4D6TD

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
240
structure length
240
Chain Sequence
b'DLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
total genus 67
structure length 240
sequence length 240
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4d6tD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4d6tD02
1DW0A 1CIFA 3ORVA 3CX5D 1CXAA 1L0ND 1MG3D 3L4OA 1IRWA 3WFBC 2KNCB 2RN0A 2BH5X 1CHIA 1JDLA 1YTCA 3CWBD 4WQCA 1CYCA 351CA 4UB8V 1I55A 5CIGB 3VMAA 3PRJA 1I5TA 1E2RA 1CRHA 2C2CA 1FJ0A 5GTIV 3X39A 2Q3EA 1YICA 2K9JB 3ZOYA 4EDFA 1AOQA 2KS1A 2A06D 1L9BC 1S5LV 3RMZA 3NBSA 1HH7A 1CO6A 1DW2A 3DMIA 1YNRA 3ZOWA 5CICB 2B12B 451CA 1I54A 5IY51 1CRIA 1CEDA 1BL9A 2QG4A 5CIDB 1WVEC 4KMGA 1NTZD 3H1LD 2BLFB 5DJQB 2N18C 3SLEA 1CNOA 2V07A 5AURA 1CTZA 2N9IA 1CIHA 4WQEA 5KLVD 5KLIB 1A8CA 1H1OA 3A9FA 5C9MA 1GKSA 2XTSB 1E29A 3SXTA 1CIGA 4DY9A 1SQQD 2EXVA 1NMLA 4WQ9A 5CIHB 3DP5A 1PP9D 1GDVA 1CC5A 2YCCA 3CX5W 3HQ6A 1L9JC 1CTYA 4XYDB 1CRJA 3JBTB 2L4DA 1NTMD 2DVHA 1DW3A 4YE1A 2VHDA 1CXCA 1BE3D 1CHJA 1C6OA 3PTZA 1H9XA 3VRDA 2ZXYA 3HQ9A 1J3SA 2DGEA 2ZZS1 4H0JA 3ZCFA 4O1WA 2RMZA 5TJHA 5B6QA 1LC1A 3O5CA 2C1DA 1KB0A 1SQPD 4PWAA 4RSZA 2N9JA 4GYDA 1CYJA 1SQBD 4J20A 3CXHD 2LITA 1LFMA 1HJ5A 3PXTA 5CYTR 1RZ6A 1WEJF 3SJLA 3A0HV 4EICA 3GG2A 2N9YB 1CYIA 4FA9A 2BCNB 4PW9B 1BGYD 3MK7B 5TISV 1C2RA 3CU4A 2AI5A 5CIEB 4QAOA 1GJQA 1SQXD 1NIRA 3BCCD 3VNWA 4AALA 3O20A 1COTA 3L70D 1RZ5A 4Y5RA 4P4QB 4Q5PA 4L3HA 3A0BV 1W2LA 2ZONG 1A56A 1NTKD 1FCDC 2FYNB 2ZOOA 1K3GA 1I8PA 2PACA 3TYIA 1DVVA 3OA8A 3NBTA 1LS9A 5EXQA 1DT1A 1FI3A 2FYUD 2YK3A 3WFCC 3ITKA 2BH4X 1EB7A 3ZOOA 1EZVD 3L73D 2C9XB 1CTJA 3RN1A 4FB1A 3ZOXA 1MZ4A 3PXSA 4AAMA 4AX3A 2HV4A 1H33A 2CA3B 3L71D 2I8FA 1HCMA 1F1FA 1W5CT 4JCGA 4LJIA 3CXHW 3NWVA 3WU2V 1HROA 1QN2A 3WC8A 2CE0A 1GU2A 1LMSA 1M6ZA 1KYOD 4L3GA 3TDKA 5CIBB 3L75D 4H0KA 2CE1A 4WQ7A 5KAIV 3SVWA 1ZRTD 1U74B 1NNOA 3MK7C 2L91A 1K3HA 1H31B 1U75B 1KV9A 2D0WA 3C2CA 1HJ4A 1H31A 2B4ZA 3L72D 1C6SA 2V08A 4K3IA 3H1KD 3L74D 1ETPA 5B5EV 1CORA 1OAEA 2QJYB 4WQAA 1CSUA 4XXLA 1BCCD 1FHBA 1R0QA 2C1DB 3PLNA 1CRGA 5DF5A 1KIBA 1F1CA 1CSXA 2C8SA 3WUIA 1AYGA 1YFCA 1H32B 1C6RA 3KHUA 3O0RC 1M70A 4PD4D 1H32A 4PJ0V 1SQVD 1LC2A 1KX7A 3H1JD 2FRCA 1IZL0 1CHHA 1PPJD 3RN0A 1S6VB 1N50A 1CIEA 2Y0CA 2MHMA 2PCBB 2Y0EA 4V2KA 3RLMA 1IRVA 5H2FV 2B0ZB 3WFDC 1C52A 1H9YA 2GIWA 1KYOW 2AXTV 5KKZB 4WQ8A 3VYMA 5B66V 2GC7D 3WFEC 3OCDB 4WQDA 2ORLA 1HRCA 1QL3A 5DFSA 1I6EA 1N15A 1L0LD 2QJKB 3OCDA 1DIQC 2BPBB 3HQ8A 3O1YA 1ZZHA 2AIUA 3OA8B 1CSVA 4FA5A 4A7PA 2CA4B 2JTIB 4AANA 1FI9A 2OZ1B 3L4MA 1CRCA 4RJTA 1HZUA 2ZBOA 3TF5A 2B10B 2OZ1A 2BGVX 2QJPB 1CRYA 1H33B 1HJ3A 4EIFA 3DR0A 5GTHV 1OCDA 5C0ZA 1E8EA 1QYZA 1IO3A 3CYTI 2GB8B 3KZIV 1KB9D 1FI7A 1DVHA 1YEBA 3ZBMA 1NU1D 4EIEA 2B11B 2C1VA 2FWLA 3TGUD 4FA1A 4AAOA 4UB6V 2MTAC 4WQBA 1AKKA 1CSWA 1VYDA 1I6DA 1GQ1A 5KAFV 2C1UA 1M60A 2JWAA 1C2NA 1P84D 5E79V 1FOCA 3PXWA 4NFGB 1YEAA 1C75A 5CIFB 4GEDB 1I8OA 2LIRA 1NMIA 2CXBA 3H1ID 4MU8A 1B7VA 3M97X 1IQCA 3GW6A 2IBZD 3H1HD 4FA4A 2Y0DA 3CP5A 2GC4D 2JQRA 1AOFA 1N90A 155CA 4D6TD 3ZIYA 3HQ7A 4N0KA 1DW1A 3PH2B 4FANA 1QKSA 1YCCA 3FWLA 1RAPA 1C7MA 2N18B 2YIUB 3SWSA 4IL6V 1YIQA 4L1QA 1CCHA 4U3FD 1DIIC 4O1QA 4EIDA 1GIWA 1KX2A 1QL4A 2D0SA 3PHLA 1A2SA 4FAVA 1RAQA 1CCRA 5DJQC 1N9CA 2N3YA 1HZVA 2PCCB 1MG2D 2N3BA 2O3JA 2YQBA 2BCCD
chains in the Genus database with same CATH superfamily
1LTBC 3ORVA 2E75B 1KQLA 4N78E 1IRWA 2RN0A 1GL2A 2IPPA 2OTKE 3CWBD 1T2KD 3II6A 2B9BA 4UB8V 1I55A 1DX7A 5H2FE 5AW6B 2Z4EA 1ZRTE 1FJ0A 1RHZB 1L0NJ 1L9BC 1S5LV 1Q82Q 3NBSA 2Z5HA 1BE3G 2WSEH 3B5NB 2E75D 1IFJA 2WSFJ 1SQXJ 1BL9A 1BCCE 4KMGA 4YXDC 3M0AA 2BLFB 1JOCA 2C0WA 3AEBC 1CTZA 1BDCA 5H2FH 2XU6A 2JR8A 3PH0A 3A9FA 1L0LK 2W27A 3EFFK 2XTSB 3H1JE 3V2PA 1FDIA 2CK3H 4DY9A 3P8CE 1AJYA 2JO1A 4RKUJ 1NMLA 2K9YA 4GT1A 1HVVA 2IX7C 2I8DA 1H0TA 1W2EA 2FYZA 1EDKA 4PD4H 2L4DA 1NTMD 1M1JA 1YYCA 3SWKA 1BGYG 2WT7B 3M0DA 1L0LE 1KQGB 3T97B 1N7LA 2QM8A 3VRDA 1VQNP 2WMMA 2ZXYA 1BE3J 3LIDA 4GOFA 3RL0g 1JTHA 2E76B 5TJHA 1EZVE 3MTUE 3L72J 4L75A 3H1KJ 2ZT9C 3L74J 1S9KE 4AUWA 3HD7B 2I1JA 3L73G 4WBAA 4GYDA 1YJ9P 1J1DC 2LITA 2P1JA 2RKLA 1FZCC 3AEDC 5KJ7A 1KD1Q 1WT6A 5APQA 1WEJF 3SJLA 1N2DC 4EICA 4OGQC 4GIFA 1L4AD 1FJPA 4H0LC 2ZFCA 3GG2A 4PW9B 2PRRA 3MK7B 2WZ7A 1GJQA 1SQXD 4HH2A 3CMEP 3CD6P 4PV1D 4AALA 1A02F 3O20A 1M56D 1RZ5A 5AW0B 5CMZA 1RH5B 1A56A 3A7OA 1MFTA 3TYIA 3QWOC 1DVVA 2IBZE 1URQC 4NPDA 1XTCC 3C1LA 3AE6C 1DT1A 2FXOA 3PP5A 2HODA 4D6TE 4UB8E 1AVOA 1EB7A 3LW5J 1NJIQ 2W83C 4FB1A 3ZOXA 3S9OA 3CCEP 3VP8A 4AAMA 1S5LE 2W6AA 1IK9A 3CX5I 1VQ5P 1T2KC 1OX3A 2HV4A 3R2PA 1IJDB 1OMIA 3HTKB 1RE4C 2CA3B 2PAJA 1HCMA 1W5CT 4U3FE 4LJIA 1YJWP 5APSA 1RQVA 3NWVA 5AW1B 1H0TB 2CE0A 1GU2A 1LMSA 1X22A 5TISH 1EDLA 1PIXA 3OJAB 2CE1A 3RL0D 3U1AA 1J1EC 3GHGC 3SVWA 1K3HA 2QSIA 3WMM0 3MIWA 1RE3C 4C7NB 3L72D 1C6SA 2QIWA 3Q5RA 4K3IA 3H1KD 4GODA 5KLVK 3L74D 1LWUA 2D2CB 1NU1K 4WQAA 1JTHB 1LTJA 4XXLA 1FHBA 2Z5IA 1R0QA 5DF5A 2AEJA 3KQGA 3RBXA 1F1CA 1CSXA 1AYGA 1YFCA 3AE1C 3SWYA 3H1IJ 3IN6A 2M0BA 2OYHA 4PJ0V 1JY3P 1UIXA 1RY3A 3CCRP 2FRCA 1IZL0 1PPJD 3FXDA 1DEEG 1KB9E 1VL2A 2OGUA 3V2NA 2MHMA 1Y9BA 2PCBB 2WSFH 2J59M 1HTLC 5KLVE 3RK3C 1NU1E 2GUVA 1AVYA 5KAIH 1H9YA 3TGUG 4WQ8A 1HJBA 5AVUB 1LTIC 4LGDE 3WFEC 2YKOA 1KFNA 1HRCA 1QL3A 1N7SB 2ZVNB 5DFSA 1DIQC 3HQ8A 3GMAA 3O1YA 4CPGA 1SFCA 2K37A 3W67A 2JTIB 1FZFA 1M7LA 2B87A 1YIJP 2OZ1B 2FFDC 4BRYA 1HZUA 3TF5A 4I2LC 2FXPA 4JYCA 5L8RJ 1L4AC 2KIKA 1FC2C 1LTSC 1N8RQ 1HJ3A 4EIFA 3DR0A 3AE2C 5GTHV 5C0ZA 1HJ0A 3AEGC 4PV1C 2ZYAA 1N73C 2OYIB 1MKMA 1YEBA 1VQKP 4JQ0D 3EWKA 2B11B 1GK6A 2OQQA 3HE5A 3V2QA 3CXHE 3UIAA 4HB1A 4FA1A 1FZCA 2P58A 4UB6V 4DT0A 1I6DA 1GQ1A 3H6PA 2ITAA 1BSNA 1P84D 1USEA 5E79V 1FOCA 3TGUJ 1NKNA 5CIFB 4GEDB 1RF1C 2E74C 2KLUA 3H1ID 1BGYE 3M97X 1IQCA 2KK7A 3H1HD 3CWBG 2VRSA 4W7YA 2Q1KA 2GC4D 1FU1A 2JQRA 2WSSH 5BVZA 1PV3A 5AVXB 1HGVA 1GDTA 1DW1A 2W6BA 1QKSA 2YMYA 1YCCA 1RAPA 1C7MA 3KZIH 1NH4A 4IL6V 3H1LE 4NPEA 4L1QA 2V4HA 2UWJE 1OW6A 1GIWA 3L73E 1RAQA 1CCRA 1M90Q 3V2RA 2PGDA 2O3JA 3LW5H 4MN4C 4GDOA 3CCQP 3HE4B 1ZMEC 4PJ0E 4B86A 5CCHA 3HUSA 1PP9E 3CX5D 4YTPC 2BEQD 1CXAA 3QH9A 2KNCB 1KYOE 2W90A 1KILD 2JKVA 1YTCA 2M3EA 4WQCA 1IFDA 3FWNA 5APWA 3VMAA 3PRJA 1E2RA 1JY3N 1CRHA 1OVRA 2KS1B 4BRYB 3GHGA 1NTMG 2Q3EA 1YICA 1MZ9A 1KN7A 2A06D 2OARA 1HH7A 1CO6A 3MP7B 1YQ4C 3AECC 1VQ6P 4N3YB 1CRIA 1QLED 1AV1A 1JY2P 4BXLA 1M8OB 5CIDB 3BCCJ 2V7QH 2ZT9B 5DJQB 2N18C 2YIUC 3L70J 5AVSB 1KTMA 2N9IA 1OW7A 3B4SA 1NTKJ 1J1DB 4U7JA 1TU3F 1H1OA 5C9MA 1FZCB 3MZWB 1GKSA 4TT3H 3SXTA 4OGQB 3FXEA 2EXVA 5GTHE 3CCMP 4WQ9A 1G1IA 3DP5A 2FYUK 1CC5A 3KYQA 5K5GB 3SSUA 1L9JC 2ZXXA 3L71J 4I1LA 5GTIH 1CRJA 1UIIA 3JBTB 2DVHA 3CI9A 2KI7B 1H88A 4YE1A 2HLOA 2VHDA 1CXCA 1HF9A 1VQPP 1SQXG 4UB6E 2WT7A 3L75J 1KB9I 4H0LD 1URQB 5CCGC 4JYBA 3PTZA 1H9XA 3T97A 4WY4D 2KXPB 1CW5A 2FYUE 1HGZA 2RMZA 2P67A 5B6QA 4H44D 1LC1A 2Q5UA 3VOPA 2XDJA 3CX5H 5AW8B 4DZOA 3MUDA 3HD7A 1HJ5A 3PXTA 2IYOA 5E79H 1K05A 5CYTR 3P8CD 1VQ7P 4IL6E 1N73A 1YHQP 3OAKA 1SQVJ 2N9YB 1CYIA 1J1EB 4FA9A 2BCNB 3TK1A 3GHGB 2KLVA 3O6QB 5TISV 3CU4A 4K35A 1E79H 4JPZB 3BCCD 3VNWA 1R8EA 1S1CX 1COTA 3G71P 3AEAC 3L70D 4P4QB 4IL6H 1NTKD 3L72G 2ZOOA 1K3GA 2PACA 3H1KG 3L74G 2KOGA 3OA8A 1LS9A 1FI3A 2IDBA 2BH4X 1NHLA 3USSA 1EZVD 2B88A 1CTJA 2R5DA 4ZKUA 4PD4E 1KILC 5CJ0A 4TLFA 5AVWB 2GM4A 3KDPB 1VF5D 1GW4A 3L71D 4JCGA 2E42A 3RK3B 1T8ZA 1FZBA 2H8PD 3CXHW 3HTKA 2N9BA 1HROA 1PPJG 3EFGA 1YBKA 4DJGA 2AEMA 3CC4P 2K88A 1M6ZA 3BRVB 3L75D 4H0KA 2WTYA 4WQ7A 5KAIV 1JY2N 1NNOA 1S4XA 1RF0A 3A0BH 1U75B 1KV9A 3C2CA 2Q7CA 3ZDMA 3RK3D 1HJ4A 4C46A 2B4ZA 1NAYA 1SLQA 4WB4A 1OFCX 3CWBE 2JEEA 3MD0A 5B5EV 1R5SA 3AE5C 3AEFC 1IFMA 3P32A 5AW5B 4C7NA 2QJYB 1CSUA 2FFDB 2G8YA 2FYNC 1L4AB 4L76A 3N7NA 3WUIA 1QGKB 1NOHA 1H32B 3TYYA 3O0RC 1LT1A 3RK2D 2KZJA 2PFXA 1P84I 1SQVD 2CPSA 1U7JA 4PV1B 2XNXA 1CHHA 1N73B 3TNUA 1CIEA 2Y0CA 1ZXGA 2OTLP 2JDIH 3C8VA 1BSHA 1LTAC 3RLMA 3C9IA 1IRVA 3HRNA 3GF7A 4WVZA 2GA1A 3WFDC 2GIWA 1KYOW 2C0XA 4WY4C 3O8ZA 3BASA 4C7RA 1XTGB 3CCSP 4H44C 1E5WA 1RF1B 1LT9C 2N1TD 2YMKA 4L73A 3K5BA 1N7SA 3OA8B 1CSVA 2H89C 2IFMA 2JP3A 3H1IG 1VQ4P 1HBWA 1FI9A 3H1HG 2AXCA 1CRCA 1T3JA 4I7ZC 5TISE 2LXBA 2ZBOA 5AVYB 4Z1MH 2B10B 2B89A 2OZ1A 3RL0B 1OIPA 1GL2D 2E74D 2NPSC 3V6IA 1L0NK 1VQLP 3B71A 1E8EA 2WPRA 1VQ8P 1EXIA 5AW4B 2GB8B 3KZIV 2O01N 1KB9D 2Q6QA 4I6MC 1DVHA 5BU5A 3W68A 3ZBMA 1NU1D 4EIEA 1QL1A 2OYIA 1NTZJ 3H1LJ 5B66H 4EIJA 1X8YA 2BCCE 1GZLA 2MTAC 4WQBA 3ABVC 1Q2NA 2C1UA 2JWAA 2XNDH 1JY3O 1JCDA 1L0NE 1CZQA 1PL5A 1C75A 3H25A 1NMIA 1HUCA 2O1JA 4MU8A 1LTGC 1VF5C 3GW6A 1AA0A 1SQQJ 1HH0A 4AQRD 1KORA 2YNYA 3MHVA 1PP9J 1SQXE 3IAOA 3M91A 1N90A 3P8MC 1K73Q 5KAIE 1X0TA 3JSVC 4ASWA 2A06G 1YTZI 3FWLA 5CBOA 3H1HJ 3V4WA 2LXCB 2N18B 2Y9YA 2YIUB 3SWSA 3B5NC 3TNUB 1FOSF 4H13D 1KC8Q 1S3JA 1A2SA 3Q2YA 4L74A 1N9CA 2QEXP 1KV4A 4JF7A 1VDFA 2GUSA 1FDOA 5KAFH 1OZHA 3NMDA 3HE4A 1DW0A 1VQ9P 1SQPJ 1YTZT 3AE7C 3A2AA 2R3SA 5B5EH 1ZR4A 2BH5X 1SQBJ 1CHIA 3RK2C 2R5BA 2KNCA 1CYCA 3G4SP 3PJSK 5CIGB 1QVFO 4PD4I 2C2CA 3I55P 5GTIV 3X39A 1OVVA 2HYNA 2YXRB 2K9JB 3WUUA 1W2BO 3ZOYA 4EDFA 1AOQA 5DJTB 1BE3E 2KS1A 3RMZA 3L35A 4KT0J 1DH3A 3L72E 1DW2A 1YNRA 3H1KE 3ZOWA 5CICB 2B12B 451CA 5IY51 1Y8AA 1DD4A 2WPQA 2QG4A 1CI6B 1WVEC 1NVOA 1NTZD 3H1LD 2DW3A 2KSEA 1CNOA 2N1TC 4WQEA 1BDDA 1A8CA 5CCGD 1MFZA 4QMAA 2H7HA 2HFED 2WSCJ 2XV5A 3GLMA 1E29A 2MKVA 2K1AA 1SQQD 3L4FA 1FZEA 5CIHB 1PP9D 5AVVB 3KZIE 4Y99C 3G6EP 1K9MQ 1GL2C 1EZVI 1FS0E 1CTYA 4XYDB 4EI2A 3VYIA 2WSEJ 4W80A 1DW3A 1SS1A 3Q5SA 1U7MA 3RGUA 3BCCG 5DJUB 1C6OA 3L70G 3Q5PA 1L2PA 5AVQB 1URQA 2NZ2A 1NTKG 1IC2A 2DGEA 3ZCFA 1Q86Q 4O1WA 3AEEC 3O5CA 1KILB 1JCCA 1J2JB 1Z56A 1SQPD 1EZVG 4PWAA 2L5GB 4RSZA 1BCCJ 2N9JA 1NGMB 2SPZA 2ZYDA 4J20A 1SQBD 1RE4A 1Y47A 5KLIC 1S5LX 2HR3A 1RZ6A 2JWDA 3L71G 2IBZI 4IOIH 3L36A 3H1JJ 1GK4A 1ZN5A 1OVUA 3CPWO 3VMYA 1C2RA 5BU8B 2LKMA 3L75G 5C39A 3O6QA 1M1JC 4H13C 1ZR2A 2AI5A 5CIEB 4QAOA 5APTA 2A45I 2WPSA 1EDIA 1RE3A 3M0DC 1LTTC 3A0BV 1W2LA 3H1IE 1JMBA 2FYNB 2H43A 3SWFA 3WFCC 2FYUD 2YK3A 2D2CC 2PP6A 1QEXA 3IF4A 1L0LJ 3M06A 5GTIE 2AEFA 4WWIA 1P84H 3PXSA 4R4MA 1FZGA 2BASA 1IFIA 1H33A 3A0HH 1F1FA 1SQVG 4AYCA 2A45G 4RESB 2QRXA 1GMJA 3R4YA 1QN2A 4H0LB 3WC8A 4OWFA 4W7ZA 1LGHB 5APUA 3NXSA 4N78D 3JCUE 4WY4B 4YXWH 5CIBB 2HG5D 1G1JA 1KMIZ 2W6JH 5EFWB 3VMXA 4H44B 1LT9B 3E1RA 3D6ZA 1ZRTD 2L91A 1H31B 3CX5E 2YKPA 4NPFX 1QL2A 3D0WA 1KILE 2V08A 3A5TA 1NAFA 3VMZA 3JCUH 1CORA 1OAEA 5E79E 4I7ZB 3BATA 1BCCD 1H8AA 3IR9A 3PLNA 1CRGA 4IFDK 2XZRA 2FFDA 3S1KA 1KIBA 1OWAA 2A06E 3VP9A 2C8SA 5AW2B 2WWWA 1L4AA 1Q90D 4GKGA 1GD2E 4PD4D 1LP1A 1H32A 2KP8A 1R5LA 1KX7A 3WU2H 3H1JD 1GU5A 4D6TJ 3H32A 4HJGH 1T6AA 1N50A 2R32A 4V2KA 1KFMA 2NPSD 3AE9C 1K04A 2ZXEB 3TGUE 1QX8A 2B0ZB 1C52A 3TSIA 2AXTV 1NU1G 4U3FJ 4ZNCA 3AE8C 4XA4A 3VN0A 3VYMA 5B66V 2GC7D 3OCDB 2M5AB 2WSCH 1KQFB 1ZLLA 3EQ2A 4KHXA 1L0LD 1VF5B 5APXA 3Q1MA 1RF1A 2RH0A 1ZZHA 1X9VA 2YKQA 2BCCJ 1QVGO 1LWUC 3E1IA 3P7KA 3U1CA 1EC5A 2FY8A 4O9BA 4A7PA 1LTJC 2CA4B 2Q3IA 3L4MA 3AE4C 2P10A 4RJTA 5CCHD 1JUNA 3CXHI 2Q9IA 2BGVX 1S9KD 2OTJP 1FJKA 1H33B 1K8AQ 1ZW0A 2OYHC 3OA7A 1RQUA 2KB7P 3CC7P 3CYTI 3A0BE 5CBNA 1FI7A 4BWNA 5AW9B 3CCJP 4LLHA 2QA4P 2WITA 1JM0A 1X79B 3U59A 1IK7A 3B5ND 1Q7YQ 1NTKK 4AAOA 1CSWA 5KAFV 5KKZC 5KLVJ 1G2CB 3RK2B 1NU1J 4GOEA 3PXWA 4NFGB 1YEAA 2CXBA 2O01J 1SFCC 2WQYC 2QJKC 2IBZD 2ZAEB 2MJZA 2OYOA 2Y0DA 1IFNA 3BCCE 1AOFA 1IO4A 155CA 4D6TD 1LP1B 1S2EA 2KZIA 3L70E 3G9RA 1NTKE 4M3LA 3H32B 2R3CA 2KSJA 1PGPA 2QJPC 1KYOI 1YIQA 2N1TB 1CCHA 4U3FD 3E7KA 1DIIC 1NTMK 4OVNF 1WMKA 1NTZG 3H1LG 2D0SA 1KX2A 5DJQC 2N3YA 1N86A 4DCKA 2PCCB 1MG2D 2N3BA 4EOTA 1SP4A 3MGNA 1FZAA 2I1KA 4YPCA 3L71E 2BCCD 2CPBA 3BRTB 4Y99B 3D71A 1CIFA 3SFEC 1GL2B 2KYVA 2E74B 1AQ5A 1SQQG 1L0ND 1MG3D 3L4OA 3WFBC 2E76D 1PP9G 1JDLA 3L75E 2R44A 351CA 1NTME 3HD7D 1I5TA 1SQVK 2IYPA 2POHA 2AXTE 3N4XA 3KPEA 3RK3E 2K9JA 1FAVA 3DMIA 5CCGA 4DOJA 2WVRA 5B66E 1BGYJ 1I54A 4RO0A 1CEDA 2E43A 2P2UA 2C9LY 1CI6A 2G3AA 3SLEA 5AURA 2V07A 3WUTA 1CIHA 1DEBA 2WPVB 5KLVD 1SQXK 5AVZB 2AXTH 5KLIB 1FE6A 1SQPG 1SQVE 3D6YA 3FGAD 1PFIA 1AQTA 1CIGA 1SQBG 3L73J 5CCHC 1M57D 3HUSC 1GDVA 2YCCA 4UB8H 1EDJA 3CCUP 3CX5W 3JC22 3HQ6A 2E75C 4IL6X 1M1JB 4H13B 1S5LH 2JJLA 1NKZB 2A45H 1BE3D 1CHJA 4LC1A 2ZJSE 1U57A 5KAFE 2V7QJ 1YJNP 5AVTB 3HQ9A 1J3SA 3CLQA 2ZZS1 4H0JA 3CMAP 5B5EE 2J5UA 2C1DA 1KB0A 2BEZF 2FYUG 4JBZA 1CSBA 1YITP 3CL3D 3M9QA 1KILA 1PGQA 1LNQA 1JNMA 1CYJA 2QE7H 3CXHD 1LFMA 1FOSE 5AW3B 2H88C 2D2CD 3A0HV 1NYHA 1JMMA 3V5BA 3AE3C 1BGYD 1AFOA 1GTWA 5KJ7D 1NIRA 5APYA 2P7JA 2IZ0A 3LIEA 1KB9H 3L37A 4Y5RA 5AVRB 4Q5PA 4L3HA 2YO3A 3L74E 2ZONG 1PGJA 1ZP0C 1FCDC 3BVHA 1I8PA 2HODB 2FXMA 3NBTA 5EXQA 3ITKA 2E5TA 3D70A 2QJYC 1BCCG 2LR2A 2O01H 3ZOOA 3M9BA 2M8RA 1Q81Q 3L73D 2C9XB 3CC2P 3RN1A 2E76C 1YI2P 3RBZA 1MZ4A 4AX3A 1N7SD 4KJMA 4HYTB 3MUDC 2FYUJ 1M1KQ 3HD7C 1PPJE 2I8FA 3Q3DA 3H1JG 3WU2V 2J58A 1KYOD 4L3GA 3TDKA 1GW3A 4WY4A 1YQ3C 1KZUB 1T3UA 1VPCA 1U74B 3MK7C 1USDA 2O1KA 2HPCA 1LT9A 3G3ZA 1NTZK 2D0WA 1LWUB 3M9HA 4IFFA 1H31A 1LJ2A 1LTJB 1VQOP 1L0LG 3F89A 1ETPA 1JEKA 4OH8B 2C1DB 2YXQB 3CXHH 3V4QA 3S4RA 2YO2A 4HKZH 3F5HA 1SQQK 1C6RA 2OYHB 3KHUA 1VQMP 1M70A 2KUBA 2NPSA 1NWQA 1LC2A 1OW8A 3RL0C 4IFMA 1EXJA 1NTZE 2FBWC 1FDMA 3A3YB 3RN0A 1S6VB 5AW7B 4ZKPA 2Y0EA 1JY2O 1GU4A 1DIPA 5H2FV 5KKZB 5CJ4A 1SQQE 4WQDA 2ORLA 2QVAA 4Y28J 1P84E 1RF0C 5M1BA 1FBMA 1I6EA 1N15A 1SFCB 2QJKB 3OCDA 2M5AA 2BPBB 1OXZA 3NFQA 3A0HE 3KXDA 2AIUA 1SQPK 1S72P 1ZV8A 4FA5A 2M3BA 3B8EB 3GF3A 4K3AA 2B87B 3H1HE 3WUVA 2C9NY 4AANA 1SQBK 2IBZG 3I56P 4PJ0H 4D6TG 3CWBJ 2QJPB 2K3RA 1CRYA 1NO4A 5CHXA 1SVFA 1SFCD 1KYOH 3B5NA 2FKWB 3IFMA 1ZOYC 1OCDA 1JO5A 1W5CE 3CCLP 1QYZA 1IO3A 5KJ7C 2QM7A 4U3FG 4XFJA 2IFNA 1SQPE 1HWTC 3HE5B 1DD3A 2C1VA 2FWLA 3TGUD 4ZMDA 1SQBE 2E5YA 3NTNA 2HPCB 1AKKA 1VYDA 4N6JA 1IFPA 2BCCG 3VTPC 1MUUA 1M60A 3SFDC 3OW2O 4EYYQ 1C2NA 2ZT9D 1G2CA 1PZQA 3WU2E 1I8OA 2LIRA 1L0NG 2XKMA 2Y9ZA 1N7SC 2ZVOB 4R4LA 1B7VA 2IZ1A 3CCVP 4FA4A 3I5CA 3FX0A 3CP5A 3ZIYA 3HQ7A 2NPSB 4N0KA 1IZNB 4OGQD 2NRGA 5GTHH 3PH2B 4FANA 1KQSO 1D7MA 1NTMJ 1WRGA 2ZYGA 5APVA 4ASVA 1JB0J 2W8ZA 4XE5B 1A02J 4O1QA 4EIDA 2N1TA 1QL4A 3PHLA 4FAVA 5KTBA 1HZVA 5KLVG 4UB6H 1MV8A 2OYIC 1PGOA 2YQBA 1EQ7A 1URQD 1H89A 3HUSB
chains in the Genus database with same CATH topology
1DW0A 1CIFA 3ORVA 3CX5D 1CXAA 1L0ND 1MG3D 3L4OA 1IRWA 3WFBC 2KNCB 2RN0A 2BH5X 1CHIA 1JDLA 1YTCA 3CWBD 4WQCA 1CYCA 351CA 4UB8V 1I55A 5CIGB 3VMAA 3PRJA 1I5TA 1E2RA 1CRHA 2C2CA 1FJ0A 5GTIV 3X39A 2Q3EA 1YICA 2K9JB 3ZOYA 4EDFA 1AOQA 2KS1A 2A06D 1L9BC 1S5LV 3RMZA 3NBSA 1HH7A 1CO6A 1DW2A 3DMIA 1YNRA 3ZOWA 5CICB 2B12B 451CA 1I54A 5IY51 1CRIA 1CEDA 1BL9A 2QG4A 5CIDB 1WVEC 4KMGA 1NTZD 3H1LD 2BLFB 5DJQB 2N18C 3SLEA 1CNOA 2V07A 5AURA 1CTZA 2N9IA 1CIHA 4WQEA 5KLVD 5KLIB 1A8CA 1H1OA 3A9FA 5C9MA 1GKSA 2XTSB 1E29A 3SXTA 1CIGA 4DY9A 1SQQD 2EXVA 1NMLA 4WQ9A 5CIHB 3DP5A 1PP9D 1GDVA 1CC5A 2YCCA 3CX5W 3HQ6A 1L9JC 1CTYA 4XYDB 1CRJA 3JBTB 2L4DA 1NTMD 2DVHA 1DW3A 4YE1A 2VHDA 1CXCA 1BE3D 1CHJA 1C6OA 3PTZA 1H9XA 3VRDA 2ZXYA 3HQ9A 1J3SA 2DGEA 2ZZS1 4H0JA 3ZCFA 4O1WA 2RMZA 5TJHA 5B6QA 1LC1A 3O5CA 2C1DA 1KB0A 1SQPD 4PWAA 4RSZA 2N9JA 4GYDA 1CYJA 1SQBD 4J20A 3CXHD 2LITA 1LFMA 1HJ5A 3PXTA 5CYTR 1RZ6A 1WEJF 3SJLA 3A0HV 4EICA 3GG2A 2N9YB 1CYIA 4FA9A 2BCNB 4PW9B 1BGYD 3MK7B 5TISV 1C2RA 3CU4A 2AI5A 5CIEB 4QAOA 1GJQA 1SQXD 1NIRA 3BCCD 3VNWA 4AALA 3O20A 1COTA 3L70D 1RZ5A 4Y5RA 4P4QB 4Q5PA 4L3HA 3A0BV 1W2LA 2ZONG 1A56A 1NTKD 1FCDC 2FYNB 2ZOOA 1K3GA 1I8PA 2PACA 3TYIA 1DVVA 3OA8A 3NBTA 1LS9A 5EXQA 1DT1A 1FI3A 2FYUD 2YK3A 3WFCC 3ITKA 2BH4X 1EB7A 3ZOOA 1EZVD 3L73D 2C9XB 1CTJA 3RN1A 4FB1A 3ZOXA 1MZ4A 3PXSA 4AAMA 4AX3A 2HV4A 1H33A 2CA3B 3L71D 2I8FA 1HCMA 1F1FA 1W5CT 4JCGA 4LJIA 3CXHW 3NWVA 3WU2V 1HROA 1QN2A 3WC8A 2CE0A 1GU2A 1LMSA 1M6ZA 1KYOD 4L3GA 3TDKA 5CIBB 3L75D 4H0KA 2CE1A 4WQ7A 5KAIV 3SVWA 1ZRTD 1U74B 1NNOA 3MK7C 2L91A 1K3HA 1H31B 1U75B 1KV9A 2D0WA 3C2CA 1HJ4A 1H31A 2B4ZA 3L72D 1C6SA 2V08A 4K3IA 3H1KD 3L74D 1ETPA 5B5EV 1CORA 1OAEA 2QJYB 4WQAA 1CSUA 4XXLA 1BCCD 1FHBA 1R0QA 2C1DB 3PLNA 1CRGA 5DF5A 1KIBA 1F1CA 1CSXA 2C8SA 3WUIA 1AYGA 1YFCA 1H32B 1C6RA 3KHUA 3O0RC 1M70A 4PD4D 1H32A 4PJ0V 1SQVD 1LC2A 1KX7A 3H1JD 2FRCA 1IZL0 1CHHA 1PPJD 3RN0A 1S6VB 1N50A 1CIEA 2Y0CA 2MHMA 2PCBB 2Y0EA 4V2KA 3RLMA 1IRVA 5H2FV 2B0ZB 3WFDC 1C52A 1H9YA 2GIWA 1KYOW 2AXTV 5KKZB 4WQ8A 3VYMA 5B66V 2GC7D 3WFEC 3OCDB 4WQDA 2ORLA 1HRCA 1QL3A 5DFSA 1I6EA 1N15A 1L0LD 2QJKB 3OCDA 1DIQC 2BPBB 3HQ8A 3O1YA 1ZZHA 2AIUA 3OA8B 1CSVA 4FA5A 4A7PA 2CA4B 2JTIB 4AANA 1FI9A 2OZ1B 3L4MA 1CRCA 4RJTA 1HZUA 2ZBOA 3TF5A 2B10B 2OZ1A 2BGVX 2QJPB 1CRYA 1H33B 1HJ3A 4EIFA 3DR0A 5GTHV 1OCDA 5C0ZA 1E8EA 1QYZA 1IO3A 3CYTI 2GB8B 3KZIV 1KB9D 1FI7A 1DVHA 1YEBA 3ZBMA 1NU1D 4EIEA 2B11B 2C1VA 2FWLA 3TGUD 4FA1A 4AAOA 4UB6V 2MTAC 4WQBA 1AKKA 1CSWA 1VYDA 1I6DA 1GQ1A 5KAFV 2C1UA 1M60A 2JWAA 1C2NA 1P84D 5E79V 1FOCA 3PXWA 4NFGB 1YEAA 1C75A 5CIFB 4GEDB 1I8OA 2LIRA 1NMIA 2CXBA 3H1ID 4MU8A 1B7VA 3M97X 1IQCA 3GW6A 2IBZD 3H1HD 4FA4A 2Y0DA 3CP5A 2GC4D 2JQRA 1AOFA 1N90A 155CA 4D6TD 3ZIYA 3HQ7A 4N0KA 1DW1A 3PH2B 4FANA 1QKSA 1YCCA 3FWLA 1RAPA 1C7MA 2N18B 2YIUB 3SWSA 4IL6V 1YIQA 4L1QA 1CCHA 4U3FD 1DIIC 4O1QA 4EIDA 1GIWA 1KX2A 1QL4A 2D0SA 3PHLA 1A2SA 4FAVA 1RAQA 1CCRA 5DJQC 1N9CA 2N3YA 1HZVA 2PCCB 1MG2D 2N3BA 2O3JA 2YQBA 2BCCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DW0 A;  1CIF A;  3ORV A;  3CX5 D;  1CXA A;  1L0N D;  1MG3 D;  3L4O A;  1IRW A;  3WFB C;  2KNC B;  2RN0 A;  2BH5 X;  1CHI A;  1JDL A;  1YTC A;  3CWB D;  4WQC A;  1CYC A;  351C A;  4UB8 V;  1I55 A;  5CIG B;  3VMA A;  3PRJ A;  1I5T A;  1E2R A;  1CRH A;  2C2C A;  1FJ0 A;  5GTI V;  3X39 A;  2Q3E A;  1YIC A;  2K9J B;  3ZOY A;  4EDF A;  1AOQ A;  2KS1 A;  2A06 D;  1L9B C;  1S5L V;  3RMZ A;  3NBS A;  1HH7 A;  1CO6 A;  1DW2 A;  3DMI A;  1YNR A;  3ZOW A;  5CIC B;  2B12 B;  451C A;  1I54 A;  5IY5 1;  1CRI A;  1CED A;  1BL9 A;  2QG4 A;  5CID B;  1WVE C;  4KMG A;  1NTZ D;  3H1L D;  2BLF B;  5DJQ B;  2N18 C;  3SLE A;  1CNO A;  2V07 A;  5AUR A;  1CTZ A;  2N9I A;  1CIH A;  4WQE A;  5KLV D;  5KLI B;  1A8C A;  1H1O A;  3A9F A;  5C9M A;  1GKS A;  2XTS B;  1E29 A;  3SXT A;  1CIG A;  4DY9 A;  1SQQ D;  2EXV A;  1NML A;  4WQ9 A;  5CIH B;  3DP5 A;  1PP9 D;  1GDV A;  1CC5 A;  2YCC A;  3CX5 W;  3HQ6 A;  1L9J C;  1CTY A;  4XYD B;  1CRJ A;  3JBT B;  2L4D A;  1NTM D;  2DVH A;  1DW3 A;  4YE1 A;  2VHD A;  1CXC A;  1BE3 D;  1CHJ A;  1C6O A;  3PTZ A;  1H9X A;  3VRD A;  2ZXY A;  3HQ9 A;  1J3S A;  2DGE A;  2ZZS 1;  4H0J A;  3ZCF A;  4O1W A;  2RMZ A;  5TJH A;  5B6Q A;  1LC1 A;  3O5C A;  2C1D A;  1KB0 A;  1SQP D;  4PWA A;  4RSZ A;  2N9J A;  4GYD A;  1CYJ A;  1SQB D;  4J20 A;  3CXH D;  2LIT A;  1LFM A;  1HJ5 A;  3PXT A;  5CYT R;  1RZ6 A;  1WEJ F;  3SJL A;  3A0H V;  4EIC A;  3GG2 A;  2N9Y B;  1CYI A;  4FA9 A;  2BCN B;  4PW9 B;  1BGY D;  3MK7 B;  5TIS V;  1C2R A;  3CU4 A;  2AI5 A;  5CIE B;  4QAO A;  1GJQ A;  1SQX D;  1NIR A;  3BCC D;  3VNW A;  4AAL A;  3O20 A;  1COT A;  3L70 D;  1RZ5 A;  4Y5R A;  4P4Q B;  4Q5P A;  4L3H A;  3A0B V;  1W2L A;  2ZON G;  1A56 A;  1NTK D;  1FCD C;  2FYN B;  2ZOO A;  1K3G A;  1I8P A;  2PAC A;  3TYI A;  1DVV A;  3OA8 A;  3NBT A;  1LS9 A;  5EXQ A;  1DT1 A;  1FI3 A;  2FYU D;  2YK3 A;  3WFC C;  3ITK A;  2BH4 X;  1EB7 A;  3ZOO A;  1EZV D;  3L73 D;  2C9X B;  1CTJ A;  3RN1 A;  4FB1 A;  3ZOX A;  1MZ4 A;  3PXS A;  4AAM A;  4AX3 A;  2HV4 A;  1H33 A;  2CA3 B;  3L71 D;  2I8F A;  1HCM A;  1F1F A;  1W5C T;  4JCG A;  4LJI A;  3CXH W;  3NWV A;  3WU2 V;  1HRO A;  1QN2 A;  3WC8 A;  2CE0 A;  1GU2 A;  1LMS A;  1M6Z A;  1KYO D;  4L3G A;  3TDK A;  5CIB B;  3L75 D;  4H0K A;  2CE1 A;  4WQ7 A;  5KAI V;  3SVW A;  1ZRT D;  1U74 B;  1NNO A;  3MK7 C;  2L91 A;  1K3H A;  1H31 B;  1U75 B;  1KV9 A;  2D0W A;  3C2C A;  1HJ4 A;  1H31 A;  2B4Z A;  3L72 D;  1C6S A;  2V08 A;  4K3I A;  3H1K D;  3L74 D;  1ETP A;  5B5E V;  1COR A;  1OAE A;  2QJY B;  4WQA A;  1CSU A;  4XXL A;  1BCC D;  1FHB A;  1R0Q A;  2C1D B;  3PLN A;  1CRG A;  5DF5 A;  1KIB A;  1F1C A;  1CSX A;  2C8S A;  3WUI A;  1AYG A;  1YFC A;  1H32 B;  1C6R A;  3KHU A;  3O0R C;  1M70 A;  4PD4 D;  1H32 A;  4PJ0 V;  1SQV D;  1LC2 A;  1KX7 A;  3H1J D;  2FRC A;  1IZL 0;  1CHH A;  1PPJ D;  3RN0 A;  1S6V B;  1N50 A;  1CIE A;  2Y0C A;  2MHM A;  2PCB B;  2Y0E A;  4V2K A;  3RLM A;  1IRV A;  5H2F V;  2B0Z B;  3WFD C;  1C52 A;  1H9Y A;  2GIW A;  1KYO W;  2AXT V;  5KKZ B;  4WQ8 A;  3VYM A;  5B66 V;  2GC7 D;  3WFE C;  3OCD B;  4WQD A;  2ORL A;  1HRC A;  1QL3 A;  5DFS A;  1I6E A;  1N15 A;  1L0L D;  2QJK B;  3OCD A;  1DIQ C;  2BPB B;  3HQ8 A;  3O1Y A;  1ZZH A;  2AIU A;  3OA8 B;  1CSV A;  4FA5 A;  4A7P A;  2CA4 B;  2JTI B;  4AAN A;  1FI9 A;  2OZ1 B;  3L4M A;  1CRC A;  4RJT A;  1HZU A;  2ZBO A;  3TF5 A;  2B10 B;  2OZ1 A;  2BGV X;  2QJP B;  1CRY A;  1H33 B;  1HJ3 A;  4EIF A;  3DR0 A;  5GTH V;  1OCD A;  5C0Z A;  1E8E A;  1QYZ A;  1IO3 A;  3CYT I;  2GB8 B;  3KZI V;  1KB9 D;  1FI7 A;  1DVH A;  1YEB A;  3ZBM A;  1NU1 D;  4EIE A;  2B11 B;  2C1V A;  2FWL A;  3TGU D;  4FA1 A;  4AAO A;  4UB6 V;  2MTA C;  4WQB A;  1AKK A;  1CSW A;  1VYD A;  1I6D A;  1GQ1 A;  5KAF V;  2C1U A;  1M60 A;  2JWA A;  1C2N A;  1P84 D;  5E79 V;  1FOC A;  3PXW A;  4NFG B;  1YEA A;  1C75 A;  5CIF B;  4GED B;  1I8O A;  2LIR A;  1NMI A;  2CXB A;  3H1I D;  4MU8 A;  1B7V A;  3M97 X;  1IQC A;  3GW6 A;  2IBZ D;  3H1H D;  4FA4 A;  2Y0D A;  3CP5 A;  2GC4 D;  2JQR A;  1AOF A;  1N90 A;  155C A;  4D6T D;  3ZIY A;  3HQ7 A;  4N0K A;  1DW1 A;  3PH2 B;  4FAN A;  1QKS A;  1YCC A;  3FWL A;  1RAP A;  1C7M A;  2N18 B;  2YIU B;  3SWS A;  4IL6 V;  1YIQ A;  4L1Q A;  1CCH A;  4U3F D;  1DII C;  4O1Q A;  4EID A;  1GIW A;  1KX2 A;  1QL4 A;  2D0S A;  3PHL A;  1A2S A;  4FAV A;  1RAQ A;  1CCR A;  5DJQ C;  1N9C A;  2N3Y A;  1HZV A;  2PCC B;  1MG2 D;  2N3B A;  2O3J A;  2YQB A;  2BCC D; 
#chains in the Genus database with same CATH topology
 1LTB C;  3ORV A;  2E75 B;  1KQL A;  4N78 E;  1IRW A;  2RN0 A;  1GL2 A;  2IPP A;  2OTK E;  3CWB D;  1T2K D;  3II6 A;  2B9B A;  4UB8 V;  1I55 A;  1DX7 A;  5H2F E;  5AW6 B;  2Z4E A;  1ZRT E;  1FJ0 A;  1RHZ B;  1L0N J;  1L9B C;  1S5L V;  1Q82 Q;  3NBS A;  2Z5H A;  1BE3 G;  2WSE H;  3B5N B;  2E75 D;  1IFJ A;  2WSF J;  1SQX J;  1BL9 A;  1BCC E;  4KMG A;  4YXD C;  3M0A A;  2BLF B;  1JOC A;  2C0W A;  3AEB C;  1CTZ A;  1BDC A;  5H2F H;  2XU6 A;  2JR8 A;  3PH0 A;  3A9F A;  1L0L K;  2W27 A;  3EFF K;  2XTS B;  3H1J E;  3V2P A;  1FDI A;  2CK3 H;  4DY9 A;  3P8C E;  1AJY A;  2JO1 A;  4RKU J;  1NML A;  2K9Y A;  4GT1 A;  1HVV A;  2IX7 C;  2I8D A;  1H0T A;  1W2E A;  2FYZ A;  1EDK A;  4PD4 H;  2L4D A;  1NTM D;  1M1J A;  1YYC A;  3SWK A;  1BGY G;  2WT7 B;  3M0D A;  1L0L E;  1KQG B;  3T97 B;  1N7L A;  2QM8 A;  3VRD A;  1VQN P;  2WMM A;  2ZXY A;  1BE3 J;  3LID A;  4GOF A;  3RL0 g;  1JTH A;  2E76 B;  5TJH A;  1EZV E;  3MTU E;  3L72 J;  4L75 A;  3H1K J;  2ZT9 C;  3L74 J;  1S9K E;  4AUW A;  3HD7 B;  2I1J A;  3L73 G;  4WBA A;  4GYD A;  1YJ9 P;  1J1D C;  2LIT A;  2P1J A;  2RKL A;  1FZC C;  3AED C;  5KJ7 A;  1KD1 Q;  1WT6 A;  5APQ A;  1WEJ F;  3SJL A;  1N2D C;  4EIC A;  4OGQ C;  4GIF A;  1L4A D;  1FJP A;  4H0L C;  2ZFC A;  3GG2 A;  4PW9 B;  2PRR A;  3MK7 B;  2WZ7 A;  1GJQ A;  1SQX D;  4HH2 A;  3CME P;  3CD6 P;  4PV1 D;  4AAL A;  1A02 F;  3O20 A;  1M56 D;  1RZ5 A;  5AW0 B;  5CMZ A;  1RH5 B;  1A56 A;  3A7O A;  1MFT A;  3TYI A;  3QWO C;  1DVV A;  2IBZ E;  1URQ C;  4NPD A;  1XTC C;  3C1L A;  3AE6 C;  1DT1 A;  2FXO A;  3PP5 A;  2HOD A;  4D6T E;  4UB8 E;  1AVO A;  1EB7 A;  3LW5 J;  1NJI Q;  2W83 C;  4FB1 A;  3ZOX A;  3S9O A;  3CCE P;  3VP8 A;  4AAM A;  1S5L E;  2W6A A;  1IK9 A;  3CX5 I;  1VQ5 P;  1T2K C;  1OX3 A;  2HV4 A;  3R2P A;  1IJD B;  1OMI A;  3HTK B;  1RE4 C;  2CA3 B;  2PAJ A;  1HCM A;  1W5C T;  4U3F E;  4LJI A;  1YJW P;  5APS A;  1RQV A;  3NWV A;  5AW1 B;  1H0T B;  2CE0 A;  1GU2 A;  1LMS A;  1X22 A;  5TIS H;  1EDL A;  1PIX A;  3OJA B;  2CE1 A;  3RL0 D;  3U1A A;  1J1E C;  3GHG C;  3SVW A;  1K3H A;  2QSI A;  3WMM 0;  3MIW A;  1RE3 C;  4C7N B;  3L72 D;  1C6S A;  2QIW A;  3Q5R A;  4K3I A;  3H1K D;  4GOD A;  5KLV K;  3L74 D;  1LWU A;  2D2C B;  1NU1 K;  4WQA A;  1JTH B;  1LTJ A;  4XXL A;  1FHB A;  2Z5I A;  1R0Q A;  5DF5 A;  2AEJ A;  3KQG A;  3RBX A;  1F1C A;  1CSX A;  1AYG A;  1YFC A;  3AE1 C;  3SWY A;  3H1I J;  3IN6 A;  2M0B A;  2OYH A;  4PJ0 V;  1JY3 P;  1UIX A;  1RY3 A;  3CCR P;  2FRC A;  1IZL 0;  1PPJ D;  3FXD A;  1DEE G;  1KB9 E;  1VL2 A;  2OGU A;  3V2N A;  2MHM A;  1Y9B A;  2PCB B;  2WSF H;  2J59 M;  1HTL C;  5KLV E;  3RK3 C;  1NU1 E;  2GUV A;  1AVY A;  5KAI H;  1H9Y A;  3TGU G;  4WQ8 A;  1HJB A;  5AVU B;  1LTI C;  4LGD E;  3WFE C;  2YKO A;  1KFN A;  1HRC A;  1QL3 A;  1N7S B;  2ZVN B;  5DFS A;  1DIQ C;  3HQ8 A;  3GMA A;  3O1Y A;  4CPG A;  1SFC A;  2K37 A;  3W67 A;  2JTI B;  1FZF A;  1M7L A;  2B87 A;  1YIJ P;  2OZ1 B;  2FFD C;  4BRY A;  1HZU A;  3TF5 A;  4I2L C;  2FXP A;  4JYC A;  5L8R J;  1L4A C;  2KIK A;  1FC2 C;  1LTS C;  1N8R Q;  1HJ3 A;  4EIF A;  3DR0 A;  3AE2 C;  5GTH V;  5C0Z A;  1HJ0 A;  3AEG C;  4PV1 C;  2ZYA A;  1N73 C;  2OYI B;  1MKM A;  1YEB A;  1VQK P;  4JQ0 D;  3EWK A;  2B11 B;  1GK6 A;  2OQQ A;  3HE5 A;  3V2Q A;  3CXH E;  3UIA A;  4HB1 A;  4FA1 A;  1FZC A;  2P58 A;  4UB6 V;  4DT0 A;  1I6D A;  1GQ1 A;  3H6P A;  2ITA A;  1BSN A;  1P84 D;  1USE A;  5E79 V;  1FOC A;  3TGU J;  1NKN A;  5CIF B;  4GED B;  1RF1 C;  2E74 C;  2KLU A;  3H1I D;  1BGY E;  3M97 X;  1IQC A;  2KK7 A;  3H1H D;  3CWB G;  2VRS A;  4W7Y A;  2Q1K A;  2GC4 D;  1FU1 A;  2JQR A;  2WSS H;  5BVZ A;  1PV3 A;  5AVX B;  1HGV A;  1GDT A;  1DW1 A;  2W6B A;  1QKS A;  2YMY A;  1YCC A;  1RAP A;  1C7M A;  3KZI H;  1NH4 A;  4IL6 V;  3H1L E;  4NPE A;  4L1Q A;  2V4H A;  2UWJ E;  1OW6 A;  1GIW A;  3L73 E;  1RAQ A;  1CCR A;  1M90 Q;  3V2R A;  2PGD A;  2O3J A;  3LW5 H;  4MN4 C;  4GDO A;  3CCQ P;  3HE4 B;  1ZME C;  4PJ0 E;  4B86 A;  5CCH A;  3HUS A;  1PP9 E;  3CX5 D;  4YTP C;  2BEQ D;  1CXA A;  3QH9 A;  2KNC B;  1KYO E;  2W90 A;  1KIL D;  2JKV A;  1YTC A;  2M3E A;  4WQC A;  1IFD A;  3FWN A;  5APW A;  3VMA A;  3PRJ A;  1E2R A;  1JY3 N;  1CRH A;  1OVR A;  2KS1 B;  4BRY B;  3GHG A;  1NTM G;  2Q3E A;  1YIC A;  1MZ9 A;  1KN7 A;  2A06 D;  2OAR A;  1HH7 A;  1CO6 A;  3MP7 B;  1YQ4 C;  3AEC C;  1VQ6 P;  4N3Y B;  1CRI A;  1QLE D;  1AV1 A;  1JY2 P;  4BXL A;  1M8O B;  5CID B;  3BCC J;  2V7Q H;  2ZT9 B;  5DJQ B;  2N18 C;  2YIU C;  3L70 J;  5AVS B;  1KTM A;  2N9I A;  1OW7 A;  3B4S A;  1NTK J;  1J1D B;  4U7J A;  1TU3 F;  1H1O A;  5C9M A;  1FZC B;  3MZW B;  1GKS A;  4TT3 H;  3SXT A;  4OGQ B;  3FXE A;  2EXV A;  5GTH E;  3CCM P;  4WQ9 A;  1G1I A;  3DP5 A;  2FYU K;  1CC5 A;  3KYQ A;  5K5G B;  3SSU A;  1L9J C;  2ZXX A;  3L71 J;  4I1L A;  5GTI H;  1CRJ A;  1UII A;  3JBT B;  2DVH A;  3CI9 A;  2KI7 B;  1H88 A;  4YE1 A;  2HLO A;  2VHD A;  1CXC A;  1HF9 A;  1VQP P;  1SQX G;  4UB6 E;  2WT7 A;  3L75 J;  1KB9 I;  4H0L D;  1URQ B;  5CCG C;  4JYB A;  3PTZ A;  1H9X A;  3T97 A;  4WY4 D;  2KXP B;  1CW5 A;  2FYU E;  1HGZ A;  2RMZ A;  2P67 A;  5B6Q A;  4H44 D;  1LC1 A;  2Q5U A;  3VOP A;  2XDJ A;  3CX5 H;  5AW8 B;  4DZO A;  3MUD A;  3HD7 A;  1HJ5 A;  3PXT A;  2IYO A;  5E79 H;  1K05 A;  5CYT R;  3P8C D;  1VQ7 P;  4IL6 E;  1N73 A;  1YHQ P;  3OAK A;  1SQV J;  2N9Y B;  1CYI A;  1J1E B;  4FA9 A;  2BCN B;  3TK1 A;  3GHG B;  2KLV A;  3O6Q B;  5TIS V;  3CU4 A;  4K35 A;  1E79 H;  4JPZ B;  3BCC D;  3VNW A;  1R8E A;  1S1C X;  1COT A;  3G71 P;  3AEA C;  3L70 D;  4P4Q B;  4IL6 H;  1NTK D;  3L72 G;  2ZOO A;  1K3G A;  2PAC A;  3H1K G;  3L74 G;  2KOG A;  3OA8 A;  1LS9 A;  1FI3 A;  2IDB A;  2BH4 X;  1NHL A;  3USS A;  1EZV D;  2B88 A;  1CTJ A;  2R5D A;  4ZKU A;  4PD4 E;  1KIL C;  5CJ0 A;  4TLF A;  5AVW B;  2GM4 A;  3KDP B;  1VF5 D;  1GW4 A;  3L71 D;  4JCG A;  2E42 A;  3RK3 B;  1T8Z A;  1FZB A;  2H8P D;  3CXH W;  3HTK A;  2N9B A;  1HRO A;  1PPJ G;  3EFG A;  1YBK A;  4DJG A;  2AEM A;  3CC4 P;  2K88 A;  1M6Z A;  3BRV B;  3L75 D;  4H0K A;  2WTY A;  4WQ7 A;  5KAI V;  1JY2 N;  1NNO A;  1S4X A;  1RF0 A;  3A0B H;  1U75 B;  1KV9 A;  3C2C A;  2Q7C A;  3ZDM A;  3RK3 D;  1HJ4 A;  4C46 A;  2B4Z A;  1NAY A;  1SLQ A;  4WB4 A;  1OFC X;  3CWB E;  2JEE A;  3MD0 A;  5B5E V;  1R5S A;  3AE5 C;  3AEF C;  1IFM A;  3P32 A;  5AW5 B;  4C7N A;  2QJY B;  1CSU A;  2FFD B;  2G8Y A;  2FYN C;  1L4A B;  4L76 A;  3N7N A;  3WUI A;  1QGK B;  1NOH A;  1H32 B;  3TYY A;  3O0R C;  1LT1 A;  3RK2 D;  2KZJ A;  2PFX A;  1P84 I;  1SQV D;  2CPS A;  1U7J A;  4PV1 B;  2XNX A;  1CHH A;  1N73 B;  3TNU A;  1CIE A;  2Y0C A;  1ZXG A;  2OTL P;  2JDI H;  3C8V A;  1BSH A;  1LTA C;  3RLM A;  3C9I A;  1IRV A;  3HRN A;  3GF7 A;  4WVZ A;  2GA1 A;  3WFD C;  2GIW A;  1KYO W;  2C0X A;  4WY4 C;  3O8Z A;  3BAS A;  4C7R A;  1XTG B;  3CCS P;  4H44 C;  1E5W A;  1RF1 B;  1LT9 C;  2N1T D;  2YMK A;  4L73 A;  3K5B A;  1N7S A;  3OA8 B;  1CSV A;  2H89 C;  2IFM A;  2JP3 A;  3H1I G;  1VQ4 P;  1HBW A;  1FI9 A;  3H1H G;  2AXC A;  1CRC A;  1T3J A;  4I7Z C;  5TIS E;  2LXB A;  2ZBO A;  5AVY B;  4Z1M H;  2B10 B;  2B89 A;  2OZ1 A;  3RL0 B;  1OIP A;  1GL2 D;  2E74 D;  2NPS C;  3V6I A;  1L0N K;  1VQL P;  3B71 A;  1E8E A;  2WPR A;  1VQ8 P;  1EXI A;  5AW4 B;  2GB8 B;  3KZI V;  2O01 N;  1KB9 D;  2Q6Q A;  4I6M C;  1DVH A;  5BU5 A;  3W68 A;  3ZBM A;  1NU1 D;  4EIE A;  1QL1 A;  2OYI A;  1NTZ J;  3H1L J;  5B66 H;  4EIJ A;  1X8Y A;  2BCC E;  1GZL A;  2MTA C;  4WQB A;  3ABV C;  1Q2N A;  2C1U A;  2JWA A;  2XND H;  1JY3 O;  1JCD A;  1L0N E;  1CZQ A;  1PL5 A;  1C75 A;  3H25 A;  1NMI A;  1HUC A;  2O1J A;  4MU8 A;  1LTG C;  1VF5 C;  3GW6 A;  1AA0 A;  1SQQ J;  1HH0 A;  4AQR D;  1KOR A;  2YNY A;  3MHV A;  1PP9 J;  1SQX E;  3IAO A;  3M91 A;  1N90 A;  3P8M C;  1K73 Q;  5KAI E;  1X0T A;  3JSV C;  4ASW A;  2A06 G;  1YTZ I;  3FWL A;  5CBO A;  3H1H J;  3V4W A;  2LXC B;  2N18 B;  2Y9Y A;  2YIU B;  3SWS A;  3B5N C;  3TNU B;  1FOS F;  4H13 D;  1KC8 Q;  1S3J A;  1A2S A;  3Q2Y A;  4L74 A;  1N9C A;  2QEX P;  1KV4 A;  4JF7 A;  1VDF A;  2GUS A;  1FDO A;  5KAF H;  1OZH A;  3NMD A;  3HE4 A;  1DW0 A;  1VQ9 P;  1SQP J;  1YTZ T;  3AE7 C;  3A2A A;  2R3S A;  5B5E H;  1ZR4 A;  2BH5 X;  1SQB J;  1CHI A;  3RK2 C;  2R5B A;  2KNC A;  1CYC A;  3G4S P;  3PJS K;  5CIG B;  1QVF O;  4PD4 I;  2C2C A;  3I55 P;  5GTI V;  3X39 A;  1OVV A;  2HYN A;  2YXR B;  2K9J B;  3WUU A;  1W2B O;  3ZOY A;  4EDF A;  1AOQ A;  5DJT B;  1BE3 E;  2KS1 A;  3RMZ A;  3L35 A;  4KT0 J;  1DH3 A;  3L72 E;  1DW2 A;  1YNR A;  3H1K E;  3ZOW A;  5CIC B;  2B12 B;  451C A;  5IY5 1;  1Y8A A;  1DD4 A;  2WPQ A;  2QG4 A;  1CI6 B;  1WVE C;  1NVO A;  1NTZ D;  3H1L D;  2DW3 A;  2KSE A;  1CNO A;  2N1T C;  4WQE A;  1BDD A;  1A8C A;  5CCG D;  1MFZ A;  4QMA A;  2H7H A;  2HFE D;  2WSC J;  2XV5 A;  3GLM A;  1E29 A;  2MKV A;  2K1A A;  1SQQ D;  3L4F A;  1FZE A;  5CIH B;  1PP9 D;  5AVV B;  3KZI E;  4Y99 C;  3G6E P;  1K9M Q;  1GL2 C;  1EZV I;  1FS0 E;  1CTY A;  4XYD B;  4EI2 A;  3VYI A;  2WSE J;  4W80 A;  1DW3 A;  1SS1 A;  3Q5S A;  1U7M A;  3RGU A;  3BCC G;  5DJU B;  1C6O A;  3L70 G;  3Q5P A;  1L2P A;  5AVQ B;  1URQ A;  2NZ2 A;  1NTK G;  1IC2 A;  2DGE A;  3ZCF A;  1Q86 Q;  4O1W A;  3AEE C;  3O5C A;  1KIL B;  1JCC A;  1J2J B;  1Z56 A;  1SQP D;  1EZV G;  4PWA A;  2L5G B;  4RSZ A;  1BCC J;  2N9J A;  1NGM B;  2SPZ A;  2ZYD A;  4J20 A;  1SQB D;  1RE4 A;  1Y47 A;  5KLI C;  1S5L X;  2HR3 A;  1RZ6 A;  2JWD A;  3L71 G;  2IBZ I;  4IOI H;  3L36 A;  3H1J J;  1GK4 A;  1ZN5 A;  1OVU A;  3CPW O;  3VMY A;  1C2R A;  5BU8 B;  2LKM A;  3L75 G;  5C39 A;  3O6Q A;  1M1J C;  4H13 C;  1ZR2 A;  2AI5 A;  5CIE B;  4QAO A;  5APT A;  2A45 I;  2WPS A;  1EDI A;  1RE3 A;  3M0D C;  1LTT C;  3A0B V;  1W2L A;  3H1I E;  1JMB A;  2FYN B;  2H43 A;  3SWF A;  3WFC C;  2FYU D;  2YK3 A;  2D2C C;  2PP6 A;  1QEX A;  3IF4 A;  1L0L J;  3M06 A;  5GTI E;  2AEF A;  4WWI A;  1P84 H;  3PXS A;  4R4M A;  1FZG A;  2BAS A;  1IFI A;  1H33 A;  3A0H H;  1F1F A;  1SQV G;  4AYC A;  2A45 G;  4RES B;  2QRX A;  1GMJ A;  3R4Y A;  1QN2 A;  4H0L B;  3WC8 A;  4OWF A;  4W7Z A;  1LGH B;  5APU A;  3NXS A;  4N78 D;  3JCU E;  4WY4 B;  4YXW H;  5CIB B;  2HG5 D;  1G1J A;  1KMI Z;  2W6J H;  5EFW B;  3VMX A;  4H44 B;  1LT9 B;  3E1R A;  3D6Z A;  1ZRT D;  2L91 A;  1H31 B;  3CX5 E;  2YKP A;  4NPF X;  1QL2 A;  3D0W A;  1KIL E;  2V08 A;  3A5T A;  1NAF A;  3VMZ A;  3JCU H;  1COR A;  1OAE A;  5E79 E;  4I7Z B;  3BAT A;  1BCC D;  1H8A A;  3IR9 A;  3PLN A;  1CRG A;  4IFD K;  2XZR A;  2FFD A;  3S1K A;  1KIB A;  1OWA A;  2A06 E;  3VP9 A;  2C8S A;  5AW2 B;  2WWW A;  1L4A A;  1Q90 D;  4GKG A;  1GD2 E;  4PD4 D;  1LP1 A;  1H32 A;  2KP8 A;  1R5L A;  1KX7 A;  3WU2 H;  3H1J D;  1GU5 A;  4D6T J;  3H32 A;  4HJG H;  1T6A A;  1N50 A;  2R32 A;  4V2K A;  1KFM A;  2NPS D;  3AE9 C;  1K04 A;  2ZXE B;  3TGU E;  1QX8 A;  2B0Z B;  1C52 A;  3TSI A;  2AXT V;  1NU1 G;  4U3F J;  4ZNC A;  3AE8 C;  4XA4 A;  3VN0 A;  3VYM A;  5B66 V;  2GC7 D;  3OCD B;  2M5A B;  2WSC H;  1KQF B;  1ZLL A;  3EQ2 A;  4KHX A;  1L0L D;  1VF5 B;  5APX A;  3Q1M A;  1RF1 A;  2RH0 A;  1ZZH A;  1X9V A;  2YKQ A;  2BCC J;  1QVG O;  1LWU C;  3E1I A;  3P7K A;  3U1C A;  1EC5 A;  2FY8 A;  4O9B A;  4A7P A;  1LTJ C;  2CA4 B;  2Q3I A;  3L4M A;  3AE4 C;  2P10 A;  4RJT A;  5CCH D;  1JUN A;  3CXH I;  2Q9I A;  2BGV X;  1S9K D;  2OTJ P;  1FJK A;  1H33 B;  1K8A Q;  1ZW0 A;  2OYH C;  3OA7 A;  1RQU A;  2KB7 P;  3CC7 P;  3CYT I;  3A0B E;  5CBN A;  1FI7 A;  4BWN A;  5AW9 B;  3CCJ P;  4LLH A;  2QA4 P;  2WIT A;  1JM0 A;  1X79 B;  3U59 A;  1IK7 A;  3B5N D;  1Q7Y Q;  1NTK K;  4AAO A;  1CSW A;  5KAF V;  5KKZ C;  5KLV J;  1G2C B;  3RK2 B;  1NU1 J;  4GOE A;  3PXW A;  4NFG B;  1YEA A;  2CXB A;  2O01 J;  1SFC C;  2WQY C;  2QJK C;  2IBZ D;  2ZAE B;  2MJZ A;  2OYO A;  2Y0D A;  1IFN A;  3BCC E;  1AOF A;  1IO4 A;  155C A;  4D6T D;  1LP1 B;  1S2E A;  2KZI A;  3L70 E;  3G9R A;  1NTK E;  4M3L A;  3H32 B;  2R3C A;  2KSJ A;  1PGP A;  2QJP C;  1KYO I;  1YIQ A;  2N1T B;  1CCH A;  4U3F D;  3E7K A;  1DII C;  1NTM K;  4OVN F;  1WMK A;  1NTZ G;  3H1L G;  2D0S A;  1KX2 A;  5DJQ C;  2N3Y A;  1N86 A;  4DCK A;  2PCC B;  1MG2 D;  2N3B A;  4EOT A;  1SP4 A;  3MGN A;  1FZA A;  2I1K A;  4YPC A;  3L71 E;  2BCC D;  2CPB A;  3BRT B;  4Y99 B;  3D71 A;  1CIF A;  3SFE C;  1GL2 B;  2KYV A;  2E74 B;  1AQ5 A;  1SQQ G;  1L0N D;  1MG3 D;  3L4O A;  3WFB C;  2E76 D;  1PP9 G;  1JDL A;  3L75 E;  2R44 A;  351C A;  1NTM E;  3HD7 D;  1I5T A;  1SQV K;  2IYP A;  2POH A;  2AXT E;  3N4X A;  3KPE A;  3RK3 E;  2K9J A;  1FAV A;  3DMI A;  5CCG A;  4DOJ A;  2WVR A;  5B66 E;  1BGY J;  1I54 A;  4RO0 A;  1CED A;  2E43 A;  2P2U A;  2C9L Y;  1CI6 A;  2G3A A;  3SLE A;  5AUR A;  2V07 A;  3WUT A;  1CIH A;  1DEB A;  2WPV B;  5KLV D;  1SQX K;  5AVZ B;  2AXT H;  5KLI B;  1FE6 A;  1SQP G;  1SQV E;  3D6Y A;  3FGA D;  1PFI A;  1AQT A;  1CIG A;  1SQB G;  3L73 J;  5CCH C;  1M57 D;  3HUS C;  1GDV A;  2YCC A;  4UB8 H;  1EDJ A;  3CCU P;  3CX5 W;  3JC2 2;  3HQ6 A;  2E75 C;  4IL6 X;  1M1J B;  4H13 B;  1S5L H;  2JJL A;  1NKZ B;  2A45 H;  1BE3 D;  1CHJ A;  4LC1 A;  2ZJS E;  1U57 A;  5KAF E;  2V7Q J;  1YJN P;  5AVT B;  3HQ9 A;  1J3S A;  3CLQ A;  2ZZS 1;  4H0J A;  3CMA P;  5B5E E;  2J5U A;  2C1D A;  1KB0 A;  2BEZ F;  2FYU G;  4JBZ A;  1CSB A;  1YIT P;  3CL3 D;  3M9Q A;  1KIL A;  1PGQ A;  1LNQ A;  1JNM A;  1CYJ A;  2QE7 H;  3CXH D;  1LFM A;  1FOS E;  5AW3 B;  2H88 C;  2D2C D;  3A0H V;  1NYH A;  1JMM A;  3V5B A;  3AE3 C;  1BGY D;  1AFO A;  1GTW A;  5KJ7 D;  1NIR A;  5APY A;  2P7J A;  2IZ0 A;  3LIE A;  1KB9 H;  3L37 A;  4Y5R A;  5AVR B;  4Q5P A;  4L3H A;  2YO3 A;  3L74 E;  2ZON G;  1PGJ A;  1ZP0 C;  1FCD C;  3BVH A;  1I8P A;  2HOD B;  2FXM A;  3NBT A;  5EXQ A;  3ITK A;  2E5T A;  3D70 A;  2QJY C;  1BCC G;  2LR2 A;  2O01 H;  3ZOO A;  3M9B A;  2M8R A;  1Q81 Q;  3L73 D;  2C9X B;  3CC2 P;  3RN1 A;  2E76 C;  1YI2 P;  3RBZ A;  1MZ4 A;  4AX3 A;  1N7S D;  4KJM A;  4HYT B;  3MUD C;  2FYU J;  1M1K Q;  3HD7 C;  1PPJ E;  2I8F A;  3Q3D A;  3H1J G;  3WU2 V;  2J58 A;  1KYO D;  4L3G A;  3TDK A;  1GW3 A;  4WY4 A;  1YQ3 C;  1KZU B;  1T3U A;  1VPC A;  1U74 B;  3MK7 C;  1USD A;  2O1K A;  2HPC A;  1LT9 A;  3G3Z A;  1NTZ K;  2D0W A;  1LWU B;  3M9H A;  4IFF A;  1H31 A;  1LJ2 A;  1LTJ B;  1VQO P;  1L0L G;  3F89 A;  1ETP A;  1JEK A;  4OH8 B;  2C1D B;  2YXQ B;  3CXH H;  3V4Q A;  3S4R A;  2YO2 A;  4HKZ H;  3F5H A;  1SQQ K;  1C6R A;  2OYH B;  3KHU A;  1VQM P;  1M70 A;  2KUB A;  2NPS A;  1NWQ A;  1LC2 A;  1OW8 A;  3RL0 C;  4IFM A;  1EXJ A;  1NTZ E;  2FBW C;  1FDM A;  3A3Y B;  3RN0 A;  1S6V B;  5AW7 B;  4ZKP A;  2Y0E A;  1JY2 O;  1GU4 A;  1DIP A;  5H2F V;  5KKZ B;  5CJ4 A;  1SQQ E;  4WQD A;  2ORL A;  2QVA A;  4Y28 J;  1P84 E;  1RF0 C;  5M1B A;  1FBM A;  1I6E A;  1N15 A;  1SFC B;  2QJK B;  3OCD A;  2M5A A;  2BPB B;  1OXZ A;  3NFQ A;  3A0H E;  3KXD A;  2AIU A;  1SQP K;  1S72 P;  1ZV8 A;  4FA5 A;  2M3B A;  3B8E B;  3GF3 A;  4K3A A;  2B87 B;  3H1H E;  3WUV A;  2C9N Y;  4AAN A;  1SQB K;  2IBZ G;  3I56 P;  4PJ0 H;  4D6T G;  3CWB J;  2QJP B;  2K3R A;  1CRY A;  1NO4 A;  5CHX A;  1SVF A;  1SFC D;  1KYO H;  3B5N A;  2FKW B;  3IFM A;  1ZOY C;  1OCD A;  1JO5 A;  1W5C E;  3CCL P;  1QYZ A;  1IO3 A;  5KJ7 C;  2QM7 A;  4U3F G;  4XFJ A;  2IFN A;  1SQP E;  1HWT C;  3HE5 B;  1DD3 A;  2C1V A;  2FWL A;  3TGU D;  4ZMD A;  1SQB E;  2E5Y A;  3NTN A;  2HPC B;  1AKK A;  1VYD A;  4N6J A;  1IFP A;  2BCC G;  3VTP C;  1MUU A;  1M60 A;  3SFD C;  3OW2 O;  4EYY Q;  1C2N A;  2ZT9 D;  1G2C A;  1PZQ A;  3WU2 E;  1I8O A;  2LIR A;  1L0N G;  2XKM A;  2Y9Z A;  1N7S C;  2ZVO B;  4R4L A;  1B7V A;  2IZ1 A;  3CCV P;  4FA4 A;  3I5C A;  3FX0 A;  3CP5 A;  3ZIY A;  3HQ7 A;  2NPS B;  4N0K A;  1IZN B;  4OGQ D;  2NRG A;  5GTH H;  3PH2 B;  4FAN A;  1KQS O;  1D7M A;  1NTM J;  1WRG A;  2ZYG A;  5APV A;  4ASV A;  1JB0 J;  2W8Z A;  4XE5 B;  1A02 J;  4O1Q A;  4EID A;  2N1T A;  1QL4 A;  3PHL A;  4FAV A;  5KTB A;  1HZV A;  5KLV G;  4UB6 H;  1MV8 A;  2OYI C;  1PGO A;  2YQB A;  1EQ7 A;  1URQ D;  1H89 A;  3HUS B; 
#chains in the Genus database with same CATH homology
 1DW0 A;  1CIF A;  3ORV A;  3CX5 D;  1CXA A;  1L0N D;  1MG3 D;  3L4O A;  1IRW A;  3WFB C;  2KNC B;  2RN0 A;  2BH5 X;  1CHI A;  1JDL A;  1YTC A;  3CWB D;  4WQC A;  1CYC A;  351C A;  4UB8 V;  1I55 A;  5CIG B;  3VMA A;  3PRJ A;  1I5T A;  1E2R A;  1CRH A;  2C2C A;  1FJ0 A;  5GTI V;  3X39 A;  2Q3E A;  1YIC A;  2K9J B;  3ZOY A;  4EDF A;  1AOQ A;  2KS1 A;  2A06 D;  1L9B C;  1S5L V;  3RMZ A;  3NBS A;  1HH7 A;  1CO6 A;  1DW2 A;  3DMI A;  1YNR A;  3ZOW A;  5CIC B;  2B12 B;  451C A;  1I54 A;  5IY5 1;  1CRI A;  1CED A;  1BL9 A;  2QG4 A;  5CID B;  1WVE C;  4KMG A;  1NTZ D;  3H1L D;  2BLF B;  5DJQ B;  2N18 C;  3SLE A;  1CNO A;  2V07 A;  5AUR A;  1CTZ A;  2N9I A;  1CIH A;  4WQE A;  5KLV D;  5KLI B;  1A8C A;  1H1O A;  3A9F A;  5C9M A;  1GKS A;  2XTS B;  1E29 A;  3SXT A;  1CIG A;  4DY9 A;  1SQQ D;  2EXV A;  1NML A;  4WQ9 A;  5CIH B;  3DP5 A;  1PP9 D;  1GDV A;  1CC5 A;  2YCC A;  3CX5 W;  3HQ6 A;  1L9J C;  1CTY A;  4XYD B;  1CRJ A;  3JBT B;  2L4D A;  1NTM D;  2DVH A;  1DW3 A;  4YE1 A;  2VHD A;  1CXC A;  1BE3 D;  1CHJ A;  1C6O A;  3PTZ A;  1H9X A;  3VRD A;  2ZXY A;  3HQ9 A;  1J3S A;  2DGE A;  2ZZS 1;  4H0J A;  3ZCF A;  4O1W A;  2RMZ A;  5TJH A;  5B6Q A;  1LC1 A;  3O5C A;  2C1D A;  1KB0 A;  1SQP D;  4PWA A;  4RSZ A;  2N9J A;  4GYD A;  1CYJ A;  1SQB D;  4J20 A;  3CXH D;  2LIT A;  1LFM A;  1HJ5 A;  3PXT A;  5CYT R;  1RZ6 A;  1WEJ F;  3SJL A;  3A0H V;  4EIC A;  3GG2 A;  2N9Y B;  1CYI A;  4FA9 A;  2BCN B;  4PW9 B;  1BGY D;  3MK7 B;  5TIS V;  1C2R A;  3CU4 A;  2AI5 A;  5CIE B;  4QAO A;  1GJQ A;  1SQX D;  1NIR A;  3BCC D;  3VNW A;  4AAL A;  3O20 A;  1COT A;  3L70 D;  1RZ5 A;  4Y5R A;  4P4Q B;  4Q5P A;  4L3H A;  3A0B V;  1W2L A;  2ZON G;  1A56 A;  1NTK D;  1FCD C;  2FYN B;  2ZOO A;  1K3G A;  1I8P A;  2PAC A;  3TYI A;  1DVV A;  3OA8 A;  3NBT A;  1LS9 A;  5EXQ A;  1DT1 A;  1FI3 A;  2FYU D;  2YK3 A;  3WFC C;  3ITK A;  2BH4 X;  1EB7 A;  3ZOO A;  1EZV D;  3L73 D;  2C9X B;  1CTJ A;  3RN1 A;  4FB1 A;  3ZOX A;  1MZ4 A;  3PXS A;  4AAM A;  4AX3 A;  2HV4 A;  1H33 A;  2CA3 B;  3L71 D;  2I8F A;  1HCM A;  1F1F A;  1W5C T;  4JCG A;  4LJI A;  3CXH W;  3NWV A;  3WU2 V;  1HRO A;  1QN2 A;  3WC8 A;  2CE0 A;  1GU2 A;  1LMS A;  1M6Z A;  1KYO D;  4L3G A;  3TDK A;  5CIB B;  3L75 D;  4H0K A;  2CE1 A;  4WQ7 A;  5KAI V;  3SVW A;  1ZRT D;  1U74 B;  1NNO A;  3MK7 C;  2L91 A;  1K3H A;  1H31 B;  1U75 B;  1KV9 A;  2D0W A;  3C2C A;  1HJ4 A;  1H31 A;  2B4Z A;  3L72 D;  1C6S A;  2V08 A;  4K3I A;  3H1K D;  3L74 D;  1ETP A;  5B5E V;  1COR A;  1OAE A;  2QJY B;  4WQA A;  1CSU A;  4XXL A;  1BCC D;  1FHB A;  1R0Q A;  2C1D B;  3PLN A;  1CRG A;  5DF5 A;  1KIB A;  1F1C A;  1CSX A;  2C8S A;  3WUI A;  1AYG A;  1YFC A;  1H32 B;  1C6R A;  3KHU A;  3O0R C;  1M70 A;  4PD4 D;  1H32 A;  4PJ0 V;  1SQV D;  1LC2 A;  1KX7 A;  3H1J D;  2FRC A;  1IZL 0;  1CHH A;  1PPJ D;  3RN0 A;  1S6V B;  1N50 A;  1CIE A;  2Y0C A;  2MHM A;  2PCB B;  2Y0E A;  4V2K A;  3RLM A;  1IRV A;  5H2F V;  2B0Z B;  3WFD C;  1C52 A;  1H9Y A;  2GIW A;  1KYO W;  2AXT V;  5KKZ B;  4WQ8 A;  3VYM A;  5B66 V;  2GC7 D;  3WFE C;  3OCD B;  4WQD A;  2ORL A;  1HRC A;  1QL3 A;  5DFS A;  1I6E A;  1N15 A;  1L0L D;  2QJK B;  3OCD A;  1DIQ C;  2BPB B;  3HQ8 A;  3O1Y A;  1ZZH A;  2AIU A;  3OA8 B;  1CSV A;  4FA5 A;  4A7P A;  2CA4 B;  2JTI B;  4AAN A;  1FI9 A;  2OZ1 B;  3L4M A;  1CRC A;  4RJT A;  1HZU A;  2ZBO A;  3TF5 A;  2B10 B;  2OZ1 A;  2BGV X;  2QJP B;  1CRY A;  1H33 B;  1HJ3 A;  4EIF A;  3DR0 A;  5GTH V;  1OCD A;  5C0Z A;  1E8E A;  1QYZ A;  1IO3 A;  3CYT I;  2GB8 B;  3KZI V;  1KB9 D;  1FI7 A;  1DVH A;  1YEB A;  3ZBM A;  1NU1 D;  4EIE A;  2B11 B;  2C1V A;  2FWL A;  3TGU D;  4FA1 A;  4AAO A;  4UB6 V;  2MTA C;  4WQB A;  1AKK A;  1CSW A;  1VYD A;  1I6D A;  1GQ1 A;  5KAF V;  2C1U A;  1M60 A;  2JWA A;  1C2N A;  1P84 D;  5E79 V;  1FOC A;  3PXW A;  4NFG B;  1YEA A;  1C75 A;  5CIF B;  4GED B;  1I8O A;  2LIR A;  1NMI A;  2CXB A;  3H1I D;  4MU8 A;  1B7V A;  3M97 X;  1IQC A;  3GW6 A;  2IBZ D;  3H1H D;  4FA4 A;  2Y0D A;  3CP5 A;  2GC4 D;  2JQR A;  1AOF A;  1N90 A;  155C A;  4D6T D;  3ZIY A;  3HQ7 A;  4N0K A;  1DW1 A;  3PH2 B;  4FAN A;  1QKS A;  1YCC A;  3FWL A;  1RAP A;  1C7M A;  2N18 B;  2YIU B;  3SWS A;  4IL6 V;  1YIQ A;  4L1Q A;  1CCH A;  4U3F D;  1DII C;  4O1Q A;  4EID A;  1GIW A;  1KX2 A;  1QL4 A;  2D0S A;  3PHL A;  1A2S A;  4FAV A;  1RAQ A;  1CCR A;  5DJQ C;  1N9C A;  2N3Y A;  1HZV A;  2PCC B;  1MG2 D;  2N3B A;  2O3J A;  2YQB A;  2BCC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...