4D6TD

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
240
structure length
240
Chain Sequence
DLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
total genus 67
structure length 240
sequence length 240
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4d6tD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4d6tD02
1CIEA 3C2CA 1CHIA 1N9CA 4Q5PA 1GIWA 2N3BA 1U75B 2FYNB 2HV4A 2YIUB 4FA9A 1M60A 2N9IA 3L4MA 1QN2A 4L1QA 1DW0A 2GC7D 1DW1A 2AI5A 3PXWA 1YIQA 3WFCC 1DW2A 1DW3A 1DVHA 4O1WA 4XYDB 2C1DA 5DF5A 1FCDC 1QYZA 1KYOW 2N3YA 5DJQC 5C9MA 1E8EA 2OZ1B 1N90A 5KLIB 2L4DA 2N18C 1A8CA 1MZ4A 2PCBB 1LC1A 1BL9A 3VYMA 1QKSA 1I54A 3VNWA 4RSZA 2MHMA 1CSXA 3RLMA 1U74B 1LS9A 2AXTV 3WC8A 2MTAC 3L74D 2KS1A 2CXBA 2C1UA 3H1HD 4PWAA 5CICB 3CWBD 1H9YA 3NBTA 4WQAA 3TF5A 2N9JA 1KYOD 3H1JD 1IRVA 4PD4D 2FRCA 4EIFA 1AKKA 1DIIC 4KMGA 3NBSA 2Q3EA 1YEBA 3A0BV 1A56A 1CXAA 4Y5RA 1GJQA 1YICA 3PHLA 1CYCA 4FA1A 5CIDB 1N50A 2B4ZA 4WQEA 3ZOXA 1H1OA 1VYDA 1CRIA 3HQ7A 3OA8A 2ZONG 2N9YB 1RZ5A 2QJKB 1C52A 2B0ZB 4PW9B 2BLFB 1CSVA 3H1KD 3CX5W 1C75A 4AAOA 1HCMA 5TISV 5KAIV 3SJLA 1CRCA 2GB8B 2LIRA 1PP9D 1NMIA 3SLEA 4EIDA 1I8PA 1R0QA 2I8FA 1AOFA 1HZVA 1HJ4A 1I55A 4FANA 5CIHB 2QJYB 1L9BC 1H31A 1CHJA 3WFEC 2GIWA 3FWLA 1CRYA 1CSWA 3OCDB 1B7VA 2L91A 2XTSB 3CX5D 1KB9D 4A7PA 3JBTB 1IRWA 3PXSA 1GU2A 4LJIA 3H1ID 1H32B 4V2KA 5B66V 3L73D 1KB0A 4RJTA 2Y0EA 1WEJF 4L3GA 3KZIV 3WFDC 3X39A 4L3HA 4JCGA 3A0HV 1EB7A 1C2RA 5CIFB 3MK7B 1AOQA 1CO6A 5GTHV 5CIBB 4YE1A 2QJPB 3NWVA 2VHDA 4J20A 1RAPA 1NTMD 2PACA 1C7MA 1CYJA 5EXQA 2LITA 1I6EA 1H9XA 1E29A 1YTCA 4WQCA 4FAVA 1E2RA 3GW6A 5GTIV 3H1LD 1L0ND 3PH2B 5C0ZA 1CIFA 1CRGA 2DGEA 3WUIA 1C6SA 1CEDA 2FWLA 3ZOOA 3SWSA 5CIGB 1NIRA 1CXCA 1AYGA 3CYTI 4UB8V 1NU1D 1SQBD 1GDVA 3ORVA 1NTZD 3TDKA 2OZ1A 3ZOWA 3GG2A 1F1FA 2QG4A 2JQRA 1H33B 5KAFV 4MU8A 3PTZA 2C1VA 1CRJA 4AANA 5IY51 2V08A 3ZBMA 1RAQA 2DVHA 451CA 3HQ6A 3KHUA 1I6DA 4AALA 3M97X 5KLVD 3A9FA 2ZXYA 4QAOA 2B11B 3DR0A 2BCNB 1CIGA 5B6QA 2EXVA 3SVWA 2A06D 1ZZHA 4K3IA 1L0LD 1S5LV 4FA5A 1DT1A 2C1DB 3CXHW 1WVEC 3MK7C 5TJHA 4WQBA 1MG3D 3HQ9A 2D0SA 3VRDA 2JTIB 4U3FD 1C6OA 3L70D 1C2NA 1M70A 3ZCFA 2Y0DA 4EICA 1CC5A 4WQDA 1MG2D 5DFSA 2JWAA 3VMAA 2BCCD 3RN0A 1K3HA 4DY9A 1YNRA 3L72D 2CA4B 1LC2A 1CNOA 1GQ1A 3CXHD 4WQ9A 2B10B 2V07A 1QL3A 1P84D 5CIEB 3RN1A 5KKZB 1BGYD 1IZL0 351CA 4EIEA 1J3SA 1LMSA 1CCRA 1CSUA 4PJ0V 1A2SA 1GKSA 1C6RA 4GYDA 1DIQC 2ORLA 1HZUA 1ZRTD 2Y0CA 1YCCA 3PLNA 3OCDA 1COTA 3L71D 4H0KA 3WFBC 4WQ8A 3O5CA 1I8OA 4AX3A 2RN0A 1L9JC 4N0KA 1CTYA 3OA8B 2YQBA 2C2CA 1LFMA 1SQVD 3PXTA 3O0RC 1I5TA 1HJ5A 1H32A 1CCHA 1CTJA 2D0WA 2YCCA 1YEAA 4EDFA 1FI9A 2AIUA 2RMZA 4UB6V 3ITKA 1SQXD 3DMIA 1IO3A 1HJ3A 1HH7A 2B12B 1JDLA 5DJQB 1FI7A 5E79V 2C9XB 4WQ7A 3DP5A 2N18B 1HROA 1CHHA 2C8SA 1YFCA 3SXTA 1FJ0A 1W2LA 4NFGB 2ZBOA 4AAMA 155CA 1OCDA 4GEDB 1S6VB 2BGVX 3O20A 3CP5A 1PPJD 1H31B 1KX2A 1CORA 2YK3A 2BH5X 1BCCD 2ZZS1 2K9JB 2PCCB 3WU2V 2KNCB 1KX7A 3PRJA 1FHBA 2IBZD 3ZOYA 3O1YA 1EZVD 1OAEA 1SQPD 2CE1A 2GC4D 1CIHA 1QL4A 4H0JA 1BE3D 1W5CT 3BCCD 3L4OA 2CA3B 1ETPA 1NMLA 5CYTR 3RMZA 3TYIA 2BPBB 1FI3A 3L75D 4IL6V 1NTKD 1CYIA 1IQCA 4FB1A 1KV9A 1RZ6A 2CE0A 1FOCA 1H33A 4O1QA 1DVVA 3CU4A 4P4QB 1CTZA 1NNOA 3HQ8A 4FA4A 1M6ZA 1HRCA 5AURA 1K3GA 3ZIYA 5B5EV 2BH4X 4D6TD 2FYUD 2O3JA 5H2FV 3TGUD 1KIBA 2ZOOA 1N15A 1F1CA 4XXLA 1CRHA 1SQQD
chains in the Genus database with same CATH superfamily
1KILB 3C2CA 1S5LH 2LR2A 1RF1B 1SLQA 2N3BA 1PPJE 2BCCG 2FYNB 3M9HA 2ZYDA 2NPSA 2R44A 1PZQA 2AI5A 3E1RA 1YIQA 1DVHA 4K3AA 3D6ZA 2C1DA 1FE6A 1KQSO 1JM0A 1CI6B 2HG5D 2Q1KA 1N90A 3USSA 1OVRA 2L4DA 1NAYA 3IAOA 3CMEP 3RK3D 3KXDA 2KZJA 1FDMA 3W68A 3CL3D 3VNWA 1CSXA 2JKVA 1SQVJ 1URQB 4GODA 2AXTV 1ZOYC 3L74D 2CXBA 1Z56A 5CICB 1S9KD 1KB9H 3KZIE 1NU1K 4H13D 1FOSF 1H9YA 2OTLP 1IFNA 3TF5A 2N9JA 2LXBA 4RESB 5KTBA 3VMXA 3L72E 4EIFA 1AQTA 3GHGB 4KMGA 1FZFA 2WSSH 2Q3EA 4GOEA 4H44B 3TK1A 2D2CC 1YEBA 3FXEA 1LWUA 3TNUA 3F5HA 2Q6QA 1GL2D 1P84E 4IFMA 1YICA 3LIEA 4PV1D 1USDA 5APXA 4FA1A 1SQPJ 3VTPC 1N50A 5CBNA 4DCKA 4WB4A 1CRIA 1ZRTE 5E79H 2N9YB 1C52A 4NPEA 4UB8E 1NTKJ 4YXDC 3BCCG 3CX5W 2WPSA 4O9BA 3SJLA 4JQ0D 1SQVE 2KOGA 4NPFX 3Q5SA 1PP9D 1M1KQ 1K05A 5CCGD 1HF9A 2K88A 1QL2A 1I55A 2QJYB 2KSEA 2KI7B 2OTJP 3KDPB 1N86A 2POHA 3VP8A 2KNCA 2FYUG 2LKMA 1M57D 4KT0J 3OCDB 5CCGC 2L91A 2XTSB 3HE5A 1YQ3C 1SQQK 1AQ5A 2FFDC 4A7PA 3JBTB 3UIAA 2G8YA 5KJ7D 1GU2A 1EXJA 4LJIA 3HD7A 1K8AQ 1MZ9A 1KB0A 2QRXA 1SQPE 4Z1MH 3WFDC 1DX7A 3A0HV 2ZJSE 5CMZA 2H88C 3MUDA 3N4XA 1AOQA 1CO6A 2M5AA 3MTUE 5KJ7C 3RL0B 4J20A 1NTMD 1KD1Q 1HJBA 1Q90D 1FBMA 1YYCA 2CPSA 4WQCA 4FAVA 1MFZA 1FAVA 3H1HJ 2HFED 5AVXB 1YBKA 1KB9I 1NO4A 3GW6A 2KYVA 5GTIV 3H1LD 3CCUP 5C0ZA 3VYIA 1JOCA 1CEDA 5AVQB 4ASWA 3ZOOA 1HGVA 2OYHC 1AYGA 2ZT9B 1SQBD 3AE9C 3H1JG 1NHLA 2JEEA 1SFCA 1VL2A 2YKQA 1J1EC 1KILD 1FDIA 2XKMA 3S9OA 1JY3O 2QM8A 2C1VA 4KHXA 3U1CA 1KZUB 1CRJA 2O01N 1IFDA 3CLQA 3HE4A 1EDKA 3P8CD 5M1BA 1LTBC 3L37A 1KILC 1VQNP 1RF1C 5KLVD 1G1JA 2FYNC 3H1KG 1JY3P 3DR0A 1IFPA 1AVOA 1T2KC 2NPSB 2KUBA 3H1HE 1CW5A 2Y9YA 1IO4A 3V2RA 4K3IA 1YJWP 4XFJA 1X22A 3I5CA 2C1DB 3CXHW 1L2PA 4WQBA 1X8YA 1MG3D 3CCRP 2P10A 3QWOC 2JTIB 4PD4E 2WPVB 3LIDA 4D6TG 2ZFCA 2FYUK 3WU2E 3ZCFA 1JY2N 1NTZE 4WQDA 2J5UA 1URQC 3V5BA 1QL1A 3H1IJ 5CCHD 2JWAA 1J1DB 1YTZI 3VMAA 3B4SA 2E75B 2BEZF 4NPDA 1S5LE 1YNRA 3L72D 2CA4B 2YXQB 1AFOA 3L73G 1AV1A 4EIJA 3FX0A 2B10B 2O1KA 1P84D 5CIEB 5KKZB 3WUUA 351CA 4EIEA 1KTMA 5AVYB 4H44C 1KQFB 4PJ0V 1VQMP 1GDTA 2WVRA 1GKSA 3LW5J 2H43A 1NTMK 1C6RA 2QM7A 1LWUB 1HZUA 2WITA 1ZRTD 3TNUB 2Q7CA 3WUVA 4H0KA 3WFBC 1I8OA 1OVUA 2R3CA 1CTYA 1SQVD 3CMAP 3O0RC 1AA0A 2E76B 4GOFA 1I5TA 1CCHA 1CTJA 1N7LA 1FZBA 2AIUA 3ITKA 3L35A 4PJ0H 3CCSP 3DMIA 2CK3H 1SQBK 1IO3A 2B12B 1JDLA 3H1IE 2DW3A 3MHVA 2QVAA 1HROA 2QJYC 1S6VB 2BGVX 3O20A 2FKWB 1CORA 3IR9A 2AXTE 2KNCB 3PRJA 3OAKA 3FXDA 5AW1B 1Q81Q 1X79B 3Q2YA 2NRGA 1EZVD 1OAEA 1SQPD 3HE5B 2PP6A 1QL4A 1SVFA 5KLVK 3RL0D 3L4OA 1ETPA 1NMLA 4N78E 3HD7B 5CYTR 3RMZA 1PL5A 3SWKA 1S4XA 2BPBB 3SSUA 3A2AA 1NTKD 1VQ8P 1GW4A 1IQCA 4FB1A 2A06G 3V2PA 1L0LG 1BSNA 1A02J 1LTIC 1FOCA 2JDIH 2M5AB 1H33A 4O1QA 1RE4C 3CU4A 3RL0C 1NNOA 3F89A 4U3FG 2PFXA 1K3GA 2O3JA 2IBZI 2ZT9D 3M0DC 3B5ND 1YIJP 1N15A 2FXMA 1N9CA 4Q5PA 2YO3A 5CBOA 3OW2O 5BU5A 2E5TA 4L1QA 1PGPA 2QA4P 1DW0A 1SP4A 1AJYA 3RK2D 1DW3A 1XTGB 3CI9A 3NTNA 1KYOW 5DJQC 1BGYG 5C9MA 1E8EA 1SFCB 1S1CX 3V6IA 1MZ4A 1LC1A 1OX3A 1BL9A 3AE5C 1QKSA 1I54A 4RSZA 2MHMA 3L71G 3RLMA 1ZP0C 1U57A 2NPSD 1LS9A 3HE4B 2IFMA 3G71P 3WC8A 2E74B 2MTAC 1WT6A 1SQXJ 3H1HD 1SQVK 3CX5H 1NU1G 1HBWA 2ZYAA 3A0HE 3OJAB 3E7KA 1P84I 4WQAA 2NPSC 3BATA 3T97A 1N8RQ 3NMDA 4PD4D 2YMKA 3H32B 1YI2P 1AKKA 2H7HA 1DIIC 5AW6B 3VN0A 1LP1B 5AW7B 1BCCJ 2A45I 2E75D 1PFIA 3M0DA 1A56A 4Y5RA 1GJQA 1CYCA 1W5CE 5CIDB 3P7KA 5GTIE 4WQEA 3GLMA 4I6MC 2OQQA 2C9LY 2Q9IA 2IX7C 3A5TA 2ZONG 1GK6A 1RZ5A 1Y47A 1SQPK 4I1LA 2B0ZB 1BE3G 3L75J 4B86A 1UIIA 1HCMA 2WPQA 1L4AD 1NYHA 1CRCA 1HWTC 1LTTC 1H8AA 1NTKK 4EIDA 1I8PA 1R0QA 2I8FA 1AOFA 2E43A 2WSFH 1SQXE 1HJ4A 3D6YA 1JMBA 4D6TJ 2P1JA 1L9BC 2E76D 1LWUC 3TGUJ 2PAJA 2GIWA 2K9JA 1UIXA 3HUSA 1B7VA 3HTKA 3KQGA 1WRGA 5AW0B 1SQQG 1W2BO 1KB9D 1BCCE 3S1KA 3M9BA 1LNQA 2E76C 5BVZA 2IBZE 3H1ID 4V2KA 2XDJA 2E5YA 1U7MA 3CCQP 3VOPA 4L3HA 1EB7A 5GTHV 2QJPB 2VHDA 1OW8A 3L75E 1OWAA 2PACA 1KORA 1YTZT 5EXQA 3G4SP 4EYYQ 1E29A 1VPCA 3CWBJ 4L76A 4N78D 5AVUB 3B8EB 3L74G 5AVRB 1CRGA 2DGEA 3WUIA 5APQA 2D2CD 4D6TE 1VQOP 1N2DC 3AEFC 4R4LA 1CZQA 3TGUE 2M3BA 3HD7C 5CIGB 2YXRB 1NIRA 1CXCA 2KK7A 4I2LC 3MUDC 4PJ0E 3CCJP 3CXHH 3PH0A 2AXTH 2JQRA 1H33B 4N3YB 3VMZA 3MGNA 5IY51 1H0TA 3N7NA 3LW5H 5EFWB 3RGUA 2OYIA 2JJLA 3HQ6A 3KHUA 1IK9A 1ZN5A 2XNXA 1SFCD 4CPGA 3A9FA 4PD4I 4QAOA 2IZ1A 2FXOA 2KB7P 2BCNB 2Q3IA 2EXVA 3SVWA 1PP9G 2AEMA 3CWBE 4BRYA 1SFCC 4FA5A 3L4FA 4WY4A 5TJHA 3HQ9A 2HR3A 1OW7A 1C6OA 4XE5B 4ZKUA 3IFMA 3P8MC 4C7NA 1CC5A 3AE7C 1MG2D 5DFSA 4GT1A 3O6QA 2NZ2A 2E74C 1PGJA 1ZR4A 1RH5B 2KXPB 1AVYA 1LGHB 1M56D 3D71A 2N9BA 3K5BA 1EQ7A 4U7JA 4QMAA 1G1IA 1S3JA 1GQ1A 4WBAA 2V07A 3T97B 3RN1A 1LMSA 1CSUA 1EDJA 1RY3A 1NTMG 1JCCA 1YCCA 2WQYC 3PLNA 1COTA 1L0NJ 4WQ8A 3PP5A 3A0HH 4AX3A 2RN0A 2FYZA 2RH0A 3ABVC 4N0KA 3H1LG 1Q2NA 2C2CA 1NU1J 4U3FE 3I56P 2OARA 1NTZJ 2WSFJ 4EDFA 1EDLA 1GL2A 4UB6V 1JY3N 3CX5E 1G2CA 1SQXD 1SQBG 1NOHA 1HH7A 3JSVC 3M91A 5DJQB 1K04A 2C8SA 1JO5A 5GTIH 3BRVB 1N73C 155CA 1OCDA 1T8ZA 1GU4A 2E42A 1PPJD 1T2KD 1BCCD 2ZZS1 2K9JB 2PCCB 1KFNA 2IBZD 1NH4A 5DJTB 4YTPC 3HUSB 1GD2E 4UB6H 3O1YA 3AE8C 5KLVG 3OA7A 3BASA 2JO1A 3QH9A 1L0NE 1VF5B 3L75D 3VP9A 4C46A 1URQD 1CYIA 1KYOH 1E5WA 1H88A 2QJPC 3M0AA 1NU1E 4P4QB 5APWA 3G3ZA 3HQ8A 2GUVA 3IN6A 5APUA 4OGQB 1M7LA 4MN4C 2WT7A 2BH4X 4D6TD 3D0WA 2KP8A 4IFFA 3SFDC 5H2FV 3TGUD 2ZOOA 2BCCJ 1FZCA 2ZYGA 4H44D 1NAFA 2P58A 2K1AA 2FY8A 1U75B 2ZVOB 2K37A 3L72G 2JWDA 2RKLA 4JPZB 2YIUB 2W83C 1M60A 4TLFA 3L4MA 1QN2A 2GC7D 1DW1A 3PXWA 1DW2A 1N73A 4O1WA 4XYDB 1TU3F 1VQLP 1Y8AA 1QYZA 1NGMB 1X9VA 1RF0C 2BEQD 2W27A 5H2FH 2HODA 1VQPP 1LTGC 1A8CA 3EFFK 1X0TA 2IYPA 3V2NA 2KLUA 2WTYA 2A45G 4DZOA 1U74B 5APVA 1HUCA 1FZGA 4IL6X 2KS1A 5AW5B 2OYIB 1NJIQ 1SQVG 4PWAA 4ZMDA 3H25A 3HRNA 2W6AA 3CWBD 1FOSE 1LT9A 5GTHE 1SQXK 2BCCE 1SQQE 1IRVA 1N7SA 2IPPA 3NBSA 3W67A 4WY4B 3CXHE 3A0BV 1CXAA 4WVZA 2V7QH 3PHLA 3CC7P 2R32A 2B4ZA 1M8OB 3ZOXA 1H1OA 2AXCA 1DD4A 2Q5UA 3U1AA 3FWNA 3HQ7A 3BCCJ 3O6QB 2ITAA 3Q1MA 1EZVG 1LTJA 1SQPG 2QJKB 2BLFB 4HJGH 1CSVA 2J59M 1PIXA 3KPEA 4AAOA 2YKPA 5TISV 1KYOI 5KAIV 4OH8B 4EI2A 1JNMA 3G9RA 3RK3B 1FS0E 1RF0A 1NTKG 3AE2C 1DH3A 2W6BA 2FBWC 1HZVA 5CCHA 3EFGA 3L70G 1Q7YQ 2FYUJ 4FANA 5CIHB 3GHGA 2K9YA 1CRYA 1NWQA 4AQRD 1RE3A 1CSWA 4I7ZC 1HGZA 1R8EA 1GZLA 5TISH 5KAIH 3S4RA 2GA1A 1JUNA 3CX5D 5DJUB 4K35A 1GMJA 1IRWA 3PXSA 1RQUA 1S72P 5B66V 4H0LC 4RJTA 1MFTA 2FXPA 3X39A 1G2CB 3L36A 1DIPA 4PV1B 1C2RA 3BCCE 3MIWA 5CIBB 3NWVA 4JBZA 1IFIA 1QVGO 3PJSK 5AW8B 1RAPA 2O1JA 1CYJA 1ZLLA 2LITA 5L8RJ 1H9XA 2B9BA 2AEFA 3HUSC 1YITP 3M9QA 5B66H 2P2UA 4Y99C 3SWFA 5APSA 1L0ND 3PH2B 2H8PD 1CIFA 2FYUE 2OGUA 2V4HA 3EQ2A 3H1HG 3H1JJ 3SWSA 4BXLA 1M1JA 3RL0g 3GMAA 2OYOA 1VF5C 2BASA 4Y28J 1JEKA 1HJ0A 1NU1D 3AEBC 1ZMEC 1OVVA 3ORVA 3AE6C 1JB0J 1NTZD 2OZ1A 3ZOWA 3GG2A 1F1FA 4LLHA 4W7YA 5KAFV 3PTZA 4OGQC 4AANA 3ZBMA 2WT7B 3B71A 2C0WA 2HPCA 3H1KJ 451CA 4M3LA 1FZCB 1I6DA 2PGDA 4OVNF 4UB6E 2WPRA 1VQ6P 2ZXYA 5CHXA 2YIUC 1KV4A 1QX8A 5KAFH 4DOJA 5B6QA 5AW3B 1MUUA 1IC2A 1QGKB 1ZZHA 3B5NA 4R4MA 1S5LV 1N73B 1DT1A 3MK7C 1WVEC 1KYOE 1VQ9P 2D0SA 3H1JE 3Q5RA 1C2NA 4ASVA 1M70A 3CCMP 2Y0DA 1YJ9P 1S2EA 5C39A 2R3SA 2OYIC 3C8VA 1NVOA 3L73J 2I1KA 2KS1B 2BCCD 3RN0A 1LT1A 1K3HA 2W8ZA 3H1IG 3H6PA 4TT3H 1LC2A 1CNOA 3CC4P 3P8CE 1LT9B 1U7JA 1ZV8A 2JP3A 3CXHD 4WQ9A 2V7QJ 1QL3A 1R5LA 2YO2A 3H1KE 1N7SB 5KLVE 2B87A 2YNYA 4WY4C 1JMMA 3HD7D 3BVHA 2WWWA 5H2FE 1DIQC 3CC2P 2R5BA 5AVWB 2N1TA 3CX5I 5CJ0A 3Q5PA 3CCEP 2M8RA 2WMMA 2IZ0A 2QJKC 1L9JC 5GTHH 4AUWA 1L0NK 1LTJB 3PXTA 1R5SA 1DD3A 1HJ5A 1H32A 2D0WA 2YCCA 4L74A 2RMZA 3RK3C 2J58A 1HJ3A 4HH2A 2Y9ZA 3R2PA 1NTZK 5E79V 1YQ4C 4WQ7A 1OW6A 3E1IA 3L73E 5BU8B 1VQKP 1BSHA 1YFCA 1FJ0A 1W2LA 4NFGB 1IJDB 4AAMA 2YMYA 2QSIA 4RKUJ 2Z4EA 2W90A 1KX2A 2YK3A 4H13C 2BH5X 1L4AA 1M90Q 2I1JA 3ZOYA 2GC4D 1CIHA 1MKMA 1W5CT 1GU5A 3R4YA 3BCCD 3WUTA 2CA3B 1KFMA 3JCUE 1L0LJ 3TYIA 1GL2C 1VQ5P 4PV1C 4IL6V 2KZIA 2E74D 4IOIH 3SWYA 1VQ7P 1KV9A 2CE0A 4U3FJ 3A0BE 3L70J 1DVVA 1IFJA 1CTZA 4DJGA 1KMIZ 2C0XA 1M6ZA 3JC22 3ZIYA 5B5EV 2FYUD 1F1CA 4XXLA 1CIEA 1CHIA 2MKVA 4IL6H 5KAIE 2XZRA 5TISE 1GIWA 1PGOA 1FDOA 2HV4A 1RHZB 1M1JB 4FA9A 1DEEG 1BGYJ 1PGQA 4AYCA 2N9IA 2UWJE 3WFCC 1EZVE 3U59A 1MV8A 5DF5A 1FCDC 2N3YA 1ZXGA 5B5EH 2OZ1B 4JYBA 3AEDC 5KLIB 2N18C 3L71J 5APYA 1VDFA 1JTHA 1Y9BA 2PCBB 2A06E 1L0LE 3WMM0 4I7ZB 3VYMA 1NTKE 1T3JA 1FJPA 2YKOA 2H89C 3O8ZA 1OXZA 2WSCH 3AE3C 1A02F 1S5LX 3TSIA 3L70E 1FZCC 2HPCB 4IFDK 5B66E 2C1UA 4L73A 3CXHI 3M06A 2VRSA 1GTWA 4H0LB 2K3RA 3CPWO 3NBTA 1KYOD 1SQXG 2C9NY 2QIWA 3H1JD 2FRCA 2G3AA 3D70A 4XA4A 3NXSA 3B5NB 3RBXA 3SFEC 3V2QA 2O01H 1PPJG 1BGYE 2IDBA 1BCCG 3HTKB 5CCGA 4Y99B 1EXIA 1VYDA 1BE3J 4JYCA 2IBZG 3OA8A 1N7SD 3RK2B 1KQGB 2FFDA 2ZXXA 2CPBA 3L71E 1YJNP 4PW9B 2HLOA 1IFMA 2R5DA 1WMKA 3H1KD 1C75A 1LT9C 2GB8B 3L75G 2LIRA 2P7JA 2XV5A 1NMIA 3SLEA 1N7SC 2QE7H 5KAFE 1KC8Q 3H32A 5KJ7A 3MP7B 3GF7A 2B87B 1LP1A 1H31A 4W80A 1CHJA 3WFEC 3FWLA 1SQQJ 3A3YB 4C7RA 2N1TB 3AECC 1BDCA 3TGUG 2GM4A 2SPZA 1LTJC 3A7OA 1HVVA 3AEGC 2W6JH 2OYHA 3V4WA 1H32B 1JY2O 3P32A 3L73D 2Y0EA 1WEJF 4L3GA 3KZIV 2MJZA 4JCGA 1BE3E 3NFQA 5CIFB 3AE4C 3MK7B 1QEXA 1QVFO 5AVZB 4YE1A 1Q86Q 1H89A 2WSEH 5CCHC 1FU1A 2HYNA 4GDOA 3GHGC 1H0TB 1C7MA 5AW4B 1OFCX 1JY2P 1BDDA 3L74J 1RE3C 1I6EA 1YTCA 1L4AB 2KIKA 1PV3A 5AVTB 1KILA 1E2RA 3G6EP 1RF1A 3KZIH 1ZW0A 1C6SA 1SS1A 2Z5HA 1YHQP 2FWLA 1VQ4P 3CWBG 2AEJA 2JR8A 3CYTI 4UB8V 1GDVA 4BRYB 3CCVP 3TDKA 1KB9E 1CI6A 2QG4A 1P84H 5AVSB 4MU8A 1Q82Q 4C7NB 2V08A 5AVVB 2ZAEB 2M0BA 5AW2B 1URQA 1NKNA 3JCUH 2A45H 4OWFA 1RAQA 2DVHA 3RK3E 4UB8H 1FZEA 4AALA 3M97X 1JCDA 1J2JB 1PP9J 4ZNCA 1M1JC 3A0BH 3CD6P 4YPCA 3MD0A 3L74E 2B11B 5E79E 4LGDE 1CIGA 1S9KE 4RO0A 2A06D 2L5GB 1FC2C 1L0LD 2KSJA 4W7ZA 5KLIC 2WSCJ 2Z5IA 3VRDA 3AEEC 4H13B 1DEBA 1OIPA 2D2CB 3AE1C 4U3FD 1JTHB 3L70D 4H0LD 4EICA 1EC5A 2OTKE 1FJKA 1IZNB 2PRRA 3C1LA 3V4QA 2M3EA 3FGAD 4DY9A 1GL2B 4IL6E 3BRTB 4JF7A 2IFNA 2ZT9C 1IK7A 2O01J 3CCLP 1T6AA 1HTLC 1NTMJ 4KJMA 1EDIA 3B5NC 1BGYD 1IZL0 1CSBA 2P67A 1J3SA 1CCRA 2ZXEB 5B5EE 1PP9E 1A2SA 3KYQA 4GYDA 4GKGA 1VF5D 2ORLA 2KLVA 2Y0CA 2XU6A 3OCDA 1W2EA 3H1LJ 3L71D 2B89A 3Q3DA 1T3UA 4LC1A 3O5CA 5APTA 1ZR2A 1K9MQ 1LJ2A 3RK2C 4GIFA 4HYTB 3OA8B 1L0NG 2YQBA 1LFMA 1SQBJ 3EWKA 2FFDB 2ZVNB 4OGQD 4N6JA 5CJ4A 1OMIA 1K73Q 1YEAA 1NKZB 1FI9A 4BWNA 1GK4A 1HH0A 2N1TD 1NTZG 4L75A 1FI7A 3II6A 2C9XB 2GUSA 3DP5A 2N18B 1RE4A 1CHHA 4EOTA 3SXTA 1USEA 4HB1A 2ZBOA 4GEDB 3RBZA 1LTSC 3CP5A 1D7MA 2IYOA 4YXWH 1E79H 1H31B 5AW9B 1KN7A 1KQLA 2N1TC 3VMYA 3WU2V 3IF4A 1KX7A 1FHBA 1NTME 5KLVJ 3C9IA 2WZ7A 1XTCC 2B88A 1LTAC 2CE1A 4H0JA 4WWIA 1BE3D 1J1DC 1GW3A 2LXCB 4ZKPA 3ZDMA 1RQVA 2E75C 2WSEJ 2OYHB 3H1LE 1FI3A 5K5GB 3AEAC 2I8DA 2XNDH 1RZ6A 1L0LK 2HODB 3MZWB 4PD4H 3I55P 1SQBE 3WU2H 1J1EB 4DT0A 2QEXP 5KKZC 4HKZH 1OZHA 3TYYA 4FA4A 1HRCA 5AURA 1FZAA 1KILE 1L4AC 1KIBA 3GF3A 1EZVI 1CRHA 1SQQD 3L72J 4WY4D 1QLED
chains in the Genus database with same CATH topology
1CIEA 3C2CA 1CHIA 1N9CA 4Q5PA 1GIWA 2N3BA 1U75B 2FYNB 2HV4A 2YIUB 4FA9A 1M60A 2N9IA 3L4MA 1QN2A 4L1QA 1DW0A 2GC7D 1DW1A 2AI5A 3PXWA 1YIQA 3WFCC 1DW2A 1DW3A 1DVHA 4O1WA 4XYDB 2C1DA 5DF5A 1FCDC 1QYZA 1KYOW 2N3YA 5DJQC 5C9MA 1E8EA 2OZ1B 1N90A 5KLIB 2L4DA 2N18C 1A8CA 1MZ4A 2PCBB 1LC1A 1BL9A 3VYMA 1QKSA 1I54A 3VNWA 4RSZA 2MHMA 1CSXA 3RLMA 1U74B 1LS9A 2AXTV 3WC8A 2MTAC 3L74D 2KS1A 2CXBA 2C1UA 3H1HD 4PWAA 5CICB 3CWBD 1H9YA 3NBTA 4WQAA 3TF5A 2N9JA 1KYOD 3H1JD 1IRVA 4PD4D 2FRCA 4EIFA 1AKKA 1DIIC 4KMGA 3NBSA 2Q3EA 1YEBA 3A0BV 1A56A 1CXAA 4Y5RA 1GJQA 1YICA 3PHLA 1CYCA 4FA1A 5CIDB 1N50A 2B4ZA 4WQEA 3ZOXA 1H1OA 1VYDA 1CRIA 3HQ7A 3OA8A 2ZONG 2N9YB 1RZ5A 2QJKB 1C52A 2B0ZB 4PW9B 2BLFB 1CSVA 3H1KD 3CX5W 1C75A 4AAOA 1HCMA 5TISV 5KAIV 3SJLA 1CRCA 2GB8B 2LIRA 1PP9D 1NMIA 3SLEA 4EIDA 1I8PA 1R0QA 2I8FA 1AOFA 1HZVA 1HJ4A 1I55A 4FANA 5CIHB 2QJYB 1L9BC 1H31A 1CHJA 3WFEC 2GIWA 3FWLA 1CRYA 1CSWA 3OCDB 1B7VA 2L91A 2XTSB 3CX5D 1KB9D 4A7PA 3JBTB 1IRWA 3PXSA 1GU2A 4LJIA 3H1ID 1H32B 4V2KA 5B66V 3L73D 1KB0A 4RJTA 2Y0EA 1WEJF 4L3GA 3KZIV 3WFDC 3X39A 4L3HA 4JCGA 3A0HV 1EB7A 1C2RA 5CIFB 3MK7B 1AOQA 1CO6A 5GTHV 5CIBB 4YE1A 2QJPB 3NWVA 2VHDA 4J20A 1RAPA 1NTMD 2PACA 1C7MA 1CYJA 5EXQA 2LITA 1I6EA 1H9XA 1E29A 1YTCA 4WQCA 4FAVA 1E2RA 3GW6A 5GTIV 3H1LD 1L0ND 3PH2B 5C0ZA 1CIFA 1CRGA 2DGEA 3WUIA 1C6SA 1CEDA 2FWLA 3ZOOA 3SWSA 5CIGB 1NIRA 1CXCA 1AYGA 3CYTI 4UB8V 1NU1D 1SQBD 1GDVA 3ORVA 1NTZD 3TDKA 2OZ1A 3ZOWA 3GG2A 1F1FA 2QG4A 2JQRA 1H33B 5KAFV 4MU8A 3PTZA 2C1VA 1CRJA 4AANA 5IY51 2V08A 3ZBMA 1RAQA 2DVHA 451CA 3HQ6A 3KHUA 1I6DA 4AALA 3M97X 5KLVD 3A9FA 2ZXYA 4QAOA 2B11B 3DR0A 2BCNB 1CIGA 5B6QA 2EXVA 3SVWA 2A06D 1ZZHA 4K3IA 1L0LD 1S5LV 4FA5A 1DT1A 2C1DB 3CXHW 1WVEC 3MK7C 5TJHA 4WQBA 1MG3D 3HQ9A 2D0SA 3VRDA 2JTIB 4U3FD 1C6OA 3L70D 1C2NA 1M70A 3ZCFA 2Y0DA 4EICA 1CC5A 4WQDA 1MG2D 5DFSA 2JWAA 3VMAA 2BCCD 3RN0A 1K3HA 4DY9A 1YNRA 3L72D 2CA4B 1LC2A 1CNOA 1GQ1A 3CXHD 4WQ9A 2B10B 2V07A 1QL3A 1P84D 5CIEB 3RN1A 5KKZB 1BGYD 1IZL0 351CA 4EIEA 1J3SA 1LMSA 1CCRA 1CSUA 4PJ0V 1A2SA 1GKSA 1C6RA 4GYDA 1DIQC 2ORLA 1HZUA 1ZRTD 2Y0CA 1YCCA 3PLNA 3OCDA 1COTA 3L71D 4H0KA 3WFBC 4WQ8A 3O5CA 1I8OA 4AX3A 2RN0A 1L9JC 4N0KA 1CTYA 3OA8B 2YQBA 2C2CA 1LFMA 1SQVD 3PXTA 3O0RC 1I5TA 1HJ5A 1H32A 1CCHA 1CTJA 2D0WA 2YCCA 1YEAA 4EDFA 1FI9A 2AIUA 2RMZA 4UB6V 3ITKA 1SQXD 3DMIA 1IO3A 1HJ3A 1HH7A 2B12B 1JDLA 5DJQB 1FI7A 5E79V 2C9XB 4WQ7A 3DP5A 2N18B 1HROA 1CHHA 2C8SA 1YFCA 3SXTA 1FJ0A 1W2LA 4NFGB 2ZBOA 4AAMA 155CA 1OCDA 4GEDB 1S6VB 2BGVX 3O20A 3CP5A 1PPJD 1H31B 1KX2A 1CORA 2YK3A 2BH5X 1BCCD 2ZZS1 2K9JB 2PCCB 3WU2V 2KNCB 1KX7A 3PRJA 1FHBA 2IBZD 3ZOYA 3O1YA 1EZVD 1OAEA 1SQPD 2CE1A 2GC4D 1CIHA 1QL4A 4H0JA 1BE3D 1W5CT 3BCCD 3L4OA 2CA3B 1ETPA 1NMLA 5CYTR 3RMZA 3TYIA 2BPBB 1FI3A 3L75D 4IL6V 1NTKD 1CYIA 1IQCA 4FB1A 1KV9A 1RZ6A 2CE0A 1FOCA 1H33A 4O1QA 1DVVA 3CU4A 4P4QB 1CTZA 1NNOA 3HQ8A 4FA4A 1M6ZA 1HRCA 5AURA 1K3GA 3ZIYA 5B5EV 2BH4X 4D6TD 2FYUD 2O3JA 5H2FV 3TGUD 1KIBA 2ZOOA 1N15A 1F1CA 4XXLA 1CRHA 1SQQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CIE A;  3C2C A;  1CHI A;  1N9C A;  4Q5P A;  1GIW A;  2N3B A;  1U75 B;  2FYN B;  2HV4 A;  2YIU B;  4FA9 A;  1M60 A;  2N9I A;  3L4M A;  1QN2 A;  4L1Q A;  1DW0 A;  2GC7 D;  1DW1 A;  2AI5 A;  3PXW A;  1YIQ A;  3WFC C;  1DW2 A;  1DW3 A;  1DVH A;  4O1W A;  4XYD B;  2C1D A;  5DF5 A;  1FCD C;  1QYZ A;  1KYO W;  2N3Y A;  5DJQ C;  5C9M A;  1E8E A;  2OZ1 B;  1N90 A;  5KLI B;  2L4D A;  2N18 C;  1A8C A;  1MZ4 A;  2PCB B;  1LC1 A;  1BL9 A;  3VYM A;  1QKS A;  1I54 A;  3VNW A;  4RSZ A;  2MHM A;  1CSX A;  3RLM A;  1U74 B;  1LS9 A;  2AXT V;  3WC8 A;  2MTA C;  3L74 D;  2KS1 A;  2CXB A;  2C1U A;  3H1H D;  4PWA A;  5CIC B;  3CWB D;  1H9Y A;  3NBT A;  4WQA A;  3TF5 A;  2N9J A;  1KYO D;  3H1J D;  1IRV A;  4PD4 D;  2FRC A;  4EIF A;  1AKK A;  1DII C;  4KMG A;  3NBS A;  2Q3E A;  1YEB A;  3A0B V;  1A56 A;  1CXA A;  4Y5R A;  1GJQ A;  1YIC A;  3PHL A;  1CYC A;  4FA1 A;  5CID B;  1N50 A;  2B4Z A;  4WQE A;  3ZOX A;  1H1O A;  1VYD A;  1CRI A;  3HQ7 A;  3OA8 A;  2ZON G;  2N9Y B;  1RZ5 A;  2QJK B;  1C52 A;  2B0Z B;  4PW9 B;  2BLF B;  1CSV A;  3H1K D;  3CX5 W;  1C75 A;  4AAO A;  1HCM A;  5TIS V;  5KAI V;  3SJL A;  1CRC A;  2GB8 B;  2LIR A;  1PP9 D;  1NMI A;  3SLE A;  4EID A;  1I8P A;  1R0Q A;  2I8F A;  1AOF A;  1HZV A;  1HJ4 A;  1I55 A;  4FAN A;  5CIH B;  2QJY B;  1L9B C;  1H31 A;  1CHJ A;  3WFE C;  2GIW A;  3FWL A;  1CRY A;  1CSW A;  3OCD B;  1B7V A;  2L91 A;  2XTS B;  3CX5 D;  1KB9 D;  4A7P A;  3JBT B;  1IRW A;  3PXS A;  1GU2 A;  4LJI A;  3H1I D;  1H32 B;  4V2K A;  5B66 V;  3L73 D;  1KB0 A;  4RJT A;  2Y0E A;  1WEJ F;  4L3G A;  3KZI V;  3WFD C;  3X39 A;  4L3H A;  4JCG A;  3A0H V;  1EB7 A;  1C2R A;  5CIF B;  3MK7 B;  1AOQ A;  1CO6 A;  5GTH V;  5CIB B;  4YE1 A;  2QJP B;  3NWV A;  2VHD A;  4J20 A;  1RAP A;  1NTM D;  2PAC A;  1C7M A;  1CYJ A;  5EXQ A;  2LIT A;  1I6E A;  1H9X A;  1E29 A;  1YTC A;  4WQC A;  4FAV A;  1E2R A;  3GW6 A;  5GTI V;  3H1L D;  1L0N D;  3PH2 B;  5C0Z A;  1CIF A;  1CRG A;  2DGE A;  3WUI A;  1C6S A;  1CED A;  2FWL A;  3ZOO A;  3SWS A;  5CIG B;  1NIR A;  1CXC A;  1AYG A;  3CYT I;  4UB8 V;  1NU1 D;  1SQB D;  1GDV A;  3ORV A;  1NTZ D;  3TDK A;  2OZ1 A;  3ZOW A;  3GG2 A;  1F1F A;  2QG4 A;  2JQR A;  1H33 B;  5KAF V;  4MU8 A;  3PTZ A;  2C1V A;  1CRJ A;  4AAN A;  5IY5 1;  2V08 A;  3ZBM A;  1RAQ A;  2DVH A;  451C A;  3HQ6 A;  3KHU A;  1I6D A;  4AAL A;  3M97 X;  5KLV D;  3A9F A;  2ZXY A;  4QAO A;  2B11 B;  3DR0 A;  2BCN B;  1CIG A;  5B6Q A;  2EXV A;  3SVW A;  2A06 D;  1ZZH A;  4K3I A;  1L0L D;  1S5L V;  4FA5 A;  1DT1 A;  2C1D B;  3CXH W;  1WVE C;  3MK7 C;  5TJH A;  4WQB A;  1MG3 D;  3HQ9 A;  2D0S A;  3VRD A;  2JTI B;  4U3F D;  1C6O A;  3L70 D;  1C2N A;  1M70 A;  3ZCF A;  2Y0D A;  4EIC A;  1CC5 A;  4WQD A;  1MG2 D;  5DFS A;  2JWA A;  3VMA A;  2BCC D;  3RN0 A;  1K3H A;  4DY9 A;  1YNR A;  3L72 D;  2CA4 B;  1LC2 A;  1CNO A;  1GQ1 A;  3CXH D;  4WQ9 A;  2B10 B;  2V07 A;  1QL3 A;  1P84 D;  5CIE B;  3RN1 A;  5KKZ B;  1BGY D;  1IZL 0;  351C A;  4EIE A;  1J3S A;  1LMS A;  1CCR A;  1CSU A;  4PJ0 V;  1A2S A;  1GKS A;  1C6R A;  4GYD A;  1DIQ C;  2ORL A;  1HZU A;  1ZRT D;  2Y0C A;  1YCC A;  3PLN A;  3OCD A;  1COT A;  3L71 D;  4H0K A;  3WFB C;  4WQ8 A;  3O5C A;  1I8O A;  4AX3 A;  2RN0 A;  1L9J C;  4N0K A;  1CTY A;  3OA8 B;  2YQB A;  2C2C A;  1LFM A;  1SQV D;  3PXT A;  3O0R C;  1I5T A;  1HJ5 A;  1H32 A;  1CCH A;  1CTJ A;  2D0W A;  2YCC A;  1YEA A;  4EDF A;  1FI9 A;  2AIU A;  2RMZ A;  4UB6 V;  3ITK A;  1SQX D;  3DMI A;  1IO3 A;  1HJ3 A;  1HH7 A;  2B12 B;  1JDL A;  5DJQ B;  1FI7 A;  5E79 V;  2C9X B;  4WQ7 A;  3DP5 A;  2N18 B;  1HRO A;  1CHH A;  2C8S A;  1YFC A;  3SXT A;  1FJ0 A;  1W2L A;  4NFG B;  2ZBO A;  4AAM A;  155C A;  1OCD A;  4GED B;  1S6V B;  2BGV X;  3O20 A;  3CP5 A;  1PPJ D;  1H31 B;  1KX2 A;  1COR A;  2YK3 A;  2BH5 X;  1BCC D;  2ZZS 1;  2K9J B;  2PCC B;  3WU2 V;  2KNC B;  1KX7 A;  3PRJ A;  1FHB A;  2IBZ D;  3ZOY A;  3O1Y A;  1EZV D;  1OAE A;  1SQP D;  2CE1 A;  2GC4 D;  1CIH A;  1QL4 A;  4H0J A;  1BE3 D;  1W5C T;  3BCC D;  3L4O A;  2CA3 B;  1ETP A;  1NML A;  5CYT R;  3RMZ A;  3TYI A;  2BPB B;  1FI3 A;  3L75 D;  4IL6 V;  1NTK D;  1CYI A;  1IQC A;  4FB1 A;  1KV9 A;  1RZ6 A;  2CE0 A;  1FOC A;  1H33 A;  4O1Q A;  1DVV A;  3CU4 A;  4P4Q B;  1CTZ A;  1NNO A;  3HQ8 A;  4FA4 A;  1M6Z A;  1HRC A;  5AUR A;  1K3G A;  3ZIY A;  5B5E V;  2BH4 X;  4D6T D;  2FYU D;  2O3J A;  5H2F V;  3TGU D;  1KIB A;  2ZOO A;  1N15 A;  1F1C A;  4XXL A;  1CRH A;  1SQQ D; 
#chains in the Genus database with same CATH topology
 1KIL B;  3C2C A;  1S5L H;  2LR2 A;  1RF1 B;  1SLQ A;  2N3B A;  1PPJ E;  2BCC G;  2FYN B;  3M9H A;  2ZYD A;  2NPS A;  2R44 A;  1PZQ A;  2AI5 A;  3E1R A;  1YIQ A;  1DVH A;  4K3A A;  3D6Z A;  2C1D A;  1FE6 A;  1KQS O;  1JM0 A;  1CI6 B;  2HG5 D;  2Q1K A;  1N90 A;  3USS A;  1OVR A;  2L4D A;  1NAY A;  3IAO A;  3CME P;  3RK3 D;  3KXD A;  2KZJ A;  1FDM A;  3W68 A;  3CL3 D;  3VNW A;  1CSX A;  2JKV A;  1SQV J;  1URQ B;  4GOD A;  2AXT V;  1ZOY C;  3L74 D;  2CXB A;  1Z56 A;  5CIC B;  1S9K D;  1KB9 H;  3KZI E;  1NU1 K;  4H13 D;  1FOS F;  1H9Y A;  2OTL P;  1IFN A;  3TF5 A;  2N9J A;  2LXB A;  4RES B;  5KTB A;  3VMX A;  3L72 E;  4EIF A;  1AQT A;  3GHG B;  4KMG A;  1FZF A;  2WSS H;  2Q3E A;  4GOE A;  4H44 B;  3TK1 A;  2D2C C;  1YEB A;  3FXE A;  1LWU A;  3TNU A;  3F5H A;  2Q6Q A;  1GL2 D;  1P84 E;  4IFM A;  1YIC A;  3LIE A;  4PV1 D;  1USD A;  5APX A;  4FA1 A;  1SQP J;  3VTP C;  1N50 A;  5CBN A;  4DCK A;  4WB4 A;  1CRI A;  1ZRT E;  5E79 H;  2N9Y B;  1C52 A;  4NPE A;  4UB8 E;  1NTK J;  4YXD C;  3BCC G;  3CX5 W;  2WPS A;  4O9B A;  3SJL A;  4JQ0 D;  1SQV E;  2KOG A;  4NPF X;  3Q5S A;  1PP9 D;  1M1K Q;  1K05 A;  5CCG D;  1HF9 A;  2K88 A;  1QL2 A;  1I55 A;  2QJY B;  2KSE A;  2KI7 B;  2OTJ P;  3KDP B;  1N86 A;  2POH A;  3VP8 A;  2KNC A;  2FYU G;  2LKM A;  1M57 D;  4KT0 J;  3OCD B;  5CCG C;  2L91 A;  2XTS B;  3HE5 A;  1YQ3 C;  1SQQ K;  1AQ5 A;  2FFD C;  4A7P A;  3JBT B;  3UIA A;  2G8Y A;  5KJ7 D;  1GU2 A;  1EXJ A;  4LJI A;  3HD7 A;  1K8A Q;  1MZ9 A;  1KB0 A;  2QRX A;  1SQP E;  4Z1M H;  3WFD C;  1DX7 A;  3A0H V;  2ZJS E;  5CMZ A;  2H88 C;  3MUD A;  3N4X A;  1AOQ A;  1CO6 A;  2M5A A;  3MTU E;  5KJ7 C;  3RL0 B;  4J20 A;  1NTM D;  1KD1 Q;  1HJB A;  1Q90 D;  1FBM A;  1YYC A;  2CPS A;  4WQC A;  4FAV A;  1MFZ A;  1FAV A;  3H1H J;  2HFE D;  5AVX B;  1YBK A;  1KB9 I;  1NO4 A;  3GW6 A;  2KYV A;  5GTI V;  3H1L D;  3CCU P;  5C0Z A;  3VYI A;  1JOC A;  1CED A;  5AVQ B;  4ASW A;  3ZOO A;  1HGV A;  2OYH C;  1AYG A;  2ZT9 B;  1SQB D;  3AE9 C;  3H1J G;  1NHL A;  2JEE A;  1SFC A;  1VL2 A;  2YKQ A;  1J1E C;  1KIL D;  1FDI A;  2XKM A;  3S9O A;  1JY3 O;  2QM8 A;  2C1V A;  4KHX A;  3U1C A;  1KZU B;  1CRJ A;  2O01 N;  1IFD A;  3CLQ A;  3HE4 A;  1EDK A;  3P8C D;  5M1B A;  1LTB C;  3L37 A;  1KIL C;  1VQN P;  1RF1 C;  5KLV D;  1G1J A;  2FYN C;  3H1K G;  1JY3 P;  3DR0 A;  1IFP A;  1AVO A;  1T2K C;  2NPS B;  2KUB A;  3H1H E;  1CW5 A;  2Y9Y A;  1IO4 A;  3V2R A;  4K3I A;  1YJW P;  4XFJ A;  1X22 A;  3I5C A;  2C1D B;  3CXH W;  1L2P A;  4WQB A;  1X8Y A;  1MG3 D;  3CCR P;  2P10 A;  3QWO C;  2JTI B;  4PD4 E;  2WPV B;  3LID A;  4D6T G;  2ZFC A;  2FYU K;  3WU2 E;  3ZCF A;  1JY2 N;  1NTZ E;  4WQD A;  2J5U A;  1URQ C;  3V5B A;  1QL1 A;  3H1I J;  5CCH D;  2JWA A;  1J1D B;  1YTZ I;  3VMA A;  3B4S A;  2E75 B;  2BEZ F;  4NPD A;  1S5L E;  1YNR A;  3L72 D;  2CA4 B;  2YXQ B;  1AFO A;  3L73 G;  1AV1 A;  4EIJ A;  3FX0 A;  2B10 B;  2O1K A;  1P84 D;  5CIE B;  5KKZ B;  3WUU A;  351C A;  4EIE A;  1KTM A;  5AVY B;  4H44 C;  1KQF B;  4PJ0 V;  1VQM P;  1GDT A;  2WVR A;  1GKS A;  3LW5 J;  2H43 A;  1NTM K;  1C6R A;  2QM7 A;  1LWU B;  1HZU A;  2WIT A;  1ZRT D;  3TNU B;  2Q7C A;  3WUV A;  4H0K A;  3WFB C;  1I8O A;  1OVU A;  2R3C A;  1CTY A;  1SQV D;  3CMA P;  3O0R C;  1AA0 A;  2E76 B;  4GOF A;  1I5T A;  1CCH A;  1CTJ A;  1N7L A;  1FZB A;  2AIU A;  3ITK A;  3L35 A;  4PJ0 H;  3CCS P;  3DMI A;  2CK3 H;  1SQB K;  1IO3 A;  2B12 B;  1JDL A;  3H1I E;  2DW3 A;  3MHV A;  2QVA A;  1HRO A;  2QJY C;  1S6V B;  2BGV X;  3O20 A;  2FKW B;  1COR A;  3IR9 A;  2AXT E;  2KNC B;  3PRJ A;  3OAK A;  3FXD A;  5AW1 B;  1Q81 Q;  1X79 B;  3Q2Y A;  2NRG A;  1EZV D;  1OAE A;  1SQP D;  3HE5 B;  2PP6 A;  1QL4 A;  1SVF A;  5KLV K;  3RL0 D;  3L4O A;  1ETP A;  1NML A;  4N78 E;  3HD7 B;  5CYT R;  3RMZ A;  1PL5 A;  3SWK A;  1S4X A;  2BPB B;  3SSU A;  3A2A A;  1NTK D;  1VQ8 P;  1GW4 A;  1IQC A;  4FB1 A;  2A06 G;  3V2P A;  1L0L G;  1BSN A;  1A02 J;  1LTI C;  1FOC A;  2JDI H;  2M5A B;  1H33 A;  4O1Q A;  1RE4 C;  3CU4 A;  3RL0 C;  1NNO A;  3F89 A;  4U3F G;  2PFX A;  1K3G A;  2O3J A;  2IBZ I;  2ZT9 D;  3M0D C;  3B5N D;  1YIJ P;  1N15 A;  2FXM A;  1N9C A;  4Q5P A;  2YO3 A;  5CBO A;  3OW2 O;  5BU5 A;  2E5T A;  4L1Q A;  1PGP A;  2QA4 P;  1DW0 A;  1SP4 A;  1AJY A;  3RK2 D;  1DW3 A;  1XTG B;  3CI9 A;  3NTN A;  1KYO W;  5DJQ C;  1BGY G;  5C9M A;  1E8E A;  1SFC B;  1S1C X;  3V6I A;  1MZ4 A;  1LC1 A;  1OX3 A;  1BL9 A;  3AE5 C;  1QKS A;  1I54 A;  4RSZ A;  2MHM A;  3L71 G;  3RLM A;  1ZP0 C;  1U57 A;  2NPS D;  1LS9 A;  3HE4 B;  2IFM A;  3G71 P;  3WC8 A;  2E74 B;  2MTA C;  1WT6 A;  1SQX J;  3H1H D;  1SQV K;  3CX5 H;  1NU1 G;  1HBW A;  2ZYA A;  3A0H E;  3OJA B;  3E7K A;  1P84 I;  4WQA A;  2NPS C;  3BAT A;  3T97 A;  1N8R Q;  3NMD A;  4PD4 D;  2YMK A;  3H32 B;  1YI2 P;  1AKK A;  2H7H A;  1DII C;  5AW6 B;  3VN0 A;  1LP1 B;  5AW7 B;  1BCC J;  2A45 I;  2E75 D;  1PFI A;  3M0D A;  1A56 A;  4Y5R A;  1GJQ A;  1CYC A;  1W5C E;  5CID B;  3P7K A;  5GTI E;  4WQE A;  3GLM A;  4I6M C;  2OQQ A;  2C9L Y;  2Q9I A;  2IX7 C;  3A5T A;  2ZON G;  1GK6 A;  1RZ5 A;  1Y47 A;  1SQP K;  4I1L A;  2B0Z B;  1BE3 G;  3L75 J;  4B86 A;  1UII A;  1HCM A;  2WPQ A;  1L4A D;  1NYH A;  1CRC A;  1HWT C;  1LTT C;  1H8A A;  1NTK K;  4EID A;  1I8P A;  1R0Q A;  2I8F A;  1AOF A;  2E43 A;  2WSF H;  1SQX E;  1HJ4 A;  3D6Y A;  1JMB A;  4D6T J;  2P1J A;  1L9B C;  2E76 D;  1LWU C;  3TGU J;  2PAJ A;  2GIW A;  2K9J A;  1UIX A;  3HUS A;  1B7V A;  3HTK A;  3KQG A;  1WRG A;  5AW0 B;  1SQQ G;  1W2B O;  1KB9 D;  1BCC E;  3S1K A;  3M9B A;  1LNQ A;  2E76 C;  5BVZ A;  2IBZ E;  3H1I D;  4V2K A;  2XDJ A;  2E5Y A;  1U7M A;  3CCQ P;  3VOP A;  4L3H A;  1EB7 A;  5GTH V;  2QJP B;  2VHD A;  1OW8 A;  3L75 E;  1OWA A;  2PAC A;  1KOR A;  1YTZ T;  5EXQ A;  3G4S P;  4EYY Q;  1E29 A;  1VPC A;  3CWB J;  4L76 A;  4N78 D;  5AVU B;  3B8E B;  3L74 G;  5AVR B;  1CRG A;  2DGE A;  3WUI A;  5APQ A;  2D2C D;  4D6T E;  1VQO P;  1N2D C;  3AEF C;  4R4L A;  1CZQ A;  3TGU E;  2M3B A;  3HD7 C;  5CIG B;  2YXR B;  1NIR A;  1CXC A;  2KK7 A;  4I2L C;  3MUD C;  4PJ0 E;  3CCJ P;  3CXH H;  3PH0 A;  2AXT H;  2JQR A;  1H33 B;  4N3Y B;  3VMZ A;  3MGN A;  5IY5 1;  1H0T A;  3N7N A;  3LW5 H;  5EFW B;  3RGU A;  2OYI A;  2JJL A;  3HQ6 A;  3KHU A;  1IK9 A;  1ZN5 A;  2XNX A;  1SFC D;  4CPG A;  3A9F A;  4PD4 I;  4QAO A;  2IZ1 A;  2FXO A;  2KB7 P;  2BCN B;  2Q3I A;  2EXV A;  3SVW A;  1PP9 G;  2AEM A;  3CWB E;  4BRY A;  1SFC C;  4FA5 A;  3L4F A;  4WY4 A;  5TJH A;  3HQ9 A;  2HR3 A;  1OW7 A;  1C6O A;  4XE5 B;  4ZKU A;  3IFM A;  3P8M C;  4C7N A;  1CC5 A;  3AE7 C;  1MG2 D;  5DFS A;  4GT1 A;  3O6Q A;  2NZ2 A;  2E74 C;  1PGJ A;  1ZR4 A;  1RH5 B;  2KXP B;  1AVY A;  1LGH B;  1M56 D;  3D71 A;  2N9B A;  3K5B A;  1EQ7 A;  4U7J A;  4QMA A;  1G1I A;  1S3J A;  1GQ1 A;  4WBA A;  2V07 A;  3T97 B;  3RN1 A;  1LMS A;  1CSU A;  1EDJ A;  1RY3 A;  1NTM G;  1JCC A;  1YCC A;  2WQY C;  3PLN A;  1COT A;  1L0N J;  4WQ8 A;  3PP5 A;  3A0H H;  4AX3 A;  2RN0 A;  2FYZ A;  2RH0 A;  3ABV C;  4N0K A;  3H1L G;  1Q2N A;  2C2C A;  1NU1 J;  4U3F E;  3I56 P;  2OAR A;  1NTZ J;  2WSF J;  4EDF A;  1EDL A;  1GL2 A;  4UB6 V;  1JY3 N;  3CX5 E;  1G2C A;  1SQX D;  1SQB G;  1NOH A;  1HH7 A;  3JSV C;  3M91 A;  5DJQ B;  1K04 A;  2C8S A;  1JO5 A;  5GTI H;  3BRV B;  1N73 C;  155C A;  1OCD A;  1T8Z A;  1GU4 A;  2E42 A;  1PPJ D;  1T2K D;  1BCC D;  2ZZS 1;  2K9J B;  2PCC B;  1KFN A;  2IBZ D;  1NH4 A;  5DJT B;  4YTP C;  3HUS B;  1GD2 E;  4UB6 H;  3O1Y A;  3AE8 C;  5KLV G;  3OA7 A;  3BAS A;  2JO1 A;  3QH9 A;  1L0N E;  1VF5 B;  3L75 D;  3VP9 A;  4C46 A;  1URQ D;  1CYI A;  1KYO H;  1E5W A;  1H88 A;  2QJP C;  3M0A A;  1NU1 E;  4P4Q B;  5APW A;  3G3Z A;  3HQ8 A;  2GUV A;  3IN6 A;  5APU A;  4OGQ B;  1M7L A;  4MN4 C;  2WT7 A;  2BH4 X;  4D6T D;  3D0W A;  2KP8 A;  4IFF A;  3SFD C;  5H2F V;  3TGU D;  2ZOO A;  2BCC J;  1FZC A;  2ZYG A;  4H44 D;  1NAF A;  2P58 A;  2K1A A;  2FY8 A;  1U75 B;  2ZVO B;  2K37 A;  3L72 G;  2JWD A;  2RKL A;  4JPZ B;  2YIU B;  2W83 C;  1M60 A;  4TLF A;  3L4M A;  1QN2 A;  2GC7 D;  1DW1 A;  3PXW A;  1DW2 A;  1N73 A;  4O1W A;  4XYD B;  1TU3 F;  1VQL P;  1Y8A A;  1QYZ A;  1NGM B;  1X9V A;  1RF0 C;  2BEQ D;  2W27 A;  5H2F H;  2HOD A;  1VQP P;  1LTG C;  1A8C A;  3EFF K;  1X0T A;  2IYP A;  3V2N A;  2KLU A;  2WTY A;  2A45 G;  4DZO A;  1U74 B;  5APV A;  1HUC A;  1FZG A;  4IL6 X;  2KS1 A;  5AW5 B;  2OYI B;  1NJI Q;  1SQV G;  4PWA A;  4ZMD A;  3H25 A;  3HRN A;  2W6A A;  3CWB D;  1FOS E;  1LT9 A;  5GTH E;  1SQX K;  2BCC E;  1SQQ E;  1IRV A;  1N7S A;  2IPP A;  3NBS A;  3W67 A;  4WY4 B;  3CXH E;  3A0B V;  1CXA A;  4WVZ A;  2V7Q H;  3PHL A;  3CC7 P;  2R32 A;  2B4Z A;  1M8O B;  3ZOX A;  1H1O A;  2AXC A;  1DD4 A;  2Q5U A;  3U1A A;  3FWN A;  3HQ7 A;  3BCC J;  3O6Q B;  2ITA A;  3Q1M A;  1EZV G;  1LTJ A;  1SQP G;  2QJK B;  2BLF B;  4HJG H;  1CSV A;  2J59 M;  1PIX A;  3KPE A;  4AAO A;  2YKP A;  5TIS V;  1KYO I;  5KAI V;  4OH8 B;  4EI2 A;  1JNM A;  3G9R A;  3RK3 B;  1FS0 E;  1RF0 A;  1NTK G;  3AE2 C;  1DH3 A;  2W6B A;  2FBW C;  1HZV A;  5CCH A;  3EFG A;  3L70 G;  1Q7Y Q;  2FYU J;  4FAN A;  5CIH B;  3GHG A;  2K9Y A;  1CRY A;  1NWQ A;  4AQR D;  1RE3 A;  1CSW A;  4I7Z C;  1HGZ A;  1R8E A;  1GZL A;  5TIS H;  5KAI H;  3S4R A;  2GA1 A;  1JUN A;  3CX5 D;  5DJU B;  4K35 A;  1GMJ A;  1IRW A;  3PXS A;  1RQU A;  1S72 P;  5B66 V;  4H0L C;  4RJT A;  1MFT A;  2FXP A;  3X39 A;  1G2C B;  3L36 A;  1DIP A;  4PV1 B;  1C2R A;  3BCC E;  3MIW A;  5CIB B;  3NWV A;  4JBZ A;  1IFI A;  1QVG O;  3PJS K;  5AW8 B;  1RAP A;  2O1J A;  1CYJ A;  1ZLL A;  2LIT A;  5L8R J;  1H9X A;  2B9B A;  2AEF A;  3HUS C;  1YIT P;  3M9Q A;  5B66 H;  2P2U A;  4Y99 C;  3SWF A;  5APS A;  1L0N D;  3PH2 B;  2H8P D;  1CIF A;  2FYU E;  2OGU A;  2V4H A;  3EQ2 A;  3H1H G;  3H1J J;  3SWS A;  4BXL A;  1M1J A;  3RL0 g;  3GMA A;  2OYO A;  1VF5 C;  2BAS A;  4Y28 J;  1JEK A;  1HJ0 A;  1NU1 D;  3AEB C;  1ZME C;  1OVV A;  3ORV A;  3AE6 C;  1JB0 J;  1NTZ D;  2OZ1 A;  3ZOW A;  3GG2 A;  1F1F A;  4LLH A;  4W7Y A;  5KAF V;  3PTZ A;  4OGQ C;  4AAN A;  3ZBM A;  2WT7 B;  3B71 A;  2C0W A;  2HPC A;  3H1K J;  451C A;  4M3L A;  1FZC B;  1I6D A;  2PGD A;  4OVN F;  4UB6 E;  2WPR A;  1VQ6 P;  2ZXY A;  5CHX A;  2YIU C;  1KV4 A;  1QX8 A;  5KAF H;  4DOJ A;  5B6Q A;  5AW3 B;  1MUU A;  1IC2 A;  1QGK B;  1ZZH A;  3B5N A;  4R4M A;  1S5L V;  1N73 B;  1DT1 A;  3MK7 C;  1WVE C;  1KYO E;  1VQ9 P;  2D0S A;  3H1J E;  3Q5R A;  1C2N A;  4ASV A;  1M70 A;  3CCM P;  2Y0D A;  1YJ9 P;  1S2E A;  5C39 A;  2R3S A;  2OYI C;  3C8V A;  1NVO A;  3L73 J;  2I1K A;  2KS1 B;  2BCC D;  3RN0 A;  1LT1 A;  1K3H A;  2W8Z A;  3H1I G;  3H6P A;  4TT3 H;  1LC2 A;  1CNO A;  3CC4 P;  3P8C E;  1LT9 B;  1U7J A;  1ZV8 A;  2JP3 A;  3CXH D;  4WQ9 A;  2V7Q J;  1QL3 A;  1R5L A;  2YO2 A;  3H1K E;  1N7S B;  5KLV E;  2B87 A;  2YNY A;  4WY4 C;  1JMM A;  3HD7 D;  3BVH A;  2WWW A;  5H2F E;  1DIQ C;  3CC2 P;  2R5B A;  5AVW B;  2N1T A;  3CX5 I;  5CJ0 A;  3Q5P A;  3CCE P;  2M8R A;  2WMM A;  2IZ0 A;  2QJK C;  1L9J C;  5GTH H;  4AUW A;  1L0N K;  1LTJ B;  3PXT A;  1R5S A;  1DD3 A;  1HJ5 A;  1H32 A;  2D0W A;  2YCC A;  4L74 A;  2RMZ A;  3RK3 C;  2J58 A;  1HJ3 A;  4HH2 A;  2Y9Z A;  3R2P A;  1NTZ K;  5E79 V;  1YQ4 C;  4WQ7 A;  1OW6 A;  3E1I A;  3L73 E;  5BU8 B;  1VQK P;  1BSH A;  1YFC A;  1FJ0 A;  1W2L A;  4NFG B;  1IJD B;  4AAM A;  2YMY A;  2QSI A;  4RKU J;  2Z4E A;  2W90 A;  1KX2 A;  2YK3 A;  4H13 C;  2BH5 X;  1L4A A;  1M90 Q;  2I1J A;  3ZOY A;  2GC4 D;  1CIH A;  1MKM A;  1W5C T;  1GU5 A;  3R4Y A;  3BCC D;  3WUT A;  2CA3 B;  1KFM A;  3JCU E;  1L0L J;  3TYI A;  1GL2 C;  1VQ5 P;  4PV1 C;  4IL6 V;  2KZI A;  2E74 D;  4IOI H;  3SWY A;  1VQ7 P;  1KV9 A;  2CE0 A;  4U3F J;  3A0B E;  3L70 J;  1DVV A;  1IFJ A;  1CTZ A;  4DJG A;  1KMI Z;  2C0X A;  1M6Z A;  3JC2 2;  3ZIY A;  5B5E V;  2FYU D;  1F1C A;  4XXL A;  1CIE A;  1CHI A;  2MKV A;  4IL6 H;  5KAI E;  2XZR A;  5TIS E;  1GIW A;  1PGO A;  1FDO A;  2HV4 A;  1RHZ B;  1M1J B;  4FA9 A;  1DEE G;  1BGY J;  1PGQ A;  4AYC A;  2N9I A;  2UWJ E;  3WFC C;  1EZV E;  3U59 A;  1MV8 A;  5DF5 A;  1FCD C;  2N3Y A;  1ZXG A;  5B5E H;  2OZ1 B;  4JYB A;  3AED C;  5KLI B;  2N18 C;  3L71 J;  5APY A;  1VDF A;  1JTH A;  1Y9B A;  2PCB B;  2A06 E;  1L0L E;  3WMM 0;  4I7Z B;  3VYM A;  1NTK E;  1T3J A;  1FJP A;  2YKO A;  2H89 C;  3O8Z A;  1OXZ A;  2WSC H;  3AE3 C;  1A02 F;  1S5L X;  3TSI A;  3L70 E;  1FZC C;  2HPC B;  4IFD K;  5B66 E;  2C1U A;  4L73 A;  3CXH I;  3M06 A;  2VRS A;  1GTW A;  4H0L B;  2K3R A;  3CPW O;  3NBT A;  1KYO D;  1SQX G;  2C9N Y;  2QIW A;  3H1J D;  2FRC A;  2G3A A;  3D70 A;  4XA4 A;  3NXS A;  3B5N B;  3RBX A;  3SFE C;  3V2Q A;  2O01 H;  1PPJ G;  1BGY E;  2IDB A;  1BCC G;  3HTK B;  5CCG A;  4Y99 B;  1EXI A;  1VYD A;  1BE3 J;  4JYC A;  2IBZ G;  3OA8 A;  1N7S D;  3RK2 B;  1KQG B;  2FFD A;  2ZXX A;  2CPB A;  3L71 E;  1YJN P;  4PW9 B;  2HLO A;  1IFM A;  2R5D A;  1WMK A;  3H1K D;  1C75 A;  1LT9 C;  2GB8 B;  3L75 G;  2LIR A;  2P7J A;  2XV5 A;  1NMI A;  3SLE A;  1N7S C;  2QE7 H;  5KAF E;  1KC8 Q;  3H32 A;  5KJ7 A;  3MP7 B;  3GF7 A;  2B87 B;  1LP1 A;  1H31 A;  4W80 A;  1CHJ A;  3WFE C;  3FWL A;  1SQQ J;  3A3Y B;  4C7R A;  2N1T B;  3AEC C;  1BDC A;  3TGU G;  2GM4 A;  2SPZ A;  1LTJ C;  3A7O A;  1HVV A;  3AEG C;  2W6J H;  2OYH A;  3V4W A;  1H32 B;  1JY2 O;  3P32 A;  3L73 D;  2Y0E A;  1WEJ F;  4L3G A;  3KZI V;  2MJZ A;  4JCG A;  1BE3 E;  3NFQ A;  5CIF B;  3AE4 C;  3MK7 B;  1QEX A;  1QVF O;  5AVZ B;  4YE1 A;  1Q86 Q;  1H89 A;  2WSE H;  5CCH C;  1FU1 A;  2HYN A;  4GDO A;  3GHG C;  1H0T B;  1C7M A;  5AW4 B;  1OFC X;  1JY2 P;  1BDD A;  3L74 J;  1RE3 C;  1I6E A;  1YTC A;  1L4A B;  2KIK A;  1PV3 A;  5AVT B;  1KIL A;  1E2R A;  3G6E P;  1RF1 A;  3KZI H;  1ZW0 A;  1C6S A;  1SS1 A;  2Z5H A;  1YHQ P;  2FWL A;  1VQ4 P;  3CWB G;  2AEJ A;  2JR8 A;  3CYT I;  4UB8 V;  1GDV A;  4BRY B;  3CCV P;  3TDK A;  1KB9 E;  1CI6 A;  2QG4 A;  1P84 H;  5AVS B;  4MU8 A;  1Q82 Q;  4C7N B;  2V08 A;  5AVV B;  2ZAE B;  2M0B A;  5AW2 B;  1URQ A;  1NKN A;  3JCU H;  2A45 H;  4OWF A;  1RAQ A;  2DVH A;  3RK3 E;  4UB8 H;  1FZE A;  4AAL A;  3M97 X;  1JCD A;  1J2J B;  1PP9 J;  4ZNC A;  1M1J C;  3A0B H;  3CD6 P;  4YPC A;  3MD0 A;  3L74 E;  2B11 B;  5E79 E;  4LGD E;  1CIG A;  1S9K E;  4RO0 A;  2A06 D;  2L5G B;  1FC2 C;  1L0L D;  2KSJ A;  4W7Z A;  5KLI C;  2WSC J;  2Z5I A;  3VRD A;  3AEE C;  4H13 B;  1DEB A;  1OIP A;  2D2C B;  3AE1 C;  4U3F D;  1JTH B;  3L70 D;  4H0L D;  4EIC A;  1EC5 A;  2OTK E;  1FJK A;  1IZN B;  2PRR A;  3C1L A;  3V4Q A;  2M3E A;  3FGA D;  4DY9 A;  1GL2 B;  4IL6 E;  3BRT B;  4JF7 A;  2IFN A;  2ZT9 C;  1IK7 A;  2O01 J;  3CCL P;  1T6A A;  1HTL C;  1NTM J;  4KJM A;  1EDI A;  3B5N C;  1BGY D;  1IZL 0;  1CSB A;  2P67 A;  1J3S A;  1CCR A;  2ZXE B;  5B5E E;  1PP9 E;  1A2S A;  3KYQ A;  4GYD A;  4GKG A;  1VF5 D;  2ORL A;  2KLV A;  2Y0C A;  2XU6 A;  3OCD A;  1W2E A;  3H1L J;  3L71 D;  2B89 A;  3Q3D A;  1T3U A;  4LC1 A;  3O5C A;  5APT A;  1ZR2 A;  1K9M Q;  1LJ2 A;  3RK2 C;  4GIF A;  4HYT B;  3OA8 B;  1L0N G;  2YQB A;  1LFM A;  1SQB J;  3EWK A;  2FFD B;  2ZVN B;  4OGQ D;  4N6J A;  5CJ4 A;  1OMI A;  1K73 Q;  1YEA A;  1NKZ B;  1FI9 A;  4BWN A;  1GK4 A;  1HH0 A;  2N1T D;  1NTZ G;  4L75 A;  1FI7 A;  3II6 A;  2C9X B;  2GUS A;  3DP5 A;  2N18 B;  1RE4 A;  1CHH A;  4EOT A;  3SXT A;  1USE A;  4HB1 A;  2ZBO A;  4GED B;  3RBZ A;  1LTS C;  3CP5 A;  1D7M A;  2IYO A;  4YXW H;  1E79 H;  1H31 B;  5AW9 B;  1KN7 A;  1KQL A;  2N1T C;  3VMY A;  3WU2 V;  3IF4 A;  1KX7 A;  1FHB A;  1NTM E;  5KLV J;  3C9I A;  2WZ7 A;  1XTC C;  2B88 A;  1LTA C;  2CE1 A;  4H0J A;  4WWI A;  1BE3 D;  1J1D C;  1GW3 A;  2LXC B;  4ZKP A;  3ZDM A;  1RQV A;  2E75 C;  2WSE J;  2OYH B;  3H1L E;  1FI3 A;  5K5G B;  3AEA C;  2I8D A;  2XND H;  1RZ6 A;  1L0L K;  2HOD B;  3MZW B;  4PD4 H;  3I55 P;  1SQB E;  3WU2 H;  1J1E B;  4DT0 A;  2QEX P;  5KKZ C;  4HKZ H;  1OZH A;  3TYY A;  4FA4 A;  1HRC A;  5AUR A;  1FZA A;  1KIL E;  1L4A C;  1KIB A;  3GF3 A;  1EZV I;  1CRH A;  1SQQ D;  3L72 J;  4WY4 D;  1QLE D; 
#chains in the Genus database with same CATH homology
 1CIE A;  3C2C A;  1CHI A;  1N9C A;  4Q5P A;  1GIW A;  2N3B A;  1U75 B;  2FYN B;  2HV4 A;  2YIU B;  4FA9 A;  1M60 A;  2N9I A;  3L4M A;  1QN2 A;  4L1Q A;  1DW0 A;  2GC7 D;  1DW1 A;  2AI5 A;  3PXW A;  1YIQ A;  3WFC C;  1DW2 A;  1DW3 A;  1DVH A;  4O1W A;  4XYD B;  2C1D A;  5DF5 A;  1FCD C;  1QYZ A;  1KYO W;  2N3Y A;  5DJQ C;  5C9M A;  1E8E A;  2OZ1 B;  1N90 A;  5KLI B;  2L4D A;  2N18 C;  1A8C A;  1MZ4 A;  2PCB B;  1LC1 A;  1BL9 A;  3VYM A;  1QKS A;  1I54 A;  3VNW A;  4RSZ A;  2MHM A;  1CSX A;  3RLM A;  1U74 B;  1LS9 A;  2AXT V;  3WC8 A;  2MTA C;  3L74 D;  2KS1 A;  2CXB A;  2C1U A;  3H1H D;  4PWA A;  5CIC B;  3CWB D;  1H9Y A;  3NBT A;  4WQA A;  3TF5 A;  2N9J A;  1KYO D;  3H1J D;  1IRV A;  4PD4 D;  2FRC A;  4EIF A;  1AKK A;  1DII C;  4KMG A;  3NBS A;  2Q3E A;  1YEB A;  3A0B V;  1A56 A;  1CXA A;  4Y5R A;  1GJQ A;  1YIC A;  3PHL A;  1CYC A;  4FA1 A;  5CID B;  1N50 A;  2B4Z A;  4WQE A;  3ZOX A;  1H1O A;  1VYD A;  1CRI A;  3HQ7 A;  3OA8 A;  2ZON G;  2N9Y B;  1RZ5 A;  2QJK B;  1C52 A;  2B0Z B;  4PW9 B;  2BLF B;  1CSV A;  3H1K D;  3CX5 W;  1C75 A;  4AAO A;  1HCM A;  5TIS V;  5KAI V;  3SJL A;  1CRC A;  2GB8 B;  2LIR A;  1PP9 D;  1NMI A;  3SLE A;  4EID A;  1I8P A;  1R0Q A;  2I8F A;  1AOF A;  1HZV A;  1HJ4 A;  1I55 A;  4FAN A;  5CIH B;  2QJY B;  1L9B C;  1H31 A;  1CHJ A;  3WFE C;  2GIW A;  3FWL A;  1CRY A;  1CSW A;  3OCD B;  1B7V A;  2L91 A;  2XTS B;  3CX5 D;  1KB9 D;  4A7P A;  3JBT B;  1IRW A;  3PXS A;  1GU2 A;  4LJI A;  3H1I D;  1H32 B;  4V2K A;  5B66 V;  3L73 D;  1KB0 A;  4RJT A;  2Y0E A;  1WEJ F;  4L3G A;  3KZI V;  3WFD C;  3X39 A;  4L3H A;  4JCG A;  3A0H V;  1EB7 A;  1C2R A;  5CIF B;  3MK7 B;  1AOQ A;  1CO6 A;  5GTH V;  5CIB B;  4YE1 A;  2QJP B;  3NWV A;  2VHD A;  4J20 A;  1RAP A;  1NTM D;  2PAC A;  1C7M A;  1CYJ A;  5EXQ A;  2LIT A;  1I6E A;  1H9X A;  1E29 A;  1YTC A;  4WQC A;  4FAV A;  1E2R A;  3GW6 A;  5GTI V;  3H1L D;  1L0N D;  3PH2 B;  5C0Z A;  1CIF A;  1CRG A;  2DGE A;  3WUI A;  1C6S A;  1CED A;  2FWL A;  3ZOO A;  3SWS A;  5CIG B;  1NIR A;  1CXC A;  1AYG A;  3CYT I;  4UB8 V;  1NU1 D;  1SQB D;  1GDV A;  3ORV A;  1NTZ D;  3TDK A;  2OZ1 A;  3ZOW A;  3GG2 A;  1F1F A;  2QG4 A;  2JQR A;  1H33 B;  5KAF V;  4MU8 A;  3PTZ A;  2C1V A;  1CRJ A;  4AAN A;  5IY5 1;  2V08 A;  3ZBM A;  1RAQ A;  2DVH A;  451C A;  3HQ6 A;  3KHU A;  1I6D A;  4AAL A;  3M97 X;  5KLV D;  3A9F A;  2ZXY A;  4QAO A;  2B11 B;  3DR0 A;  2BCN B;  1CIG A;  5B6Q A;  2EXV A;  3SVW A;  2A06 D;  1ZZH A;  4K3I A;  1L0L D;  1S5L V;  4FA5 A;  1DT1 A;  2C1D B;  3CXH W;  1WVE C;  3MK7 C;  5TJH A;  4WQB A;  1MG3 D;  3HQ9 A;  2D0S A;  3VRD A;  2JTI B;  4U3F D;  1C6O A;  3L70 D;  1C2N A;  1M70 A;  3ZCF A;  2Y0D A;  4EIC A;  1CC5 A;  4WQD A;  1MG2 D;  5DFS A;  2JWA A;  3VMA A;  2BCC D;  3RN0 A;  1K3H A;  4DY9 A;  1YNR A;  3L72 D;  2CA4 B;  1LC2 A;  1CNO A;  1GQ1 A;  3CXH D;  4WQ9 A;  2B10 B;  2V07 A;  1QL3 A;  1P84 D;  5CIE B;  3RN1 A;  5KKZ B;  1BGY D;  1IZL 0;  351C A;  4EIE A;  1J3S A;  1LMS A;  1CCR A;  1CSU A;  4PJ0 V;  1A2S A;  1GKS A;  1C6R A;  4GYD A;  1DIQ C;  2ORL A;  1HZU A;  1ZRT D;  2Y0C A;  1YCC A;  3PLN A;  3OCD A;  1COT A;  3L71 D;  4H0K A;  3WFB C;  4WQ8 A;  3O5C A;  1I8O A;  4AX3 A;  2RN0 A;  1L9J C;  4N0K A;  1CTY A;  3OA8 B;  2YQB A;  2C2C A;  1LFM A;  1SQV D;  3PXT A;  3O0R C;  1I5T A;  1HJ5 A;  1H32 A;  1CCH A;  1CTJ A;  2D0W A;  2YCC A;  1YEA A;  4EDF A;  1FI9 A;  2AIU A;  2RMZ A;  4UB6 V;  3ITK A;  1SQX D;  3DMI A;  1IO3 A;  1HJ3 A;  1HH7 A;  2B12 B;  1JDL A;  5DJQ B;  1FI7 A;  5E79 V;  2C9X B;  4WQ7 A;  3DP5 A;  2N18 B;  1HRO A;  1CHH A;  2C8S A;  1YFC A;  3SXT A;  1FJ0 A;  1W2L A;  4NFG B;  2ZBO A;  4AAM A;  155C A;  1OCD A;  4GED B;  1S6V B;  2BGV X;  3O20 A;  3CP5 A;  1PPJ D;  1H31 B;  1KX2 A;  1COR A;  2YK3 A;  2BH5 X;  1BCC D;  2ZZS 1;  2K9J B;  2PCC B;  3WU2 V;  2KNC B;  1KX7 A;  3PRJ A;  1FHB A;  2IBZ D;  3ZOY A;  3O1Y A;  1EZV D;  1OAE A;  1SQP D;  2CE1 A;  2GC4 D;  1CIH A;  1QL4 A;  4H0J A;  1BE3 D;  1W5C T;  3BCC D;  3L4O A;  2CA3 B;  1ETP A;  1NML A;  5CYT R;  3RMZ A;  3TYI A;  2BPB B;  1FI3 A;  3L75 D;  4IL6 V;  1NTK D;  1CYI A;  1IQC A;  4FB1 A;  1KV9 A;  1RZ6 A;  2CE0 A;  1FOC A;  1H33 A;  4O1Q A;  1DVV A;  3CU4 A;  4P4Q B;  1CTZ A;  1NNO A;  3HQ8 A;  4FA4 A;  1M6Z A;  1HRC A;  5AUR A;  1K3G A;  3ZIY A;  5B5E V;  2BH4 X;  4D6T D;  2FYU D;  2O3J A;  5H2F V;  3TGU D;  1KIB A;  2ZOO A;  1N15 A;  1F1C A;  4XXL A;  1CRH A;  1SQQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...