4D6TD

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
240
structure length
240
Chain Sequence
DLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
total genus 67
structure length 240
sequence length 240
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4d6tD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4d6tD02
2B12B 4WQ7A 4GEDB 1PPJD 5CIDB 2O3JA 1E29A 4WQAA 1KB9D 1SQBD 3PRJA 3SJLA 1FI3A 5TJHA 3L4MA 2C8SA 5AURA 4O1QA 3FWLA 1HCMA 1J3SA 2D0SA 2CA4B 3H1HD 1HJ5A 1SQQD 1U74B 3L74D 3RN1A 1KX7A 2N18B 3DMIA 1COTA 4L3GA 2GC4D 1AOFA 1M60A 1H9YA 1GKSA 1U75B 2QJKB 2BGVX 4P4QB 4Q5PA 2EXVA 2N9IA 4QAOA 1GU2A 4O1WA 3CP5A 2JQRA 2XTSB 3HQ6A 1CHHA 3A0BV 3L4OA 1DIQC 1RAQA 3A9FA 1C6SA 1S6VB 1M70A 1HRCA 1CIHA 1RZ6A 5IY51 2ZBOA 3ZOXA 4WQDA 4FANA 2N9YB 2BCCD 5KAFV 3O0RC 2KNCB 1W2LA 2I8FA 3RN0A 1CRJA 1HJ3A 4AAOA 4RSZA 1AOQA 1DVVA 1YCCA 5B66V 1SQVD 3PXTA 1L0LD 4N0KA 2QJPB 3CWBD 4KMGA 2JWAA 4RJTA 1SQPD 1WEJF 1WVEC 2C1UA 2YCCA 4XXLA 1H1OA 1EZVD 1CTYA 1IQCA 2OZ1A 3GG2A 2ZONG 1KYOD 1MG3D 1F1CA 3WFBC 2N18C 1NIRA 4PW9B 3WU2V 1CYCA 2BCNB 1GQ1A 4AANA 1GIWA 3OA8A 5H2FV 2A06D 2B0ZB 2AXTV 5C9MA 3VRDA 2N3BA 3ZOWA 3CXHW 1JDLA 1HZUA 2ZXYA 3MK7C 4PD4D 3L75D 4PWAA 1I8OA 3OCDA 4FA9A 1H32A 1FI7A 1QKSA 2BH4X 4LJIA 4J20A 1FI9A 4AALA 4FB1A 2BPBB 4D6TD 1LFMA 2Y0CA 3A0HV 1I8PA 2BLFB 5GTIV 1DVHA 1CSXA 1IZL0 1QL3A 3NBSA 1NTZD 4Y5RA 1AYGA 3L70D 1N50A 2JTIB 1S5LV 1I54A 5DFSA 1KYOW 1NTKD 4AAMA 3GW6A 2GB8B 1C7MA 1LMSA 3O20A 2B11B 1CYJA 1DIIC 2Q3EA 1E2RA 2FWLA 3MK7B 4GYDA 5CYTR 1KV9A 1BCCD 4EICA 1CHIA 5KLIB 4FAVA 1H33A 2L4DA 3VYMA 1DW1A 1CXAA 2PCCB 4FA5A 1BGYD 1DW0A 1A56A 1ETPA 1M6ZA 1ZRTD 5CIHB 1YEAA 2MTAC 1L0ND 3TYIA 1K3HA 1W5CT 2V08A 1CRIA 3ZBMA 1OAEA 1YEBA 1C2NA 1MZ4A 3PTZA 3WUIA 3CU4A 3O1YA 3CX5D 1C75A 1CORA 3WFEC 1N9CA 4WQEA 4XYDB 1LC2A 2QG4A 1H31A 5E79V 4MU8A 1YTCA 1FJ0A 1YNRA 3TF5A 1HROA 2GC7D 4H0KA 3L72D 1KX2A 1C2RA 3H1JD 3O5CA 1CTZA 4EDFA 3TDKA 3PXSA 2K9JB 3JBTB 2KS1A 2YQBA 1BE3D 1FOCA 3SWSA 4FA1A 1H9XA 1CIFA 1QN2A 3ZOOA 4PJ0V 2YK3A 2ORLA 2OZ1B 3HQ9A 3C2CA 1H33B 1CYIA 1C52A 1L9BC 2PACA 3TGUD 2CA3B 4A7PA 1CIEA 2IBZD 3HQ7A 4DY9A 3NWVA 1L9JC 1A2SA 1AKKA 5CIBB 3VMAA 1LS9A 2C9XB 1YFCA 1CTJA 3ZIYA 3OA8B 2DVHA 1NU1D 3SLEA 3WFDC 1FCDC 2CXBA 3H1KD 1KB0A 4L3HA 1NTMD 1F1FA 3DP5A 4EIEA 3ITKA 3CYTI 2AIUA 4UB6V 2B10B 3CX5W 4UB8V 1CHJA 5EXQA 1CSVA 3L71D 3HQ8A 2AI5A 1OCDA 2V07A 1RZ5A 2RMZA 2Y0DA 1PP9D 1H32B 5KAIV 1I6DA 2Y0EA 1C6RA 1HZVA 1C6OA 1CRHA 1VYDA 5CIEB 1CRGA 1CC5A 1I6EA 2ZZS1 1CCRA 3VNWA 3L73D 3KZIV 2N9JA 4IL6V 1CO6A 3WC8A 3H1LD 1CSWA 1GJQA 1MG2D 1IRVA 3ZOYA 2B4ZA 4YE1A 4H0JA 4AX3A 1GDVA 1I55A 5CICB 1P84D 4K3IA 3H1ID 1SQXD 1NMIA 3ORVA 1CSUA 1CNOA 4NFGB 1E8EA 2RN0A 1CCHA 1I5TA 1N15A 5B6QA 1CXCA 3RLMA 1A8CA 1HH7A 4EIDA 3PH2B 1BL9A 1NNOA 4WQBA 3ZCFA 3X39A 4FA4A 1IRWA 5C0ZA 2C1DB 1HJ4A 3BCCD 155CA 3PHLA 1LC1A 2LIRA 4V2KA 3CXHD 3PLNA 1DT1A 4WQ8A 3SVWA 3M97X 5TISV 5KLVD 1ZZHA 5GTHV 1FHBA 4WQCA 1IO3A 2FYUD 1QYZA 2C1VA 4JCGA 2N3YA 4U3FD 4L1QA 3OCDB 2ZOOA 351CA 1DW3A 1K3GA 1R0QA 2C1DA 1CEDA 1N90A 2CE0A 1B7VA 1DW2A 2PCBB 2BH5X 1CRCA 5DJQB 1KIBA 5KKZB 1CIGA 2VHDA 2D0WA 1CRYA 2FYNB 2LITA 5DF5A 2MHMA 4WQ9A 5DJQC 2FRCA 5B5EV 451CA 1QL4A 3SXTA 3RMZA 2DGEA 5CIGB 2CE1A 3WFCC 1YIQA 2GIWA 1YICA 2YIUB 2HV4A 5CIFB 3KHUA 1EB7A 2QJYB 1NMLA 4EIFA 1RAPA 3DR0A 3NBTA 3PXWA 2C2CA 1H31B 2L91A
chains in the Genus database with same CATH superfamily
3H25A 3AECC 2IDBA 1S2EA 3VYIA 4JYCA 3D6YA 4WQAA 5APUA 2W6JH 1AA0A 1LWUC 1S4XA 3IFMA 2JR8A 4DZOA 3L72J 1QX8A 2QM8A 2OGUA 1URQC 1J3SA 1FZAA 5AVZB 3CXHI 2D0SA 5KKZC 1HJ5A 1SQQD 1OIPA 2N18B 5K5GB 2KK7A 2A06G 1M60A 1QL2A 4GDOA 3G71P 4PD4H 3HUSA 4L73A 2YKOA 2BGVX 1H89A 5AW7B 2XTSB 2BEZF 3H1JJ 2WZ7A 3L4OA 3TNUB 1MFTA 1DIQC 2C9LY 2V7QH 2E74D 1VL2A 5TISE 1HRCA 4PV1D 1LNQA 1CIHA 3WUVA 1RZ6A 2K9YA 5AW0B 3AE4C 1W2LA 1FOSF 1JY2N 5DJUB 1GZLA 3BATA 4RSZA 1AOQA 3H1LJ 4N3YB 1IFMA 2JWAA 1WEJF 2C1UA 2R5DA 1H1OA 1JUNA 1EZVD 1CTYA 1HWTC 4D6TG 2W83C 1N73B 2MKVA 2BCCE 2OYHB 1JMMA 3WFBC 1JCDA 1OW8A 2KZIA 1SQPG 4H44B 2BCNB 1HGZA 1GQ1A 1GIWA 4XA4A 2HG5D 1S1CX 2IYOA 2XZRA 3VRDA 1PIXA 1EDIA 1SVFA 3VN0A 2N3BA 2YO3A 3CXHW 1JOCA 4PD4D 3OCDA 2BCCJ 3H1HE 1AJYA 1GL2D 3B5NC 4LJIA 1T8ZA 2Q6QA 2QRXA 3AE5C 1EDJA 2BPBB 4D6TD 3S4RA 1N86A 1JTHA 1T3UA 4I6MC 3V5BA 1U57A 3MP7B 1IJDB 1BSHA 1ZW0A 3CCRP 1DVHA 1CSXA 1IZL0 5GTHH 1ZXGA 5M1BA 1SFCB 3CWBG 1FBMA 4H0LC 1N50A 2B87B 1FZCA 3VMXA 5DFSA 1NTKD 1SQXJ 2LR2A 1LMSA 2B88A 3O20A 1CYJA 1DIIC 3L70J 2P1JA 1RH5B 1L2PA 1NTZE 3MK7B 4GYDA 4C7RA 4GT1A 2G3AA 3MZWB 1YTZI 3D0WA 5KLVJ 5AVTB 1IK7A 1DW0A 1YTZT 1ZRTD 1P84H 1KORA 3TYIA 2V08A 1YBKA 3TSIA 4JBZA 1YEBA 4W80A 1C2NA 4EOTA 1NU1G 3O6QB 3O1YA 4ZNCA 3CCUP 4YTPC 1C75A 4WQEA 4HJGH 2D2CC 2BCCG 1LC2A 2WITA 1XTCC 1URQB 3TGUJ 1KN7A 5CHXA 1SFCC 1YTCA 1AVOA 1HROA 2GC7D 4PV1B 1FE6A 5APSA 2N1TB 3EQ2A 2ITAA 1L0NK 4JF7A 3VOPA 4YXDC 2A45I 3WUTA 2R32A 4Z1MH 2KS1A 2HODA 3E1RA 1BE3D 3S9OA 3P8MC 4PJ0V 2P10A 2WVRA 2W27A 3A0HH 1LTGC 1LP1A 4DOJA 3HQ9A 1DH3A 1K9MQ 1J1EC 5C39A 3Q3DA 1L9BC 2PACA 2JJLA 2LXBA 3LIEA 3L74G 3H1HJ 3NWVA 1L9JC 1NU1J 3T97B 1BDDA 5CIBB 4H13C 1X22A 2WSFJ 3G4SP 1LS9A 2C9XB 1CTJA 2OYIC 2OTLP 2LXCB 1EDKA 1K73Q 1FCDC 1ZR2A 1NTMD 1F1FA 4EIEA 2AIUA 4L76A 4D6TE 1HGVA 2IFMA 2XKMA 3AE7C 3MGNA 1FZCB 2KUBA 2FYUJ 1Q2NA 4C7NB 1RZ5A 2Y0DA 5APVA 1KV4A 1I6DA 3CMAP 1RQVA 5E79E 1C6RA 3IAOA 3CI9A 2H43A 3MTUE 1HUCA 1CRGA 3CC4P 2AXTE 3CCSP 1CW5A 4HH2A 2B4ZA 2YXQB 4H0JA 3TK1A 3H1HG 3EFGA 1DD4A 1NAFA 2A45H 1E8EA 1N15A 2M3BA 5CJ0A 2Q5UA 1JY2O 3E1IA 2KSEA 4CPGA 1A8CA 1KQGB 3P8CD 1USDA 4ASWA 4WQBA 3X39A 5DJTB 1RF1A 1WRGA 3II6A 3M0DC 3T97A 1KILD 3CXHD 1MFZA 4WQ8A 3SVWA 3H32B 1FHBA 4WVZA 2FYUD 1QYZA 2C1VA 4JCGA 1S3JA 2OQQA 3L74J 4NPEA 1KQFB 4U3FD 351CA 1DW3A 1K3GA 3D71A 1R0QA 3SWKA 4XFJA 1KB9E 4R4MA 3Q5SA 2C1DA 1B7VA 2J58A 2PCBB 4HKZH 1NH4A 3GLMA 1CRCA 1KIBA 2VHDA 3CCVP 1PFIA 1K04A 4WQ9A 2JDIH 1HJ0A 2FRCA 1R5LA 5KAIE 3I56P 1YICA 2JKVA 1BGYJ 2Z5IA 3SWYA 2HV4A 1NGMB 4IFDK 1NTMK 1BGYE 1SQPK 1VQ5P 1FJKA 1LWUA 1VQ9P 2WPSA 3V2RA 1KYOE 4GEDB 3HTKB 5CIDB 3VMYA 2QEXP 1SQBD 1N73C 3L4MA 1G1JA 2YMKA 3HD7C 3CWBE 2C8SA 2KI7B 2E42A 3KZIH 5APYA 3FWLA 4C46A 1U74B 4LLHA 4TLFA 3DMIA 1COTA 4PD4E 2GC4D 1A02J 2POHA 1KYOH 3B71A 5CCHA 2K37A 5APXA 1H9YA 4NPDA 1GKSA 4L74A 5AVRB 2QJKB 2EXVA 1FDMA 4QAOA 1GU2A 3CP5A 1IFDA 2WPQA 2GUSA 3HQ6A 3A0BV 3L75G 1GMJA 2R44A 1LT9C 3HRNA 3M0AA 1RAQA 1M70A 1JO5A 1FU1A 1RHZB 1GU5A 2N1TA 2KXPB 1VQ4P 3V2QA 3CWBJ 1QL1A 2I8FA 4U3FJ 3RBXA 2O1JA 3L72G 1HJ3A 4AAOA 1PGPA 2QJPC 1X9VA 1W2BO 1N73A 1DVVA 1Y47A 2D2CB 1IFNA 2FYUE 3MIWA 1RF1B 1N7LA 1L0LD 4N0KA 3O8ZA 2QJPB 4DT0A 4KMGA 3L70G 4YXWH 3JSVC 1L4AC 2Q1KA 1OXZA 3HE4A 3GG2A 1NOHA 3G9RA 1KYOD 4EI2A 4AYCA 2ZT9D 1J1DB 3RBZA 1F1CA 2N18C 3BCCG 3HD7A 4PW9B 3WU2V 1G2CA 3AE3C 2YIUC 2Z5HA 3RL0B 5APWA 1CYCA 3H1JE 2E74B 2W6BA 1IK9A 3OA8A 4RO0A 2OYIA 2A06D 3P32A 2AXTV 2YNYA 3WMM0 3F5HA 2NZ2A 2QJYC 4H44D 4U3FG 3N4XA 1M57D 3A0HE 2Z4EA 2O01H 1I8OA 1BCCE 3AE2C 2C0XA 1FI7A 4ZMDA 3NXSA 3L72E 3Q1MA 1FI9A 3RK3B 4R4LA 1HF9A 1KB9I 4FB1A 3A2AA 2Y0CA 2N1TC 2OTKE 1I8PA 3MUDC 4PJ0E 2E5TA 1QVFO 4WY4C 1EZVG 5GTHE 4H13B 3D6ZA 3H1KE 1QL3A 1ZLLA 3NBSA 4Y5RA 1AYGA 1LJ2A 4K3AA 3RK3D 3H1IG 4GODA 1KYOW 2KYVA 3B5ND 3GW6A 2GB8B 1ZRTE 2KS1B 2B11B 1LTJC 3TYYA 5TISH 2Q3EA 4M3LA 3FWNA 2FWLA 3PH0A 3V4QA 1PGJA 2YKQA 1BCCD 5CBOA 4EICA 1CHIA 1PP9G 1NTKG 1JY2P 4GOEA 1JNMA 1GDTA 3VYMA 3SFEC 2ZXEB 3W67A 1SP4A 1BGYD 1KFMA 2FXPA 5CCGD 1YEAA 3M06A 1NWQA 3QWOC 2KB7P 1YJ9P 2WPRA 1MZ4A 1NTME 5B5EH 2HFED 3BVHA 3WFEC 3I5CA 1M8OB 1OWAA 1GU4A 1SQXG 2QG4A 1A02F 2QM7A 1FJ0A 3L72D 1N7SB 2CK3H 1SQXE 2L5GB 1C2RA 3M9QA 3TDKA 2I8DA 3WUUA 3L73E 1NJIQ 1FZEA 4BRYB 2WQYC 1R5SA 1CIFA 1QN2A 4PD4I 1N7SD 1OZHA 3C9IA 2YK3A 2ORLA 3HE4B 4N78D 2IYPA 3H1IJ 1L0LE 5AW5B 4ZKPA 2E76C 2CA3B 1MKMA 1CIEA 1HTLC 4DY9A 1X0TA 3ZIYA 5B66E 2NPSC 3OA8B 2DVHA 2GM4A 1ZV8A 1NU1D 1JY3P 2OYOA 3H1KD 2CXBA 2K1AA 4WWIA 1NTKJ 1TU3F 3CX5E 3M91A 3CYTI 2HYNA 1ZMEC 2FBWC 3SSUA 3TGUG 1FAVA 1AQ5A 1CHJA 3CL3D 3H1IE 5EXQA 1MV8A 1OCDA 3H1LE 3WU2E 2QIWA 2V07A 5KLIC 1H32B 3Q2YA 4OVNF 5CCGA 4OWFA 3HD7D 1VYDA 3RL0C 1CC5A 3L73D 2N9JA 4IL6V 1CO6A 3A5TA 1CZQA 4XE5B 2P58A 3CCQP 3AE9C 4BWNA 4AX3A 2A06E 1I55A 4K3IA 1M7LA 1SQXD 1LWUB 3ORVA 5B6QA 3R2PA 1RF1C 4BRYA 1KFNA 1BDCA 4EIDA 3PH2B 2H8PD 1LP1B 1NNOA 2Q9IA 1L4AB 1IRWA 1W2EA 2OYIB 3BCCD 3L74E 3AE1C 2LIRA 4V2KA 1EZVI 1JEKA 5KLVD 1EC5A 1SQVE 2E74C 1KB9H 5KLVE 2PGDA 2ZOOA 4PV1C 3LW5H 2JP3A 1X8YA 4YPCA 1MZ9A 1VF5B 1N90A 2CE0A 2RKLA 1DW2A 5CCGC 3VTPC 1PPJE 2W90A 1R8EA 2H88C 1CIGA 2GA1A 1CRYA 2FYNB 2LITA 4I1LA 1KILC 2AXCA 2WMMA 5CIGB 2CE1A 1WT6A 1VQMP 1YIQA 2ZT9C 3GMAA 1VQ8P 1NMLA 4EIFA 1H31B 2O3JA 1E29A 1FDIA 1RQUA 1KB9D 3MHVA 3PRJA 3CPWO 1SQQE 1FI3A 5TJHA 3L37A 4TT3H 5APQA 3P7KA 2YXRB 3QH9A 4H44C 2KSJA 4PJ0H 1HCMA 5CCHC 1VQ7P 4ASVA 3HE5A 3H1HD 2R5BA 5APTA 3L74D 3RN1A 3BRVB 1OW7A 3TNUA 3L70E 2FFDB 1HJBA 5AVSB 4C7NA 4WBAA 2C0WA 1U75B 4P4QB 2MJZA 1GL2C 1L0LJ 1S9KD 1BGYG 2KLVA 3GF7A 4O1WA 2JQRA 2WSSH 1M1JC 4H0LB 1CHHA 3B8EB 1P84I 1VPCA 2WWWA 1S5LH 1G1IA 1C6SA 1S6VB 1IFIA 1YIJP 4IL6E 1FZGA 5IY51 2ZBOA 5BU8B 1N7SA 4WQDA 2HLOA 3C8VA 1JY3O 2N9YB 2M0BA 2QE7H 5KAFV 3IR9A 1H0TB 2WTYA 1SQVK 4H0LD 1KQLA 3RN0A 2O01J 3HUSC 1L4AA 1SQBJ 2UWJE 3SFDC 1EXIA 5BVZA 2XU6A 2IX7C 3PXTA 1AV1A 3HD7B 4RJTA 1SQPD 1AVYA 3L71J 2YCCA 4XXLA 3CLQA 1IQCA 2ZONG 1MG3D 2KZJA 2HR3A 1L0LG 5AVUB 2ZYAA 1NTKK 1YQ3C 2AXTH 2FYZA 1ZP0C 4AANA 2B0ZB 5C9MA 3SWFA 1QVGO 4K35A 1JCCA 1JDLA 1HZUA 1HVVA 3L75D 4PWAA 3CCEP 2D2CD 2WSEJ 1JM0A 2V7QJ 2XNXA 1QKSA 1GW3A 2Q3IA 2BH4X 2ZYDA 5KAFH 1MUUA 1YYCA 3L71E 2PFXA 2V4HA 1SS1A 4AALA 1L0LK 3A0HV 2XDJA 1J1DC 1N2DC 1SQBE 3BCCE 4IL6H 1KMIZ 3CMEP 5GTIV 4IFMA 3BCCJ 1FOSE 2E76D 1T2KC 1CI6A 1NTZD 2NPSB 3L70D 1LTIC 1H88A 1OVVA 5CJ4A 2K3RA 1S5LV 1I54A 4IFFA 1LTBC 4AAMA 1SQBG 1S72P 2M3EA 3L73G 1S9KE 2XNDH 4H13D 2N1TD 5CYTR 4OH8B 2B87A 5KLIB 3B5NB 4HYTB 3ZDMA 3E7KA 4O9BA 2L4DA 1VDFA 2KLUA 2LKMA 1IO4A 4FA5A 3OA7A 2P67A 4BXLA 1M1KQ 1ETPA 1FC2C 2OTJP 1M6ZA 5CIHB 3RL0D 3IN6A 1K3HA 3ZBMA 3U1CA 5EFWB 1URQA 2WPVB 1LT1A 3PTZA 3CU4A 3CX5D 1OVUA 4RKUJ 1N9CA 1LTSC 4XYDB 2JWDA 3KYQA 4B86A 2PRRA 1H31A 2O01N 3V4WA 1OVRA 1YNRA 3TF5A 3L73J 1SLQA 1KX2A 1YJNP 1CTZA 1ZN5A 1GD2E 3PXSA 1PPJG 1YI2P 1PP9J 2WT7A 3H1KJ 3JBTB 3BASA 5AVVB 3OW2O 1FOCA 1FDOA 3BRTB 1VF5C 1H8AA 1H9XA 3ZOOA 3P8CE 2OZ1B 4AUWA 1T6AA 3AE6C 3C2CA 2FYNC 4W7ZA 1GK6A 2HODB 2IBZD 1SQVJ 3HQ7A 3L35A 1KILE 1AKKA 4KJMA 3VMAA 2RH0A 4GIFA 1YFCA 2ZYGA 1RF0C 3RK2C 3WFDC 1KB0A 4L3HA 2E75B 1M1JA 4ZKUA 4WY4B 3FGAD 3FX0A 5AW1B 3CX5W 3MUDA 2ZVNB 1LGHB 2E75C 4UB8V 3VP9A 4KT0J 5GTIE 2YO2A 3L71D 2KNCA 3HQ8A 1M1JB 3EFFK 2RMZA 2B9BA 3C1LA 1PP9D 4QMAA 4UB8E 2P7JA 3L75E 1CRHA 4Y99C 1QEXA 1CCRA 3VNWA 2W8ZA 3ABVC 1OMIA 3KZIV 1SQQK 1Y8AA 2J5UA 3WC8A 3H1LD 1CSWA 1GJQA 1MG2D 3B5NA 4YE1A 1KZUB 2C9NY 5CICB 1P84D 3H1ID 2WT7B 2DW3A 1CSUA 3PP5A 2IPPA 1CCHA 1I5TA 3IF4A 1CXCA 2G8YA 3RLMA 3L36A 3FXEA 2IZ1A 1YITP 1BL9A 1Q90D 3CCMP 5B5EE 3ZCFA 2KOGA 3CCLP 2C1DB 155CA 2FYUK 2I1JA 3RK2B 1LC1A 5AW3B 2WSCH 1FZCC 1KD1Q 3M97X 5TISV 1CSBA 2QA4P 1DEBA 1ZZHA 5GTHV 4WQCA 1RE3A 2FFDA 3W68A 1SQVG 5KAFE 2B89A 1FZBA 4U7JA 5KLVK 4LGDE 1KILA 5AW4B 3S1KA 2BH5X 2HPCB 5DJQB 1SQQG 3VP8A 5KKZB 2D0WA 2P2UA 5DF5A 3D70A 2MHMA 1RE4A 5DJQC 1L0NG 2XV5A 5B5EV 451CA 3SXTA 3LW5J 1DEEG 5KJ7D 1BSNA 2YIUB 5GTIH 1D7MA 5CIFB 2WSCJ 3KHUA 3H1JG 1EB7A 2I1KA 5E79H 1OFCX 1L4AD 1RAPA 3DR0A 2L91A 2B12B 1KTMA 4WQ7A 1BCCJ 4UB8H 1PPJD 1ZOYC 2K88A 1PGQA 2IBZI 3A0BE 3B4SA 3SJLA 1SQPE 1GK4A 3M9HA 2R3SA 2VRSA 1JTHB 3LIDA 3U59A 5AURA 1P84E 4O1QA 1OX3A 1FJPA 1VF5D 3H1LG 4RESB 1KQSO 2IBZG 1HH0A 1NTKE 2CA4B 4I2LC 1KX7A 1GW4A 4AQRD 1U7JA 2KIKA 1QGKB 4L3GA 1E79H 1AOFA 1Y9BA 1Q82Q 1L0NJ 4D6TJ 4N6JA 3FXDA 5H2FH 3L4FA 4Q5PA 5L8RJ 2N9IA 2ZT9B 1RE4C 1NU1K 1LTJB 1H0TA 5CBNA 2H89C 1S5LX 1IFJA 1KILB 1NHLA 3A9FA 5CCHD 2GUVA 2HPCA 4W7YA 1JMBA 2E75D 4WY4D 3CX5I 3ZOXA 3M0DA 4FANA 2BCCD 3O0RC 2KNCB 1SQQJ 1VQ6P 5KAIH 1GTWA 1CRJA 3UIAA 5H2FE 2IBZE 2WSEH 3VMZA 1SQBK 1YCCA 5B66V 1SQVD 5AVWB 3H6PA 3CWBD 2YKPA 1WVEC 4IOIH 1LT9A 3RL0g 1IFPA 2IZ0A 2OZ1A 1SQXK 2QJKC 1DIPA 2ZJSE 2FKWB 1AQTA 1NIRA 3KXDA 2QSIA 3HE5B 5BU5A 3AEGC 3AEAC 5H2FV 4EYYQ 2A45G 2WSFH 3OAKA 2AEJA 1UIXA 4JYBA 2ZFCA 1NO4A 3AE8C 3M9BA 3ZOWA 4UB6E 1G2CB 5CMZA 3GF3A 2JO1A 1URQD 3MK7C 2ZXYA 1NVOA 2SPZA 1NAYA 2J59M 4FA9A 1E5WA 1H32A 4I7ZB 1PP9E 5AW6B 1BE3J 1CI6B 1PV3A 1KC8Q 4J20A 3L71G 2PAJA 3CXHE 4IL6X 1LFMA 1M56D 1IZNB 3OJAB 4EIJA 2M5AA 2BLFB 1LTAC 5KJ7C 3NFQA 1U7MA 3NMDA 1M90Q 2W6AA 3U1AA 2JTIB 1LT9B 1NTMJ 1UIIA 1C7MA 1L0NE 3CCJP 3RK2D 1VQNP 1QLED 3TGUE 1PZQA 1VQPP 3AEDC 2H7HA 2FXOA 1NTZG 1X79B 2E76B 1Q86Q 1E2RA 2OYHC 2NPSD 1KV9A 1ZR4A 1VQKP 1VQLP 5B66H 4FAVA 1T2KD 1BE3E 4OGQB 1H33A 4KHXA 4HB1A 1BE3G 1DW1A 1RE3C 1SQPJ 1CXAA 2PCCB 4OGQC 1A56A 3KQGA 2MTAC 3JCUH 1L0ND 1W5CT 3HUSB 1CRIA 2QVAA 1OAEA 1USEA 3USSA 1LTJA 1YJWP 1NKNA 2R3CA 3WUIA 1FS0E 3WU2H 3V2NA 1AFOA 2Y9ZA 4NPFX 1CORA 3GHGA 2AEFA 4Y28J 2JEEA 2KP8A 1NTMG 3V2PA 4Y99B 5AVYB 4L75A 1NTZK 1XTGB 2IFNA 5E79V 4MU8A 3R4YA 3PJSK 2ZXXA 4H0KA 2CPSA 2PP6A 3JCUE 3H1JD 3O5CA 4N78E 3G6EP 5KJ7A 4EDFA 3CXHH 2FYUG 2K9JB 1SFCA 3AEFC 2YQBA 1EXJA 3SWSA 3A7OA 4FA1A 3I55P 2ZVOB 4GOFA 1Z56A 4U3FE 3RK3C 2YMYA 5AW9B 1RF0A 2N9BA 1H33B 1T3JA 1CYIA 1PGOA 1C52A 3TGUD 4A7PA 1IC2A 4WY4A 2OYHA 1A2SA 2OARA 2Y9YA 1J1EB 1NTZJ 2FXMA 3A0BH 3F89A 3SLEA 4I7ZC 3DP5A 3CC2P 1PL5A 1NU1E 2E5YA 1W5CE 3ITKA 1EZVE 3O6QA 4UB6V 2B10B 5KLVG 1RY3A 4MN4C 3KZIE 3CD6P 1CSVA 3GHGB 2ZAEB 2AI5A 3H1KG 4JPZB 5KAIV 4DCKA 3GHGC 2Y0EA 1BCCG 1HZVA 5AW2B 1C6OA 5AVQB 5CIEB 1GL2B 1I6EA 4LC1A 2ZZS1 4DJGA 3EWKA 1DX7A 1JB0J 3CC7P 1IRVA 3ZOYA 2K9JA 2CPBA 1JY3N 1GDVA 3HTKA 3AEEC 1OW6A 1K05A 1NMIA 1GL2A 1K8AQ 1CNOA 3RGUA 4NFGB 4GKGA 2RN0A 3AEBC 3K5BA 1HH7A 3KDPB 1SFCD 2O1KA 4JQ0D 1Q7YQ 1N8RQ 1EDLA 2FY8A 2BASA 4FA4A 2BEQD 4WB4A 1VQOP 5C0ZA 1HBWA 2FFDC 1HJ4A 3PHLA 1N7SC 3G3ZA 1LTTC 3PLNA 1DT1A 3N7NA 5AVXB 3JC22 1IO3A 1NKZB 2N3YA 4L1QA 3OCDB 3Q5RA 2Q7CA 1S5LE 1CEDA 2NRGA 3CX5H 4OGQD 1KYOI 1WMKA 1YHQP 1J2JB 1DD3A 3NTNA 3H32A 3V6IA 3A3YB 1Q81Q 2M5AB 2E43A 3KPEA 1QL4A 2M8RA 3RMZA 2DGEA 3WFCC 2AEMA 5AW8B 2GIWA 1YQ4C 4UB6H 2NPSA 1NYHA 1FZFA 3Q5PA 3L75J 2QJYB 5KTBA 3RK3E 3NBTA 1EQ7A 3PXWA 2C2CA 3MD0A
chains in the Genus database with same CATH topology
2B12B 4WQ7A 4GEDB 1PPJD 5CIDB 2O3JA 1E29A 4WQAA 1KB9D 1SQBD 3PRJA 3SJLA 1FI3A 5TJHA 3L4MA 2C8SA 5AURA 4O1QA 3FWLA 1HCMA 1J3SA 2D0SA 2CA4B 3H1HD 1HJ5A 1SQQD 1U74B 3L74D 3RN1A 1KX7A 2N18B 3DMIA 1COTA 4L3GA 2GC4D 1AOFA 1M60A 1H9YA 1GKSA 1U75B 2QJKB 2BGVX 4P4QB 4Q5PA 2EXVA 2N9IA 4QAOA 1GU2A 4O1WA 3CP5A 2JQRA 2XTSB 3HQ6A 1CHHA 3A0BV 3L4OA 1DIQC 1RAQA 3A9FA 1C6SA 1S6VB 1M70A 1HRCA 1CIHA 1RZ6A 5IY51 2ZBOA 3ZOXA 4WQDA 4FANA 2N9YB 2BCCD 5KAFV 3O0RC 2KNCB 1W2LA 2I8FA 3RN0A 1CRJA 1HJ3A 4AAOA 4RSZA 1AOQA 1DVVA 1YCCA 5B66V 1SQVD 3PXTA 1L0LD 4N0KA 2QJPB 3CWBD 4KMGA 2JWAA 4RJTA 1SQPD 1WEJF 1WVEC 2C1UA 2YCCA 4XXLA 1H1OA 1EZVD 1CTYA 1IQCA 2OZ1A 3GG2A 2ZONG 1KYOD 1MG3D 1F1CA 3WFBC 2N18C 1NIRA 4PW9B 3WU2V 1CYCA 2BCNB 1GQ1A 4AANA 1GIWA 3OA8A 5H2FV 2A06D 2B0ZB 2AXTV 5C9MA 3VRDA 2N3BA 3ZOWA 3CXHW 1JDLA 1HZUA 2ZXYA 3MK7C 4PD4D 3L75D 4PWAA 1I8OA 3OCDA 4FA9A 1H32A 1FI7A 1QKSA 2BH4X 4LJIA 4J20A 1FI9A 4AALA 4FB1A 2BPBB 4D6TD 1LFMA 2Y0CA 3A0HV 1I8PA 2BLFB 5GTIV 1DVHA 1CSXA 1IZL0 1QL3A 3NBSA 1NTZD 4Y5RA 1AYGA 3L70D 1N50A 2JTIB 1S5LV 1I54A 5DFSA 1KYOW 1NTKD 4AAMA 3GW6A 2GB8B 1C7MA 1LMSA 3O20A 2B11B 1CYJA 1DIIC 2Q3EA 1E2RA 2FWLA 3MK7B 4GYDA 5CYTR 1KV9A 1BCCD 4EICA 1CHIA 5KLIB 4FAVA 1H33A 2L4DA 3VYMA 1DW1A 1CXAA 2PCCB 4FA5A 1BGYD 1DW0A 1A56A 1ETPA 1M6ZA 1ZRTD 5CIHB 1YEAA 2MTAC 1L0ND 3TYIA 1K3HA 1W5CT 2V08A 1CRIA 3ZBMA 1OAEA 1YEBA 1C2NA 1MZ4A 3PTZA 3WUIA 3CU4A 3O1YA 3CX5D 1C75A 1CORA 3WFEC 1N9CA 4WQEA 4XYDB 1LC2A 2QG4A 1H31A 5E79V 4MU8A 1YTCA 1FJ0A 1YNRA 3TF5A 1HROA 2GC7D 4H0KA 3L72D 1KX2A 1C2RA 3H1JD 3O5CA 1CTZA 4EDFA 3TDKA 3PXSA 2K9JB 3JBTB 2KS1A 2YQBA 1BE3D 1FOCA 3SWSA 4FA1A 1H9XA 1CIFA 1QN2A 3ZOOA 4PJ0V 2YK3A 2ORLA 2OZ1B 3HQ9A 3C2CA 1H33B 1CYIA 1C52A 1L9BC 2PACA 3TGUD 2CA3B 4A7PA 1CIEA 2IBZD 3HQ7A 4DY9A 3NWVA 1L9JC 1A2SA 1AKKA 5CIBB 3VMAA 1LS9A 2C9XB 1YFCA 1CTJA 3ZIYA 3OA8B 2DVHA 1NU1D 3SLEA 3WFDC 1FCDC 2CXBA 3H1KD 1KB0A 4L3HA 1NTMD 1F1FA 3DP5A 4EIEA 3ITKA 3CYTI 2AIUA 4UB6V 2B10B 3CX5W 4UB8V 1CHJA 5EXQA 1CSVA 3L71D 3HQ8A 2AI5A 1OCDA 2V07A 1RZ5A 2RMZA 2Y0DA 1PP9D 1H32B 5KAIV 1I6DA 2Y0EA 1C6RA 1HZVA 1C6OA 1CRHA 1VYDA 5CIEB 1CRGA 1CC5A 1I6EA 2ZZS1 1CCRA 3VNWA 3L73D 3KZIV 2N9JA 4IL6V 1CO6A 3WC8A 3H1LD 1CSWA 1GJQA 1MG2D 1IRVA 3ZOYA 2B4ZA 4YE1A 4H0JA 4AX3A 1GDVA 1I55A 5CICB 1P84D 4K3IA 3H1ID 1SQXD 1NMIA 3ORVA 1CSUA 1CNOA 4NFGB 1E8EA 2RN0A 1CCHA 1I5TA 1N15A 5B6QA 1CXCA 3RLMA 1A8CA 1HH7A 4EIDA 3PH2B 1BL9A 1NNOA 4WQBA 3ZCFA 3X39A 4FA4A 1IRWA 5C0ZA 2C1DB 1HJ4A 3BCCD 155CA 3PHLA 1LC1A 2LIRA 4V2KA 3CXHD 3PLNA 1DT1A 4WQ8A 3SVWA 3M97X 5TISV 5KLVD 1ZZHA 5GTHV 1FHBA 4WQCA 1IO3A 2FYUD 1QYZA 2C1VA 4JCGA 2N3YA 4U3FD 4L1QA 3OCDB 2ZOOA 351CA 1DW3A 1K3GA 1R0QA 2C1DA 1CEDA 1N90A 2CE0A 1B7VA 1DW2A 2PCBB 2BH5X 1CRCA 5DJQB 1KIBA 5KKZB 1CIGA 2VHDA 2D0WA 1CRYA 2FYNB 2LITA 5DF5A 2MHMA 4WQ9A 5DJQC 2FRCA 5B5EV 451CA 1QL4A 3SXTA 3RMZA 2DGEA 5CIGB 2CE1A 3WFCC 1YIQA 2GIWA 1YICA 2YIUB 2HV4A 5CIFB 3KHUA 1EB7A 2QJYB 1NMLA 4EIFA 1RAPA 3DR0A 3NBTA 3PXWA 2C2CA 1H31B 2L91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B12 B;  4WQ7 A;  4GED B;  1PPJ D;  5CID B;  2O3J A;  1E29 A;  4WQA A;  1KB9 D;  1SQB D;  3PRJ A;  3SJL A;  1FI3 A;  5TJH A;  3L4M A;  2C8S A;  5AUR A;  4O1Q A;  3FWL A;  1HCM A;  1J3S A;  2D0S A;  2CA4 B;  3H1H D;  1HJ5 A;  1SQQ D;  1U74 B;  3L74 D;  3RN1 A;  1KX7 A;  2N18 B;  3DMI A;  1COT A;  4L3G A;  2GC4 D;  1AOF A;  1M60 A;  1H9Y A;  1GKS A;  1U75 B;  2QJK B;  2BGV X;  4P4Q B;  4Q5P A;  2EXV A;  2N9I A;  4QAO A;  1GU2 A;  4O1W A;  3CP5 A;  2JQR A;  2XTS B;  3HQ6 A;  1CHH A;  3A0B V;  3L4O A;  1DIQ C;  1RAQ A;  3A9F A;  1C6S A;  1S6V B;  1M70 A;  1HRC A;  1CIH A;  1RZ6 A;  5IY5 1;  2ZBO A;  3ZOX A;  4WQD A;  4FAN A;  2N9Y B;  2BCC D;  5KAF V;  3O0R C;  2KNC B;  1W2L A;  2I8F A;  3RN0 A;  1CRJ A;  1HJ3 A;  4AAO A;  4RSZ A;  1AOQ A;  1DVV A;  1YCC A;  5B66 V;  1SQV D;  3PXT A;  1L0L D;  4N0K A;  2QJP B;  3CWB D;  4KMG A;  2JWA A;  4RJT A;  1SQP D;  1WEJ F;  1WVE C;  2C1U A;  2YCC A;  4XXL A;  1H1O A;  1EZV D;  1CTY A;  1IQC A;  2OZ1 A;  3GG2 A;  2ZON G;  1KYO D;  1MG3 D;  1F1C A;  3WFB C;  2N18 C;  1NIR A;  4PW9 B;  3WU2 V;  1CYC A;  2BCN B;  1GQ1 A;  4AAN A;  1GIW A;  3OA8 A;  5H2F V;  2A06 D;  2B0Z B;  2AXT V;  5C9M A;  3VRD A;  2N3B A;  3ZOW A;  3CXH W;  1JDL A;  1HZU A;  2ZXY A;  3MK7 C;  4PD4 D;  3L75 D;  4PWA A;  1I8O A;  3OCD A;  4FA9 A;  1H32 A;  1FI7 A;  1QKS A;  2BH4 X;  4LJI A;  4J20 A;  1FI9 A;  4AAL A;  4FB1 A;  2BPB B;  4D6T D;  1LFM A;  2Y0C A;  3A0H V;  1I8P A;  2BLF B;  5GTI V;  1DVH A;  1CSX A;  1IZL 0;  1QL3 A;  3NBS A;  1NTZ D;  4Y5R A;  1AYG A;  3L70 D;  1N50 A;  2JTI B;  1S5L V;  1I54 A;  5DFS A;  1KYO W;  1NTK D;  4AAM A;  3GW6 A;  2GB8 B;  1C7M A;  1LMS A;  3O20 A;  2B11 B;  1CYJ A;  1DII C;  2Q3E A;  1E2R A;  2FWL A;  3MK7 B;  4GYD A;  5CYT R;  1KV9 A;  1BCC D;  4EIC A;  1CHI A;  5KLI B;  4FAV A;  1H33 A;  2L4D A;  3VYM A;  1DW1 A;  1CXA A;  2PCC B;  4FA5 A;  1BGY D;  1DW0 A;  1A56 A;  1ETP A;  1M6Z A;  1ZRT D;  5CIH B;  1YEA A;  2MTA C;  1L0N D;  3TYI A;  1K3H A;  1W5C T;  2V08 A;  1CRI A;  3ZBM A;  1OAE A;  1YEB A;  1C2N A;  1MZ4 A;  3PTZ A;  3WUI A;  3CU4 A;  3O1Y A;  3CX5 D;  1C75 A;  1COR A;  3WFE C;  1N9C A;  4WQE A;  4XYD B;  1LC2 A;  2QG4 A;  1H31 A;  5E79 V;  4MU8 A;  1YTC A;  1FJ0 A;  1YNR A;  3TF5 A;  1HRO A;  2GC7 D;  4H0K A;  3L72 D;  1KX2 A;  1C2R A;  3H1J D;  3O5C A;  1CTZ A;  4EDF A;  3TDK A;  3PXS A;  2K9J B;  3JBT B;  2KS1 A;  2YQB A;  1BE3 D;  1FOC A;  3SWS A;  4FA1 A;  1H9X A;  1CIF A;  1QN2 A;  3ZOO A;  4PJ0 V;  2YK3 A;  2ORL A;  2OZ1 B;  3HQ9 A;  3C2C A;  1H33 B;  1CYI A;  1C52 A;  1L9B C;  2PAC A;  3TGU D;  2CA3 B;  4A7P A;  1CIE A;  2IBZ D;  3HQ7 A;  4DY9 A;  3NWV A;  1L9J C;  1A2S A;  1AKK A;  5CIB B;  3VMA A;  1LS9 A;  2C9X B;  1YFC A;  1CTJ A;  3ZIY A;  3OA8 B;  2DVH A;  1NU1 D;  3SLE A;  3WFD C;  1FCD C;  2CXB A;  3H1K D;  1KB0 A;  4L3H A;  1NTM D;  1F1F A;  3DP5 A;  4EIE A;  3ITK A;  3CYT I;  2AIU A;  4UB6 V;  2B10 B;  3CX5 W;  4UB8 V;  1CHJ A;  5EXQ A;  1CSV A;  3L71 D;  3HQ8 A;  2AI5 A;  1OCD A;  2V07 A;  1RZ5 A;  2RMZ A;  2Y0D A;  1PP9 D;  1H32 B;  5KAI V;  1I6D A;  2Y0E A;  1C6R A;  1HZV A;  1C6O A;  1CRH A;  1VYD A;  5CIE B;  1CRG A;  1CC5 A;  1I6E A;  2ZZS 1;  1CCR A;  3VNW A;  3L73 D;  3KZI V;  2N9J A;  4IL6 V;  1CO6 A;  3WC8 A;  3H1L D;  1CSW A;  1GJQ A;  1MG2 D;  1IRV A;  3ZOY A;  2B4Z A;  4YE1 A;  4H0J A;  4AX3 A;  1GDV A;  1I55 A;  5CIC B;  1P84 D;  4K3I A;  3H1I D;  1SQX D;  1NMI A;  3ORV A;  1CSU A;  1CNO A;  4NFG B;  1E8E A;  2RN0 A;  1CCH A;  1I5T A;  1N15 A;  5B6Q A;  1CXC A;  3RLM A;  1A8C A;  1HH7 A;  4EID A;  3PH2 B;  1BL9 A;  1NNO A;  4WQB A;  3ZCF A;  3X39 A;  4FA4 A;  1IRW A;  5C0Z A;  2C1D B;  1HJ4 A;  3BCC D;  155C A;  3PHL A;  1LC1 A;  2LIR A;  4V2K A;  3CXH D;  3PLN A;  1DT1 A;  4WQ8 A;  3SVW A;  3M97 X;  5TIS V;  5KLV D;  1ZZH A;  5GTH V;  1FHB A;  4WQC A;  1IO3 A;  2FYU D;  1QYZ A;  2C1V A;  4JCG A;  2N3Y A;  4U3F D;  4L1Q A;  3OCD B;  2ZOO A;  351C A;  1DW3 A;  1K3G A;  1R0Q A;  2C1D A;  1CED A;  1N90 A;  2CE0 A;  1B7V A;  1DW2 A;  2PCB B;  2BH5 X;  1CRC A;  5DJQ B;  1KIB A;  5KKZ B;  1CIG A;  2VHD A;  2D0W A;  1CRY A;  2FYN B;  2LIT A;  5DF5 A;  2MHM A;  4WQ9 A;  5DJQ C;  2FRC A;  5B5E V;  451C A;  1QL4 A;  3SXT A;  3RMZ A;  2DGE A;  5CIG B;  2CE1 A;  3WFC C;  1YIQ A;  2GIW A;  1YIC A;  2YIU B;  2HV4 A;  5CIF B;  3KHU A;  1EB7 A;  2QJY B;  1NML A;  4EIF A;  1RAP A;  3DR0 A;  3NBT A;  3PXW A;  2C2C A;  1H31 B;  2L91 A; 
#chains in the Genus database with same CATH topology
 3H25 A;  3AEC C;  2IDB A;  1S2E A;  3VYI A;  4JYC A;  3D6Y A;  4WQA A;  5APU A;  2W6J H;  1AA0 A;  1LWU C;  1S4X A;  3IFM A;  2JR8 A;  4DZO A;  3L72 J;  1QX8 A;  2QM8 A;  2OGU A;  1URQ C;  1J3S A;  1FZA A;  5AVZ B;  3CXH I;  2D0S A;  5KKZ C;  1HJ5 A;  1SQQ D;  1OIP A;  2N18 B;  5K5G B;  2KK7 A;  2A06 G;  1M60 A;  1QL2 A;  4GDO A;  3G71 P;  4PD4 H;  3HUS A;  4L73 A;  2YKO A;  2BGV X;  1H89 A;  5AW7 B;  2XTS B;  2BEZ F;  3H1J J;  2WZ7 A;  3L4O A;  3TNU B;  1MFT A;  1DIQ C;  2C9L Y;  2V7Q H;  2E74 D;  1VL2 A;  5TIS E;  1HRC A;  4PV1 D;  1LNQ A;  1CIH A;  3WUV A;  1RZ6 A;  2K9Y A;  5AW0 B;  3AE4 C;  1W2L A;  1FOS F;  1JY2 N;  5DJU B;  1GZL A;  3BAT A;  4RSZ A;  1AOQ A;  3H1L J;  4N3Y B;  1IFM A;  2JWA A;  1WEJ F;  2C1U A;  2R5D A;  1H1O A;  1JUN A;  1EZV D;  1CTY A;  1HWT C;  4D6T G;  2W83 C;  1N73 B;  2MKV A;  2BCC E;  2OYH B;  1JMM A;  3WFB C;  1JCD A;  1OW8 A;  2KZI A;  1SQP G;  4H44 B;  2BCN B;  1HGZ A;  1GQ1 A;  1GIW A;  4XA4 A;  2HG5 D;  1S1C X;  2IYO A;  2XZR A;  3VRD A;  1PIX A;  1EDI A;  1SVF A;  3VN0 A;  2N3B A;  2YO3 A;  3CXH W;  1JOC A;  4PD4 D;  3OCD A;  2BCC J;  3H1H E;  1AJY A;  1GL2 D;  3B5N C;  4LJI A;  1T8Z A;  2Q6Q A;  2QRX A;  3AE5 C;  1EDJ A;  2BPB B;  4D6T D;  3S4R A;  1N86 A;  1JTH A;  1T3U A;  4I6M C;  3V5B A;  1U57 A;  3MP7 B;  1IJD B;  1BSH A;  1ZW0 A;  3CCR P;  1DVH A;  1CSX A;  1IZL 0;  5GTH H;  1ZXG A;  5M1B A;  1SFC B;  3CWB G;  1FBM A;  4H0L C;  1N50 A;  2B87 B;  1FZC A;  3VMX A;  5DFS A;  1NTK D;  1SQX J;  2LR2 A;  1LMS A;  2B88 A;  3O20 A;  1CYJ A;  1DII C;  3L70 J;  2P1J A;  1RH5 B;  1L2P A;  1NTZ E;  3MK7 B;  4GYD A;  4C7R A;  4GT1 A;  2G3A A;  3MZW B;  1YTZ I;  3D0W A;  5KLV J;  5AVT B;  1IK7 A;  1DW0 A;  1YTZ T;  1ZRT D;  1P84 H;  1KOR A;  3TYI A;  2V08 A;  1YBK A;  3TSI A;  4JBZ A;  1YEB A;  4W80 A;  1C2N A;  4EOT A;  1NU1 G;  3O6Q B;  3O1Y A;  4ZNC A;  3CCU P;  4YTP C;  1C75 A;  4WQE A;  4HJG H;  2D2C C;  2BCC G;  1LC2 A;  2WIT A;  1XTC C;  1URQ B;  3TGU J;  1KN7 A;  5CHX A;  1SFC C;  1YTC A;  1AVO A;  1HRO A;  2GC7 D;  4PV1 B;  1FE6 A;  5APS A;  2N1T B;  3EQ2 A;  2ITA A;  1L0N K;  4JF7 A;  3VOP A;  4YXD C;  2A45 I;  3WUT A;  2R32 A;  4Z1M H;  2KS1 A;  2HOD A;  3E1R A;  1BE3 D;  3S9O A;  3P8M C;  4PJ0 V;  2P10 A;  2WVR A;  2W27 A;  3A0H H;  1LTG C;  1LP1 A;  4DOJ A;  3HQ9 A;  1DH3 A;  1K9M Q;  1J1E C;  5C39 A;  3Q3D A;  1L9B C;  2PAC A;  2JJL A;  2LXB A;  3LIE A;  3L74 G;  3H1H J;  3NWV A;  1L9J C;  1NU1 J;  3T97 B;  1BDD A;  5CIB B;  4H13 C;  1X22 A;  2WSF J;  3G4S P;  1LS9 A;  2C9X B;  1CTJ A;  2OYI C;  2OTL P;  2LXC B;  1EDK A;  1K73 Q;  1FCD C;  1ZR2 A;  1NTM D;  1F1F A;  4EIE A;  2AIU A;  4L76 A;  4D6T E;  1HGV A;  2IFM A;  2XKM A;  3AE7 C;  3MGN A;  1FZC B;  2KUB A;  2FYU J;  1Q2N A;  4C7N B;  1RZ5 A;  2Y0D A;  5APV A;  1KV4 A;  1I6D A;  3CMA P;  1RQV A;  5E79 E;  1C6R A;  3IAO A;  3CI9 A;  2H43 A;  3MTU E;  1HUC A;  1CRG A;  3CC4 P;  2AXT E;  3CCS P;  1CW5 A;  4HH2 A;  2B4Z A;  2YXQ B;  4H0J A;  3TK1 A;  3H1H G;  3EFG A;  1DD4 A;  1NAF A;  2A45 H;  1E8E A;  1N15 A;  2M3B A;  5CJ0 A;  2Q5U A;  1JY2 O;  3E1I A;  2KSE A;  4CPG A;  1A8C A;  1KQG B;  3P8C D;  1USD A;  4ASW A;  4WQB A;  3X39 A;  5DJT B;  1RF1 A;  1WRG A;  3II6 A;  3M0D C;  3T97 A;  1KIL D;  3CXH D;  1MFZ A;  4WQ8 A;  3SVW A;  3H32 B;  1FHB A;  4WVZ A;  2FYU D;  1QYZ A;  2C1V A;  4JCG A;  1S3J A;  2OQQ A;  3L74 J;  4NPE A;  1KQF B;  4U3F D;  351C A;  1DW3 A;  1K3G A;  3D71 A;  1R0Q A;  3SWK A;  4XFJ A;  1KB9 E;  4R4M A;  3Q5S A;  2C1D A;  1B7V A;  2J58 A;  2PCB B;  4HKZ H;  1NH4 A;  3GLM A;  1CRC A;  1KIB A;  2VHD A;  3CCV P;  1PFI A;  1K04 A;  4WQ9 A;  2JDI H;  1HJ0 A;  2FRC A;  1R5L A;  5KAI E;  3I56 P;  1YIC A;  2JKV A;  1BGY J;  2Z5I A;  3SWY A;  2HV4 A;  1NGM B;  4IFD K;  1NTM K;  1BGY E;  1SQP K;  1VQ5 P;  1FJK A;  1LWU A;  1VQ9 P;  2WPS A;  3V2R A;  1KYO E;  4GED B;  3HTK B;  5CID B;  3VMY A;  2QEX P;  1SQB D;  1N73 C;  3L4M A;  1G1J A;  2YMK A;  3HD7 C;  3CWB E;  2C8S A;  2KI7 B;  2E42 A;  3KZI H;  5APY A;  3FWL A;  4C46 A;  1U74 B;  4LLH A;  4TLF A;  3DMI A;  1COT A;  4PD4 E;  2GC4 D;  1A02 J;  2POH A;  1KYO H;  3B71 A;  5CCH A;  2K37 A;  5APX A;  1H9Y A;  4NPD A;  1GKS A;  4L74 A;  5AVR B;  2QJK B;  2EXV A;  1FDM A;  4QAO A;  1GU2 A;  3CP5 A;  1IFD A;  2WPQ A;  2GUS A;  3HQ6 A;  3A0B V;  3L75 G;  1GMJ A;  2R44 A;  1LT9 C;  3HRN A;  3M0A A;  1RAQ A;  1M70 A;  1JO5 A;  1FU1 A;  1RHZ B;  1GU5 A;  2N1T A;  2KXP B;  1VQ4 P;  3V2Q A;  3CWB J;  1QL1 A;  2I8F A;  4U3F J;  3RBX A;  2O1J A;  3L72 G;  1HJ3 A;  4AAO A;  1PGP A;  2QJP C;  1X9V A;  1W2B O;  1N73 A;  1DVV A;  1Y47 A;  2D2C B;  1IFN A;  2FYU E;  3MIW A;  1RF1 B;  1N7L A;  1L0L D;  4N0K A;  3O8Z A;  2QJP B;  4DT0 A;  4KMG A;  3L70 G;  4YXW H;  3JSV C;  1L4A C;  2Q1K A;  1OXZ A;  3HE4 A;  3GG2 A;  1NOH A;  3G9R A;  1KYO D;  4EI2 A;  4AYC A;  2ZT9 D;  1J1D B;  3RBZ A;  1F1C A;  2N18 C;  3BCC G;  3HD7 A;  4PW9 B;  3WU2 V;  1G2C A;  3AE3 C;  2YIU C;  2Z5H A;  3RL0 B;  5APW A;  1CYC A;  3H1J E;  2E74 B;  2W6B A;  1IK9 A;  3OA8 A;  4RO0 A;  2OYI A;  2A06 D;  3P32 A;  2AXT V;  2YNY A;  3WMM 0;  3F5H A;  2NZ2 A;  2QJY C;  4H44 D;  4U3F G;  3N4X A;  1M57 D;  3A0H E;  2Z4E A;  2O01 H;  1I8O A;  1BCC E;  3AE2 C;  2C0X A;  1FI7 A;  4ZMD A;  3NXS A;  3L72 E;  3Q1M A;  1FI9 A;  3RK3 B;  4R4L A;  1HF9 A;  1KB9 I;  4FB1 A;  3A2A A;  2Y0C A;  2N1T C;  2OTK E;  1I8P A;  3MUD C;  4PJ0 E;  2E5T A;  1QVF O;  4WY4 C;  1EZV G;  5GTH E;  4H13 B;  3D6Z A;  3H1K E;  1QL3 A;  1ZLL A;  3NBS A;  4Y5R A;  1AYG A;  1LJ2 A;  4K3A A;  3RK3 D;  3H1I G;  4GOD A;  1KYO W;  2KYV A;  3B5N D;  3GW6 A;  2GB8 B;  1ZRT E;  2KS1 B;  2B11 B;  1LTJ C;  3TYY A;  5TIS H;  2Q3E A;  4M3L A;  3FWN A;  2FWL A;  3PH0 A;  3V4Q A;  1PGJ A;  2YKQ A;  1BCC D;  5CBO A;  4EIC A;  1CHI A;  1PP9 G;  1NTK G;  1JY2 P;  4GOE A;  1JNM A;  1GDT A;  3VYM A;  3SFE C;  2ZXE B;  3W67 A;  1SP4 A;  1BGY D;  1KFM A;  2FXP A;  5CCG D;  1YEA A;  3M06 A;  1NWQ A;  3QWO C;  2KB7 P;  1YJ9 P;  2WPR A;  1MZ4 A;  1NTM E;  5B5E H;  2HFE D;  3BVH A;  3WFE C;  3I5C A;  1M8O B;  1OWA A;  1GU4 A;  1SQX G;  2QG4 A;  1A02 F;  2QM7 A;  1FJ0 A;  3L72 D;  1N7S B;  2CK3 H;  1SQX E;  2L5G B;  1C2R A;  3M9Q A;  3TDK A;  2I8D A;  3WUU A;  3L73 E;  1NJI Q;  1FZE A;  4BRY B;  2WQY C;  1R5S A;  1CIF A;  1QN2 A;  4PD4 I;  1N7S D;  1OZH A;  3C9I A;  2YK3 A;  2ORL A;  3HE4 B;  4N78 D;  2IYP A;  3H1I J;  1L0L E;  5AW5 B;  4ZKP A;  2E76 C;  2CA3 B;  1MKM A;  1CIE A;  1HTL C;  4DY9 A;  1X0T A;  3ZIY A;  5B66 E;  2NPS C;  3OA8 B;  2DVH A;  2GM4 A;  1ZV8 A;  1NU1 D;  1JY3 P;  2OYO A;  3H1K D;  2CXB A;  2K1A A;  4WWI A;  1NTK J;  1TU3 F;  3CX5 E;  3M91 A;  3CYT I;  2HYN A;  1ZME C;  2FBW C;  3SSU A;  3TGU G;  1FAV A;  1AQ5 A;  1CHJ A;  3CL3 D;  3H1I E;  5EXQ A;  1MV8 A;  1OCD A;  3H1L E;  3WU2 E;  2QIW A;  2V07 A;  5KLI C;  1H32 B;  3Q2Y A;  4OVN F;  5CCG A;  4OWF A;  3HD7 D;  1VYD A;  3RL0 C;  1CC5 A;  3L73 D;  2N9J A;  4IL6 V;  1CO6 A;  3A5T A;  1CZQ A;  4XE5 B;  2P58 A;  3CCQ P;  3AE9 C;  4BWN A;  4AX3 A;  2A06 E;  1I55 A;  4K3I A;  1M7L A;  1SQX D;  1LWU B;  3ORV A;  5B6Q A;  3R2P A;  1RF1 C;  4BRY A;  1KFN A;  1BDC A;  4EID A;  3PH2 B;  2H8P D;  1LP1 B;  1NNO A;  2Q9I A;  1L4A B;  1IRW A;  1W2E A;  2OYI B;  3BCC D;  3L74 E;  3AE1 C;  2LIR A;  4V2K A;  1EZV I;  1JEK A;  5KLV D;  1EC5 A;  1SQV E;  2E74 C;  1KB9 H;  5KLV E;  2PGD A;  2ZOO A;  4PV1 C;  3LW5 H;  2JP3 A;  1X8Y A;  4YPC A;  1MZ9 A;  1VF5 B;  1N90 A;  2CE0 A;  2RKL A;  1DW2 A;  5CCG C;  3VTP C;  1PPJ E;  2W90 A;  1R8E A;  2H88 C;  1CIG A;  2GA1 A;  1CRY A;  2FYN B;  2LIT A;  4I1L A;  1KIL C;  2AXC A;  2WMM A;  5CIG B;  2CE1 A;  1WT6 A;  1VQM P;  1YIQ A;  2ZT9 C;  3GMA A;  1VQ8 P;  1NML A;  4EIF A;  1H31 B;  2O3J A;  1E29 A;  1FDI A;  1RQU A;  1KB9 D;  3MHV A;  3PRJ A;  3CPW O;  1SQQ E;  1FI3 A;  5TJH A;  3L37 A;  4TT3 H;  5APQ A;  3P7K A;  2YXR B;  3QH9 A;  4H44 C;  2KSJ A;  4PJ0 H;  1HCM A;  5CCH C;  1VQ7 P;  4ASV A;  3HE5 A;  3H1H D;  2R5B A;  5APT A;  3L74 D;  3RN1 A;  3BRV B;  1OW7 A;  3TNU A;  3L70 E;  2FFD B;  1HJB A;  5AVS B;  4C7N A;  4WBA A;  2C0W A;  1U75 B;  4P4Q B;  2MJZ A;  1GL2 C;  1L0L J;  1S9K D;  1BGY G;  2KLV A;  3GF7 A;  4O1W A;  2JQR A;  2WSS H;  1M1J C;  4H0L B;  1CHH A;  3B8E B;  1P84 I;  1VPC A;  2WWW A;  1S5L H;  1G1I A;  1C6S A;  1S6V B;  1IFI A;  1YIJ P;  4IL6 E;  1FZG A;  5IY5 1;  2ZBO A;  5BU8 B;  1N7S A;  4WQD A;  2HLO A;  3C8V A;  1JY3 O;  2N9Y B;  2M0B A;  2QE7 H;  5KAF V;  3IR9 A;  1H0T B;  2WTY A;  1SQV K;  4H0L D;  1KQL A;  3RN0 A;  2O01 J;  3HUS C;  1L4A A;  1SQB J;  2UWJ E;  3SFD C;  1EXI A;  5BVZ A;  2XU6 A;  2IX7 C;  3PXT A;  1AV1 A;  3HD7 B;  4RJT A;  1SQP D;  1AVY A;  3L71 J;  2YCC A;  4XXL A;  3CLQ A;  1IQC A;  2ZON G;  1MG3 D;  2KZJ A;  2HR3 A;  1L0L G;  5AVU B;  2ZYA A;  1NTK K;  1YQ3 C;  2AXT H;  2FYZ A;  1ZP0 C;  4AAN A;  2B0Z B;  5C9M A;  3SWF A;  1QVG O;  4K35 A;  1JCC A;  1JDL A;  1HZU A;  1HVV A;  3L75 D;  4PWA A;  3CCE P;  2D2C D;  2WSE J;  1JM0 A;  2V7Q J;  2XNX A;  1QKS A;  1GW3 A;  2Q3I A;  2BH4 X;  2ZYD A;  5KAF H;  1MUU A;  1YYC A;  3L71 E;  2PFX A;  2V4H A;  1SS1 A;  4AAL A;  1L0L K;  3A0H V;  2XDJ A;  1J1D C;  1N2D C;  1SQB E;  3BCC E;  4IL6 H;  1KMI Z;  3CME P;  5GTI V;  4IFM A;  3BCC J;  1FOS E;  2E76 D;  1T2K C;  1CI6 A;  1NTZ D;  2NPS B;  3L70 D;  1LTI C;  1H88 A;  1OVV A;  5CJ4 A;  2K3R A;  1S5L V;  1I54 A;  4IFF A;  1LTB C;  4AAM A;  1SQB G;  1S72 P;  2M3E A;  3L73 G;  1S9K E;  2XND H;  4H13 D;  2N1T D;  5CYT R;  4OH8 B;  2B87 A;  5KLI B;  3B5N B;  4HYT B;  3ZDM A;  3E7K A;  4O9B A;  2L4D A;  1VDF A;  2KLU A;  2LKM A;  1IO4 A;  4FA5 A;  3OA7 A;  2P67 A;  4BXL A;  1M1K Q;  1ETP A;  1FC2 C;  2OTJ P;  1M6Z A;  5CIH B;  3RL0 D;  3IN6 A;  1K3H A;  3ZBM A;  3U1C A;  5EFW B;  1URQ A;  2WPV B;  1LT1 A;  3PTZ A;  3CU4 A;  3CX5 D;  1OVU A;  4RKU J;  1N9C A;  1LTS C;  4XYD B;  2JWD A;  3KYQ A;  4B86 A;  2PRR A;  1H31 A;  2O01 N;  3V4W A;  1OVR A;  1YNR A;  3TF5 A;  3L73 J;  1SLQ A;  1KX2 A;  1YJN P;  1CTZ A;  1ZN5 A;  1GD2 E;  3PXS A;  1PPJ G;  1YI2 P;  1PP9 J;  2WT7 A;  3H1K J;  3JBT B;  3BAS A;  5AVV B;  3OW2 O;  1FOC A;  1FDO A;  3BRT B;  1VF5 C;  1H8A A;  1H9X A;  3ZOO A;  3P8C E;  2OZ1 B;  4AUW A;  1T6A A;  3AE6 C;  3C2C A;  2FYN C;  4W7Z A;  1GK6 A;  2HOD B;  2IBZ D;  1SQV J;  3HQ7 A;  3L35 A;  1KIL E;  1AKK A;  4KJM A;  3VMA A;  2RH0 A;  4GIF A;  1YFC A;  2ZYG A;  1RF0 C;  3RK2 C;  3WFD C;  1KB0 A;  4L3H A;  2E75 B;  1M1J A;  4ZKU A;  4WY4 B;  3FGA D;  3FX0 A;  5AW1 B;  3CX5 W;  3MUD A;  2ZVN B;  1LGH B;  2E75 C;  4UB8 V;  3VP9 A;  4KT0 J;  5GTI E;  2YO2 A;  3L71 D;  2KNC A;  3HQ8 A;  1M1J B;  3EFF K;  2RMZ A;  2B9B A;  3C1L A;  1PP9 D;  4QMA A;  4UB8 E;  2P7J A;  3L75 E;  1CRH A;  4Y99 C;  1QEX A;  1CCR A;  3VNW A;  2W8Z A;  3ABV C;  1OMI A;  3KZI V;  1SQQ K;  1Y8A A;  2J5U A;  3WC8 A;  3H1L D;  1CSW A;  1GJQ A;  1MG2 D;  3B5N A;  4YE1 A;  1KZU B;  2C9N Y;  5CIC B;  1P84 D;  3H1I D;  2WT7 B;  2DW3 A;  1CSU A;  3PP5 A;  2IPP A;  1CCH A;  1I5T A;  3IF4 A;  1CXC A;  2G8Y A;  3RLM A;  3L36 A;  3FXE A;  2IZ1 A;  1YIT P;  1BL9 A;  1Q90 D;  3CCM P;  5B5E E;  3ZCF A;  2KOG A;  3CCL P;  2C1D B;  155C A;  2FYU K;  2I1J A;  3RK2 B;  1LC1 A;  5AW3 B;  2WSC H;  1FZC C;  1KD1 Q;  3M97 X;  5TIS V;  1CSB A;  2QA4 P;  1DEB A;  1ZZH A;  5GTH V;  4WQC A;  1RE3 A;  2FFD A;  3W68 A;  1SQV G;  5KAF E;  2B89 A;  1FZB A;  4U7J A;  5KLV K;  4LGD E;  1KIL A;  5AW4 B;  3S1K A;  2BH5 X;  2HPC B;  5DJQ B;  1SQQ G;  3VP8 A;  5KKZ B;  2D0W A;  2P2U A;  5DF5 A;  3D70 A;  2MHM A;  1RE4 A;  5DJQ C;  1L0N G;  2XV5 A;  5B5E V;  451C A;  3SXT A;  3LW5 J;  1DEE G;  5KJ7 D;  1BSN A;  2YIU B;  5GTI H;  1D7M A;  5CIF B;  2WSC J;  3KHU A;  3H1J G;  1EB7 A;  2I1K A;  5E79 H;  1OFC X;  1L4A D;  1RAP A;  3DR0 A;  2L91 A;  2B12 B;  1KTM A;  4WQ7 A;  1BCC J;  4UB8 H;  1PPJ D;  1ZOY C;  2K88 A;  1PGQ A;  2IBZ I;  3A0B E;  3B4S A;  3SJL A;  1SQP E;  1GK4 A;  3M9H A;  2R3S A;  2VRS A;  1JTH B;  3LID A;  3U59 A;  5AUR A;  1P84 E;  4O1Q A;  1OX3 A;  1FJP A;  1VF5 D;  3H1L G;  4RES B;  1KQS O;  2IBZ G;  1HH0 A;  1NTK E;  2CA4 B;  4I2L C;  1KX7 A;  1GW4 A;  4AQR D;  1U7J A;  2KIK A;  1QGK B;  4L3G A;  1E79 H;  1AOF A;  1Y9B A;  1Q82 Q;  1L0N J;  4D6T J;  4N6J A;  3FXD A;  5H2F H;  3L4F A;  4Q5P A;  5L8R J;  2N9I A;  2ZT9 B;  1RE4 C;  1NU1 K;  1LTJ B;  1H0T A;  5CBN A;  2H89 C;  1S5L X;  1IFJ A;  1KIL B;  1NHL A;  3A9F A;  5CCH D;  2GUV A;  2HPC A;  4W7Y A;  1JMB A;  2E75 D;  4WY4 D;  3CX5 I;  3ZOX A;  3M0D A;  4FAN A;  2BCC D;  3O0R C;  2KNC B;  1SQQ J;  1VQ6 P;  5KAI H;  1GTW A;  1CRJ A;  3UIA A;  5H2F E;  2IBZ E;  2WSE H;  3VMZ A;  1SQB K;  1YCC A;  5B66 V;  1SQV D;  5AVW B;  3H6P A;  3CWB D;  2YKP A;  1WVE C;  4IOI H;  1LT9 A;  3RL0 g;  1IFP A;  2IZ0 A;  2OZ1 A;  1SQX K;  2QJK C;  1DIP A;  2ZJS E;  2FKW B;  1AQT A;  1NIR A;  3KXD A;  2QSI A;  3HE5 B;  5BU5 A;  3AEG C;  3AEA C;  5H2F V;  4EYY Q;  2A45 G;  2WSF H;  3OAK A;  2AEJ A;  1UIX A;  4JYB A;  2ZFC A;  1NO4 A;  3AE8 C;  3M9B A;  3ZOW A;  4UB6 E;  1G2C B;  5CMZ A;  3GF3 A;  2JO1 A;  1URQ D;  3MK7 C;  2ZXY A;  1NVO A;  2SPZ A;  1NAY A;  2J59 M;  4FA9 A;  1E5W A;  1H32 A;  4I7Z B;  1PP9 E;  5AW6 B;  1BE3 J;  1CI6 B;  1PV3 A;  1KC8 Q;  4J20 A;  3L71 G;  2PAJ A;  3CXH E;  4IL6 X;  1LFM A;  1M56 D;  1IZN B;  3OJA B;  4EIJ A;  2M5A A;  2BLF B;  1LTA C;  5KJ7 C;  3NFQ A;  1U7M A;  3NMD A;  1M90 Q;  2W6A A;  3U1A A;  2JTI B;  1LT9 B;  1NTM J;  1UII A;  1C7M A;  1L0N E;  3CCJ P;  3RK2 D;  1VQN P;  1QLE D;  3TGU E;  1PZQ A;  1VQP P;  3AED C;  2H7H A;  2FXO A;  1NTZ G;  1X79 B;  2E76 B;  1Q86 Q;  1E2R A;  2OYH C;  2NPS D;  1KV9 A;  1ZR4 A;  1VQK P;  1VQL P;  5B66 H;  4FAV A;  1T2K D;  1BE3 E;  4OGQ B;  1H33 A;  4KHX A;  4HB1 A;  1BE3 G;  1DW1 A;  1RE3 C;  1SQP J;  1CXA A;  2PCC B;  4OGQ C;  1A56 A;  3KQG A;  2MTA C;  3JCU H;  1L0N D;  1W5C T;  3HUS B;  1CRI A;  2QVA A;  1OAE A;  1USE A;  3USS A;  1LTJ A;  1YJW P;  1NKN A;  2R3C A;  3WUI A;  1FS0 E;  3WU2 H;  3V2N A;  1AFO A;  2Y9Z A;  4NPF X;  1COR A;  3GHG A;  2AEF A;  4Y28 J;  2JEE A;  2KP8 A;  1NTM G;  3V2P A;  4Y99 B;  5AVY B;  4L75 A;  1NTZ K;  1XTG B;  2IFN A;  5E79 V;  4MU8 A;  3R4Y A;  3PJS K;  2ZXX A;  4H0K A;  2CPS A;  2PP6 A;  3JCU E;  3H1J D;  3O5C A;  4N78 E;  3G6E P;  5KJ7 A;  4EDF A;  3CXH H;  2FYU G;  2K9J B;  1SFC A;  3AEF C;  2YQB A;  1EXJ A;  3SWS A;  3A7O A;  4FA1 A;  3I55 P;  2ZVO B;  4GOF A;  1Z56 A;  4U3F E;  3RK3 C;  2YMY A;  5AW9 B;  1RF0 A;  2N9B A;  1H33 B;  1T3J A;  1CYI A;  1PGO A;  1C52 A;  3TGU D;  4A7P A;  1IC2 A;  4WY4 A;  2OYH A;  1A2S A;  2OAR A;  2Y9Y A;  1J1E B;  1NTZ J;  2FXM A;  3A0B H;  3F89 A;  3SLE A;  4I7Z C;  3DP5 A;  3CC2 P;  1PL5 A;  1NU1 E;  2E5Y A;  1W5C E;  3ITK A;  1EZV E;  3O6Q A;  4UB6 V;  2B10 B;  5KLV G;  1RY3 A;  4MN4 C;  3KZI E;  3CD6 P;  1CSV A;  3GHG B;  2ZAE B;  2AI5 A;  3H1K G;  4JPZ B;  5KAI V;  4DCK A;  3GHG C;  2Y0E A;  1BCC G;  1HZV A;  5AW2 B;  1C6O A;  5AVQ B;  5CIE B;  1GL2 B;  1I6E A;  4LC1 A;  2ZZS 1;  4DJG A;  3EWK A;  1DX7 A;  1JB0 J;  3CC7 P;  1IRV A;  3ZOY A;  2K9J A;  2CPB A;  1JY3 N;  1GDV A;  3HTK A;  3AEE C;  1OW6 A;  1K05 A;  1NMI A;  1GL2 A;  1K8A Q;  1CNO A;  3RGU A;  4NFG B;  4GKG A;  2RN0 A;  3AEB C;  3K5B A;  1HH7 A;  3KDP B;  1SFC D;  2O1K A;  4JQ0 D;  1Q7Y Q;  1N8R Q;  1EDL A;  2FY8 A;  2BAS A;  4FA4 A;  2BEQ D;  4WB4 A;  1VQO P;  5C0Z A;  1HBW A;  2FFD C;  1HJ4 A;  3PHL A;  1N7S C;  3G3Z A;  1LTT C;  3PLN A;  1DT1 A;  3N7N A;  5AVX B;  3JC2 2;  1IO3 A;  1NKZ B;  2N3Y A;  4L1Q A;  3OCD B;  3Q5R A;  2Q7C A;  1S5L E;  1CED A;  2NRG A;  3CX5 H;  4OGQ D;  1KYO I;  1WMK A;  1YHQ P;  1J2J B;  1DD3 A;  3NTN A;  3H32 A;  3V6I A;  3A3Y B;  1Q81 Q;  2M5A B;  2E43 A;  3KPE A;  1QL4 A;  2M8R A;  3RMZ A;  2DGE A;  3WFC C;  2AEM A;  5AW8 B;  2GIW A;  1YQ4 C;  4UB6 H;  2NPS A;  1NYH A;  1FZF A;  3Q5P A;  3L75 J;  2QJY B;  5KTB A;  3RK3 E;  3NBT A;  1EQ7 A;  3PXW A;  2C2C A;  3MD0 A; 
#chains in the Genus database with same CATH homology
 2B12 B;  4WQ7 A;  4GED B;  1PPJ D;  5CID B;  2O3J A;  1E29 A;  4WQA A;  1KB9 D;  1SQB D;  3PRJ A;  3SJL A;  1FI3 A;  5TJH A;  3L4M A;  2C8S A;  5AUR A;  4O1Q A;  3FWL A;  1HCM A;  1J3S A;  2D0S A;  2CA4 B;  3H1H D;  1HJ5 A;  1SQQ D;  1U74 B;  3L74 D;  3RN1 A;  1KX7 A;  2N18 B;  3DMI A;  1COT A;  4L3G A;  2GC4 D;  1AOF A;  1M60 A;  1H9Y A;  1GKS A;  1U75 B;  2QJK B;  2BGV X;  4P4Q B;  4Q5P A;  2EXV A;  2N9I A;  4QAO A;  1GU2 A;  4O1W A;  3CP5 A;  2JQR A;  2XTS B;  3HQ6 A;  1CHH A;  3A0B V;  3L4O A;  1DIQ C;  1RAQ A;  3A9F A;  1C6S A;  1S6V B;  1M70 A;  1HRC A;  1CIH A;  1RZ6 A;  5IY5 1;  2ZBO A;  3ZOX A;  4WQD A;  4FAN A;  2N9Y B;  2BCC D;  5KAF V;  3O0R C;  2KNC B;  1W2L A;  2I8F A;  3RN0 A;  1CRJ A;  1HJ3 A;  4AAO A;  4RSZ A;  1AOQ A;  1DVV A;  1YCC A;  5B66 V;  1SQV D;  3PXT A;  1L0L D;  4N0K A;  2QJP B;  3CWB D;  4KMG A;  2JWA A;  4RJT A;  1SQP D;  1WEJ F;  1WVE C;  2C1U A;  2YCC A;  4XXL A;  1H1O A;  1EZV D;  1CTY A;  1IQC A;  2OZ1 A;  3GG2 A;  2ZON G;  1KYO D;  1MG3 D;  1F1C A;  3WFB C;  2N18 C;  1NIR A;  4PW9 B;  3WU2 V;  1CYC A;  2BCN B;  1GQ1 A;  4AAN A;  1GIW A;  3OA8 A;  5H2F V;  2A06 D;  2B0Z B;  2AXT V;  5C9M A;  3VRD A;  2N3B A;  3ZOW A;  3CXH W;  1JDL A;  1HZU A;  2ZXY A;  3MK7 C;  4PD4 D;  3L75 D;  4PWA A;  1I8O A;  3OCD A;  4FA9 A;  1H32 A;  1FI7 A;  1QKS A;  2BH4 X;  4LJI A;  4J20 A;  1FI9 A;  4AAL A;  4FB1 A;  2BPB B;  4D6T D;  1LFM A;  2Y0C A;  3A0H V;  1I8P A;  2BLF B;  5GTI V;  1DVH A;  1CSX A;  1IZL 0;  1QL3 A;  3NBS A;  1NTZ D;  4Y5R A;  1AYG A;  3L70 D;  1N50 A;  2JTI B;  1S5L V;  1I54 A;  5DFS A;  1KYO W;  1NTK D;  4AAM A;  3GW6 A;  2GB8 B;  1C7M A;  1LMS A;  3O20 A;  2B11 B;  1CYJ A;  1DII C;  2Q3E A;  1E2R A;  2FWL A;  3MK7 B;  4GYD A;  5CYT R;  1KV9 A;  1BCC D;  4EIC A;  1CHI A;  5KLI B;  4FAV A;  1H33 A;  2L4D A;  3VYM A;  1DW1 A;  1CXA A;  2PCC B;  4FA5 A;  1BGY D;  1DW0 A;  1A56 A;  1ETP A;  1M6Z A;  1ZRT D;  5CIH B;  1YEA A;  2MTA C;  1L0N D;  3TYI A;  1K3H A;  1W5C T;  2V08 A;  1CRI A;  3ZBM A;  1OAE A;  1YEB A;  1C2N A;  1MZ4 A;  3PTZ A;  3WUI A;  3CU4 A;  3O1Y A;  3CX5 D;  1C75 A;  1COR A;  3WFE C;  1N9C A;  4WQE A;  4XYD B;  1LC2 A;  2QG4 A;  1H31 A;  5E79 V;  4MU8 A;  1YTC A;  1FJ0 A;  1YNR A;  3TF5 A;  1HRO A;  2GC7 D;  4H0K A;  3L72 D;  1KX2 A;  1C2R A;  3H1J D;  3O5C A;  1CTZ A;  4EDF A;  3TDK A;  3PXS A;  2K9J B;  3JBT B;  2KS1 A;  2YQB A;  1BE3 D;  1FOC A;  3SWS A;  4FA1 A;  1H9X A;  1CIF A;  1QN2 A;  3ZOO A;  4PJ0 V;  2YK3 A;  2ORL A;  2OZ1 B;  3HQ9 A;  3C2C A;  1H33 B;  1CYI A;  1C52 A;  1L9B C;  2PAC A;  3TGU D;  2CA3 B;  4A7P A;  1CIE A;  2IBZ D;  3HQ7 A;  4DY9 A;  3NWV A;  1L9J C;  1A2S A;  1AKK A;  5CIB B;  3VMA A;  1LS9 A;  2C9X B;  1YFC A;  1CTJ A;  3ZIY A;  3OA8 B;  2DVH A;  1NU1 D;  3SLE A;  3WFD C;  1FCD C;  2CXB A;  3H1K D;  1KB0 A;  4L3H A;  1NTM D;  1F1F A;  3DP5 A;  4EIE A;  3ITK A;  3CYT I;  2AIU A;  4UB6 V;  2B10 B;  3CX5 W;  4UB8 V;  1CHJ A;  5EXQ A;  1CSV A;  3L71 D;  3HQ8 A;  2AI5 A;  1OCD A;  2V07 A;  1RZ5 A;  2RMZ A;  2Y0D A;  1PP9 D;  1H32 B;  5KAI V;  1I6D A;  2Y0E A;  1C6R A;  1HZV A;  1C6O A;  1CRH A;  1VYD A;  5CIE B;  1CRG A;  1CC5 A;  1I6E A;  2ZZS 1;  1CCR A;  3VNW A;  3L73 D;  3KZI V;  2N9J A;  4IL6 V;  1CO6 A;  3WC8 A;  3H1L D;  1CSW A;  1GJQ A;  1MG2 D;  1IRV A;  3ZOY A;  2B4Z A;  4YE1 A;  4H0J A;  4AX3 A;  1GDV A;  1I55 A;  5CIC B;  1P84 D;  4K3I A;  3H1I D;  1SQX D;  1NMI A;  3ORV A;  1CSU A;  1CNO A;  4NFG B;  1E8E A;  2RN0 A;  1CCH A;  1I5T A;  1N15 A;  5B6Q A;  1CXC A;  3RLM A;  1A8C A;  1HH7 A;  4EID A;  3PH2 B;  1BL9 A;  1NNO A;  4WQB A;  3ZCF A;  3X39 A;  4FA4 A;  1IRW A;  5C0Z A;  2C1D B;  1HJ4 A;  3BCC D;  155C A;  3PHL A;  1LC1 A;  2LIR A;  4V2K A;  3CXH D;  3PLN A;  1DT1 A;  4WQ8 A;  3SVW A;  3M97 X;  5TIS V;  5KLV D;  1ZZH A;  5GTH V;  1FHB A;  4WQC A;  1IO3 A;  2FYU D;  1QYZ A;  2C1V A;  4JCG A;  2N3Y A;  4U3F D;  4L1Q A;  3OCD B;  2ZOO A;  351C A;  1DW3 A;  1K3G A;  1R0Q A;  2C1D A;  1CED A;  1N90 A;  2CE0 A;  1B7V A;  1DW2 A;  2PCB B;  2BH5 X;  1CRC A;  5DJQ B;  1KIB A;  5KKZ B;  1CIG A;  2VHD A;  2D0W A;  1CRY A;  2FYN B;  2LIT A;  5DF5 A;  2MHM A;  4WQ9 A;  5DJQ C;  2FRC A;  5B5E V;  451C A;  1QL4 A;  3SXT A;  3RMZ A;  2DGE A;  5CIG B;  2CE1 A;  3WFC C;  1YIQ A;  2GIW A;  1YIC A;  2YIU B;  2HV4 A;  5CIF B;  3KHU A;  1EB7 A;  2QJY B;  1NML A;  4EIF A;  1RAP A;  3DR0 A;  3NBT A;  3PXW A;  2C2C A;  1H31 B;  2L91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...