1BCCD

Cytochrome bc1 complex from chicken
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGPLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSVREGLYFNPYFPGQAIGMAPPIYNDVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLVPLVYYMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 59
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1bccD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1bccD01
1YICA 3O1YA 2XTSB 1K3GA 4D6TD 1RZ5A 3ZOWA 5AURA 3ZOYA 2B11B 2DVHA 3SVWA 3SWSA 4XYDB 2RMZA 1I5TA 2C2CA 2FRCA 3L70D 1DVHA 1YTCA 2BGVX 1CYCA 1L9JC 1M60A 4IL6V 2B12B 1CRGA 4GEDB 4EICA 3CP5A 3O0RC 3SJLA 1RAPA 3VMAA 2QJPB 3PHLA 1U74B 1CRJA 2CXBA 2BPBB 2LIRA 1A56A 3H1KD 1SQVD 3RN1A 1I55A 2FYUD 4H0JA 2L4DA 3SLEA 3ORVA 3L4MA 3DMIA 1CRCA 1CO6A 2PACA 1GIWA 1FOCA 1WEJF 1GJQA 3BCCD 3TYIA 1BGYD 3TGUD 5CIGB 3L75D 3TF5A 4K3IA 5DFSA 1W2LA 1DW3A 2KS1A 3HQ8A 1H33B 5IY51 4KMGA 3RLMA 1HRCA 2N3BA 2JTIB 1CIFA 4EIDA 1U75B 1I6EA 3FWLA 1PPJD 1N9CA 2B0ZB 3L4OA 2A06D 4L3HA 1N50A 1CHIA 5CYTR 1N15A 1OAEA 5GTIV 2CA3B 1I8OA 5E79V 1L9BC 5TISV 1QN2A 4AANA 1CC5A 3KHUA 1CSVA 351CA 2ZBOA 3GG2A 4MU8A 1ZRTD 1C7MA 1DW2A 3M97X 3A0HV 2N3YA 3OA8A 2GB8B 1C75A 1LC2A 4WQEA 3PH2B 5GTHV 1C2RA 5CIEB 3TDKA 1FI3A 4LJIA 4PWAA 4J20A 1I8PA 1H1OA 1I54A 2KNCB 1CRYA 4AALA 2Y0DA 2GC4D 1VYDA 1H31A 1CHJA 1LMSA 1DIIC 1NTKD 2MTAC 1NTZD 2CE0A 4QAOA 3MK7C 1HZUA 1DW0A 2IBZD 4AAOA 1CNOA 2OZ1A 2K9JB 4L3GA 1CORA 2LITA 1CIEA 1F1FA 2HV4A 1CXAA 155CA 4FA4A 2C1DA 2PCCB 3JBTB 1AOQA 2CA4B 3CX5W 3CYTI 3X39A 1GU2A 5CIHB 4N0KA 1MG3D 1N90A 2MHMA 451CA 3RMZA 4EIEA 1E8EA 4EDFA 2BLFB 1GQ1A 3NWVA 1IRVA 1YFCA 1KB0A 3A0BV 2DGEA 4JCGA 2JQRA 1QYZA 3HQ7A 5CIDB 2D0SA 1CTZA 1YNRA 1W5CT 1FJ0A 3L72D 1ZZHA 5KAIV 1MG2D 4V2KA 1KYOD 1CYJA 2D0WA 3VYMA 2Q3EA 5KKZB 2ZONG 1GDVA 1NIRA 4UB8V 1C52A 1CXCA 2B10B 4P4QB 5EXQA 3CXHD 2FYNB 3PXTA 1CRIA 5CIFB 5KAFV 1SQBD 1HROA 3PXSA 1FI9A 1CRHA 3HQ9A 1BE3D 3L71D 3OA8B 1RAQA 4DY9A 4Q5PA 5C9MA 1M6ZA 1AOFA 1KX7A 1KB9D 4AX3A 3SXTA 4WQAA 2GC7D 1EZVD 3WUIA 3ZOOA 5CICB 1H32B 2N9JA 1K3HA 1FI7A 1C2NA 2N9IA 3ZIYA 1CYIA 2QG4A 3NBTA 1H31B 3CXHW 2YIUB 2AIUA 1KIBA 3A9FA 3VRDA 1NNOA 4FA5A 3MK7B 4WQBA 3RN0A 3WFBC 1CCHA 2OZ1B 1CHHA 2ZXYA 1J3SA 1CSWA 1H32A 5B6QA 1EB7A 3OCDB 3WFEC 1YEAA 1A8CA 1CSXA 2GIWA 4XXLA 1B7VA 1AYGA 2Y0EA 2C1DB 5DF5A 4O1QA 1CCRA 2YQBA 3H1HD 4FA9A 1MZ4A 5KLVD 2QJKB 1CTYA 2C8SA 1S6VB 5B5EV 1DW1A 4AAMA 1L0ND 3ZOXA 1SQXD 1C6RA 1CIHA 4GYDA 2BCNB 3HQ6A 3OCDA 2B4ZA 2JWAA 3WU2V 2C1VA 2N18B 3KZIV 1NU1D 5CIBB 2V07A 3PRJA 1QKSA 5DJQC 3ITKA 1L0LD 4L1QA 2ORLA 1LFMA 1COTA 2FWLA 5KLIB 4RJTA 1KX2A 2QJYB 5C0ZA 4EIFA 4RSZA 4WQ7A 2CE1A 1CEDA 4WQCA 3PTZA 2RN0A 1CIGA 2N18C 1DT1A 2BH5X 1IO3A 1CTJA 3O5CA 3WFCC 1HZVA 4U3FD 4PW9B 1BL9A 3CU4A 4PD4D 1HJ5A 1FCDC 1DVVA 2AXTV 5H2FV 2ZZS1 1IRWA 2Y0CA 2BCCD 2C1UA 1LS9A 4PJ0V 2N9YB 1AKKA 1FHBA 1PP9D 1OCDA 1HCMA 3H1JD 1IQCA 3L74D 4UB6V 1JDLA 2ZOOA 1NMLA 1QL4A 1YIQA 2EXVA 2I8FA 5B66V 4WQ8A 1QL3A 2C9XB 3H1ID 2L91A 3PLNA 1H9YA 3NBSA 3L73D 1C6SA 1SQPD 3DR0A 1CSUA 3ZBMA 4NFGB 1GKSA 1I6DA 4O1WA 2YCCA 1KYOW 3GW6A 3C2CA 1IZL0 4YE1A 4WQDA 2YK3A 3PXWA 1KV9A 1ETPA 1WVEC 1A2SA 1BCCD 2O3JA 3H1LD 5TJHA 1YCCA 1E29A 4FB1A 1H33A 3O20A 1RZ6A 2BH4X 1M70A 1P84D 1R0QA 1LC1A 2PCBB 3WFDC 1C6OA 1YEBA 4FAVA 3WC8A 1HJ3A 1H9XA 1DIQC 3DP5A 4H0KA 5DJQB 3ZCFA 1HH7A 4A7PA 1NTMD 1F1CA 1HJ4A 1S5LV 3CWBD 1E2RA 4WQ9A 2AI5A 2VHDA 4Y5RA 1SQQD 3VNWA 4FANA 4FA1A 2V08A 1NMIA 3CX5D
chains in the Genus database with same CATH superfamily
1L0LK 1GTWA 3EWKA 1KILC 1RZ5A 3AEAC 2M8RA 3L73J 1LTIC 5B66E 1SQPE 2L5GB 2J59M 2DVHA 2WWWA 1A02J 1FZFA 3L70D 1ZW0A 2FFDA 1CYCA 4GEDB 2IZ1A 4KHXA 3CCVP 2WSFH 3SJLA 1SQPG 3VMAA 1QVFO 2QJPB 4MN4C 4LC1A 1CRJA 1JB0J 2BPBB 2LIRA 1EDIA 1IFNA 1A56A 2YNYA 4RESB 3PH0A 5B5EH 2L4DA 3AE4C 3SLEA 2KSEA 3ORVA 2WSFJ 3L4MA 2JDIH 1CO6A 1NTME 1QLED 2Z5IA 1FJKA 3BCCD 3CL3D 1BGYD 1VF5B 2C0WA 1SQPK 3TGUD 1FJPA 5CIGB 5BU8B 1LTJB 4H13C 3L75D 1CZQA 3VMYA 1HH0A 2WQYC 3BRVB 1NTMG 3H1HG 1J1EB 3CX5E 3CWBG 1GW3A 3HQ8A 5IY51 1UIXA 2FYZA 2M5AA 2K1AA 1L0NG 3HD7C 1PPJD 3MTUE 2NPSB 2QM8A 2B0ZB 5CHXA 2AXTH 1ZOYC 1MZ9A 3S9OA 4IL6E 1RE3A 1G1JA 3P8CD 3A7OA 2M0BA 351CA 5KAFH 1NTMK 3GG2A 3B71A 2R44A 4UB6H 1DW2A 3M9QA 2WT7A 2W27A 3AEGC 4WWIA 3A0HV 1M56D 2BASA 1L4AD 1L0NK 4IL6X 1SQVG 1Q7YQ 3RK3B 5H2FE 4B86A 2HPCA 1VQMP 1IC2A 1MKMA 3L74J 5APYA 1DH3A 1NKZB 1LP1A 1H1OA 1I54A 2Y0DA 2GC4D 1VYDA 1CHJA 4GOEA 3H1IJ 1IFIA 1LMSA 3NMDA 2OYHB 1AFOA 1AVYA 3CXHE 3MK7C 1HZUA 5AVTB 4L74A 1N7SA 4AAOA 1RE4C 2K9JB 3BRTB 3OW2O 3CD6P 4C7RA 1SQVK 2KLVA 3HRNA 3M0DC 3S1KA 1RF1C 1KB9E 2JP3A 2OYIA 4NPEA 1LT9C 2CA4B 3CYTI 1GU2A 1NGMB 3W67A 4N0KA 1MG3D 3L4FA 5BVZA 5E79E 2YXRB 5APQA 1E8EA 2K9YA 2HLOA 2BLFB 1KV4A 1IJDB 2M5AB 1JCDA 1EDKA 4W80A 1KQFB 2P2UA 1JOCA 2D2CB 1FJ0A 3L72D 1MG2D 2E76C 4V2KA 2D0WA 1W5CE 2Q9IA 1USEA 4UB8V 1C52A 1VPCA 4P4QB 2R3SA 2FYNB 2IFMA 1QGKB 1SQBD 1NTZJ 2NRGA 3HQ9A 1BE3D 1FZCA 4TLFA 3L70J 2CPSA 4IFMA 1OW6A 1KX7A 1DD4A 4O9BA 1HUCA 1NTKG 2WPRA 2HPCB 1ZN5A 1NU1E 2GUVA 1LP1B 2N9IA 3MGNA 3ZIYA 1CYIA 2ZAEB 2ZT9B 1PV3A 2H7HA 1KIBA 3A9FA 1NNOA 3FGAD 4FA5A 1NHLA 4YXWH 3RN0A 3WFBC 1HJBA 5AW7B 3RL0C 2GUSA 2ZXYA 2IZ0A 3AE1C 1K05A 1CSWA 1H32A 1JY3O 1BGYJ 1GU5A 3OCDB 4W7YA 2SPZA 1YEAA 1NTKK 2GIWA 2WSCJ 2FBWC 3TGUJ 1IZNB 3JCUH 4U3FE 2OYIB 4O1QA 2XNDH 2YMYA 1R8EA 3H1HD 2YQBA 1M1JA 1IFPA 2YIUC 5K5GB 2QJKB 2C8SA 3EFFK 1LTGC 1S9KE 5B5EV 1DW1A 1L0ND 3ZOXA 1SQXD 3L37A 1C6RA 1CIHA 4OGQB 1PGOA 2PP6A 4WY4D 2CPBA 3RBZA 1MV8A 3WU2V 2C1VA 5AVZB 1VQOP 3PRJA 1QKSA 1YTZT 3IF4A 1HWTC 5GTIE 1Y8AA 1LWUC 5TISE 4RJTA 1L4AA 4C7NB 2QJYB 1PZQA 2I8DA 3V2PA 5AW5B 2IFNA 1VF5D 1YHQP 2WPVB 4WQ7A 1BCCE 2OYOA 3HE4A 2RN0A 1CIGA 2XDJA 3WFCC 1PL5A 1FZCB 4PV1C 3Q1MA 1X8YA 5GTHE 3CU4A 1SVFA 1OXZA 2AXTV 4L73A 2OGUA 4H44B 1KQLA 3VN0A 4JF7A 3C9IA 1PP9D 2NPSD 1OVUA 2B89A 4UB6V 1T2KC 2XNXA 2QA4P 1JY3P 3IR9A 4GOFA 3CCUP 3T97B 1QL3A 2KSJA 1H9YA 5AW8B 5KLVG 1VQLP 3L73D 1URQD 3A0BH 3AE3C 4PD4H 1ETPA 3RK3D 1KFMA 2QE7H 3M0AA 2OARA 4RKUJ 1YCCA 1FDMA 3C8VA 3WMM0 1NJIQ 3WFDC 4FAVA 1H8AA 1D7MA 5KLVK 1FZAA 4H0KA 4ZKUA 5DJQB 1SS1A 5KAIE 1F1CA 2BCCE 1E2RA 1HJ0A 5CJ4A 3FWNA 4YXDC 1SQBJ 3VNWA 1SQQD 1FS0E 1L4AB 3BCCE 4WVZA 4FA1A 2V08A 1S1CX 1ZR4A 2BCCG 2NZ2A 2AEJA 3HE4B 3L75E 4N78D 2ZFCA 4D6TD 3H1JG 2OQQA 3D6ZA 1AA0A 3SWSA 2V7QJ 3A5TA 1I5TA 2FKWB 4GT1A 4AYCA 2D2CD 2KNCA 2CXBA 1OVRA 1N86A 4BWNA 3RN1A 5AVSB 3F89A 3SWFA 3CX5H 1FE6A 2KS1B 5L8RJ 1X0TA 3H1LG 1GK4A 3HD7B 1WEJF 1FOCA 3H1HJ 3CWBJ 1GJQA 1PGJA 1HTLC 1SP4A 4WY4A 1E5WA 1L0NJ 1HGZA 1JY3N 3UIAA 4HKZH 3TF5A 2IPPA 5DFSA 1DW3A 3N7NA 3A2AA 4RO0A 2ZT9D 4KMGA 2N1TD 1WRGA 3U59A 1I6EA 1S3JA 3FWLA 3VYIA 2FXOA 3JSVC 4BRYB 2A06D 1N50A 1CHIA 1VQ7P 5CYTR 1N15A 1NH4A 1LTJA 1GL2D 3W68A 2H43A 5H2FH 2AXCA 1N73A 2G3AA 1L9BC 3D71A 1QN2A 4AANA 1SQVJ 3H1KE 1YBKA 2ZBOA 1ZLLA 2QIWA 2WPQA 2QEXP 1ZRTD 3SSUA 1C7MA 1SFCC 3V2NA 2FYUE 2IBZI 2N9BA 2NPSA 4LGDE 1C75A 3NTNA 3C1LA 4WQEA 3H1KG 4OGQD 3SWYA 3PH2B 1PP9J 1C2RA 2HFED 4I7ZC 4DT0A 1FI3A 1FZBA 2LR2A 2ZYGA 2J58A 3CC4P 1I8PA 1RF1B 2FXMA 1FZEA 3L72E 2KNCB 3CCQP 1URQA 1LT9B 3FXEA 4OH8B 2WITA 2Z5HA 3V5BA 1JTHA 5KJ7D 2MTAC 2O1KA 4HH2A 1NTZD 4XE5B 4QAOA 2E75D 2IBZD 1QL1A 1CNOA 1NWQA 3MUDA 3BVHA 1CORA 3Q5SA 2LITA 1OW8A 1BE3E 5CBNA 2O1JA 2HV4A 2PCCB 3CPWO 2B9BA 5M1BA 4WY4B 4H44D 2OYHA 4Y99B 451CA 4EIEA 1IO4A 2PFXA 1YFCA 2K9JA 5CJ0A 3A0BV 1VQPP 2DGEA 2P1JA 3PJSK 3HQ7A 3U1CA 1W2EA 3WU2H 1K8AQ 1R5LA 2UWJE 2FY8A 3A0HE 3E1IA 1EZVI 2JO1A 1S5LE 5CCGC 1VQ9P 1SQQJ 1UIIA 1KQGB 1NYHA 2Q5UA 1T8ZA 2XZRA 2Q3EA 1FZGA 1N73B 1KORA 5KLIC 2ZXEB 3HUSC 5EXQA 4D6TJ 3PXTA 1CRIA 3R2PA 2KI7B 4EOTA 1NTKJ 1HROA 2ZVNB 1S5LX 2B88A 1L2PA 2LXBA 2HR3A 3L71D 2Q1KA 2P58A 1SQXE 2B87B 3RL0B 4AX3A 1DEBA 3SXTA 4WQAA 3P8MC 2GC7D 1EZVD 3ZOOA 5CICB 1KILD 1H88A 4NPDA 3RK2C 1C2NA 2KZIA 1H89A 1RH5B 1URQB 4N6JA 1LNQA 2YIUB 2AIUA 1JTHB 3AE6C 4C46A 1OVVA 4WQBA 4ZNCA 2KYVA 3KXDA 4JQ0D 5B6QA 2C9NY 1EB7A 2YKQA 1HVVA 1B7VA 2Y0EA 3EFGA 4OVNF 1KYOE 2YXQB 1OFCX 2N1TA 1CCRA 2BEQD 4FA9A 1CTYA 5EFWB 1EDLA 1XTCC 1Y9BA 5TISH 4GYDA 1GL2A 3HQ6A 1JY2P 1U7MA 3OCDA 4H13D 2B4ZA 2WVRA 1R5SA 2Q6QA 4PD4I 5CIBB 3CC2P 1JM0A 3L73E 2H88C 3ITKA 1L0LD 4L1QA 1FOSE 1WMKA 5AVVB 3HD7D 2CK3H 3NXSA 3KYQA 2FWLA 1K04A 3AEBC 1KX2A 1U57A 2MKVA 4EIFA 3RK3E 2E74C 4WQCA 1DX7A 1QVGO 2N18C 1IO3A 1CTJA 1YQ3C 4W7ZA 4L75A 4DJGA 2O01N 1BL9A 4PD4D 5H2FV 2ZZS1 1WT6A 1YTZI 5KJ7A 4C7NA 1AKKA 5AVXB 1OCDA 2K3RA 3GHGA 1IFJA 5KLVJ 2QJPC 2ZOOA 3GF3A 1BDDA 2KB7P 1QL4A 2I8FA 4I6MC 5B5EE 2L91A 3II6A 1SQPD 4N78E 2IYOA 4I2LC 2IX7C 1IZL0 2M3BA 2YK3A 2KP8A 1KV9A 2N1TB 1YIJP 4GDOA 1NU1G 3T97A 5DJUB 3CX5I 4FB1A 1GL2B 1M70A 1LC1A 2PCBB 1N8RQ 2ZJSE 1NAFA 3RL0g 1H9XA 1DIQC 3DP5A 2JJLA 1LT1A 2WSSH 1NTMD 5APVA 1RF0A 3CWBD 3BASA 1BSNA 4M3LA 3H1JJ 1QL2A 4U3FG 4Y5RA 3L74E 3V4WA 1T6AA 1NU1K 5KAFE 5CBOA 1NMIA 3L71J 2E76D 3CX5D 1YICA 3O1YA 4UB6E 1KILA 3V2QA 2KXPB 3SFEC 1K3GA 3L35A 3H1IE 4N3YB 3ZOWA 5AURA 3ZOYA 1YYCA 4XYDB 3KPEA 2GM4A 1GW4A 2FRCA 1DVHA 2OTLP 2BGVX 1M60A 2B12B 2PAJA 1CRGA 2XKMA 3H1IG 2FFDC 3VOPA 4H0LC 2A06E 3CP5A 3O0RC 1YJWP 2E75B 3ABVC 3GHGB 3PHLA 3USSA 3H1LJ 1SQVD 2KUBA 1FDOA 4XA4A 3WUUA 4ASWA 4WBAA 1P84E 2IYPA 1BCCG 1IFMA 4NPFX 3V6IA 2XU6A 1QEXA 1CRCA 1LTSC 2PACA 4HB1A 1GIWA 1FU1A 3RL0D 3VP8A 1OZHA 5CCGA 1DIPA 1NOHA 1EQ7A 3I5CA 1FDIA 1ZXGA 4JYCA 1VQ6P 2KS1A 2Q3IA 1G2CA 2POHA 1CIFA 3HD7A 3Q2YA 4EIDA 1NTZE 1MUUA 4XFJA 1L0LJ 1ZP0C 1ZV8A 1N9CA 2R3CA 3KZIE 4ZMDA 2ZYDA 3FXDA 2IBZE 3L4OA 4L3HA 2A45G 2KK7A 4IFFA 3L70E 1OAEA 5GTIV 4I7ZB 1LJ2A 2IDBA 1U7JA 4PJ0H 1NAYA 5TISV 3JC22 3QWOC 1CC5A 1RE3C 1PFIA 1PGQA 1VL2A 1CSVA 2HYNA 1HGVA 4MU8A 3IAOA 1J1DC 2E42A 1FAVA 1KILB 2ZXXA 4BRYA 3OA8A 5B66H 1LC2A 4GODA 5GTHV 2JWDA 3H32B 5CIEB 3TDKA 2GA1A 4LJIA 1X22A 4PWAA 4J20A 1Q2NA 2W90A 4AQRD 4K35A 1BGYE 2H89C 2HG5D 4PV1D 1JUNA 3TGUE 3P7KA 1DIIC 1NTKD 3BCCG 4L76A 1SQPJ 1BGYG 1RY3A 1RE4A 1W2BO 1KTMA 1DW0A 3TGUG 1RQUA 3M91A 4TT3H 1AVOA 2KOGA 3B5NC 1N7SC 1PPJE 4L3GA 3L75G 1T2KD 4GKGA 2M3EA 1CIEA 3M0DA 1M1KQ 1VDFA 1RF1A 1F1FA 2J5UA 3JCUE 155CA 4FA4A 2C1DA 1LT9A 2OYIC 1EZVE 2P10A 3CX5W 3X39A 4H13B 5CIHB 3P8CE 5CCHC 1N90A 2MHMA 1M8OB 1IK9A 4EDFA 3NWVA 5APUA 1KB0A 3OA7A 1G2CB 4JCGA 2QVAA 2JQRA 3AEEC 1NTMJ 1CTZA 1YNRA 1PIXA 1W5CT 2K88A 1IK7A 1ZZHA 5KAIV 2LXCB 1CYJA 1GDVA 1NIRA 4IL6H 4R4LA 1CXCA 3RK2B 2PRRA 1EC5A 1RHZB 3MHVA 3K5BA 2QRXA 3M06A 2Y9ZA 5CIFB 2O01H 3PXSA 2HODB 1CRHA 1JMMA 2R32A 3HE5B 3OA8B 2KLUA 2VRSA 3VP9A 4DY9A 4Q5PA 1Q86Q 1YITP 3V2RA 1E79H 2XV5A 1FZCC 3CLQA 5AW2B 5KKZC 2C0XA 3KQGA 2N9JA 3VMZA 3R4YA 2E5TA 2WTYA 2O01J 1L0LE 3NBTA 3H25A 1KYOH 3CXHW 1T3UA 2WZ7A 2V4HA 1LTBC 3OAKA 2B87A 3MK7B 1GZLA 3G4SP 3CXHH 2YKOA 1NO4A 2I1KA 3M9HA 1CHHA 5AW6B 3BATA 2JR8A 2FYUG 4KJMA 1Z56A 3FX0A 1VQ5P 1Q81Q 5BU5A 3D6YA 1AJYA 4XXLA 1AYGA 2C1DB 1KB9H 4PD4E 5DF5A 1T3JA 5KLVD 1M1JC 5E79H 2WMMA 3AE9C 1S6VB 3L72G 1SQBE 2AEFA 2E74B 1OW7A 2JWAA 3O6QA 2N18B 5CMZA 1N2DC 2FYUK 5AVUB 1SQBG 2E76B 5DJQC 5AVQB 1ZMEC 2ORLA 1LWUA 1BE3G 1Y47A 1GDTA 1LFMA 1COTA 1EDJA 4YPCA 1KFNA 1L4AC 3Q5RA 2ZYAA 3S4RA 1GD2E 2CE1A 1CEDA 1KC8Q 3TK1A 1DT1A 3CCMP 1K73Q 1JY2O 4PW9B 1VQKP 1HJ5A 1CSBA 1DVVA 4AUWA 1SQBK 1SFCD 2WPSA 1KD1Q 2Y0CA 2BCCD 4PJ0V 4WB4A 2Q7CA 1TU3F 3MIWA 1JNMA 1G1IA 3H1JD 2R5DA 3H1HE 2DW3A 3CWBE 5AW1B 1CW5A 1XTGB 2AEMA 3WUVA 1DEEG 1L0NE 1NMLA 2EXVA 5B66V 2C9XB 3AE5C 1C6SA 3DR0A 3ZBMA 1GKSA 1I6DA 1NU1J 3EQ2A 3GW6A 3O8ZA 1SQXG 3C2CA 1LTAC 4EI2A 3TSIA 3CCSP 3PXWA 5APSA 1WVEC 1JO5A 1LGHB 2O3JA 3H1LD 5TJHA 1H33A 3O20A 1RZ6A 4ZKPA 5AW0B 1SQVE 1R0QA 4OWFA 2QM7A 1YEBA 3O6QB 4U3FJ 1N7LA 1VQ4P 4JYBA 4Z1MH 1SQXK 4A7PA 1HJ4A 1S5LV 2OTKE 3B8EB 5GTIH 1PP9E 1LWUB 1VQ8P 4UB8E 2AI5A 2FFDB 2VHDA 4H0LB 3LIDA 5CCGD 3L36A 1KN7A 4EIJA 3H6PA 2YMKA 1PP9G 2XTSB 3ZDMA 3Q5PA 4PV1B 3CCRP 2BEZF 3OJAB 2B11B 3SVWA 5GTHH 3B5NA 1P84H 1Q90D 3AE8C 2RMZA 2C2CA 3AE2C 1YTCA 1L9JC 4IL6V 4EICA 1FC2C 3L73G 1RAPA 3E7KA 1U74B 1BCCJ 3LW5H 3G6EP 3PP5A 1OWAA 2KIKA 3H1KD 5CCHA 3RK2D 3VMXA 5KTBA 1I55A 2FYUD 4H0JA 3CI9A 3MD0A 2OTJP 2A45H 4IFDK 3G71P 3DMIA 2FXPA 2W6AA 4DZOA 3LW5J 1X79B 3KZIH 5AW3B 3TYIA 1HBWA 3GMAA 1SQQE 4WY4C 4Y99C 3HTKA 4K3IA 1W2LA 1H33B 2RKLA 3RLMA 4D6TE 1HRCA 2N3BA 2JTIB 1JEKA 1J1DB 1NTKE 1SQQG 1U75B 3WU2E 2WT7B 3CCLP 3I55P 1KZUB 4I1LA 1VF5C 5KAIH 4D6TG 2CA3B 1I8OA 1LTJC 5E79V 1N73C 4HYTB 1GMJA 1J1EC 1RQVA 3KHUA 1FBMA 1X9VA 2WSCH 1SFCA 3M97X 1YJ9P 2N3YA 2GB8B 2NPSC 3CMEP 1SQQK 3V4QA 1S4XA 2BCCJ 3B5NB 2AXTE 1N7SB 2E74D 3TYYA 3U1AA 1YJNP 3BCCJ 2I1JA 1CRYA 4AALA 1JY2N 3WUTA 3L75J 1H31A 1URQC 4YTPC 3RGUA 1NVOA 4EYYQ 3L74G 2CE0A 4K3AA 4BXLA 1CI6A 3H32A 2YO3A 2OZ1A 3B4SA 3RK3C 2WSEH 3MUDC 1CXAA 4HJGH 1KYOI 4U7JA 3JBTB 2MJZA 1AOQA 1DD3A 2LKMA 1NKNA 2A06G 3CXHI 2OYHC 3E1RA 3RMZA 2R5BA 3HTKB 1GQ1A 2WSEJ 1IRVA 1ZRTE 4DOJA 2JEEA 1BSHA 1QYZA 3D0WA 5CIDB 2W6JH 2D0SA 2JKVA 5C39A 1KB9I 1KQSO 1IFDA 1H0TA 4Y28J 3IN6A 3TNUA 2P7JA 1KYOD 3VYMA 5KKZB 2ZONG 5APWA 2B10B 1AQTA 3HUSA 3CXHD 5KAFV 5APXA 4ASVA 5KLVE 1SFCB 3AEDC 1FI9A 2KZJA 3KDPB 1RAQA 5C9MA 2D2CC 2Y9YA 1M6ZA 1AOFA 1KB9D 1NTZG 3WUIA 1H32B 2IBZG 2H8PD 1K3HA 1FI7A 3H1KJ 3L70G 5AVYB 2FYNC 2QG4A 1LTTC 1GK6A 1H31B 2HODA 2FYUJ 1USDA 2W6BA 3HE5A 1M1JB 3VRDA 4H0LD 4QMAA 1SLQA 1HF9A 1CI6B 1CCHA 3SWKA 1MFTA 2OZ1B 3AECC 4GIFA 1J3SA 3WFEC 1A8CA 1CSXA 1NTZK 3L72J 2YO2A 3CC7P 1OMIA 2P67A 2ZT9C 5AW4B 1K9MQ 3IFMA 2N1TC 3GF7A 1GU4A 1MZ4A 2V7QH 3F5HA 2PGDA 4AAMA 3H1JE 1OIPA 5APTA 1AV1A 3Q3DA 2BCNB 4JBZA 4KT0J 1BE3J 3L71E 1GL2C 1S2EA 4JPZB 2YKPA 1PGPA 3KZIV 3A0HH 5DJTB 1NU1D 2V07A 3M9BA 1YQ4C 2Z4EA 1PPJG 1H0TB 1S5LH 1KILE 3TNUB 3NFQA 3L71G 3CCJP 2QJKC 1QX8A 5KLIB 3HUSB 5C0ZA 1MFZA 3N4XA 4RSZA 1EZVG 3QH9A 4OGQC 5AVRB 2E43A 3PTZA 3D70A 3I56P 3SFDC 3H1LE 1BDCA 3O5CA 2BH5X 2ITAA 3GLMA 1HZVA 3P32A 1EXJA 4U3FD 3VTPC 1FCDC 1IRWA 2W83C 2C1UA 2N9YB 1LS9A 1FHBA 5KJ7C 2G8YA 2QSIA 2QJYC 1HCMA 1S9KD 1S72P 2E75C 1IQCA 3L74D 3GHGC 1M7LA 1JDLA 2W8ZA 1SQXJ 3AE7C 1ZR2A 1YIQA 1P84I 4WQ8A 3CCEP 3H1ID 3PLNA 3AEFC 1EXIA 3NBSA 1CSUA 4NFGB 1M90Q 4O1WA 5AVWB 2YCCA 4H44C 1KYOW 4YE1A 1OX3A 4WQDA 3B5ND 1N7SD 3RBXA 1A2SA 1BCCD 4R4MA 3G3ZA 1YI2P 4UB8H 2ZVOB 3LIEA 1L0LG 2A45I 1M57D 4LLHA 1E29A 3G9RA 3A0BE 5AW9B 1Q82Q 2BH4X 1P84D 3MZWB 1C6OA 5CCHD 3WC8A 3A3YB 2RH0A 1HJ3A 3MP7B 3ZCFA 1HH7A 1JMBA 1FOSF 2C9LY 1AQ5A 1A02F 1KMIZ 1RF0C 4WQ9A 1J2JB 3CMAP 4DCKA 4PJ0E 4CPGA 2K37A 4FANA 1JCCA 1VQNP 2E5YA 4IOIH
chains in the Genus database with same CATH topology
1YICA 3O1YA 2XTSB 1K3GA 4D6TD 1RZ5A 3ZOWA 5AURA 3ZOYA 2B11B 2DVHA 3SVWA 3SWSA 4XYDB 2RMZA 1I5TA 2C2CA 2FRCA 3L70D 1DVHA 1YTCA 2BGVX 1CYCA 1L9JC 1M60A 4IL6V 2B12B 1CRGA 4GEDB 4EICA 3CP5A 3O0RC 3SJLA 1RAPA 3VMAA 2QJPB 3PHLA 1U74B 1CRJA 2CXBA 2BPBB 2LIRA 1A56A 3H1KD 1SQVD 3RN1A 1I55A 2FYUD 4H0JA 2L4DA 3SLEA 3ORVA 3L4MA 3DMIA 1CRCA 1CO6A 2PACA 1GIWA 1FOCA 1WEJF 1GJQA 3BCCD 3TYIA 1BGYD 3TGUD 5CIGB 3L75D 3TF5A 4K3IA 5DFSA 1W2LA 1DW3A 2KS1A 3HQ8A 1H33B 5IY51 4KMGA 3RLMA 1HRCA 2N3BA 2JTIB 1CIFA 4EIDA 1U75B 1I6EA 3FWLA 1PPJD 1N9CA 2B0ZB 3L4OA 2A06D 4L3HA 1N50A 1CHIA 5CYTR 1N15A 1OAEA 5GTIV 2CA3B 1I8OA 5E79V 1L9BC 5TISV 1QN2A 4AANA 1CC5A 3KHUA 1CSVA 351CA 2ZBOA 3GG2A 4MU8A 1ZRTD 1C7MA 1DW2A 3M97X 3A0HV 2N3YA 3OA8A 2GB8B 1C75A 1LC2A 4WQEA 3PH2B 5GTHV 1C2RA 5CIEB 3TDKA 1FI3A 4LJIA 4PWAA 4J20A 1I8PA 1H1OA 1I54A 2KNCB 1CRYA 4AALA 2Y0DA 2GC4D 1VYDA 1H31A 1CHJA 1LMSA 1DIIC 1NTKD 2MTAC 1NTZD 2CE0A 4QAOA 3MK7C 1HZUA 1DW0A 2IBZD 4AAOA 1CNOA 2OZ1A 2K9JB 4L3GA 1CORA 2LITA 1CIEA 1F1FA 2HV4A 1CXAA 155CA 4FA4A 2C1DA 2PCCB 3JBTB 1AOQA 2CA4B 3CX5W 3CYTI 3X39A 1GU2A 5CIHB 4N0KA 1MG3D 1N90A 2MHMA 451CA 3RMZA 4EIEA 1E8EA 4EDFA 2BLFB 1GQ1A 3NWVA 1IRVA 1YFCA 1KB0A 3A0BV 2DGEA 4JCGA 2JQRA 1QYZA 3HQ7A 5CIDB 2D0SA 1CTZA 1YNRA 1W5CT 1FJ0A 3L72D 1ZZHA 5KAIV 1MG2D 4V2KA 1KYOD 1CYJA 2D0WA 3VYMA 2Q3EA 5KKZB 2ZONG 1GDVA 1NIRA 4UB8V 1C52A 1CXCA 2B10B 4P4QB 5EXQA 3CXHD 2FYNB 3PXTA 1CRIA 5CIFB 5KAFV 1SQBD 1HROA 3PXSA 1FI9A 1CRHA 3HQ9A 1BE3D 3L71D 3OA8B 1RAQA 4DY9A 4Q5PA 5C9MA 1M6ZA 1AOFA 1KX7A 1KB9D 4AX3A 3SXTA 4WQAA 2GC7D 1EZVD 3WUIA 3ZOOA 5CICB 1H32B 2N9JA 1K3HA 1FI7A 1C2NA 2N9IA 3ZIYA 1CYIA 2QG4A 3NBTA 1H31B 3CXHW 2YIUB 2AIUA 1KIBA 3A9FA 3VRDA 1NNOA 4FA5A 3MK7B 4WQBA 3RN0A 3WFBC 1CCHA 2OZ1B 1CHHA 2ZXYA 1J3SA 1CSWA 1H32A 5B6QA 1EB7A 3OCDB 3WFEC 1YEAA 1A8CA 1CSXA 2GIWA 4XXLA 1B7VA 1AYGA 2Y0EA 2C1DB 5DF5A 4O1QA 1CCRA 2YQBA 3H1HD 4FA9A 1MZ4A 5KLVD 2QJKB 1CTYA 2C8SA 1S6VB 5B5EV 1DW1A 4AAMA 1L0ND 3ZOXA 1SQXD 1C6RA 1CIHA 4GYDA 2BCNB 3HQ6A 3OCDA 2B4ZA 2JWAA 3WU2V 2C1VA 2N18B 3KZIV 1NU1D 5CIBB 2V07A 3PRJA 1QKSA 5DJQC 3ITKA 1L0LD 4L1QA 2ORLA 1LFMA 1COTA 2FWLA 5KLIB 4RJTA 1KX2A 2QJYB 5C0ZA 4EIFA 4RSZA 4WQ7A 2CE1A 1CEDA 4WQCA 3PTZA 2RN0A 1CIGA 2N18C 1DT1A 2BH5X 1IO3A 1CTJA 3O5CA 3WFCC 1HZVA 4U3FD 4PW9B 1BL9A 3CU4A 4PD4D 1HJ5A 1FCDC 1DVVA 2AXTV 5H2FV 2ZZS1 1IRWA 2Y0CA 2BCCD 2C1UA 1LS9A 4PJ0V 2N9YB 1AKKA 1FHBA 1PP9D 1OCDA 1HCMA 3H1JD 1IQCA 3L74D 4UB6V 1JDLA 2ZOOA 1NMLA 1QL4A 1YIQA 2EXVA 2I8FA 5B66V 4WQ8A 1QL3A 2C9XB 3H1ID 2L91A 3PLNA 1H9YA 3NBSA 3L73D 1C6SA 1SQPD 3DR0A 1CSUA 3ZBMA 4NFGB 1GKSA 1I6DA 4O1WA 2YCCA 1KYOW 3GW6A 3C2CA 1IZL0 4YE1A 4WQDA 2YK3A 3PXWA 1KV9A 1ETPA 1WVEC 1A2SA 1BCCD 2O3JA 3H1LD 5TJHA 1YCCA 1E29A 4FB1A 1H33A 3O20A 1RZ6A 2BH4X 1M70A 1P84D 1R0QA 1LC1A 2PCBB 3WFDC 1C6OA 1YEBA 4FAVA 3WC8A 1HJ3A 1H9XA 1DIQC 3DP5A 4H0KA 5DJQB 3ZCFA 1HH7A 4A7PA 1NTMD 1F1CA 1HJ4A 1S5LV 3CWBD 1E2RA 4WQ9A 2AI5A 2VHDA 4Y5RA 1SQQD 3VNWA 4FANA 4FA1A 2V08A 1NMIA 3CX5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIC A;  3O1Y A;  2XTS B;  1K3G A;  4D6T D;  1RZ5 A;  3ZOW A;  5AUR A;  3ZOY A;  2B11 B;  2DVH A;  3SVW A;  3SWS A;  4XYD B;  2RMZ A;  1I5T A;  2C2C A;  2FRC A;  3L70 D;  1DVH A;  1YTC A;  2BGV X;  1CYC A;  1L9J C;  1M60 A;  4IL6 V;  2B12 B;  1CRG A;  4GED B;  4EIC A;  3CP5 A;  3O0R C;  3SJL A;  1RAP A;  3VMA A;  2QJP B;  3PHL A;  1U74 B;  1CRJ A;  2CXB A;  2BPB B;  2LIR A;  1A56 A;  3H1K D;  1SQV D;  3RN1 A;  1I55 A;  2FYU D;  4H0J A;  2L4D A;  3SLE A;  3ORV A;  3L4M A;  3DMI A;  1CRC A;  1CO6 A;  2PAC A;  1GIW A;  1FOC A;  1WEJ F;  1GJQ A;  3BCC D;  3TYI A;  1BGY D;  3TGU D;  5CIG B;  3L75 D;  3TF5 A;  4K3I A;  5DFS A;  1W2L A;  1DW3 A;  2KS1 A;  3HQ8 A;  1H33 B;  5IY5 1;  4KMG A;  3RLM A;  1HRC A;  2N3B A;  2JTI B;  1CIF A;  4EID A;  1U75 B;  1I6E A;  3FWL A;  1PPJ D;  1N9C A;  2B0Z B;  3L4O A;  2A06 D;  4L3H A;  1N50 A;  1CHI A;  5CYT R;  1N15 A;  1OAE A;  5GTI V;  2CA3 B;  1I8O A;  5E79 V;  1L9B C;  5TIS V;  1QN2 A;  4AAN A;  1CC5 A;  3KHU A;  1CSV A;  351C A;  2ZBO A;  3GG2 A;  4MU8 A;  1ZRT D;  1C7M A;  1DW2 A;  3M97 X;  3A0H V;  2N3Y A;  3OA8 A;  2GB8 B;  1C75 A;  1LC2 A;  4WQE A;  3PH2 B;  5GTH V;  1C2R A;  5CIE B;  3TDK A;  1FI3 A;  4LJI A;  4PWA A;  4J20 A;  1I8P A;  1H1O A;  1I54 A;  2KNC B;  1CRY A;  4AAL A;  2Y0D A;  2GC4 D;  1VYD A;  1H31 A;  1CHJ A;  1LMS A;  1DII C;  1NTK D;  2MTA C;  1NTZ D;  2CE0 A;  4QAO A;  3MK7 C;  1HZU A;  1DW0 A;  2IBZ D;  4AAO A;  1CNO A;  2OZ1 A;  2K9J B;  4L3G A;  1COR A;  2LIT A;  1CIE A;  1F1F A;  2HV4 A;  1CXA A;  155C A;  4FA4 A;  2C1D A;  2PCC B;  3JBT B;  1AOQ A;  2CA4 B;  3CX5 W;  3CYT I;  3X39 A;  1GU2 A;  5CIH B;  4N0K A;  1MG3 D;  1N90 A;  2MHM A;  451C A;  3RMZ A;  4EIE A;  1E8E A;  4EDF A;  2BLF B;  1GQ1 A;  3NWV A;  1IRV A;  1YFC A;  1KB0 A;  3A0B V;  2DGE A;  4JCG A;  2JQR A;  1QYZ A;  3HQ7 A;  5CID B;  2D0S A;  1CTZ A;  1YNR A;  1W5C T;  1FJ0 A;  3L72 D;  1ZZH A;  5KAI V;  1MG2 D;  4V2K A;  1KYO D;  1CYJ A;  2D0W A;  3VYM A;  2Q3E A;  5KKZ B;  2ZON G;  1GDV A;  1NIR A;  4UB8 V;  1C52 A;  1CXC A;  2B10 B;  4P4Q B;  5EXQ A;  3CXH D;  2FYN B;  3PXT A;  1CRI A;  5CIF B;  5KAF V;  1SQB D;  1HRO A;  3PXS A;  1FI9 A;  1CRH A;  3HQ9 A;  1BE3 D;  3L71 D;  3OA8 B;  1RAQ A;  4DY9 A;  4Q5P A;  5C9M A;  1M6Z A;  1AOF A;  1KX7 A;  1KB9 D;  4AX3 A;  3SXT A;  4WQA A;  2GC7 D;  1EZV D;  3WUI A;  3ZOO A;  5CIC B;  1H32 B;  2N9J A;  1K3H A;  1FI7 A;  1C2N A;  2N9I A;  3ZIY A;  1CYI A;  2QG4 A;  3NBT A;  1H31 B;  3CXH W;  2YIU B;  2AIU A;  1KIB A;  3A9F A;  3VRD A;  1NNO A;  4FA5 A;  3MK7 B;  4WQB A;  3RN0 A;  3WFB C;  1CCH A;  2OZ1 B;  1CHH A;  2ZXY A;  1J3S A;  1CSW A;  1H32 A;  5B6Q A;  1EB7 A;  3OCD B;  3WFE C;  1YEA A;  1A8C A;  1CSX A;  2GIW A;  4XXL A;  1B7V A;  1AYG A;  2Y0E A;  2C1D B;  5DF5 A;  4O1Q A;  1CCR A;  2YQB A;  3H1H D;  4FA9 A;  1MZ4 A;  5KLV D;  2QJK B;  1CTY A;  2C8S A;  1S6V B;  5B5E V;  1DW1 A;  4AAM A;  1L0N D;  3ZOX A;  1SQX D;  1C6R A;  1CIH A;  4GYD A;  2BCN B;  3HQ6 A;  3OCD A;  2B4Z A;  2JWA A;  3WU2 V;  2C1V A;  2N18 B;  3KZI V;  1NU1 D;  5CIB B;  2V07 A;  3PRJ A;  1QKS A;  5DJQ C;  3ITK A;  1L0L D;  4L1Q A;  2ORL A;  1LFM A;  1COT A;  2FWL A;  5KLI B;  4RJT A;  1KX2 A;  2QJY B;  5C0Z A;  4EIF A;  4RSZ A;  4WQ7 A;  2CE1 A;  1CED A;  4WQC A;  3PTZ A;  2RN0 A;  1CIG A;  2N18 C;  1DT1 A;  2BH5 X;  1IO3 A;  1CTJ A;  3O5C A;  3WFC C;  1HZV A;  4U3F D;  4PW9 B;  1BL9 A;  3CU4 A;  4PD4 D;  1HJ5 A;  1FCD C;  1DVV A;  2AXT V;  5H2F V;  2ZZS 1;  1IRW A;  2Y0C A;  2BCC D;  2C1U A;  1LS9 A;  4PJ0 V;  2N9Y B;  1AKK A;  1FHB A;  1PP9 D;  1OCD A;  1HCM A;  3H1J D;  1IQC A;  3L74 D;  4UB6 V;  1JDL A;  2ZOO A;  1NML A;  1QL4 A;  1YIQ A;  2EXV A;  2I8F A;  5B66 V;  4WQ8 A;  1QL3 A;  2C9X B;  3H1I D;  2L91 A;  3PLN A;  1H9Y A;  3NBS A;  3L73 D;  1C6S A;  1SQP D;  3DR0 A;  1CSU A;  3ZBM A;  4NFG B;  1GKS A;  1I6D A;  4O1W A;  2YCC A;  1KYO W;  3GW6 A;  3C2C A;  1IZL 0;  4YE1 A;  4WQD A;  2YK3 A;  3PXW A;  1KV9 A;  1ETP A;  1WVE C;  1A2S A;  1BCC D;  2O3J A;  3H1L D;  5TJH A;  1YCC A;  1E29 A;  4FB1 A;  1H33 A;  3O20 A;  1RZ6 A;  2BH4 X;  1M70 A;  1P84 D;  1R0Q A;  1LC1 A;  2PCB B;  3WFD C;  1C6O A;  1YEB A;  4FAV A;  3WC8 A;  1HJ3 A;  1H9X A;  1DIQ C;  3DP5 A;  4H0K A;  5DJQ B;  3ZCF A;  1HH7 A;  4A7P A;  1NTM D;  1F1C A;  1HJ4 A;  1S5L V;  3CWB D;  1E2R A;  4WQ9 A;  2AI5 A;  2VHD A;  4Y5R A;  1SQQ D;  3VNW A;  4FAN A;  4FA1 A;  2V08 A;  1NMI A;  3CX5 D; 
#chains in the Genus database with same CATH topology
 1L0L K;  1GTW A;  3EWK A;  1KIL C;  1RZ5 A;  3AEA C;  2M8R A;  3L73 J;  1LTI C;  5B66 E;  1SQP E;  2L5G B;  2J59 M;  2DVH A;  2WWW A;  1A02 J;  1FZF A;  3L70 D;  1ZW0 A;  2FFD A;  1CYC A;  4GED B;  2IZ1 A;  4KHX A;  3CCV P;  2WSF H;  3SJL A;  1SQP G;  3VMA A;  1QVF O;  2QJP B;  4MN4 C;  4LC1 A;  1CRJ A;  1JB0 J;  2BPB B;  2LIR A;  1EDI A;  1IFN A;  1A56 A;  2YNY A;  4RES B;  3PH0 A;  5B5E H;  2L4D A;  3AE4 C;  3SLE A;  2KSE A;  3ORV A;  2WSF J;  3L4M A;  2JDI H;  1CO6 A;  1NTM E;  1QLE D;  2Z5I A;  1FJK A;  3BCC D;  3CL3 D;  1BGY D;  1VF5 B;  2C0W A;  1SQP K;  3TGU D;  1FJP A;  5CIG B;  5BU8 B;  1LTJ B;  4H13 C;  3L75 D;  1CZQ A;  3VMY A;  1HH0 A;  2WQY C;  3BRV B;  1NTM G;  3H1H G;  1J1E B;  3CX5 E;  3CWB G;  1GW3 A;  3HQ8 A;  5IY5 1;  1UIX A;  2FYZ A;  2M5A A;  2K1A A;  1L0N G;  3HD7 C;  1PPJ D;  3MTU E;  2NPS B;  2QM8 A;  2B0Z B;  5CHX A;  2AXT H;  1ZOY C;  1MZ9 A;  3S9O A;  4IL6 E;  1RE3 A;  1G1J A;  3P8C D;  3A7O A;  2M0B A;  351C A;  5KAF H;  1NTM K;  3GG2 A;  3B71 A;  2R44 A;  4UB6 H;  1DW2 A;  3M9Q A;  2WT7 A;  2W27 A;  3AEG C;  4WWI A;  3A0H V;  1M56 D;  2BAS A;  1L4A D;  1L0N K;  4IL6 X;  1SQV G;  1Q7Y Q;  3RK3 B;  5H2F E;  4B86 A;  2HPC A;  1VQM P;  1IC2 A;  1MKM A;  3L74 J;  5APY A;  1DH3 A;  1NKZ B;  1LP1 A;  1H1O A;  1I54 A;  2Y0D A;  2GC4 D;  1VYD A;  1CHJ A;  4GOE A;  3H1I J;  1IFI A;  1LMS A;  3NMD A;  2OYH B;  1AFO A;  1AVY A;  3CXH E;  3MK7 C;  1HZU A;  5AVT B;  4L74 A;  1N7S A;  4AAO A;  1RE4 C;  2K9J B;  3BRT B;  3OW2 O;  3CD6 P;  4C7R A;  1SQV K;  2KLV A;  3HRN A;  3M0D C;  3S1K A;  1RF1 C;  1KB9 E;  2JP3 A;  2OYI A;  4NPE A;  1LT9 C;  2CA4 B;  3CYT I;  1GU2 A;  1NGM B;  3W67 A;  4N0K A;  1MG3 D;  3L4F A;  5BVZ A;  5E79 E;  2YXR B;  5APQ A;  1E8E A;  2K9Y A;  2HLO A;  2BLF B;  1KV4 A;  1IJD B;  2M5A B;  1JCD A;  1EDK A;  4W80 A;  1KQF B;  2P2U A;  1JOC A;  2D2C B;  1FJ0 A;  3L72 D;  1MG2 D;  2E76 C;  4V2K A;  2D0W A;  1W5C E;  2Q9I A;  1USE A;  4UB8 V;  1C52 A;  1VPC A;  4P4Q B;  2R3S A;  2FYN B;  2IFM A;  1QGK B;  1SQB D;  1NTZ J;  2NRG A;  3HQ9 A;  1BE3 D;  1FZC A;  4TLF A;  3L70 J;  2CPS A;  4IFM A;  1OW6 A;  1KX7 A;  1DD4 A;  4O9B A;  1HUC A;  1NTK G;  2WPR A;  2HPC B;  1ZN5 A;  1NU1 E;  2GUV A;  1LP1 B;  2N9I A;  3MGN A;  3ZIY A;  1CYI A;  2ZAE B;  2ZT9 B;  1PV3 A;  2H7H A;  1KIB A;  3A9F A;  1NNO A;  3FGA D;  4FA5 A;  1NHL A;  4YXW H;  3RN0 A;  3WFB C;  1HJB A;  5AW7 B;  3RL0 C;  2GUS A;  2ZXY A;  2IZ0 A;  3AE1 C;  1K05 A;  1CSW A;  1H32 A;  1JY3 O;  1BGY J;  1GU5 A;  3OCD B;  4W7Y A;  2SPZ A;  1YEA A;  1NTK K;  2GIW A;  2WSC J;  2FBW C;  3TGU J;  1IZN B;  3JCU H;  4U3F E;  2OYI B;  4O1Q A;  2XND H;  2YMY A;  1R8E A;  3H1H D;  2YQB A;  1M1J A;  1IFP A;  2YIU C;  5K5G B;  2QJK B;  2C8S A;  3EFF K;  1LTG C;  1S9K E;  5B5E V;  1DW1 A;  1L0N D;  3ZOX A;  1SQX D;  3L37 A;  1C6R A;  1CIH A;  4OGQ B;  1PGO A;  2PP6 A;  4WY4 D;  2CPB A;  3RBZ A;  1MV8 A;  3WU2 V;  2C1V A;  5AVZ B;  1VQO P;  3PRJ A;  1QKS A;  1YTZ T;  3IF4 A;  1HWT C;  5GTI E;  1Y8A A;  1LWU C;  5TIS E;  4RJT A;  1L4A A;  4C7N B;  2QJY B;  1PZQ A;  2I8D A;  3V2P A;  5AW5 B;  2IFN A;  1VF5 D;  1YHQ P;  2WPV B;  4WQ7 A;  1BCC E;  2OYO A;  3HE4 A;  2RN0 A;  1CIG A;  2XDJ A;  3WFC C;  1PL5 A;  1FZC B;  4PV1 C;  3Q1M A;  1X8Y A;  5GTH E;  3CU4 A;  1SVF A;  1OXZ A;  2AXT V;  4L73 A;  2OGU A;  4H44 B;  1KQL A;  3VN0 A;  4JF7 A;  3C9I A;  1PP9 D;  2NPS D;  1OVU A;  2B89 A;  4UB6 V;  1T2K C;  2XNX A;  2QA4 P;  1JY3 P;  3IR9 A;  4GOF A;  3CCU P;  3T97 B;  1QL3 A;  2KSJ A;  1H9Y A;  5AW8 B;  5KLV G;  1VQL P;  3L73 D;  1URQ D;  3A0B H;  3AE3 C;  4PD4 H;  1ETP A;  3RK3 D;  1KFM A;  2QE7 H;  3M0A A;  2OAR A;  4RKU J;  1YCC A;  1FDM A;  3C8V A;  3WMM 0;  1NJI Q;  3WFD C;  4FAV A;  1H8A A;  1D7M A;  5KLV K;  1FZA A;  4H0K A;  4ZKU A;  5DJQ B;  1SS1 A;  5KAI E;  1F1C A;  2BCC E;  1E2R A;  1HJ0 A;  5CJ4 A;  3FWN A;  4YXD C;  1SQB J;  3VNW A;  1SQQ D;  1FS0 E;  1L4A B;  3BCC E;  4WVZ A;  4FA1 A;  2V08 A;  1S1C X;  1ZR4 A;  2BCC G;  2NZ2 A;  2AEJ A;  3HE4 B;  3L75 E;  4N78 D;  2ZFC A;  4D6T D;  3H1J G;  2OQQ A;  3D6Z A;  1AA0 A;  3SWS A;  2V7Q J;  3A5T A;  1I5T A;  2FKW B;  4GT1 A;  4AYC A;  2D2C D;  2KNC A;  2CXB A;  1OVR A;  1N86 A;  4BWN A;  3RN1 A;  5AVS B;  3F89 A;  3SWF A;  3CX5 H;  1FE6 A;  2KS1 B;  5L8R J;  1X0T A;  3H1L G;  1GK4 A;  3HD7 B;  1WEJ F;  1FOC A;  3H1H J;  3CWB J;  1GJQ A;  1PGJ A;  1HTL C;  1SP4 A;  4WY4 A;  1E5W A;  1L0N J;  1HGZ A;  1JY3 N;  3UIA A;  4HKZ H;  3TF5 A;  2IPP A;  5DFS A;  1DW3 A;  3N7N A;  3A2A A;  4RO0 A;  2ZT9 D;  4KMG A;  2N1T D;  1WRG A;  3U59 A;  1I6E A;  1S3J A;  3FWL A;  3VYI A;  2FXO A;  3JSV C;  4BRY B;  2A06 D;  1N50 A;  1CHI A;  1VQ7 P;  5CYT R;  1N15 A;  1NH4 A;  1LTJ A;  1GL2 D;  3W68 A;  2H43 A;  5H2F H;  2AXC A;  1N73 A;  2G3A A;  1L9B C;  3D71 A;  1QN2 A;  4AAN A;  1SQV J;  3H1K E;  1YBK A;  2ZBO A;  1ZLL A;  2QIW A;  2WPQ A;  2QEX P;  1ZRT D;  3SSU A;  1C7M A;  1SFC C;  3V2N A;  2FYU E;  2IBZ I;  2N9B A;  2NPS A;  4LGD E;  1C75 A;  3NTN A;  3C1L A;  4WQE A;  3H1K G;  4OGQ D;  3SWY A;  3PH2 B;  1PP9 J;  1C2R A;  2HFE D;  4I7Z C;  4DT0 A;  1FI3 A;  1FZB A;  2LR2 A;  2ZYG A;  2J58 A;  3CC4 P;  1I8P A;  1RF1 B;  2FXM A;  1FZE A;  3L72 E;  2KNC B;  3CCQ P;  1URQ A;  1LT9 B;  3FXE A;  4OH8 B;  2WIT A;  2Z5H A;  3V5B A;  1JTH A;  5KJ7 D;  2MTA C;  2O1K A;  4HH2 A;  1NTZ D;  4XE5 B;  4QAO A;  2E75 D;  2IBZ D;  1QL1 A;  1CNO A;  1NWQ A;  3MUD A;  3BVH A;  1COR A;  3Q5S A;  2LIT A;  1OW8 A;  1BE3 E;  5CBN A;  2O1J A;  2HV4 A;  2PCC B;  3CPW O;  2B9B A;  5M1B A;  4WY4 B;  4H44 D;  2OYH A;  4Y99 B;  451C A;  4EIE A;  1IO4 A;  2PFX A;  1YFC A;  2K9J A;  5CJ0 A;  3A0B V;  1VQP P;  2DGE A;  2P1J A;  3PJS K;  3HQ7 A;  3U1C A;  1W2E A;  3WU2 H;  1K8A Q;  1R5L A;  2UWJ E;  2FY8 A;  3A0H E;  3E1I A;  1EZV I;  2JO1 A;  1S5L E;  5CCG C;  1VQ9 P;  1SQQ J;  1UII A;  1KQG B;  1NYH A;  2Q5U A;  1T8Z A;  2XZR A;  2Q3E A;  1FZG A;  1N73 B;  1KOR A;  5KLI C;  2ZXE B;  3HUS C;  5EXQ A;  4D6T J;  3PXT A;  1CRI A;  3R2P A;  2KI7 B;  4EOT A;  1NTK J;  1HRO A;  2ZVN B;  1S5L X;  2B88 A;  1L2P A;  2LXB A;  2HR3 A;  3L71 D;  2Q1K A;  2P58 A;  1SQX E;  2B87 B;  3RL0 B;  4AX3 A;  1DEB A;  3SXT A;  4WQA A;  3P8M C;  2GC7 D;  1EZV D;  3ZOO A;  5CIC B;  1KIL D;  1H88 A;  4NPD A;  3RK2 C;  1C2N A;  2KZI A;  1H89 A;  1RH5 B;  1URQ B;  4N6J A;  1LNQ A;  2YIU B;  2AIU A;  1JTH B;  3AE6 C;  4C46 A;  1OVV A;  4WQB A;  4ZNC A;  2KYV A;  3KXD A;  4JQ0 D;  5B6Q A;  2C9N Y;  1EB7 A;  2YKQ A;  1HVV A;  1B7V A;  2Y0E A;  3EFG A;  4OVN F;  1KYO E;  2YXQ B;  1OFC X;  2N1T A;  1CCR A;  2BEQ D;  4FA9 A;  1CTY A;  5EFW B;  1EDL A;  1XTC C;  1Y9B A;  5TIS H;  4GYD A;  1GL2 A;  3HQ6 A;  1JY2 P;  1U7M A;  3OCD A;  4H13 D;  2B4Z A;  2WVR A;  1R5S A;  2Q6Q A;  4PD4 I;  5CIB B;  3CC2 P;  1JM0 A;  3L73 E;  2H88 C;  3ITK A;  1L0L D;  4L1Q A;  1FOS E;  1WMK A;  5AVV B;  3HD7 D;  2CK3 H;  3NXS A;  3KYQ A;  2FWL A;  1K04 A;  3AEB C;  1KX2 A;  1U57 A;  2MKV A;  4EIF A;  3RK3 E;  2E74 C;  4WQC A;  1DX7 A;  1QVG O;  2N18 C;  1IO3 A;  1CTJ A;  1YQ3 C;  4W7Z A;  4L75 A;  4DJG A;  2O01 N;  1BL9 A;  4PD4 D;  5H2F V;  2ZZS 1;  1WT6 A;  1YTZ I;  5KJ7 A;  4C7N A;  1AKK A;  5AVX B;  1OCD A;  2K3R A;  3GHG A;  1IFJ A;  5KLV J;  2QJP C;  2ZOO A;  3GF3 A;  1BDD A;  2KB7 P;  1QL4 A;  2I8F A;  4I6M C;  5B5E E;  2L91 A;  3II6 A;  1SQP D;  4N78 E;  2IYO A;  4I2L C;  2IX7 C;  1IZL 0;  2M3B A;  2YK3 A;  2KP8 A;  1KV9 A;  2N1T B;  1YIJ P;  4GDO A;  1NU1 G;  3T97 A;  5DJU B;  3CX5 I;  4FB1 A;  1GL2 B;  1M70 A;  1LC1 A;  2PCB B;  1N8R Q;  2ZJS E;  1NAF A;  3RL0 g;  1H9X A;  1DIQ C;  3DP5 A;  2JJL A;  1LT1 A;  2WSS H;  1NTM D;  5APV A;  1RF0 A;  3CWB D;  3BAS A;  1BSN A;  4M3L A;  3H1J J;  1QL2 A;  4U3F G;  4Y5R A;  3L74 E;  3V4W A;  1T6A A;  1NU1 K;  5KAF E;  5CBO A;  1NMI A;  3L71 J;  2E76 D;  3CX5 D;  1YIC A;  3O1Y A;  4UB6 E;  1KIL A;  3V2Q A;  2KXP B;  3SFE C;  1K3G A;  3L35 A;  3H1I E;  4N3Y B;  3ZOW A;  5AUR A;  3ZOY A;  1YYC A;  4XYD B;  3KPE A;  2GM4 A;  1GW4 A;  2FRC A;  1DVH A;  2OTL P;  2BGV X;  1M60 A;  2B12 B;  2PAJ A;  1CRG A;  2XKM A;  3H1I G;  2FFD C;  3VOP A;  4H0L C;  2A06 E;  3CP5 A;  3O0R C;  1YJW P;  2E75 B;  3ABV C;  3GHG B;  3PHL A;  3USS A;  3H1L J;  1SQV D;  2KUB A;  1FDO A;  4XA4 A;  3WUU A;  4ASW A;  4WBA A;  1P84 E;  2IYP A;  1BCC G;  1IFM A;  4NPF X;  3V6I A;  2XU6 A;  1QEX A;  1CRC A;  1LTS C;  2PAC A;  4HB1 A;  1GIW A;  1FU1 A;  3RL0 D;  3VP8 A;  1OZH A;  5CCG A;  1DIP A;  1NOH A;  1EQ7 A;  3I5C A;  1FDI A;  1ZXG A;  4JYC A;  1VQ6 P;  2KS1 A;  2Q3I A;  1G2C A;  2POH A;  1CIF A;  3HD7 A;  3Q2Y A;  4EID A;  1NTZ E;  1MUU A;  4XFJ A;  1L0L J;  1ZP0 C;  1ZV8 A;  1N9C A;  2R3C A;  3KZI E;  4ZMD A;  2ZYD A;  3FXD A;  2IBZ E;  3L4O A;  4L3H A;  2A45 G;  2KK7 A;  4IFF A;  3L70 E;  1OAE A;  5GTI V;  4I7Z B;  1LJ2 A;  2IDB A;  1U7J A;  4PJ0 H;  1NAY A;  5TIS V;  3JC2 2;  3QWO C;  1CC5 A;  1RE3 C;  1PFI A;  1PGQ A;  1VL2 A;  1CSV A;  2HYN A;  1HGV A;  4MU8 A;  3IAO A;  1J1D C;  2E42 A;  1FAV A;  1KIL B;  2ZXX A;  4BRY A;  3OA8 A;  5B66 H;  1LC2 A;  4GOD A;  5GTH V;  2JWD A;  3H32 B;  5CIE B;  3TDK A;  2GA1 A;  4LJI A;  1X22 A;  4PWA A;  4J20 A;  1Q2N A;  2W90 A;  4AQR D;  4K35 A;  1BGY E;  2H89 C;  2HG5 D;  4PV1 D;  1JUN A;  3TGU E;  3P7K A;  1DII C;  1NTK D;  3BCC G;  4L76 A;  1SQP J;  1BGY G;  1RY3 A;  1RE4 A;  1W2B O;  1KTM A;  1DW0 A;  3TGU G;  1RQU A;  3M91 A;  4TT3 H;  1AVO A;  2KOG A;  3B5N C;  1N7S C;  1PPJ E;  4L3G A;  3L75 G;  1T2K D;  4GKG A;  2M3E A;  1CIE A;  3M0D A;  1M1K Q;  1VDF A;  1RF1 A;  1F1F A;  2J5U A;  3JCU E;  155C A;  4FA4 A;  2C1D A;  1LT9 A;  2OYI C;  1EZV E;  2P10 A;  3CX5 W;  3X39 A;  4H13 B;  5CIH B;  3P8C E;  5CCH C;  1N90 A;  2MHM A;  1M8O B;  1IK9 A;  4EDF A;  3NWV A;  5APU A;  1KB0 A;  3OA7 A;  1G2C B;  4JCG A;  2QVA A;  2JQR A;  3AEE C;  1NTM J;  1CTZ A;  1YNR A;  1PIX A;  1W5C T;  2K88 A;  1IK7 A;  1ZZH A;  5KAI V;  2LXC B;  1CYJ A;  1GDV A;  1NIR A;  4IL6 H;  4R4L A;  1CXC A;  3RK2 B;  2PRR A;  1EC5 A;  1RHZ B;  3MHV A;  3K5B A;  2QRX A;  3M06 A;  2Y9Z A;  5CIF B;  2O01 H;  3PXS A;  2HOD B;  1CRH A;  1JMM A;  2R32 A;  3HE5 B;  3OA8 B;  2KLU A;  2VRS A;  3VP9 A;  4DY9 A;  4Q5P A;  1Q86 Q;  1YIT P;  3V2R A;  1E79 H;  2XV5 A;  1FZC C;  3CLQ A;  5AW2 B;  5KKZ C;  2C0X A;  3KQG A;  2N9J A;  3VMZ A;  3R4Y A;  2E5T A;  2WTY A;  2O01 J;  1L0L E;  3NBT A;  3H25 A;  1KYO H;  3CXH W;  1T3U A;  2WZ7 A;  2V4H A;  1LTB C;  3OAK A;  2B87 A;  3MK7 B;  1GZL A;  3G4S P;  3CXH H;  2YKO A;  1NO4 A;  2I1K A;  3M9H A;  1CHH A;  5AW6 B;  3BAT A;  2JR8 A;  2FYU G;  4KJM A;  1Z56 A;  3FX0 A;  1VQ5 P;  1Q81 Q;  5BU5 A;  3D6Y A;  1AJY A;  4XXL A;  1AYG A;  2C1D B;  1KB9 H;  4PD4 E;  5DF5 A;  1T3J A;  5KLV D;  1M1J C;  5E79 H;  2WMM A;  3AE9 C;  1S6V B;  3L72 G;  1SQB E;  2AEF A;  2E74 B;  1OW7 A;  2JWA A;  3O6Q A;  2N18 B;  5CMZ A;  1N2D C;  2FYU K;  5AVU B;  1SQB G;  2E76 B;  5DJQ C;  5AVQ B;  1ZME C;  2ORL A;  1LWU A;  1BE3 G;  1Y47 A;  1GDT A;  1LFM A;  1COT A;  1EDJ A;  4YPC A;  1KFN A;  1L4A C;  3Q5R A;  2ZYA A;  3S4R A;  1GD2 E;  2CE1 A;  1CED A;  1KC8 Q;  3TK1 A;  1DT1 A;  3CCM P;  1K73 Q;  1JY2 O;  4PW9 B;  1VQK P;  1HJ5 A;  1CSB A;  1DVV A;  4AUW A;  1SQB K;  1SFC D;  2WPS A;  1KD1 Q;  2Y0C A;  2BCC D;  4PJ0 V;  4WB4 A;  2Q7C A;  1TU3 F;  3MIW A;  1JNM A;  1G1I A;  3H1J D;  2R5D A;  3H1H E;  2DW3 A;  3CWB E;  5AW1 B;  1CW5 A;  1XTG B;  2AEM A;  3WUV A;  1DEE G;  1L0N E;  1NML A;  2EXV A;  5B66 V;  2C9X B;  3AE5 C;  1C6S A;  3DR0 A;  3ZBM A;  1GKS A;  1I6D A;  1NU1 J;  3EQ2 A;  3GW6 A;  3O8Z A;  1SQX G;  3C2C A;  1LTA C;  4EI2 A;  3TSI A;  3CCS P;  3PXW A;  5APS A;  1WVE C;  1JO5 A;  1LGH B;  2O3J A;  3H1L D;  5TJH A;  1H33 A;  3O20 A;  1RZ6 A;  4ZKP A;  5AW0 B;  1SQV E;  1R0Q A;  4OWF A;  2QM7 A;  1YEB A;  3O6Q B;  4U3F J;  1N7L A;  1VQ4 P;  4JYB A;  4Z1M H;  1SQX K;  4A7P A;  1HJ4 A;  1S5L V;  2OTK E;  3B8E B;  5GTI H;  1PP9 E;  1LWU B;  1VQ8 P;  4UB8 E;  2AI5 A;  2FFD B;  2VHD A;  4H0L B;  3LID A;  5CCG D;  3L36 A;  1KN7 A;  4EIJ A;  3H6P A;  2YMK A;  1PP9 G;  2XTS B;  3ZDM A;  3Q5P A;  4PV1 B;  3CCR P;  2BEZ F;  3OJA B;  2B11 B;  3SVW A;  5GTH H;  3B5N A;  1P84 H;  1Q90 D;  3AE8 C;  2RMZ A;  2C2C A;  3AE2 C;  1YTC A;  1L9J C;  4IL6 V;  4EIC A;  1FC2 C;  3L73 G;  1RAP A;  3E7K A;  1U74 B;  1BCC J;  3LW5 H;  3G6E P;  3PP5 A;  1OWA A;  2KIK A;  3H1K D;  5CCH A;  3RK2 D;  3VMX A;  5KTB A;  1I55 A;  2FYU D;  4H0J A;  3CI9 A;  3MD0 A;  2OTJ P;  2A45 H;  4IFD K;  3G71 P;  3DMI A;  2FXP A;  2W6A A;  4DZO A;  3LW5 J;  1X79 B;  3KZI H;  5AW3 B;  3TYI A;  1HBW A;  3GMA A;  1SQQ E;  4WY4 C;  4Y99 C;  3HTK A;  4K3I A;  1W2L A;  1H33 B;  2RKL A;  3RLM A;  4D6T E;  1HRC A;  2N3B A;  2JTI B;  1JEK A;  1J1D B;  1NTK E;  1SQQ G;  1U75 B;  3WU2 E;  2WT7 B;  3CCL P;  3I55 P;  1KZU B;  4I1L A;  1VF5 C;  5KAI H;  4D6T G;  2CA3 B;  1I8O A;  1LTJ C;  5E79 V;  1N73 C;  4HYT B;  1GMJ A;  1J1E C;  1RQV A;  3KHU A;  1FBM A;  1X9V A;  2WSC H;  1SFC A;  3M97 X;  1YJ9 P;  2N3Y A;  2GB8 B;  2NPS C;  3CME P;  1SQQ K;  3V4Q A;  1S4X A;  2BCC J;  3B5N B;  2AXT E;  1N7S B;  2E74 D;  3TYY A;  3U1A A;  1YJN P;  3BCC J;  2I1J A;  1CRY A;  4AAL A;  1JY2 N;  3WUT A;  3L75 J;  1H31 A;  1URQ C;  4YTP C;  3RGU A;  1NVO A;  4EYY Q;  3L74 G;  2CE0 A;  4K3A A;  4BXL A;  1CI6 A;  3H32 A;  2YO3 A;  2OZ1 A;  3B4S A;  3RK3 C;  2WSE H;  3MUD C;  1CXA A;  4HJG H;  1KYO I;  4U7J A;  3JBT B;  2MJZ A;  1AOQ A;  1DD3 A;  2LKM A;  1NKN A;  2A06 G;  3CXH I;  2OYH C;  3E1R A;  3RMZ A;  2R5B A;  3HTK B;  1GQ1 A;  2WSE J;  1IRV A;  1ZRT E;  4DOJ A;  2JEE A;  1BSH A;  1QYZ A;  3D0W A;  5CID B;  2W6J H;  2D0S A;  2JKV A;  5C39 A;  1KB9 I;  1KQS O;  1IFD A;  1H0T A;  4Y28 J;  3IN6 A;  3TNU A;  2P7J A;  1KYO D;  3VYM A;  5KKZ B;  2ZON G;  5APW A;  2B10 B;  1AQT A;  3HUS A;  3CXH D;  5KAF V;  5APX A;  4ASV A;  5KLV E;  1SFC B;  3AED C;  1FI9 A;  2KZJ A;  3KDP B;  1RAQ A;  5C9M A;  2D2C C;  2Y9Y A;  1M6Z A;  1AOF A;  1KB9 D;  1NTZ G;  3WUI A;  1H32 B;  2IBZ G;  2H8P D;  1K3H A;  1FI7 A;  3H1K J;  3L70 G;  5AVY B;  2FYN C;  2QG4 A;  1LTT C;  1GK6 A;  1H31 B;  2HOD A;  2FYU J;  1USD A;  2W6B A;  3HE5 A;  1M1J B;  3VRD A;  4H0L D;  4QMA A;  1SLQ A;  1HF9 A;  1CI6 B;  1CCH A;  3SWK A;  1MFT A;  2OZ1 B;  3AEC C;  4GIF A;  1J3S A;  3WFE C;  1A8C A;  1CSX A;  1NTZ K;  3L72 J;  2YO2 A;  3CC7 P;  1OMI A;  2P67 A;  2ZT9 C;  5AW4 B;  1K9M Q;  3IFM A;  2N1T C;  3GF7 A;  1GU4 A;  1MZ4 A;  2V7Q H;  3F5H A;  2PGD A;  4AAM A;  3H1J E;  1OIP A;  5APT A;  1AV1 A;  3Q3D A;  2BCN B;  4JBZ A;  4KT0 J;  1BE3 J;  3L71 E;  1GL2 C;  1S2E A;  4JPZ B;  2YKP A;  1PGP A;  3KZI V;  3A0H H;  5DJT B;  1NU1 D;  2V07 A;  3M9B A;  1YQ4 C;  2Z4E A;  1PPJ G;  1H0T B;  1S5L H;  1KIL E;  3TNU B;  3NFQ A;  3L71 G;  3CCJ P;  2QJK C;  1QX8 A;  5KLI B;  3HUS B;  5C0Z A;  1MFZ A;  3N4X A;  4RSZ A;  1EZV G;  3QH9 A;  4OGQ C;  5AVR B;  2E43 A;  3PTZ A;  3D70 A;  3I56 P;  3SFD C;  3H1L E;  1BDC A;  3O5C A;  2BH5 X;  2ITA A;  3GLM A;  1HZV A;  3P32 A;  1EXJ A;  4U3F D;  3VTP C;  1FCD C;  1IRW A;  2W83 C;  2C1U A;  2N9Y B;  1LS9 A;  1FHB A;  5KJ7 C;  2G8Y A;  2QSI A;  2QJY C;  1HCM A;  1S9K D;  1S72 P;  2E75 C;  1IQC A;  3L74 D;  3GHG C;  1M7L A;  1JDL A;  2W8Z A;  1SQX J;  3AE7 C;  1ZR2 A;  1YIQ A;  1P84 I;  4WQ8 A;  3CCE P;  3H1I D;  3PLN A;  3AEF C;  1EXI A;  3NBS A;  1CSU A;  4NFG B;  1M90 Q;  4O1W A;  5AVW B;  2YCC A;  4H44 C;  1KYO W;  4YE1 A;  1OX3 A;  4WQD A;  3B5N D;  1N7S D;  3RBX A;  1A2S A;  1BCC D;  4R4M A;  3G3Z A;  1YI2 P;  4UB8 H;  2ZVO B;  3LIE A;  1L0L G;  2A45 I;  1M57 D;  4LLH A;  1E29 A;  3G9R A;  3A0B E;  5AW9 B;  1Q82 Q;  2BH4 X;  1P84 D;  3MZW B;  1C6O A;  5CCH D;  3WC8 A;  3A3Y B;  2RH0 A;  1HJ3 A;  3MP7 B;  3ZCF A;  1HH7 A;  1JMB A;  1FOS F;  2C9L Y;  1AQ5 A;  1A02 F;  1KMI Z;  1RF0 C;  4WQ9 A;  1J2J B;  3CMA P;  4DCK A;  4PJ0 E;  4CPG A;  2K37 A;  4FAN A;  1JCC A;  1VQN P;  2E5Y A;  4IOI H; 
#chains in the Genus database with same CATH homology
 1YIC A;  3O1Y A;  2XTS B;  1K3G A;  4D6T D;  1RZ5 A;  3ZOW A;  5AUR A;  3ZOY A;  2B11 B;  2DVH A;  3SVW A;  3SWS A;  4XYD B;  2RMZ A;  1I5T A;  2C2C A;  2FRC A;  3L70 D;  1DVH A;  1YTC A;  2BGV X;  1CYC A;  1L9J C;  1M60 A;  4IL6 V;  2B12 B;  1CRG A;  4GED B;  4EIC A;  3CP5 A;  3O0R C;  3SJL A;  1RAP A;  3VMA A;  2QJP B;  3PHL A;  1U74 B;  1CRJ A;  2CXB A;  2BPB B;  2LIR A;  1A56 A;  3H1K D;  1SQV D;  3RN1 A;  1I55 A;  2FYU D;  4H0J A;  2L4D A;  3SLE A;  3ORV A;  3L4M A;  3DMI A;  1CRC A;  1CO6 A;  2PAC A;  1GIW A;  1FOC A;  1WEJ F;  1GJQ A;  3BCC D;  3TYI A;  1BGY D;  3TGU D;  5CIG B;  3L75 D;  3TF5 A;  4K3I A;  5DFS A;  1W2L A;  1DW3 A;  2KS1 A;  3HQ8 A;  1H33 B;  5IY5 1;  4KMG A;  3RLM A;  1HRC A;  2N3B A;  2JTI B;  1CIF A;  4EID A;  1U75 B;  1I6E A;  3FWL A;  1PPJ D;  1N9C A;  2B0Z B;  3L4O A;  2A06 D;  4L3H A;  1N50 A;  1CHI A;  5CYT R;  1N15 A;  1OAE A;  5GTI V;  2CA3 B;  1I8O A;  5E79 V;  1L9B C;  5TIS V;  1QN2 A;  4AAN A;  1CC5 A;  3KHU A;  1CSV A;  351C A;  2ZBO A;  3GG2 A;  4MU8 A;  1ZRT D;  1C7M A;  1DW2 A;  3M97 X;  3A0H V;  2N3Y A;  3OA8 A;  2GB8 B;  1C75 A;  1LC2 A;  4WQE A;  3PH2 B;  5GTH V;  1C2R A;  5CIE B;  3TDK A;  1FI3 A;  4LJI A;  4PWA A;  4J20 A;  1I8P A;  1H1O A;  1I54 A;  2KNC B;  1CRY A;  4AAL A;  2Y0D A;  2GC4 D;  1VYD A;  1H31 A;  1CHJ A;  1LMS A;  1DII C;  1NTK D;  2MTA C;  1NTZ D;  2CE0 A;  4QAO A;  3MK7 C;  1HZU A;  1DW0 A;  2IBZ D;  4AAO A;  1CNO A;  2OZ1 A;  2K9J B;  4L3G A;  1COR A;  2LIT A;  1CIE A;  1F1F A;  2HV4 A;  1CXA A;  155C A;  4FA4 A;  2C1D A;  2PCC B;  3JBT B;  1AOQ A;  2CA4 B;  3CX5 W;  3CYT I;  3X39 A;  1GU2 A;  5CIH B;  4N0K A;  1MG3 D;  1N90 A;  2MHM A;  451C A;  3RMZ A;  4EIE A;  1E8E A;  4EDF A;  2BLF B;  1GQ1 A;  3NWV A;  1IRV A;  1YFC A;  1KB0 A;  3A0B V;  2DGE A;  4JCG A;  2JQR A;  1QYZ A;  3HQ7 A;  5CID B;  2D0S A;  1CTZ A;  1YNR A;  1W5C T;  1FJ0 A;  3L72 D;  1ZZH A;  5KAI V;  1MG2 D;  4V2K A;  1KYO D;  1CYJ A;  2D0W A;  3VYM A;  2Q3E A;  5KKZ B;  2ZON G;  1GDV A;  1NIR A;  4UB8 V;  1C52 A;  1CXC A;  2B10 B;  4P4Q B;  5EXQ A;  3CXH D;  2FYN B;  3PXT A;  1CRI A;  5CIF B;  5KAF V;  1SQB D;  1HRO A;  3PXS A;  1FI9 A;  1CRH A;  3HQ9 A;  1BE3 D;  3L71 D;  3OA8 B;  1RAQ A;  4DY9 A;  4Q5P A;  5C9M A;  1M6Z A;  1AOF A;  1KX7 A;  1KB9 D;  4AX3 A;  3SXT A;  4WQA A;  2GC7 D;  1EZV D;  3WUI A;  3ZOO A;  5CIC B;  1H32 B;  2N9J A;  1K3H A;  1FI7 A;  1C2N A;  2N9I A;  3ZIY A;  1CYI A;  2QG4 A;  3NBT A;  1H31 B;  3CXH W;  2YIU B;  2AIU A;  1KIB A;  3A9F A;  3VRD A;  1NNO A;  4FA5 A;  3MK7 B;  4WQB A;  3RN0 A;  3WFB C;  1CCH A;  2OZ1 B;  1CHH A;  2ZXY A;  1J3S A;  1CSW A;  1H32 A;  5B6Q A;  1EB7 A;  3OCD B;  3WFE C;  1YEA A;  1A8C A;  1CSX A;  2GIW A;  4XXL A;  1B7V A;  1AYG A;  2Y0E A;  2C1D B;  5DF5 A;  4O1Q A;  1CCR A;  2YQB A;  3H1H D;  4FA9 A;  1MZ4 A;  5KLV D;  2QJK B;  1CTY A;  2C8S A;  1S6V B;  5B5E V;  1DW1 A;  4AAM A;  1L0N D;  3ZOX A;  1SQX D;  1C6R A;  1CIH A;  4GYD A;  2BCN B;  3HQ6 A;  3OCD A;  2B4Z A;  2JWA A;  3WU2 V;  2C1V A;  2N18 B;  3KZI V;  1NU1 D;  5CIB B;  2V07 A;  3PRJ A;  1QKS A;  5DJQ C;  3ITK A;  1L0L D;  4L1Q A;  2ORL A;  1LFM A;  1COT A;  2FWL A;  5KLI B;  4RJT A;  1KX2 A;  2QJY B;  5C0Z A;  4EIF A;  4RSZ A;  4WQ7 A;  2CE1 A;  1CED A;  4WQC A;  3PTZ A;  2RN0 A;  1CIG A;  2N18 C;  1DT1 A;  2BH5 X;  1IO3 A;  1CTJ A;  3O5C A;  3WFC C;  1HZV A;  4U3F D;  4PW9 B;  1BL9 A;  3CU4 A;  4PD4 D;  1HJ5 A;  1FCD C;  1DVV A;  2AXT V;  5H2F V;  2ZZS 1;  1IRW A;  2Y0C A;  2BCC D;  2C1U A;  1LS9 A;  4PJ0 V;  2N9Y B;  1AKK A;  1FHB A;  1PP9 D;  1OCD A;  1HCM A;  3H1J D;  1IQC A;  3L74 D;  4UB6 V;  1JDL A;  2ZOO A;  1NML A;  1QL4 A;  1YIQ A;  2EXV A;  2I8F A;  5B66 V;  4WQ8 A;  1QL3 A;  2C9X B;  3H1I D;  2L91 A;  3PLN A;  1H9Y A;  3NBS A;  3L73 D;  1C6S A;  1SQP D;  3DR0 A;  1CSU A;  3ZBM A;  4NFG B;  1GKS A;  1I6D A;  4O1W A;  2YCC A;  1KYO W;  3GW6 A;  3C2C A;  1IZL 0;  4YE1 A;  4WQD A;  2YK3 A;  3PXW A;  1KV9 A;  1ETP A;  1WVE C;  1A2S A;  1BCC D;  2O3J A;  3H1L D;  5TJH A;  1YCC A;  1E29 A;  4FB1 A;  1H33 A;  3O20 A;  1RZ6 A;  2BH4 X;  1M70 A;  1P84 D;  1R0Q A;  1LC1 A;  2PCB B;  3WFD C;  1C6O A;  1YEB A;  4FAV A;  3WC8 A;  1HJ3 A;  1H9X A;  1DIQ C;  3DP5 A;  4H0K A;  5DJQ B;  3ZCF A;  1HH7 A;  4A7P A;  1NTM D;  1F1C A;  1HJ4 A;  1S5L V;  3CWB D;  1E2R A;  4WQ9 A;  2AI5 A;  2VHD A;  4Y5R A;  1SQQ D;  3VNW A;  4FAN A;  4FA1 A;  2V08 A;  1NMI A;  3CX5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...