4D6TD

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
240
structure length
240
Chain Sequence
DLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
total genus 67
structure length 240
sequence length 240
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4d6tD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4d6tD02
1CIGA 3WFCC 4K3IA 2OZ1A 3JBTB 1A8CA 451CA 1YFCA 3VRDA 1FOCA 1E2RA 3ZBMA 1LC1A 5B6QA 3MK7C 5EXQA 3L75D 3A9FA 1QL3A 1LMSA 2ZZS1 3ZOYA 1I6DA 1N50A 3DMIA 2BCCD 5TISV 1CCHA 5KLVD 4AANA 4Q5PA 4JCGA 2AXTV 4LJIA 1AOQA 2A06D 4A7PA 1GQ1A 5KAIV 2LIRA 4EICA 2N9YB 1C6SA 1HROA 5C0ZA 1FI3A 1DVVA 4PJ0V 4WQEA 3PXTA 3X39A 1CIEA 3L4MA 1ZRTD 1GJQA 3L71D 1CC5A 1KX7A 5KKZB 2JWAA 2FYUD 1YCCA 1CYCA 2BLFB 1K3GA 4YE1A 1CRCA 1HCMA 2V08A 4QAOA 2ZXYA 4WQCA 1H32A 3VYMA 3PXSA 1QKSA 1R0QA 1H33A 2PACA 5CIBB 3ZOWA 2B4ZA 2L91A 4L3GA 2CA4B 3HQ8A 2BGVX 2N9JA 2N3BA 3L73D 2EXVA 4H0KA 4XYDB 5DJQC 2C1DB 1OAEA 2CE1A 1YEBA 1YIQA 3CXHW 1CSUA 1KX2A 3SVWA 1CXCA 2D0SA 1GU2A 1CRHA 1FCDC 1COTA 4RJTA 2QJPB 2QJKB 3OA8B 2RMZA 3MK7B 3ZOXA 3ZCFA 5KAFV 2V07A 3M97X 1H9XA 1U75B 2JTIB 3O1YA 1GKSA 1CHIA 3WFDC 3CP5A 1C6RA 2N9IA 3KZIV 1IO3A 5CYTR 3CWBD 1NMIA 3PXWA 3H1ID 3H1JD 1IQCA 4FAVA 4EIFA 1CEDA 1EB7A 3RLMA 2DVHA 1NNOA 4IL6V 1NTKD 4FA5A 2D0WA 2C2CA 3RMZA 4O1QA 5GTIV 1CHJA 1MZ4A 3SLEA 2VHDA 1W5CT 2KNCB 2CE0A 2YK3A 1YTCA 3PLNA 1SQQD 4AAOA 1N15A 3L4OA 1IRWA 1CSVA 2GC4D 1OCDA 1M60A 2C8SA 5CICB 5C9MA 1H1OA 1RAPA 4WQ8A 2KS1A 1NTMD 1E8EA 3WC8A 3TF5A 1EZVD 1YEAA 3NBSA 1PPJD 2ZBOA 1L0LD 2Q3EA 2GB8B 5H2FV 4GYDA 5KLIB 3H1LD 1RZ6A 2RN0A 4DY9A 1AKKA 1CCRA 4EIDA 3SWSA 1HRCA 1QN2A 3RN0A 1DT1A 4KMGA 1BE3D 1I8OA 2HV4A 3TDKA 2DGEA 1AYGA 1CRYA 1CYIA 4H0JA 5CIFB 1I8PA 2B11B 1J3SA 1KYOD 1S5LV 1RZ5A 1ZZHA 1CTJA 2BH5X 1N90A 2L4DA 4PWAA 3H1HD 1DW2A 1I6EA 2PCCB 1SQPD 4PD4D 1CTZA 1SQXD 3H1KD 4AAMA 2C1DA 4Y5RA 1B7VA 2I8FA 2MTAC 1CORA 2YQBA 2B10B 3ZOOA 3VMAA 4WQDA 3RN1A 1E29A 1CHHA 1CSXA 5IY51 3O20A 3SJLA 1KYOW 1N9CA 1KB0A 1DVHA 3DR0A 1FHBA 1F1CA 1KB9D 2C1UA 3CXHD 1MG2D 4WQAA 3C2CA 4U3FD 1NU1D 5CIHB 1WVEC 5B66V 3L72D 1WEJF 2ORLA 4XXLA 3CX5D 1HJ3A 2FWLA 4WQ7A 1CTYA 3O0RC 2YCCA 4AALA 1H31B 1DW3A 1M6ZA 2FYNB 1A2SA 1ETPA 1P84D 1HJ4A 1CNOA 1L9JC 4EDFA 2MHMA 2BH4X 2Y0DA 5AURA 1CRJA 3CX5W 2N18C 1K3HA 2GC7D 5DF5A 3VNWA 1U74B 4UB8V 3HQ9A 3L70D 1IZL0 1GDVA 2AIUA 2AI5A 4P4QB 1CXAA 2IBZD 4L3HA 2Y0EA 3NBTA 1M70A 1C2RA 3ZIYA 1BL9A 1A56A 1H9YA 2QJYB 4PW9B 2QG4A 3O5CA 1GIWA 3CU4A 2N3YA 4UB6V 1I5TA 3A0HV 1MG3D 4NFGB 4AX3A 1F1FA 2GIWA 1QYZA 1H31A 1CO6A 2O3JA 1CIFA 2JQRA 3NWVA 5E79V 1CRIA 1C2NA 2CA3B 1HZUA 351CA 4FB1A 1PP9D 5B5EV 5DJQB 1LS9A 3TYIA 3WUIA 4RSZA 5CIEB 5TJHA 3PH2B 3WU2V 1QL4A 1BCCD 3CYTI 1DW1A 1AOFA 4L1QA 1KV9A 1CSWA 4GEDB 3A0BV 1C75A 1NIRA 1I55A 2C1VA 5GTHV 3L74D 1L0ND 2OZ1B 4WQ9A 3WFEC 3SXTA 1BGYD 1JDLA 3KHUA 1IRVA 4J20A 1LC2A 1SQVD 2BCNB 2ZOOA 1NMLA 4D6TD 1VYDA 5DFSA 3FWLA 4WQBA 1S6VB 1I54A 2LITA 4V2KA 3PHLA 2BPBB 1YNRA 3PTZA 1DW0A 3ITKA 3WFBC 4O1WA 2ZONG 4MU8A 1L9BC 1FJ0A 155CA 3OCDB 2B0ZB 3DP5A 2PCBB 3ORVA 1HZVA 1HJ5A 4EIEA 1FI9A 3HQ7A 4FA4A 2CXBA 1HH7A 1RAQA 4FA9A 4N0KA 3GW6A 3PRJA 2N18B 1FI7A 2YIUB 2C9XB 1CIHA 1W2LA 4FANA 5CIDB 3OCDA 2Y0CA 3HQ6A 2FRCA 1C52A 3OA8A 1DIQC 1DIIC 1H32B 2XTSB 3TGUD 1H33B 3BCCD 1SQBD 1YICA 1C6OA 1CYJA 1CRGA 4FA1A 1KIBA 1LFMA 2B12B 2K9JB 5CIGB 1NTZD 1C7MA 3GG2A
chains in the Genus database with same CATH superfamily
1SQBG 4ASWA 1SQPJ 1IJDB 451CA 1YFCA 3VRDA 1GL2C 1E2RA 1OWAA 5EXQA 3GF3A 3V5BA 4NPFX 3A9FA 2KLVA 4MN4C 1SFCA 5H2FE 1LMSA 1L0LK 4H0LD 4GT1A 1LWUB 3IAOA 2BCCD 2WSCJ 4H44B 4Q5PA 2OYIB 1H89A 1ZMEC 2A06D 1L0NG 2YNYA 3O8ZA 1JTHA 3RL0C 2Z5HA 1VQPP 3OA7A 3PP5A 2BEZF 1NAFA 3WMM0 1GK4A 2YO3A 4I7ZC 5C0ZA 1MV8A 5AW5B 3RGUA 4D6TE 1LP1A 4RKUJ 1K8AQ 3B5ND 3PXTA 3X39A 3L4MA 2KIKA 3TGUG 1YIJP 4ZMDA 3P7KA 2RKLA 2FYUD 1CYCA 4JQ0D 4UB8E 4WBAA 1K3GA 1SFCB 4W7YA 3GF7A 2ZT9B 3L72E 5CCGC 2V08A 1S9KE 4QAOA 5AVRB 1G1IA 5CIBB 3VYIA 1LTJA 3ZOWA 2L91A 2P67A 3AE2C 2QJYC 3L70G 1IFNA 4I6MC 4L75A 1EDIA 1IK7A 2FYUE 1RQVA 2YO2A 2R5DA 2N9JA 3L73D 1Q2NA 1YEBA 1YIQA 2HYNA 1PL5A 1FE6A 1HGZA 5B5EE 1CSUA 4DT0A 1L0LJ 2D0SA 1NU1J 2NRGA 4C7RA 1COTA 1YQ3C 1KYOH 1JMMA 1L4AA 4D6TG 4IFMA 2OTKE 3ZOXA 2IFMA 1ZRTE 1VQ7P 1KYOE 1RHZB 2M3BA 3ZCFA 2V07A 1EDLA 1YJWP 2ZVNB 3CC2P 4XFJA 3WFDC 2QM8A 3CP5A 5AW7B 3CWBD 3OAKA 5B66H 1SFCC 4RESB 4EIFA 1BDCA 3N7NA 1CEDA 1OW7A 4IL6H 5DJUB 3H1JJ 3SFEC 1NNOA 4IL6V 5APVA 2HPCA 1VQMP 3HE4A 3V2RA 4FA5A 1GL2A 1NTKE 3HD7C 4O1QA 2WPVB 2PP6A 1NO4A 1L2PA 3T97A 4GDOA 1ZR4A 1MZ4A 1GK6A 5TISH 4K35A 2CE0A 4AUWA 3RL0B 2HLOA 2O01H 4JYCA 5KLIC 1N15A 2P10A 1U7MA 2GC4D 4AYCA 1S72P 1M60A 2PFXA 3VOPA 2A06G 4TT3H 4JPZB 4WQ8A 2ZYDA 1EZVD 1YEAA 1PPJD 1HTLC 2IZ1A 1NGMB 1XTGB 5KLIB 2ZXXA 2NPSA 1KN7A 2J5UA 2ZYAA 4M3LA 4EIDA 1HRCA 4GOFA 3U1AA 1LT1A 4KMGA 2WWWA 1T2KC 2A06E 1I8OA 1LNQA 2K9JA 2HV4A 3FWNA 1AYGA 1CRYA 1UIIA 2ZT9D 2R44A 4H0JA 2B11B 1RZ5A 2Q3IA 1CTJA 3WUTA 1QGKB 2L4DA 4BRYA 1DW2A 1I6EA 4IL6X 4N6JA 1VQ6P 2RH0A 1L0NJ 1AVYA 3H1KD 2ZFCA 1OX3A 1JOCA 2I8FA 3P32A 1PP9E 5CBOA 3TNUB 3VMAA 1KORA 1MUUA 4WQDA 3RN1A 1JY3P 2WPQA 1M1JA 1KB9I 2AEMA 5KAFE 2LKMA 3HRNA 1PGQA 2QVAA 3G3ZA 4LGDE 1M1KQ 1OMIA 1L0LE 2QIWA 2YXQB 2N1TB 4UB6H 1NTMJ 5AVVB 5CIHB 5B66V 4XXLA 2FWLA 4R4LA 3L75E 3O0RC 2IFNA 2KXPB 4AALA 1IFIA 3L4FA 4O9BA 1YTZI 4BRYB 4ZNCA 5AVXB 2G3AA 2E5TA 2YKQA 4WY4B 1HJ4A 1L4AC 1LT9C 2MHMA 3Q1MA 3LIEA 2V7QJ 2YIUC 2E74D 4UB8V 1ZW0A 2AI5A 4P4QB 3VMXA 3KDPB 1PV3A 3D0WA 3M0AA 1N73C 1GD2E 5M1BA 2FYNC 1C2RA 3ZIYA 1N2DC 1H9YA 2QG4A 4ASVA 2JJLA 3H1LE 5AVYB 2Z4EA 4UB6V 1S5LX 3V4QA 2OYHC 5CCGA 2N9BA 2IDBA 1CO6A 1CIFA 3GMAA 1YJNP 3L75G 4U7JA 5APXA 3TGUE 2CA3B 3MIWA 5AVQB 4FB1A 5B5EV 5DJQB 4OGQB 3CL3D 1VQ8P 2H89C 5GTHH 5TJHA 4WWIA 2KS1B 2R3SA 1BCCD 2FY8A 3L74J 1C75A 3B5NC 2AXCA 1I55A 4OWFA 3JCUH 1VQ9P 4DJGA 1KB9E 1OIPA 2W83C 4WQ9A 1L0ND 2OZ1B 3SXTA 3HD7B 5APWA 1IC2A 3R4YA 3KHUA 1J1DB 1SQVD 2BCNB 2W6JH 1RY3A 2QM7A 4D6TD 1VYDA 4N3YB 1GL2B 1FDMA 1ZV8A 4V2KA 1KQGB 3IN6A 3PHLA 3RK3D 2BPBB 3BRVB 2VRSA 3PTZA 3VN0A 1DW0A 1YQ4C 3ITKA 1JCCA 3AEEC 3H1IE 1SQXK 1SQPK 2ZONG 3HUSA 1TU3F 3A0BH 155CA 2A45G 2B0ZB 1KC8Q 1HZVA 5L8RJ 2O1JA 4FA9A 3PRJA 2XDJA 4JYBA 4FANA 1CSBA 1VPCA 1WT6A 3OA8A 1FAVA 3A2AA 3TGUD 2PGDA 1H33B 2NPSB 1X9VA 1IFDA 2C9NY 4FA1A 1KIBA 1W2BO 1W5CE 4YPCA 2K9JB 1NTZD 2HODA 3GG2A 3P8MC 4OH8B 1ZP0C 1ZLLA 3JBTB 1P84H 2KSJA 1BSHA 1A8CA 3NFQA 1AV1A 2IYOA 1H0TB 1OVVA 1VQKP 4OVNF 3MK7C 1SVFA 1FZBA 3C9IA 2FYZA 3IR9A 1Q86Q 3E7KA 3F5HA 3GHGC 1YYCA 3CXHE 3II6A 4AANA 4JCGA 5AVTB 5B5EH 1JO5A 3VP9A 1EQ7A 1N7SA 1RF1B 5KAIV 3H1LJ 2KLUA 1DEBA 4EICA 1HJ0A 1RH5B 4OGQD 3HUSB 3V4WA 1C6SA 1FI3A 1PIXA 3CCSP 1QVFO 1CIEA 1GJQA 1CC5A 4GKGA 1BGYE 1JY2N 5CCHA 2OTLP 2JWAA 1BE3G 4UB8H 1U57A 2V7QH 1CRCA 1JMBA 1NJIQ 2WT7B 4EI2A 1S9KD 2WITA 2ZXYA 4WQCA 3H1KE 3PXSA 1FZCB 1R0QA 1H33A 2GA1A 3HUSC 3L71E 3CCMP 3L75J 3G71P 4H0KA 4XYDB 4JBZA 2N1TD 1NTKJ 1OAEA 3RK2C 3CX5I 3CXHW 3H1JE 1SP4A 4W80A 1S4XA 1GU2A 4RJTA 1JY3O 3KQGA 2QJKB 1OVRA 1SQXG 1NOHA 2WQYC 3MK7B 2E5YA 3AEGC 2WMMA 1DH3A 5AVZB 2ZAEB 3AE4C 4H13D 4U3FJ 1H9XA 1DEEG 2B9BA 3JSVC 2FXMA 5APQA 2N9IA 1IO3A 2OYOA 2K88A 2OYHA 2KUBA 3L73G 4FAVA 2FXPA 5KJ7D 1FZCA 1X79B 3VMYA 2K1AA 1NTKD 2FXOA 3LIDA 1EXIA 2IX7C 2VHDA 2WSSH 2KNCB 1S3JA 2MKVA 2WSEH 1YTCA 3USSA 1HGVA 2AEFA 3W67A 1LT9A 3CI9A 1AA0A 1IRWA 1CSVA 2M5AA 1JCDA 2BCCE 1AFOA 2C8SA 4PV1C 5C9MA 1EC5A 1H1OA 1HH0A 1DD4A 1NH4A 1NTMD 3L36A 1E8EA 2OYHB 1NTMK 2N1TC 4TLFA 3SWFA 1FDIA 1X22A 1L0LD 3V2NA 2GB8B 3ZDMA 2XZRA 3U59A 4KHXA 3SWSA 4YXWH 2H43A 1QN2A 3RN0A 1PPJG 1EZVG 1J1EB 4WVZA 2DGEA 4BXLA 3D71A 1CYIA 2MJZA 1S5LV 3S9OA 1Y9BA 1M57D 3H1HD 2HODB 4EYYQ 2PCCB 4PD4D 2PRRA 1CTZA 2BCCJ 4AAMA 4Y5RA 1B7VA 1SLQA 1SQBK 2WSFJ 1VF5C 2YQBA 3MZWB 2B10B 1FOSE 5AVUB 1HVVA 1J1EC 1CSXA 1RE3A 2KZJA 4H44D 1KILE 1OW6A 2M8RA 1SQPE 3TK1A 1PP9G 1KB0A 3DR0A 2FFDB 3CXHD 1MG2D 2Y9ZA 1GW4A 4U3FD 1NU1D 4QMAA 1WVEC 1K05A 1HJ3A 5CHXA 1PGPA 3RBXA 2C9LY 3AE8C 4XE5B 2KI7B 5KAIE 2SPZA 1DW3A 5H2FH 1L4AB 1IFPA 1M6ZA 4B86A 1A2SA 2E75D 4KJMA 2FFDC 2QA4P 2E43A 5GTIE 1CNOA 1L9JC 3EQ2A 4EDFA 2Y0DA 1FJPA 1SQVK 1IO4A 1EZVE 3CX5H 5E79E 1JY3N 1E79H 5DF5A 2GC7D 3VNWA 1W2EA 1JEKA 3HQ9A 1LJ2A 1IZL0 3AEDC 1SQXJ 2OYIA 1URQC 2Y0EA 3AE7C 3H1HG 1Q7YQ 3B4SA 5APUA 3AE6C 2QJYB 5BVZA 3MP7B 1YJ9P 3L37A 4C7NB 2N3YA 1FBMA 2ZYGA 2NZ2A 1F1FA 1Y8AA 3Q5RA 1KQLA 1QYZA 2KYVA 1H8AA 1N7SD 2B87A 3NWVA 2E74C 5AW1B 1SQQJ 351CA 4EOTA 1S2EA 4N78E 4RSZA 1M7LA 3KZIH 4HH2A 2HR3A 1QL4A 3L72J 1DW1A 4U3FE 1AOFA 1KV9A 1DD3A 1CSWA 4GEDB 1FDOA 3RK3B 4HJGH 1K73Q 3TGUJ 2WSFH 2Z5IA 3TNUA 1JDLA 1IRVA 1LC2A 1KILD 1T8ZA 1NWQA 1MZ9A 5CCGD 1FZFA 2ITAA 4IOIH 3I56P 3FWLA 4WQBA 3HTKA 2LITA 1YHQP 2JWDA 1YNRA 3AE5C 2LXCB 2WSEJ 3L70J 5AW8B 1FZCC 3O6QA 3WFBC 1LTJB 1MFTA 4MU8A 1G2CB 1VL2A 2GM4A 3ORVA 5GTHE 1KQSO 2W90A 2P2UA 3H1KJ 1HJ5A 1FI9A 3HQ7A 1AQ5A 3L74E 1HBWA 1IFMA 1RAQA 4N0KA 1NVOA 2Q9IA 2N18B 1FI7A 3G9RA 2YIUB 2C9XB 1CIHA 2B87B 1KTMA 1W2LA 5CIDB 4H13B 3OCDA 5CMZA 1SQBJ 3A5TA 1SQQE 2HFED 3CD6P 2P58A 2J58A 3KYQA 3G6EP 1H32B 2XTSB 4NPEA 1CYJA 2IBZI 2KP8A 5KKZC 1CRGA 2J59M 3GLMA 5CIGB 4Z1MH 1BDDA 1CIGA 2QE7H 1YI2P 2JKVA 1ZXGA 2W27A 2OZ1A 2OARA 1CI6A 1URQB 5C39A 3O6QB 3ZBMA 1LC1A 1G2CA 3L75D 3QH9A 1QL3A 3VP8A 1HJBA 1VQNP 1L0NE 1VQ4P 1N50A 1KD1Q 3P8CD 3DMIA 3PJSK 5TISV 5KLVD 3GHGB 2K9YA 3G4SP 4UB6E 1NKNA 1GQ1A 1FC2C 1EDKA 2LXBA 4YXDC 1T3JA 2LIRA 3A0HH 5AW0B 2YXRB 2N9YB 2C0XA 2E75C 1DVVA 2FKWB 4WQEA 1LWUC 2FYUJ 3SWKA 5KKZB 1SQBE 4L76A 2B88A 3V6IA 1YCCA 2BLFB 3WU2H 4YE1A 3V2PA 1J1DC 5AW3B 2KK7A 1FS0E 3ABVC 1FU1A 2O01J 1QL1A 1H32A 1QKSA 5AW6B 1T3UA 2B4ZA 3OW2O 1BGYJ 1OXZA 4L3GA 1LGHB 3HQ8A 1E5WA 4D6TJ 1M1JB 4Y28J 1NTZE 2EXVA 5DJQC 2UWJE 2C1DB 1X8YA 2NPSD 3FXEA 3LW5J 2WVRA 3BASA 1KX2A 5CCHD 1CRHA 3B5NB 3H6PA 2K37A 3CC4P 5BU8B 2FYUK 4I1LA 1T2KD 3OA8B 2RMZA 1P84I 3L71J 3BVHA 3H1IG 5KAFV 1J2JB 5AW2B 2JTIB 1GW3A 1CHIA 2E75B 3C8VA 1NMIA 3FXDA 4GODA 3PXWA 3H1ID 1KV4A 1IQCA 3AEAC 1NU1E 3MD0A 1VDFA 5APYA 1EB7A 2DVHA 1NTME 5CJ0A 2D0WA 3RBZA 2C2CA 4DOJA 4LLHA 3RMZA 4H0LC 1BCCE 3SLEA 1KFNA 1W5CT 1SQQK 2YK3A 3PLNA 4PV1D 4GIFA 2E42A 1PP9J 5KJ7C 1SQVG 1BSNA 5APSA 4HKZH 1D7MA 3L4OA 1OCDA 1EZVI 5CICB 1NTZK 1ZN5A 2KS1A 2WPRA 4HB1A 4Y99B 3U1CA 3WUUA 3H1LD 1RZ6A 4DY9A 3L74G 2I8DA 2WPSA 5GTIH 3CX5E 2A45I 1SS1A 4GOEA 5KAIH 5CIFB 1N73A 5KJ7A 1A02F 3SFDC 2BH5X 1FZGA 1KILC 1GDTA 1FJKA 1Y47A 4H0LB 3H1HJ 2MTAC 3ZOOA 1QVGO 1PGOA 3CCJP 1NTMG 2QEXP 4I7ZB 5IY51 3O20A 3RL0D 1NU1G 1VQOP 3A7OA 1KYOW 3L73E 5AW9B 2M0BA 1L4AD 1DX7A 4PJ0E 1YITP 1L0NK 1F1CA 1KB9D 4WY4C 5TISE 2C1UA 2BASA 2ZXEB 4H13C 1Z56A 2IYPA 3IFMA 1WEJF 3CMEP 3CX5D 1NYHA 4WQ7A 2XV5A 1CTYA 1PGJA 1H31B 5EFWB 4BWNA 1DIPA 2R5BA 1URQD 3NMDA 1RF1C 2FYNB 3E1RA 1CZQA 1SFCD 1YBKA 1M1JC 1JY2P 1ZOYC 3H1HE 2OYIC 1FZEA 3H1JG 3VTPC 1CRJA 4NPDA 5AVWB 3CX5W 2QRXA 2N18C 2B89A 1K3HA 2K3RA 3EFGA 4RO0A 1HF9A 3Q3DA 2IBZD 4L3HA 1EDJA 5BU5A 3FGAD 3AEBC 3NBTA 3L71G 1BL9A 1VQ5P 3I55P 4PW9B 1GIWA 1NKZB 3CU4A 2WTYA 3CMAP 1MG3D 4NFGB 3HE5B 2I1JA 2GIWA 1BCCG 1M90Q 1H31A 1KQFB 4JF7A 1C2NA 4IFFA 3KXDA 4EIJA 1N7LA 5CIEB 4LC1A 3PH2B 3WU2V 1ZR2A 1KB9H 4R4MA 1USEA 1M8OB 1RE3C 3PH0A 1USDA 2YKOA 2PAJA 2GUSA 3L74D 2IPPA 1JTHB 5CBNA 2ZOOA 2E74B 4WB4A 2OGUA 1NMLA 3CCQP 5DFSA 1PZQA 1S6VB 1IFJA 1HWTC 1I54A 1SQVJ 3HD7A 1RE4C 4O1WA 3RK3C 1NU1K 1FJ0A 2PCBB 2E76B 2YMKA 1JUNA 2JEEA 3LW5H 2CXBA 4W7ZA 1HH7A 4CPGA 2N1TA 3CCUP 1H88A 2Y0CA 3HQ6A 1C52A 1LP1B 1DIQC 3CCEP 2C0WA 2POHA 2FYUG 3BCCD 1SQBD 1YICA 1R8EA 2M3EA 3L70E 1MFZA 1SQVE 1G1JA 3AE1C 1RF0A 1LFMA 2B12B 1C7MA 2WSCH 3WFCC 4K3IA 2P1JA 1QLED 1GU5A 3RK2B 2HG5D 3WU2E 3L73J 1LTGC 2OQQA 3RK2D 1BGYG 1KMIZ 1FOCA 5AW4B 1KYOI 5B6QA 1LTJC 1S1CX 4PD4H 3HE4B 1WMKA 3UIAA 3CWBG 2KB7P 4H44C 3A3YB 3H32B 2ZZS1 3ZOYA 1I6DA 1NTKK 3T97B 1CCHA 2AXTV 2O01N 1JB0J 4LJIA 3WUVA 1AOQA 4A7PA 1CW5A 1YTZT 2Y9YA 5E79H 1MKMA 1WRGA 1LTTC 1S5LH 3RK3E 1RF0C 3CWBE 3CXHH 3KPEA 1R5LA 2QSIA 2I1KA 4C7NA 1HROA 1SQXE 4PJ0V 3RL0g 1ZRTD 3L71D 1KX7A 5AVSB 3NXSA 1UIXA 2YKPA 3JC22 3M9HA 2JR8A 1HCMA 1NTZG 1PFIA 1OZHA 2Q1KA 3VYMA 1RQUA 2PACA 3Q2YA 3M9QA 2H88C 1RE4A 4DZOA 3CC7P 3H25A 1T6AA 2CA4B 3OJAB 1BE3J 1URQA 1AJYA 2BGVX 3M9BA 2N3BA 2CE1A 2GUVA 1U7JA 3HTKB 3R2PA 3HE5A 3SVWA 1CXCA 3BCCJ 3FX0A 1FCDC 2QJPB 2KZIA 2W6BA 3E1IA 4C46A 2FFDA 3CLQA 1GU4A 1M56D 5KLVE 2D2CD 1Q82Q 3M97X 1U75B 3Q5PA 3O1YA 1GKSA 1N86A 1C6RA 3CXHI 2QJPC 1KZUB 3KZIV 3SWYA 5CYTR 3L35A 1K9MQ 3M0DA 4N78D 3SSUA 3H1JD 2ZVOB 3GHGA 3MTUE 4OGQC 1OFCX 1QEXA 4U3FG 1GL2D 3B8EB 1FZAA 3RLMA 3MUDC 4L73A 1OVUA 2XKMA 1H0TA 1NAYA 1GMJA 2JDIH 5GTIV 1CHJA 1LTSC 3D6ZA 4I2LC 2AXTH 2R3CA 1Q90D 3MHVA 1SQQD 2V4HA 4AAOA 5KAFH 4WY4D 1A02J 3MGNA 3H1LG 1RF1A 5KLVJ 2KNCA 1RAPA 3VMZA 1SQQG 3WC8A 2IBZG 3TF5A 1LT9B 3NBSA 4XA4A 2ZBOA 2Q3EA 5H2FV 2JP3A 3K5BA 2D2CC 3BCCE 4GYDA 2RN0A 2Q7CA 4WY4A 1AKKA 1CCRA 1IZNB 1LTAC 1DT1A 2BCCG 1BE3D 3CWBJ 3TDKA 1LTIC 1I8PA 4ZKUA 1J3SA 1KYOD 2ZJSE 1ZZHA 1P84E 1N90A 4PWAA 1K04A 1SQPD 3B71A 1SQXD 3AE9C 2C1DA 4IFDK 1NTKG 2HPCB 1CORA 1VQLP 1KILA 1AQTA 1FOSF 1SQPG 1E29A 1CHHA 3BRTB 2XNDH 2ZT9C 3QWOC 3B5NA 4PD4E 3SJLA 1BCCJ 3S1KA 3A0HE 3HD7D 1N9CA 1DVHA 3CCRP 3M06A 1FHBA 1X0TA 1S5LE 5APTA 2W8ZA 2L5GB 2BEQD 2AXTE 4WQAA 3C2CA 2DW3A 1KFMA 3L72D 1NTZJ 2ORLA 2XNXA 3D6YA 5K5GB 1VF5D 1LTBC 2O1KA 2YCCA 1VF5B 4L74A 5CJ4A 4PV1B 3A0BE 3N4XA 1ETPA 3V2QA 2FBWC 2CK3H 3C1LA 1P84D 2AEJA 3AECC 5B66E 2QJKC 4ZKPA 2BH4X 1CI6B 1KILB 5AURA 1U74B 1IK9A 3BCCG 3L70D 1JY2O 4KT0J 2Q6QA 3D70A 1GDVA 2AIUA 1GTWA 1CXAA 1HUCA 4DCKA 2IBZE 3CCVP 3TSIA 4PJ0H 1M70A 2M5AB 1A56A 3IF4A 1Q81Q 3O5CA 3BATA 5KTBA 2W6AA 3L72G 3CPWO 1I5TA 3A0HV 4AX3A 4Y99C 2CPBA 2O3JA 1BE3E 2JQRA 5E79V 1CRIA 5CCHC 1HZUA 1PP9D 1LS9A 3TYIA 3WUIA 1AVOA 2IZ0A 3CYTI 1L0LG 3M91A 4AQRD 2E76D 4L1QA 3TYYA 3A0BV 3NTNA 1NIRA 2XU6A 2C1VA 4IL6E 5GTHV 1N8RQ 3EFFK 3WFEC 5KLVK 4PD4I 1BGYD 3P8CE 4YTPC 1N7SC 1QL2A 4J20A 2P7JA 2KSEA 3CCLP 1R5SA 3H32A 2LR2A 4HYTB 1JM0A 2Q5UA 5KLVG 3MUDA 3AEFC 1N73B 1L9BC 1GZLA 3S4RA 2JO1A 3OCDB 3KZIE 3DP5A 2A45H 2KOGA 1PPJE 3M0DC 2OTJP 2NPSC 1N7SB 4EIEA 2D2CB 4FA4A 1OW8A 2WZ7A 3Q5SA 3AE3C 3GW6A 3F89A 2R32A 1JNMA 1LWUA 2YMYA 1XTCC 2FRCA 3I5CA 1DIIC 3JCUE 1QX8A 4K3AA 3H1KG 3H1IJ 2CPSA 1C6OA 3EWKA 5DJTB 1NHLA 2H8PD 3W68A 2E76C 2G8YA 2WT7A 1EXJA 2H7HA
chains in the Genus database with same CATH topology
1CIGA 3WFCC 4K3IA 2OZ1A 3JBTB 1A8CA 451CA 1YFCA 3VRDA 1FOCA 1E2RA 3ZBMA 1LC1A 5B6QA 3MK7C 5EXQA 3L75D 3A9FA 1QL3A 1LMSA 2ZZS1 3ZOYA 1I6DA 1N50A 3DMIA 2BCCD 5TISV 1CCHA 5KLVD 4AANA 4Q5PA 4JCGA 2AXTV 4LJIA 1AOQA 2A06D 4A7PA 1GQ1A 5KAIV 2LIRA 4EICA 2N9YB 1C6SA 1HROA 5C0ZA 1FI3A 1DVVA 4PJ0V 4WQEA 3PXTA 3X39A 1CIEA 3L4MA 1ZRTD 1GJQA 3L71D 1CC5A 1KX7A 5KKZB 2JWAA 2FYUD 1YCCA 1CYCA 2BLFB 1K3GA 4YE1A 1CRCA 1HCMA 2V08A 4QAOA 2ZXYA 4WQCA 1H32A 3VYMA 3PXSA 1QKSA 1R0QA 1H33A 2PACA 5CIBB 3ZOWA 2B4ZA 2L91A 4L3GA 2CA4B 3HQ8A 2BGVX 2N9JA 2N3BA 3L73D 2EXVA 4H0KA 4XYDB 5DJQC 2C1DB 1OAEA 2CE1A 1YEBA 1YIQA 3CXHW 1CSUA 1KX2A 3SVWA 1CXCA 2D0SA 1GU2A 1CRHA 1FCDC 1COTA 4RJTA 2QJPB 2QJKB 3OA8B 2RMZA 3MK7B 3ZOXA 3ZCFA 5KAFV 2V07A 3M97X 1H9XA 1U75B 2JTIB 3O1YA 1GKSA 1CHIA 3WFDC 3CP5A 1C6RA 2N9IA 3KZIV 1IO3A 5CYTR 3CWBD 1NMIA 3PXWA 3H1ID 3H1JD 1IQCA 4FAVA 4EIFA 1CEDA 1EB7A 3RLMA 2DVHA 1NNOA 4IL6V 1NTKD 4FA5A 2D0WA 2C2CA 3RMZA 4O1QA 5GTIV 1CHJA 1MZ4A 3SLEA 2VHDA 1W5CT 2KNCB 2CE0A 2YK3A 1YTCA 3PLNA 1SQQD 4AAOA 1N15A 3L4OA 1IRWA 1CSVA 2GC4D 1OCDA 1M60A 2C8SA 5CICB 5C9MA 1H1OA 1RAPA 4WQ8A 2KS1A 1NTMD 1E8EA 3WC8A 3TF5A 1EZVD 1YEAA 3NBSA 1PPJD 2ZBOA 1L0LD 2Q3EA 2GB8B 5H2FV 4GYDA 5KLIB 3H1LD 1RZ6A 2RN0A 4DY9A 1AKKA 1CCRA 4EIDA 3SWSA 1HRCA 1QN2A 3RN0A 1DT1A 4KMGA 1BE3D 1I8OA 2HV4A 3TDKA 2DGEA 1AYGA 1CRYA 1CYIA 4H0JA 5CIFB 1I8PA 2B11B 1J3SA 1KYOD 1S5LV 1RZ5A 1ZZHA 1CTJA 2BH5X 1N90A 2L4DA 4PWAA 3H1HD 1DW2A 1I6EA 2PCCB 1SQPD 4PD4D 1CTZA 1SQXD 3H1KD 4AAMA 2C1DA 4Y5RA 1B7VA 2I8FA 2MTAC 1CORA 2YQBA 2B10B 3ZOOA 3VMAA 4WQDA 3RN1A 1E29A 1CHHA 1CSXA 5IY51 3O20A 3SJLA 1KYOW 1N9CA 1KB0A 1DVHA 3DR0A 1FHBA 1F1CA 1KB9D 2C1UA 3CXHD 1MG2D 4WQAA 3C2CA 4U3FD 1NU1D 5CIHB 1WVEC 5B66V 3L72D 1WEJF 2ORLA 4XXLA 3CX5D 1HJ3A 2FWLA 4WQ7A 1CTYA 3O0RC 2YCCA 4AALA 1H31B 1DW3A 1M6ZA 2FYNB 1A2SA 1ETPA 1P84D 1HJ4A 1CNOA 1L9JC 4EDFA 2MHMA 2BH4X 2Y0DA 5AURA 1CRJA 3CX5W 2N18C 1K3HA 2GC7D 5DF5A 3VNWA 1U74B 4UB8V 3HQ9A 3L70D 1IZL0 1GDVA 2AIUA 2AI5A 4P4QB 1CXAA 2IBZD 4L3HA 2Y0EA 3NBTA 1M70A 1C2RA 3ZIYA 1BL9A 1A56A 1H9YA 2QJYB 4PW9B 2QG4A 3O5CA 1GIWA 3CU4A 2N3YA 4UB6V 1I5TA 3A0HV 1MG3D 4NFGB 4AX3A 1F1FA 2GIWA 1QYZA 1H31A 1CO6A 2O3JA 1CIFA 2JQRA 3NWVA 5E79V 1CRIA 1C2NA 2CA3B 1HZUA 351CA 4FB1A 1PP9D 5B5EV 5DJQB 1LS9A 3TYIA 3WUIA 4RSZA 5CIEB 5TJHA 3PH2B 3WU2V 1QL4A 1BCCD 3CYTI 1DW1A 1AOFA 4L1QA 1KV9A 1CSWA 4GEDB 3A0BV 1C75A 1NIRA 1I55A 2C1VA 5GTHV 3L74D 1L0ND 2OZ1B 4WQ9A 3WFEC 3SXTA 1BGYD 1JDLA 3KHUA 1IRVA 4J20A 1LC2A 1SQVD 2BCNB 2ZOOA 1NMLA 4D6TD 1VYDA 5DFSA 3FWLA 4WQBA 1S6VB 1I54A 2LITA 4V2KA 3PHLA 2BPBB 1YNRA 3PTZA 1DW0A 3ITKA 3WFBC 4O1WA 2ZONG 4MU8A 1L9BC 1FJ0A 155CA 3OCDB 2B0ZB 3DP5A 2PCBB 3ORVA 1HZVA 1HJ5A 4EIEA 1FI9A 3HQ7A 4FA4A 2CXBA 1HH7A 1RAQA 4FA9A 4N0KA 3GW6A 3PRJA 2N18B 1FI7A 2YIUB 2C9XB 1CIHA 1W2LA 4FANA 5CIDB 3OCDA 2Y0CA 3HQ6A 2FRCA 1C52A 3OA8A 1DIQC 1DIIC 1H32B 2XTSB 3TGUD 1H33B 3BCCD 1SQBD 1YICA 1C6OA 1CYJA 1CRGA 4FA1A 1KIBA 1LFMA 2B12B 2K9JB 5CIGB 1NTZD 1C7MA 3GG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CIG A;  3WFC C;  4K3I A;  2OZ1 A;  3JBT B;  1A8C A;  451C A;  1YFC A;  3VRD A;  1FOC A;  1E2R A;  3ZBM A;  1LC1 A;  5B6Q A;  3MK7 C;  5EXQ A;  3L75 D;  3A9F A;  1QL3 A;  1LMS A;  2ZZS 1;  3ZOY A;  1I6D A;  1N50 A;  3DMI A;  2BCC D;  5TIS V;  1CCH A;  5KLV D;  4AAN A;  4Q5P A;  4JCG A;  2AXT V;  4LJI A;  1AOQ A;  2A06 D;  4A7P A;  1GQ1 A;  5KAI V;  2LIR A;  4EIC A;  2N9Y B;  1C6S A;  1HRO A;  5C0Z A;  1FI3 A;  1DVV A;  4PJ0 V;  4WQE A;  3PXT A;  3X39 A;  1CIE A;  3L4M A;  1ZRT D;  1GJQ A;  3L71 D;  1CC5 A;  1KX7 A;  5KKZ B;  2JWA A;  2FYU D;  1YCC A;  1CYC A;  2BLF B;  1K3G A;  4YE1 A;  1CRC A;  1HCM A;  2V08 A;  4QAO A;  2ZXY A;  4WQC A;  1H32 A;  3VYM A;  3PXS A;  1QKS A;  1R0Q A;  1H33 A;  2PAC A;  5CIB B;  3ZOW A;  2B4Z A;  2L91 A;  4L3G A;  2CA4 B;  3HQ8 A;  2BGV X;  2N9J A;  2N3B A;  3L73 D;  2EXV A;  4H0K A;  4XYD B;  5DJQ C;  2C1D B;  1OAE A;  2CE1 A;  1YEB A;  1YIQ A;  3CXH W;  1CSU A;  1KX2 A;  3SVW A;  1CXC A;  2D0S A;  1GU2 A;  1CRH A;  1FCD C;  1COT A;  4RJT A;  2QJP B;  2QJK B;  3OA8 B;  2RMZ A;  3MK7 B;  3ZOX A;  3ZCF A;  5KAF V;  2V07 A;  3M97 X;  1H9X A;  1U75 B;  2JTI B;  3O1Y A;  1GKS A;  1CHI A;  3WFD C;  3CP5 A;  1C6R A;  2N9I A;  3KZI V;  1IO3 A;  5CYT R;  3CWB D;  1NMI A;  3PXW A;  3H1I D;  3H1J D;  1IQC A;  4FAV A;  4EIF A;  1CED A;  1EB7 A;  3RLM A;  2DVH A;  1NNO A;  4IL6 V;  1NTK D;  4FA5 A;  2D0W A;  2C2C A;  3RMZ A;  4O1Q A;  5GTI V;  1CHJ A;  1MZ4 A;  3SLE A;  2VHD A;  1W5C T;  2KNC B;  2CE0 A;  2YK3 A;  1YTC A;  3PLN A;  1SQQ D;  4AAO A;  1N15 A;  3L4O A;  1IRW A;  1CSV A;  2GC4 D;  1OCD A;  1M60 A;  2C8S A;  5CIC B;  5C9M A;  1H1O A;  1RAP A;  4WQ8 A;  2KS1 A;  1NTM D;  1E8E A;  3WC8 A;  3TF5 A;  1EZV D;  1YEA A;  3NBS A;  1PPJ D;  2ZBO A;  1L0L D;  2Q3E A;  2GB8 B;  5H2F V;  4GYD A;  5KLI B;  3H1L D;  1RZ6 A;  2RN0 A;  4DY9 A;  1AKK A;  1CCR A;  4EID A;  3SWS A;  1HRC A;  1QN2 A;  3RN0 A;  1DT1 A;  4KMG A;  1BE3 D;  1I8O A;  2HV4 A;  3TDK A;  2DGE A;  1AYG A;  1CRY A;  1CYI A;  4H0J A;  5CIF B;  1I8P A;  2B11 B;  1J3S A;  1KYO D;  1S5L V;  1RZ5 A;  1ZZH A;  1CTJ A;  2BH5 X;  1N90 A;  2L4D A;  4PWA A;  3H1H D;  1DW2 A;  1I6E A;  2PCC B;  1SQP D;  4PD4 D;  1CTZ A;  1SQX D;  3H1K D;  4AAM A;  2C1D A;  4Y5R A;  1B7V A;  2I8F A;  2MTA C;  1COR A;  2YQB A;  2B10 B;  3ZOO A;  3VMA A;  4WQD A;  3RN1 A;  1E29 A;  1CHH A;  1CSX A;  5IY5 1;  3O20 A;  3SJL A;  1KYO W;  1N9C A;  1KB0 A;  1DVH A;  3DR0 A;  1FHB A;  1F1C A;  1KB9 D;  2C1U A;  3CXH D;  1MG2 D;  4WQA A;  3C2C A;  4U3F D;  1NU1 D;  5CIH B;  1WVE C;  5B66 V;  3L72 D;  1WEJ F;  2ORL A;  4XXL A;  3CX5 D;  1HJ3 A;  2FWL A;  4WQ7 A;  1CTY A;  3O0R C;  2YCC A;  4AAL A;  1H31 B;  1DW3 A;  1M6Z A;  2FYN B;  1A2S A;  1ETP A;  1P84 D;  1HJ4 A;  1CNO A;  1L9J C;  4EDF A;  2MHM A;  2BH4 X;  2Y0D A;  5AUR A;  1CRJ A;  3CX5 W;  2N18 C;  1K3H A;  2GC7 D;  5DF5 A;  3VNW A;  1U74 B;  4UB8 V;  3HQ9 A;  3L70 D;  1IZL 0;  1GDV A;  2AIU A;  2AI5 A;  4P4Q B;  1CXA A;  2IBZ D;  4L3H A;  2Y0E A;  3NBT A;  1M70 A;  1C2R A;  3ZIY A;  1BL9 A;  1A56 A;  1H9Y A;  2QJY B;  4PW9 B;  2QG4 A;  3O5C A;  1GIW A;  3CU4 A;  2N3Y A;  4UB6 V;  1I5T A;  3A0H V;  1MG3 D;  4NFG B;  4AX3 A;  1F1F A;  2GIW A;  1QYZ A;  1H31 A;  1CO6 A;  2O3J A;  1CIF A;  2JQR A;  3NWV A;  5E79 V;  1CRI A;  1C2N A;  2CA3 B;  1HZU A;  351C A;  4FB1 A;  1PP9 D;  5B5E V;  5DJQ B;  1LS9 A;  3TYI A;  3WUI A;  4RSZ A;  5CIE B;  5TJH A;  3PH2 B;  3WU2 V;  1QL4 A;  1BCC D;  3CYT I;  1DW1 A;  1AOF A;  4L1Q A;  1KV9 A;  1CSW A;  4GED B;  3A0B V;  1C75 A;  1NIR A;  1I55 A;  2C1V A;  5GTH V;  3L74 D;  1L0N D;  2OZ1 B;  4WQ9 A;  3WFE C;  3SXT A;  1BGY D;  1JDL A;  3KHU A;  1IRV A;  4J20 A;  1LC2 A;  1SQV D;  2BCN B;  2ZOO A;  1NML A;  4D6T D;  1VYD A;  5DFS A;  3FWL A;  4WQB A;  1S6V B;  1I54 A;  2LIT A;  4V2K A;  3PHL A;  2BPB B;  1YNR A;  3PTZ A;  1DW0 A;  3ITK A;  3WFB C;  4O1W A;  2ZON G;  4MU8 A;  1L9B C;  1FJ0 A;  155C A;  3OCD B;  2B0Z B;  3DP5 A;  2PCB B;  3ORV A;  1HZV A;  1HJ5 A;  4EIE A;  1FI9 A;  3HQ7 A;  4FA4 A;  2CXB A;  1HH7 A;  1RAQ A;  4FA9 A;  4N0K A;  3GW6 A;  3PRJ A;  2N18 B;  1FI7 A;  2YIU B;  2C9X B;  1CIH A;  1W2L A;  4FAN A;  5CID B;  3OCD A;  2Y0C A;  3HQ6 A;  2FRC A;  1C52 A;  3OA8 A;  1DIQ C;  1DII C;  1H32 B;  2XTS B;  3TGU D;  1H33 B;  3BCC D;  1SQB D;  1YIC A;  1C6O A;  1CYJ A;  1CRG A;  4FA1 A;  1KIB A;  1LFM A;  2B12 B;  2K9J B;  5CIG B;  1NTZ D;  1C7M A;  3GG2 A; 
#chains in the Genus database with same CATH topology
 1SQB G;  4ASW A;  1SQP J;  1IJD B;  451C A;  1YFC A;  3VRD A;  1GL2 C;  1E2R A;  1OWA A;  5EXQ A;  3GF3 A;  3V5B A;  4NPF X;  3A9F A;  2KLV A;  4MN4 C;  1SFC A;  5H2F E;  1LMS A;  1L0L K;  4H0L D;  4GT1 A;  1LWU B;  3IAO A;  2BCC D;  2WSC J;  4H44 B;  4Q5P A;  2OYI B;  1H89 A;  1ZME C;  2A06 D;  1L0N G;  2YNY A;  3O8Z A;  1JTH A;  3RL0 C;  2Z5H A;  1VQP P;  3OA7 A;  3PP5 A;  2BEZ F;  1NAF A;  3WMM 0;  1GK4 A;  2YO3 A;  4I7Z C;  5C0Z A;  1MV8 A;  5AW5 B;  3RGU A;  4D6T E;  1LP1 A;  4RKU J;  1K8A Q;  3B5N D;  3PXT A;  3X39 A;  3L4M A;  2KIK A;  3TGU G;  1YIJ P;  4ZMD A;  3P7K A;  2RKL A;  2FYU D;  1CYC A;  4JQ0 D;  4UB8 E;  4WBA A;  1K3G A;  1SFC B;  4W7Y A;  3GF7 A;  2ZT9 B;  3L72 E;  5CCG C;  2V08 A;  1S9K E;  4QAO A;  5AVR B;  1G1I A;  5CIB B;  3VYI A;  1LTJ A;  3ZOW A;  2L91 A;  2P67 A;  3AE2 C;  2QJY C;  3L70 G;  1IFN A;  4I6M C;  4L75 A;  1EDI A;  1IK7 A;  2FYU E;  1RQV A;  2YO2 A;  2R5D A;  2N9J A;  3L73 D;  1Q2N A;  1YEB A;  1YIQ A;  2HYN A;  1PL5 A;  1FE6 A;  1HGZ A;  5B5E E;  1CSU A;  4DT0 A;  1L0L J;  2D0S A;  1NU1 J;  2NRG A;  4C7R A;  1COT A;  1YQ3 C;  1KYO H;  1JMM A;  1L4A A;  4D6T G;  4IFM A;  2OTK E;  3ZOX A;  2IFM A;  1ZRT E;  1VQ7 P;  1KYO E;  1RHZ B;  2M3B A;  3ZCF A;  2V07 A;  1EDL A;  1YJW P;  2ZVN B;  3CC2 P;  4XFJ A;  3WFD C;  2QM8 A;  3CP5 A;  5AW7 B;  3CWB D;  3OAK A;  5B66 H;  1SFC C;  4RES B;  4EIF A;  1BDC A;  3N7N A;  1CED A;  1OW7 A;  4IL6 H;  5DJU B;  3H1J J;  3SFE C;  1NNO A;  4IL6 V;  5APV A;  2HPC A;  1VQM P;  3HE4 A;  3V2R A;  4FA5 A;  1GL2 A;  1NTK E;  3HD7 C;  4O1Q A;  2WPV B;  2PP6 A;  1NO4 A;  1L2P A;  3T97 A;  4GDO A;  1ZR4 A;  1MZ4 A;  1GK6 A;  5TIS H;  4K35 A;  2CE0 A;  4AUW A;  3RL0 B;  2HLO A;  2O01 H;  4JYC A;  5KLI C;  1N15 A;  2P10 A;  1U7M A;  2GC4 D;  4AYC A;  1S72 P;  1M60 A;  2PFX A;  3VOP A;  2A06 G;  4TT3 H;  4JPZ B;  4WQ8 A;  2ZYD A;  1EZV D;  1YEA A;  1PPJ D;  1HTL C;  2IZ1 A;  1NGM B;  1XTG B;  5KLI B;  2ZXX A;  2NPS A;  1KN7 A;  2J5U A;  2ZYA A;  4M3L A;  4EID A;  1HRC A;  4GOF A;  3U1A A;  1LT1 A;  4KMG A;  2WWW A;  1T2K C;  2A06 E;  1I8O A;  1LNQ A;  2K9J A;  2HV4 A;  3FWN A;  1AYG A;  1CRY A;  1UII A;  2ZT9 D;  2R44 A;  4H0J A;  2B11 B;  1RZ5 A;  2Q3I A;  1CTJ A;  3WUT A;  1QGK B;  2L4D A;  4BRY A;  1DW2 A;  1I6E A;  4IL6 X;  4N6J A;  1VQ6 P;  2RH0 A;  1L0N J;  1AVY A;  3H1K D;  2ZFC A;  1OX3 A;  1JOC A;  2I8F A;  3P32 A;  1PP9 E;  5CBO A;  3TNU B;  3VMA A;  1KOR A;  1MUU A;  4WQD A;  3RN1 A;  1JY3 P;  2WPQ A;  1M1J A;  1KB9 I;  2AEM A;  5KAF E;  2LKM A;  3HRN A;  1PGQ A;  2QVA A;  3G3Z A;  4LGD E;  1M1K Q;  1OMI A;  1L0L E;  2QIW A;  2YXQ B;  2N1T B;  4UB6 H;  1NTM J;  5AVV B;  5CIH B;  5B66 V;  4XXL A;  2FWL A;  4R4L A;  3L75 E;  3O0R C;  2IFN A;  2KXP B;  4AAL A;  1IFI A;  3L4F A;  4O9B A;  1YTZ I;  4BRY B;  4ZNC A;  5AVX B;  2G3A A;  2E5T A;  2YKQ A;  4WY4 B;  1HJ4 A;  1L4A C;  1LT9 C;  2MHM A;  3Q1M A;  3LIE A;  2V7Q J;  2YIU C;  2E74 D;  4UB8 V;  1ZW0 A;  2AI5 A;  4P4Q B;  3VMX A;  3KDP B;  1PV3 A;  3D0W A;  3M0A A;  1N73 C;  1GD2 E;  5M1B A;  2FYN C;  1C2R A;  3ZIY A;  1N2D C;  1H9Y A;  2QG4 A;  4ASV A;  2JJL A;  3H1L E;  5AVY B;  2Z4E A;  4UB6 V;  1S5L X;  3V4Q A;  2OYH C;  5CCG A;  2N9B A;  2IDB A;  1CO6 A;  1CIF A;  3GMA A;  1YJN P;  3L75 G;  4U7J A;  5APX A;  3TGU E;  2CA3 B;  3MIW A;  5AVQ B;  4FB1 A;  5B5E V;  5DJQ B;  4OGQ B;  3CL3 D;  1VQ8 P;  2H89 C;  5GTH H;  5TJH A;  4WWI A;  2KS1 B;  2R3S A;  1BCC D;  2FY8 A;  3L74 J;  1C75 A;  3B5N C;  2AXC A;  1I55 A;  4OWF A;  3JCU H;  1VQ9 P;  4DJG A;  1KB9 E;  1OIP A;  2W83 C;  4WQ9 A;  1L0N D;  2OZ1 B;  3SXT A;  3HD7 B;  5APW A;  1IC2 A;  3R4Y A;  3KHU A;  1J1D B;  1SQV D;  2BCN B;  2W6J H;  1RY3 A;  2QM7 A;  4D6T D;  1VYD A;  4N3Y B;  1GL2 B;  1FDM A;  1ZV8 A;  4V2K A;  1KQG B;  3IN6 A;  3PHL A;  3RK3 D;  2BPB B;  3BRV B;  2VRS A;  3PTZ A;  3VN0 A;  1DW0 A;  1YQ4 C;  3ITK A;  1JCC A;  3AEE C;  3H1I E;  1SQX K;  1SQP K;  2ZON G;  3HUS A;  1TU3 F;  3A0B H;  155C A;  2A45 G;  2B0Z B;  1KC8 Q;  1HZV A;  5L8R J;  2O1J A;  4FA9 A;  3PRJ A;  2XDJ A;  4JYB A;  4FAN A;  1CSB A;  1VPC A;  1WT6 A;  3OA8 A;  1FAV A;  3A2A A;  3TGU D;  2PGD A;  1H33 B;  2NPS B;  1X9V A;  1IFD A;  2C9N Y;  4FA1 A;  1KIB A;  1W2B O;  1W5C E;  4YPC A;  2K9J B;  1NTZ D;  2HOD A;  3GG2 A;  3P8M C;  4OH8 B;  1ZP0 C;  1ZLL A;  3JBT B;  1P84 H;  2KSJ A;  1BSH A;  1A8C A;  3NFQ A;  1AV1 A;  2IYO A;  1H0T B;  1OVV A;  1VQK P;  4OVN F;  3MK7 C;  1SVF A;  1FZB A;  3C9I A;  2FYZ A;  3IR9 A;  1Q86 Q;  3E7K A;  3F5H A;  3GHG C;  1YYC A;  3CXH E;  3II6 A;  4AAN A;  4JCG A;  5AVT B;  5B5E H;  1JO5 A;  3VP9 A;  1EQ7 A;  1N7S A;  1RF1 B;  5KAI V;  3H1L J;  2KLU A;  1DEB A;  4EIC A;  1HJ0 A;  1RH5 B;  4OGQ D;  3HUS B;  3V4W A;  1C6S A;  1FI3 A;  1PIX A;  3CCS P;  1QVF O;  1CIE A;  1GJQ A;  1CC5 A;  4GKG A;  1BGY E;  1JY2 N;  5CCH A;  2OTL P;  2JWA A;  1BE3 G;  4UB8 H;  1U57 A;  2V7Q H;  1CRC A;  1JMB A;  1NJI Q;  2WT7 B;  4EI2 A;  1S9K D;  2WIT A;  2ZXY A;  4WQC A;  3H1K E;  3PXS A;  1FZC B;  1R0Q A;  1H33 A;  2GA1 A;  3HUS C;  3L71 E;  3CCM P;  3L75 J;  3G71 P;  4H0K A;  4XYD B;  4JBZ A;  2N1T D;  1NTK J;  1OAE A;  3RK2 C;  3CX5 I;  3CXH W;  3H1J E;  1SP4 A;  4W80 A;  1S4X A;  1GU2 A;  4RJT A;  1JY3 O;  3KQG A;  2QJK B;  1OVR A;  1SQX G;  1NOH A;  2WQY C;  3MK7 B;  2E5Y A;  3AEG C;  2WMM A;  1DH3 A;  5AVZ B;  2ZAE B;  3AE4 C;  4H13 D;  4U3F J;  1H9X A;  1DEE G;  2B9B A;  3JSV C;  2FXM A;  5APQ A;  2N9I A;  1IO3 A;  2OYO A;  2K88 A;  2OYH A;  2KUB A;  3L73 G;  4FAV A;  2FXP A;  5KJ7 D;  1FZC A;  1X79 B;  3VMY A;  2K1A A;  1NTK D;  2FXO A;  3LID A;  1EXI A;  2IX7 C;  2VHD A;  2WSS H;  2KNC B;  1S3J A;  2MKV A;  2WSE H;  1YTC A;  3USS A;  1HGV A;  2AEF A;  3W67 A;  1LT9 A;  3CI9 A;  1AA0 A;  1IRW A;  1CSV A;  2M5A A;  1JCD A;  2BCC E;  1AFO A;  2C8S A;  4PV1 C;  5C9M A;  1EC5 A;  1H1O A;  1HH0 A;  1DD4 A;  1NH4 A;  1NTM D;  3L36 A;  1E8E A;  2OYH B;  1NTM K;  2N1T C;  4TLF A;  3SWF A;  1FDI A;  1X22 A;  1L0L D;  3V2N A;  2GB8 B;  3ZDM A;  2XZR A;  3U59 A;  4KHX A;  3SWS A;  4YXW H;  2H43 A;  1QN2 A;  3RN0 A;  1PPJ G;  1EZV G;  1J1E B;  4WVZ A;  2DGE A;  4BXL A;  3D71 A;  1CYI A;  2MJZ A;  1S5L V;  3S9O A;  1Y9B A;  1M57 D;  3H1H D;  2HOD B;  4EYY Q;  2PCC B;  4PD4 D;  2PRR A;  1CTZ A;  2BCC J;  4AAM A;  4Y5R A;  1B7V A;  1SLQ A;  1SQB K;  2WSF J;  1VF5 C;  2YQB A;  3MZW B;  2B10 B;  1FOS E;  5AVU B;  1HVV A;  1J1E C;  1CSX A;  1RE3 A;  2KZJ A;  4H44 D;  1KIL E;  1OW6 A;  2M8R A;  1SQP E;  3TK1 A;  1PP9 G;  1KB0 A;  3DR0 A;  2FFD B;  3CXH D;  1MG2 D;  2Y9Z A;  1GW4 A;  4U3F D;  1NU1 D;  4QMA A;  1WVE C;  1K05 A;  1HJ3 A;  5CHX A;  1PGP A;  3RBX A;  2C9L Y;  3AE8 C;  4XE5 B;  2KI7 B;  5KAI E;  2SPZ A;  1DW3 A;  5H2F H;  1L4A B;  1IFP A;  1M6Z A;  4B86 A;  1A2S A;  2E75 D;  4KJM A;  2FFD C;  2QA4 P;  2E43 A;  5GTI E;  1CNO A;  1L9J C;  3EQ2 A;  4EDF A;  2Y0D A;  1FJP A;  1SQV K;  1IO4 A;  1EZV E;  3CX5 H;  5E79 E;  1JY3 N;  1E79 H;  5DF5 A;  2GC7 D;  3VNW A;  1W2E A;  1JEK A;  3HQ9 A;  1LJ2 A;  1IZL 0;  3AED C;  1SQX J;  2OYI A;  1URQ C;  2Y0E A;  3AE7 C;  3H1H G;  1Q7Y Q;  3B4S A;  5APU A;  3AE6 C;  2QJY B;  5BVZ A;  3MP7 B;  1YJ9 P;  3L37 A;  4C7N B;  2N3Y A;  1FBM A;  2ZYG A;  2NZ2 A;  1F1F A;  1Y8A A;  3Q5R A;  1KQL A;  1QYZ A;  2KYV A;  1H8A A;  1N7S D;  2B87 A;  3NWV A;  2E74 C;  5AW1 B;  1SQQ J;  351C A;  4EOT A;  1S2E A;  4N78 E;  4RSZ A;  1M7L A;  3KZI H;  4HH2 A;  2HR3 A;  1QL4 A;  3L72 J;  1DW1 A;  4U3F E;  1AOF A;  1KV9 A;  1DD3 A;  1CSW A;  4GED B;  1FDO A;  3RK3 B;  4HJG H;  1K73 Q;  3TGU J;  2WSF H;  2Z5I A;  3TNU A;  1JDL A;  1IRV A;  1LC2 A;  1KIL D;  1T8Z A;  1NWQ A;  1MZ9 A;  5CCG D;  1FZF A;  2ITA A;  4IOI H;  3I56 P;  3FWL A;  4WQB A;  3HTK A;  2LIT A;  1YHQ P;  2JWD A;  1YNR A;  3AE5 C;  2LXC B;  2WSE J;  3L70 J;  5AW8 B;  1FZC C;  3O6Q A;  3WFB C;  1LTJ B;  1MFT A;  4MU8 A;  1G2C B;  1VL2 A;  2GM4 A;  3ORV A;  5GTH E;  1KQS O;  2W90 A;  2P2U A;  3H1K J;  1HJ5 A;  1FI9 A;  3HQ7 A;  1AQ5 A;  3L74 E;  1HBW A;  1IFM A;  1RAQ A;  4N0K A;  1NVO A;  2Q9I A;  2N18 B;  1FI7 A;  3G9R A;  2YIU B;  2C9X B;  1CIH A;  2B87 B;  1KTM A;  1W2L A;  5CID B;  4H13 B;  3OCD A;  5CMZ A;  1SQB J;  3A5T A;  1SQQ E;  2HFE D;  3CD6 P;  2P58 A;  2J58 A;  3KYQ A;  3G6E P;  1H32 B;  2XTS B;  4NPE A;  1CYJ A;  2IBZ I;  2KP8 A;  5KKZ C;  1CRG A;  2J59 M;  3GLM A;  5CIG B;  4Z1M H;  1BDD A;  1CIG A;  2QE7 H;  1YI2 P;  2JKV A;  1ZXG A;  2W27 A;  2OZ1 A;  2OAR A;  1CI6 A;  1URQ B;  5C39 A;  3O6Q B;  3ZBM A;  1LC1 A;  1G2C A;  3L75 D;  3QH9 A;  1QL3 A;  3VP8 A;  1HJB A;  1VQN P;  1L0N E;  1VQ4 P;  1N50 A;  1KD1 Q;  3P8C D;  3DMI A;  3PJS K;  5TIS V;  5KLV D;  3GHG B;  2K9Y A;  3G4S P;  4UB6 E;  1NKN A;  1GQ1 A;  1FC2 C;  1EDK A;  2LXB A;  4YXD C;  1T3J A;  2LIR A;  3A0H H;  5AW0 B;  2YXR B;  2N9Y B;  2C0X A;  2E75 C;  1DVV A;  2FKW B;  4WQE A;  1LWU C;  2FYU J;  3SWK A;  5KKZ B;  1SQB E;  4L76 A;  2B88 A;  3V6I A;  1YCC A;  2BLF B;  3WU2 H;  4YE1 A;  3V2P A;  1J1D C;  5AW3 B;  2KK7 A;  1FS0 E;  3ABV C;  1FU1 A;  2O01 J;  1QL1 A;  1H32 A;  1QKS A;  5AW6 B;  1T3U A;  2B4Z A;  3OW2 O;  1BGY J;  1OXZ A;  4L3G A;  1LGH B;  3HQ8 A;  1E5W A;  4D6T J;  1M1J B;  4Y28 J;  1NTZ E;  2EXV A;  5DJQ C;  2UWJ E;  2C1D B;  1X8Y A;  2NPS D;  3FXE A;  3LW5 J;  2WVR A;  3BAS A;  1KX2 A;  5CCH D;  1CRH A;  3B5N B;  3H6P A;  2K37 A;  3CC4 P;  5BU8 B;  2FYU K;  4I1L A;  1T2K D;  3OA8 B;  2RMZ A;  1P84 I;  3L71 J;  3BVH A;  3H1I G;  5KAF V;  1J2J B;  5AW2 B;  2JTI B;  1GW3 A;  1CHI A;  2E75 B;  3C8V A;  1NMI A;  3FXD A;  4GOD A;  3PXW A;  3H1I D;  1KV4 A;  1IQC A;  3AEA C;  1NU1 E;  3MD0 A;  1VDF A;  5APY A;  1EB7 A;  2DVH A;  1NTM E;  5CJ0 A;  2D0W A;  3RBZ A;  2C2C A;  4DOJ A;  4LLH A;  3RMZ A;  4H0L C;  1BCC E;  3SLE A;  1KFN A;  1W5C T;  1SQQ K;  2YK3 A;  3PLN A;  4PV1 D;  4GIF A;  2E42 A;  1PP9 J;  5KJ7 C;  1SQV G;  1BSN A;  5APS A;  4HKZ H;  1D7M A;  3L4O A;  1OCD A;  1EZV I;  5CIC B;  1NTZ K;  1ZN5 A;  2KS1 A;  2WPR A;  4HB1 A;  4Y99 B;  3U1C A;  3WUU A;  3H1L D;  1RZ6 A;  4DY9 A;  3L74 G;  2I8D A;  2WPS A;  5GTI H;  3CX5 E;  2A45 I;  1SS1 A;  4GOE A;  5KAI H;  5CIF B;  1N73 A;  5KJ7 A;  1A02 F;  3SFD C;  2BH5 X;  1FZG A;  1KIL C;  1GDT A;  1FJK A;  1Y47 A;  4H0L B;  3H1H J;  2MTA C;  3ZOO A;  1QVG O;  1PGO A;  3CCJ P;  1NTM G;  2QEX P;  4I7Z B;  5IY5 1;  3O20 A;  3RL0 D;  1NU1 G;  1VQO P;  3A7O A;  1KYO W;  3L73 E;  5AW9 B;  2M0B A;  1L4A D;  1DX7 A;  4PJ0 E;  1YIT P;  1L0N K;  1F1C A;  1KB9 D;  4WY4 C;  5TIS E;  2C1U A;  2BAS A;  2ZXE B;  4H13 C;  1Z56 A;  2IYP A;  3IFM A;  1WEJ F;  3CME P;  3CX5 D;  1NYH A;  4WQ7 A;  2XV5 A;  1CTY A;  1PGJ A;  1H31 B;  5EFW B;  4BWN A;  1DIP A;  2R5B A;  1URQ D;  3NMD A;  1RF1 C;  2FYN B;  3E1R A;  1CZQ A;  1SFC D;  1YBK A;  1M1J C;  1JY2 P;  1ZOY C;  3H1H E;  2OYI C;  1FZE A;  3H1J G;  3VTP C;  1CRJ A;  4NPD A;  5AVW B;  3CX5 W;  2QRX A;  2N18 C;  2B89 A;  1K3H A;  2K3R A;  3EFG A;  4RO0 A;  1HF9 A;  3Q3D A;  2IBZ D;  4L3H A;  1EDJ A;  5BU5 A;  3FGA D;  3AEB C;  3NBT A;  3L71 G;  1BL9 A;  1VQ5 P;  3I55 P;  4PW9 B;  1GIW A;  1NKZ B;  3CU4 A;  2WTY A;  3CMA P;  1MG3 D;  4NFG B;  3HE5 B;  2I1J A;  2GIW A;  1BCC G;  1M90 Q;  1H31 A;  1KQF B;  4JF7 A;  1C2N A;  4IFF A;  3KXD A;  4EIJ A;  1N7L A;  5CIE B;  4LC1 A;  3PH2 B;  3WU2 V;  1ZR2 A;  1KB9 H;  4R4M A;  1USE A;  1M8O B;  1RE3 C;  3PH0 A;  1USD A;  2YKO A;  2PAJ A;  2GUS A;  3L74 D;  2IPP A;  1JTH B;  5CBN A;  2ZOO A;  2E74 B;  4WB4 A;  2OGU A;  1NML A;  3CCQ P;  5DFS A;  1PZQ A;  1S6V B;  1IFJ A;  1HWT C;  1I54 A;  1SQV J;  3HD7 A;  1RE4 C;  4O1W A;  3RK3 C;  1NU1 K;  1FJ0 A;  2PCB B;  2E76 B;  2YMK A;  1JUN A;  2JEE A;  3LW5 H;  2CXB A;  4W7Z A;  1HH7 A;  4CPG A;  2N1T A;  3CCU P;  1H88 A;  2Y0C A;  3HQ6 A;  1C52 A;  1LP1 B;  1DIQ C;  3CCE P;  2C0W A;  2POH A;  2FYU G;  3BCC D;  1SQB D;  1YIC A;  1R8E A;  2M3E A;  3L70 E;  1MFZ A;  1SQV E;  1G1J A;  3AE1 C;  1RF0 A;  1LFM A;  2B12 B;  1C7M A;  2WSC H;  3WFC C;  4K3I A;  2P1J A;  1QLE D;  1GU5 A;  3RK2 B;  2HG5 D;  3WU2 E;  3L73 J;  1LTG C;  2OQQ A;  3RK2 D;  1BGY G;  1KMI Z;  1FOC A;  5AW4 B;  1KYO I;  5B6Q A;  1LTJ C;  1S1C X;  4PD4 H;  3HE4 B;  1WMK A;  3UIA A;  3CWB G;  2KB7 P;  4H44 C;  3A3Y B;  3H32 B;  2ZZS 1;  3ZOY A;  1I6D A;  1NTK K;  3T97 B;  1CCH A;  2AXT V;  2O01 N;  1JB0 J;  4LJI A;  3WUV A;  1AOQ A;  4A7P A;  1CW5 A;  1YTZ T;  2Y9Y A;  5E79 H;  1MKM A;  1WRG A;  1LTT C;  1S5L H;  3RK3 E;  1RF0 C;  3CWB E;  3CXH H;  3KPE A;  1R5L A;  2QSI A;  2I1K A;  4C7N A;  1HRO A;  1SQX E;  4PJ0 V;  3RL0 g;  1ZRT D;  3L71 D;  1KX7 A;  5AVS B;  3NXS A;  1UIX A;  2YKP A;  3JC2 2;  3M9H A;  2JR8 A;  1HCM A;  1NTZ G;  1PFI A;  1OZH A;  2Q1K A;  3VYM A;  1RQU A;  2PAC A;  3Q2Y A;  3M9Q A;  2H88 C;  1RE4 A;  4DZO A;  3CC7 P;  3H25 A;  1T6A A;  2CA4 B;  3OJA B;  1BE3 J;  1URQ A;  1AJY A;  2BGV X;  3M9B A;  2N3B A;  2CE1 A;  2GUV A;  1U7J A;  3HTK B;  3R2P A;  3HE5 A;  3SVW A;  1CXC A;  3BCC J;  3FX0 A;  1FCD C;  2QJP B;  2KZI A;  2W6B A;  3E1I A;  4C46 A;  2FFD A;  3CLQ A;  1GU4 A;  1M56 D;  5KLV E;  2D2C D;  1Q82 Q;  3M97 X;  1U75 B;  3Q5P A;  3O1Y A;  1GKS A;  1N86 A;  1C6R A;  3CXH I;  2QJP C;  1KZU B;  3KZI V;  3SWY A;  5CYT R;  3L35 A;  1K9M Q;  3M0D A;  4N78 D;  3SSU A;  3H1J D;  2ZVO B;  3GHG A;  3MTU E;  4OGQ C;  1OFC X;  1QEX A;  4U3F G;  1GL2 D;  3B8E B;  1FZA A;  3RLM A;  3MUD C;  4L73 A;  1OVU A;  2XKM A;  1H0T A;  1NAY A;  1GMJ A;  2JDI H;  5GTI V;  1CHJ A;  1LTS C;  3D6Z A;  4I2L C;  2AXT H;  2R3C A;  1Q90 D;  3MHV A;  1SQQ D;  2V4H A;  4AAO A;  5KAF H;  4WY4 D;  1A02 J;  3MGN A;  3H1L G;  1RF1 A;  5KLV J;  2KNC A;  1RAP A;  3VMZ A;  1SQQ G;  3WC8 A;  2IBZ G;  3TF5 A;  1LT9 B;  3NBS A;  4XA4 A;  2ZBO A;  2Q3E A;  5H2F V;  2JP3 A;  3K5B A;  2D2C C;  3BCC E;  4GYD A;  2RN0 A;  2Q7C A;  4WY4 A;  1AKK A;  1CCR A;  1IZN B;  1LTA C;  1DT1 A;  2BCC G;  1BE3 D;  3CWB J;  3TDK A;  1LTI C;  1I8P A;  4ZKU A;  1J3S A;  1KYO D;  2ZJS E;  1ZZH A;  1P84 E;  1N90 A;  4PWA A;  1K04 A;  1SQP D;  3B71 A;  1SQX D;  3AE9 C;  2C1D A;  4IFD K;  1NTK G;  2HPC B;  1COR A;  1VQL P;  1KIL A;  1AQT A;  1FOS F;  1SQP G;  1E29 A;  1CHH A;  3BRT B;  2XND H;  2ZT9 C;  3QWO C;  3B5N A;  4PD4 E;  3SJL A;  1BCC J;  3S1K A;  3A0H E;  3HD7 D;  1N9C A;  1DVH A;  3CCR P;  3M06 A;  1FHB A;  1X0T A;  1S5L E;  5APT A;  2W8Z A;  2L5G B;  2BEQ D;  2AXT E;  4WQA A;  3C2C A;  2DW3 A;  1KFM A;  3L72 D;  1NTZ J;  2ORL A;  2XNX A;  3D6Y A;  5K5G B;  1VF5 D;  1LTB C;  2O1K A;  2YCC A;  1VF5 B;  4L74 A;  5CJ4 A;  4PV1 B;  3A0B E;  3N4X A;  1ETP A;  3V2Q A;  2FBW C;  2CK3 H;  3C1L A;  1P84 D;  2AEJ A;  3AEC C;  5B66 E;  2QJK C;  4ZKP A;  2BH4 X;  1CI6 B;  1KIL B;  5AUR A;  1U74 B;  1IK9 A;  3BCC G;  3L70 D;  1JY2 O;  4KT0 J;  2Q6Q A;  3D70 A;  1GDV A;  2AIU A;  1GTW A;  1CXA A;  1HUC A;  4DCK A;  2IBZ E;  3CCV P;  3TSI A;  4PJ0 H;  1M70 A;  2M5A B;  1A56 A;  3IF4 A;  1Q81 Q;  3O5C A;  3BAT A;  5KTB A;  2W6A A;  3L72 G;  3CPW O;  1I5T A;  3A0H V;  4AX3 A;  4Y99 C;  2CPB A;  2O3J A;  1BE3 E;  2JQR A;  5E79 V;  1CRI A;  5CCH C;  1HZU A;  1PP9 D;  1LS9 A;  3TYI A;  3WUI A;  1AVO A;  2IZ0 A;  3CYT I;  1L0L G;  3M91 A;  4AQR D;  2E76 D;  4L1Q A;  3TYY A;  3A0B V;  3NTN A;  1NIR A;  2XU6 A;  2C1V A;  4IL6 E;  5GTH V;  1N8R Q;  3EFF K;  3WFE C;  5KLV K;  4PD4 I;  1BGY D;  3P8C E;  4YTP C;  1N7S C;  1QL2 A;  4J20 A;  2P7J A;  2KSE A;  3CCL P;  1R5S A;  3H32 A;  2LR2 A;  4HYT B;  1JM0 A;  2Q5U A;  5KLV G;  3MUD A;  3AEF C;  1N73 B;  1L9B C;  1GZL A;  3S4R A;  2JO1 A;  3OCD B;  3KZI E;  3DP5 A;  2A45 H;  2KOG A;  1PPJ E;  3M0D C;  2OTJ P;  2NPS C;  1N7S B;  4EIE A;  2D2C B;  4FA4 A;  1OW8 A;  2WZ7 A;  3Q5S A;  3AE3 C;  3GW6 A;  3F89 A;  2R32 A;  1JNM A;  1LWU A;  2YMY A;  1XTC C;  2FRC A;  3I5C A;  1DII C;  3JCU E;  1QX8 A;  4K3A A;  3H1K G;  3H1I J;  2CPS A;  1C6O A;  3EWK A;  5DJT B;  1NHL A;  2H8P D;  3W68 A;  2E76 C;  2G8Y A;  2WT7 A;  1EXJ A;  2H7H A; 
#chains in the Genus database with same CATH homology
 1CIG A;  3WFC C;  4K3I A;  2OZ1 A;  3JBT B;  1A8C A;  451C A;  1YFC A;  3VRD A;  1FOC A;  1E2R A;  3ZBM A;  1LC1 A;  5B6Q A;  3MK7 C;  5EXQ A;  3L75 D;  3A9F A;  1QL3 A;  1LMS A;  2ZZS 1;  3ZOY A;  1I6D A;  1N50 A;  3DMI A;  2BCC D;  5TIS V;  1CCH A;  5KLV D;  4AAN A;  4Q5P A;  4JCG A;  2AXT V;  4LJI A;  1AOQ A;  2A06 D;  4A7P A;  1GQ1 A;  5KAI V;  2LIR A;  4EIC A;  2N9Y B;  1C6S A;  1HRO A;  5C0Z A;  1FI3 A;  1DVV A;  4PJ0 V;  4WQE A;  3PXT A;  3X39 A;  1CIE A;  3L4M A;  1ZRT D;  1GJQ A;  3L71 D;  1CC5 A;  1KX7 A;  5KKZ B;  2JWA A;  2FYU D;  1YCC A;  1CYC A;  2BLF B;  1K3G A;  4YE1 A;  1CRC A;  1HCM A;  2V08 A;  4QAO A;  2ZXY A;  4WQC A;  1H32 A;  3VYM A;  3PXS A;  1QKS A;  1R0Q A;  1H33 A;  2PAC A;  5CIB B;  3ZOW A;  2B4Z A;  2L91 A;  4L3G A;  2CA4 B;  3HQ8 A;  2BGV X;  2N9J A;  2N3B A;  3L73 D;  2EXV A;  4H0K A;  4XYD B;  5DJQ C;  2C1D B;  1OAE A;  2CE1 A;  1YEB A;  1YIQ A;  3CXH W;  1CSU A;  1KX2 A;  3SVW A;  1CXC A;  2D0S A;  1GU2 A;  1CRH A;  1FCD C;  1COT A;  4RJT A;  2QJP B;  2QJK B;  3OA8 B;  2RMZ A;  3MK7 B;  3ZOX A;  3ZCF A;  5KAF V;  2V07 A;  3M97 X;  1H9X A;  1U75 B;  2JTI B;  3O1Y A;  1GKS A;  1CHI A;  3WFD C;  3CP5 A;  1C6R A;  2N9I A;  3KZI V;  1IO3 A;  5CYT R;  3CWB D;  1NMI A;  3PXW A;  3H1I D;  3H1J D;  1IQC A;  4FAV A;  4EIF A;  1CED A;  1EB7 A;  3RLM A;  2DVH A;  1NNO A;  4IL6 V;  1NTK D;  4FA5 A;  2D0W A;  2C2C A;  3RMZ A;  4O1Q A;  5GTI V;  1CHJ A;  1MZ4 A;  3SLE A;  2VHD A;  1W5C T;  2KNC B;  2CE0 A;  2YK3 A;  1YTC A;  3PLN A;  1SQQ D;  4AAO A;  1N15 A;  3L4O A;  1IRW A;  1CSV A;  2GC4 D;  1OCD A;  1M60 A;  2C8S A;  5CIC B;  5C9M A;  1H1O A;  1RAP A;  4WQ8 A;  2KS1 A;  1NTM D;  1E8E A;  3WC8 A;  3TF5 A;  1EZV D;  1YEA A;  3NBS A;  1PPJ D;  2ZBO A;  1L0L D;  2Q3E A;  2GB8 B;  5H2F V;  4GYD A;  5KLI B;  3H1L D;  1RZ6 A;  2RN0 A;  4DY9 A;  1AKK A;  1CCR A;  4EID A;  3SWS A;  1HRC A;  1QN2 A;  3RN0 A;  1DT1 A;  4KMG A;  1BE3 D;  1I8O A;  2HV4 A;  3TDK A;  2DGE A;  1AYG A;  1CRY A;  1CYI A;  4H0J A;  5CIF B;  1I8P A;  2B11 B;  1J3S A;  1KYO D;  1S5L V;  1RZ5 A;  1ZZH A;  1CTJ A;  2BH5 X;  1N90 A;  2L4D A;  4PWA A;  3H1H D;  1DW2 A;  1I6E A;  2PCC B;  1SQP D;  4PD4 D;  1CTZ A;  1SQX D;  3H1K D;  4AAM A;  2C1D A;  4Y5R A;  1B7V A;  2I8F A;  2MTA C;  1COR A;  2YQB A;  2B10 B;  3ZOO A;  3VMA A;  4WQD A;  3RN1 A;  1E29 A;  1CHH A;  1CSX A;  5IY5 1;  3O20 A;  3SJL A;  1KYO W;  1N9C A;  1KB0 A;  1DVH A;  3DR0 A;  1FHB A;  1F1C A;  1KB9 D;  2C1U A;  3CXH D;  1MG2 D;  4WQA A;  3C2C A;  4U3F D;  1NU1 D;  5CIH B;  1WVE C;  5B66 V;  3L72 D;  1WEJ F;  2ORL A;  4XXL A;  3CX5 D;  1HJ3 A;  2FWL A;  4WQ7 A;  1CTY A;  3O0R C;  2YCC A;  4AAL A;  1H31 B;  1DW3 A;  1M6Z A;  2FYN B;  1A2S A;  1ETP A;  1P84 D;  1HJ4 A;  1CNO A;  1L9J C;  4EDF A;  2MHM A;  2BH4 X;  2Y0D A;  5AUR A;  1CRJ A;  3CX5 W;  2N18 C;  1K3H A;  2GC7 D;  5DF5 A;  3VNW A;  1U74 B;  4UB8 V;  3HQ9 A;  3L70 D;  1IZL 0;  1GDV A;  2AIU A;  2AI5 A;  4P4Q B;  1CXA A;  2IBZ D;  4L3H A;  2Y0E A;  3NBT A;  1M70 A;  1C2R A;  3ZIY A;  1BL9 A;  1A56 A;  1H9Y A;  2QJY B;  4PW9 B;  2QG4 A;  3O5C A;  1GIW A;  3CU4 A;  2N3Y A;  4UB6 V;  1I5T A;  3A0H V;  1MG3 D;  4NFG B;  4AX3 A;  1F1F A;  2GIW A;  1QYZ A;  1H31 A;  1CO6 A;  2O3J A;  1CIF A;  2JQR A;  3NWV A;  5E79 V;  1CRI A;  1C2N A;  2CA3 B;  1HZU A;  351C A;  4FB1 A;  1PP9 D;  5B5E V;  5DJQ B;  1LS9 A;  3TYI A;  3WUI A;  4RSZ A;  5CIE B;  5TJH A;  3PH2 B;  3WU2 V;  1QL4 A;  1BCC D;  3CYT I;  1DW1 A;  1AOF A;  4L1Q A;  1KV9 A;  1CSW A;  4GED B;  3A0B V;  1C75 A;  1NIR A;  1I55 A;  2C1V A;  5GTH V;  3L74 D;  1L0N D;  2OZ1 B;  4WQ9 A;  3WFE C;  3SXT A;  1BGY D;  1JDL A;  3KHU A;  1IRV A;  4J20 A;  1LC2 A;  1SQV D;  2BCN B;  2ZOO A;  1NML A;  4D6T D;  1VYD A;  5DFS A;  3FWL A;  4WQB A;  1S6V B;  1I54 A;  2LIT A;  4V2K A;  3PHL A;  2BPB B;  1YNR A;  3PTZ A;  1DW0 A;  3ITK A;  3WFB C;  4O1W A;  2ZON G;  4MU8 A;  1L9B C;  1FJ0 A;  155C A;  3OCD B;  2B0Z B;  3DP5 A;  2PCB B;  3ORV A;  1HZV A;  1HJ5 A;  4EIE A;  1FI9 A;  3HQ7 A;  4FA4 A;  2CXB A;  1HH7 A;  1RAQ A;  4FA9 A;  4N0K A;  3GW6 A;  3PRJ A;  2N18 B;  1FI7 A;  2YIU B;  2C9X B;  1CIH A;  1W2L A;  4FAN A;  5CID B;  3OCD A;  2Y0C A;  3HQ6 A;  2FRC A;  1C52 A;  3OA8 A;  1DIQ C;  1DII C;  1H32 B;  2XTS B;  3TGU D;  1H33 B;  3BCC D;  1SQB D;  1YIC A;  1C6O A;  1CYJ A;  1CRG A;  4FA1 A;  1KIB A;  1LFM A;  2B12 B;  2K9J B;  5CIG B;  1NTZ D;  1C7M A;  3GG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...