N D;  2AIU A;  2N9Y B;  4XYD B;  2P1J A;  3I5C A;  3CU4 A;  1LMS A;  5C9M A;  5AW4 B;  5H2F H;  1M1J A;  2PGD A;  3KZI H;  5GTH V;  3GW6 A;  4EIF A;  3DR0 A;  5EXQ A;  2N18 B;  1YJW P;  2M0B A;  3H1L D;  1PGP A;  1T3J A;  3H6P A;  3L75 E;  1N9C A;  3DMI A;  3PLN A;  3CCR P;  1GZL A;  1SQQ K;  2AEJ A;  3CCS P;  1PP9 J;  2D2C D;  5GTH H;  3LW5 J;  4GKG A;  2WSC H;  1LTS C;  1YIQ A;  1S9K D;  1RZ5 A;  2KLU A;  1AYG A;  2MHM A;  2HR3 A;  1JEK A;  1URQ A;  1NTK E;  1N90 A;  3H32 B;  2BH5 X;  4OGQ D;  4EIJ A;  4P4Q B;  3L71 G;  3CP5 A;  1SQX E;  1KIL D;  2FFD A;  2OYI B;  3USS A;  1I6D A;  2QSI A;  3BCC E;  2N9B A;  3L70 E;  2NPS B;  4EOT A;  4AYC A;  3SFE C;  2QE7 H;  4OWF A;  1IFM A;  5H2F E;  1H88 A;  3KZI E;  1CHH A;  4NPF X;  1HRC A;  1LJ2 A;  3D71 A;  1P84 E;  1HGV A;  3M06 A;  1DII C;  5DJQ B;  4FAN A;  1LWU C;  5AVU B;  1HJ5 A;  1JTH A;  2OQQ A;  1U74 B;  3P32 A;  3C9I A;  4H0L B;  1PP9 G;  4K3I A;  5AW1 B;  5GTH E;  3RLM A;  1AQT A;  1OWA A;  2CE0 A;  1VQN P;  3GHG B;  5K5G B;  1ZV8 A;  2QJP C;  3AE3 C;  1S5L V;  3FXE A;  1G1I A;  5CIH B;  4I6M C;  3VMX A;  1EB7 A;  2QIW A;  3BRT B;  2V07 A;  1FZB A;  1BE3 E;  2WSF H;  3HRN A;  3WFE C;  1PZQ A;  1LTI C;  1CRH A;  1N86 A;  2O1K A;  3L74 E;  1JMB A;  3B5N B;  1M1K Q;  2OYO A;  2JQR A;  4FAV A;  1QL1 A;  1S5L H;  3S4R A;  2FXP A;  2BEQ D;  1OVR A;  2P58 A;  3V6I A;  1YJN P;  1N2D C;  4BRY B;  4AAN A;  1YTC A;  1F1C A;  2Q7C A;  1RZ6 A;  5CJ4 A;  1NTZ D;  4DJG A;  4PWA A;  1YNR A;  2XV5 A;  4DT0 A;  1QX8 A;  1KZU B;  1CIE A;  3AE2 C;  2W8Z A;  1EXJ A;  1ZW0 A;  1H32 A;  2D2C B;  1VQ9 P;  1QL2 A;  4RJT A;  1RAQ A;  3GF7 A;  2G3A A;  1HZV A;  351C A;  1CCR A;  3RK2 C;  5CBN A;  1FZC A;  1N15 A;  3EFF K;  1FE6 A;  3G3Z A;  4EID A;  1KX7 A;  3D6Y A;  1G2C B;  1QEX A;  4U3F D;  3LIE A;  2OZ1 A;  1L0L D;  5C0Z A;  1GL2 B;  1HH7 A;  4OVN F;  3G4S P;  1E2R A;  2E74 D;  3ORV A;  4RES B;  1HJ0 A;  1RY3 A;  2LXC B;  2YKQ A;  2XNX A;  1DX7 A;  2I8F A;  1H33 B;  451C A;  3GLM A;  1SQB D;  1KOR A;  1YEA A;  2AEM A;  1KFM A;  3G6E P;  1MZ9 A;  4GOF A;  1S5L E;  1EZV E;  3WUV A;  2W6B A;  1HJB A;  2XZR A;  2QRX A;  3PP5 A;  5KLI B;  1UIX A;  2Q5U A;  1LTB C;  2OYH C;  3WUU A;  3O8Z A;  3TGU E;  3CCQ P;  4HB1 A;  3U59 A;  4V2K A;  2MKV A;  3EFG A;  1KFN A;  1LNQ A;  3VP8 A;  4PV1 C;  1LT9 C;  2LIR A;  5AW3 B;  1YHQ P;  4ZKU A;  3MUD C;  5DJU B;  1NGM B;  1W2E A;  5KTB A;  3CWB D;  3AEE C;  2XND H;  4PD4 D;  1SQP D;  2IBZ I;  5CIF B;  4WVZ A;  1GK4 A;  4K35 A;  3OJA B;  1C7M A;  1CRG A;  3HUS B;  5B6Q A;  3ABV C;  1RF1 B;  4WY4 D;  1NU1 D;  1SFC D;  3L72 D;  2H7H A;  1PIX A;  1BCC J;  4HH2 A;  1VQL P;  2W6A A;  1CRJ A;  1NO4 A;  3HQ9 A;  1QGK B;  2OYH A;  1YQ4 C;  3L36 A;  4IL6 X;  2ZXY A;  2BH4 X;  4XFJ A;  2QJK B;  1IFJ A;  2WPV B;  5BU8 B;  5AW2 B;  3C8V A;  2CA4 B;  1SP4 A;  2WT7 A;  4EYY Q;  3V4Q A;  3PH2 B;  3M91 A;  3MUD A;  1DD4 A;  2D0W A;  1W5C E;  2ZXX A;  1PPJ E;  1NYH A;  2HPC B;  1N7S B;  1SS1 A;  1FAV A;  2KS1 B;  4H0K A;  1IO3 A;  1FOC A;  1NAY A;  1FJP A;  2M5A A;  2Q3E A;  3TF5 A;  3AEB C;  2Y0E A;  4AUW A;  1I55 A;  3CD6 P;  3AEC C;  2VRS A;  1T3U A;  3AE1 C;  1ZZH A;  1CED A;  2PCC B;  1WT6 A;  1IFD A;  5CJ0 A;  1GDV A;  1BCC G;  4KT0 J;  3AE9 C;  2K9J A;  5APU A;  4GOD A;  3L75 D;  3JSV C;  1HH0 A;  1H8A A;  1RQV A;  2PRR A;  1BL9 A;  1C6S A;  1JOC A;  1JO5 A;  2YMY A;  2CA3 B;  5AUR A;  3HE4 B;  2FRC A;  1IFN A;  4FA5 A;  3RK3 E;  1C52 A;  2JO1 A;  1LTJ B;  1GMJ A;  2ORL A;  1N50 A;  3I55 P;  4AAL A;  4WQB A;  3CCM P;  1W5C T;  4WQ7 A;  2Y0C A;  3C2C A;  2KSJ A;  1FJK A;  2WTY A;  1NTK D;  5APW A;  4L3G A;  5AVW B;  1FJ0 A;  1YTZ I;  3A3Y B;  3O6Q B;  3TNU B;  3JBT B;  1SQX D;  1SQV J;  3Q2Y A;  3B4S A;  2YXR B;  3BCC D;  3L70 D;  2B88 A;  2ZAE B;  3NWV A;  2E43 A;  3L35 A;  4HKZ H;  2E76 C;  1L0N J;  3CCE P;  1H0T A;  1E79 H;  3O0R C;  5L8R J;  3ZDM A;  1AV1 A;  2WIT A;  1A8C A;  2P67 A;  2H88 C;  2CPB A;  1H9Y A;  3AEF C;  4FA9 A;  1P84 D;  5KKZ B;  1KQG B;  3RL0 g;  4QAO A;  2A45 I;  2KK7 A;  3JCU E;  3Q3D A;  1BGY J;  3NBT A;  1E5W A;  2C1D A;  2DGE A;  3A2A A;  3OA8 A;  3NTN A;  1WMK A;  1FI3 A;  2YO2 A;  4IFF A;  1ZLL A;  2P2U A;  1BE3 D;  1L2P A;  2N1T C;  1J1D B;  3KPE A;  1DEB A;  2R44 A;  1CIG A;  2RKL A;  1SQV G;  3L74 D;  5M1B A;  1OX3 A;  4H13 B;  1DVV A;  1RH5 B;  2A06 E;  3M97 X;  1FZA A;  2QJY C;  5B66 V;  1VQK P;  2HG5 D;  3RL0 C;  1L0N G;  3S1K A;  1J1E B;  3VNW A;  2KUB A;  1KQS O;  3VP9 A;  4Y99 C;  3CL3 D;  3DP5 A;  1DEE G;  1CO6 A;  2M3B A;  4N6J A;  3M0A A;  4A7P A;  1DIQ C;  1IRW A;  1RE4 C;  5B66 H;  2NPS D;  5AVY B;  3CCJ P;  1W2B O;  1IK7 A;  4DOJ A;  4GYD A;  3M9Q A;  3L37 A;  3CX5 W;  1WVE C;  1K05 A;  2P10 A;  1EXI A;  1KX2 A;  1HJ3 A;  2OYI C;  3V2N A;  1M1J C;  1BGY G;  4NFG B;  2ITA A;  3UIA A;  1C2R A;  4NPE A;  1Q82 Q;  5CCG C;  2BCC J;  4C46 A;  3VRD A;  4YPC A;  1EQ7 A;  2LKM A;  2HLO A;  4KMG A;  4H0L D;  2KZJ A;  4WQC A;  4YXD C;  4XXL A;  3TK1 A;  1VQ8 P;  2L91 A;  3H25 A;  3SWY A;  1EZV D;  3FGA D;  3CME P;  1NML A;  2WPQ A;  3HTK B;  3VN0 A;  1KTM A;  3OCD B;  3PH0 A;  1RE4 A;  2YCC A;  4Y28 J;  1QLE D;  3VOP A;  4FA4 A;  3KHU A;  1NTM K;  3AE8 C;  3TGU D;  3H32 A;  1G1J A;  3T97 B;  2KB7 P;  3AEA C;  5B66 E;  3L73 J;  4DZO A;  4H0J A;  3CXH H;  3W67 A;  2OYI A;  2KOG A;  2C1U A;  2JP3 A;  3QWO C;  2NPS A;  4W7Z A;  3IAO A;  2Z4E A;  1AKK A;  1R5S A;  5KJ7 A;  3D0W A;  4W7Y A;  2YK3 A;  1MG2 D;  1SQV K;  2N9I A;  3KDP B;  5CCG A;  1A02 J;  3U1C A;  2G8Y A;  3HE5 A;  2W6J H;  1P84 I;  1U7M A;  1LTA C;  2AEF A;  3H1I E;  2DVH A;  2RN0 A;  1M57 D;  3GF3 A;  1BSN A;  3A0B V;  2FYN B;  1L0N K;  2BCC G;  3CCL P;  3FWL A;  2I1J A;  1Q81 Q;  5CIE B;  3V4W A;  1HWT C;  3MK7 C;  2C9N Y;  1ZN5 A;  2Z5H A;  2E42 A;  3A0B H;  1C2N A;  4OH8 B;  3GHG A;  1GL2 D;  4L75 A;  2PAJ A;  1AOQ A;  2KLV A;  2WPS A;  5TIS V;  2K1A A;  1F1F A;  3Q1M A;  4OGQ C;  4I7Z C;  2K37 A;  3AE6 C;  3L73 G;  1CSB A;  3CXH E;  1KIL C;  2HOD A;  3B5N A;  1PPJ D;  2GUV A;  3HD7 B;  2LIT A;  3S9O A;  2B11 B;  5TIS H;  4YXW H;  1K73 Q;  4L74 A;  3H1H E;  3K5B A;  4Z1M H;  2IDB A;  5BVZ A;  1N7L A;  3AE4 C;  2Q9I A;  2V4H A;  1KB9 I;  2J59 M;  3RBX A;  2IBZ G;  5AVS B;  1JUN A;  1Z56 A;  4PW9 B;  1CI6 B;  2IYP A;  1FS0 E;  1MUU A;  3BAS A;  1T2K D;  2ZT9 D;  3BRV B;  1FZC C;  1H9X A;  3A0B E;  2ZZS 1;  3MGN A;  3TDK A;  2QVA A;  4XE5 B;  3BVH A;  2OTL P;  2AI5 A;  1CC5 A;  4PJ0 V;  3ZOO A;  1AVO A;  4U3F J;  2FFD B;  1L0L J;  1H31 B;  1OIP A;  1KIL A;  3KYQ A;  1SQQ E;  1CSX A;  1KYO I;  3RK3 D;  1H33 A;  1CSV A;  1SQB J;  1QN2 A;  1OAE A;  3VYI A;  1OZH A;  1CRC A;  3MHV A;  3CC2 P;  1K3H A;  1CXA A;  1GDT A;  4PJ0 H;  4H44 C;  5TIS E;  1VQ7 P;  3NMD A;  2ZJS E;  2O01 J;  2KNC B;  4N0K A;  1YQ3 C;  2E75 D;  3IFM A;  1YJ9 P;  1GIW A;  3EQ2 A;  1Q90 D;  2YIU C;  5CHX A;  1JY2 N;  4CPG A;  3H1K E;  1OW6 A;  5DF5 A;  5CMZ A;  2PCB B;  1HRO A;  1EDK A;  3L4M A;  4JPZ B;  4RO0 A;  2P7J A;  2XDJ A;  1GU4 A;  1N7S D;  1JCD A;  3E1R A;  2V7Q J;  2Q1K A;  4LGD E;  2WSE J;  3RK2 D;  2Q3I A;  3CLQ A;  2J58 A;  4L3H A;  3VMY A;  1YI2 P;  4I1L A;  1KIB A;  3CWB J;  5CCH D;  1BSH A;  4GOE A;  1Y47 A;  3WMM 0;  1SQP J;  1GD2 E;  3ZIY A;  1GK6 A;  3A5T A;  4U3F G;  1L0L G;  5APT A;  2Q6Q A;  3R4Y A;  4D6T E;  1RF1 A;  1NU1 J;  5AW9 B;  3L72 J;  2E74 C;  3TYI A;  1IZL 0;  3CXH W;  5AVX B;  1SQB G;  3II6 A;  1CRY A;  3PXT A;  4PJ0 E;  1YFC A;  3RMZ A;  2BAS A;  3SLE A;  1LWU B;  3CI9 A;  2OGU A;  2E5T A;  3M9H A;  1X79 B;  3R2P A;  5AVQ B;  1U57 A;  3MTU E;  1C6O A;  1I5T A;  1OVV A;  2A06 D;  2CXB A;  1LGH B;  3L4F A;  4Y5R A;  2B87 B;  2QJP B;  2ZT9 B;  1JCC A;  2JWD A;  3P8C E;  2WMM A;  3CWB G;  4YE1 A;  1LTT C;  1FZE A;  2KS1 A;  2OZ1 B;  3VMA A;  2BCC E;  2KIK A;  2M8R A;  1SQP G;  3LW5 H;  2C0X A;  4AQR D;  1DD3 A;  3VTP C;  3JC2 2;  2IYO A;  3RK3 B;  2EXV A;  2YMK A;  2A45 G;  1YBK A;  1NU1 G;  1R5L A;  3L72 G;  1MFT A;  2QA4 P;  4WY4 C;  1SFC C;  4BWN A;  1DW2 A;  1NTZ K;  3E1I A;  2WSS H;  3L71 E;  2OTJ P;  3CX5 H;  2E75 B;  3PXS A;  2ZFC A;  1MFZ A;  3MZW B;  5APY A;  3BAT A;  1FI7 A;  1FU1 A;  5AW8 B;  1CYI A;  3SWS A;  2JDI H;  5APV A;  3L73 E;  1N73 C;  3M0D C;  3SFD C;  3OA7 A;  3RK2 B;  2FYZ A;  2BLF B;  1MKM A;  2WQY C;  2N9J A;  1S4X A;  1L0L K;  5GTI H;  2B10 B;  2ZYA A;  1GU5 A;  1PGO A;  3CYT I;  1NTK J;  1H1O A;  4H13 D;  1HZU A;  1SQB K;  1AQ5 A;  1PP9 E;  4Q5P A;  3HQ6 A;  2IBZ E;  1Y9B A;  3BCC J;  2XTS B;  1VF5 C;  1QYZ A;  4WY4 A;  1EC5 A;  1SFC A;  1DW1 A;  1W2L A;  3CCU P;  1GQ1 A;  2IX7 C;  4GDO A;  3X39 A;  1SVF A;  3H1I D;  3CX5 E;  1BDC A;  1NHL A;  1S5L X;  1NTM J;  1LTG C;  1M8O B;  1N73 A;  1LT9 B;  3M0D A;  3LID A;  2FYU J;  5KLV J;  1CSW A;  2RH0 A;  1AFO A;  3O1Y A;  4RKU J;  1HJ4 A;  3ZCF A;  1CTY A;  1I54 A;  1AA0 A;  2ZVN B;  1SQP K;  5AW7 B;  2AXT V;  1KV9 A;  1RHZ B;  4L1Q A;  1L4A D;  1CIH A;  2B0Z B;  1NU1 K;  1DW3 A;  1NTK G;  2N3Y A;  3QH9 A;  1IQC A;  3D70 A;  1VQ5 P;  3L74 J;  3CXH D;  1SLQ A;  2AXT H;  2KSE A;  3BCC G;  3F5H A;  3WUI A;  2JR8 A;  1KN7 A;  1MV8 A;  2WSE H;  4PD4 I;  1I8P A;  4R4L A;  5DFS A;  1CRI A;  2ZVO B;  3H1H D;  3HQ7 A;  1RF0 C;  3RBZ A;  1OW7 A;  3I56 P;  2H8P D;  2LXB A;  2NZ2 A;  1VDF A;  1YYC A;  2B12 B;  1NTM G;  2BPB B;  1Q7Y Q;  3MP7 B;  2A45 H;  2FYU G;  3V2P A;  1LP1 B;  2YKO A;  2CPS A;  5KLV G;  1ZR4 A;  1GW4 A;  4C7N B;  1EDL A;  4KJM A;  3OW2 O;  2N18 C;  3Q5R A;  1T6A A;  5BU5 A;  1NH4 A;  1JNM A;  2K9Y A;  5CID B;  3PJS K;  1H89 A;  2O1J A;  1CYC A;  1NVO A;  1KQL A;  1JB0 J;  5AW0 B;  1SQQ D;  2SPZ A;  3CMA P;  3L74 G;  2AXT E;  4FA1 A;  3FX0 A;  3FXD A;  3H1J J;  1DW0 A;  1X0T A;  4JYB A;  1RF0 A;  3HTK A;  1JMM A;  2ZXE B;  4N78 E;  3OCD A;  3ITK A;  5E79 V;  2QEX P;  3H1K D;  1VL2 A;  3NBS A;  3TGU J;  3WC8 A;  1PL5 A;  1OMI A;  1JY3 P;  3HD7 D;  2HV4 A;  2NPS C;  1HUC A;  5KJ7 C;  4WBA A;  3SWF A;  1NTK K;  2QG4 A;  5E79 H;  3GMA A;  3OA8 B;  4EIE A;  3C1L A;  1SQX K;  1K3G A;  4WQ8 A;  1EDI A;  3H1L J;  2JWA A;  1L4A B;  1RE3 C;  2IFN A;  1D7M A;  3EWK A;  2H89 C;  5DJQ C;  2IZ1 A;  1L9J C;  2E76 B;  1CSU A;  4D6T D;  1YTZ T;  1JY3 N;  4H0L C;  2HFE D;  1IO4 A;  2LR2 A;  4LLH A;  1URQ D;  2XKM A;  3H1J G;  3GHG C;  3B71 A;  4O1Q A;  1ZRT E;  2W90 A;  4UB6 V;  3SJL A;  2FYU K;  1KD1 Q;  5KLV K;  1GW3 A;  2RMZ A;  5APX A;  3U1A A;  4U7J A;  2FKW B;  3TGU G;  4AAO A;  3B5N C;  1BCC E;  3WFB C;  3HQ8 A;  5AVZ B;  4AX3 A;  1DH3 A;  4UB6 H;  1HBW A;  4TLF A;  3HD7 A;  5E79 E;  1RE3 A;  3P8C D;  1VQM P;  2N1T B;  1K9M Q;  3H1L G;  3W68 A;  2IZ0 A;  2BCC D;  2IFM A;  3G71 P;  1P84 H;  2L5G B;  2QJY B;  2KZI A;  5IY5 1;  1DIP A;  2D2C C;  3RL0 B;  2GM4 A;  1S1C X;  1OVU A;  4IL6 V;  4JQ0 D;  3Q5P A;  1XTC C;  4Y99 B;  1CI6 A;  4XA4 A;  4GIF A;  1MZ4 A;  3V5B A;  1J3S A;  3CCV P;  3L71 D;  3D6Z A;  4TT3 H;  2CK3 H;  1NWQ A;  4B86 A;  2GC7 D;  1LFM A;  1AOF A;  4WQE A;  1CZQ A;  1GL2 C;  3OAK A;  1CYJ A;  5CIG B;  4IL6 H;  3L73 D;  2L4D A;  1CHI A;  1H31 A;  1IZN B;  1M1J B;  4WQ9 A;  2ZBO A;  2R5D A;  1PGJ A;  2YKP A;  4L73 A;  4HJG H;  4BRY A;  4UB6 E;  3SWK A;  4LJI A;  1PPJ G;  2XU6 A;  1ZXG A;  4O9B A;  1NTZ J;  1OCD A;  4I2L C;  1OXZ A;  5KLI C;  4R4M A;  3P7K A;  3HE5 B;  1I6E A;  2KNC A;  3KXD A;  2QM7 A;  1RAP A;  1PP9 D;  2IBZ D;  1NTM E;  1L9B C;  1KB9 H;  5TJH A;  2WPR A;  4ZKP A;  4L76 A;  2FYU E;  1KMI Z;  5KLV E;  1JY2 P;  1URQ B;  4MU8 A;  4JF7 A;  2K3R A;  1G2C A;  1JY2 O;  3CX5 D;  1VYD A;  1T2K C;  1SQV E;  4EDF A;  2ZT9 C;  1VQ6 P;  1GL2 A;  4UB8 V;  2HYN A;  3HUS C;  1EZV I;  2C2C A;  2B89 A;  2R5B A;  1RF1 C;  1ZP0 C;  1L0N E;  4IL6 E;  1HF9 A;  2HOD B;  4H44 D;  1M70 A;  1KYO H;  4AAM A;  3RK3 C;  4UB8 H;  3TSI A;  4WQA A;  2Y0D A;  3O5C A;  4NPD A;  1EDJ A;  3M9B A;  1HVV A;  1S3J A;  1NTZ G;  1JTH B;  2V08 A;  3L4O A;  1IJD B;  3AEG C;  4YTP C;  2R32 A;  2QJK C;  4O1W A;  1C6R A;  1LWU A;  1U75 B;  2E75 C;  2GA1 A;  1JM0 A;  1NIR A;  3MK7 B;  4GT1 A;  4FB1 A;  1IC2 A;  1BGY E;  1Y8A A;  3SVW A;  1KB9 E;  1FDM A;  3SXT A;  3E7K A;  1DVH A;  2B87 A;  4C7R A;  3IF4 A;  1N7S C;  3V2R A;  2W27 A;  2KYV A;  1NNO A;  5B5E V;  3HUS A;  1S2E A;  4IFD K;  4OGQ B;  4I7Z B;  1ETP A;  5AW6 B;  3Q5S A;  2K88 A;  4BXL A;  5CCH C;  2C1V A;  1YIT P;  1MG3 D;  1KIL B;  3FWN A;  1FOS E;  3IR9 A;  3VMZ A;  1YIJ P;  1ZOY C;  2GC4 D;  2OTK E;  1TU3 F;  4DCK A;  1KC8 Q;  4WQD A;  2UWJ E;  1CIF A;  5B5E H;  1FDO A;  1KYO E;  3H1J E;  2ZYD A;  1PV3 A;  4UB8 E;  5APQ A;  2VHD A;  1M6Z A;  2FBW C;  5KAF V;  4PV1 D;  2OAR A;  1H32 B;  5EFW B;  1IFI A;  1USE A;  2Z5I A;  3AED C;  3RN0 A;  1I8O A;  2A06 G;  1NKZ B;  3MIW A;  2HPC A;  1FZC B;  1FC2 C;  1M90 Q;  1N7S A;  1AVY A;  1LTJ C;  2KI7 B;  5KAF H;  2WVR A;  3NXS A;  4EIC A;  1FZF A;  4N78 D;  3H1L E;  1YCC A;  5CCH A;  3V2Q A;  3B8E B;  3AE5 C;  2R3S A;  1PGQ A;  5KAI V;  1XTG B;  4J20 A;  1LS9 A;  4IOI H;  3SSU A;  2B9B A;  1R8E A;  1A2S A;  1IK9 A;  2QM8 A;  1HGZ A;  4H44 B;  1S9K E;  1Q2N A;  3PHL A;  4GED B;  1S6V B;  2KP8 A;  2ZOO A;  5B5E E;  3A0H V;  2FXO A;  3L75 J;  1J2J B;  3F89 A;  1BDD A;  2JEE A;  3CX5 I;  2YIU B;  1UII A;  5KAI H;  5GTI V;  3H1I J;  1LC2 A;  5CIC B;  5AVV B;  2BEZ F;  5KKZ C;  1KIL E;  2PFX A;  4ZMD A;  1E29 A;  2AXC A;  3HE4 A;  4ASV A;  3A0H H;  1LT9 A;  2I1K A;  1LTJ A;  1CW5 A;  3AE7 C;  2R3C A;  2B4Z A;  1M7L A;  1QVF O;  1KB0 A;  1X9V A;  4IFM A;  4LC1 A;  1COT A;  2GB8 B;  1DT1 A;  1ZRT D;  5KAF E;  3O6Q A;  3TNU A;  2YNY A;  1SQX J;  2PAC A;  1A56 A;  1Q86 Q;  1J1D C;  3A9F A;  3L70 J;  2GIW A;  1NKN A;  1VF5 D;  1NMI A;  1GJQ A;  1FZG A;  1BCC D;  2E74 B;  3N7N A;  1USD A;  4H13 C;  4EI2 A;  4KHX A;  1NOH A;  2H43 A;  3KQG A;  1T8Z A;  1FI9 A;  2OYH B;  1J1E C;  2C8S A;  3CC4 P;  4M3L A;  1FOS F;  4MN4 C;  1LT1 A;  2C9L Y;  4RSZ A;  1KYO W;  4WWI A;  2PP6 A;  3L75 G;  3H1H J;  4QMA A;  4JBZ A;  5KAI E;  1VQP P;  4PV1 B;  3H1I G;  2WT7 B;  3ZOW A;  3P8M C;  2JTI B;  4JYC A;  4K3A A;  1M56 D;  5AVR B;  5C39 A;  1IRV A;  1QKS A;  2KXP B;  2WSC J;  3JCU H;  3PTZ A;  1JDL A;  2FWL A;  2CE1 A;  3A0H E;  3PRJ A;  2C9X B;  2NRG A;  2O01 H;  1LP1 A;  2WWW A;  5GTI E;  1HTL C;  5CBO A;  1BE3 J;  1FCD C;  2M5A B;  4N3Y B;  4C7N A;  1NTZ E;  2JKV A;  1RQU A;  3MD0 A;  1R0Q A;  1SQX G;  2E76 D;  1QL3 A;  3RGU A;  2JJL A;  3L70 G;  1L4A C;  3CPW O;  2V7Q H;  1CHJ A;  2N3B A;  1ZME C;  1SQQ J;  4WY4 B;  1SFC B;  2K9J B;  2E5Y A;  3PXW A;  5DJT B;  2O3J A;  2Y9Z A;  2M3E A;  1X8Y A;  5AW5 B;  4PD4 H;  2J5U A;  3ZBM A;  3CC7 P;  1ZR2 A;  3IN6 A;  2Y9Y A;  4U3F E;  3H1H G;  1L0L E;  2FY8 A;  3H1K J;  2YQB A;  1NAF A;  4W80 A;  1NTM D;  1YIC A;  1N73 B;  1SQB E;  4HYT B;  2FYU D;  1GU2 A;  5CYT R;  3ZOX A;  5KLV D;  4ZNC A;  3ZOY A;  1K8A Q;  1CCH A;  2N1T D;  3WU2 V;  4DY9 A;  1GKS A;  2DW3 A;  3N4X A;  2IPP A;  1CTZ A;  1SQV D;  1CNO A;  1BE3 G;  2WSF J;  2POH A;  3NFQ A;  5AVT B;  3TYY A;  1L4A A;  2FYN C;  1A02 F;  1K04 A;  3RL0 D;  1L0N D;  1H0T B;  3WU2 H;  1VF5 B;  1AJY A;  1U7J A;  3VYM A;  2W83 C;  4D6T J;  2MJZ A;  1N8R Q;  1SQQ G;  2YXQ B;  3CWB E;  1C75 A;  1QVG O;  4PD4 E;  3WUT A;  1SQP E;  3T97 A;  1FDI A;  1OW8 A;  1PFI A;  1QL4 A;  3H1K G;  1BGY D;  2BGV X;  1IFP A;  1JY3 O;  1NU1 E;  3L72 E;  2C0W A;  5KJ7 D;  1KB9 D;  4JCG A;  2C1D B;  2GUS A;  1VPC A;  1GTW A;  1VQO P;  2YO3 A;  3HD7 C;  5CCG D;  1CXC A;  1KQF B;  3WFD C;  1FBM A;  1S72 P;  1FHB A;  2N1T A;  2MTA C;  2O01 N;  2FXM A;  1X22 A;  1M60 A; 
#chains in the Genus database with same CATH homology
 1HCM A;  1FJ0 A;  1WEJ F;  5TJH A;  3JBT B;  3O20 A;  2D0S A;  1B7V A;  1SQX D;  155C A;  1E8E A;  3BCC D;  5CIB B;  3L70 D;  4YE1 A;  3WFC C;  4MU8 A;  2KS1 A;  3NWV A;  2OZ1 B;  3VMA A;  3RN1 A;  3CX5 D;  3GG2 A;  1VYD A;  2BCN B;  1KYO D;  3H1J D;  4EDF A;  3O0R C;  1COR A;  1YEB A;  4UB8 V;  2ZON G;  5H2F V;  1A8C A;  2EXV A;  3KZI V;  2C2C A;  1H9Y A;  4FA9 A;  1CTJ A;  1DW2 A;  1P84 D;  5KKZ B;  1LC1 A;  2AIU A;  2N9Y B;  4XYD B;  1M70 A;  3PXS A;  4QAO A;  4AAM A;  3CU4 A;  1LMS A;  5C9M A;  4WQA A;  2Y0D A;  3O5C A;  1FI7 A;  5GTH V;  3GW6 A;  4EIF A;  3DR0 A;  3NBT A;  1CYI A;  3SWS A;  5EXQ A;  2N18 B;  2V08 A;  3L4O A;  4O1W A;  2C1D A;  2DGE A;  1C6R A;  3H1L D;  3OA8 A;  1U75 B;  1N9C A;  1NIR A;  3DMI A;  1FI3 A;  3MK7 B;  3PLN A;  4FB1 A;  2BLF B;  1BE3 D;  3SVW A;  2N9J A;  3SXT A;  1CIG A;  1DVH A;  2B10 B;  3L74 D;  3CYT I;  1YIQ A;  1H1O A;  1DVV A;  1RZ5 A;  1HZU A;  2MHM A;  1AYG A;  3M97 X;  1NNO A;  5B66 V;  4Q5P A;  3HQ6 A;  5B5E V;  3VNW A;  1N90 A;  2BH5 X;  2XTS B;  1QYZ A;  1ETP A;  1DW1 A;  3DP5 A;  3CP5 A;  4P4Q B;  1CO6 A;  2C1V A;  1W2L A;  1MG3 D;  1I6D A;  1GQ1 A;  4A7P A;  3X39 A;  1DIQ C;  2GC4 D;  1IRW A;  4WQD A;  3H1I D;  1CIF A;  4GYD A;  3CX5 W;  1WVE C;  1KX2 A;  1HJ3 A;  2VHD A;  1M6Z A;  1CHH A;  5KAF V;  1H32 B;  4NFG B;  1CSW A;  1HRC A;  1C2R A;  3O1Y A;  1HJ4 A;  1DII C;  5DJQ B;  4FAN A;  3ZCF A;  1HJ5 A;  3RN0 A;  1CTY A;  1I54 A;  1I8O A;  3VRD A;  1U74 B;  2AXT V;  1KV9 A;  4KMG A;  4K3I A;  4L1Q A;  3RLM A;  4WQC A;  1CIH A;  2CE0 A;  2B0Z B;  4XXL A;  4EIC A;  1DW3 A;  2N3Y A;  2L91 A;  1IQC A;  1EZV D;  1S5L V;  1NML A;  3CXH D;  1YCC A;  5CIH B;  3WUI A;  1EB7 A;  2V07 A;  5KAI V;  3WFE C;  3OCD B;  4J20 A;  1LS9 A;  1CRH A;  1I8P A;  2YCC A;  5DFS A;  1CRI A;  4FA4 A;  3KHU A;  1A2S A;  3H1H D;  3HQ7 A;  3TGU D;  2JQR A;  3PHL A;  4GED B;  1S6V B;  4FAV A;  2ZOO A;  4H0J A;  3A0H V;  2YIU B;  2C1U A;  2B12 B;  5GTI V;  4AAN A;  1AKK A;  1YTC A;  2BPB B;  1F1C A;  5CIC B;  1LC2 A;  1RZ6 A;  1NTZ D;  2YK3 A;  1MG2 D;  4PWA A;  1E29 A;  2N9I A;  1YNR A;  2RN0 A;  2DVH A;  1CIE A;  3A0B V;  2B4Z A;  1H32 A;  2FYN B;  1KB0 A;  4RJT A;  1COT A;  2N18 C;  1RAQ A;  2GB8 B;  3FWL A;  1DT1 A;  5CIE B;  1ZRT D;  5CID B;  1CYC A;  1HZV A;  351C A;  3MK7 C;  1CCR A;  2PAC A;  1A56 A;  1N15 A;  3A9F A;  1SQQ D;  4EID A;  1KX7 A;  1C2N A;  2GIW A;  4U3F D;  4FA1 A;  2OZ1 A;  1L0L D;  5C0Z A;  1NMI A;  1GJQ A;  1HH7 A;  1BCC D;  1DW0 A;  1E2R A;  1AOQ A;  3ORV A;  5TIS V;  2I8F A;  1F1F A;  1H33 B;  451C A;  1SQB D;  1FI9 A;  1YEA A;  2C8S A;  3OCD A;  3ITK A;  5E79 V;  3H1K D;  4RSZ A;  1KYO W;  3NBS A;  3WC8 A;  5KLI B;  1PPJ D;  2LIT A;  2B11 B;  2HV4 A;  3ZOW A;  2JTI B;  2QG4 A;  1IRV A;  1QKS A;  3PTZ A;  1JDL A;  2FWL A;  4V2K A;  3OA8 B;  4EIE A;  2CE1 A;  3PRJ A;  1K3G A;  2C9X B;  4WQ8 A;  2JWA A;  2LIR A;  1FCD C;  5DJQ C;  4PW9 B;  3CWB D;  1R0Q A;  1L9J C;  1CSU A;  4D6T D;  4PD4 D;  1QL3 A;  1SQP D;  5CIF B;  1H9X A;  1C7M A;  2ZZS 1;  1CHJ A;  1CRG A;  3TDK A;  5B6Q A;  2N3B A;  2AI5 A;  1NU1 D;  1CC5 A;  4PJ0 V;  2K9J B;  3L72 D;  4O1Q A;  3ZOO A;  3PXW A;  2O3J A;  4UB6 V;  1H31 B;  3SJL A;  3ZBM A;  1CRJ A;  3HQ9 A;  1CSX A;  1H33 A;  1CSV A;  2RMZ A;  1QN2 A;  1OAE A;  1CRC A;  4AAO A;  2ZXY A;  1K3H A;  2YQB A;  1CXA A;  3WFB C;  3HQ8 A;  2BH4 X;  1NTM D;  4AX3 A;  2QJK B;  1YIC A;  2KNC B;  4N0K A;  1GIW A;  2FYU D;  1GU2 A;  5CYT R;  3ZOX A;  5KLV D;  2CA4 B;  3ZOY A;  1CCH A;  5DF5 A;  2PCB B;  3WU2 V;  3PH2 B;  1HRO A;  4DY9 A;  1GKS A;  3L4M A;  2D0W A;  2BCC D;  1CTZ A;  1SQV D;  1CNO A;  2QJY B;  5IY5 1;  4H0K A;  1IO3 A;  1FOC A;  4L3H A;  1L0N D;  2Q3E A;  3TF5 A;  4IL6 V;  3VYM A;  1KIB A;  2Y0E A;  1I55 A;  1MZ4 A;  1J3S A;  3L71 D;  3ZIY A;  1ZZH A;  1CED A;  2PCC B;  2GC7 D;  1LFM A;  1AOF A;  4WQE A;  1GDV A;  1C75 A;  1CYJ A;  5CIG B;  3TYI A;  1IZL 0;  3L73 D;  3CXH W;  2L4D A;  1CHI A;  1H31 A;  3L75 D;  4WQ9 A;  2ZBO A;  1CRY A;  1QL4 A;  3PXT A;  1BGY D;  2BGV X;  1YFC A;  3RMZ A;  1BL9 A;  1C6S A;  1KB9 D;  4JCG A;  2C1D B;  4LJI A;  3SLE A;  1OCD A;  2CA3 B;  5AUR A;  2FRC A;  4FA5 A;  1C6O A;  1CXC A;  1I5T A;  1C52 A;  1I6E A;  2A06 D;  2CXB A;  2ORL A;  1N50 A;  1RAP A;  3WFD C;  1PP9 D;  4AAL A;  2IBZ D;  4WQB A;  4Y5R A;  1W5C T;  4WQ7 A;  1FHB A;  2Y0C A;  3C2C A;  2MTA C;  1L9B C;  2QJP B;  1NTK D;  4L3G A;  1M60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...