1BCCD

Cytochrome bc1 complex from chicken
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGPLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSVREGLYFNPYFPGQAIGMAPPIYNDVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLVPLVYYMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
total genus 59
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1bccD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1bccD01
1EZVD 3TYIA 2O3JA 4MU8A 4PW9B 2C1UA 1N50A 1CNOA 1I8PA 4Q5PA 1YEAA 2AXTV 1CTJA 3PLNA 1SQBD 4AX3A 4WQEA 3CXHW 2N9YB 1KYOD 5CIDB 1L9BC 1A56A 2CE1A 1BL9A 3PRJA 1W5CT 3OA8A 3X39A 3NBTA 3GW6A 4Y5RA 4RJTA 4WQBA 1L0LD 4EIEA 4EICA 1I5TA 1I6EA 3KZIV 4V2KA 1QYZA 1CXAA 4O1WA 3H1HD 5CIEB 4EIDA 1YIQA 1CYJA 5E79V 1CHIA 2Q3EA 2ZBOA 5C9MA 5DJQC 1K3GA 1YTCA 2V07A 1NIRA 4KMGA 2BCCD 2AI5A 1B7VA 2BGVX 1NMIA 3OA8B 3SVWA 1COTA 2JWAA 1CORA 1CRCA 2N9IA 3O0RC 4FA9A 5CIFB 3A9FA 1CEDA 1C75A 1C2NA 1I54A 1H9XA 2D0SA 1I55A 1KV9A 3ZBMA 2BPBB 2FWLA 1PPJD 4WQ7A 3H1LD 4RSZA 3SLEA 1N9CA 4AAMA 3DP5A 3TF5A 2C1DA 1YICA 5KLVD 1LMSA 3L72D 1CCHA 1PP9D 1N15A 3HQ7A 3PXSA 1CHJA 1LFMA 1SQQD 2FYUD 4QAOA 4FB1A 1C7MA 3CU4A 1RZ6A 2YIUB 2Y0EA 1S6VB 3PTZA 3H1JD 4P4QB 3FWLA 2DVHA 3CP5A 1GU2A 5IY51 4A7PA 1BGYD 2MHMA 3L73D 1DVVA 4O1QA 3L75D 1NTKD 1MG2D 3ZOXA 2KS1A 2C1DB 3H1ID 4YE1A 5GTIV 5AURA 5KKZB 1NTMD 2JQRA 2LIRA 1H31A 1N90A 2RMZA 1FI9A 2C9XB 2N18C 1FOCA 1IO3A 3JBTB 3RN1A 1OCDA 1QKSA 451CA 1CYCA 4WQCA 1GDVA 1LC1A 1DIQC 3WFDC 1GJQA 3L4MA 1C2RA 4XXLA 2ZZS1 3TDKA 4LJIA 2IBZD 2A06D 3ZIYA 2C8SA 1L0ND 3ZOWA 1VYDA 3HQ6A 3ZOOA 1CRIA 1H31B 1QN2A 2N3YA 1E29A 3ZOYA 3PHLA 3CX5W 3M97X 2C1VA 1KB9D 3CYTI 2L4DA 3A0HV 1HROA 2GIWA 4DY9A 2CA4B 1HJ4A 3MK7B 2BH4X 1MG3D 4L3HA 1RZ5A 2DGEA 155CA 3ZCFA 2N3BA 4K3IA 1HJ5A 3WFBC 1CYIA 1CIFA 1KX7A 1CRGA 2BCNB 2D0WA 1FI7A 4EDFA 1A2SA 2QJPB 1DIIC 3WFCC 3WUIA 2B0ZB 4AAOA 4D6TD 4WQDA 3VYMA 1U75B 3SXTA 4FAVA 5CIBB 1C6OA 5EXQA 1MZ4A 2GC4D 1HJ3A 1F1FA 1YNRA 3HQ9A 4EIFA 1E8EA 4AALA 4H0KA 1KYOW 1IZL0 2PCBB 1HZUA 4GEDB 4PJ0V 1WEJF 4N0KA 4UB8V 5B6QA 4UB6V 1FHBA 1C52A 5KAIV 3SJLA 1WVEC 2QJKB 1R0QA 3ORVA 4GYDA 1CIEA 3VRDA 3L74D 1K3HA 4FA5A 2CXBA 5B66V 3NWVA 1AOFA 3DMIA 1CSUA 1E2RA 2B11B 1LC2A 3PXTA 1ZRTD 4L3GA 3PXWA 5CICB 4J20A 1YFCA 1A8CA 1KB0A 1RAQA 1FCDC 1DW2A 2YK3A 3DR0A 3CXHD 1CRYA 4H0JA 1NTZD 1U74B 2Y0CA 1CC5A 5DJQB 1HRCA 3TGUD 1CSVA 4FANA 5GTHV 1H32A 2RN0A 3WU2V 4PD4D 2YCCA 2N9JA 2B4ZA 2JTIB 1AKKA 1QL4A 4FA1A 3NBSA 4PWAA 3O20A 2ZXYA 3VNWA 2GB8B 4L1QA 1CIHA 1ZZHA 2HV4A 1NU1D 1CXCA 1FI3A 1NMLA 4U3FD 3VMAA 1OAEA 351CA 2BH5X 2PACA 3WC8A 2VHDA 5KLIB 1H32B 2CA3B 2ORLA 2MTAC 2PCCB 5CIHB 5C0ZA 2L91A 1CCRA 1P84D 2QJYB 1RAPA 1M6ZA 1C6RA 4NFGB 1EB7A 1GKSA 1W2LA 1DVHA 1HH7A 5DF5A 1CRJA 4AANA 1FJ0A 1YCCA 1CO6A 3SWSA 2QG4A 4WQ8A 4FA4A 3HQ8A 1I8OA 2AIUA 3O5CA 3ITKA 1I6DA 3KHUA 1DW0A 2B12B 1F1CA 1H1OA 1M70A 3WFEC 1SQPD 3L4OA 3O1YA 2FRCA 2N18B 3GG2A 2BLFB 2CE0A 1H33A 2XTSB 1IRWA 1DT1A 1GIWA 2YQBA 3BCCD 5DFSA 1ETPA 1C6SA 1CSWA 1BCCD 1J3SA 4WQAA 1AYGA 1IQCA 1SQXD 2OZ1A 2FYNB 3OCDA 1CTZA 2V08A 1DW3A 1DW1A 2ZONG 4IL6V 1M60A 3RLMA 1L9JC 3RN0A 5CIGB 1HCMA 2EXVA 3C2CA 1H33B 2Y0DA 5TISV 1NNOA 1CIGA 1H9YA 1KIBA 1CRHA 1QL3A 1S5LV 1YEBA 2K9JB 1KX2A 2OZ1B 3OCDB 5CYTR 1JDLA 3H1KD 1LS9A 2GC7D 3L70D 2C2CA 1AOQA 3CX5D 1IRVA 4JCGA 1GQ1A 3MK7C 2LITA 4XYDB 3A0BV 5H2FV 3PH2B 5KAFV 2KNCB 3L71D 2I8FA 5TJHA 4WQ9A 3RMZA 1CSXA 1BE3D 1HZVA 1CTYA 1CHHA 1SQVD 5B5EV 2ZOOA 3CWBD 2B10B
chains in the Genus database with same CATH superfamily
2JO1A 3TYIA 2LXBA 2O3JA 4JYCA 4LGDE 1CNOA 2BCCJ 3HD7A 4KHXA 1I8PA 4Q5PA 2AXTV 3SFEC 1T2KD 4AX3A 2QJKC 3GHGB 2N9YB 1L9BC 1M1JC 1MFTA 1BL9A 3PRJA 1W5CT 1SQVG 4ZNCA 1RH5B 4Y99B 3CWBG 3X39A 1VQMP 1M1KQ 1H0TB 1MV8A 4RJTA 1NOHA 4WQBA 3B5NC 4EICA 1Q81Q 4C46A 1I6EA 4RESB 5CBNA 4O1WA 1YYCA 1S5LE 1CYJA 3HD7B 3WMM0 4WY4A 1R5LA 4HKZH 5C9MA 4OH8B 5APTA 5DJQC 1LTTC 1YITP 1PL5A 1NIRA 2AI5A 1OW8A 2ZJSE 2BGVX 1Y9BA 1FZCA 3LIDA 1CRCA 4GIFA 4PV1D 4R4LA 3RK3C 1AA0A 3EFFK 1K9MQ 1JB0J 3A5TA 4DOJA 2O01H 2OTLP 1SFCD 1C75A 4WY4B 4WQ7A 2IX7C 2LKMA 5KAFH 2GUVA 1N9CA 3DP5A 2E76C 3M0DA 3TF5A 1KTMA 3W67A 1FZCB 1KORA 1LMSA 1CCHA 2H8PD 1KZUB 3HQ7A 4NPFX 1IO4A 5B5EH 1R5SA 2MKVA 1W5CE 4OGQD 4QAOA 2QJYC 5AW9B 2HFED 3PTZA 2FY8A 3U1AA 1FZEA 4P4QB 3NMDA 3CP5A 2JR8A 1L0LJ 1DVVA 5CCGA 1H89A 2V7QH 1NWQA 1NJIQ 1VPCA 2OYIC 4YE1A 3H6PA 2BEQD 5GTIV 5AURA 3AE2C 1NTMD 1NTKK 2J58A 1J1DC 1H31A 4ASWA 2O01J 1JEKA 1AVYA 3KZIH 1LNQA 3A3YB 3MHVA 1X9VA 1VQ9P 1NO4A 3CL3D 3RBXA 1J1EB 4WQCA 1LTJA 4PD4H 1GJQA 1C2RA 1QVFO 1NTMG 2FYNC 4UB8E 1KILA 3V6IA 1FJKA 2HODA 3ZOOA 1CRIA 1H31B 5BVZA 3CXHI 3CX5W 3H1LJ 1U57A 2NPSC 3B5ND 1Y47A 3V2RA 1HJ4A 3MK7B 1PGJA 3KPEA 4JQ0D 1LTJB 2V7QJ 3CX5I 1M56D 2KYVA 1KILB 3WUVA 2BCNB 1FI7A 2W90A 1IFPA 1KB9H 3M06A 1A2SA 2HODB 1DIIC 2WZ7A 2B0ZB 4D6TD 4WQDA 3VYMA 1U75B 3RK3D 2KIKA 3M9QA 1HF9A 1HJ3A 3L75J 3HQ9A 4EIFA 1JMBA 2M8RA 2SPZA 4H0KA 1BCCE 2PCBB 4PJ0V 1EZVI 4JBZA 3HRNA 3IAOA 3VRDA 3WUUA 4RO0A 3L74D 2CXBA 5CBOA 4D6TG 3DMIA 3MIWA 2B11B 1LC2A 2E76D 4L3GA 3NFQA 3I56P 5AVWB 2HPCA 3GHGC 1RAQA 1JNMA 3CXHE 2WQYC 1BCCG 1RQUA 2E75B 3CXHD 1FZAA 1NTZD 4Y99C 3L74G 4K35A 3TGUD 1OZHA 1YBKA 3CCMP 2WPQA 2WPSA 3CX5E 4I2LC 3S1KA 3HD7C 1VQ4P 2JTIB 1AKKA 2HPCB 4PWAA 3O20A 1PGOA 4XA4A 2ZYAA 2ZXYA 3D0WA 1T3UA 1NU1E 3TGUG 2HV4A 3A0HH 1NU1D 2XNXA 2J59M 1VQ6P 4GODA 4U3FD 3CD6P 1CW5A 1L2PA 4IOIH 1IFDA 1YJNP 2WSEH 1PFIA 1GU4A 1RE4A 2H43A 3HE5A 2MTAC 2PCCB 4WY4C 5CIHB 2KB7P 2R32A 1NU1G 3NXSA 2IZ0A 4U3FG 2NPSD 1ZR4A 1BSHA 1FZCC 1L0LE 1DVHA 3E1RA 3E7KA 3M9HA 4WQ8A 3HQ8A 1I8OA 4HJGH 1JY3N 3ITKA 5B66H 1I6DA 1PGQA 3HE5B 3G6EP 1F1CA 1WRGA 3B71A 1NYHA 2FRCA 2C0XA 2Z5IA 2CE0A 3JCUE 1IRWA 1AVOA 3BCCD 2E43A 5APXA 5DFSA 1LP1A 3MTUE 5TISH 1J3SA 4WQAA 3AE6C 1VQLP 2WSEJ 3MZWB 3OCDA 1AV1A 1CTZA 5APWA 2V08A 1DW1A 2ZONG 4HYTB 4IL6V 5B5EE 1RQVA 3CCJP 3RLMA 1NH4A 1BE3J 3TSIA 3C9IA 1J1EC 3BCCG 5APQA 5CCGC 1OIPA 1QL1A 5TISV 3CC7P 1HJ0A 1NNOA 1LP1B 4XE5B 1S5LV 3USSA 3L70E 2M3BA 3OCDB 1W2EA 1OW6A 3L70D 1AOQA 3MK7C 3BASA 3KZIE 3M0AA 5AVRB 2LITA 3HD7D 1LTJC 1HGZA 4M3LA 4Z1MH 3CMAP 1GU5A 2I8FA 1GZLA 4AUWA 2MJZA 3RMZA 1KILC 1AFOA 2W6BA 3CWBD 2WTYA 2ZOOA 3CCQP 3L70G 1SQPJ 1SQVK 2R5BA 2W8ZA 3OAKA 1QL2A 2C1UA 1N50A 3AEGC 1KYOE 5E79H 3P7KA 5AW6B 1KYOD 5CIDB 4WY4D 1A56A 1SQXJ 2CE1A 1GK4A 1NGMB 2L5GB 2BEZF 1QX8A 2QIWA 3GW6A 4Y5RA 1K05A 2FXMA 3H1HE 1VQ5P 3EWKA 1QYZA 3EFGA 3L4FA 4DJGA 4NPEA 3H1HD 5CIEB 4EIDA 1YIQA 5E79V 1CHIA 2Q3EA 3H32A 2KP8A 1IJDB 5L8RJ 1LT1A 2AEFA 3LIEA 1AJYA 3AEBC 1M7LA 1NAFA 1SQPK 1B7VA 1K73Q 3A0BE 1CORA 3H1HG 3O0RC 2IYOA 1SFCC 4L73A 3SFDC 3VYIA 2D0SA 2IDBA 1I55A 1KV9A 3ZBMA 2BPBB 3H32B 1UIXA 2KOGA 2H89C 4IFMA 3GF3A 3SLEA 1YQ4C 1Q2NA 5KLVE 4AAMA 2AEJA 1YICA 5CCGD 1NKNA 5KLVD 1PP9D 1SQBJ 3PXSA 1CHJA 1SQQD 2Z4EA 1RZ6A 3SWKA 1GK6A 3R4YA 2PGDA 2Y0EA 1S6VB 3AE3C 3KQGA 1N86A 5AVZB 3FWLA 1OX3A 3M91A 3G9RA 5KLVG 3N7NA 1OVUA 1MG2D 3ZOXA 1X0TA 3GMAA 4GOFA 1N7SA 3VP9A 1K8AQ 1KILD 1RE4C 1FZFA 3QH9A 3SSUA 1QVGO 1NTMK 2PRRA 2P2UA 1GTWA 1ZV8A 4N78E 1JY2N 3B8EB 3JBTB 3VP8A 3Q5SA 2K9YA 1FJPA 1HUCA 1CYCA 1SS1A 1SQBK 3L4MA 1FBMA 3AEAC 4LJIA 2QM7A 5KJ7A 1N7SB 3ZDMA 2ZT9B 1N8RQ 2IZ1A 1JY2O 2C9NY 1H88A 3SWFA 1HROA 4DY9A 1JMMA 2CA4B 4EIJA 1HTLC 3PH0A 1G2CA 3P8MC 3L72J 2E75D 2DGEA 1ZP0C 3ZCFA 4UB6H 1HJ5A 1G1JA 1YHQP 1CIFA 1KX7A 2GUSA 2FYUJ 3L36A 2H88C 3CCLP 1IFNA 2KSJA 5AW3B 1FOSE 4EDFA 2QJPB 2JDIH 3I55P 3WFCC 3WUIA 1NTZJ 2GM4A 3H1JJ 2OARA 2YO2A 2QRXA 1URQA 5GTHE 2M3EA 1KV4A 5CIBB 1MZ4A 1BGYJ 3L73J 2GC4D 1F1FA 1YNRA 1E8EA 1NTKJ 1LT9A 3C1LA 4GEDB 3H1IJ 4N0KA 1A02F 1FHBA 4UB6V 1C52A 5KAIV 1G2CB 3ORVA 4GYDA 1T8ZA 1JY3P 3P32A 1FS0E 1AOFA 1JM0A 5APVA 1ZRTE 1X8YA 1A02J 5EFWB 3WU2H 5GTIH 1ZRTD 4IFDK 1URQB 1ZOYC 4U3FJ 1A8CA 1FCDC 1BDCA 1OWAA 2N9BA 3DR0A 2FYUK 2IPPA 1LT9B 5AW7B 1L0NJ 2OQQA 1NTZK 1HRCA 4BXLA 2K1AA 3AECC 3V2QA 1KN7A 4FANA 4C7NA 1ZN5A 3WU2V 2B4ZA 4AQRD 1T3JA 1QL4A 2B87A 1IC2A 1LTSC 3NBSA 3L71E 1ZMEC 2ZFCA 2G8YA 1ZZHA 1VQPP 1CXCA 1FI3A 1T6AA 351CA 1KQFB 2PACA 4C7NB 1H8AA 2CA3B 1PGPA 3FX0A 1RE3A 1S72P 1L0NK 5C0ZA 2L91A 3L71G 2B87B 5AW2B 2A45H 1RAPA 1M6ZA 4NFGB 1EB7A 1MFZA 1MKMA 1W2LA 1E79H 4PJ0H 5DF5A 1FJ0A 1RY3A 1YCCA 3SWSA 2Z5HA 4LLHA 4ZMDA 1P84H 2QVAA 2AIUA 2Q9IA 3VMXA 1GW4A 2BCCE 1KQSO 3GG2A 2O1KA 3HE4A 4QMAA 1GIWA 1DD3A 3F89A 4JPZB 1BCCD 4I6MC 2P10A 4WBAA 2K9JA 1EDJA 3V4QA 2AEMA 2KI7B 3OJAB 5AVSB 2CPBA 3VTPC 2HR3A 1L9JC 2ITAA 1HJBA 1CZQA 2BCCG 1X79B 2IBZI 1JO5A 3C2CA 2EXVA 2POHA 3HE4B 2AXTE 2XKMA 3VN0A 3WUTA 3KYQA 1H9YA 1USEA 2CPSA 3TNUA 2ZT9C 1CRHA 1YEBA 2GA1A 2K9JB 2E5TA 1JUNA 1JDLA 4OWFA 1L4AA 1FE6A 1YJ9P 2R3CA 3CX5D 4HH2A 2XU6A 3L73E 3A0BV 5H2FV 2YMKA 3PH2B 1NTKE 4WB4A 1KFNA 3F5HA 3GF7A 1TU3F 5AVQB 4LC1A 1CHHA 3TNUB 1PV3A 5CJ0A 2QJPC 1EZVE 3FXEA 2P58A 3U59A 3R2PA 2B10B 1VQ7P 1EZVD 1RF1A 1S3JA 1L4AB 1DEEG 1ZXGA 3S9OA 1VQOP 1YEAA 1CTJA 3PLNA 4WQEA 4ZKUA 4EI2A 3Q3DA 2IBZE 2R44A 3OA8A 1OW7A 1EZVG 3NBTA 2KXPB 1K04A 1L0LD 1FU1A 3E1IA 1JY2P 1URQC 2KUBA 4V2KA 3HTKA 1RF1B 1CXAA 4N3YB 3AE7C 2KZIA 4IL6H 2ZBOA 2JP3A 1PP9J 4PD4I 3MP7B 4ZKPA 4YPCA 4KMGA 1NVOA 1SQQJ 1FC2C 2I1JA 1IK9A 5CCHA 3H1KJ 1NMIA 1JOCA 3OA8B 3SVWA 1COTA 1L0LG 3M0DC 3MD0A 2JWAA 3BATA 1VDFA 5KAFE 3CCEP 2JKVA 2N9IA 5CMZA 4N6JA 4FA9A 2YKPA 1LTBC 1S5LH 3RGUA 4B86A 5AVUB 3HTKB 5GTIE 2A45I 2WSFH 3S4RA 1KQGB 3H1LE 1FAVA 1SQVJ 2XNDH 3H1LD 1OMIA 4K3AA 3CWBJ 1IK7A 1JTHA 5DJTB 3CPWO 1FDMA 1BDDA 1P84I 2WVRA 1KB9I 2O1JA 4XFJA 1N7SD 2ZT9D 1C7MA 3L37A 2JJLA 1SQQK 3H1LG 2IYPA 3L75E 1GU2A 5IY51 1NAYA 4A7PA 2MHMA 1JTHB 3L75D 3U1CA 1U7JA 2IFNA 4PD4E 2KS1A 2QEXP 5KKZB 1LJ2A 2JQRA 3QWOC 1RE3C 1N90A 5KJ7D 1M90Q 2AXCA 2WSFJ 1OXZA 2C9XB 2YMYA 3B4SA 3RN1A 3MUDA 1OCDA 1QKSA 3L75G 5AVTB 1Y8AA 1LC1A 1G1IA 3WFDC 3TDKA 3Q2YA 2A06E 3D71A 1SP4A 2ZAEB 2KS1B 2A06D 3ZIYA 2C8SA 3ZOWA 1VYDA 5C39A 3HQ6A 2B88A 1E29A 3PHLA 1KB9E 1EQ7A 3T97A 3PP5A 2C1VA 1URQD 4TLFA 1KB9D 1HWTC 2L4DA 2E75C 2GIWA 2FKWB 2QA4P 3OA7A 2BH4X 1ZW0A 1AQTA 1LWUA 4IFFA 4L3HA 4YXWH 3G4SP 1FDOA 1RZ5A 2QE7H 1PZQA 4TT3H 2A06G 1CYIA 2E5YA 1CRGA 4HB1A 5AW5B 3N4XA 2D0WA 2P67A 4W80A 1RHZB 4H13B 3FGAD 4FAVA 5EXQA 3T97B 3D70A 3AE4C 1DX7A 3II6A 1HZUA 5B6QA 1WT6A 1WEJF 4UB8V 1LWUB 1WVEC 1NTMJ 2H7HA 2JWDA 3IFMA 2W6JH 1N73A 1K3HA 3NWVA 1L4AC 4GDOA 4EYYQ 3CCUP 1CSUA 3PXWA 1KD1Q 2UWJE 2ZVNB 1R8EA 1DW2A 4WWIA 3Q1MA 1KFMA 2Q5UA 2YK3A 4EOTA 2VRSA 1QEXA 1U74B 3C8VA 2Y0CA 3KDPB 2K3RA 3A0HE 1N73B 1CSVA 3H1KE 5APSA 2ZXEB 1RF1C 1H32A 2RN0A 2V4HA 2YCCA 2N9JA 2YXQB 3CXHH 1HH0A 2OGUA 4FA1A 3O6QA 1BE3E 2OYHA 1UIIA 3HUSA 3CCRP 4N78D 1CIHA 3W68A 1NMLA 2Q3IA 4CPGA 4D6TJ 2BH5X 3L35A 3V4WA 5KLIB 2WSCH 3UIAA 1H32B 5BU5A 1CI6A 1YQ3C 5B66E 3D6ZA 1BCCJ 1CCRA 2QM8A 1YIJP 4IL6E 3O6QB 1BE3G 2D2CB 2IFMA 1C6RA 2B9BA 3L74J 2OYHB 1USDA 3HUSB 3KXDA 5CCHC 1GKSA 1CRJA 2G3AA 4AANA 2WITA 2YO3A 3TYYA 5KAIH 3RK2B 2Y9ZA 1EDIA 1CO6A 5TISE 2N1TA 1GL2A 1VL2A 1IFIA 2JEEA 3O5CA 1LGHB 4KJMA 2OYOA 1CI6B 1SQPE 1DW0A 1M70A 3WFEC 3CCVP 1SQPD 2K88A 3O1YA 2N18B 3TGUJ 2DW3A 5AW4B 1H33A 1GW3A 1BSNA 3BRVB 1NHLA 2RH0A 1CSWA 1IFJA 5KKZC 1SQXE 3IF4A 1AYGA 1IQCA 2YKOA 2ZXXA 2WSCJ 1SQXD 2N1TB 1GL2B 3SWYA 5BU8B 1M60A 1OFCX 1SQPG 1Q7YQ 1L4AD 1NU1J 3G3ZA 1EXJA 2E74B 3JCUH 3CC4P 5CIGB 1H33B 2Y0DA 1DH3A 1M8OB 2B89A 2Y9YA 1JCCA 1SQXG 1KIBA 1QL3A 5AVXB 1GDTA 5CYTR 1DD4A 3JSVC 1VF5B 2C2CA 1IZNB 3MUDC 4JCGA 1EC5A 2WPVB 1GQ1A 1KC8Q 1LTAC 3A2AA 5KAFV 5E79E 3L71D 2QSIA 1NTME 2BASA 1CSXA 1HZVA 1Q90D 1KMIZ 5B5EV 4YXDC 1NU1K 4H13C 2Q7CA 4MU8A 4PW9B 1SQBE 3BCCJ 4IL6X 2OTJP 1SQBD 2PFXA 2WMMA 1LWUC 3CXHW 4JYBA 3I5CA 1AQ5A 2I1KA 2C9LY 3Q5PA 1RF0A 3H25A 1GMJA 4H44B 5CCHD 1S5LX 4EIEA 1I5TA 3KZIV 1L0LK 1SQBG 1KYOH 3VOPA 4NPDA 2O01N 4H0LB 1K3GA 1YTCA 2V07A 2WPRA 3RL0B 4YTPC 1N73C 1KQLA 2BCCD 3IR9A 4DT0A 3V5BA 2XZRA 3L70J 1FZGA 1LTIC 4D6TE 3RK3E 3AEEC 3K5BA 5CIFB 3A9FA 1CEDA 1VQNP 1C2NA 1GD2E 1I54A 1PPJE 1H9XA 1MUUA 2PP6A 4MN4C 2FWLA 2FFDA 3M9BA 1PPJD 3RBZA 3FXDA 3A7OA 3L74E 1HGVA 3A0BH 5H2FH 4RSZA 2Q1KA 3L72E 5KLIC 2C1DA 1EDLA 2KLUA 1N7SC 3L72D 2PAJA 1N15A 2FYUE 1SFCA 2LR2A 1LFMA 2FYUD 4FB1A 3TK1A 3CU4A 1PPJG 4AYCA 2YIUB 1NTZE 2D2CC 3H1JE 2OYHC 3HUSC 2ZVOB 2FFDB 1IFMA 3H1JD 1BGYE 3TGUE 2DVHA 2FYZA 3RK2C 1LTGC 1BGYD 3L73D 4O1QA 3OW2O 3H1IE 3L72G 1QGKB 1Z56A 1NTKD 4PV1B 3H1HJ 2E42A 2C1DB 3H1ID 5KJ7C 2FYUG 2LIRA 3GLMA 1SFCB 1SVFA 2P1JA 3AE9C 2RMZA 1FI9A 2N18C 1NTZG 1FOCA 1CSBA 1IO3A 2CK3H 3H1JG 1XTGB 4H13D 5AVVB 5AW0B 4U3FE 451CA 1BGYG 3L73G 2HG5D 2J5UA 4I7ZB 1GDVA 1NTKG 3H1IG 1DIQC 2M0BA 4JF7A 4XXLA 2ZZS1 4U7JA 2N1TC 1GL2C 1L0NE 4UB6E 3NTNA 2R3SA 5KAIE 2RKLA 2IBZD 1Q82Q 1S1CX 1L0ND 1J2JB 1JCDA 4OGQB 1QN2A 2N3YA 4W7ZA 3ZOYA 2E74C 1HBWA 3RL0g 2HYNA 3M97X 1FDIA 4R4MA 3CYTI 1NKZB 3A0HV 1LT9C 1MG3D 4DZOA 5KLVJ 155CA 1M1JA 3VMYA 3CLQA 2N3BA 4K3IA 3WFBC 2IBZG 5AW8B 1L0NG 5CHXA 3BVHA 1VF5C 1PIXA 3Q5RA 3B5NA 4AAOA 1OVVA 2I8DA 3SXTA 1C6OA 3WU2E 1MZ9A 3BCCE 3MGNA 4GT1A 4AALA 1KYOW 1IZL0 2FXPA 4DCKA 4RKUJ 3SJLA 2QJKB 1EDKA 1R0QA 3V2NA 1M1JB 3LW5H 5M1BA 1CIEA 1JY3O 4GKGA 4FA5A 5B66V 1E5WA 1KYOI 5GTHH 1E2RA 5APUA 3PXTA 3B5NB 5CICB 5KLVK 4J20A 1YFCA 1KB0A 3G71P 3AE5C 4Y28J 2W27A 5APYA 1CRYA 4H0JA 1N7LA 2D2CD 4H44C 2K37A 1CC5A 5DJQB 2LXCB 5DJUB 1WMKA 1D7MA 1FZBA 3D6YA 1S9KE 5GTHV 2ZYGA 3RK2D 1S2EA 2YNYA 4PD4D 1S9KD 4H0LC 3RK3B 4L75A 5AW1B 2KSEA 1FOSF 3CC2P 3V2PA 3RL0C 3VNWA 2GB8B 4L1QA 2KK7A 1RF0C 1X22A 5KTBA 3LW5J 4L74A 3CCSP 1YJWP 1OVRA 1XTCC 3ABVC 3VMAA 1OAEA 2Q6QA 1EXIA 3WC8A 4PJ0E 2E76B 2VHDA 2OYIA 2WT7A 1Q86Q 2N1TD 1GL2D 2W83C 1T2KC 2WWWA 2ORLA 1ZLLA 1P84E 5K5GB 1P84D 2QJYB 2C0WA 4ASVA 2A45G 2E74D 2XV5A 2R5DA 2FXOA 2M5AA 1HH7A 4UB8H 1VQ8P 3BRTB 3AE1C 1VQKP 1YTZT 3CMEP 3AEDC 2QG4A 4WVZA 4FA4A 4C7RA 3P8CE 2OYIB 2WT7B 2YIUC 1YTZI 1J1DB 3O8ZA 3P8CD 3KHUA 2B12B 3FWNA 2FFDC 1VF5D 1H1OA 1N2DC 4L76A 2XDJA 3L4OA 2NPSA 4BRYA 2BLFB 2YKQA 2HLOA 3JC22 2XTSB 2KZJA 1W2BO 1DT1A 3AEFC 2YQBA 4W7YA 4PV1C 1QLED 1ETPA 5H2FE 1C6SA 2M5AB 3AE8C 1S4XA 1SLQA 2NRGA 2OZ1A 2FYNB 1DW3A 1HVVA 1YI2P 1SQXK 3L71J 2OTKE 4OVNF 1U7MA 2WSSH 4I7ZC 3RN0A 2NPSB 4BRYB 2KNCA 1HCMA 2P7JA 5CJ4A 1ZR2A 1PP9E 3CI9A 1CIGA 2NZ2A 2YXRB 1SQQE 4OGQC 4H44D 2W6AA 1KX2A 2OZ1B 3H1KD 1LS9A 2GC7D 2ZYDA 4O9BA 1IRVA 1M57D 4H0LD 3GHGA 4XYDB 2AXTH 3IN6A 3VMZA 2KNCB 5AVYB 4GOEA 5TJHA 1PP9G 4WQ9A 1SQVE 3RL0D 1BE3D 1KILE 1CTYA 1H0TA 2FBWC 1DEBA 3CWBE 1SQQG 1SQVD 4I1LA 1DIPA 3H1KG 2KLVA 3CX5H 3PJSK 4KT0J 4BWNA 3EQ2A
chains in the Genus database with same CATH topology
1EZVD 3TYIA 2O3JA 4MU8A 4PW9B 2C1UA 1N50A 1CNOA 1I8PA 4Q5PA 1YEAA 2AXTV 1CTJA 3PLNA 1SQBD 4AX3A 4WQEA 3CXHW 2N9YB 1KYOD 5CIDB 1L9BC 1A56A 2CE1A 1BL9A 3PRJA 1W5CT 3OA8A 3X39A 3NBTA 3GW6A 4Y5RA 4RJTA 4WQBA 1L0LD 4EIEA 4EICA 1I5TA 1I6EA 3KZIV 4V2KA 1QYZA 1CXAA 4O1WA 3H1HD 5CIEB 4EIDA 1YIQA 1CYJA 5E79V 1CHIA 2Q3EA 2ZBOA 5C9MA 5DJQC 1K3GA 1YTCA 2V07A 1NIRA 4KMGA 2BCCD 2AI5A 1B7VA 2BGVX 1NMIA 3OA8B 3SVWA 1COTA 2JWAA 1CORA 1CRCA 2N9IA 3O0RC 4FA9A 5CIFB 3A9FA 1CEDA 1C75A 1C2NA 1I54A 1H9XA 2D0SA 1I55A 1KV9A 3ZBMA 2BPBB 2FWLA 1PPJD 4WQ7A 3H1LD 4RSZA 3SLEA 1N9CA 4AAMA 3DP5A 3TF5A 2C1DA 1YICA 5KLVD 1LMSA 3L72D 1CCHA 1PP9D 1N15A 3HQ7A 3PXSA 1CHJA 1LFMA 1SQQD 2FYUD 4QAOA 4FB1A 1C7MA 3CU4A 1RZ6A 2YIUB 2Y0EA 1S6VB 3PTZA 3H1JD 4P4QB 3FWLA 2DVHA 3CP5A 1GU2A 5IY51 4A7PA 1BGYD 2MHMA 3L73D 1DVVA 4O1QA 3L75D 1NTKD 1MG2D 3ZOXA 2KS1A 2C1DB 3H1ID 4YE1A 5GTIV 5AURA 5KKZB 1NTMD 2JQRA 2LIRA 1H31A 1N90A 2RMZA 1FI9A 2C9XB 2N18C 1FOCA 1IO3A 3JBTB 3RN1A 1OCDA 1QKSA 451CA 1CYCA 4WQCA 1GDVA 1LC1A 1DIQC 3WFDC 1GJQA 3L4MA 1C2RA 4XXLA 2ZZS1 3TDKA 4LJIA 2IBZD 2A06D 3ZIYA 2C8SA 1L0ND 3ZOWA 1VYDA 3HQ6A 3ZOOA 1CRIA 1H31B 1QN2A 2N3YA 1E29A 3ZOYA 3PHLA 3CX5W 3M97X 2C1VA 1KB9D 3CYTI 2L4DA 3A0HV 1HROA 2GIWA 4DY9A 2CA4B 1HJ4A 3MK7B 2BH4X 1MG3D 4L3HA 1RZ5A 2DGEA 155CA 3ZCFA 2N3BA 4K3IA 1HJ5A 3WFBC 1CYIA 1CIFA 1KX7A 1CRGA 2BCNB 2D0WA 1FI7A 4EDFA 1A2SA 2QJPB 1DIIC 3WFCC 3WUIA 2B0ZB 4AAOA 4D6TD 4WQDA 3VYMA 1U75B 3SXTA 4FAVA 5CIBB 1C6OA 5EXQA 1MZ4A 2GC4D 1HJ3A 1F1FA 1YNRA 3HQ9A 4EIFA 1E8EA 4AALA 4H0KA 1KYOW 1IZL0 2PCBB 1HZUA 4GEDB 4PJ0V 1WEJF 4N0KA 4UB8V 5B6QA 4UB6V 1FHBA 1C52A 5KAIV 3SJLA 1WVEC 2QJKB 1R0QA 3ORVA 4GYDA 1CIEA 3VRDA 3L74D 1K3HA 4FA5A 2CXBA 5B66V 3NWVA 1AOFA 3DMIA 1CSUA 1E2RA 2B11B 1LC2A 3PXTA 1ZRTD 4L3GA 3PXWA 5CICB 4J20A 1YFCA 1A8CA 1KB0A 1RAQA 1FCDC 1DW2A 2YK3A 3DR0A 3CXHD 1CRYA 4H0JA 1NTZD 1U74B 2Y0CA 1CC5A 5DJQB 1HRCA 3TGUD 1CSVA 4FANA 5GTHV 1H32A 2RN0A 3WU2V 4PD4D 2YCCA 2N9JA 2B4ZA 2JTIB 1AKKA 1QL4A 4FA1A 3NBSA 4PWAA 3O20A 2ZXYA 3VNWA 2GB8B 4L1QA 1CIHA 1ZZHA 2HV4A 1NU1D 1CXCA 1FI3A 1NMLA 4U3FD 3VMAA 1OAEA 351CA 2BH5X 2PACA 3WC8A 2VHDA 5KLIB 1H32B 2CA3B 2ORLA 2MTAC 2PCCB 5CIHB 5C0ZA 2L91A 1CCRA 1P84D 2QJYB 1RAPA 1M6ZA 1C6RA 4NFGB 1EB7A 1GKSA 1W2LA 1DVHA 1HH7A 5DF5A 1CRJA 4AANA 1FJ0A 1YCCA 1CO6A 3SWSA 2QG4A 4WQ8A 4FA4A 3HQ8A 1I8OA 2AIUA 3O5CA 3ITKA 1I6DA 3KHUA 1DW0A 2B12B 1F1CA 1H1OA 1M70A 3WFEC 1SQPD 3L4OA 3O1YA 2FRCA 2N18B 3GG2A 2BLFB 2CE0A 1H33A 2XTSB 1IRWA 1DT1A 1GIWA 2YQBA 3BCCD 5DFSA 1ETPA 1C6SA 1CSWA 1BCCD 1J3SA 4WQAA 1AYGA 1IQCA 1SQXD 2OZ1A 2FYNB 3OCDA 1CTZA 2V08A 1DW3A 1DW1A 2ZONG 4IL6V 1M60A 3RLMA 1L9JC 3RN0A 5CIGB 1HCMA 2EXVA 3C2CA 1H33B 2Y0DA 5TISV 1NNOA 1CIGA 1H9YA 1KIBA 1CRHA 1QL3A 1S5LV 1YEBA 2K9JB 1KX2A 2OZ1B 3OCDB 5CYTR 1JDLA 3H1KD 1LS9A 2GC7D 3L70D 2C2CA 1AOQA 3CX5D 1IRVA 4JCGA 1GQ1A 3MK7C 2LITA 4XYDB 3A0BV 5H2FV 3PH2B 5KAFV 2KNCB 3L71D 2I8FA 5TJHA 4WQ9A 3RMZA 1CSXA 1BE3D 1HZVA 1CTYA 1CHHA 1SQVD 5B5EV 2ZOOA 3CWBD 2B10B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV D;  3TYI A;  2O3J A;  4MU8 A;  4PW9 B;  2C1U A;  1N50 A;  1CNO A;  1I8P A;  4Q5P A;  1YEA A;  2AXT V;  1CTJ A;  3PLN A;  1SQB D;  4AX3 A;  4WQE A;  3CXH W;  2N9Y B;  1KYO D;  5CID B;  1L9B C;  1A56 A;  2CE1 A;  1BL9 A;  3PRJ A;  1W5C T;  3OA8 A;  3X39 A;  3NBT A;  3GW6 A;  4Y5R A;  4RJT A;  4WQB A;  1L0L D;  4EIE A;  4EIC A;  1I5T A;  1I6E A;  3KZI V;  4V2K A;  1QYZ A;  1CXA A;  4O1W A;  3H1H D;  5CIE B;  4EID A;  1YIQ A;  1CYJ A;  5E79 V;  1CHI A;  2Q3E A;  2ZBO A;  5C9M A;  5DJQ C;  1K3G A;  1YTC A;  2V07 A;  1NIR A;  4KMG A;  2BCC D;  2AI5 A;  1B7V A;  2BGV X;  1NMI A;  3OA8 B;  3SVW A;  1COT A;  2JWA A;  1COR A;  1CRC A;  2N9I A;  3O0R C;  4FA9 A;  5CIF B;  3A9F A;  1CED A;  1C75 A;  1C2N A;  1I54 A;  1H9X A;  2D0S A;  1I55 A;  1KV9 A;  3ZBM A;  2BPB B;  2FWL A;  1PPJ D;  4WQ7 A;  3H1L D;  4RSZ A;  3SLE A;  1N9C A;  4AAM A;  3DP5 A;  3TF5 A;  2C1D A;  1YIC A;  5KLV D;  1LMS A;  3L72 D;  1CCH A;  1PP9 D;  1N15 A;  3HQ7 A;  3PXS A;  1CHJ A;  1LFM A;  1SQQ D;  2FYU D;  4QAO A;  4FB1 A;  1C7M A;  3CU4 A;  1RZ6 A;  2YIU B;  2Y0E A;  1S6V B;  3PTZ A;  3H1J D;  4P4Q B;  3FWL A;  2DVH A;  3CP5 A;  1GU2 A;  5IY5 1;  4A7P A;  1BGY D;  2MHM A;  3L73 D;  1DVV A;  4O1Q A;  3L75 D;  1NTK D;  1MG2 D;  3ZOX A;  2KS1 A;  2C1D B;  3H1I D;  4YE1 A;  5GTI V;  5AUR A;  5KKZ B;  1NTM D;  2JQR A;  2LIR A;  1H31 A;  1N90 A;  2RMZ A;  1FI9 A;  2C9X B;  2N18 C;  1FOC A;  1IO3 A;  3JBT B;  3RN1 A;  1OCD A;  1QKS A;  451C A;  1CYC A;  4WQC A;  1GDV A;  1LC1 A;  1DIQ C;  3WFD C;  1GJQ A;  3L4M A;  1C2R A;  4XXL A;  2ZZS 1;  3TDK A;  4LJI A;  2IBZ D;  2A06 D;  3ZIY A;  2C8S A;  1L0N D;  3ZOW A;  1VYD A;  3HQ6 A;  3ZOO A;  1CRI A;  1H31 B;  1QN2 A;  2N3Y A;  1E29 A;  3ZOY A;  3PHL A;  3CX5 W;  3M97 X;  2C1V A;  1KB9 D;  3CYT I;  2L4D A;  3A0H V;  1HRO A;  2GIW A;  4DY9 A;  2CA4 B;  1HJ4 A;  3MK7 B;  2BH4 X;  1MG3 D;  4L3H A;  1RZ5 A;  2DGE A;  155C A;  3ZCF A;  2N3B A;  4K3I A;  1HJ5 A;  3WFB C;  1CYI A;  1CIF A;  1KX7 A;  1CRG A;  2BCN B;  2D0W A;  1FI7 A;  4EDF A;  1A2S A;  2QJP B;  1DII C;  3WFC C;  3WUI A;  2B0Z B;  4AAO A;  4D6T D;  4WQD A;  3VYM A;  1U75 B;  3SXT A;  4FAV A;  5CIB B;  1C6O A;  5EXQ A;  1MZ4 A;  2GC4 D;  1HJ3 A;  1F1F A;  1YNR A;  3HQ9 A;  4EIF A;  1E8E A;  4AAL A;  4H0K A;  1KYO W;  1IZL 0;  2PCB B;  1HZU A;  4GED B;  4PJ0 V;  1WEJ F;  4N0K A;  4UB8 V;  5B6Q A;  4UB6 V;  1FHB A;  1C52 A;  5KAI V;  3SJL A;  1WVE C;  2QJK B;  1R0Q A;  3ORV A;  4GYD A;  1CIE A;  3VRD A;  3L74 D;  1K3H A;  4FA5 A;  2CXB A;  5B66 V;  3NWV A;  1AOF A;  3DMI A;  1CSU A;  1E2R A;  2B11 B;  1LC2 A;  3PXT A;  1ZRT D;  4L3G A;  3PXW A;  5CIC B;  4J20 A;  1YFC A;  1A8C A;  1KB0 A;  1RAQ A;  1FCD C;  1DW2 A;  2YK3 A;  3DR0 A;  3CXH D;  1CRY A;  4H0J A;  1NTZ D;  1U74 B;  2Y0C A;  1CC5 A;  5DJQ B;  1HRC A;  3TGU D;  1CSV A;  4FAN A;  5GTH V;  1H32 A;  2RN0 A;  3WU2 V;  4PD4 D;  2YCC A;  2N9J A;  2B4Z A;  2JTI B;  1AKK A;  1QL4 A;  4FA1 A;  3NBS A;  4PWA A;  3O20 A;  2ZXY A;  3VNW A;  2GB8 B;  4L1Q A;  1CIH A;  1ZZH A;  2HV4 A;  1NU1 D;  1CXC A;  1FI3 A;  1NML A;  4U3F D;  3VMA A;  1OAE A;  351C A;  2BH5 X;  2PAC A;  3WC8 A;  2VHD A;  5KLI B;  1H32 B;  2CA3 B;  2ORL A;  2MTA C;  2PCC B;  5CIH B;  5C0Z A;  2L91 A;  1CCR A;  1P84 D;  2QJY B;  1RAP A;  1M6Z A;  1C6R A;  4NFG B;  1EB7 A;  1GKS A;  1W2L A;  1DVH A;  1HH7 A;  5DF5 A;  1CRJ A;  4AAN A;  1FJ0 A;  1YCC A;  1CO6 A;  3SWS A;  2QG4 A;  4WQ8 A;  4FA4 A;  3HQ8 A;  1I8O A;  2AIU A;  3O5C A;  3ITK A;  1I6D A;  3KHU A;  1DW0 A;  2B12 B;  1F1C A;  1H1O A;  1M70 A;  3WFE C;  1SQP D;  3L4O A;  3O1Y A;  2FRC A;  2N18 B;  3GG2 A;  2BLF B;  2CE0 A;  1H33 A;  2XTS B;  1IRW A;  1DT1 A;  1GIW A;  2YQB A;  3BCC D;  5DFS A;  1ETP A;  1C6S A;  1CSW A;  1BCC D;  1J3S A;  4WQA A;  1AYG A;  1IQC A;  1SQX D;  2OZ1 A;  2FYN B;  3OCD A;  1CTZ A;  2V08 A;  1DW3 A;  1DW1 A;  2ZON G;  4IL6 V;  1M60 A;  3RLM A;  1L9J C;  3RN0 A;  5CIG B;  1HCM A;  2EXV A;  3C2C A;  1H33 B;  2Y0D A;  5TIS V;  1NNO A;  1CIG A;  1H9Y A;  1KIB A;  1CRH A;  1QL3 A;  1S5L V;  1YEB A;  2K9J B;  1KX2 A;  2OZ1 B;  3OCD B;  5CYT R;  1JDL A;  3H1K D;  1LS9 A;  2GC7 D;  3L70 D;  2C2C A;  1AOQ A;  3CX5 D;  1IRV A;  4JCG A;  1GQ1 A;  3MK7 C;  2LIT A;  4XYD B;  3A0B V;  5H2F V;  3PH2 B;  5KAF V;  2KNC B;  3L71 D;  2I8F A;  5TJH A;  4WQ9 A;  3RMZ A;  1CSX A;  1BE3 D;  1HZV A;  1CTY A;  1CHH A;  1SQV D;  5B5E V;  2ZOO A;  3CWB D;  2B10 B; 
#chains in the Genus database with same CATH topology
 2JO1 A;  3TYI A;  2LXB A;  2O3J A;  4JYC A;  4LGD E;  1CNO A;  2BCC J;  3HD7 A;  4KHX A;  1I8P A;  4Q5P A;  2AXT V;  3SFE C;  1T2K D;  4AX3 A;  2QJK C;  3GHG B;  2N9Y B;  1L9B C;  1M1J C;  1MFT A;  1BL9 A;  3PRJ A;  1W5C T;  1SQV G;  4ZNC A;  1RH5 B;  4Y99 B;  3CWB G;  3X39 A;  1VQM P;  1M1K Q;  1H0T B;  1MV8 A;  4RJT A;  1NOH A;  4WQB A;  3B5N C;  4EIC A;  1Q81 Q;  4C46 A;  1I6E A;  4RES B;  5CBN A;  4O1W A;  1YYC A;  1S5L E;  1CYJ A;  3HD7 B;  3WMM 0;  4WY4 A;  1R5L A;  4HKZ H;  5C9M A;  4OH8 B;  5APT A;  5DJQ C;  1LTT C;  1YIT P;  1PL5 A;  1NIR A;  2AI5 A;  1OW8 A;  2ZJS E;  2BGV X;  1Y9B A;  1FZC A;  3LID A;  1CRC A;  4GIF A;  4PV1 D;  4R4L A;  3RK3 C;  1AA0 A;  3EFF K;  1K9M Q;  1JB0 J;  3A5T A;  4DOJ A;  2O01 H;  2OTL P;  1SFC D;  1C75 A;  4WY4 B;  4WQ7 A;  2IX7 C;  2LKM A;  5KAF H;  2GUV A;  1N9C A;  3DP5 A;  2E76 C;  3M0D A;  3TF5 A;  1KTM A;  3W67 A;  1FZC B;  1KOR A;  1LMS A;  1CCH A;  2H8P D;  1KZU B;  3HQ7 A;  4NPF X;  1IO4 A;  5B5E H;  1R5S A;  2MKV A;  1W5C E;  4OGQ D;  4QAO A;  2QJY C;  5AW9 B;  2HFE D;  3PTZ A;  2FY8 A;  3U1A A;  1FZE A;  4P4Q B;  3NMD A;  3CP5 A;  2JR8 A;  1L0L J;  1DVV A;  5CCG A;  1H89 A;  2V7Q H;  1NWQ A;  1NJI Q;  1VPC A;  2OYI C;  4YE1 A;  3H6P A;  2BEQ D;  5GTI V;  5AUR A;  3AE2 C;  1NTM D;  1NTK K;  2J58 A;  1J1D C;  1H31 A;  4ASW A;  2O01 J;  1JEK A;  1AVY A;  3KZI H;  1LNQ A;  3A3Y B;  3MHV A;  1X9V A;  1VQ9 P;  1NO4 A;  3CL3 D;  3RBX A;  1J1E B;  4WQC A;  1LTJ A;  4PD4 H;  1GJQ A;  1C2R A;  1QVF O;  1NTM G;  2FYN C;  4UB8 E;  1KIL A;  3V6I A;  1FJK A;  2HOD A;  3ZOO A;  1CRI A;  1H31 B;  5BVZ A;  3CXH I;  3CX5 W;  3H1L J;  1U57 A;  2NPS C;  3B5N D;  1Y47 A;  3V2R A;  1HJ4 A;  3MK7 B;  1PGJ A;  3KPE A;  4JQ0 D;  1LTJ B;  2V7Q J;  3CX5 I;  1M56 D;  2KYV A;  1KIL B;  3WUV A;  2BCN B;  1FI7 A;  2W90 A;  1IFP A;  1KB9 H;  3M06 A;  1A2S A;  2HOD B;  1DII C;  2WZ7 A;  2B0Z B;  4D6T D;  4WQD A;  3VYM A;  1U75 B;  3RK3 D;  2KIK A;  3M9Q A;  1HF9 A;  1HJ3 A;  3L75 J;  3HQ9 A;  4EIF A;  1JMB A;  2M8R A;  2SPZ A;  4H0K A;  1BCC E;  2PCB B;  4PJ0 V;  1EZV I;  4JBZ A;  3HRN A;  3IAO A;  3VRD A;  3WUU A;  4RO0 A;  3L74 D;  2CXB A;  5CBO A;  4D6T G;  3DMI A;  3MIW A;  2B11 B;  1LC2 A;  2E76 D;  4L3G A;  3NFQ A;  3I56 P;  5AVW B;  2HPC A;  3GHG C;  1RAQ A;  1JNM A;  3CXH E;  2WQY C;  1BCC G;  1RQU A;  2E75 B;  3CXH D;  1FZA A;  1NTZ D;  4Y99 C;  3L74 G;  4K35 A;  3TGU D;  1OZH A;  1YBK A;  3CCM P;  2WPQ A;  2WPS A;  3CX5 E;  4I2L C;  3S1K A;  3HD7 C;  1VQ4 P;  2JTI B;  1AKK A;  2HPC B;  4PWA A;  3O20 A;  1PGO A;  4XA4 A;  2ZYA A;  2ZXY A;  3D0W A;  1T3U A;  1NU1 E;  3TGU G;  2HV4 A;  3A0H H;  1NU1 D;  2XNX A;  2J59 M;  1VQ6 P;  4GOD A;  4U3F D;  3CD6 P;  1CW5 A;  1L2P A;  4IOI H;  1IFD A;  1YJN P;  2WSE H;  1PFI A;  1GU4 A;  1RE4 A;  2H43 A;  3HE5 A;  2MTA C;  2PCC B;  4WY4 C;  5CIH B;  2KB7 P;  2R32 A;  1NU1 G;  3NXS A;  2IZ0 A;  4U3F G;  2NPS D;  1ZR4 A;  1BSH A;  1FZC C;  1L0L E;  1DVH A;  3E1R A;  3E7K A;  3M9H A;  4WQ8 A;  3HQ8 A;  1I8O A;  4HJG H;  1JY3 N;  3ITK A;  5B66 H;  1I6D A;  1PGQ A;  3HE5 B;  3G6E P;  1F1C A;  1WRG A;  3B71 A;  1NYH A;  2FRC A;  2C0X A;  2Z5I A;  2CE0 A;  3JCU E;  1IRW A;  1AVO A;  3BCC D;  2E43 A;  5APX A;  5DFS A;  1LP1 A;  3MTU E;  5TIS H;  1J3S A;  4WQA A;  3AE6 C;  1VQL P;  2WSE J;  3MZW B;  3OCD A;  1AV1 A;  1CTZ A;  5APW A;  2V08 A;  1DW1 A;  2ZON G;  4HYT B;  4IL6 V;  5B5E E;  1RQV A;  3CCJ P;  3RLM A;  1NH4 A;  1BE3 J;  3TSI A;  3C9I A;  1J1E C;  3BCC G;  5APQ A;  5CCG C;  1OIP A;  1QL1 A;  5TIS V;  3CC7 P;  1HJ0 A;  1NNO A;  1LP1 B;  4XE5 B;  1S5L V;  3USS A;  3L70 E;  2M3B A;  3OCD B;  1W2E A;  1OW6 A;  3L70 D;  1AOQ A;  3MK7 C;  3BAS A;  3KZI E;  3M0A A;  5AVR B;  2LIT A;  3HD7 D;  1LTJ C;  1HGZ A;  4M3L A;  4Z1M H;  3CMA P;  1GU5 A;  2I8F A;  1GZL A;  4AUW A;  2MJZ A;  3RMZ A;  1KIL C;  1AFO A;  2W6B A;  3CWB D;  2WTY A;  2ZOO A;  3CCQ P;  3L70 G;  1SQP J;  1SQV K;  2R5B A;  2W8Z A;  3OAK A;  1QL2 A;  2C1U A;  1N50 A;  3AEG C;  1KYO E;  5E79 H;  3P7K A;  5AW6 B;  1KYO D;  5CID B;  4WY4 D;  1A56 A;  1SQX J;  2CE1 A;  1GK4 A;  1NGM B;  2L5G B;  2BEZ F;  1QX8 A;  2QIW A;  3GW6 A;  4Y5R A;  1K05 A;  2FXM A;  3H1H E;  1VQ5 P;  3EWK A;  1QYZ A;  3EFG A;  3L4F A;  4DJG A;  4NPE A;  3H1H D;  5CIE B;  4EID A;  1YIQ A;  5E79 V;  1CHI A;  2Q3E A;  3H32 A;  2KP8 A;  1IJD B;  5L8R J;  1LT1 A;  2AEF A;  3LIE A;  1AJY A;  3AEB C;  1M7L A;  1NAF A;  1SQP K;  1B7V A;  1K73 Q;  3A0B E;  1COR A;  3H1H G;  3O0R C;  2IYO A;  1SFC C;  4L73 A;  3SFD C;  3VYI A;  2D0S A;  2IDB A;  1I55 A;  1KV9 A;  3ZBM A;  2BPB B;  3H32 B;  1UIX A;  2KOG A;  2H89 C;  4IFM A;  3GF3 A;  3SLE A;  1YQ4 C;  1Q2N A;  5KLV E;  4AAM A;  2AEJ A;  1YIC A;  5CCG D;  1NKN A;  5KLV D;  1PP9 D;  1SQB J;  3PXS A;  1CHJ A;  1SQQ D;  2Z4E A;  1RZ6 A;  3SWK A;  1GK6 A;  3R4Y A;  2PGD A;  2Y0E A;  1S6V B;  3AE3 C;  3KQG A;  1N86 A;  5AVZ B;  3FWL A;  1OX3 A;  3M91 A;  3G9R A;  5KLV G;  3N7N A;  1OVU A;  1MG2 D;  3ZOX A;  1X0T A;  3GMA A;  4GOF A;  1N7S A;  3VP9 A;  1K8A Q;  1KIL D;  1RE4 C;  1FZF A;  3QH9 A;  3SSU A;  1QVG O;  1NTM K;  2PRR A;  2P2U A;  1GTW A;  1ZV8 A;  4N78 E;  1JY2 N;  3B8E B;  3JBT B;  3VP8 A;  3Q5S A;  2K9Y A;  1FJP A;  1HUC A;  1CYC A;  1SS1 A;  1SQB K;  3L4M A;  1FBM A;  3AEA C;  4LJI A;  2QM7 A;  5KJ7 A;  1N7S B;  3ZDM A;  2ZT9 B;  1N8R Q;  2IZ1 A;  1JY2 O;  2C9N Y;  1H88 A;  3SWF A;  1HRO A;  4DY9 A;  1JMM A;  2CA4 B;  4EIJ A;  1HTL C;  3PH0 A;  1G2C A;  3P8M C;  3L72 J;  2E75 D;  2DGE A;  1ZP0 C;  3ZCF A;  4UB6 H;  1HJ5 A;  1G1J A;  1YHQ P;  1CIF A;  1KX7 A;  2GUS A;  2FYU J;  3L36 A;  2H88 C;  3CCL P;  1IFN A;  2KSJ A;  5AW3 B;  1FOS E;  4EDF A;  2QJP B;  2JDI H;  3I55 P;  3WFC C;  3WUI A;  1NTZ J;  2GM4 A;  3H1J J;  2OAR A;  2YO2 A;  2QRX A;  1URQ A;  5GTH E;  2M3E A;  1KV4 A;  5CIB B;  1MZ4 A;  1BGY J;  3L73 J;  2GC4 D;  1F1F A;  1YNR A;  1E8E A;  1NTK J;  1LT9 A;  3C1L A;  4GED B;  3H1I J;  4N0K A;  1A02 F;  1FHB A;  4UB6 V;  1C52 A;  5KAI V;  1G2C B;  3ORV A;  4GYD A;  1T8Z A;  1JY3 P;  3P32 A;  1FS0 E;  1AOF A;  1JM0 A;  5APV A;  1ZRT E;  1X8Y A;  1A02 J;  5EFW B;  3WU2 H;  5GTI H;  1ZRT D;  4IFD K;  1URQ B;  1ZOY C;  4U3F J;  1A8C A;  1FCD C;  1BDC A;  1OWA A;  2N9B A;  3DR0 A;  2FYU K;  2IPP A;  1LT9 B;  5AW7 B;  1L0N J;  2OQQ A;  1NTZ K;  1HRC A;  4BXL A;  2K1A A;  3AEC C;  3V2Q A;  1KN7 A;  4FAN A;  4C7N A;  1ZN5 A;  3WU2 V;  2B4Z A;  4AQR D;  1T3J A;  1QL4 A;  2B87 A;  1IC2 A;  1LTS C;  3NBS A;  3L71 E;  1ZME C;  2ZFC A;  2G8Y A;  1ZZH A;  1VQP P;  1CXC A;  1FI3 A;  1T6A A;  351C A;  1KQF B;  2PAC A;  4C7N B;  1H8A A;  2CA3 B;  1PGP A;  3FX0 A;  1RE3 A;  1S72 P;  1L0N K;  5C0Z A;  2L91 A;  3L71 G;  2B87 B;  5AW2 B;  2A45 H;  1RAP A;  1M6Z A;  4NFG B;  1EB7 A;  1MFZ A;  1MKM A;  1W2L A;  1E79 H;  4PJ0 H;  5DF5 A;  1FJ0 A;  1RY3 A;  1YCC A;  3SWS A;  2Z5H A;  4LLH A;  4ZMD A;  1P84 H;  2QVA A;  2AIU A;  2Q9I A;  3VMX A;  1GW4 A;  2BCC E;  1KQS O;  3GG2 A;  2O1K A;  3HE4 A;  4QMA A;  1GIW A;  1DD3 A;  3F89 A;  4JPZ B;  1BCC D;  4I6M C;  2P10 A;  4WBA A;  2K9J A;  1EDJ A;  3V4Q A;  2AEM A;  2KI7 B;  3OJA B;  5AVS B;  2CPB A;  3VTP C;  2HR3 A;  1L9J C;  2ITA A;  1HJB A;  1CZQ A;  2BCC G;  1X79 B;  2IBZ I;  1JO5 A;  3C2C A;  2EXV A;  2POH A;  3HE4 B;  2AXT E;  2XKM A;  3VN0 A;  3WUT A;  3KYQ A;  1H9Y A;  1USE A;  2CPS A;  3TNU A;  2ZT9 C;  1CRH A;  1YEB A;  2GA1 A;  2K9J B;  2E5T A;  1JUN A;  1JDL A;  4OWF A;  1L4A A;  1FE6 A;  1YJ9 P;  2R3C A;  3CX5 D;  4HH2 A;  2XU6 A;  3L73 E;  3A0B V;  5H2F V;  2YMK A;  3PH2 B;  1NTK E;  4WB4 A;  1KFN A;  3F5H A;  3GF7 A;  1TU3 F;  5AVQ B;  4LC1 A;  1CHH A;  3TNU B;  1PV3 A;  5CJ0 A;  2QJP C;  1EZV E;  3FXE A;  2P58 A;  3U59 A;  3R2P A;  2B10 B;  1VQ7 P;  1EZV D;  1RF1 A;  1S3J A;  1L4A B;  1DEE G;  1ZXG A;  3S9O A;  1VQO P;  1YEA A;  1CTJ A;  3PLN A;  4WQE A;  4ZKU A;  4EI2 A;  3Q3D A;  2IBZ E;  2R44 A;  3OA8 A;  1OW7 A;  1EZV G;  3NBT A;  2KXP B;  1K04 A;  1L0L D;  1FU1 A;  3E1I A;  1JY2 P;  1URQ C;  2KUB A;  4V2K A;  3HTK A;  1RF1 B;  1CXA A;  4N3Y B;  3AE7 C;  2KZI A;  4IL6 H;  2ZBO A;  2JP3 A;  1PP9 J;  4PD4 I;  3MP7 B;  4ZKP A;  4YPC A;  4KMG A;  1NVO A;  1SQQ J;  1FC2 C;  2I1J A;  1IK9 A;  5CCH A;  3H1K J;  1NMI A;  1JOC A;  3OA8 B;  3SVW A;  1COT A;  1L0L G;  3M0D C;  3MD0 A;  2JWA A;  3BAT A;  1VDF A;  5KAF E;  3CCE P;  2JKV A;  2N9I A;  5CMZ A;  4N6J A;  4FA9 A;  2YKP A;  1LTB C;  1S5L H;  3RGU A;  4B86 A;  5AVU B;  3HTK B;  5GTI E;  2A45 I;  2WSF H;  3S4R A;  1KQG B;  3H1L E;  1FAV A;  1SQV J;  2XND H;  3H1L D;  1OMI A;  4K3A A;  3CWB J;  1IK7 A;  1JTH A;  5DJT B;  3CPW O;  1FDM A;  1BDD A;  1P84 I;  2WVR A;  1KB9 I;  2O1J A;  4XFJ A;  1N7S D;  2ZT9 D;  1C7M A;  3L37 A;  2JJL A;  1SQQ K;  3H1L G;  2IYP A;  3L75 E;  1GU2 A;  5IY5 1;  1NAY A;  4A7P A;  2MHM A;  1JTH B;  3L75 D;  3U1C A;  1U7J A;  2IFN A;  4PD4 E;  2KS1 A;  2QEX P;  5KKZ B;  1LJ2 A;  2JQR A;  3QWO C;  1RE3 C;  1N90 A;  5KJ7 D;  1M90 Q;  2AXC A;  2WSF J;  1OXZ A;  2C9X B;  2YMY A;  3B4S A;  3RN1 A;  3MUD A;  1OCD A;  1QKS A;  3L75 G;  5AVT B;  1Y8A A;  1LC1 A;  1G1I A;  3WFD C;  3TDK A;  3Q2Y A;  2A06 E;  3D71 A;  1SP4 A;  2ZAE B;  2KS1 B;  2A06 D;  3ZIY A;  2C8S A;  3ZOW A;  1VYD A;  5C39 A;  3HQ6 A;  2B88 A;  1E29 A;  3PHL A;  1KB9 E;  1EQ7 A;  3T97 A;  3PP5 A;  2C1V A;  1URQ D;  4TLF A;  1KB9 D;  1HWT C;  2L4D A;  2E75 C;  2GIW A;  2FKW B;  2QA4 P;  3OA7 A;  2BH4 X;  1ZW0 A;  1AQT A;  1LWU A;  4IFF A;  4L3H A;  4YXW H;  3G4S P;  1FDO A;  1RZ5 A;  2QE7 H;  1PZQ A;  4TT3 H;  2A06 G;  1CYI A;  2E5Y A;  1CRG A;  4HB1 A;  5AW5 B;  3N4X A;  2D0W A;  2P67 A;  4W80 A;  1RHZ B;  4H13 B;  3FGA D;  4FAV A;  5EXQ A;  3T97 B;  3D70 A;  3AE4 C;  1DX7 A;  3II6 A;  1HZU A;  5B6Q A;  1WT6 A;  1WEJ F;  4UB8 V;  1LWU B;  1WVE C;  1NTM J;  2H7H A;  2JWD A;  3IFM A;  2W6J H;  1N73 A;  1K3H A;  3NWV A;  1L4A C;  4GDO A;  4EYY Q;  3CCU P;  1CSU A;  3PXW A;  1KD1 Q;  2UWJ E;  2ZVN B;  1R8E A;  1DW2 A;  4WWI A;  3Q1M A;  1KFM A;  2Q5U A;  2YK3 A;  4EOT A;  2VRS A;  1QEX A;  1U74 B;  3C8V A;  2Y0C A;  3KDP B;  2K3R A;  3A0H E;  1N73 B;  1CSV A;  3H1K E;  5APS A;  2ZXE B;  1RF1 C;  1H32 A;  2RN0 A;  2V4H A;  2YCC A;  2N9J A;  2YXQ B;  3CXH H;  1HH0 A;  2OGU A;  4FA1 A;  3O6Q A;  1BE3 E;  2OYH A;  1UII A;  3HUS A;  3CCR P;  4N78 D;  1CIH A;  3W68 A;  1NML A;  2Q3I A;  4CPG A;  4D6T J;  2BH5 X;  3L35 A;  3V4W A;  5KLI B;  2WSC H;  3UIA A;  1H32 B;  5BU5 A;  1CI6 A;  1YQ3 C;  5B66 E;  3D6Z A;  1BCC J;  1CCR A;  2QM8 A;  1YIJ P;  4IL6 E;  3O6Q B;  1BE3 G;  2D2C B;  2IFM A;  1C6R A;  2B9B A;  3L74 J;  2OYH B;  1USD A;  3HUS B;  3KXD A;  5CCH C;  1GKS A;  1CRJ A;  2G3A A;  4AAN A;  2WIT A;  2YO3 A;  3TYY A;  5KAI H;  3RK2 B;  2Y9Z A;  1EDI A;  1CO6 A;  5TIS E;  2N1T A;  1GL2 A;  1VL2 A;  1IFI A;  2JEE A;  3O5C A;  1LGH B;  4KJM A;  2OYO A;  1CI6 B;  1SQP E;  1DW0 A;  1M70 A;  3WFE C;  3CCV P;  1SQP D;  2K88 A;  3O1Y A;  2N18 B;  3TGU J;  2DW3 A;  5AW4 B;  1H33 A;  1GW3 A;  1BSN A;  3BRV B;  1NHL A;  2RH0 A;  1CSW A;  1IFJ A;  5KKZ C;  1SQX E;  3IF4 A;  1AYG A;  1IQC A;  2YKO A;  2ZXX A;  2WSC J;  1SQX D;  2N1T B;  1GL2 B;  3SWY A;  5BU8 B;  1M60 A;  1OFC X;  1SQP G;  1Q7Y Q;  1L4A D;  1NU1 J;  3G3Z A;  1EXJ A;  2E74 B;  3JCU H;  3CC4 P;  5CIG B;  1H33 B;  2Y0D A;  1DH3 A;  1M8O B;  2B89 A;  2Y9Y A;  1JCC A;  1SQX G;  1KIB A;  1QL3 A;  5AVX B;  1GDT A;  5CYT R;  1DD4 A;  3JSV C;  1VF5 B;  2C2C A;  1IZN B;  3MUD C;  4JCG A;  1EC5 A;  2WPV B;  1GQ1 A;  1KC8 Q;  1LTA C;  3A2A A;  5KAF V;  5E79 E;  3L71 D;  2QSI A;  1NTM E;  2BAS A;  1CSX A;  1HZV A;  1Q90 D;  1KMI Z;  5B5E V;  4YXD C;  1NU1 K;  4H13 C;  2Q7C A;  4MU8 A;  4PW9 B;  1SQB E;  3BCC J;  4IL6 X;  2OTJ P;  1SQB D;  2PFX A;  2WMM A;  1LWU C;  3CXH W;  4JYB A;  3I5C A;  1AQ5 A;  2I1K A;  2C9L Y;  3Q5P A;  1RF0 A;  3H25 A;  1GMJ A;  4H44 B;  5CCH D;  1S5L X;  4EIE A;  1I5T A;  3KZI V;  1L0L K;  1SQB G;  1KYO H;  3VOP A;  4NPD A;  2O01 N;  4H0L B;  1K3G A;  1YTC A;  2V07 A;  2WPR A;  3RL0 B;  4YTP C;  1N73 C;  1KQL A;  2BCC D;  3IR9 A;  4DT0 A;  3V5B A;  2XZR A;  3L70 J;  1FZG A;  1LTI C;  4D6T E;  3RK3 E;  3AEE C;  3K5B A;  5CIF B;  3A9F A;  1CED A;  1VQN P;  1C2N A;  1GD2 E;  1I54 A;  1PPJ E;  1H9X A;  1MUU A;  2PP6 A;  4MN4 C;  2FWL A;  2FFD A;  3M9B A;  1PPJ D;  3RBZ A;  3FXD A;  3A7O A;  3L74 E;  1HGV A;  3A0B H;  5H2F H;  4RSZ A;  2Q1K A;  3L72 E;  5KLI C;  2C1D A;  1EDL A;  2KLU A;  1N7S C;  3L72 D;  2PAJ A;  1N15 A;  2FYU E;  1SFC A;  2LR2 A;  1LFM A;  2FYU D;  4FB1 A;  3TK1 A;  3CU4 A;  1PPJ G;  4AYC A;  2YIU B;  1NTZ E;  2D2C C;  3H1J E;  2OYH C;  3HUS C;  2ZVO B;  2FFD B;  1IFM A;  3H1J D;  1BGY E;  3TGU E;  2DVH A;  2FYZ A;  3RK2 C;  1LTG C;  1BGY D;  3L73 D;  4O1Q A;  3OW2 O;  3H1I E;  3L72 G;  1QGK B;  1Z56 A;  1NTK D;  4PV1 B;  3H1H J;  2E42 A;  2C1D B;  3H1I D;  5KJ7 C;  2FYU G;  2LIR A;  3GLM A;  1SFC B;  1SVF A;  2P1J A;  3AE9 C;  2RMZ A;  1FI9 A;  2N18 C;  1NTZ G;  1FOC A;  1CSB A;  1IO3 A;  2CK3 H;  3H1J G;  1XTG B;  4H13 D;  5AVV B;  5AW0 B;  4U3F E;  451C A;  1BGY G;  3L73 G;  2HG5 D;  2J5U A;  4I7Z B;  1GDV A;  1NTK G;  3H1I G;  1DIQ C;  2M0B A;  4JF7 A;  4XXL A;  2ZZS 1;  4U7J A;  2N1T C;  1GL2 C;  1L0N E;  4UB6 E;  3NTN A;  2R3S A;  5KAI E;  2RKL A;  2IBZ D;  1Q82 Q;  1S1C X;  1L0N D;  1J2J B;  1JCD A;  4OGQ B;  1QN2 A;  2N3Y A;  4W7Z A;  3ZOY A;  2E74 C;  1HBW A;  3RL0 g;  2HYN A;  3M97 X;  1FDI A;  4R4M A;  3CYT I;  1NKZ B;  3A0H V;  1LT9 C;  1MG3 D;  4DZO A;  5KLV J;  155C A;  1M1J A;  3VMY A;  3CLQ A;  2N3B A;  4K3I A;  3WFB C;  2IBZ G;  5AW8 B;  1L0N G;  5CHX A;  3BVH A;  1VF5 C;  1PIX A;  3Q5R A;  3B5N A;  4AAO A;  1OVV A;  2I8D A;  3SXT A;  1C6O A;  3WU2 E;  1MZ9 A;  3BCC E;  3MGN A;  4GT1 A;  4AAL A;  1KYO W;  1IZL 0;  2FXP A;  4DCK A;  4RKU J;  3SJL A;  2QJK B;  1EDK A;  1R0Q A;  3V2N A;  1M1J B;  3LW5 H;  5M1B A;  1CIE A;  1JY3 O;  4GKG A;  4FA5 A;  5B66 V;  1E5W A;  1KYO I;  5GTH H;  1E2R A;  5APU A;  3PXT A;  3B5N B;  5CIC B;  5KLV K;  4J20 A;  1YFC A;  1KB0 A;  3G71 P;  3AE5 C;  4Y28 J;  2W27 A;  5APY A;  1CRY A;  4H0J A;  1N7L A;  2D2C D;  4H44 C;  2K37 A;  1CC5 A;  5DJQ B;  2LXC B;  5DJU B;  1WMK A;  1D7M A;  1FZB A;  3D6Y A;  1S9K E;  5GTH V;  2ZYG A;  3RK2 D;  1S2E A;  2YNY A;  4PD4 D;  1S9K D;  4H0L C;  3RK3 B;  4L75 A;  5AW1 B;  2KSE A;  1FOS F;  3CC2 P;  3V2P A;  3RL0 C;  3VNW A;  2GB8 B;  4L1Q A;  2KK7 A;  1RF0 C;  1X22 A;  5KTB A;  3LW5 J;  4L74 A;  3CCS P;  1YJW P;  1OVR A;  1XTC C;  3ABV C;  3VMA A;  1OAE A;  2Q6Q A;  1EXI A;  3WC8 A;  4PJ0 E;  2E76 B;  2VHD A;  2OYI A;  2WT7 A;  1Q86 Q;  2N1T D;  1GL2 D;  2W83 C;  1T2K C;  2WWW A;  2ORL A;  1ZLL A;  1P84 E;  5K5G B;  1P84 D;  2QJY B;  2C0W A;  4ASV A;  2A45 G;  2E74 D;  2XV5 A;  2R5D A;  2FXO A;  2M5A A;  1HH7 A;  4UB8 H;  1VQ8 P;  3BRT B;  3AE1 C;  1VQK P;  1YTZ T;  3CME P;  3AED C;  2QG4 A;  4WVZ A;  4FA4 A;  4C7R A;  3P8C E;  2OYI B;  2WT7 B;  2YIU C;  1YTZ I;  1J1D B;  3O8Z A;  3P8C D;  3KHU A;  2B12 B;  3FWN A;  2FFD C;  1VF5 D;  1H1O A;  1N2D C;  4L76 A;  2XDJ A;  3L4O A;  2NPS A;  4BRY A;  2BLF B;  2YKQ A;  2HLO A;  3JC2 2;  2XTS B;  2KZJ A;  1W2B O;  1DT1 A;  3AEF C;  2YQB A;  4W7Y A;  4PV1 C;  1QLE D;  1ETP A;  5H2F E;  1C6S A;  2M5A B;  3AE8 C;  1S4X A;  1SLQ A;  2NRG A;  2OZ1 A;  2FYN B;  1DW3 A;  1HVV A;  1YI2 P;  1SQX K;  3L71 J;  2OTK E;  4OVN F;  1U7M A;  2WSS H;  4I7Z C;  3RN0 A;  2NPS B;  4BRY B;  2KNC A;  1HCM A;  2P7J A;  5CJ4 A;  1ZR2 A;  1PP9 E;  3CI9 A;  1CIG A;  2NZ2 A;  2YXR B;  1SQQ E;  4OGQ C;  4H44 D;  2W6A A;  1KX2 A;  2OZ1 B;  3H1K D;  1LS9 A;  2GC7 D;  2ZYD A;  4O9B A;  1IRV A;  1M57 D;  4H0L D;  3GHG A;  4XYD B;  2AXT H;  3IN6 A;  3VMZ A;  2KNC B;  5AVY B;  4GOE A;  5TJH A;  1PP9 G;  4WQ9 A;  1SQV E;  3RL0 D;  1BE3 D;  1KIL E;  1CTY A;  1H0T A;  2FBW C;  1DEB A;  3CWB E;  1SQQ G;  1SQV D;  4I1L A;  1DIP A;  3H1K G;  2KLV A;  3CX5 H;  3PJS K;  4KT0 J;  4BWN A;  3EQ2 A; 
#chains in the Genus database with same CATH homology
 1EZV D;  3TYI A;  2O3J A;  4MU8 A;  4PW9 B;  2C1U A;  1N50 A;  1CNO A;  1I8P A;  4Q5P A;  1YEA A;  2AXT V;  1CTJ A;  3PLN A;  1SQB D;  4AX3 A;  4WQE A;  3CXH W;  2N9Y B;  1KYO D;  5CID B;  1L9B C;  1A56 A;  2CE1 A;  1BL9 A;  3PRJ A;  1W5C T;  3OA8 A;  3X39 A;  3NBT A;  3GW6 A;  4Y5R A;  4RJT A;  4WQB A;  1L0L D;  4EIE A;  4EIC A;  1I5T A;  1I6E A;  3KZI V;  4V2K A;  1QYZ A;  1CXA A;  4O1W A;  3H1H D;  5CIE B;  4EID A;  1YIQ A;  1CYJ A;  5E79 V;  1CHI A;  2Q3E A;  2ZBO A;  5C9M A;  5DJQ C;  1K3G A;  1YTC A;  2V07 A;  1NIR A;  4KMG A;  2BCC D;  2AI5 A;  1B7V A;  2BGV X;  1NMI A;  3OA8 B;  3SVW A;  1COT A;  2JWA A;  1COR A;  1CRC A;  2N9I A;  3O0R C;  4FA9 A;  5CIF B;  3A9F A;  1CED A;  1C75 A;  1C2N A;  1I54 A;  1H9X A;  2D0S A;  1I55 A;  1KV9 A;  3ZBM A;  2BPB B;  2FWL A;  1PPJ D;  4WQ7 A;  3H1L D;  4RSZ A;  3SLE A;  1N9C A;  4AAM A;  3DP5 A;  3TF5 A;  2C1D A;  1YIC A;  5KLV D;  1LMS A;  3L72 D;  1CCH A;  1PP9 D;  1N15 A;  3HQ7 A;  3PXS A;  1CHJ A;  1LFM A;  1SQQ D;  2FYU D;  4QAO A;  4FB1 A;  1C7M A;  3CU4 A;  1RZ6 A;  2YIU B;  2Y0E A;  1S6V B;  3PTZ A;  3H1J D;  4P4Q B;  3FWL A;  2DVH A;  3CP5 A;  1GU2 A;  5IY5 1;  4A7P A;  1BGY D;  2MHM A;  3L73 D;  1DVV A;  4O1Q A;  3L75 D;  1NTK D;  1MG2 D;  3ZOX A;  2KS1 A;  2C1D B;  3H1I D;  4YE1 A;  5GTI V;  5AUR A;  5KKZ B;  1NTM D;  2JQR A;  2LIR A;  1H31 A;  1N90 A;  2RMZ A;  1FI9 A;  2C9X B;  2N18 C;  1FOC A;  1IO3 A;  3JBT B;  3RN1 A;  1OCD A;  1QKS A;  451C A;  1CYC A;  4WQC A;  1GDV A;  1LC1 A;  1DIQ C;  3WFD C;  1GJQ A;  3L4M A;  1C2R A;  4XXL A;  2ZZS 1;  3TDK A;  4LJI A;  2IBZ D;  2A06 D;  3ZIY A;  2C8S A;  1L0N D;  3ZOW A;  1VYD A;  3HQ6 A;  3ZOO A;  1CRI A;  1H31 B;  1QN2 A;  2N3Y A;  1E29 A;  3ZOY A;  3PHL A;  3CX5 W;  3M97 X;  2C1V A;  1KB9 D;  3CYT I;  2L4D A;  3A0H V;  1HRO A;  2GIW A;  4DY9 A;  2CA4 B;  1HJ4 A;  3MK7 B;  2BH4 X;  1MG3 D;  4L3H A;  1RZ5 A;  2DGE A;  155C A;  3ZCF A;  2N3B A;  4K3I A;  1HJ5 A;  3WFB C;  1CYI A;  1CIF A;  1KX7 A;  1CRG A;  2BCN B;  2D0W A;  1FI7 A;  4EDF A;  1A2S A;  2QJP B;  1DII C;  3WFC C;  3WUI A;  2B0Z B;  4AAO A;  4D6T D;  4WQD A;  3VYM A;  1U75 B;  3SXT A;  4FAV A;  5CIB B;  1C6O A;  5EXQ A;  1MZ4 A;  2GC4 D;  1HJ3 A;  1F1F A;  1YNR A;  3HQ9 A;  4EIF A;  1E8E A;  4AAL A;  4H0K A;  1KYO W;  1IZL 0;  2PCB B;  1HZU A;  4GED B;  4PJ0 V;  1WEJ F;  4N0K A;  4UB8 V;  5B6Q A;  4UB6 V;  1FHB A;  1C52 A;  5KAI V;  3SJL A;  1WVE C;  2QJK B;  1R0Q A;  3ORV A;  4GYD A;  1CIE A;  3VRD A;  3L74 D;  1K3H A;  4FA5 A;  2CXB A;  5B66 V;  3NWV A;  1AOF A;  3DMI A;  1CSU A;  1E2R A;  2B11 B;  1LC2 A;  3PXT A;  1ZRT D;  4L3G A;  3PXW A;  5CIC B;  4J20 A;  1YFC A;  1A8C A;  1KB0 A;  1RAQ A;  1FCD C;  1DW2 A;  2YK3 A;  3DR0 A;  3CXH D;  1CRY A;  4H0J A;  1NTZ D;  1U74 B;  2Y0C A;  1CC5 A;  5DJQ B;  1HRC A;  3TGU D;  1CSV A;  4FAN A;  5GTH V;  1H32 A;  2RN0 A;  3WU2 V;  4PD4 D;  2YCC A;  2N9J A;  2B4Z A;  2JTI B;  1AKK A;  1QL4 A;  4FA1 A;  3NBS A;  4PWA A;  3O20 A;  2ZXY A;  3VNW A;  2GB8 B;  4L1Q A;  1CIH A;  1ZZH A;  2HV4 A;  1NU1 D;  1CXC A;  1FI3 A;  1NML A;  4U3F D;  3VMA A;  1OAE A;  351C A;  2BH5 X;  2PAC A;  3WC8 A;  2VHD A;  5KLI B;  1H32 B;  2CA3 B;  2ORL A;  2MTA C;  2PCC B;  5CIH B;  5C0Z A;  2L91 A;  1CCR A;  1P84 D;  2QJY B;  1RAP A;  1M6Z A;  1C6R A;  4NFG B;  1EB7 A;  1GKS A;  1W2L A;  1DVH A;  1HH7 A;  5DF5 A;  1CRJ A;  4AAN A;  1FJ0 A;  1YCC A;  1CO6 A;  3SWS A;  2QG4 A;  4WQ8 A;  4FA4 A;  3HQ8 A;  1I8O A;  2AIU A;  3O5C A;  3ITK A;  1I6D A;  3KHU A;  1DW0 A;  2B12 B;  1F1C A;  1H1O A;  1M70 A;  3WFE C;  1SQP D;  3L4O A;  3O1Y A;  2FRC A;  2N18 B;  3GG2 A;  2BLF B;  2CE0 A;  1H33 A;  2XTS B;  1IRW A;  1DT1 A;  1GIW A;  2YQB A;  3BCC D;  5DFS A;  1ETP A;  1C6S A;  1CSW A;  1BCC D;  1J3S A;  4WQA A;  1AYG A;  1IQC A;  1SQX D;  2OZ1 A;  2FYN B;  3OCD A;  1CTZ A;  2V08 A;  1DW3 A;  1DW1 A;  2ZON G;  4IL6 V;  1M60 A;  3RLM A;  1L9J C;  3RN0 A;  5CIG B;  1HCM A;  2EXV A;  3C2C A;  1H33 B;  2Y0D A;  5TIS V;  1NNO A;  1CIG A;  1H9Y A;  1KIB A;  1CRH A;  1QL3 A;  1S5L V;  1YEB A;  2K9J B;  1KX2 A;  2OZ1 B;  3OCD B;  5CYT R;  1JDL A;  3H1K D;  1LS9 A;  2GC7 D;  3L70 D;  2C2C A;  1AOQ A;  3CX5 D;  1IRV A;  4JCG A;  1GQ1 A;  3MK7 C;  2LIT A;  4XYD B;  3A0B V;  5H2F V;  3PH2 B;  5KAF V;  2KNC B;  3L71 D;  2I8F A;  5TJH A;  4WQ9 A;  3RMZ A;  1CSX A;  1BE3 D;  1HZV A;  1CTY A;  1CHH A;  1SQV D;  5B5E V;  2ZOO A;  3CWB D;  2B10 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...