4D6TD

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
240
structure length
240
Chain Sequence
DLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
total genus 67
structure length 240
sequence length 240
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4d6tD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4d6tD02
4DY9A 3ZCFA 5DFSA 1KB9D 2D0SA 2CA4B 1FI7A 2ZBOA 3VYMA 4FA5A 1LMSA 4EIEA 1CTJA 1CSVA 4RJTA 2D0WA 1CRJA 3CP5A 1HZVA 1NMLA 1CSXA 2FYNB 3H1JD 4KMGA 1CYJA 2AI5A 1GJQA 1P84D 3H1HD 1DW0A 5CIEB 3RLMA 4H0JA 2V07A 1E29A 1H31A 1SQXD 1L0ND 3PTZA 1QKSA 1KYOD 2L4DA 1HJ5A 2ZOOA 3O5CA 2QJPB 2N18C 3ZIYA 4WQ7A 1YTCA 2O3JA 2CXBA 1HRCA 1DVVA 1F1CA 1M70A 4U3FD 1CCHA 1CYIA 1DW1A 1KX7A 3CXHD 1BCCD 1FI9A 2LIRA 2N18B 1CRIA 3H1LD 3SLEA 2JTIB 1AYGA 2BPBB 3H1ID 4PD4D 3L4MA 1NTMD 5H2FV 1C75A 3L70D 5TISV 1N90A 1S5LV 3GW6A 1CTYA 3HQ7A 1NNOA 1JDLA 1I6EA 4J20A 5CYTR 1B7VA 2BCCD 4FANA 3ITKA 2N3BA 1NIRA 4AAMA 3NBTA 3A9FA 1MG2D 5C0ZA 1U75B 1YFCA 2FWLA 2BCNB 2IBZD 1CXAA 1DIQC 3SWSA 1LFMA 1CIHA 2JWAA 1CRHA 1C7MA 3PXTA 3H1KD 1YEAA 5CIGB 155CA 1QYZA 1H31B 3ZOXA 1CYCA 2FYUD 1M60A 2JQRA 2Y0EA 1YEBA 3RN0A 1CHHA 1I6DA 5CIHB 3WUIA 3VRDA 5B5EV 1BE3D 1HH7A 5GTIV 3TGUD 1NMIA 1K3GA 2ORLA 1QL3A 4K3IA 1SQQD 3ZOOA 1U74B 1C2NA 1RZ6A 351CA 2AXTV 4A7PA 2YIUB 2DVHA 4FAVA 1QN2A 2N9YB 1I8OA 3CYTI 3HQ8A 3A0HV 4AANA 3C2CA 2Y0DA 1SQBD 1WEJF 5KAIV 451CA 4AAOA 2B10B 3KHUA 3CX5W 4PWAA 1IO3A 3X39A 3DP5A 3PXWA 1CRYA 2QJKB 1FCDC 4JCGA 1LC2A 5KLIB 4WQ8A 3WFBC 1FI3A 3L4OA 1DVHA 4PJ0V 1C6SA 1H9YA 1MZ4A 1SQPD 1YCCA 2GC7D 5EXQA 2KS1A 1NU1D 2KNCB 4WQAA 2C9XB 5E79V 3PRJA 3SJLA 1CHIA 2V08A 3L72D 1COTA 4L3GA 2OZ1A 2C1DA 2AIUA 1CHJA 4WQDA 4NFGB 1FJ0A 3DMIA 1KIBA 1HJ3A 1W2LA 4WQBA 4IL6V 1IRWA 2EXVA 2XTSB 5GTHV 2YQBA 5AURA 3NWVA 1H1OA 4FB1A 1A56A 2BLFB 1I54A 3WC8A 2C1VA 3ZOYA 4GEDB 4MU8A 2I8FA 5DF5A 3ZOWA 2ZXYA 5IY51 3GG2A 1EZVD 1FOCA 4PW9B 5CICB 1ETPA 1DT1A 2DGEA 1J3SA 5CIDB 1CRGA 3OA8A 1DW2A 2B0ZB 2B12B 1ZRTD 5DJQC 1IQCA 3CU4A 4FA1A 1KB0A 1E2RA 3VNWA 1AKKA 2GIWA 1IZL0 1SQVD 1I8PA 2K9JB 1NTKD 1KV9A 3NBSA 2ZZS1 3O1YA 3FWLA 3PXSA 4AX3A 3CX5D 4H0KA 4UB8V 3RMZA 5CIFB 5DJQB 4LJIA 2QG4A 3OCDA 1GIWA 4EIFA 1YICA 1YIQA 2GB8B 2LITA 1A2SA 4FA9A 1GDVA 5B66V 3PLNA 2BH5X 3TDKA 1HCMA 2OZ1B 2C1DB 3HQ9A 1MG3D 2PCCB 5TJHA 1EB7A 2CA3B 5KLVD 3L75D 1PPJD 4WQCA 1AOQA 2BH4X 2N9JA 1RZ5A 2CE0A 1DIIC 1GKSA 3RN1A 1LC1A 2Y0CA 1H33A 1BL9A 1HROA 2ZONG 3M97X 2PCBB 3O20A 3A0BV 4EIDA 1M6ZA 4D6TD 1CIEA 1L0LD 3WFDC 2N9IA 4Q5PA 1PP9D 2RMZA 3TF5A 3L74D 2MTAC 2A06D 1CO6A 1N9CA 1R0QA 1N50A 3SVWA 1I55A 4P4QB 4QAOA 1CXCA 3OA8B 3HQ6A 1FHBA 2BGVX 1VYDA 1H32A 1CNOA 1CSWA 1CSUA 3L71D 3BCCD 1L9BC 1HZUA 1CTZA 4AALA 3WU2V 4O1WA 4Y5RA 1I5TA 3TYIA 1F1FA 2HV4A 3VMAA 5B6QA 4L3HA 4XYDB 1IRVA 1WVEC 1BGYD 1CORA 1QL4A 5KKZB 3MK7C 2YCCA 3OCDB 1C52A 1E8EA 4GYDA 1L9JC 5C9MA 1GQ1A 2C2CA 1W5CT 1DW3A 1CCRA 3CWBD 1AOFA 1KX2A 4XXLA 1CIGA 1A8CA 2VHDA 1YNRA 3MK7B 1GU2A 5CIBB 1CRCA 3JBTB 3ZBMA 2PACA 1C6OA 1KYOW 1OCDA 2C1UA 1N15A 2B4ZA 1S6VB 1NTZD 1RAQA 1H33B 2B11B 4L1QA 4YE1A 3WFCC 2MHMA 3L73D 3KZIV 3WFEC 2QJYB 2C8SA 1RAPA 1HJ4A 2Q3EA 3DR0A 2FRCA 2YK3A 2RN0A 1C2RA 3CXHW 1C6RA 2N3YA 3SXTA 1CC5A 5KAFV 1H9XA 1CIFA 3PH2B 4WQEA 1K3HA 1ZZHA 3O0RC 1CEDA 4N0KA 4UB6V 4EDFA 4RSZA 4O1QA 2L91A 4FA4A 1OAEA 1H32B 4EICA 4V2KA 3PHLA 4WQ9A 2GC4D 2CE1A 1LS9A 3ORVA
chains in the Genus database with same CATH superfamily
3KDPB 4RESB 1FI7A 2ZBOA 4IFFA 1H0TA 3L37A 1CTJA 1CSVA 1R5LA 1CRJA 1IO4A 1KV4A 4JPZB 2C9NY 1LJ2A 3LW5H 2A06E 1S3JA 2HG5D 1GW4A 3Q5PA 1N73C 1OX3A 2IZ0A 1BE3J 4KMGA 1MZ9A 2QJPC 3M0DC 2KSJA 1GJQA 3AE9C 1P84D 3BRVB 1KYOE 1PZQA 3M9BA 3LW5J 1NO4A 3AE6C 3ABVC 1NWQA 2K37A 4H44B 3O5CA 4QMAA 1CW5A 3ZIYA 1SQXG 1FDIA 1L0NG 5GTIE 1OVUA 5AW0B 1ZV8A 1YTCA 2WPSA 1L4AD 2AXTE 3AE3C 1CCHA 2C0XA 3OAKA 1A02F 1KILC 1KQFB 1JTHA 1M1JC 1FI9A 3CI9A 5AW9B 2JTIB 1AYGA 2BPBB 4EYYQ 1FJPA 5C39A 1CI6B 2Z4EA 1NTMD 1VPCA 2WSCH 3L70D 1HGZA 1BSHA 4PJ0E 1SQBK 3A7OA 1NNOA 1DD4A 1S4XA 5E79E 4J20A 2KNCA 1H0TB 2WSCJ 3RBXA 1SQXK 3ITKA 1L0NK 1EXIA 3HUSC 2N3BA 2IBZE 3A9FA 1SQPK 1FDOA 4LGDE 2Q6QA 3VOPA 4B86A 5GTHE 4PV1B 4IFDK 3WU2H 1CIHA 5AVWB 3MHVA 1SP4A 3CX5H 3H1KD 3A5TA 5CIGB 155CA 1M1JA 1M60A 1M1KQ 2JR8A 3K5BA 3I5CA 2M3BA 4N78D 1HH7A 4MN4C 4OGQC 5GTIV 1LT9A 2ORLA 1TU3F 1U74B 1C2NA 1BE3G 1LP1A 3H1JE 1X79B 2AXTV 2AEJA 2KIKA 1KQLA 1JTHB 5CJ0A 1VQNP 1QL2A 1LTIC 1S1CX 2Y0DA 1SQBD 1WEJF 1KYOI 1K73Q 3CCRP 3I56P 5APTA 4AAOA 4HH2A 2B89A 3KHUA 4PWAA 3HUSA 3DP5A 4GOEA 5KLVJ 2QEXP 3MD0A 3P8MC 2JWDA 1CSBA 1PGOA 3H32A 4O9BA 3RK3E 4PJ0V 2FY8A 1SQPD 2GC7D 5EXQA 2KS1A 4U3FE 2KNCB 2YNYA 5E79V 3PRJA 2IFNA 3L72D 4D6TJ 2C1DA 1L0LJ 1FJKA 4WQDA 3HRNA 4PD4E 2JO1A 3TSIA 2IYOA 1BCCG 1W2LA 2EXVA 2XTSB 3A0BE 5GTHV 5AURA 1MUUA 4FB1A 2BLFB 3SSUA 2C1VA 1N7SC 1HTLC 3W67A 2Q7CA 1KILB 4JF7A 4R4LA 1M1JB 2BCCE 5DF5A 2OYIC 2ZXYA 3SFEC 3GG2A 5CICB 4I2LC 2CK3H 3WUVA 1BGYJ 1MFTA 2DGEA 2AXCA 1LT9B 5CIDB 1NH4A 2IBZI 2LXBA 1LP1B 4XFJA 3FWNA 1ZRTD 5DJQC 1IQCA 1HGVA 2B88A 3CU4A 4FA1A 1NU1K 3CWBJ 2N1TD 2YMKA 1ZR4A 2W6JH 2MKVA 4ZNCA 1IZL0 1T3JA 1VQ8P 2A45I 2ZZS1 3MP7B 3PXSA 3HUSB 2H88C 4H0LD 5CIFB 2WSEH 4LJIA 4EIFA 3H32B 1YIQA 2GB8B 2Z5HA 4ZMDA 1SQQE 2KS1B 3L75E 1GDVA 1DH3A 1GDTA 3QWOC 2WSEJ 2C1DB 2WSFH 2PCCB 5AW1B 5TJHA 1PPJD 4WQCA 3JSVC 2BH4X 2N9JA 2OYIA 2P67A 5KLVG 2WITA 3KZIE 5TISH 2FYNC 1BL9A 4OGQB 2ZONG 2WSFJ 1GD2E 2QA4P 1AFOA 3A0BV 1PFIA 1NTZK 3CC2P 4Y99C 4IL6X 4D6TG 1L0LG 1JY2O 5B66E 1RF0C 3N4XA 2A06D 1R0QA 3BCCE 2HFED 1P84H 1T8ZA 3AEGC 5AVTB 2BGVX 1H32A 3L71D 1CSUA 1YJ9P 1ZP0C 2ZXEB 4LLHA 2OTLP 1GK4A 1EQ7A 3VMAA 2I1KA 1EZVE 1Q2NA 5AW4B 1E8EA 2E42A 1L2PA 3G4SP 1DW3A 4DJGA 1VQPP 2O1JA 2B9BA 1OIPA 1RHZB 1L0LK 4C46A 1OFCX 2P2UA 2R5DA 1J1EC 3MK7B 1RF1A 1CRCA 1IZNB 1YTZT 1FDMA 1NTKE 2C1UA 2OYIB 3HD7D 1YI2P 1NTZD 1RF0A 1RAQA 2B11B 4L1QA 3WFCC 1IFNA 4WVZA 3KZIV 2D2CB 1NTMJ 2C8SA 3HE4A 4RO0A 4YPCA 3L70J 3VYIA 2E74C 2FRCA 2RN0A 1VQ4P 1SFCC 3RK2C 2RKLA 5KJ7D 3CLQA 4GDOA 1ZZHA 5H2FE 2FXOA 4RSZA 2I8DA 3D71A 2AEMA 1H32B 1X8YA 1KB9E 4TLFA 4EICA 1J1DC 1LS9A 1X22A 3V2QA 1OVVA 1QEXA 2Q5UA 2DW3A 4FA5A 1L4AA 1LMSA 3SWKA 3H1KJ 1PP9E 1M57D 4GOFA 3Q1MA 1K04A 1RQVA 1NMLA 1CSXA 1R5SA 2J59M 1GL2D 2Z5IA 4H44C 2FYNB 3H1JD 2YKOA 3EWKA 3T97A 2AI5A 5AVXB 5CIEB 3RLMA 3MUDC 4H0JA 3L74G 1VQ5P 1RF1B 1SFCA 4Y99B 1K8AQ 1VF5D 4IFMA 1QKSA 3P32A 2P10A 2ZOOA 1SQBJ 3AE7C 1DEEG 2OYHA 2CXBA 3HE4B 1EZVI 1HRCA 3RK3D 1NAYA 3RL0g 1AV1A 1Y9BA 1F1CA 1M70A 2HPCA 1YQ4C 4U3FD 2K1AA 2Y9ZA 1RE4C 3D6ZA 1SQPJ 3E1IA 2IYPA 1CRIA 2W27A 3H1LD 3RL0D 1OW6A 4DZOA 3L72J 3H1ID 4PD4D 2KXPB 5H2FV 1A02J 3VMZA 1NTMG 4JYCA 3GHGC 3GW6A 3HQ7A 5EFWB 3L70G 4OWFA 1I6EA 2I1JA 3GF7A 3WMM0 5CYTR 1B7VA 4NPDA 2BCCD 3AEBC 1L4AB 4I6MC 3AE1C 1RY3A 4YTPC 5AW2B 5C0ZA 2YO3A 1YFCA 2FWLA 2IX7C 2BCNB 3KXDA 3T97B 5CCHD 3SWSA 1QGKB 1KB9I 1C7MA 1SFCB 3B5NC 5L8RJ 1NTMK 2NPSC 3MIWA 3VRDA 5B5EV 2IFMA 3TGUD 2LKMA 3II6A 3AEAC 1NMIA 1QL3A 1SQQD 3ZOOA 1FE6A 4H0LC 4W7YA 351CA 2HPCB 1OZHA 4A7PA 2DVHA 4FAVA 3GHGA 2C0WA 1J1DB 2CPBA 1M7LA 4W80A 1LTGC 2PGDA 2K9JA 1S9KE 2WZ7A 1KILE 3V4QA 4UB8E 1IO3A 1SQBG 3PXWA 1Q81Q 2QJKB 1JNMA 3H1HG 4WQ8A 3SFDC 3KQGA 4ZKUA 2M0BA 1VQ7P 1MZ4A 2PRRA 1LTTC 3CXHI 4NPEA 4N6JA 1BCCE 3FXDA 2V08A 1KN7A 4L3GA 1S5LX 3O6QA 1SQPG 2Q9IA 5CCGD 2H43A 3B5NA 3L72G 1YIJP 4NFGB 4UB6H 2N1TA 2O01H 2NPSA 1NU1J 1IJDB 5CBNA 2Q3IA 1LT9C 1H1OA 3HE5A 1A56A 2LXCB 1VQMP 3ZOYA 3L71J 2O01J 4MU8A 5AVUB 2H7HA 4H13D 3ZOWA 5IY51 5AVQB 1EZVD 1G1IA 4PW9B 4RKUJ 3D70A 1J3SA 1LTAC 2KYVA 3S4RA 4YXWH 1ZN5A 1YJWP 3OA8A 3WU2E 2E75D 2QIWA 3GHGB 2QE7H 2ZFCA 3C8VA 4WY4C 1KB0A 2V4HA 2FFDA 1E2RA 2KP8A 3CX5E 2ZYGA 2K9JB 3W68A 1NTKD 2FYUE 1FZGA 3VMXA 1QL1A 4UB8V 4LC1A 5E79H 1GIWA 3BASA 1NAFA 1NTZJ 3SWFA 2J5UA 1KD1Q 1PV3A 4R4MA 4FA9A 5KLVE 3P7KA 1W2BO 3JCUH 1NGMB 4GIFA 2ZXXA 2E76D 3O6QB 1R8EA 3ZDMA 3B5NB 4EI2A 1XTGB 1AOQA 5GTHH 1T2KD 1RZ5A 1S2EA 1GKSA 2N1TB 3RN1A 1PPJG 1H33A 2OTJP 4D6TE 2NPSB 1BDCA 1S5LH 4WWIA 2WPRA 1S72P 3M97X 1EDKA 2PCBB 2IDBA 3HE5B 4H0LB 3O20A 4EIDA 3AE8C 1M6ZA 4L75A 1KQGB 1FC2C 1XTCC 4WY4A 3KPEA 4Y28J 1NKZB 3SWYA 1H89A 1IFMA 1PP9D 2RMZA 2WSSH 2MTAC 1CO6A 1N9CA 1N50A 5APXA 1URQD 1NU1G 2A06G 3OA8B 4NPFX 1VYDA 1CNOA 3IR9A 3HD7A 5AW7B 2E5TA 4AALA 3WU2V 3MTUE 3H1JJ 1GL2C 4O1WA 3S1KA 2J58A 3L71G 1SVFA 1F1FA 2KSEA 1HH0A 1JY2P 2P58A 3VMYA 3MK7C 4GYDA 5C9MA 1GQ1A 2AEFA 2W90A 1GTWA 1W5CT 1CCRA 2SPZA 1AOFA 3P8CE 1KX2A 2H8PD 5K5GB 4XXLA 1CIGA 4PV1D 2ZT9D 4W7ZA 2D2CC 2KK7A 4PD4H 3A0HH 2W8ZA 5AVVB 4U3FJ 2K3RA 1GU2A 4DCKA 1H8AA 1SQVE 2QVAA 2PACA 1EDIA 1KYOW 3CX5I 3N7NA 2B4ZA 3H1LJ 3E7KA 1H33B 4AYCA 3H1IJ 3L73D 3WFEC 1NTZG 2R3CA 3DR0A 3G3ZA 1NKNA 4I7ZC 3MGNA 4WY4B 2N3YA 1GL2A 1GZLA 1CC5A 1H9XA 1DIPA 4BWNA 3L35A 3O0RC 1CEDA 2BCCJ 1JOCA 4EOTA 4EDFA 4O1QA 5TISE 1OAEA 3M91A 3LIEA 1JMBA 3FX0A 4V2KA 3V6IA 3HD7B 2YIUC 2OGUA 1VQLP 1Y8AA 3U1AA 4DY9A 3ZCFA 5APSA 3V2RA 5DFSA 1USEA 3AEDC 4GODA 2E5YA 1AJYA 4EIEA 5AW8B 1NOHA 4RJTA 3CC7P 3D0WA 1FAVA 3CP5A 1RF1C 1HZVA 3L74E 2GM4A 4KJMA 1KTMA 1RQUA 3TGUJ 1CYJA 1SQQJ 1LWUC 3TK1A 3TNUA 1X9VA 3KZIH 1E29A 1H31A 1WT6A 1S9KD 1KILD 1KYOD 2L4DA 1HJ5A 2YXRB 4BRYA 1EXJA 3D6YA 3Q2YA 3CCJP 2QM7A 5B66H 3CMEP 1BGYG 1KX7A 1BCCD 1LTJA 3G71P 2LIRA 1GL2B 1YHQP 2QSIA 2N18B 4U3FG 5KAIE 1JY2N 3SLEA 2FXPA 5CCHA 2ZYAA 1ZR2A 3H1LG 3CWBG 1L4AC 1W2EA 5KTBA 1C75A 3A2AA 2N9BA 3H1IG 1VF5B 3AE2C 5TISV 1Q90D 4JBZA 1OXZA 1GK6A 1MV8A 1CTYA 2WT7A 3AE4C 1AA0A 1JDLA 2PFXA 2KLVA 2POHA 3CL3D 2KOGA 1LWUA 3RK3B 3JC22 4XA4A 2YMYA 1RH5B 1JEKA 1YQ3C 5AW5B 3OA7A 3TYYA 3BATA 5CHXA 2V7QH 3CCSP 1FU1A 1JCCA 1U75B 4U7JA 2ZVNB 4IL6E 2IBZD 4ASVA 2KLUA 2OYHC 1DIQC 1GMJA 4OGQD 4L76A 4HYTB 4I7ZB 2V7QJ 3TNUB 2C9LY 3CCQP 1H31B 4N78E 1CYCA 2FYUD 1JY3O 2Y0EA 1I6DA 3RBZA 4BRYB 4N3YB 1NTKJ 1CZQA 2NZ2A 5CCGA 3G9RA 2WWWA 1LTSC 4K3IA 1RZ6A 1P84I 1SQBE 3TGUG 2YIUB 2QJKC 5H2FH 1LTJB 3H1HE 1SQQG 1ZMEC 2G8YA 1I8OA 3HQ8A 4K3AA 1X0TA 5KAIV 1SQXE 1L0NE 2M3EA 2R32A 1SQPE 1CRYA 1YTZI 1FZEA 1ZW0A 5KLIB 2PP6A 3L72E 3U59A 2YO2A 1DVHA 1C6SA 2WT7B 5B5EE 1YCCA 3H25A 4WQAA 3V4WA 3CXHE 1LWUB 1FZCC 5KAFH 1COTA 2OZ1A 2AIUA 1G1JA 3Q5RA 3CCMP 1NYHA 5APYA 1N7SD 5KKZC 1YITP 3DMIA 1PP9J 1LNQA 1JO5A 1KIBA 1T6AA 4KHXA 4IL6V 1IRWA 1SQQK 1WRGA 2FKWB 1FS0E 4KT0J 4HJGH 3IN6A 1ZOYC 4GEDB 1QVFO 3B8EB 2O01N 1ZRTE 1FOSE 1DT1A 2QJYC 1CRGA 2KZJA 2R44A 3E1RA 1DW2A 1IK9A 3P8CD 3PH0A 1NHLA 1N8RQ 1HBWA 3VNWA 1AKKA 1E79H 1JUNA 1SQVD 1I8PA 1NJIQ 1FZCA 2H89C 1KV9A 1AVYA 4I1LA 3FWLA 2ZJSE 4AX3A 3RMZA 1NTKG 3OCDA 1BE3E 4H13B 5AVYB 2JJLA 3BVHA 3F89A 2O1KA 3PJSK 2HLOA 2LITA 2N1TC 3H1KG 3L73J 3NMDA 2OYHB 4C7NA 2BH5X 3TDKA 1KFMA 1CI6A 2KZIA 1E5WA 1URQA 2YKQA 2OZ1B 1U57A 3HQ9A 2IPPA 1EB7A 2WMMA 2E75B 3L75D 2R3SA 2WPVB 5AW6B 1LC1A 2Y0CA 4M3LA 3IAOA 3AECC 5AVSB 2QRXA 1DEBA 2HYNA 4JQ0D 1CIEA 1NVOA 3AEFC 3WFDC 1NU1E 2N9IA 3CCLP 1UIXA 2FFDC 5APUA 3EQ2A 1NTKK 3M0AA 5APVA 2FYZA 1MFZA 1GU5A 3L74D 3L71E 4UB6E 2E76B 1PP9G 1CXCA 2Y9YA 1JCDA 2BEZF 5AVZB 5DJUB 1AVOA 3BCCD 1L9BC 1HZUA 5M1BA 1CTZA 1FBMA 1BSNA 1KYOH 4UB8H 5BU5A 1I5TA 2HV4A 1FZCB 2Q1KA 2ITAA 5B6QA 4L3HA 4XYDB 1IRVA 2PAJA 3CPWO 1CORA 2WPQA 1QL4A 5KKZB 3NTNA 1EDLA 3OCDB 1C52A 5GTIH 1BDDA 2C2CA 3CCEP 2AXTH 4C7NB 1H88A 3AE5C 1IK7A 1GW3A 1URQB 2VHDA 1NTZE 2LR2A 2E74D 5CIBB 3JBTB 4ASWA 1SFCD 1BCCJ 4DOJA 1C6OA 3RK2D 2G3AA 1OMIA 1Q82Q 3GMAA 1S6VB 1N73A 1ZXGA 4YE1A 3M0DA 2WTYA 1U7JA 5APWA 2QJYB 1AQTA 1RAPA 1HJ4A 4PJ0H 1GU4A 3GF3A 3L73G 2YK3A 2OARA 1C2RA 3CXHW 1UIIA 1C6RA 1SS1A 3JCUE 1FZFA 3HD7C 1N86A 1FOSF 4JYBA 3Q3DA 4WQEA 2ZT9B 4UB6V 2L5GB 4FA4A 1S5LE 4IOIH 1KILA 3HTKA 2WVRA 4WQ9A 3PHLA 2CE1A 5KJ7C 1MKMA 3ORVA 1VL2A 2A45H 4H44D 1L0LE 1KB9D 2D0SA 2CA4B 3VYMA 2HR3A 1J2JB 2B87A 2BASA 2D0WA 1LT1A 2QM8A 2FYUJ 1YBKA 4EIJA 3B4SA 1W5CE 3M06A 2JDIH 3H1HD 5BVZA 1DW0A 4BXLA 2V07A 3S9OA 1QVGO 3A3YB 1SQXD 1L0ND 3PTZA 2FFDB 1BGYE 1N73B 3VP8A 2QJPB 1IFJA 2N18C 4WQ7A 4L74A 3G6EP 2O3JA 2YKPA 1DVVA 5CMZA 2VRSA 3V2PA 4C7RA 3H1LE 3CWBE 1CYIA 1DW1A 1VF5C 3V2NA 3H1IE 4OH8B 5KJ7A 3CXHD 3A0HE 3I55P 3FGAD 2OYOA 1M8OB 3L4MA 3RK3C 2FXMA 4HB1A 3HTKB 1N90A 3C1LA 2M5AA 1S5LV 3A0BH 3B71A 1OW7A 2P7JA 1LTBC 3RL0C 1M90Q 4FANA 2B87B 1HJ0A 2M8RA 2W83C 1HUCA 5CJ4A 1NIRA 4AAMA 3NBTA 3B5ND 1T3UA 1MG2D 3NFQA 3CMAP 3V5BA 2E43A 2NPSD 3CD6P 1CXAA 2ZAEB 1LFMA 4GT1A 2JWAA 4YXDC 2IBZG 1CRHA 3PXTA 1YEAA 1EC5A 1QYZA 3ZOXA 4ZKPA 3TGUE 2XNDH 2JQRA 1LTJC 2UWJE 1YEBA 3RN0A 4AQRD 1CHHA 5CIHB 1SQVJ 1KC8Q 3H6PA 3WUIA 2FYUG 1PGJA 5CCHC 1BE3D 2A45G 1VQKP 1K3GA 3C9IA 1N7SA 3VP9A 1P84E 1QN2A 2N9YB 5KLIC 1QLED 1Y47A 1RE3C 2CPSA 1WMKA 3CYTI 3Q5SA 3A0HV 2OQQA 4CPGA 4AANA 3C2CA 1JY3P 451CA 2B10B 1VQOP 3CX5W 3MZWB 3H1JG 3X39A 3LIDA 3L75J 1FCDC 4JCGA 1LC2A 2M5AB 3WFBC 1FI3A 3L4OA 1H9YA 2KI7B 3NXSA 1FZBA 1IC2A 1NU1D 5APQA 2R5BA 2C9XB 4OVNF 3SJLA 1CHIA 3OJAB 2FYUK 4AUWA 3O8ZA 3R2PA 1CHJA 4PD4I 2JP3A 2WQYC 2GA1A 1FJ0A 3CCVP 1N2DC 1NTME 1LGHB 3KYQA 2FBWC 5CBOA 2W6BA 3L74J 1HJ3A 3L70E 4WQBA 2JEEA 1Q86Q 1JB0J 2XNXA 5AVRB 5KLVK 2YQBA 3WUTA 3NWVA 5CCGC 1I54A 3WC8A 3BCCJ 1G2CA 4WY4D 1OW8A 3FXEA 2I8FA 1RE3A 1PL5A 1FOCA 3L4FA 4L73A 1EDJA 1U7MA 1ETPA 2RH0A 1KORA 3PP5A 5BU8B 3VN0A 1N7SB 1SLQA 5KAIH 2BCCG 2W6AA 2B0ZB 2KB7P 2B12B 1IFPA 4H13C 3RL0B 2GIWA 3EFGA 3H1KE 1K9MQ 1D7MA 1K05A 1HJBA 3NBSA 2K88A 3O1YA 1Z56A 3GLMA 1JMMA 1SQVG 3CX5D 4H0KA 5DJQB 2QG4A 2OTKE 2E75C 1YJNP 1FZAA 1YICA 1IFIA 1Q7YQ 4TT3H 3OW2O 2ZYDA 1OWAA 1OVRA 1A2SA 3M9QA 5DJTB 5B66V 3PLNA 2K9YA 1KZUB 1HCMA 2XZRA 1MG3D 4IL6H 2CA3B 5KLVD 3CC4P 1KQSO 2CE0A 1DIIC 2GUVA 1KMIZ 3L75G 3M9HA 1HWTC 4K35A 1HROA 1KB9H 3EFFK 5AW3B 2E76C 1PIXA 2HODA 4D6TD 1L0LD 2KUBA 3U1CA 1G2CB 4Q5PA 5KAFE 3R4YA 1T2KC 1SQVK 1USDA 1JY3N 1IFDA 1PGQA 3TF5A 1HF9A 1DX7A 3BRTB 3SVWA 4DT0A 1I55A 4P4QB 4QAOA 3RGUA 2XDJA 3HQ6A 1FHBA 3L36A 2BEQD 1CSWA 1VQ6P 1N7LA 4Z1MH 4Y5RA 3BCCG 3TYIA 4WB4A 2NRGA 3H1HJ 2MJZA 3AEEC 2D2CD 1WVEC 1BGYD 1URQC 5B5EH 2YCCA 1SQXJ 1L0NJ 1L9JC 1HVVA 3CXHH 3IF4A 4GKGA 3CWBD 4XE5B 2IZ1A 4WBAA 1A8CA 2GUSA 1EZVG 1YNRA 2XKMA 2ZVOB 3ZBMA 3L73E 1AQ5A 1OCDA 1N15A 1DD3A 2MHMA 4PV1C 2ZT9C 2JKVA 3QH9A 2Q3EA 1J1EB 3MUDA 2HODB 3UIAA 3VTPC 3CCUP 2XU6A 2P1JA 3SXTA 1VQ9P 1VDFA 5KAFV 1YYCA 1CIFA 3PH2B 1K3HA 1QX8A 1PPJE 1M56D 4N0KA 3WUUA 1ZLLA 2E74B 1JM0A 2L91A 1KFNA 4HKZH 3IFMA 3RK2B 1PGPA 2GC4D 2YXQB 3USSA 1RE4A 2XV5A 3F5HA
chains in the Genus database with same CATH topology
4DY9A 3ZCFA 5DFSA 1KB9D 2D0SA 2CA4B 1FI7A 2ZBOA 3VYMA 4FA5A 1LMSA 4EIEA 1CTJA 1CSVA 4RJTA 2D0WA 1CRJA 3CP5A 1HZVA 1NMLA 1CSXA 2FYNB 3H1JD 4KMGA 1CYJA 2AI5A 1GJQA 1P84D 3H1HD 1DW0A 5CIEB 3RLMA 4H0JA 2V07A 1E29A 1H31A 1SQXD 1L0ND 3PTZA 1QKSA 1KYOD 2L4DA 1HJ5A 2ZOOA 3O5CA 2QJPB 2N18C 3ZIYA 4WQ7A 1YTCA 2O3JA 2CXBA 1HRCA 1DVVA 1F1CA 1M70A 4U3FD 1CCHA 1CYIA 1DW1A 1KX7A 3CXHD 1BCCD 1FI9A 2LIRA 2N18B 1CRIA 3H1LD 3SLEA 2JTIB 1AYGA 2BPBB 3H1ID 4PD4D 3L4MA 1NTMD 5H2FV 1C75A 3L70D 5TISV 1N90A 1S5LV 3GW6A 1CTYA 3HQ7A 1NNOA 1JDLA 1I6EA 4J20A 5CYTR 1B7VA 2BCCD 4FANA 3ITKA 2N3BA 1NIRA 4AAMA 3NBTA 3A9FA 1MG2D 5C0ZA 1U75B 1YFCA 2FWLA 2BCNB 2IBZD 1CXAA 1DIQC 3SWSA 1LFMA 1CIHA 2JWAA 1CRHA 1C7MA 3PXTA 3H1KD 1YEAA 5CIGB 155CA 1QYZA 1H31B 3ZOXA 1CYCA 2FYUD 1M60A 2JQRA 2Y0EA 1YEBA 3RN0A 1CHHA 1I6DA 5CIHB 3WUIA 3VRDA 5B5EV 1BE3D 1HH7A 5GTIV 3TGUD 1NMIA 1K3GA 2ORLA 1QL3A 4K3IA 1SQQD 3ZOOA 1U74B 1C2NA 1RZ6A 351CA 2AXTV 4A7PA 2YIUB 2DVHA 4FAVA 1QN2A 2N9YB 1I8OA 3CYTI 3HQ8A 3A0HV 4AANA 3C2CA 2Y0DA 1SQBD 1WEJF 5KAIV 451CA 4AAOA 2B10B 3KHUA 3CX5W 4PWAA 1IO3A 3X39A 3DP5A 3PXWA 1CRYA 2QJKB 1FCDC 4JCGA 1LC2A 5KLIB 4WQ8A 3WFBC 1FI3A 3L4OA 1DVHA 4PJ0V 1C6SA 1H9YA 1MZ4A 1SQPD 1YCCA 2GC7D 5EXQA 2KS1A 1NU1D 2KNCB 4WQAA 2C9XB 5E79V 3PRJA 3SJLA 1CHIA 2V08A 3L72D 1COTA 4L3GA 2OZ1A 2C1DA 2AIUA 1CHJA 4WQDA 4NFGB 1FJ0A 3DMIA 1KIBA 1HJ3A 1W2LA 4WQBA 4IL6V 1IRWA 2EXVA 2XTSB 5GTHV 2YQBA 5AURA 3NWVA 1H1OA 4FB1A 1A56A 2BLFB 1I54A 3WC8A 2C1VA 3ZOYA 4GEDB 4MU8A 2I8FA 5DF5A 3ZOWA 2ZXYA 5IY51 3GG2A 1EZVD 1FOCA 4PW9B 5CICB 1ETPA 1DT1A 2DGEA 1J3SA 5CIDB 1CRGA 3OA8A 1DW2A 2B0ZB 2B12B 1ZRTD 5DJQC 1IQCA 3CU4A 4FA1A 1KB0A 1E2RA 3VNWA 1AKKA 2GIWA 1IZL0 1SQVD 1I8PA 2K9JB 1NTKD 1KV9A 3NBSA 2ZZS1 3O1YA 3FWLA 3PXSA 4AX3A 3CX5D 4H0KA 4UB8V 3RMZA 5CIFB 5DJQB 4LJIA 2QG4A 3OCDA 1GIWA 4EIFA 1YICA 1YIQA 2GB8B 2LITA 1A2SA 4FA9A 1GDVA 5B66V 3PLNA 2BH5X 3TDKA 1HCMA 2OZ1B 2C1DB 3HQ9A 1MG3D 2PCCB 5TJHA 1EB7A 2CA3B 5KLVD 3L75D 1PPJD 4WQCA 1AOQA 2BH4X 2N9JA 1RZ5A 2CE0A 1DIIC 1GKSA 3RN1A 1LC1A 2Y0CA 1H33A 1BL9A 1HROA 2ZONG 3M97X 2PCBB 3O20A 3A0BV 4EIDA 1M6ZA 4D6TD 1CIEA 1L0LD 3WFDC 2N9IA 4Q5PA 1PP9D 2RMZA 3TF5A 3L74D 2MTAC 2A06D 1CO6A 1N9CA 1R0QA 1N50A 3SVWA 1I55A 4P4QB 4QAOA 1CXCA 3OA8B 3HQ6A 1FHBA 2BGVX 1VYDA 1H32A 1CNOA 1CSWA 1CSUA 3L71D 3BCCD 1L9BC 1HZUA 1CTZA 4AALA 3WU2V 4O1WA 4Y5RA 1I5TA 3TYIA 1F1FA 2HV4A 3VMAA 5B6QA 4L3HA 4XYDB 1IRVA 1WVEC 1BGYD 1CORA 1QL4A 5KKZB 3MK7C 2YCCA 3OCDB 1C52A 1E8EA 4GYDA 1L9JC 5C9MA 1GQ1A 2C2CA 1W5CT 1DW3A 1CCRA 3CWBD 1AOFA 1KX2A 4XXLA 1CIGA 1A8CA 2VHDA 1YNRA 3MK7B 1GU2A 5CIBB 1CRCA 3JBTB 3ZBMA 2PACA 1C6OA 1KYOW 1OCDA 2C1UA 1N15A 2B4ZA 1S6VB 1NTZD 1RAQA 1H33B 2B11B 4L1QA 4YE1A 3WFCC 2MHMA 3L73D 3KZIV 3WFEC 2QJYB 2C8SA 1RAPA 1HJ4A 2Q3EA 3DR0A 2FRCA 2YK3A 2RN0A 1C2RA 3CXHW 1C6RA 2N3YA 3SXTA 1CC5A 5KAFV 1H9XA 1CIFA 3PH2B 4WQEA 1K3HA 1ZZHA 3O0RC 1CEDA 4N0KA 4UB6V 4EDFA 4RSZA 4O1QA 2L91A 4FA4A 1OAEA 1H32B 4EICA 4V2KA 3PHLA 4WQ9A 2GC4D 2CE1A 1LS9A 3ORVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DY9 A;  3ZCF A;  5DFS A;  1KB9 D;  2D0S A;  2CA4 B;  1FI7 A;  2ZBO A;  3VYM A;  4FA5 A;  1LMS A;  4EIE A;  1CTJ A;  1CSV A;  4RJT A;  2D0W A;  1CRJ A;  3CP5 A;  1HZV A;  1NML A;  1CSX A;  2FYN B;  3H1J D;  4KMG A;  1CYJ A;  2AI5 A;  1GJQ A;  1P84 D;  3H1H D;  1DW0 A;  5CIE B;  3RLM A;  4H0J A;  2V07 A;  1E29 A;  1H31 A;  1SQX D;  1L0N D;  3PTZ A;  1QKS A;  1KYO D;  2L4D A;  1HJ5 A;  2ZOO A;  3O5C A;  2QJP B;  2N18 C;  3ZIY A;  4WQ7 A;  1YTC A;  2O3J A;  2CXB A;  1HRC A;  1DVV A;  1F1C A;  1M70 A;  4U3F D;  1CCH A;  1CYI A;  1DW1 A;  1KX7 A;  3CXH D;  1BCC D;  1FI9 A;  2LIR A;  2N18 B;  1CRI A;  3H1L D;  3SLE A;  2JTI B;  1AYG A;  2BPB B;  3H1I D;  4PD4 D;  3L4M A;  1NTM D;  5H2F V;  1C75 A;  3L70 D;  5TIS V;  1N90 A;  1S5L V;  3GW6 A;  1CTY A;  3HQ7 A;  1NNO A;  1JDL A;  1I6E A;  4J20 A;  5CYT R;  1B7V A;  2BCC D;  4FAN A;  3ITK A;  2N3B A;  1NIR A;  4AAM A;  3NBT A;  3A9F A;  1MG2 D;  5C0Z A;  1U75 B;  1YFC A;  2FWL A;  2BCN B;  2IBZ D;  1CXA A;  1DIQ C;  3SWS A;  1LFM A;  1CIH A;  2JWA A;  1CRH A;  1C7M A;  3PXT A;  3H1K D;  1YEA A;  5CIG B;  155C A;  1QYZ A;  1H31 B;  3ZOX A;  1CYC A;  2FYU D;  1M60 A;  2JQR A;  2Y0E A;  1YEB A;  3RN0 A;  1CHH A;  1I6D A;  5CIH B;  3WUI A;  3VRD A;  5B5E V;  1BE3 D;  1HH7 A;  5GTI V;  3TGU D;  1NMI A;  1K3G A;  2ORL A;  1QL3 A;  4K3I A;  1SQQ D;  3ZOO A;  1U74 B;  1C2N A;  1RZ6 A;  351C A;  2AXT V;  4A7P A;  2YIU B;  2DVH A;  4FAV A;  1QN2 A;  2N9Y B;  1I8O A;  3CYT I;  3HQ8 A;  3A0H V;  4AAN A;  3C2C A;  2Y0D A;  1SQB D;  1WEJ F;  5KAI V;  451C A;  4AAO A;  2B10 B;  3KHU A;  3CX5 W;  4PWA A;  1IO3 A;  3X39 A;  3DP5 A;  3PXW A;  1CRY A;  2QJK B;  1FCD C;  4JCG A;  1LC2 A;  5KLI B;  4WQ8 A;  3WFB C;  1FI3 A;  3L4O A;  1DVH A;  4PJ0 V;  1C6S A;  1H9Y A;  1MZ4 A;  1SQP D;  1YCC A;  2GC7 D;  5EXQ A;  2KS1 A;  1NU1 D;  2KNC B;  4WQA A;  2C9X B;  5E79 V;  3PRJ A;  3SJL A;  1CHI A;  2V08 A;  3L72 D;  1COT A;  4L3G A;  2OZ1 A;  2C1D A;  2AIU A;  1CHJ A;  4WQD A;  4NFG B;  1FJ0 A;  3DMI A;  1KIB A;  1HJ3 A;  1W2L A;  4WQB A;  4IL6 V;  1IRW A;  2EXV A;  2XTS B;  5GTH V;  2YQB A;  5AUR A;  3NWV A;  1H1O A;  4FB1 A;  1A56 A;  2BLF B;  1I54 A;  3WC8 A;  2C1V A;  3ZOY A;  4GED B;  4MU8 A;  2I8F A;  5DF5 A;  3ZOW A;  2ZXY A;  5IY5 1;  3GG2 A;  1EZV D;  1FOC A;  4PW9 B;  5CIC B;  1ETP A;  1DT1 A;  2DGE A;  1J3S A;  5CID B;  1CRG A;  3OA8 A;  1DW2 A;  2B0Z B;  2B12 B;  1ZRT D;  5DJQ C;  1IQC A;  3CU4 A;  4FA1 A;  1KB0 A;  1E2R A;  3VNW A;  1AKK A;  2GIW A;  1IZL 0;  1SQV D;  1I8P A;  2K9J B;  1NTK D;  1KV9 A;  3NBS A;  2ZZS 1;  3O1Y A;  3FWL A;  3PXS A;  4AX3 A;  3CX5 D;  4H0K A;  4UB8 V;  3RMZ A;  5CIF B;  5DJQ B;  4LJI A;  2QG4 A;  3OCD A;  1GIW A;  4EIF A;  1YIC A;  1YIQ A;  2GB8 B;  2LIT A;  1A2S A;  4FA9 A;  1GDV A;  5B66 V;  3PLN A;  2BH5 X;  3TDK A;  1HCM A;  2OZ1 B;  2C1D B;  3HQ9 A;  1MG3 D;  2PCC B;  5TJH A;  1EB7 A;  2CA3 B;  5KLV D;  3L75 D;  1PPJ D;  4WQC A;  1AOQ A;  2BH4 X;  2N9J A;  1RZ5 A;  2CE0 A;  1DII C;  1GKS A;  3RN1 A;  1LC1 A;  2Y0C A;  1H33 A;  1BL9 A;  1HRO A;  2ZON G;  3M97 X;  2PCB B;  3O20 A;  3A0B V;  4EID A;  1M6Z A;  4D6T D;  1CIE A;  1L0L D;  3WFD C;  2N9I A;  4Q5P A;  1PP9 D;  2RMZ A;  3TF5 A;  3L74 D;  2MTA C;  2A06 D;  1CO6 A;  1N9C A;  1R0Q A;  1N50 A;  3SVW A;  1I55 A;  4P4Q B;  4QAO A;  1CXC A;  3OA8 B;  3HQ6 A;  1FHB A;  2BGV X;  1VYD A;  1H32 A;  1CNO A;  1CSW A;  1CSU A;  3L71 D;  3BCC D;  1L9B C;  1HZU A;  1CTZ A;  4AAL A;  3WU2 V;  4O1W A;  4Y5R A;  1I5T A;  3TYI A;  1F1F A;  2HV4 A;  3VMA A;  5B6Q A;  4L3H A;  4XYD B;  1IRV A;  1WVE C;  1BGY D;  1COR A;  1QL4 A;  5KKZ B;  3MK7 C;  2YCC A;  3OCD B;  1C52 A;  1E8E A;  4GYD A;  1L9J C;  5C9M A;  1GQ1 A;  2C2C A;  1W5C T;  1DW3 A;  1CCR A;  3CWB D;  1AOF A;  1KX2 A;  4XXL A;  1CIG A;  1A8C A;  2VHD A;  1YNR A;  3MK7 B;  1GU2 A;  5CIB B;  1CRC A;  3JBT B;  3ZBM A;  2PAC A;  1C6O A;  1KYO W;  1OCD A;  2C1U A;  1N15 A;  2B4Z A;  1S6V B;  1NTZ D;  1RAQ A;  1H33 B;  2B11 B;  4L1Q A;  4YE1 A;  3WFC C;  2MHM A;  3L73 D;  3KZI V;  3WFE C;  2QJY B;  2C8S A;  1RAP A;  1HJ4 A;  2Q3E A;  3DR0 A;  2FRC A;  2YK3 A;  2RN0 A;  1C2R A;  3CXH W;  1C6R A;  2N3Y A;  3SXT A;  1CC5 A;  5KAF V;  1H9X A;  1CIF A;  3PH2 B;  4WQE A;  1K3H A;  1ZZH A;  3O0R C;  1CED A;  4N0K A;  4UB6 V;  4EDF A;  4RSZ A;  4O1Q A;  2L91 A;  4FA4 A;  1OAE A;  1H32 B;  4EIC A;  4V2K A;  3PHL A;  4WQ9 A;  2GC4 D;  2CE1 A;  1LS9 A;  3ORV A; 
#chains in the Genus database with same CATH topology
 3KDP B;  4RES B;  1FI7 A;  2ZBO A;  4IFF A;  1H0T A;  3L37 A;  1CTJ A;  1CSV A;  1R5L A;  1CRJ A;  1IO4 A;  1KV4 A;  4JPZ B;  2C9N Y;  1LJ2 A;  3LW5 H;  2A06 E;  1S3J A;  2HG5 D;  1GW4 A;  3Q5P A;  1N73 C;  1OX3 A;  2IZ0 A;  1BE3 J;  4KMG A;  1MZ9 A;  2QJP C;  3M0D C;  2KSJ A;  1GJQ A;  3AE9 C;  1P84 D;  3BRV B;  1KYO E;  1PZQ A;  3M9B A;  3LW5 J;  1NO4 A;  3AE6 C;  3ABV C;  1NWQ A;  2K37 A;  4H44 B;  3O5C A;  4QMA A;  1CW5 A;  3ZIY A;  1SQX G;  1FDI A;  1L0N G;  5GTI E;  1OVU A;  5AW0 B;  1ZV8 A;  1YTC A;  2WPS A;  1L4A D;  2AXT E;  3AE3 C;  1CCH A;  2C0X A;  3OAK A;  1A02 F;  1KIL C;  1KQF B;  1JTH A;  1M1J C;  1FI9 A;  3CI9 A;  5AW9 B;  2JTI B;  1AYG A;  2BPB B;  4EYY Q;  1FJP A;  5C39 A;  1CI6 B;  2Z4E A;  1NTM D;  1VPC A;  2WSC H;  3L70 D;  1HGZ A;  1BSH A;  4PJ0 E;  1SQB K;  3A7O A;  1NNO A;  1DD4 A;  1S4X A;  5E79 E;  4J20 A;  2KNC A;  1H0T B;  2WSC J;  3RBX A;  1SQX K;  3ITK A;  1L0N K;  1EXI A;  3HUS C;  2N3B A;  2IBZ E;  3A9F A;  1SQP K;  1FDO A;  4LGD E;  2Q6Q A;  3VOP A;  4B86 A;  5GTH E;  4PV1 B;  4IFD K;  3WU2 H;  1CIH A;  5AVW B;  3MHV A;  1SP4 A;  3CX5 H;  3H1K D;  3A5T A;  5CIG B;  155C A;  1M1J A;  1M60 A;  1M1K Q;  2JR8 A;  3K5B A;  3I5C A;  2M3B A;  4N78 D;  1HH7 A;  4MN4 C;  4OGQ C;  5GTI V;  1LT9 A;  2ORL A;  1TU3 F;  1U74 B;  1C2N A;  1BE3 G;  1LP1 A;  3H1J E;  1X79 B;  2AXT V;  2AEJ A;  2KIK A;  1KQL A;  1JTH B;  5CJ0 A;  1VQN P;  1QL2 A;  1LTI C;  1S1C X;  2Y0D A;  1SQB D;  1WEJ F;  1KYO I;  1K73 Q;  3CCR P;  3I56 P;  5APT A;  4AAO A;  4HH2 A;  2B89 A;  3KHU A;  4PWA A;  3HUS A;  3DP5 A;  4GOE A;  5KLV J;  2QEX P;  3MD0 A;  3P8M C;  2JWD A;  1CSB A;  1PGO A;  3H32 A;  4O9B A;  3RK3 E;  4PJ0 V;  2FY8 A;  1SQP D;  2GC7 D;  5EXQ A;  2KS1 A;  4U3F E;  2KNC B;  2YNY A;  5E79 V;  3PRJ A;  2IFN A;  3L72 D;  4D6T J;  2C1D A;  1L0L J;  1FJK A;  4WQD A;  3HRN A;  4PD4 E;  2JO1 A;  3TSI A;  2IYO A;  1BCC G;  1W2L A;  2EXV A;  2XTS B;  3A0B E;  5GTH V;  5AUR A;  1MUU A;  4FB1 A;  2BLF B;  3SSU A;  2C1V A;  1N7S C;  1HTL C;  3W67 A;  2Q7C A;  1KIL B;  4JF7 A;  4R4L A;  1M1J B;  2BCC E;  5DF5 A;  2OYI C;  2ZXY A;  3SFE C;  3GG2 A;  5CIC B;  4I2L C;  2CK3 H;  3WUV A;  1BGY J;  1MFT A;  2DGE A;  2AXC A;  1LT9 B;  5CID B;  1NH4 A;  2IBZ I;  2LXB A;  1LP1 B;  4XFJ A;  3FWN A;  1ZRT D;  5DJQ C;  1IQC A;  1HGV A;  2B88 A;  3CU4 A;  4FA1 A;  1NU1 K;  3CWB J;  2N1T D;  2YMK A;  1ZR4 A;  2W6J H;  2MKV A;  4ZNC A;  1IZL 0;  1T3J A;  1VQ8 P;  2A45 I;  2ZZS 1;  3MP7 B;  3PXS A;  3HUS B;  2H88 C;  4H0L D;  5CIF B;  2WSE H;  4LJI A;  4EIF A;  3H32 B;  1YIQ A;  2GB8 B;  2Z5H A;  4ZMD A;  1SQQ E;  2KS1 B;  3L75 E;  1GDV A;  1DH3 A;  1GDT A;  3QWO C;  2WSE J;  2C1D B;  2WSF H;  2PCC B;  5AW1 B;  5TJH A;  1PPJ D;  4WQC A;  3JSV C;  2BH4 X;  2N9J A;  2OYI A;  2P67 A;  5KLV G;  2WIT A;  3KZI E;  5TIS H;  2FYN C;  1BL9 A;  4OGQ B;  2ZON G;  2WSF J;  1GD2 E;  2QA4 P;  1AFO A;  3A0B V;  1PFI A;  1NTZ K;  3CC2 P;  4Y99 C;  4IL6 X;  4D6T G;  1L0L G;  1JY2 O;  5B66 E;  1RF0 C;  3N4X A;  2A06 D;  1R0Q A;  3BCC E;  2HFE D;  1P84 H;  1T8Z A;  3AEG C;  5AVT B;  2BGV X;  1H32 A;  3L71 D;  1CSU A;  1YJ9 P;  1ZP0 C;  2ZXE B;  4LLH A;  2OTL P;  1GK4 A;  1EQ7 A;  3VMA A;  2I1K A;  1EZV E;  1Q2N A;  5AW4 B;  1E8E A;  2E42 A;  1L2P A;  3G4S P;  1DW3 A;  4DJG A;  1VQP P;  2O1J A;  2B9B A;  1OIP A;  1RHZ B;  1L0L K;  4C46 A;  1OFC X;  2P2U A;  2R5D A;  1J1E C;  3MK7 B;  1RF1 A;  1CRC A;  1IZN B;  1YTZ T;  1FDM A;  1NTK E;  2C1U A;  2OYI B;  3HD7 D;  1YI2 P;  1NTZ D;  1RF0 A;  1RAQ A;  2B11 B;  4L1Q A;  3WFC C;  1IFN A;  4WVZ A;  3KZI V;  2D2C B;  1NTM J;  2C8S A;  3HE4 A;  4RO0 A;  4YPC A;  3L70 J;  3VYI A;  2E74 C;  2FRC A;  2RN0 A;  1VQ4 P;  1SFC C;  3RK2 C;  2RKL A;  5KJ7 D;  3CLQ A;  4GDO A;  1ZZH A;  5H2F E;  2FXO A;  4RSZ A;  2I8D A;  3D71 A;  2AEM A;  1H32 B;  1X8Y A;  1KB9 E;  4TLF A;  4EIC A;  1J1D C;  1LS9 A;  1X22 A;  3V2Q A;  1OVV A;  1QEX A;  2Q5U A;  2DW3 A;  4FA5 A;  1L4A A;  1LMS A;  3SWK A;  3H1K J;  1PP9 E;  1M57 D;  4GOF A;  3Q1M A;  1K04 A;  1RQV A;  1NML A;  1CSX A;  1R5S A;  2J59 M;  1GL2 D;  2Z5I A;  4H44 C;  2FYN B;  3H1J D;  2YKO A;  3EWK A;  3T97 A;  2AI5 A;  5AVX B;  5CIE B;  3RLM A;  3MUD C;  4H0J A;  3L74 G;  1VQ5 P;  1RF1 B;  1SFC A;  4Y99 B;  1K8A Q;  1VF5 D;  4IFM A;  1QKS A;  3P32 A;  2P10 A;  2ZOO A;  1SQB J;  3AE7 C;  1DEE G;  2OYH A;  2CXB A;  3HE4 B;  1EZV I;  1HRC A;  3RK3 D;  1NAY A;  3RL0 g;  1AV1 A;  1Y9B A;  1F1C A;  1M70 A;  2HPC A;  1YQ4 C;  4U3F D;  2K1A A;  2Y9Z A;  1RE4 C;  3D6Z A;  1SQP J;  3E1I A;  2IYP A;  1CRI A;  2W27 A;  3H1L D;  3RL0 D;  1OW6 A;  4DZO A;  3L72 J;  3H1I D;  4PD4 D;  2KXP B;  5H2F V;  1A02 J;  3VMZ A;  1NTM G;  4JYC A;  3GHG C;  3GW6 A;  3HQ7 A;  5EFW B;  3L70 G;  4OWF A;  1I6E A;  2I1J A;  3GF7 A;  3WMM 0;  5CYT R;  1B7V A;  4NPD A;  2BCC D;  3AEB C;  1L4A B;  4I6M C;  3AE1 C;  1RY3 A;  4YTP C;  5AW2 B;  5C0Z A;  2YO3 A;  1YFC A;  2FWL A;  2IX7 C;  2BCN B;  3KXD A;  3T97 B;  5CCH D;  3SWS A;  1QGK B;  1KB9 I;  1C7M A;  1SFC B;  3B5N C;  5L8R J;  1NTM K;  2NPS C;  3MIW A;  3VRD A;  5B5E V;  2IFM A;  3TGU D;  2LKM A;  3II6 A;  3AEA C;  1NMI A;  1QL3 A;  1SQQ D;  3ZOO A;  1FE6 A;  4H0L C;  4W7Y A;  351C A;  2HPC B;  1OZH A;  4A7P A;  2DVH A;  4FAV A;  3GHG A;  2C0W A;  1J1D B;  2CPB A;  1M7L A;  4W80 A;  1LTG C;  2PGD A;  2K9J A;  1S9K E;  2WZ7 A;  1KIL E;  3V4Q A;  4UB8 E;  1IO3 A;  1SQB G;  3PXW A;  1Q81 Q;  2QJK B;  1JNM A;  3H1H G;  4WQ8 A;  3SFD C;  3KQG A;  4ZKU A;  2M0B A;  1VQ7 P;  1MZ4 A;  2PRR A;  1LTT C;  3CXH I;  4NPE A;  4N6J A;  1BCC E;  3FXD A;  2V08 A;  1KN7 A;  4L3G A;  1S5L X;  3O6Q A;  1SQP G;  2Q9I A;  5CCG D;  2H43 A;  3B5N A;  3L72 G;  1YIJ P;  4NFG B;  4UB6 H;  2N1T A;  2O01 H;  2NPS A;  1NU1 J;  1IJD B;  5CBN A;  2Q3I A;  1LT9 C;  1H1O A;  3HE5 A;  1A56 A;  2LXC B;  1VQM P;  3ZOY A;  3L71 J;  2O01 J;  4MU8 A;  5AVU B;  2H7H A;  4H13 D;  3ZOW A;  5IY5 1;  5AVQ B;  1EZV D;  1G1I A;  4PW9 B;  4RKU J;  3D70 A;  1J3S A;  1LTA C;  2KYV A;  3S4R A;  4YXW H;  1ZN5 A;  1YJW P;  3OA8 A;  3WU2 E;  2E75 D;  2QIW A;  3GHG B;  2QE7 H;  2ZFC A;  3C8V A;  4WY4 C;  1KB0 A;  2V4H A;  2FFD A;  1E2R A;  2KP8 A;  3CX5 E;  2ZYG A;  2K9J B;  3W68 A;  1NTK D;  2FYU E;  1FZG A;  3VMX A;  1QL1 A;  4UB8 V;  4LC1 A;  5E79 H;  1GIW A;  3BAS A;  1NAF A;  1NTZ J;  3SWF A;  2J5U A;  1KD1 Q;  1PV3 A;  4R4M A;  4FA9 A;  5KLV E;  3P7K A;  1W2B O;  3JCU H;  1NGM B;  4GIF A;  2ZXX A;  2E76 D;  3O6Q B;  1R8E A;  3ZDM A;  3B5N B;  4EI2 A;  1XTG B;  1AOQ A;  5GTH H;  1T2K D;  1RZ5 A;  1S2E A;  1GKS A;  2N1T B;  3RN1 A;  1PPJ G;  1H33 A;  2OTJ P;  4D6T E;  2NPS B;  1BDC A;  1S5L H;  4WWI A;  2WPR A;  1S72 P;  3M97 X;  1EDK A;  2PCB B;  2IDB A;  3HE5 B;  4H0L B;  3O20 A;  4EID A;  3AE8 C;  1M6Z A;  4L75 A;  1KQG B;  1FC2 C;  1XTC C;  4WY4 A;  3KPE A;  4Y28 J;  1NKZ B;  3SWY A;  1H89 A;  1IFM A;  1PP9 D;  2RMZ A;  2WSS H;  2MTA C;  1CO6 A;  1N9C A;  1N50 A;  5APX A;  1URQ D;  1NU1 G;  2A06 G;  3OA8 B;  4NPF X;  1VYD A;  1CNO A;  3IR9 A;  3HD7 A;  5AW7 B;  2E5T A;  4AAL A;  3WU2 V;  3MTU E;  3H1J J;  1GL2 C;  4O1W A;  3S1K A;  2J58 A;  3L71 G;  1SVF A;  1F1F A;  2KSE A;  1HH0 A;  1JY2 P;  2P58 A;  3VMY A;  3MK7 C;  4GYD A;  5C9M A;  1GQ1 A;  2AEF A;  2W90 A;  1GTW A;  1W5C T;  1CCR A;  2SPZ A;  1AOF A;  3P8C E;  1KX2 A;  2H8P D;  5K5G B;  4XXL A;  1CIG A;  4PV1 D;  2ZT9 D;  4W7Z A;  2D2C C;  2KK7 A;  4PD4 H;  3A0H H;  2W8Z A;  5AVV B;  4U3F J;  2K3R A;  1GU2 A;  4DCK A;  1H8A A;  1SQV E;  2QVA A;  2PAC A;  1EDI A;  1KYO W;  3CX5 I;  3N7N A;  2B4Z A;  3H1L J;  3E7K A;  1H33 B;  4AYC A;  3H1I J;  3L73 D;  3WFE C;  1NTZ G;  2R3C A;  3DR0 A;  3G3Z A;  1NKN A;  4I7Z C;  3MGN A;  4WY4 B;  2N3Y A;  1GL2 A;  1GZL A;  1CC5 A;  1H9X A;  1DIP A;  4BWN A;  3L35 A;  3O0R C;  1CED A;  2BCC J;  1JOC A;  4EOT A;  4EDF A;  4O1Q A;  5TIS E;  1OAE A;  3M91 A;  3LIE A;  1JMB A;  3FX0 A;  4V2K A;  3V6I A;  3HD7 B;  2YIU C;  2OGU A;  1VQL P;  1Y8A A;  3U1A A;  4DY9 A;  3ZCF A;  5APS A;  3V2R A;  5DFS A;  1USE A;  3AED C;  4GOD A;  2E5Y A;  1AJY A;  4EIE A;  5AW8 B;  1NOH A;  4RJT A;  3CC7 P;  3D0W A;  1FAV A;  3CP5 A;  1RF1 C;  1HZV A;  3L74 E;  2GM4 A;  4KJM A;  1KTM A;  1RQU A;  3TGU J;  1CYJ A;  1SQQ J;  1LWU C;  3TK1 A;  3TNU A;  1X9V A;  3KZI H;  1E29 A;  1H31 A;  1WT6 A;  1S9K D;  1KIL D;  1KYO D;  2L4D A;  1HJ5 A;  2YXR B;  4BRY A;  1EXJ A;  3D6Y A;  3Q2Y A;  3CCJ P;  2QM7 A;  5B66 H;  3CME P;  1BGY G;  1KX7 A;  1BCC D;  1LTJ A;  3G71 P;  2LIR A;  1GL2 B;  1YHQ P;  2QSI A;  2N18 B;  4U3F G;  5KAI E;  1JY2 N;  3SLE A;  2FXP A;  5CCH A;  2ZYA A;  1ZR2 A;  3H1L G;  3CWB G;  1L4A C;  1W2E A;  5KTB A;  1C75 A;  3A2A A;  2N9B A;  3H1I G;  1VF5 B;  3AE2 C;  5TIS V;  1Q90 D;  4JBZ A;  1OXZ A;  1GK6 A;  1MV8 A;  1CTY A;  2WT7 A;  3AE4 C;  1AA0 A;  1JDL A;  2PFX A;  2KLV A;  2POH A;  3CL3 D;  2KOG A;  1LWU A;  3RK3 B;  3JC2 2;  4XA4 A;  2YMY A;  1RH5 B;  1JEK A;  1YQ3 C;  5AW5 B;  3OA7 A;  3TYY A;  3BAT A;  5CHX A;  2V7Q H;  3CCS P;  1FU1 A;  1JCC A;  1U75 B;  4U7J A;  2ZVN B;  4IL6 E;  2IBZ D;  4ASV A;  2KLU A;  2OYH C;  1DIQ C;  1GMJ A;  4OGQ D;  4L76 A;  4HYT B;  4I7Z B;  2V7Q J;  3TNU B;  2C9L Y;  3CCQ P;  1H31 B;  4N78 E;  1CYC A;  2FYU D;  1JY3 O;  2Y0E A;  1I6D A;  3RBZ A;  4BRY B;  4N3Y B;  1NTK J;  1CZQ A;  2NZ2 A;  5CCG A;  3G9R A;  2WWW A;  1LTS C;  4K3I A;  1RZ6 A;  1P84 I;  1SQB E;  3TGU G;  2YIU B;  2QJK C;  5H2F H;  1LTJ B;  3H1H E;  1SQQ G;  1ZME C;  2G8Y A;  1I8O A;  3HQ8 A;  4K3A A;  1X0T A;  5KAI V;  1SQX E;  1L0N E;  2M3E A;  2R32 A;  1SQP E;  1CRY A;  1YTZ I;  1FZE A;  1ZW0 A;  5KLI B;  2PP6 A;  3L72 E;  3U59 A;  2YO2 A;  1DVH A;  1C6S A;  2WT7 B;  5B5E E;  1YCC A;  3H25 A;  4WQA A;  3V4W A;  3CXH E;  1LWU B;  1FZC C;  5KAF H;  1COT A;  2OZ1 A;  2AIU A;  1G1J A;  3Q5R A;  3CCM P;  1NYH A;  5APY A;  1N7S D;  5KKZ C;  1YIT P;  3DMI A;  1PP9 J;  1LNQ A;  1JO5 A;  1KIB A;  1T6A A;  4KHX A;  4IL6 V;  1IRW A;  1SQQ K;  1WRG A;  2FKW B;  1FS0 E;  4KT0 J;  4HJG H;  3IN6 A;  1ZOY C;  4GED B;  1QVF O;  3B8E B;  2O01 N;  1ZRT E;  1FOS E;  1DT1 A;  2QJY C;  1CRG A;  2KZJ A;  2R44 A;  3E1R A;  1DW2 A;  1IK9 A;  3P8C D;  3PH0 A;  1NHL A;  1N8R Q;  1HBW A;  3VNW A;  1AKK A;  1E79 H;  1JUN A;  1SQV D;  1I8P A;  1NJI Q;  1FZC A;  2H89 C;  1KV9 A;  1AVY A;  4I1L A;  3FWL A;  2ZJS E;  4AX3 A;  3RMZ A;  1NTK G;  3OCD A;  1BE3 E;  4H13 B;  5AVY B;  2JJL A;  3BVH A;  3F89 A;  2O1K A;  3PJS K;  2HLO A;  2LIT A;  2N1T C;  3H1K G;  3L73 J;  3NMD A;  2OYH B;  4C7N A;  2BH5 X;  3TDK A;  1KFM A;  1CI6 A;  2KZI A;  1E5W A;  1URQ A;  2YKQ A;  2OZ1 B;  1U57 A;  3HQ9 A;  2IPP A;  1EB7 A;  2WMM A;  2E75 B;  3L75 D;  2R3S A;  2WPV B;  5AW6 B;  1LC1 A;  2Y0C A;  4M3L A;  3IAO A;  3AEC C;  5AVS B;  2QRX A;  1DEB A;  2HYN A;  4JQ0 D;  1CIE A;  1NVO A;  3AEF C;  3WFD C;  1NU1 E;  2N9I A;  3CCL P;  1UIX A;  2FFD C;  5APU A;  3EQ2 A;  1NTK K;  3M0A A;  5APV A;  2FYZ A;  1MFZ A;  1GU5 A;  3L74 D;  3L71 E;  4UB6 E;  2E76 B;  1PP9 G;  1CXC A;  2Y9Y A;  1JCD A;  2BEZ F;  5AVZ B;  5DJU B;  1AVO A;  3BCC D;  1L9B C;  1HZU A;  5M1B A;  1CTZ A;  1FBM A;  1BSN A;  1KYO H;  4UB8 H;  5BU5 A;  1I5T A;  2HV4 A;  1FZC B;  2Q1K A;  2ITA A;  5B6Q A;  4L3H A;  4XYD B;  1IRV A;  2PAJ A;  3CPW O;  1COR A;  2WPQ A;  1QL4 A;  5KKZ B;  3NTN A;  1EDL A;  3OCD B;  1C52 A;  5GTI H;  1BDD A;  2C2C A;  3CCE P;  2AXT H;  4C7N B;  1H88 A;  3AE5 C;  1IK7 A;  1GW3 A;  1URQ B;  2VHD A;  1NTZ E;  2LR2 A;  2E74 D;  5CIB B;  3JBT B;  4ASW A;  1SFC D;  1BCC J;  4DOJ A;  1C6O A;  3RK2 D;  2G3A A;  1OMI A;  1Q82 Q;  3GMA A;  1S6V B;  1N73 A;  1ZXG A;  4YE1 A;  3M0D A;  2WTY A;  1U7J A;  5APW A;  2QJY B;  1AQT A;  1RAP A;  1HJ4 A;  4PJ0 H;  1GU4 A;  3GF3 A;  3L73 G;  2YK3 A;  2OAR A;  1C2R A;  3CXH W;  1UII A;  1C6R A;  1SS1 A;  3JCU E;  1FZF A;  3HD7 C;  1N86 A;  1FOS F;  4JYB A;  3Q3D A;  4WQE A;  2ZT9 B;  4UB6 V;  2L5G B;  4FA4 A;  1S5L E;  4IOI H;  1KIL A;  3HTK A;  2WVR A;  4WQ9 A;  3PHL A;  2CE1 A;  5KJ7 C;  1MKM A;  3ORV A;  1VL2 A;  2A45 H;  4H44 D;  1L0L E;  1KB9 D;  2D0S A;  2CA4 B;  3VYM A;  2HR3 A;  1J2J B;  2B87 A;  2BAS A;  2D0W A;  1LT1 A;  2QM8 A;  2FYU J;  1YBK A;  4EIJ A;  3B4S A;  1W5C E;  3M06 A;  2JDI H;  3H1H D;  5BVZ A;  1DW0 A;  4BXL A;  2V07 A;  3S9O A;  1QVG O;  3A3Y B;  1SQX D;  1L0N D;  3PTZ A;  2FFD B;  1BGY E;  1N73 B;  3VP8 A;  2QJP B;  1IFJ A;  2N18 C;  4WQ7 A;  4L74 A;  3G6E P;  2O3J A;  2YKP A;  1DVV A;  5CMZ A;  2VRS A;  3V2P A;  4C7R A;  3H1L E;  3CWB E;  1CYI A;  1DW1 A;  1VF5 C;  3V2N A;  3H1I E;  4OH8 B;  5KJ7 A;  3CXH D;  3A0H E;  3I55 P;  3FGA D;  2OYO A;  1M8O B;  3L4M A;  3RK3 C;  2FXM A;  4HB1 A;  3HTK B;  1N90 A;  3C1L A;  2M5A A;  1S5L V;  3A0B H;  3B71 A;  1OW7 A;  2P7J A;  1LTB C;  3RL0 C;  1M90 Q;  4FAN A;  2B87 B;  1HJ0 A;  2M8R A;  2W83 C;  1HUC A;  5CJ4 A;  1NIR A;  4AAM A;  3NBT A;  3B5N D;  1T3U A;  1MG2 D;  3NFQ A;  3CMA P;  3V5B A;  2E43 A;  2NPS D;  3CD6 P;  1CXA A;  2ZAE B;  1LFM A;  4GT1 A;  2JWA A;  4YXD C;  2IBZ G;  1CRH A;  3PXT A;  1YEA A;  1EC5 A;  1QYZ A;  3ZOX A;  4ZKP A;  3TGU E;  2XND H;  2JQR A;  1LTJ C;  2UWJ E;  1YEB A;  3RN0 A;  4AQR D;  1CHH A;  5CIH B;  1SQV J;  1KC8 Q;  3H6P A;  3WUI A;  2FYU G;  1PGJ A;  5CCH C;  1BE3 D;  2A45 G;  1VQK P;  1K3G A;  3C9I A;  1N7S A;  3VP9 A;  1P84 E;  1QN2 A;  2N9Y B;  5KLI C;  1QLE D;  1Y47 A;  1RE3 C;  2CPS A;  1WMK A;  3CYT I;  3Q5S A;  3A0H V;  2OQQ A;  4CPG A;  4AAN A;  3C2C A;  1JY3 P;  451C A;  2B10 B;  1VQO P;  3CX5 W;  3MZW B;  3H1J G;  3X39 A;  3LID A;  3L75 J;  1FCD C;  4JCG A;  1LC2 A;  2M5A B;  3WFB C;  1FI3 A;  3L4O A;  1H9Y A;  2KI7 B;  3NXS A;  1FZB A;  1IC2 A;  1NU1 D;  5APQ A;  2R5B A;  2C9X B;  4OVN F;  3SJL A;  1CHI A;  3OJA B;  2FYU K;  4AUW A;  3O8Z A;  3R2P A;  1CHJ A;  4PD4 I;  2JP3 A;  2WQY C;  2GA1 A;  1FJ0 A;  3CCV P;  1N2D C;  1NTM E;  1LGH B;  3KYQ A;  2FBW C;  5CBO A;  2W6B A;  3L74 J;  1HJ3 A;  3L70 E;  4WQB A;  2JEE A;  1Q86 Q;  1JB0 J;  2XNX A;  5AVR B;  5KLV K;  2YQB A;  3WUT A;  3NWV A;  5CCG C;  1I54 A;  3WC8 A;  3BCC J;  1G2C A;  4WY4 D;  1OW8 A;  3FXE A;  2I8F A;  1RE3 A;  1PL5 A;  1FOC A;  3L4F A;  4L73 A;  1EDJ A;  1U7M A;  1ETP A;  2RH0 A;  1KOR A;  3PP5 A;  5BU8 B;  3VN0 A;  1N7S B;  1SLQ A;  5KAI H;  2BCC G;  2W6A A;  2B0Z B;  2KB7 P;  2B12 B;  1IFP A;  4H13 C;  3RL0 B;  2GIW A;  3EFG A;  3H1K E;  1K9M Q;  1D7M A;  1K05 A;  1HJB A;  3NBS A;  2K88 A;  3O1Y A;  1Z56 A;  3GLM A;  1JMM A;  1SQV G;  3CX5 D;  4H0K A;  5DJQ B;  2QG4 A;  2OTK E;  2E75 C;  1YJN P;  1FZA A;  1YIC A;  1IFI A;  1Q7Y Q;  4TT3 H;  3OW2 O;  2ZYD A;  1OWA A;  1OVR A;  1A2S A;  3M9Q A;  5DJT B;  5B66 V;  3PLN A;  2K9Y A;  1KZU B;  1HCM A;  2XZR A;  1MG3 D;  4IL6 H;  2CA3 B;  5KLV D;  3CC4 P;  1KQS O;  2CE0 A;  1DII C;  2GUV A;  1KMI Z;  3L75 G;  3M9H A;  1HWT C;  4K35 A;  1HRO A;  1KB9 H;  3EFF K;  5AW3 B;  2E76 C;  1PIX A;  2HOD A;  4D6T D;  1L0L D;  2KUB A;  3U1C A;  1G2C B;  4Q5P A;  5KAF E;  3R4Y A;  1T2K C;  1SQV K;  1USD A;  1JY3 N;  1IFD A;  1PGQ A;  3TF5 A;  1HF9 A;  1DX7 A;  3BRT B;  3SVW A;  4DT0 A;  1I55 A;  4P4Q B;  4QAO A;  3RGU A;  2XDJ A;  3HQ6 A;  1FHB A;  3L36 A;  2BEQ D;  1CSW A;  1VQ6 P;  1N7L A;  4Z1M H;  4Y5R A;  3BCC G;  3TYI A;  4WB4 A;  2NRG A;  3H1H J;  2MJZ A;  3AEE C;  2D2C D;  1WVE C;  1BGY D;  1URQ C;  5B5E H;  2YCC A;  1SQX J;  1L0N J;  1L9J C;  1HVV A;  3CXH H;  3IF4 A;  4GKG A;  3CWB D;  4XE5 B;  2IZ1 A;  4WBA A;  1A8C A;  2GUS A;  1EZV G;  1YNR A;  2XKM A;  2ZVO B;  3ZBM A;  3L73 E;  1AQ5 A;  1OCD A;  1N15 A;  1DD3 A;  2MHM A;  4PV1 C;  2ZT9 C;  2JKV A;  3QH9 A;  2Q3E A;  1J1E B;  3MUD A;  2HOD B;  3UIA A;  3VTP C;  3CCU P;  2XU6 A;  2P1J A;  3SXT A;  1VQ9 P;  1VDF A;  5KAF V;  1YYC A;  1CIF A;  3PH2 B;  1K3H A;  1QX8 A;  1PPJ E;  1M56 D;  4N0K A;  3WUU A;  1ZLL A;  2E74 B;  1JM0 A;  2L91 A;  1KFN A;  4HKZ H;  3IFM A;  3RK2 B;  1PGP A;  2GC4 D;  2YXQ B;  3USS A;  1RE4 A;  2XV5 A;  3F5H A; 
#chains in the Genus database with same CATH homology
 4DY9 A;  3ZCF A;  5DFS A;  1KB9 D;  2D0S A;  2CA4 B;  1FI7 A;  2ZBO A;  3VYM A;  4FA5 A;  1LMS A;  4EIE A;  1CTJ A;  1CSV A;  4RJT A;  2D0W A;  1CRJ A;  3CP5 A;  1HZV A;  1NML A;  1CSX A;  2FYN B;  3H1J D;  4KMG A;  1CYJ A;  2AI5 A;  1GJQ A;  1P84 D;  3H1H D;  1DW0 A;  5CIE B;  3RLM A;  4H0J A;  2V07 A;  1E29 A;  1H31 A;  1SQX D;  1L0N D;  3PTZ A;  1QKS A;  1KYO D;  2L4D A;  1HJ5 A;  2ZOO A;  3O5C A;  2QJP B;  2N18 C;  3ZIY A;  4WQ7 A;  1YTC A;  2O3J A;  2CXB A;  1HRC A;  1DVV A;  1F1C A;  1M70 A;  4U3F D;  1CCH A;  1CYI A;  1DW1 A;  1KX7 A;  3CXH D;  1BCC D;  1FI9 A;  2LIR A;  2N18 B;  1CRI A;  3H1L D;  3SLE A;  2JTI B;  1AYG A;  2BPB B;  3H1I D;  4PD4 D;  3L4M A;  1NTM D;  5H2F V;  1C75 A;  3L70 D;  5TIS V;  1N90 A;  1S5L V;  3GW6 A;  1CTY A;  3HQ7 A;  1NNO A;  1JDL A;  1I6E A;  4J20 A;  5CYT R;  1B7V A;  2BCC D;  4FAN A;  3ITK A;  2N3B A;  1NIR A;  4AAM A;  3NBT A;  3A9F A;  1MG2 D;  5C0Z A;  1U75 B;  1YFC A;  2FWL A;  2BCN B;  2IBZ D;  1CXA A;  1DIQ C;  3SWS A;  1LFM A;  1CIH A;  2JWA A;  1CRH A;  1C7M A;  3PXT A;  3H1K D;  1YEA A;  5CIG B;  155C A;  1QYZ A;  1H31 B;  3ZOX A;  1CYC A;  2FYU D;  1M60 A;  2JQR A;  2Y0E A;  1YEB A;  3RN0 A;  1CHH A;  1I6D A;  5CIH B;  3WUI A;  3VRD A;  5B5E V;  1BE3 D;  1HH7 A;  5GTI V;  3TGU D;  1NMI A;  1K3G A;  2ORL A;  1QL3 A;  4K3I A;  1SQQ D;  3ZOO A;  1U74 B;  1C2N A;  1RZ6 A;  351C A;  2AXT V;  4A7P A;  2YIU B;  2DVH A;  4FAV A;  1QN2 A;  2N9Y B;  1I8O A;  3CYT I;  3HQ8 A;  3A0H V;  4AAN A;  3C2C A;  2Y0D A;  1SQB D;  1WEJ F;  5KAI V;  451C A;  4AAO A;  2B10 B;  3KHU A;  3CX5 W;  4PWA A;  1IO3 A;  3X39 A;  3DP5 A;  3PXW A;  1CRY A;  2QJK B;  1FCD C;  4JCG A;  1LC2 A;  5KLI B;  4WQ8 A;  3WFB C;  1FI3 A;  3L4O A;  1DVH A;  4PJ0 V;  1C6S A;  1H9Y A;  1MZ4 A;  1SQP D;  1YCC A;  2GC7 D;  5EXQ A;  2KS1 A;  1NU1 D;  2KNC B;  4WQA A;  2C9X B;  5E79 V;  3PRJ A;  3SJL A;  1CHI A;  2V08 A;  3L72 D;  1COT A;  4L3G A;  2OZ1 A;  2C1D A;  2AIU A;  1CHJ A;  4WQD A;  4NFG B;  1FJ0 A;  3DMI A;  1KIB A;  1HJ3 A;  1W2L A;  4WQB A;  4IL6 V;  1IRW A;  2EXV A;  2XTS B;  5GTH V;  2YQB A;  5AUR A;  3NWV A;  1H1O A;  4FB1 A;  1A56 A;  2BLF B;  1I54 A;  3WC8 A;  2C1V A;  3ZOY A;  4GED B;  4MU8 A;  2I8F A;  5DF5 A;  3ZOW A;  2ZXY A;  5IY5 1;  3GG2 A;  1EZV D;  1FOC A;  4PW9 B;  5CIC B;  1ETP A;  1DT1 A;  2DGE A;  1J3S A;  5CID B;  1CRG A;  3OA8 A;  1DW2 A;  2B0Z B;  2B12 B;  1ZRT D;  5DJQ C;  1IQC A;  3CU4 A;  4FA1 A;  1KB0 A;  1E2R A;  3VNW A;  1AKK A;  2GIW A;  1IZL 0;  1SQV D;  1I8P A;  2K9J B;  1NTK D;  1KV9 A;  3NBS A;  2ZZS 1;  3O1Y A;  3FWL A;  3PXS A;  4AX3 A;  3CX5 D;  4H0K A;  4UB8 V;  3RMZ A;  5CIF B;  5DJQ B;  4LJI A;  2QG4 A;  3OCD A;  1GIW A;  4EIF A;  1YIC A;  1YIQ A;  2GB8 B;  2LIT A;  1A2S A;  4FA9 A;  1GDV A;  5B66 V;  3PLN A;  2BH5 X;  3TDK A;  1HCM A;  2OZ1 B;  2C1D B;  3HQ9 A;  1MG3 D;  2PCC B;  5TJH A;  1EB7 A;  2CA3 B;  5KLV D;  3L75 D;  1PPJ D;  4WQC A;  1AOQ A;  2BH4 X;  2N9J A;  1RZ5 A;  2CE0 A;  1DII C;  1GKS A;  3RN1 A;  1LC1 A;  2Y0C A;  1H33 A;  1BL9 A;  1HRO A;  2ZON G;  3M97 X;  2PCB B;  3O20 A;  3A0B V;  4EID A;  1M6Z A;  4D6T D;  1CIE A;  1L0L D;  3WFD C;  2N9I A;  4Q5P A;  1PP9 D;  2RMZ A;  3TF5 A;  3L74 D;  2MTA C;  2A06 D;  1CO6 A;  1N9C A;  1R0Q A;  1N50 A;  3SVW A;  1I55 A;  4P4Q B;  4QAO A;  1CXC A;  3OA8 B;  3HQ6 A;  1FHB A;  2BGV X;  1VYD A;  1H32 A;  1CNO A;  1CSW A;  1CSU A;  3L71 D;  3BCC D;  1L9B C;  1HZU A;  1CTZ A;  4AAL A;  3WU2 V;  4O1W A;  4Y5R A;  1I5T A;  3TYI A;  1F1F A;  2HV4 A;  3VMA A;  5B6Q A;  4L3H A;  4XYD B;  1IRV A;  1WVE C;  1BGY D;  1COR A;  1QL4 A;  5KKZ B;  3MK7 C;  2YCC A;  3OCD B;  1C52 A;  1E8E A;  4GYD A;  1L9J C;  5C9M A;  1GQ1 A;  2C2C A;  1W5C T;  1DW3 A;  1CCR A;  3CWB D;  1AOF A;  1KX2 A;  4XXL A;  1CIG A;  1A8C A;  2VHD A;  1YNR A;  3MK7 B;  1GU2 A;  5CIB B;  1CRC A;  3JBT B;  3ZBM A;  2PAC A;  1C6O A;  1KYO W;  1OCD A;  2C1U A;  1N15 A;  2B4Z A;  1S6V B;  1NTZ D;  1RAQ A;  1H33 B;  2B11 B;  4L1Q A;  4YE1 A;  3WFC C;  2MHM A;  3L73 D;  3KZI V;  3WFE C;  2QJY B;  2C8S A;  1RAP A;  1HJ4 A;  2Q3E A;  3DR0 A;  2FRC A;  2YK3 A;  2RN0 A;  1C2R A;  3CXH W;  1C6R A;  2N3Y A;  3SXT A;  1CC5 A;  5KAF V;  1H9X A;  1CIF A;  3PH2 B;  4WQE A;  1K3H A;  1ZZH A;  3O0R C;  1CED A;  4N0K A;  4UB6 V;  4EDF A;  4RSZ A;  4O1Q A;  2L91 A;  4FA4 A;  1OAE A;  1H32 B;  4EIC A;  4V2K A;  3PHL A;  4WQ9 A;  2GC4 D;  2CE1 A;  1LS9 A;  3ORV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...