4D6TD

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
240
structure length
240
Chain Sequence
DLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
total genus 67
structure length 240
sequence length 240
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4d6tD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4d6tD02
1FI7A 2C8SA 5CIBB 3OA8B 2DVHA 1HROA 1LC2A 4EIDA 5CIGB 1B7VA 2D0WA 3CXHD 1C52A 1AYGA 1SQXD 2LIRA 2C1DB 4GEDB 1BCCD 4L1QA 3KHUA 1FJ0A 3PH2B 3RLMA 4FA9A 2EXVA 2N3YA 1S5LV 1RAPA 5TISV 2C2CA 1L0ND 1H33B 1KIBA 1OAEA 1S6VB 1CNOA 3L75D 155CA 1K3HA 2ZOOA 4K3IA 1SQVD 2D0SA 3NBTA 3PXWA 1CRJA 2CA3B 1AOQA 1DVHA 2VHDA 1WVEC 2ZZS1 1IRWA 1NTZD 3H1KD 3H1JD 1FHBA 4QAOA 1I8PA 4WQAA 5KAIV 2B10B 5EXQA 1C6OA 2B4ZA 3ZOWA 1HCMA 1A2SA 1L9JC 3H1LD 5GTHV 4A7PA 3WFBC 2BH5X 4WQCA 1YNRA 1IO3A 1RAQA 3L4MA 1NMIA 1GJQA 1E8EA 1NU1D 1N9CA 2QJKB 4NFGB 3H1ID 2BH4X 1H32A 1YEAA 2JQRA 1U74B 3L74D 1CSUA 1FCDC 1CTYA 1CRYA 1CRCA 2BCCD 3RN1A 4FA5A 5B6QA 3TGUD 3SVWA 1E2RA 4RJTA 4O1WA 1H31A 2PCBB 3L70D 4GYDA 3CP5A 2OZ1B 2CXBA 351CA 3TF5A 4WQDA 1DT1A 1CHHA 1L9BC 3ZOOA 1CRIA 1R0QA 5KAFV 1FOCA 1HJ3A 3HQ7A 3OA8A 3L73D 3O5CA 1W2LA 2B11B 4L3HA 1C6SA 4N0KA 1HRCA 3ZIYA 4J20A 1CHJA 1CIEA 5C9MA 4Q5PA 3TYIA 1CCRA 1SQBD 4FA1A 1U75B 1QN2A 3VMAA 1CXAA 1CHIA 1CORA 1CTZA 3CYTI 2C1DA 4AAMA 4P4QB 3L71D 4EIFA 1MZ4A 3A0HV 3CU4A 1DW2A 1YTCA 3L72D 3CWBD 1CO6A 1SQPD 1WEJF 2PACA 3DP5A 1NTMD 3VRDA 5CIHB 2ZBOA 5B5EV 1C6RA 1GQ1A 2V07A 1FI9A 3WFCC 1CSWA 4WQ9A 1H9XA 3ORVA 2XTSB 4KMGA 1CRHA 4AAOA 1IQCA 1LS9A 1DW3A 1E29A 1CSVA 1CIFA 1ETPA 4FB1A 4L3GA 2BPBB 5B66V 3SLEA 1HZVA 5CIDB 1CYCA 2QJYB 3MK7B 5DJQC 2OZ1A 1H1OA 1RZ6A 3BCCD 3PXSA 4EICA 1FI3A 3C2CA 3OCDB 1EB7A 3GW6A 2ZXYA 1QKSA 5GTIV 2RMZA 2N9YB 1CC5A 2FYUD 1RZ5A 1H9YA 2GC4D 3O20A 5CYTR 4IL6V 3JBTB 2MHMA 4UB6V 1ZZHA 1NNOA 4FANA 2B12B 1I5TA 2BCNB 5DFSA 1M70A 1C2NA 1IRVA 1A8CA 4EIEA 2Y0DA 1N50A 1CSXA 2N9IA 1NIRA 4O1QA 3RMZA 4LJIA 1F1CA 5KLVD 2YIUB 2QG4A 5AURA 2C9XB 1P84D 2C1UA 2I8FA 1M6ZA 2O3JA 3O1YA 2QJPB 1GIWA 1H33A 4RSZA 2RN0A 1IZL0 5CIEB 3VYMA 3PHLA 5C0ZA 1KX2A 2N9JA 3HQ9A 2MTAC 1LMSA 3KZIV 1CTJA 3PTZA 5DF5A 4XXLA 4U3FD 4WQBA 1CIHA 1J3SA 3WU2V 5CICB 1C7MA 2CE0A 5E79V 1DW0A 2IBZD 1CRGA 2YQBA 4DY9A 3PRJA 1HH7A 2FWLA 1KX7A 451CA 2GB8B 1LFMA 4AX3A 1KYOD 2JWAA 2AIUA 3X39A 1DVVA 1L0LD 4JCGA 1CEDA 2V08A 4UB8V 2KS1A 1KYOW 1KB0A 4AALA 1CCHA 3NWVA 1OCDA 5H2FV 2Y0EA 1C75A 2CA4B 1CYIA 4FA4A 3ITKA 2Q3EA 3FWLA 1C2RA 3ZOXA 1KB9D 4XYDB 3DR0A 4WQ7A 2A06D 1HJ5A 3CX5D 2N18C 2K9JB 3RN0A 4H0JA 1AOFA 4FAVA 5KLIB 4MU8A 1ZRTD 2HV4A 4PWAA 3NBSA 1VYDA 1HZUA 4PW9B 1H31B 3SJLA 1QL3A 2KNCB 2BGVX 1QL4A 1N15A 1GDVA 1CXCA 1N90A 1AKKA 1DIQC 3HQ6A 2GC7D 3HQ8A 4PJ0V 1NMLA 3SXTA 4WQEA 1M60A 1YIQA 1H32B 3H1HD 2FRCA 1W5CT 3WC8A 2DGEA 1I6EA 2PCCB 2CE1A 3A0BV 1COTA 1YICA 1BE3D 3SWSA 2YK3A 3WUIA 1GKSA 2B0ZB 2Y0CA 1EZVD 1NTKD 1HJ4A 3WFDC 4WQ8A 1DIIC 5IY51 1DW1A 3PLNA 3A9FA 3M97X 3TDKA 1I54A 1BGYD 1PP9D 3PXTA 4EDFA 1I55A 2FYNB 3GG2A 1A56A 2N3BA 3ZOYA 3VNWA 2ZONG 2JTIB 4AANA 5KKZB 2N18B 2AXTV 1MG3D 3CX5W 1CIGA 1YEBA 2LITA 3OCDA 1YCCA 2BLFB 5CIFB 4PD4D 1SQQD 1I8OA 1JDLA 1PPJD 3L4OA 2AI5A 2L4DA 1LC1A 4H0KA 1QYZA 2GIWA 1CYJA 3ZCFA 2YCCA 1I6DA 3ZBMA 1KV9A 4Y5RA 3MK7C 5DJQB 1GU2A 5TJHA 2ORLA 3O0RC 1BL9A 1MG2D 4D6TD 4YE1A 3DMIA 1YFCA 1K3GA 2C1VA 4V2KA 3CXHW 1F1FA 3WFEC 2L91A
chains in the Genus database with same CATH superfamily
1FI7A 3D71A 1J1DC 1U7MA 3S1KA 5CIGB 3KDPB 3A3YB 5B5EE 3MTUE 4DCKA 3CXHD 5AVVB 1NGMB 4KT0J 3CCQP 1SQQK 4YPCA 1VQNP 4DJGA 4FA9A 3VMXA 1SFCD 2E76D 1KILC 2KSEA 2C9LY 2Z5IA 1AV1A 2GM4A 2N9BA 1S72P 2RKLA 1QGKB 3FXDA 4EOTA 3L75D 4L74A 2ZYGA 1K3HA 3F89A 3CX5E 1X79B 1NTZD 3H1KD 1SQPJ 1FHBA 4PV1C 2B10B 1C6OA 4YTPC 1H0TA 4AQRD 1Q7YQ 1LT9A 1BCCG 1SQXG 2M0BA 4A7PA 1TU3F 1FZGA 1JY3O 1IO3A 1RAQA 1NMIA 1T3JA 1N9CA 4NFGB 2W6BA 2BH4X 3A0BE 4U7JA 1YEAA 1U74B 4HKZH 2HYNA 2R3CA 1FCDC 1KTMA 1CTYA 1RHZB 1AVYA 4EI2A 3L37A 3H1LE 5AW3B 3TGUD 2WPRA 1LJ2A 1E2RA 3MGNA 1LTJB 2KYVA 1H31A 2PCBB 2WPSA 1P84E 1NTKG 3L70D 3CP5A 3AE8C 1AQ5A 4H13C 3MUDA 4WQDA 1NO4A 2PGDA 1BE3E 1L9BC 1MKMA 3OJAB 1FOCA 2ZFCA 1Q82Q 1DX7A 1NH4A 1AFOA 1FZBA 3ABVC 3T97B 1YHQP 3OA8A 2Q9IA 3G71P 5C39A 4BWNA 2W6AA 1HRCA 1EZVI 1NTME 5C9MA 2HPCA 1WT6A 3L71G 1RQVA 4ZMDA 3GLMA 1BGYJ 3H6PA 2OYHA 2M3EA 3L71J 2K88A 1YJWP 2HR3A 2E74C 2XNDH 1CXAA 2RH0A 2ZYDA 3M06A 5B66H 3CU4A 3CMAP 3HTKA 1SQPD 3H1KJ 2C9NY 3VMYA 1NTMG 1SQVJ 1A02F 1GQ1A 1CSWA 1H9XA 1GTWA 2ZJSE 1T8ZA 4HB1A 1LT9C 2ZT9C 1QLED 3A7OA 1T2KD 1LS9A 1KILA 2G3AA 3L72E 1CSVA 1CIFA 2Z4EA 1RE4C 5B66V 1GU4A 3E1IA 2I1JA 2WSCJ 2WMMA 2OZ1A 1JY2N 3AEGC 3BCCD 4EICA 3WUVA 1AA0A 1PGJA 1Q90D 1FI3A 3ZDMA 2OYIA 1IFDA 3OCDB 3V2RA 2LR2A 3H1IG 4BRYB 1QKSA 1JO5A 1J1EC 2R5DA 1HJ0A 2YNYA 2WSFH 5CYTR 2I8DA 2E75D 3JBTB 5DFSA 1YQ4C 3W68A 1CSXA 1N7SA 1KMIZ 1F1CA 3CI9A 1VL2A 1VF5B 1YBKA 2QG4A 3CCSP 4XFJA 2I8FA 4GKGA 1DD3A 3U59A 4Y99B 4QMAA 5KKZC 1EDKA 2WSSH 5CCGC 3BVHA 4RSZA 1IZL0 1S9KE 1VQ9P 1OW6A 1DEBA 1WRGA 3RK3E 3L75J 1FBMA 1LMSA 1URQB 1QX8A 1USEA 3SFDC 2V4HA 3RL0B 3SFEC 3AE2C 3WU2V 3R4YA 3CXHI 2R5BA 1FOSE 1BE3J 3E7KA 4GOFA 3A0HE 1SQPE 1K73Q 1K9MQ 5APWA 1ZOYC 3HTKB 2WSEH 3SWKA 4AYCA 1RF1B 1VQ4P 2AIUA 2FYUK 3RBXA 1JNMA 2WPQA 2XV5A 2V08A 4XE5B 1YQ3C 5AVWB 3O6QA 3LW5J 2QJPC 2JKVA 1YTZI 1C75A 1CYIA 1KQSO 1C2RA 1NAYA 2P58A 2E75C 2YXQB 1PIXA 1HJ5A 3CX5D 1KZUB 3RK2D 3RN0A 2Y9ZA 1LTGC 4KHXA 3P32A 1GW4A 5AVSB 4KJMA 4PWAA 5KAFE 2AEMA 2K3RA 3CWBE 1H31B 1IZNB 1G1IA 2KB7P 2IYPA 3VOPA 1M1JB 1FOSF 1L0NE 1GK4A 4IFMA 4UB8H 5M1BA 3EFGA 4CPGA 3WUTA 3HQ8A 1LP1A 3LIDA 3SXTA 2JEEA 3G3ZA 2FRCA 3Q3DA 2C0WA 5AW4B 2DGEA 5AW2B 4W7YA 5KJ7D 2J5UA 2V7QJ 1SFCB 2E76B 5KTBA 1NTZK 2B0ZB 2Q6QA 2Y0CA 1HGVA 2QA4P 1SFCC 2E76C 1HJ4A 3L71E 1FZCC 3PH0A 3A9FA 1JTHA 2QRXA 4N3YB 1BGYD 4EDFA 2FYNB 1A56A 2N3BA 2JTIB 1SQBK 4AANA 3CX5W 1CIGA 1SQPG 3Q5PA 2ZVNB 1LTJC 2WT7B 5CIFB 4PD4D 1I8OA 1P84H 4I2LC 2B87A 3RK2C 1M1JC 3M0DC 1RE4A 1S5LE 4NPDA 5BVZA 1I6DA 2FYZA 2GA1A 1KV9A 3UIAA 2ZYAA 3MK7C 2IFNA 2IZ1A 2JR8A 5BU5A 1GL2B 1YFCA 2C1VA 3P8CE 1NU1G 1MFTA 3L74E 1C52A 3II6A 1AYGA 5CHXA 2LIRA 5AW5B 3KHUA 2JWDA 3I5CA 2PAJA 3SWYA 4I7ZB 2EXVA 2P67A 5B66E 1S5LV 1RAPA 5TISV 1LTAC 1OIPA 3H32A 3TGUG 3P7KA 1L0ND 3USSA 1L0LK 1KIBA 1S2EA 2CPSA 1OAEA 2A06E 1LNQA 1FS0E 155CA 4YXWH 1GD2E 1IFPA 1FE6A 3PXWA 1GW3A 5CBOA 1CW5A 2CA3B 2VHDA 3CWBJ 4QAOA 4WQAA 2N1TA 5EXQA 3EFFK 1FZEA 3AE5C 4H0LC 1DD4A 3H1LD 1FC2C 3NMDA 3WFBC 2WT7A 3V4QA 1E5WA 4WQCA 1GU5A 3TNUB 1HWTC 2QM8A 5H2FE 2QJKB 4H13B 4JBZA 3H1ID 3A2AA 3PJSK 1D7MA 2WSCH 4OVNF 4AUWA 1CRYA 2W27A 2BCCD 4FA5A 1VF5C 1KQFB 1YJNP 3SVWA 2POHA 4O1WA 1W2EA 1GZLA 2K37A 3M9QA 4WY4B 4GYDA 5KAIH 4MN4C 4L75A 351CA 2QJKC 2YO3A 3VN0A 3TF5A 1OX3A 2NRGA 1YJ9P 1M7LA 3HD7B 1CHHA 3ZOOA 1K04A 5AW8B 2WSFJ 1RY3A 3V5BA 1CRIA 4BRYA 1HJ3A 3HQ7A 3CPWO 3L73D 1ZP0C 1USDA 3WUUA 2B11B 1WMKA 2E5TA 4PV1B 4J20A 1VDFA 1DEEG 3B5NC 3CCRP 1YI2P 1CCRA 2FY8A 4FA1A 1YTZT 3H25A 3CCLP 1CTZA 4N6JA 1ZMEC 2C1DA 1SQQG 1NTKJ 3L71D 1HUCA 3A0HV 3KZIH 4UB8E 1YTCA 3L72D 2DW3A 1W5CE 3H1JJ 4OH8B 1WEJF 2PACA 1JCCA 4PD4I 1HF9A 1KYOE 1FDIA 5B5EV 3WFCC 3MP7B 5APUA 3ORVA 1CSBA 1CRHA 1IFMA 2E74B 1AJYA 1E29A 4L3GA 2BPBB 2O01H 2HFED 2N1TB 5GTIE 2PFXA 4H44B 1CYCA 1JY3N 2ZAEB 4W80A 3MK7B 1RZ6A 3PXSA 2PRRA 3TGUJ 3BCCJ 1SP4A 5CCGD 2H8PD 1EB7A 3HE4A 5GTIV 4D6TJ 4IL6E 3H32B 1G2CA 1KQGB 2GC4D 2K9YA 3M9BA 2FXMA 4JPZB 4IL6V 2MHMA 1PZQA 1NNOA 4FANA 2B12B 1MZ9A 4EIEA 2Q7CA 1N7SD 2N9IA 4O1QA 1EDLA 3H1KE 4RKUJ 4M3LA 1JY2O 1M57D 1IFIA 1PGOA 5AURA 1M1KQ 1HJBA 3M91A 1LWUB 1H88A 1GIWA 1NJIQ 1H33A 2RN0A 4PV1D 1KX2A 1KYOH 2MTAC 1NU1K 3Q2YA 3A5TA 4XXLA 3GHGA 1J2JB 4H0LB 1ZR4A 4RO0A 2D2CB 2CE0A 2FYUG 5APXA 1DW0A 2QE7H 4WY4D 4DY9A 3CXHH 2OTJP 5AVXB 4H0LD 3Q5RA 1KX7A 451CA 2HODA 4D6TG 4AX3A 1KYOD 2JWAA 1FAVA 1KILB 5KLIC 1CEDA 1AVOA 2KS1A 3H1LG 1LTSC 1KYOW 1CCHA 5APQA 4IOIH 2CA4B 1A02J 5KJ7A 2YIUC 1OVVA 1NWQA 1NU1E 2K9JA 1KB9D 3DR0A 2KZJA 2ZVOB 4WQ7A 1SQQJ 2K9JB 5AVUB 3P8MC 1ZRTD 1NHLA 1BCCE 2V7QH 3B8EB 2NPSD 2YKQA 1S3JA 3M9HA 1DIQC 4H44C 1JTHB 3CC7P 3E1RA 3HUSC 3BCCE 3HUSA 3SSUA 1W2BO 1H32B 3H1HD 2B89A 3RL0C 2FYNC 3G4SP 1OXZA 3SWFA 2J59M 2FKWB 3L72G 2CE1A 3A0BV 1PGQA 1COTA 1YICA 1RQUA 1K8AQ 2YK3A 3WUIA 1GKSA 1BSHA 1LP1B 1L4AC 4NPEA 4R4LA 1DW1A 3PLNA 3IAOA 1PV3A 3VTPC 2H7HA 3PXTA 1Q2NA 4K3AA 3L73E 1NTZJ 3ZOYA 3KZIE 2ZONG 2FFDA 2WZ7A 5TISE 1MG3D 2B9BA 2M5AA 1BGYG 1L0NK 2KSJA 2BLFB 1J1EB 1KFNA 2KP8A 3MHVA 1PP9E 3R2PA 1OW8A 1QEXA 2YCCA 3C9IA 3S9OA 1SFCA 2KNCA 2HODB 5APVA 4GDOA 3O0RC 2W90A 2B88A 2J58A 3L36A 2BCCG 3CXHW 1F1FA 1T6AA 3BASA 2C8SA 1IFNA 5CIBB 2DVHA 3GF3A 2P7JA 1B7VA 2WPVB 2D0WA 1QL2A 2O1JA 4HH2A 1SQXD 4GEDB 3RK3C 1BCCD 4L1QA 2G8YA 3RLMA 4JYBA 2N3YA 1G1JA 2C2CA 1ZXGA 4O9BA 1H33B 3IF4A 1KYOI 3LIEA 3L75G 4OGQD 1QVGO 1CNOA 1JMBA 3F5HA 2R44A 4K3IA 1AQTA 3U1AA 3NBTA 3IR9A 3AEBC 4WBAA 1WVEC 2ZZS1 1EXJA 1M56D 3CCEP 2XNXA 3ZOWA 3CC2P 1L9JC 1N73C 1LTTC 3WMM0 3OA7A 2BH5X 1YNRA 3GMAA 1E8EA 1SQVG 1NU1D 3L74J 1T3UA 4GT1A 3JCUE 2IPPA 3H1IJ 2JQRA 4I6MC 3CXHE 1CSUA 1S1CX 1VQPP 1CRCA 3RN1A 2AEFA 2PP6A 1OWAA 2OTLP 3CLQA 2ZT9D 2M8RA 4WY4A 3HE5A 3WU2H 1X0TA 3D0WA 2IBZE 3V4WA 2NPSC 1GL2C 1GL2D 5E79E 5CCHC 2OZ1B 2NPSA 3AE4C 2ZT9B 3L75E 2CXBA 1SQQE 1FDOA 1KILE 1DT1A 5GTHE 3EQ2A 2KLVA 2YKOA 5AW9B 3T97A 2CPBA 3U1CA 5KAFV 2WWWA 5KAIE 3H1HG 3H1HE 3O5CA 4LGDE 1DIPA 4L3HA 4OGQB 1GL2A 1CI6A 1CIEA 2A45H 2D2CC 1EZVG 1BCCJ 2H43A 1PP9J 4C7NA 1VF5D 1U75B 3CX5H 3VMAA 1HVVA 1CORA 3AE7C 3CYTI 4P4QB 3AECC 3D70A 1NTMJ 1CO6A 3DP5A 1RF0C 2WTYA 4IL6X 1C6RA 1S5LX 4WQ9A 1IK9A 3A0BH 3CC4P 4UB6E 2E43A 4KMGA 1J1DB 4TLFA 1DW3A 3OW2O 1ETPA 4FB1A 2I1KA 3RK3B 2IDBA 2AEJA 2WSEJ 3RBZA 5CJ4A 3HUSB 2QSIA 5E79H 1EXIA 5CIDB 1EDIA 1NTZE 1Y47A 3CMEP 5DJQC 3H1KG 3VP9A 1VQ5P 1OMIA 1NOHA 2HG5D 3C2CA 3L74G 2M5AB 2FFDB 1LT1A 3GW6A 4ZKUA 1ZR2A 1HH0A 2N9YB 2KZIA 1MFZA 2FYUD 2AXTE 1RF0A 1H9YA 3O20A 1E79H 1H8AA 2N1TC 4I1LA 4UB6V 4Z1MH 1NTKE 1I5TA 1R5LA 1M70A 2IBZI 1C2NA 1N50A 2XZRA 2KI7B 4HJGH 1NIRA 4LJIA 5KLVD 3H1JG 1IFJA 2YIUB 3Q5SA 1YITP 3MZWB 1OVUA 4GIFA 1P84D 2C1UA 3H1IE 1NAFA 2HLOA 1ZW0A 1H0TB 3VYMA 3PHLA 2BASA 1LT9B 5C0ZA 1N7LA 2BCCE 3HQ9A 4L76A 1PGPA 3KZIV 3A0HH 1RH5B 2M3BA 4IFDK 2YMYA 4U3FD 1Y9BA 3MUDC 1CIHA 1J3SA 1EDJA 5CICB 3IN6A 1IJDB 3L4FA 1L0LG 2E74D 1LTIC 1JMMA 5E79V 1SQVK 5KLVK 4PD4E 4TT3H 2YQBA 4DZOA 1N8RQ 3PRJA 2ITAA 1U57A 1Z56A 1HH7A 1RF1A 2FWLA 1SLQA 3RL0D 3HRNA 2IX7C 1M90Q 4ZNCA 1FJPA 1LFMA 1QVFO 2E42A 1L0NG 2IFMA 1URQD 1N2DC 1SVFA 2R32A 1L0LD 1M1JA 4JCGA 3M0DA 4UB8V 4AALA 1KB0A 3G6EP 4W7ZA 3NWVA 1OCDA 1LWUC 2KLUA 5H2FV 1L0LJ 2Y0EA 4WY4C 4N78D 1LWUA 1FZAA 4FA4A 2KS1B 2Q3EA 1GK6A 3TYYA 1NTZG 1SQBJ 1PPJG 3ZOXA 2JJLA 2NZ2A 1S9KD 2QJYC 4XYDB 2N1TD 1MUUA 1NVOA 3QH9A 2FYUJ 2YMKA 3AE3C 3KYQA 2L5GB 1XTCC 2OARA 1KN7A 4FAVA 3NFQA 3BCCG 2HV4A 3NBSA 3VYIA 2KIKA 3SJLA 1QL3A 2D2CD 1KFMA 2BGVX 3M0AA 2OGUA 3HQ6A 2GC7D 1R5SA 1Q86Q 1BDCA 5KAFH 4PJ0V 2YO2A 1YIQA 2SPZA 3V2NA 3CWBG 1W5CT 5APSA 2A45I 2BEQD 1KB9I 2Z5HA 3AEAC 1L0NJ 4Y28J 3AE6C 4JQ0D 1SS1A 1X8YA 3CX5I 1RE3A 3O8ZA 1BE3D 1BDDA 3SWSA 2W83C 3B4SA 2R3SA 3AEDC 1IO4A 1URQA 3GHGC 4WQ8A 4XA4A 5IY51 5CMZA 5K5GB 1JCDA 3TDKA 3V2QA 1I54A 1PP9D 1LTBC 1ZN5A 2GUSA 3BATA 4I7ZC 3VNWA 1KQLA 1R8EA 4ZKPA 1EQ7A 3HE4B 1NKZB 3HE5B 1YEBA 3QWOC 2LITA 1YCCA 3FXEA 1JDLA 3CCJP 3C1LA 1PPJD 3TK1A 3L4OA 5TISH 2AI5A 1LC1A 1QYZA 2GIWA 1CYJA 2Q5UA 3TSIA 4H44D 3ZCFA 3V6IA 1P84I 4NPFX 4H13D 4DOJA 3HD7C 5CJ0A 3L35A 3ZBMA 2OYIB 4Y5RA 1GU2A 1RF1C 2ORLA 1BL9A 1CZQA 5B5EH 2FFDC 4YE1A 1JEKA 2XDJA 4V2KA 2L91A 3W67A 1U7JA 4GOEA 3OA8B 1HROA 1LC2A 4EIDA 4ASWA 2K1AA 1HBWA 3IFMA 1L4AA 1FZCB 1NU1J 4PJ0E 2C1DB 1L4AB 2JO1A 1FJ0A 3PH2B 4JF7A 3CL3D 4U3FE 5AW0B 3H1LJ 3L73J 5CCGA 2Q3IA 1LTJA 3H1HJ 2JP3A 1MV8A 3JSVC 1S6VB 5AVRB 2OYOA 2A06G 2ZOOA 4Y99C 4IFFA 2KOGA 2IZ0A 1SQVD 2D0SA 1CRJA 1AOQA 1DVHA 2O01N 4UB6H 1IRWA 4HYTB 1KB9E 3H1JD 3LW5H 1I8PA 2Q1KA 5KAIV 2B4ZA 1SQXJ 1HCMA 1A2SA 5KLVJ 3RGUA 5CCHD 5GTHV 3D6ZA 2W6JH 1YYCA 2OYIC 3L4MA 1GJQA 2KK7A 1S5LH 1H32A 1OFCX 1YIJP 3L74D 2IBZG 2WQYC 5L8RJ 3RK3D 2ZXXA 5B6QA 1OW7A 3NXSA 1IC2A 1XTGB 4RJTA 1GMJA 1OVRA 3B5NA 1JY3P 5H2FH 1JM0A 1PPJE 4PJ0H 1N7SC 3JC22 3WU2E 5AVZB 4B86A 2LKMA 4IL6H 2XU6A 1R0QA 3FWNA 1NTKK 1T2KC 3RK2B 4WB4A 1L0LE 4YXDC 4JYCA 1JUNA 1W2LA 2YXRB 1C6SA 4N0KA 2IYOA 3ZIYA 1VQ8P 1KORA 1CHJA 2QEXP 5APTA 2OYHC 1KB9H 4N78E 4Q5PA 1JY2P 3KXDA 3TYIA 1SQBD 2YKPA 2HPCB 2XKMA 3N7NA 2FXPA 5BU8B 3CCUP 1BE3G 1QN2A 1VQLP 1CHIA 4AAMA 4PD4H 4EIFA 1MZ4A 1K05A 1DW2A 3KPEA 2P1JA 3CWBD 4WVZA 2MJZA 2FBWC 4K35A 1FZFA 1NTMD 1VQ7P 5GTIH 5AVQB 3VRDA 5CIHB 2ZBOA 2V07A 1FI9A 3MD0A 3S4RA 3AEFC 2C0XA 3FX0A 5CCHA 1QL1A 2VRSA 1Y8AA 1SQVE 2XTSB 4AAOA 1IQCA 1ZV8A 2LXBA 3H1JE 3KQGA 3AEEC 2W8ZA 4DT0A 3SLEA 1HZVA 1DH3A 1ZLLA 2GUVA 2B87B 4C7NB 1KV4A 2QJYB 4OGQC 3GF7A 1H1OA 1VQ6P 1CI6B 3OAKA 3I55P 5CBNA 2E5YA 3Q1MA 2ZXYA 2RMZA 1CC5A 2H88C 3JCUH 1RZ5A 3L70G 5APYA 1NYHA 1FDMA 1ZZHA 3CCMP 2BCNB 3D6YA 2NPSB 3PP5A 1PFIA 1IRVA 1A8CA 2E75B 2Y0DA 3RMZA 2P10A 2FXOA 2OQQA 4D6TE 3AE1C 3FGAD 2O1KA 2C9XB 3GHGB 4ASVA 1M6ZA 2O3JA 3O1YA 2QJPB 2P2UA 5CIEB 2WITA 2N9JA 5GTHH 1FJKA 1HGZA 2AXCA 1CTJA 4EIJA 4U3FJ 1L2PA 3PTZA 1EZVE 1N73B 5DF5A 1FU1A 2CK3H 3B71A 4OWFA 4WQBA 1IK7A 1SQBE 3EWKA 5AVYB 3B5NB 5DJUB 5AW6B 1C7MA 2QIWA 2WVRA 3L70E 2ZXEB 1RE3C 4BXLA 1KILD 2Y9YA 3B5ND 2IBZD 1CRGA 2QM7A 1NTMK 3P8CD 5EFWB 4RESB 3VP8A 5AW1B 2GB8B 1Q81Q 1FZCA 1M8OB 1G2CB 5KLVG 3HD7D 1URQC 4C46A 3X39A 1DVVA 1OZHA 3G9RA 1VPCA 3ITKA 3O6QB 1JB0J 3N4XA 3FWLA 1EC5A 2BCCJ 3C8VA 2A06D 1N7SB 4R4MA 1SQXE 2N18C 4H0JA 1AOFA 2LXCB 3TGUE 5KLIB 4MU8A 4C7RA 1VYDA 2BEZF 1BSNA 1HZUA 4LC1A 4PW9B 1UIXA 2KNCB 1X22A 2A45G 1QL4A 1N15A 2AXTH 1GDVA 1NKNA 3K5BA 1CXCA 1X9VA 1N90A 1AKKA 3VMZA 1H89A 1L4AD 1NMLA 2KXPB 4WQEA 1M60A 3BRTB 4L73A 5AVTB 3RL0g 2JDIH 4EYYQ 4GODA 3WC8A 3TNUA 1I6EA 4LLHA 2PCCB 3NTNA 1HTLC 1VQKP 1S4XA 1N73A 2H89C 3L72J 1SQXK 1KC8Q 3I56P 1SQPK 1EZVD 1NTKD 1JOCA 3CCVP 3WFDC 3HD7A 1DIIC 1SQBG 2O01J 3M97X 1VQMP 3BRVB 2KUBA 2FYUE 2OTKE 2QVAA 2UWJE 1I55A 3GG2A 1ZRTE 5KKZB 3CD6P 2N18B 2AXTV 3AE9C 1UIIA 3OCDA 2OYHB 1PP9G 4WWIA 5KLVE 5KJ7C 1PL5A 1SQQD 2L4DA 4H0KA 1BGYE 1N86A 5AW7B 1LGHB 3MIWA 4U3FG 1VQOP 3V2PA 1GDTA 1KD1Q 2MKVA 3L70J 5DJQB 5TJHA 3L73G 1MG2D 4D6TD 3DMIA 1K3GA 3WFEC 5DJTB
chains in the Genus database with same CATH topology
1FI7A 2C8SA 5CIBB 3OA8B 2DVHA 1HROA 1LC2A 4EIDA 5CIGB 1B7VA 2D0WA 3CXHD 1C52A 1AYGA 1SQXD 2LIRA 2C1DB 4GEDB 1BCCD 4L1QA 3KHUA 1FJ0A 3PH2B 3RLMA 4FA9A 2EXVA 2N3YA 1S5LV 1RAPA 5TISV 2C2CA 1L0ND 1H33B 1KIBA 1OAEA 1S6VB 1CNOA 3L75D 155CA 1K3HA 2ZOOA 4K3IA 1SQVD 2D0SA 3NBTA 3PXWA 1CRJA 2CA3B 1AOQA 1DVHA 2VHDA 1WVEC 2ZZS1 1IRWA 1NTZD 3H1KD 3H1JD 1FHBA 4QAOA 1I8PA 4WQAA 5KAIV 2B10B 5EXQA 1C6OA 2B4ZA 3ZOWA 1HCMA 1A2SA 1L9JC 3H1LD 5GTHV 4A7PA 3WFBC 2BH5X 4WQCA 1YNRA 1IO3A 1RAQA 3L4MA 1NMIA 1GJQA 1E8EA 1NU1D 1N9CA 2QJKB 4NFGB 3H1ID 2BH4X 1H32A 1YEAA 2JQRA 1U74B 3L74D 1CSUA 1FCDC 1CTYA 1CRYA 1CRCA 2BCCD 3RN1A 4FA5A 5B6QA 3TGUD 3SVWA 1E2RA 4RJTA 4O1WA 1H31A 2PCBB 3L70D 4GYDA 3CP5A 2OZ1B 2CXBA 351CA 3TF5A 4WQDA 1DT1A 1CHHA 1L9BC 3ZOOA 1CRIA 1R0QA 5KAFV 1FOCA 1HJ3A 3HQ7A 3OA8A 3L73D 3O5CA 1W2LA 2B11B 4L3HA 1C6SA 4N0KA 1HRCA 3ZIYA 4J20A 1CHJA 1CIEA 5C9MA 4Q5PA 3TYIA 1CCRA 1SQBD 4FA1A 1U75B 1QN2A 3VMAA 1CXAA 1CHIA 1CORA 1CTZA 3CYTI 2C1DA 4AAMA 4P4QB 3L71D 4EIFA 1MZ4A 3A0HV 3CU4A 1DW2A 1YTCA 3L72D 3CWBD 1CO6A 1SQPD 1WEJF 2PACA 3DP5A 1NTMD 3VRDA 5CIHB 2ZBOA 5B5EV 1C6RA 1GQ1A 2V07A 1FI9A 3WFCC 1CSWA 4WQ9A 1H9XA 3ORVA 2XTSB 4KMGA 1CRHA 4AAOA 1IQCA 1LS9A 1DW3A 1E29A 1CSVA 1CIFA 1ETPA 4FB1A 4L3GA 2BPBB 5B66V 3SLEA 1HZVA 5CIDB 1CYCA 2QJYB 3MK7B 5DJQC 2OZ1A 1H1OA 1RZ6A 3BCCD 3PXSA 4EICA 1FI3A 3C2CA 3OCDB 1EB7A 3GW6A 2ZXYA 1QKSA 5GTIV 2RMZA 2N9YB 1CC5A 2FYUD 1RZ5A 1H9YA 2GC4D 3O20A 5CYTR 4IL6V 3JBTB 2MHMA 4UB6V 1ZZHA 1NNOA 4FANA 2B12B 1I5TA 2BCNB 5DFSA 1M70A 1C2NA 1IRVA 1A8CA 4EIEA 2Y0DA 1N50A 1CSXA 2N9IA 1NIRA 4O1QA 3RMZA 4LJIA 1F1CA 5KLVD 2YIUB 2QG4A 5AURA 2C9XB 1P84D 2C1UA 2I8FA 1M6ZA 2O3JA 3O1YA 2QJPB 1GIWA 1H33A 4RSZA 2RN0A 1IZL0 5CIEB 3VYMA 3PHLA 5C0ZA 1KX2A 2N9JA 3HQ9A 2MTAC 1LMSA 3KZIV 1CTJA 3PTZA 5DF5A 4XXLA 4U3FD 4WQBA 1CIHA 1J3SA 3WU2V 5CICB 1C7MA 2CE0A 5E79V 1DW0A 2IBZD 1CRGA 2YQBA 4DY9A 3PRJA 1HH7A 2FWLA 1KX7A 451CA 2GB8B 1LFMA 4AX3A 1KYOD 2JWAA 2AIUA 3X39A 1DVVA 1L0LD 4JCGA 1CEDA 2V08A 4UB8V 2KS1A 1KYOW 1KB0A 4AALA 1CCHA 3NWVA 1OCDA 5H2FV 2Y0EA 1C75A 2CA4B 1CYIA 4FA4A 3ITKA 2Q3EA 3FWLA 1C2RA 3ZOXA 1KB9D 4XYDB 3DR0A 4WQ7A 2A06D 1HJ5A 3CX5D 2N18C 2K9JB 3RN0A 4H0JA 1AOFA 4FAVA 5KLIB 4MU8A 1ZRTD 2HV4A 4PWAA 3NBSA 1VYDA 1HZUA 4PW9B 1H31B 3SJLA 1QL3A 2KNCB 2BGVX 1QL4A 1N15A 1GDVA 1CXCA 1N90A 1AKKA 1DIQC 3HQ6A 2GC7D 3HQ8A 4PJ0V 1NMLA 3SXTA 4WQEA 1M60A 1YIQA 1H32B 3H1HD 2FRCA 1W5CT 3WC8A 2DGEA 1I6EA 2PCCB 2CE1A 3A0BV 1COTA 1YICA 1BE3D 3SWSA 2YK3A 3WUIA 1GKSA 2B0ZB 2Y0CA 1EZVD 1NTKD 1HJ4A 3WFDC 4WQ8A 1DIIC 5IY51 1DW1A 3PLNA 3A9FA 3M97X 3TDKA 1I54A 1BGYD 1PP9D 3PXTA 4EDFA 1I55A 2FYNB 3GG2A 1A56A 2N3BA 3ZOYA 3VNWA 2ZONG 2JTIB 4AANA 5KKZB 2N18B 2AXTV 1MG3D 3CX5W 1CIGA 1YEBA 2LITA 3OCDA 1YCCA 2BLFB 5CIFB 4PD4D 1SQQD 1I8OA 1JDLA 1PPJD 3L4OA 2AI5A 2L4DA 1LC1A 4H0KA 1QYZA 2GIWA 1CYJA 3ZCFA 2YCCA 1I6DA 3ZBMA 1KV9A 4Y5RA 3MK7C 5DJQB 1GU2A 5TJHA 2ORLA 3O0RC 1BL9A 1MG2D 4D6TD 4YE1A 3DMIA 1YFCA 1K3GA 2C1VA 4V2KA 3CXHW 1F1FA 3WFEC 2L91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FI7 A;  2C8S A;  5CIB B;  3OA8 B;  2DVH A;  1HRO A;  1LC2 A;  4EID A;  5CIG B;  1B7V A;  2D0W A;  3CXH D;  1C52 A;  1AYG A;  1SQX D;  2LIR A;  2C1D B;  4GED B;  1BCC D;  4L1Q A;  3KHU A;  1FJ0 A;  3PH2 B;  3RLM A;  4FA9 A;  2EXV A;  2N3Y A;  1S5L V;  1RAP A;  5TIS V;  2C2C A;  1L0N D;  1H33 B;  1KIB A;  1OAE A;  1S6V B;  1CNO A;  3L75 D;  155C A;  1K3H A;  2ZOO A;  4K3I A;  1SQV D;  2D0S A;  3NBT A;  3PXW A;  1CRJ A;  2CA3 B;  1AOQ A;  1DVH A;  2VHD A;  1WVE C;  2ZZS 1;  1IRW A;  1NTZ D;  3H1K D;  3H1J D;  1FHB A;  4QAO A;  1I8P A;  4WQA A;  5KAI V;  2B10 B;  5EXQ A;  1C6O A;  2B4Z A;  3ZOW A;  1HCM A;  1A2S A;  1L9J C;  3H1L D;  5GTH V;  4A7P A;  3WFB C;  2BH5 X;  4WQC A;  1YNR A;  1IO3 A;  1RAQ A;  3L4M A;  1NMI A;  1GJQ A;  1E8E A;  1NU1 D;  1N9C A;  2QJK B;  4NFG B;  3H1I D;  2BH4 X;  1H32 A;  1YEA A;  2JQR A;  1U74 B;  3L74 D;  1CSU A;  1FCD C;  1CTY A;  1CRY A;  1CRC A;  2BCC D;  3RN1 A;  4FA5 A;  5B6Q A;  3TGU D;  3SVW A;  1E2R A;  4RJT A;  4O1W A;  1H31 A;  2PCB B;  3L70 D;  4GYD A;  3CP5 A;  2OZ1 B;  2CXB A;  351C A;  3TF5 A;  4WQD A;  1DT1 A;  1CHH A;  1L9B C;  3ZOO A;  1CRI A;  1R0Q A;  5KAF V;  1FOC A;  1HJ3 A;  3HQ7 A;  3OA8 A;  3L73 D;  3O5C A;  1W2L A;  2B11 B;  4L3H A;  1C6S A;  4N0K A;  1HRC A;  3ZIY A;  4J20 A;  1CHJ A;  1CIE A;  5C9M A;  4Q5P A;  3TYI A;  1CCR A;  1SQB D;  4FA1 A;  1U75 B;  1QN2 A;  3VMA A;  1CXA A;  1CHI A;  1COR A;  1CTZ A;  3CYT I;  2C1D A;  4AAM A;  4P4Q B;  3L71 D;  4EIF A;  1MZ4 A;  3A0H V;  3CU4 A;  1DW2 A;  1YTC A;  3L72 D;  3CWB D;  1CO6 A;  1SQP D;  1WEJ F;  2PAC A;  3DP5 A;  1NTM D;  3VRD A;  5CIH B;  2ZBO A;  5B5E V;  1C6R A;  1GQ1 A;  2V07 A;  1FI9 A;  3WFC C;  1CSW A;  4WQ9 A;  1H9X A;  3ORV A;  2XTS B;  4KMG A;  1CRH A;  4AAO A;  1IQC A;  1LS9 A;  1DW3 A;  1E29 A;  1CSV A;  1CIF A;  1ETP A;  4FB1 A;  4L3G A;  2BPB B;  5B66 V;  3SLE A;  1HZV A;  5CID B;  1CYC A;  2QJY B;  3MK7 B;  5DJQ C;  2OZ1 A;  1H1O A;  1RZ6 A;  3BCC D;  3PXS A;  4EIC A;  1FI3 A;  3C2C A;  3OCD B;  1EB7 A;  3GW6 A;  2ZXY A;  1QKS A;  5GTI V;  2RMZ A;  2N9Y B;  1CC5 A;  2FYU D;  1RZ5 A;  1H9Y A;  2GC4 D;  3O20 A;  5CYT R;  4IL6 V;  3JBT B;  2MHM A;  4UB6 V;  1ZZH A;  1NNO A;  4FAN A;  2B12 B;  1I5T A;  2BCN B;  5DFS A;  1M70 A;  1C2N A;  1IRV A;  1A8C A;  4EIE A;  2Y0D A;  1N50 A;  1CSX A;  2N9I A;  1NIR A;  4O1Q A;  3RMZ A;  4LJI A;  1F1C A;  5KLV D;  2YIU B;  2QG4 A;  5AUR A;  2C9X B;  1P84 D;  2C1U A;  2I8F A;  1M6Z A;  2O3J A;  3O1Y A;  2QJP B;  1GIW A;  1H33 A;  4RSZ A;  2RN0 A;  1IZL 0;  5CIE B;  3VYM A;  3PHL A;  5C0Z A;  1KX2 A;  2N9J A;  3HQ9 A;  2MTA C;  1LMS A;  3KZI V;  1CTJ A;  3PTZ A;  5DF5 A;  4XXL A;  4U3F D;  4WQB A;  1CIH A;  1J3S A;  3WU2 V;  5CIC B;  1C7M A;  2CE0 A;  5E79 V;  1DW0 A;  2IBZ D;  1CRG A;  2YQB A;  4DY9 A;  3PRJ A;  1HH7 A;  2FWL A;  1KX7 A;  451C A;  2GB8 B;  1LFM A;  4AX3 A;  1KYO D;  2JWA A;  2AIU A;  3X39 A;  1DVV A;  1L0L D;  4JCG A;  1CED A;  2V08 A;  4UB8 V;  2KS1 A;  1KYO W;  1KB0 A;  4AAL A;  1CCH A;  3NWV A;  1OCD A;  5H2F V;  2Y0E A;  1C75 A;  2CA4 B;  1CYI A;  4FA4 A;  3ITK A;  2Q3E A;  3FWL A;  1C2R A;  3ZOX A;  1KB9 D;  4XYD B;  3DR0 A;  4WQ7 A;  2A06 D;  1HJ5 A;  3CX5 D;  2N18 C;  2K9J B;  3RN0 A;  4H0J A;  1AOF A;  4FAV A;  5KLI B;  4MU8 A;  1ZRT D;  2HV4 A;  4PWA A;  3NBS A;  1VYD A;  1HZU A;  4PW9 B;  1H31 B;  3SJL A;  1QL3 A;  2KNC B;  2BGV X;  1QL4 A;  1N15 A;  1GDV A;  1CXC A;  1N90 A;  1AKK A;  1DIQ C;  3HQ6 A;  2GC7 D;  3HQ8 A;  4PJ0 V;  1NML A;  3SXT A;  4WQE A;  1M60 A;  1YIQ A;  1H32 B;  3H1H D;  2FRC A;  1W5C T;  3WC8 A;  2DGE A;  1I6E A;  2PCC B;  2CE1 A;  3A0B V;  1COT A;  1YIC A;  1BE3 D;  3SWS A;  2YK3 A;  3WUI A;  1GKS A;  2B0Z B;  2Y0C A;  1EZV D;  1NTK D;  1HJ4 A;  3WFD C;  4WQ8 A;  1DII C;  5IY5 1;  1DW1 A;  3PLN A;  3A9F A;  3M97 X;  3TDK A;  1I54 A;  1BGY D;  1PP9 D;  3PXT A;  4EDF A;  1I55 A;  2FYN B;  3GG2 A;  1A56 A;  2N3B A;  3ZOY A;  3VNW A;  2ZON G;  2JTI B;  4AAN A;  5KKZ B;  2N18 B;  2AXT V;  1MG3 D;  3CX5 W;  1CIG A;  1YEB A;  2LIT A;  3OCD A;  1YCC A;  2BLF B;  5CIF B;  4PD4 D;  1SQQ D;  1I8O A;  1JDL A;  1PPJ D;  3L4O A;  2AI5 A;  2L4D A;  1LC1 A;  4H0K A;  1QYZ A;  2GIW A;  1CYJ A;  3ZCF A;  2YCC A;  1I6D A;  3ZBM A;  1KV9 A;  4Y5R A;  3MK7 C;  5DJQ B;  1GU2 A;  5TJH A;  2ORL A;  3O0R C;  1BL9 A;  1MG2 D;  4D6T D;  4YE1 A;  3DMI A;  1YFC A;  1K3G A;  2C1V A;  4V2K A;  3CXH W;  1F1F A;  3WFE C;  2L91 A; 
#chains in the Genus database with same CATH topology
 1FI7 A;  3D71 A;  1J1D C;  1U7M A;  3S1K A;  5CIG B;  3KDP B;  3A3Y B;  5B5E E;  3MTU E;  4DCK A;  3CXH D;  5AVV B;  1NGM B;  4KT0 J;  3CCQ P;  1SQQ K;  4YPC A;  1VQN P;  4DJG A;  4FA9 A;  3VMX A;  1SFC D;  2E76 D;  1KIL C;  2KSE A;  2C9L Y;  2Z5I A;  1AV1 A;  2GM4 A;  2N9B A;  1S72 P;  2RKL A;  1QGK B;  3FXD A;  4EOT A;  3L75 D;  4L74 A;  2ZYG A;  1K3H A;  3F89 A;  3CX5 E;  1X79 B;  1NTZ D;  3H1K D;  1SQP J;  1FHB A;  4PV1 C;  2B10 B;  1C6O A;  4YTP C;  1H0T A;  4AQR D;  1Q7Y Q;  1LT9 A;  1BCC G;  1SQX G;  2M0B A;  4A7P A;  1TU3 F;  1FZG A;  1JY3 O;  1IO3 A;  1RAQ A;  1NMI A;  1T3J A;  1N9C A;  4NFG B;  2W6B A;  2BH4 X;  3A0B E;  4U7J A;  1YEA A;  1U74 B;  4HKZ H;  2HYN A;  2R3C A;  1FCD C;  1KTM A;  1CTY A;  1RHZ B;  1AVY A;  4EI2 A;  3L37 A;  3H1L E;  5AW3 B;  3TGU D;  2WPR A;  1LJ2 A;  1E2R A;  3MGN A;  1LTJ B;  2KYV A;  1H31 A;  2PCB B;  2WPS A;  1P84 E;  1NTK G;  3L70 D;  3CP5 A;  3AE8 C;  1AQ5 A;  4H13 C;  3MUD A;  4WQD A;  1NO4 A;  2PGD A;  1BE3 E;  1L9B C;  1MKM A;  3OJA B;  1FOC A;  2ZFC A;  1Q82 Q;  1DX7 A;  1NH4 A;  1AFO A;  1FZB A;  3ABV C;  3T97 B;  1YHQ P;  3OA8 A;  2Q9I A;  3G71 P;  5C39 A;  4BWN A;  2W6A A;  1HRC A;  1EZV I;  1NTM E;  5C9M A;  2HPC A;  1WT6 A;  3L71 G;  1RQV A;  4ZMD A;  3GLM A;  1BGY J;  3H6P A;  2OYH A;  2M3E A;  3L71 J;  2K88 A;  1YJW P;  2HR3 A;  2E74 C;  2XND H;  1CXA A;  2RH0 A;  2ZYD A;  3M06 A;  5B66 H;  3CU4 A;  3CMA P;  3HTK A;  1SQP D;  3H1K J;  2C9N Y;  3VMY A;  1NTM G;  1SQV J;  1A02 F;  1GQ1 A;  1CSW A;  1H9X A;  1GTW A;  2ZJS E;  1T8Z A;  4HB1 A;  1LT9 C;  2ZT9 C;  1QLE D;  3A7O A;  1T2K D;  1LS9 A;  1KIL A;  2G3A A;  3L72 E;  1CSV A;  1CIF A;  2Z4E A;  1RE4 C;  5B66 V;  1GU4 A;  3E1I A;  2I1J A;  2WSC J;  2WMM A;  2OZ1 A;  1JY2 N;  3AEG C;  3BCC D;  4EIC A;  3WUV A;  1AA0 A;  1PGJ A;  1Q90 D;  1FI3 A;  3ZDM A;  2OYI A;  1IFD A;  3OCD B;  3V2R A;  2LR2 A;  3H1I G;  4BRY B;  1QKS A;  1JO5 A;  1J1E C;  2R5D A;  1HJ0 A;  2YNY A;  2WSF H;  5CYT R;  2I8D A;  2E75 D;  3JBT B;  5DFS A;  1YQ4 C;  3W68 A;  1CSX A;  1N7S A;  1KMI Z;  1F1C A;  3CI9 A;  1VL2 A;  1VF5 B;  1YBK A;  2QG4 A;  3CCS P;  4XFJ A;  2I8F A;  4GKG A;  1DD3 A;  3U59 A;  4Y99 B;  4QMA A;  5KKZ C;  1EDK A;  2WSS H;  5CCG C;  3BVH A;  4RSZ A;  1IZL 0;  1S9K E;  1VQ9 P;  1OW6 A;  1DEB A;  1WRG A;  3RK3 E;  3L75 J;  1FBM A;  1LMS A;  1URQ B;  1QX8 A;  1USE A;  3SFD C;  2V4H A;  3RL0 B;  3SFE C;  3AE2 C;  3WU2 V;  3R4Y A;  3CXH I;  2R5B A;  1FOS E;  1BE3 J;  3E7K A;  4GOF A;  3A0H E;  1SQP E;  1K73 Q;  1K9M Q;  5APW A;  1ZOY C;  3HTK B;  2WSE H;  3SWK A;  4AYC A;  1RF1 B;  1VQ4 P;  2AIU A;  2FYU K;  3RBX A;  1JNM A;  2WPQ A;  2XV5 A;  2V08 A;  4XE5 B;  1YQ3 C;  5AVW B;  3O6Q A;  3LW5 J;  2QJP C;  2JKV A;  1YTZ I;  1C75 A;  1CYI A;  1KQS O;  1C2R A;  1NAY A;  2P58 A;  2E75 C;  2YXQ B;  1PIX A;  1HJ5 A;  3CX5 D;  1KZU B;  3RK2 D;  3RN0 A;  2Y9Z A;  1LTG C;  4KHX A;  3P32 A;  1GW4 A;  5AVS B;  4KJM A;  4PWA A;  5KAF E;  2AEM A;  2K3R A;  3CWB E;  1H31 B;  1IZN B;  1G1I A;  2KB7 P;  2IYP A;  3VOP A;  1M1J B;  1FOS F;  1L0N E;  1GK4 A;  4IFM A;  4UB8 H;  5M1B A;  3EFG A;  4CPG A;  3WUT A;  3HQ8 A;  1LP1 A;  3LID A;  3SXT A;  2JEE A;  3G3Z A;  2FRC A;  3Q3D A;  2C0W A;  5AW4 B;  2DGE A;  5AW2 B;  4W7Y A;  5KJ7 D;  2J5U A;  2V7Q J;  1SFC B;  2E76 B;  5KTB A;  1NTZ K;  2B0Z B;  2Q6Q A;  2Y0C A;  1HGV A;  2QA4 P;  1SFC C;  2E76 C;  1HJ4 A;  3L71 E;  1FZC C;  3PH0 A;  3A9F A;  1JTH A;  2QRX A;  4N3Y B;  1BGY D;  4EDF A;  2FYN B;  1A56 A;  2N3B A;  2JTI B;  1SQB K;  4AAN A;  3CX5 W;  1CIG A;  1SQP G;  3Q5P A;  2ZVN B;  1LTJ C;  2WT7 B;  5CIF B;  4PD4 D;  1I8O A;  1P84 H;  4I2L C;  2B87 A;  3RK2 C;  1M1J C;  3M0D C;  1RE4 A;  1S5L E;  4NPD A;  5BVZ A;  1I6D A;  2FYZ A;  2GA1 A;  1KV9 A;  3UIA A;  2ZYA A;  3MK7 C;  2IFN A;  2IZ1 A;  2JR8 A;  5BU5 A;  1GL2 B;  1YFC A;  2C1V A;  3P8C E;  1NU1 G;  1MFT A;  3L74 E;  1C52 A;  3II6 A;  1AYG A;  5CHX A;  2LIR A;  5AW5 B;  3KHU A;  2JWD A;  3I5C A;  2PAJ A;  3SWY A;  4I7Z B;  2EXV A;  2P67 A;  5B66 E;  1S5L V;  1RAP A;  5TIS V;  1LTA C;  1OIP A;  3H32 A;  3TGU G;  3P7K A;  1L0N D;  3USS A;  1L0L K;  1KIB A;  1S2E A;  2CPS A;  1OAE A;  2A06 E;  1LNQ A;  1FS0 E;  155C A;  4YXW H;  1GD2 E;  1IFP A;  1FE6 A;  3PXW A;  1GW3 A;  5CBO A;  1CW5 A;  2CA3 B;  2VHD A;  3CWB J;  4QAO A;  4WQA A;  2N1T A;  5EXQ A;  3EFF K;  1FZE A;  3AE5 C;  4H0L C;  1DD4 A;  3H1L D;  1FC2 C;  3NMD A;  3WFB C;  2WT7 A;  3V4Q A;  1E5W A;  4WQC A;  1GU5 A;  3TNU B;  1HWT C;  2QM8 A;  5H2F E;  2QJK B;  4H13 B;  4JBZ A;  3H1I D;  3A2A A;  3PJS K;  1D7M A;  2WSC H;  4OVN F;  4AUW A;  1CRY A;  2W27 A;  2BCC D;  4FA5 A;  1VF5 C;  1KQF B;  1YJN P;  3SVW A;  2POH A;  4O1W A;  1W2E A;  1GZL A;  2K37 A;  3M9Q A;  4WY4 B;  4GYD A;  5KAI H;  4MN4 C;  4L75 A;  351C A;  2QJK C;  2YO3 A;  3VN0 A;  3TF5 A;  1OX3 A;  2NRG A;  1YJ9 P;  1M7L A;  3HD7 B;  1CHH A;  3ZOO A;  1K04 A;  5AW8 B;  2WSF J;  1RY3 A;  3V5B A;  1CRI A;  4BRY A;  1HJ3 A;  3HQ7 A;  3CPW O;  3L73 D;  1ZP0 C;  1USD A;  3WUU A;  2B11 B;  1WMK A;  2E5T A;  4PV1 B;  4J20 A;  1VDF A;  1DEE G;  3B5N C;  3CCR P;  1YI2 P;  1CCR A;  2FY8 A;  4FA1 A;  1YTZ T;  3H25 A;  3CCL P;  1CTZ A;  4N6J A;  1ZME C;  2C1D A;  1SQQ G;  1NTK J;  3L71 D;  1HUC A;  3A0H V;  3KZI H;  4UB8 E;  1YTC A;  3L72 D;  2DW3 A;  1W5C E;  3H1J J;  4OH8 B;  1WEJ F;  2PAC A;  1JCC A;  4PD4 I;  1HF9 A;  1KYO E;  1FDI A;  5B5E V;  3WFC C;  3MP7 B;  5APU A;  3ORV A;  1CSB A;  1CRH A;  1IFM A;  2E74 B;  1AJY A;  1E29 A;  4L3G A;  2BPB B;  2O01 H;  2HFE D;  2N1T B;  5GTI E;  2PFX A;  4H44 B;  1CYC A;  1JY3 N;  2ZAE B;  4W80 A;  3MK7 B;  1RZ6 A;  3PXS A;  2PRR A;  3TGU J;  3BCC J;  1SP4 A;  5CCG D;  2H8P D;  1EB7 A;  3HE4 A;  5GTI V;  4D6T J;  4IL6 E;  3H32 B;  1G2C A;  1KQG B;  2GC4 D;  2K9Y A;  3M9B A;  2FXM A;  4JPZ B;  4IL6 V;  2MHM A;  1PZQ A;  1NNO A;  4FAN A;  2B12 B;  1MZ9 A;  4EIE A;  2Q7C A;  1N7S D;  2N9I A;  4O1Q A;  1EDL A;  3H1K E;  4RKU J;  4M3L A;  1JY2 O;  1M57 D;  1IFI A;  1PGO A;  5AUR A;  1M1K Q;  1HJB A;  3M91 A;  1LWU B;  1H88 A;  1GIW A;  1NJI Q;  1H33 A;  2RN0 A;  4PV1 D;  1KX2 A;  1KYO H;  2MTA C;  1NU1 K;  3Q2Y A;  3A5T A;  4XXL A;  3GHG A;  1J2J B;  4H0L B;  1ZR4 A;  4RO0 A;  2D2C B;  2CE0 A;  2FYU G;  5APX A;  1DW0 A;  2QE7 H;  4WY4 D;  4DY9 A;  3CXH H;  2OTJ P;  5AVX B;  4H0L D;  3Q5R A;  1KX7 A;  451C A;  2HOD A;  4D6T G;  4AX3 A;  1KYO D;  2JWA A;  1FAV A;  1KIL B;  5KLI C;  1CED A;  1AVO A;  2KS1 A;  3H1L G;  1LTS C;  1KYO W;  1CCH A;  5APQ A;  4IOI H;  2CA4 B;  1A02 J;  5KJ7 A;  2YIU C;  1OVV A;  1NWQ A;  1NU1 E;  2K9J A;  1KB9 D;  3DR0 A;  2KZJ A;  2ZVO B;  4WQ7 A;  1SQQ J;  2K9J B;  5AVU B;  3P8M C;  1ZRT D;  1NHL A;  1BCC E;  2V7Q H;  3B8E B;  2NPS D;  2YKQ A;  1S3J A;  3M9H A;  1DIQ C;  4H44 C;  1JTH B;  3CC7 P;  3E1R A;  3HUS C;  3BCC E;  3HUS A;  3SSU A;  1W2B O;  1H32 B;  3H1H D;  2B89 A;  3RL0 C;  2FYN C;  3G4S P;  1OXZ A;  3SWF A;  2J59 M;  2FKW B;  3L72 G;  2CE1 A;  3A0B V;  1PGQ A;  1COT A;  1YIC A;  1RQU A;  1K8A Q;  2YK3 A;  3WUI A;  1GKS A;  1BSH A;  1LP1 B;  1L4A C;  4NPE A;  4R4L A;  1DW1 A;  3PLN A;  3IAO A;  1PV3 A;  3VTP C;  2H7H A;  3PXT A;  1Q2N A;  4K3A A;  3L73 E;  1NTZ J;  3ZOY A;  3KZI E;  2ZON G;  2FFD A;  2WZ7 A;  5TIS E;  1MG3 D;  2B9B A;  2M5A A;  1BGY G;  1L0N K;  2KSJ A;  2BLF B;  1J1E B;  1KFN A;  2KP8 A;  3MHV A;  1PP9 E;  3R2P A;  1OW8 A;  1QEX A;  2YCC A;  3C9I A;  3S9O A;  1SFC A;  2KNC A;  2HOD B;  5APV A;  4GDO A;  3O0R C;  2W90 A;  2B88 A;  2J58 A;  3L36 A;  2BCC G;  3CXH W;  1F1F A;  1T6A A;  3BAS A;  2C8S A;  1IFN A;  5CIB B;  2DVH A;  3GF3 A;  2P7J A;  1B7V A;  2WPV B;  2D0W A;  1QL2 A;  2O1J A;  4HH2 A;  1SQX D;  4GED B;  3RK3 C;  1BCC D;  4L1Q A;  2G8Y A;  3RLM A;  4JYB A;  2N3Y A;  1G1J A;  2C2C A;  1ZXG A;  4O9B A;  1H33 B;  3IF4 A;  1KYO I;  3LIE A;  3L75 G;  4OGQ D;  1QVG O;  1CNO A;  1JMB A;  3F5H A;  2R44 A;  4K3I A;  1AQT A;  3U1A A;  3NBT A;  3IR9 A;  3AEB C;  4WBA A;  1WVE C;  2ZZS 1;  1EXJ A;  1M56 D;  3CCE P;  2XNX A;  3ZOW A;  3CC2 P;  1L9J C;  1N73 C;  1LTT C;  3WMM 0;  3OA7 A;  2BH5 X;  1YNR A;  3GMA A;  1E8E A;  1SQV G;  1NU1 D;  3L74 J;  1T3U A;  4GT1 A;  3JCU E;  2IPP A;  3H1I J;  2JQR A;  4I6M C;  3CXH E;  1CSU A;  1S1C X;  1VQP P;  1CRC A;  3RN1 A;  2AEF A;  2PP6 A;  1OWA A;  2OTL P;  3CLQ A;  2ZT9 D;  2M8R A;  4WY4 A;  3HE5 A;  3WU2 H;  1X0T A;  3D0W A;  2IBZ E;  3V4W A;  2NPS C;  1GL2 C;  1GL2 D;  5E79 E;  5CCH C;  2OZ1 B;  2NPS A;  3AE4 C;  2ZT9 B;  3L75 E;  2CXB A;  1SQQ E;  1FDO A;  1KIL E;  1DT1 A;  5GTH E;  3EQ2 A;  2KLV A;  2YKO A;  5AW9 B;  3T97 A;  2CPB A;  3U1C A;  5KAF V;  2WWW A;  5KAI E;  3H1H G;  3H1H E;  3O5C A;  4LGD E;  1DIP A;  4L3H A;  4OGQ B;  1GL2 A;  1CI6 A;  1CIE A;  2A45 H;  2D2C C;  1EZV G;  1BCC J;  2H43 A;  1PP9 J;  4C7N A;  1VF5 D;  1U75 B;  3CX5 H;  3VMA A;  1HVV A;  1COR A;  3AE7 C;  3CYT I;  4P4Q B;  3AEC C;  3D70 A;  1NTM J;  1CO6 A;  3DP5 A;  1RF0 C;  2WTY A;  4IL6 X;  1C6R A;  1S5L X;  4WQ9 A;  1IK9 A;  3A0B H;  3CC4 P;  4UB6 E;  2E43 A;  4KMG A;  1J1D B;  4TLF A;  1DW3 A;  3OW2 O;  1ETP A;  4FB1 A;  2I1K A;  3RK3 B;  2IDB A;  2AEJ A;  2WSE J;  3RBZ A;  5CJ4 A;  3HUS B;  2QSI A;  5E79 H;  1EXI A;  5CID B;  1EDI A;  1NTZ E;  1Y47 A;  3CME P;  5DJQ C;  3H1K G;  3VP9 A;  1VQ5 P;  1OMI A;  1NOH A;  2HG5 D;  3C2C A;  3L74 G;  2M5A B;  2FFD B;  1LT1 A;  3GW6 A;  4ZKU A;  1ZR2 A;  1HH0 A;  2N9Y B;  2KZI A;  1MFZ A;  2FYU D;  2AXT E;  1RF0 A;  1H9Y A;  3O20 A;  1E79 H;  1H8A A;  2N1T C;  4I1L A;  4UB6 V;  4Z1M H;  1NTK E;  1I5T A;  1R5L A;  1M70 A;  2IBZ I;  1C2N A;  1N50 A;  2XZR A;  2KI7 B;  4HJG H;  1NIR A;  4LJI A;  5KLV D;  3H1J G;  1IFJ A;  2YIU B;  3Q5S A;  1YIT P;  3MZW B;  1OVU A;  4GIF A;  1P84 D;  2C1U A;  3H1I E;  1NAF A;  2HLO A;  1ZW0 A;  1H0T B;  3VYM A;  3PHL A;  2BAS A;  1LT9 B;  5C0Z A;  1N7L A;  2BCC E;  3HQ9 A;  4L76 A;  1PGP A;  3KZI V;  3A0H H;  1RH5 B;  2M3B A;  4IFD K;  2YMY A;  4U3F D;  1Y9B A;  3MUD C;  1CIH A;  1J3S A;  1EDJ A;  5CIC B;  3IN6 A;  1IJD B;  3L4F A;  1L0L G;  2E74 D;  1LTI C;  1JMM A;  5E79 V;  1SQV K;  5KLV K;  4PD4 E;  4TT3 H;  2YQB A;  4DZO A;  1N8R Q;  3PRJ A;  2ITA A;  1U57 A;  1Z56 A;  1HH7 A;  1RF1 A;  2FWL A;  1SLQ A;  3RL0 D;  3HRN A;  2IX7 C;  1M90 Q;  4ZNC A;  1FJP A;  1LFM A;  1QVF O;  2E42 A;  1L0N G;  2IFM A;  1URQ D;  1N2D C;  1SVF A;  2R32 A;  1L0L D;  1M1J A;  4JCG A;  3M0D A;  4UB8 V;  4AAL A;  1KB0 A;  3G6E P;  4W7Z A;  3NWV A;  1OCD A;  1LWU C;  2KLU A;  5H2F V;  1L0L J;  2Y0E A;  4WY4 C;  4N78 D;  1LWU A;  1FZA A;  4FA4 A;  2KS1 B;  2Q3E A;  1GK6 A;  3TYY A;  1NTZ G;  1SQB J;  1PPJ G;  3ZOX A;  2JJL A;  2NZ2 A;  1S9K D;  2QJY C;  4XYD B;  2N1T D;  1MUU A;  1NVO A;  3QH9 A;  2FYU J;  2YMK A;  3AE3 C;  3KYQ A;  2L5G B;  1XTC C;  2OAR A;  1KN7 A;  4FAV A;  3NFQ A;  3BCC G;  2HV4 A;  3NBS A;  3VYI A;  2KIK A;  3SJL A;  1QL3 A;  2D2C D;  1KFM A;  2BGV X;  3M0A A;  2OGU A;  3HQ6 A;  2GC7 D;  1R5S A;  1Q86 Q;  1BDC A;  5KAF H;  4PJ0 V;  2YO2 A;  1YIQ A;  2SPZ A;  3V2N A;  3CWB G;  1W5C T;  5APS A;  2A45 I;  2BEQ D;  1KB9 I;  2Z5H A;  3AEA C;  1L0N J;  4Y28 J;  3AE6 C;  4JQ0 D;  1SS1 A;  1X8Y A;  3CX5 I;  1RE3 A;  3O8Z A;  1BE3 D;  1BDD A;  3SWS A;  2W83 C;  3B4S A;  2R3S A;  3AED C;  1IO4 A;  1URQ A;  3GHG C;  4WQ8 A;  4XA4 A;  5IY5 1;  5CMZ A;  5K5G B;  1JCD A;  3TDK A;  3V2Q A;  1I54 A;  1PP9 D;  1LTB C;  1ZN5 A;  2GUS A;  3BAT A;  4I7Z C;  3VNW A;  1KQL A;  1R8E A;  4ZKP A;  1EQ7 A;  3HE4 B;  1NKZ B;  3HE5 B;  1YEB A;  3QWO C;  2LIT A;  1YCC A;  3FXE A;  1JDL A;  3CCJ P;  3C1L A;  1PPJ D;  3TK1 A;  3L4O A;  5TIS H;  2AI5 A;  1LC1 A;  1QYZ A;  2GIW A;  1CYJ A;  2Q5U A;  3TSI A;  4H44 D;  3ZCF A;  3V6I A;  1P84 I;  4NPF X;  4H13 D;  4DOJ A;  3HD7 C;  5CJ0 A;  3L35 A;  3ZBM A;  2OYI B;  4Y5R A;  1GU2 A;  1RF1 C;  2ORL A;  1BL9 A;  1CZQ A;  5B5E H;  2FFD C;  4YE1 A;  1JEK A;  2XDJ A;  4V2K A;  2L91 A;  3W67 A;  1U7J A;  4GOE A;  3OA8 B;  1HRO A;  1LC2 A;  4EID A;  4ASW A;  2K1A A;  1HBW A;  3IFM A;  1L4A A;  1FZC B;  1NU1 J;  4PJ0 E;  2C1D B;  1L4A B;  2JO1 A;  1FJ0 A;  3PH2 B;  4JF7 A;  3CL3 D;  4U3F E;  5AW0 B;  3H1L J;  3L73 J;  5CCG A;  2Q3I A;  1LTJ A;  3H1H J;  2JP3 A;  1MV8 A;  3JSV C;  1S6V B;  5AVR B;  2OYO A;  2A06 G;  2ZOO A;  4Y99 C;  4IFF A;  2KOG A;  2IZ0 A;  1SQV D;  2D0S A;  1CRJ A;  1AOQ A;  1DVH A;  2O01 N;  4UB6 H;  1IRW A;  4HYT B;  1KB9 E;  3H1J D;  3LW5 H;  1I8P A;  2Q1K A;  5KAI V;  2B4Z A;  1SQX J;  1HCM A;  1A2S A;  5KLV J;  3RGU A;  5CCH D;  5GTH V;  3D6Z A;  2W6J H;  1YYC A;  2OYI C;  3L4M A;  1GJQ A;  2KK7 A;  1S5L H;  1H32 A;  1OFC X;  1YIJ P;  3L74 D;  2IBZ G;  2WQY C;  5L8R J;  3RK3 D;  2ZXX A;  5B6Q A;  1OW7 A;  3NXS A;  1IC2 A;  1XTG B;  4RJT A;  1GMJ A;  1OVR A;  3B5N A;  1JY3 P;  5H2F H;  1JM0 A;  1PPJ E;  4PJ0 H;  1N7S C;  3JC2 2;  3WU2 E;  5AVZ B;  4B86 A;  2LKM A;  4IL6 H;  2XU6 A;  1R0Q A;  3FWN A;  1NTK K;  1T2K C;  3RK2 B;  4WB4 A;  1L0L E;  4YXD C;  4JYC A;  1JUN A;  1W2L A;  2YXR B;  1C6S A;  4N0K A;  2IYO A;  3ZIY A;  1VQ8 P;  1KOR A;  1CHJ A;  2QEX P;  5APT A;  2OYH C;  1KB9 H;  4N78 E;  4Q5P A;  1JY2 P;  3KXD A;  3TYI A;  1SQB D;  2YKP A;  2HPC B;  2XKM A;  3N7N A;  2FXP A;  5BU8 B;  3CCU P;  1BE3 G;  1QN2 A;  1VQL P;  1CHI A;  4AAM A;  4PD4 H;  4EIF A;  1MZ4 A;  1K05 A;  1DW2 A;  3KPE A;  2P1J A;  3CWB D;  4WVZ A;  2MJZ A;  2FBW C;  4K35 A;  1FZF A;  1NTM D;  1VQ7 P;  5GTI H;  5AVQ B;  3VRD A;  5CIH B;  2ZBO A;  2V07 A;  1FI9 A;  3MD0 A;  3S4R A;  3AEF C;  2C0X A;  3FX0 A;  5CCH A;  1QL1 A;  2VRS A;  1Y8A A;  1SQV E;  2XTS B;  4AAO A;  1IQC A;  1ZV8 A;  2LXB A;  3H1J E;  3KQG A;  3AEE C;  2W8Z A;  4DT0 A;  3SLE A;  1HZV A;  1DH3 A;  1ZLL A;  2GUV A;  2B87 B;  4C7N B;  1KV4 A;  2QJY B;  4OGQ C;  3GF7 A;  1H1O A;  1VQ6 P;  1CI6 B;  3OAK A;  3I55 P;  5CBN A;  2E5Y A;  3Q1M A;  2ZXY A;  2RMZ A;  1CC5 A;  2H88 C;  3JCU H;  1RZ5 A;  3L70 G;  5APY A;  1NYH A;  1FDM A;  1ZZH A;  3CCM P;  2BCN B;  3D6Y A;  2NPS B;  3PP5 A;  1PFI A;  1IRV A;  1A8C A;  2E75 B;  2Y0D A;  3RMZ A;  2P10 A;  2FXO A;  2OQQ A;  4D6T E;  3AE1 C;  3FGA D;  2O1K A;  2C9X B;  3GHG B;  4ASV A;  1M6Z A;  2O3J A;  3O1Y A;  2QJP B;  2P2U A;  5CIE B;  2WIT A;  2N9J A;  5GTH H;  1FJK A;  1HGZ A;  2AXC A;  1CTJ A;  4EIJ A;  4U3F J;  1L2P A;  3PTZ A;  1EZV E;  1N73 B;  5DF5 A;  1FU1 A;  2CK3 H;  3B71 A;  4OWF A;  4WQB A;  1IK7 A;  1SQB E;  3EWK A;  5AVY B;  3B5N B;  5DJU B;  5AW6 B;  1C7M A;  2QIW A;  2WVR A;  3L70 E;  2ZXE B;  1RE3 C;  4BXL A;  1KIL D;  2Y9Y A;  3B5N D;  2IBZ D;  1CRG A;  2QM7 A;  1NTM K;  3P8C D;  5EFW B;  4RES B;  3VP8 A;  5AW1 B;  2GB8 B;  1Q81 Q;  1FZC A;  1M8O B;  1G2C B;  5KLV G;  3HD7 D;  1URQ C;  4C46 A;  3X39 A;  1DVV A;  1OZH A;  3G9R A;  1VPC A;  3ITK A;  3O6Q B;  1JB0 J;  3N4X A;  3FWL A;  1EC5 A;  2BCC J;  3C8V A;  2A06 D;  1N7S B;  4R4M A;  1SQX E;  2N18 C;  4H0J A;  1AOF A;  2LXC B;  3TGU E;  5KLI B;  4MU8 A;  4C7R A;  1VYD A;  2BEZ F;  1BSN A;  1HZU A;  4LC1 A;  4PW9 B;  1UIX A;  2KNC B;  1X22 A;  2A45 G;  1QL4 A;  1N15 A;  2AXT H;  1GDV A;  1NKN A;  3K5B A;  1CXC A;  1X9V A;  1N90 A;  1AKK A;  3VMZ A;  1H89 A;  1L4A D;  1NML A;  2KXP B;  4WQE A;  1M60 A;  3BRT B;  4L73 A;  5AVT B;  3RL0 g;  2JDI H;  4EYY Q;  4GOD A;  3WC8 A;  3TNU A;  1I6E A;  4LLH A;  2PCC B;  3NTN A;  1HTL C;  1VQK P;  1S4X A;  1N73 A;  2H89 C;  3L72 J;  1SQX K;  1KC8 Q;  3I56 P;  1SQP K;  1EZV D;  1NTK D;  1JOC A;  3CCV P;  3WFD C;  3HD7 A;  1DII C;  1SQB G;  2O01 J;  3M97 X;  1VQM P;  3BRV B;  2KUB A;  2FYU E;  2OTK E;  2QVA A;  2UWJ E;  1I55 A;  3GG2 A;  1ZRT E;  5KKZ B;  3CD6 P;  2N18 B;  2AXT V;  3AE9 C;  1UII A;  3OCD A;  2OYH B;  1PP9 G;  4WWI A;  5KLV E;  5KJ7 C;  1PL5 A;  1SQQ D;  2L4D A;  4H0K A;  1BGY E;  1N86 A;  5AW7 B;  1LGH B;  3MIW A;  4U3F G;  1VQO P;  3V2P A;  1GDT A;  1KD1 Q;  2MKV A;  3L70 J;  5DJQ B;  5TJH A;  3L73 G;  1MG2 D;  4D6T D;  3DMI A;  1K3G A;  3WFE C;  5DJT B; 
#chains in the Genus database with same CATH homology
 1FI7 A;  2C8S A;  5CIB B;  3OA8 B;  2DVH A;  1HRO A;  1LC2 A;  4EID A;  5CIG B;  1B7V A;  2D0W A;  3CXH D;  1C52 A;  1AYG A;  1SQX D;  2LIR A;  2C1D B;  4GED B;  1BCC D;  4L1Q A;  3KHU A;  1FJ0 A;  3PH2 B;  3RLM A;  4FA9 A;  2EXV A;  2N3Y A;  1S5L V;  1RAP A;  5TIS V;  2C2C A;  1L0N D;  1H33 B;  1KIB A;  1OAE A;  1S6V B;  1CNO A;  3L75 D;  155C A;  1K3H A;  2ZOO A;  4K3I A;  1SQV D;  2D0S A;  3NBT A;  3PXW A;  1CRJ A;  2CA3 B;  1AOQ A;  1DVH A;  2VHD A;  1WVE C;  2ZZS 1;  1IRW A;  1NTZ D;  3H1K D;  3H1J D;  1FHB A;  4QAO A;  1I8P A;  4WQA A;  5KAI V;  2B10 B;  5EXQ A;  1C6O A;  2B4Z A;  3ZOW A;  1HCM A;  1A2S A;  1L9J C;  3H1L D;  5GTH V;  4A7P A;  3WFB C;  2BH5 X;  4WQC A;  1YNR A;  1IO3 A;  1RAQ A;  3L4M A;  1NMI A;  1GJQ A;  1E8E A;  1NU1 D;  1N9C A;  2QJK B;  4NFG B;  3H1I D;  2BH4 X;  1H32 A;  1YEA A;  2JQR A;  1U74 B;  3L74 D;  1CSU A;  1FCD C;  1CTY A;  1CRY A;  1CRC A;  2BCC D;  3RN1 A;  4FA5 A;  5B6Q A;  3TGU D;  3SVW A;  1E2R A;  4RJT A;  4O1W A;  1H31 A;  2PCB B;  3L70 D;  4GYD A;  3CP5 A;  2OZ1 B;  2CXB A;  351C A;  3TF5 A;  4WQD A;  1DT1 A;  1CHH A;  1L9B C;  3ZOO A;  1CRI A;  1R0Q A;  5KAF V;  1FOC A;  1HJ3 A;  3HQ7 A;  3OA8 A;  3L73 D;  3O5C A;  1W2L A;  2B11 B;  4L3H A;  1C6S A;  4N0K A;  1HRC A;  3ZIY A;  4J20 A;  1CHJ A;  1CIE A;  5C9M A;  4Q5P A;  3TYI A;  1CCR A;  1SQB D;  4FA1 A;  1U75 B;  1QN2 A;  3VMA A;  1CXA A;  1CHI A;  1COR A;  1CTZ A;  3CYT I;  2C1D A;  4AAM A;  4P4Q B;  3L71 D;  4EIF A;  1MZ4 A;  3A0H V;  3CU4 A;  1DW2 A;  1YTC A;  3L72 D;  3CWB D;  1CO6 A;  1SQP D;  1WEJ F;  2PAC A;  3DP5 A;  1NTM D;  3VRD A;  5CIH B;  2ZBO A;  5B5E V;  1C6R A;  1GQ1 A;  2V07 A;  1FI9 A;  3WFC C;  1CSW A;  4WQ9 A;  1H9X A;  3ORV A;  2XTS B;  4KMG A;  1CRH A;  4AAO A;  1IQC A;  1LS9 A;  1DW3 A;  1E29 A;  1CSV A;  1CIF A;  1ETP A;  4FB1 A;  4L3G A;  2BPB B;  5B66 V;  3SLE A;  1HZV A;  5CID B;  1CYC A;  2QJY B;  3MK7 B;  5DJQ C;  2OZ1 A;  1H1O A;  1RZ6 A;  3BCC D;  3PXS A;  4EIC A;  1FI3 A;  3C2C A;  3OCD B;  1EB7 A;  3GW6 A;  2ZXY A;  1QKS A;  5GTI V;  2RMZ A;  2N9Y B;  1CC5 A;  2FYU D;  1RZ5 A;  1H9Y A;  2GC4 D;  3O20 A;  5CYT R;  4IL6 V;  3JBT B;  2MHM A;  4UB6 V;  1ZZH A;  1NNO A;  4FAN A;  2B12 B;  1I5T A;  2BCN B;  5DFS A;  1M70 A;  1C2N A;  1IRV A;  1A8C A;  4EIE A;  2Y0D A;  1N50 A;  1CSX A;  2N9I A;  1NIR A;  4O1Q A;  3RMZ A;  4LJI A;  1F1C A;  5KLV D;  2YIU B;  2QG4 A;  5AUR A;  2C9X B;  1P84 D;  2C1U A;  2I8F A;  1M6Z A;  2O3J A;  3O1Y A;  2QJP B;  1GIW A;  1H33 A;  4RSZ A;  2RN0 A;  1IZL 0;  5CIE B;  3VYM A;  3PHL A;  5C0Z A;  1KX2 A;  2N9J A;  3HQ9 A;  2MTA C;  1LMS A;  3KZI V;  1CTJ A;  3PTZ A;  5DF5 A;  4XXL A;  4U3F D;  4WQB A;  1CIH A;  1J3S A;  3WU2 V;  5CIC B;  1C7M A;  2CE0 A;  5E79 V;  1DW0 A;  2IBZ D;  1CRG A;  2YQB A;  4DY9 A;  3PRJ A;  1HH7 A;  2FWL A;  1KX7 A;  451C A;  2GB8 B;  1LFM A;  4AX3 A;  1KYO D;  2JWA A;  2AIU A;  3X39 A;  1DVV A;  1L0L D;  4JCG A;  1CED A;  2V08 A;  4UB8 V;  2KS1 A;  1KYO W;  1KB0 A;  4AAL A;  1CCH A;  3NWV A;  1OCD A;  5H2F V;  2Y0E A;  1C75 A;  2CA4 B;  1CYI A;  4FA4 A;  3ITK A;  2Q3E A;  3FWL A;  1C2R A;  3ZOX A;  1KB9 D;  4XYD B;  3DR0 A;  4WQ7 A;  2A06 D;  1HJ5 A;  3CX5 D;  2N18 C;  2K9J B;  3RN0 A;  4H0J A;  1AOF A;  4FAV A;  5KLI B;  4MU8 A;  1ZRT D;  2HV4 A;  4PWA A;  3NBS A;  1VYD A;  1HZU A;  4PW9 B;  1H31 B;  3SJL A;  1QL3 A;  2KNC B;  2BGV X;  1QL4 A;  1N15 A;  1GDV A;  1CXC A;  1N90 A;  1AKK A;  1DIQ C;  3HQ6 A;  2GC7 D;  3HQ8 A;  4PJ0 V;  1NML A;  3SXT A;  4WQE A;  1M60 A;  1YIQ A;  1H32 B;  3H1H D;  2FRC A;  1W5C T;  3WC8 A;  2DGE A;  1I6E A;  2PCC B;  2CE1 A;  3A0B V;  1COT A;  1YIC A;  1BE3 D;  3SWS A;  2YK3 A;  3WUI A;  1GKS A;  2B0Z B;  2Y0C A;  1EZV D;  1NTK D;  1HJ4 A;  3WFD C;  4WQ8 A;  1DII C;  5IY5 1;  1DW1 A;  3PLN A;  3A9F A;  3M97 X;  3TDK A;  1I54 A;  1BGY D;  1PP9 D;  3PXT A;  4EDF A;  1I55 A;  2FYN B;  3GG2 A;  1A56 A;  2N3B A;  3ZOY A;  3VNW A;  2ZON G;  2JTI B;  4AAN A;  5KKZ B;  2N18 B;  2AXT V;  1MG3 D;  3CX5 W;  1CIG A;  1YEB A;  2LIT A;  3OCD A;  1YCC A;  2BLF B;  5CIF B;  4PD4 D;  1SQQ D;  1I8O A;  1JDL A;  1PPJ D;  3L4O A;  2AI5 A;  2L4D A;  1LC1 A;  4H0K A;  1QYZ A;  2GIW A;  1CYJ A;  3ZCF A;  2YCC A;  1I6D A;  3ZBM A;  1KV9 A;  4Y5R A;  3MK7 C;  5DJQ B;  1GU2 A;  5TJH A;  2ORL A;  3O0R C;  1BL9 A;  1MG2 D;  4D6T D;  4YE1 A;  3DMI A;  1YFC A;  1K3G A;  2C1V A;  4V2K A;  3CXH W;  1F1F A;  3WFE C;  2L91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...