3ZIYA

Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.01 a resolution
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
457
structure length
457
Chain Sequence
KLPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKMPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRAQPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
total genus 131
structure length 457
sequence length 457
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3ziyA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ziyA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ziyA02
1ZZHA 4K9JA 4GP4B 1WAEA 1A3ZA 1IUZA 5EXQA 1AS8A 1CC5A 1PLCA 1YCCA 1JZGA 2IDFA 2J57A 2VSKB 2PLTA 1YTCA 4AI7A 2D0SA 2DWSA 4GP8B 4BXSV 3RYMA 1AZNA 1ZIBA 4GP5B 1DVVA 1NIBA 4FANA 3M97X 1GY2A 1DW1A 3AY2A 4MFHA 1N90A 3HQ8A 5CIDB 3PLYA 1X9UA 1ZDSA 2XVBA 1ASOA 8PAZA 3L4MA 1QNIA 1J5CA 1GU2A 2AFNA 1NPNA 2PCBB 3TYIA 3CXHW 2DYSB 3FPXA 3A0BV 3EH5B 1KV7A 1OE2A 1GDVA 2LIRA 1R0QA 2BWDA 1AZRA 1TEGA 1L9JC 5B66V 3SBRA 1COTA 1CIGA 3FSZA 2BHFA 2BO0A 1CC3A 5IY5B 1L0ND 1SQXD 1PLAA 2TSAA 1DW3A 4H0KA 1AG6A 5TK2A 1BQ5A 2ZONG 4KNUA 3UGEA 3OCDA 1C2NA 1C6OA 4F2EA 3H4FA 1MG2D 4KO9A 1SHXA 3NJLA 3WNIA 4DPBX 2PACA 1JZHA 4HHGA 3CDZA 5KLVD 1CCRA 2QPEB 2BW5A 1CYXA 3S3DB 1BL9A 3T6VA 1KX2A 3QJRB 2OJ1A 4Q8BA 2EINB 1CYCA 1NMIA 4WQAA 1OE3A 1J5DA 2GSMB 2XV0A 3QJTB 1AOZA 1PP9D 1OCRB 3L73D 5CIBB 1WA2X 2IWFA 2B4ZA 4HHWA 2VW7A 1YEAA 1PLBA 2L4DA 1GY1A 4WKXA 1ASPA 4DP9X 4QAOA 2QJPB 4U3FD 1NICA 4DPCX 4ENZA 2C1VA 4RSZA 2XTSB 4HZ1A 3CVBA 1OCDA 1PCSA 1OF0A 2N3BA 1CYWA 2FQGA 1A8CA 2BPBB 3VYMA 1QKSA 3OMNB 3H1JD 1NWOA 2B08A 4XYDB 5LDUA 1NTKD 1J9SA 2A06D 1FOCA 1GQ1A 1PNCA 3NJGA 3NSYA 5DJQB 1H31A 2D0WA 2P80D 4XXLA 3O20A 2XV2A 4E9WA 4YSAA 2N9JA 3CX5W 2XV3A 4FA9A 2PPDA 2IH9A 2WO3B 2XWZA 1ET8A 1MG2C 4UB8V 4EF3A 4KOBA 1A4AA 4FA1A 3A9FA 1DZ0A 2EIJB 4O1QA 4DY9A 4J20A 1ADWA 4WQDA 1JZJA 1SHWA 4H0JA 1JOIA 2VHDA 5I5JA 2J5WA 2AI5A 4UF7C 1DW0A 1HJ4A 5AKRA 1SNRA 2B3IA 1E29A 1RZ5A 3NBSA 1H1OA 1KCBA 1SFDA 1GKSA 2CE1A 2AIUA 2AZAA 3CVDA 3T9WA 3CVCA 1KYOD 3DMIA 4WQ8A 2Y69B 3FQ1A 3FU8A 4X4KA 5AZUA 3V9CA 4AKOA 4FA4A 4L3GA 1F56A 2OZ1B 1HH7A 1KBWA 3ERXA 1F1FA 2XX1A 1BQRA 1GS8A 1VLXA 1HJ5A 2FQEA 3WI9A 2I8FA 1YFCA 4K3IA 3BVDB 1E5ZA 3OA8A 1H33B 2N3YA 4E9QA 2R7EA 1TKWA 1HZUA 1AS7A 3FU7B 1ILUA 2OCCB 3ASNB 4W9ZA 3X2QB 1C75A 1H32A 5A7EA 2VM3A 1ASQA 1H9YA 2W8CA 1GS7A 3ABKB 3GXUB 1XB6A 2CALA 2CUAA 1SDDB 2YAFA 4YSUA 1ET5A 1GSKA 4Q89A 4DP7X 1QL4A 1WS7A 3CZUB 3NSDA 2PPFA 3AG4B 4DP2X 1CYIA 4FAVA 1S5LV 1MZ4A 2GB8B 5I6LA 2UX6A 3PXLA 3OM3B 4GXFA 3T6XA 1DW2A 1BXAA 3FU9A 1KB9D 2XU9A 4A68A 3PXTA 2FQDA 2N9IA 3TA4D 4PW9B 1W5CT 2DYRB 1E8EA 2ZXYA 1BAWA 2FJSA 4P5SA 4EIFA 4KO5A 4UAHA 3FSVA 1HZVA 1AR1B 1A8ZA 1N68A 1L9PA 1W2LA 1BEXA 1CHHA 4F2FA 5AURA 1IZL0 5KAFV 3CP5A 1C7MA 1ZV2A 2C1UA 2JQRA 1OV8A 1GJQA 3V9EA 3DKHA 4G72B 4FA7B 4AALA 1IO3A 3PAVA 4L0PB 2ZXWB 5B3SB 2YAHA 2EXVA 2VSMB 2IWKA 1NNOA 3PXWA 2BP8A 2YXVA 5EHFA 5I26A 4AKPA 5D4HA 2VMJA 2FWLA 3VRDA 1A4BA 1BYPA 1J9QA 1TU2A 4WQEA 3QPKA 2YARA 3C2CA 1AG0A 5TK4A 5B5EV 4JHVA 1C2RA 2C9XB 2QJYB 2C1DB 4PAZA 1RZPA 1H9XA 1B7VA 2QDVA 1PZBA 3SLEA 2HXAA 2CAKA 2GIMA 2QDWA 5GTHV 4DP4X 1NZRA 1W6WA 3SQRA 1ETJA 4QLWA 1PAZA 1X9RA 5D4IA 3OCDB 4E9TA 1KYAA 1YNRA 4PD4D 4WQBA 4AANA 2PP7A 3S8GB 3ZOXA 3SWSA 1JVOA 3ZDWA 3CDZB 5I5MA 1SQBD 3CWBD 3MX0B 2ZWNA 3OMAB 1CTYA 1GR7A 1V55B 3L70D 1V10A 1WA0X 1T5KA 2E86A 2Y1AA 4YVNA 4YSPA 1C52A 4FAAB 3QJUB 2CXBA 1LFMA 2FT7A 2J56A 1RKRA 3ZIYA 5E79V 3ABGA 4GYDA 4NB7A 1OAEA 1NIRA 4G70B 4G7RB 1URIA 2XUWA 3NJFA 3EH4B 4N8UA 4P4QB 4YSCA 4KO6A 2JKWA 2NRDA 2YAPA 4P5RA 3AG3B 3IN2A 1I5TA 1FA4A 1JZFA 1V54B 1N9CA 3JTBA 3QJQB 4BK5C 4HIPA 2N18C 2IDQA 5B7EA 1I8OA 2MTAA 3H4HA 1JERA 1LC1A 4QKTA 5AFAA 1DT1A 1PF3A 1CHJA 2HX8A 2GHZA 1CTJA 3IBOA 3CU4A 3L75D 4D6TD 3OD3A 4BWTA 3NBTA 1GYCA 4IL6V 1QYZA 1IKOP 1PY0A 2DY2A 2BCNB 3NJJA 1RAQA 3UACA 1RZQA 2YAEA 1ZRTD 4A2DA 1ID2A 3ORVA 3AZUA 3N55A 4JHUA 1J9RA 3C75A 5PCYA 2J55A 2YCCA 1CSXA 1WVEC 2QT6A 4BXVA 1ETPA 1M6ZA 1K3GA 1QN2A 3FS9A 1NIDA 1JXDA 1CUOA 3ABLB 3MK7C 3JT2A 2DV6A 1MG3D 2I85A 3UAEA 1CIFA 2PCCB 1KGYE 1IQCA 1OCZB 3KW8A 1A56A 1SF3A 3QJVB 5CIEB 3HB3B 1HROA 351CA 3L45A 2WSDA 1DYZA 1KDIA 2PPAA 1GIWA 3L74D 4M3HA 2Q9OA 2CA4B 5B1KA 3CXHD 4TXVB 2BH4X 1LC2A 3OA8B 1FWXA 2R7EB 2CCWA 3S8FB 3IE9A 4EIDA 1H32B 4E9YA 1SFHA 2FT6A 5DFSA 5B1JA 4BWUA 1N15A 1SJMA 1NINA 3PAUA 4YSTA 2QPDB 1C6RA 1GS6X 4N0KA 1N50A 2FYUD 4AX3A 2C8SA 4KMGA 1PZAA 2IDTA 3AW5A 4HALA 3L71D 1HFUA 5CIGB 1JVLA 1TEFA 3H1KD 2BZ7A 3PH2B 4NFGB 1IRVA 1CURA 2MTAC 1WEJF 1HJ3A 1CNOA 2VM4A 1I53A 2BGVX 2IDUA 3KZIV 2IDSA 1IRWA 4BDVA 2WO2B 1P84D 2HX7A 3RN1A 1YLBB 2HX9A 3EF4A 4E9VA 3WFEC 3EH3B 4YE1A 6PAZA 1BXUA 1KIBA 4Y5RA 1MG3C 2HRHA 4YSQA 1JZIA 5F7AA 1DIQC 3H56A 3NYKA 1U75B 4A2GA 3SBQA 4YSEA 3TGUD 2N0MA 5CYTR 3NP4A 1IC0A 2YAOA 6PCYA 4HCFA 1AS6A 1KX7A 1L9QA 3ZCFA 1XB3A 3O0RC 4UANA 5D4JA 1CORA 4A2EA 2XXGA 3X1GA 1JXFA 3HQ9A 2N18B 4YVUA 1I6EA 4DPAX 2LLNA 1MDAA 1J9TA 3IEAA 4AAMA 3TBCA 9PCYA 2H5UA 2HLEB 5I5IA 2ZOOA 2BP8B 4DP1X 4KO7A 5KLIB 2FWLB 3WKPA 1NTZD 1RCYA 3TU6A 1FHBA 3NP3A 1QHQA 3VNWA 2IBZD 3ZOOA 3NSCA 4JKNA 1L9OA 2XX0A 5B1BB 4GY4A 4CSZA 5IY51 1CXCA 5CIFB 3CX5D 1CRHA 4YL4A 2UXVA 1EB7A 1FI7A 2LITA 3H1HD 2VW4A 3NJNA 2BP0A 3ASOB 2FYNB 1S6VB 1CRCA 2UXFA 3MK7B 1NTDA 1CIHA 3IN0A 4DP0X 1E65A 4HAKA 4YSSA 4A67A 2QJKB 2DGEA 1AAJA 1M56B 1W6LA 3UADA 2GC4C 4KOCA 1CSUA 3DP5A 4GYBA 2B10B 3FT0A 4E9SA 3NJIA 2BCCD 3O5CA 4AAOA 1ET7A 2B12B 3ZOYA 1NPJA 2IAAC 4WTQA 3U25A 3RN0A 5GTIV 2VW6A 5DF5A 1CO6A 1F1CA 1BXVA 3NT0A 2YAMA 1PNDA 1AANA 2PPEA 5E9NA 2IH8A 3KW7A 3TASA 4AZUA 2UX7A 1M9WA 2BW4A 2MHMA 1IBZA 4G71B 1L9TA 2YAQA 4Q5PA 2AXTV 3UABA 5I6KA 1WA1X 3SJLA 1GW0A 2BH5X 1ZIAA 1SQVD 3PXSA 1E30A 1CCHA 3O1YA 3FYEB 3WFBC 3HEIB 1U74B 2OV0A 4DP8X 3X39A 1PPJD 2AZUA 1CRJA 1L0LD 1CRGA 1XMEB 1KCWA 2IWEA 2BLFB 1A2SA 3WG7B 4AKQA 1ILSA 4KNTA 3FQ2A 4G7SB 4ZK8A 1AZCA 2B11B 4YSOA 3FPYA 3X1FA 4A66A 5I6PA 3HQ7A 2GB2A 1FI3A 1KYOW 3WKQA 2C1DA 5B7FA 1YIQA 1BE3D 2GC7C 3S3BB 4L1QA 3PPSA 1L9BC 1NTMD 3WUIA 2CBPA 1I55A 3N2JA 7PCYA 1MZZA 3JBTB 3H1ID 1E2RA 2ZZS1 5B1AB 1H31B 1NWPA 1CTZA 1FJ0A 2XYBA 2HV4A 2A3TA 4E9RA 1EZLA 3NWVA 4YSDA 3TBBA 3FSAA 1AOQA 3SXTA 1CSWA 1RAPA 1JZEA 3WU2V 3H1LD 4MU8A 5TISV 1AYGA 1CHIA 2X88A 3DTUB 3FYIB 3T6ZA 2TSBA 2JTIB 3S3CB 3L4OA 4FA5A 3BCCD 5KAIV 1CYJA 4PJ0V 5I28A 4L3HA 1EZVD 3ABMB 1NIFA 4V2KA 2PP8A 1FI9A 2XXFA 4KNSA 3HQ6A 3QQXA 1A65A 1AZUA 4LJIA 1CRYA 4RH4A 4CSPA 1BGYD 1EHKB 2H3XC 1HAUA 1CXAA 2P80A 5F7BA 1WS8A 2UXGA 3T6WA 4EICA 3WIAA 2ZBOA 3WNJA 2HZHA 2UXTA 3PAZA 1CRIA 5PAZA 2PCFA 3ZOWA 1NIEA 3WC8A 1IBYA 1NDTA 4PWAA 4BDVB 4NERA 2BZCA 2PCYA 2FT8A 1AACA 3GYRA 1A4CA 2JXMA 3SVWA 3RLMA 5I6NA 1M70A 3L72D 4UB6V 3BQVA 3DIVA 1CSVA 5C9MA 2GI0A 4WQ7A 2VN3A 1KBVA 3A0HV 1PMYA 1AKKA 2DWTA 2PPCA 3NSFA 1DIIC 1L9RA 1NU1D 3DR0A 4A2FA 4DP6X 5KKZB 4DP5X 1OCCB 4G7QB 1SQQD 2AANA 4F7KA 1SQPD 1VYDA 2YQBA 3WFCC 1ZDQA 2AVFA 1SF5A 1DVHA 1QL3A 2MRYA 2ZONA 3OMIB 1CEDA 2W88A 155CA 4JCGA 1NMLA 2H47C 2GC4D 1BQKA 1AQ8A 2CA3B 1AIZA 1E5YA 2V07A 2YK3A 2FQFA 3NJKA 4W1TA 3WFDC 1J3SA 4O1WA 2FNWA 1UATA 2FTAA 2RACA 1B3IA 3RMZA 1HAWA 4HCIA 1CIEA 1LS9A 2DVHA 3X1EA 3ZBMA 4A2HA 3X1NA 1AZBA 2JFCA 3NJHA 3EHBB 4PCYA 2B0ZB 1FFTB 1L9SA 451CA 2EILB 4HCGA 5I6MA 2BP0B 4NAJA 3CYTI 1I8PA 5B6QA 1YEBA 4WQCA 1AOFA 4YSRA 2HRGA 2I7OA 2BWIA 4M4RB 1NIAA 1QLEB 2YXWA 4E9XA 1M57B 1JXGA 1MZYA 1KB0A 2XLLA 3UAAA 2OZ1A 3D12B 3MBWB 5FC9A 2FRCA 1LMSA 2ORLA 3X1BA 1M60A 3G5WA 4FB1A 4WQ9A 1N70A 5I6OA 1HRCA 1JDLA 1H33A 5CICB 3OQRA 2CE0A 4GEDB 5B1JC 1ZPUA 3FU7A 1W8EA 2EIKB 3AG2B 1KDJA 1OE1A 3FSWA 3ZX1A 5CIHB 1I6DA 4EIEA 1E67A 2X87A 3SBPA 2Q5BA 4N4YB 2CJ3A 4BWWA 1PZCA 3QJSB 2I7SA 3GDCA 1FCDC 1BYOA 1HCMA 2PP9A 3NJMA 5H2FV 1C6SA 2GC7D 1YICA 3FQYA 1SDDA 5C0ZA 1KV9A 2GBAA 5ANHA 1R1CA 5B7MA 2GIWA 1XB8A 1K3HA 3T71A 1OCOB 1I54A 2C2CA 3AG1B 3CG8A 1BCCD 2V08A 2YIUB 3PCYA 7PAZA 5DJQC 1OOWA 1RZ6A 2EIMB
chains in the Genus database with same CATH superfamily
1OTTD 2DM4A 5DHXB 3ZDYB 4DGYH 4M02A 3SJVD 3TBVA 4KK8D 1JZGA 3OAZH 5DRNA 4ZNEA 2VSKB 2PLTA 4MNQD 4NQDD 3HZVA 4AI7A 2R39A 3P0YL 1AZNA 4FD0A 2V8MA 3ESOA 4X7TA 1T2QL 3VGGA 1AGFA 3R0NA 3TCTA 3P9LB 3SPVB 4IGBB 3ZL1A 3QULA 4JLRA 1BM7A 3FQUB 3L4MA 4LCCB 3PFUA 3TYIA 5AOLA 4ELKA 4KH2A 2QVMA 3SDAB 1A7OL 3MJ8A 3TBWB 2HG5B 3MJ6A 4DHLA 1R0QA 1QFPA 4WGVB 4WW2F 5J0BA 3U2SB 1HC1A 1FL3B 1HXYB 2ZUTA 2V17L 3VNZA 4DVBB 2BHFA 3O6MH 4JFQB 1E5UI 2HWZL 2RQ8A 5CR8A 5EU6D 3WKML 4B50A 4UINH 2LQRA 1Y07A 3V10A 4L2YA 5KYYB 5AB0A 4I85A 5I1AB 4HUUB 3BN3B 3FQWB 3UFIA 2X9XA 4AOFA 5AVVB 4MA7L 4LSPL 1URLA 2X4OA 4X6DF 1FE8L 1SXCA 2X1QA 5KVFE 3BYTA 2Z0UA 1X5XA 4JFFD 4UUJB 2GK2A 4OFDA 2IWFA 3D48R 4XH2B 5JW4R 3MJGX 3SY6A 1YEAA 2KQMA 4C4BA 2BZDA 4IBSA 4KQ4L 1Z1WA 4HZ1A 1OM3H 3INUH 3K6FA 3QARA 1QRNA 2X42A 1EBAA 2K8MA 2QEJA 4H4NA 1KIQA 3EOBA 3OMNB 1T89A 4HUNB 4K5LA 4PJ7A 2V2TA 4XYDB 1FOCA 2NNAB 3D1MC 2B7DT 1LE5B 5IM7A 2WW8A 2A6JA 4NI6A 4X99B 3O6KL 1RZ7H 3QFJE 3TYGH 4W93A 5HDBE 3PGFH 4PWKA 4UB8V 2UY7A 1A4AA 3BWSA 4KDTC 2FB4L 1VKXB 1DW0A 1DEDA 1RK1A 3RWJA 4LCWE 2ENYA 1T20B 3AT0A 1F86A 1E29A 5F44A 2DTML 1PVHA 4V1DA 2W95A 3VDBA 1DJIA 1P6WA 2X10A 3ULSB 3PDOA 2XVKA 1U8MA 2LAAA 1T80A 2UZYB 2R2CA 4ZW5A 4OKVB 2XA8L 1Q94A 1P2CB 1BBJA 1XD1A 3GZQA 1E5ZA 2X38A 1G9MC 3LNHA 4EBQL 4P3CH 1AS7A 1BQUA 1H9VA 1Q9KA 1T2XA 3D4CA 1KXQA 1U0QA 2B0SL 3FQTB 1J8SA 2IQAA 3GI8H 3H0TB 4NRXA 5KSBF 1QEXA 4RX4D 5L6YL 4HSQA 3S37H 2CDEB 1QOKA 1N0XH 3HPLA 4OZFG 3UPCA 2QKIA 2NZIA 3FU0A 4GEJA 2CJUL 5GGQL 3P4OA 1LDPL 2AAAA 2R0WH 1EO8H 3LHPL 3WCYA 2A9MH 2G5RA 5CFAA 2GB8B 1PDKA 4JM4L 1NDMA 1UB5A 4ZDHB 1HSBA 3W2DL 4WENB 3VWKA 2JELL 2CSPA 4RBPH 5LQBL 4JDVB 5DRXB 2N9IA 4UV7L 4F37K 1W5CT 4H5SA 2X4QA 5TDOB 3ISYA 4OZGA 5JW4Q 3SD2A 4N0RA 4J6RL 2XTJC 3HN8A 5IROA 1G1YA 4CU6A 4B3VA 3O0RH 3OKMB 5IOPA 2ADJA 3V9EA 4BQ8A 4FA7B 4P9HH 4AALA 3PAVA 3JSSA 1LP9A 2PYFB 4MJ5B 2CGRH 1YNTA 5EHFA 4MNGB 5BVPH 3Q3GB 1C08B 2V33A 3GSWB 4RGOL 1C2RA 1NCTA 4ANXA 4GKNA 5A2FA 3UP6A 4XB3A 3EGSA 3TT1L 2GIMA 2N3JA 2WKOA 5CCKL 1N8ZB 1W6WA 4G8EB 5DT1H 3O3AA 4G6FD 1ETJA 1QWUA 3SQRA 4TLTA 3MRNB 3FFCA 3Q2LA 5KVGH 1XXDC 1XL6A 2WCGA 2WN3A 3DX0A 1OP4A 4AANA 1U8PB 5C0FA 5IUCA 1SQBD 1CPUA 2BVOB 3CWBD 2BHYA 3MX0B 1DVZA 3ARPA 1NGYA 4XCYB 2ZNXA 4KGJA 3TTYA 3AJ7A 3DMMB 2OK0L 4HBCL 4MKTA 1YEFL 4AW4A 1WC7A 3RLSA 3U9PH 4GYDA 2GITA 5CJOL 4G7RB 5EIIG 3EBAA 1O75A 2Z64C 4NFDA 5AVZB 2VLRE 2Z7YA 5AAWC 1O7SA 4AM0Q 4K3EH 1A8JH 1NOFA 3ILQC 3NZSA 5CJBA 1JZFA 3J2PA 1V54B 2VDRL 4Q9RL 3T3PB 4QIRA 5D5ME 4WCYL 4PGDA 5D7JD 5SWSA 5L2KD 4M1CD 3OF6D 3T3MB 1FH2A 4L1BA 1CHJA 1TTFA 2I9LA 2VDMB 3MODH 4F91B 3DUHA 4H7VA 1CWVA 1ZHBB 2W65A 3RL1B 2CUMA 3NJJA 1DBAL 5ECJE 1IU1A 2E27L 4PJDE 2C3WA 3IDYC 3DRQA 1WO2A 4G82A 2JMRA 1RL1A 4WHYH 3IFLH 1CSXA 4KX7A 4OF3A 2XTJB 4TUUA 2YEQA 4QRFA 4XN4A 2RGSA 3JT2A 1MG3D 1W72B 4M7JL 5JOEA 3PNWA 5JOPE 1SF3A 4GW4B 2XJLA 4CADB 2HJFA 2H2PD 4GBXC 3CH1B 1GOFA 5EA0L 4XBPA 2C8NA 3L74D 5AL0A 2NOYA 1YPZE 3LRHA 5IR1B 3DIFB 2B1HL 2CO6B 1E28A 1DO6A 1SVBA 1TMCB 2YHGA 2G9HA 1LO5B 3WMPA 3BWZA 4K3JH 4WIQA 5B1JA 5F9AC 3EGDB 1HZKA 2Q76B 3KNBA 1UUSA 2ARJA 3I75A 1VJSA 3WXVL 2FCBA 3L71D 1XAUA 2G2RB 5D7KD 4Y9FA 1DFBL 2YO3A 4LKCA 4L5FE 4TULL 4JFYA 4PRID 3F84A 1FIGL 3BXNA 3M1CA 5BRPA 4B7LA 3EXLA 5F3BA 2BFVL 3MREA 4PCKA 3PWPB 2ZCHL 3BPLC 1QRKA 4JBSA 1Q38A 3PHOB 4YUEL 5E6IA 1KPUB 4FQCH 7FABH 2D9CA 3H56A 4NPYA 3NCCB 3FUMA 2BIOA 3H7BB 5AAMC 5E8EB 2N0MA 3FKUS 4JO5A 5F3HA 4GRWF 2O61B 4GRLC 1KX7A 5A43C 3ALXA 1IAKA 2R1XA 4OLVL 3QISA 4FQXC 4NM4L 5CUSH 2YOAA 1I6EA 3C5JA 5T5FH 4XNDA 2NY4C 5MHSE 1VGEL 4UIMA 3MBEC 1YEIH 3WKPA 3TU6A 3NSXA 3HN3A 2MOQA 3LZPA 3VNWA 2QHLA 3JWNG 1CICD 2WQXA 4HJUA 3NIGE 4MXVF 5IY51 1TO4A 4AL8L 2G5BA 3IDYB 5ICUA 3HB3C 4MB3A 2MPAL 1MUJB 4A7UA 1BF5A 4Z23A 2OP4H 3NK3A 2VDOL 1U8IA 4X5WB 4NSKA 3QJZA 3HZMB 2FEJA 3AU1B 3OAZK 3VD5A 1MIMH 4E9SA 3FT0A 5HVWA 4QRRA 4L4JA 3QWRD 4IEFA 1YHPA 3VSUA 4MSWA 1I9JH 3RVVD 2FJHB 1X4ZA 3DURB 1AGCB 1I9RL 2YAMA 1L6ZA 1FZMA 2HFGH 4UM9A 5DDHB 3KW7A 2LAGB 5FCUL 3MGTA 3OZ9H 3RJQB 3W9DB 2LU3A 4I88A 4G71B 3HNTL 4XO8A 3BSGA 2VC2L 2ORBL 4B27A 4AEIH 1PZUB 1AE6L 4XXWC 1JJUA 1CVRA 3FCSB 4HKBB 4LARH 4XGZB 4M03A 5E6RB 3TIEA 5IT2L 4Y1SA 4QHKJ 1FN4B 3LNGA 3VGEA 3K74B 1S9WB 5DS8A 5JPMA 4QJ4B 4IIZA 2YEZB 4UDUA 3SKNA 3KCWA 5E1HB 4AKQA 4F8TA 5T5NG 1K4DA 3BPLB 1OAUL 4XPFL 4DGIH 4X5PA 1LO3L 4P46A 2H1PH 1JPFB 1SMAA 8FABB 4PJ8D 1HK6A 3V4VA 1TF4A 3MLWL 2YPKA 5CO1A 2D73A 4AT6B 1OVZA 5J6SA 4G42A 3U0PB 1QSEB 2X6UA 4Y4KA 1UM6H 2HV4A 2C7UA 4XWOC 15C8L 1U8NB 4UNIA 4ES8A 4U6HB 3SXTA 3LDBB 2NY4B 2BSED 2Q7YA 3RPIB 3MBEB 5LG1A 3OL2A 5E9DE 1XZ0A 5KAIV 1RZJH 1Q9LB 4RQQA 4OSUL 2MNUA 5J12C 43C9B 1A2YA 5DJ0A 2H1LM 5JW3L 3UIZA 3V6ZA 5JXEA 1U3HD 3FC8A 4NGHH 3UROR 4NP9A 2OXHB 5F7BA 5EC2B 3KGSA 5SX4H 5IBLC 5C1MB 1CRIA 4PJXF 1TZAA 3WC8A 3GSNA 5FLVA 3K0YA 3SQOH 1U95A 1E27B 2H6PB 4JJHA 2JXMA 2NLJB 3ILPB 4AQ8A 5I73C 5I23A 3WFHB 3LIZH 2LE9A 5CF3A 4TVPL 2CM6A 4MXQD 4WQ7A 4FTDA 4LDCA 2E6JA 3LZRA 4JRXA 1UB6A 4A2FA 2YRBA 3P2DA 4LEOB 2ADGB 2AEQL 1H3PL 4NO5A 5F96L 4G9DA 1BLNB 3OMIB 1YUHA 3BUBA 2DLFH 3PQYB 4KAQL 1X5KA 5CZRA 1NFDF 4G1MA 4YHZH 3QPXL 1OIOA 3EH1A 4AQ1A 1NMBH 1XR9A 4XNYH 2YK3A 3OB0H 3WFDC 3LXBA 3EOTL 2NQCA 4PGZA 4EN3D 5I1EL 1BMWA 2BNRA 3TNMB 2NXYD 2OW7A 2EEFA 2OR9L 1ZSDA 4G7VH 3BQUB 4U0QB 4EUPG 1SXBA 2K4WA 4NAJA 1U8LA 2BSTA 3HUJA 2L0DA 4NO2B 4ZMWA 3P69A 2YXWA 4RBPK 3MV7E 1JWSB 1AO7B 1BFOA 3S35L 2AJSH 1LMSA 3S34L 1A5FL 4QHKI 3LPOA 1WBXB 4NZFA 1LEIB 3O81A 4Z9KB 4LGRB 4GEDB 2W38A 3UTPD 1E3ZA 3FU7A 3RWGB 1VEPA 3G5ZA 4XN2A 5L2JB 3HMXA 5I0WA 3SKOA 5AW9B 2QR0B 4XAKD 2WWKO 1YEGL 4TVUA 3GM0A 5EZJA 5GS2H 5T1MB 1XF2B 2VDMH 1VADB 5BJTA 3Q6GL 4NP4L 1TETL 3MRCA 5E2TH 1UACL 2OL3A 1ACCA 3BT2L 2Z91B 5I73B 3O0LA 4BK4A 3M97X 1BVKA 5A2CA 2N59A 3PDGA 4IIQB 5DHMC 5DMKA 3AXIA 1CXIA 4XN5A 2VRQA 1W72H 2LFGA 4G8FB 4YDIH 5KSAC 2VLKE 3IGAA 4BZYA 3OGCB 4WJG3 3S5LG 1V3LA 1NPNA 4UM8A 1O5PA 4APQD 4EI5C 2ZX7A 5JPNB 2XKUA 5E8PA 5BW7A 3AT9A 2YXMA 3SBRA 1J9CT 4HFUL 3OKKB 1HH6B 5F7MC 4ADIA 1T7YA 3ROLA 2Y9RT 2AQ2A 1LK3H 2XWEA 3ESNA 1NCGA 2A74C 3KEDA 4HBQA 5E5MB 4HS3B 3U4EB 5GJSH 4HIHB 4E41B 4KO9A 3CCHB 2O1AA 4HLJA 1ZLSH 4R4FH 2RMNA 4WHCA 5C7XH 2A83B 1CTOA 3V4PB 5C0BD 4Q8BA 1JDDA 1R3LA 1EXGA 1IEAA 1CYCA 1AY1H 3IDJA 5I75C 1OE3A 2PCFB 3EYVB 4PRPA 3CU7A 4PGEA 1FFRA 3QI9D 4OIFA 4YEFA 3DXAA 4JGJA 1FUNA 4H1LB 3BUYB 2BLFA 4G6AC 1PFOA 2J1WA 3CVBA 3UGUA 5LGYA 1QG3A 1FG2A 2IPUK 3QEGL 5F8RC 1EZUA 1MVYA 1T66D 4LAQL 5HJBA 3US1A 3GMRB 2QBWA 4W4OA 1ITCA 2XY1A 4JVPA 1P5VA 3D5OF 5LVEA 4FG0A 5CZXC 3O6LL 1CL7L 2D0WA 1HQRA 2XV2A 4PP1C 1IZKA 4KJWD 4U0RC 3IVKB 3HHRB 2HVKA 4YBHA 2HJKB 4PTTB 2IH9A 2F5AL 2UWEF 3UTTB 2Y2TA 1N3NA 3AB0C 3U82B 2BRRL 2R83A 3FZUC 5EF1A 2YUZA 1D3CA 3HG1B 4L4VD 3IFNH 2VHDA 4K9EC 2A4EA 4YDVB 3O4LA 3MN8A 2B5IC 3L3KA 2IPTH 1RHHB 1OQOA 4UQBA 4MA1B 4FA4A 4EI5B 5HGHB 2J1KA 2WK2A 3F00A 2OJEA 3H3KA 4Z7UA 3B43A 4DZ8A 1UQSA 4L48A 3H3BC 1DQKA 2AMUA 1HZUA 3UJJL 1HJBC 2YD4A 2A74B 2FEDC 3P30L 4P4KC 3FN9A 3TBTA 1D2PA 3T0EE 1DN0A 3STBA 2H4EA 2CO7A 2O6DA 1BF2A 2YJQA 2Q87A 3D3VD 3QWNA 4OZIB 4HKZB 1DN2A 2WD0A 4MQXD 3BEVB 5FGRA 2IBGA 3K8LA 3QIBD 2VOTA 5I75B 2HLFC 3GZOA 5H4YA 4HP5A 2VDNB 5HYJB 1D5XB 4R97C 4MD5A 3OB8A 2DYPA 3SDXF 3SKUD 1FZOA 5KS9A 1DSYA 3FSVA 3V0EA 1AR1B 1HHIA 4NKOA 5G4NA 1M7IA 1QA9B 3K6SA 1RV6X 3HHSB 5D1XD 2DDQH 3MJ9H 1ZV2A 3C6LC 5I71C 3MRHB 3D2UD 4RLDA 4JFEB 5GXBB 2F61A 1BCIA 2WCPA 5EV7A 2WTPA 2NW3B 4PJEA 3TN0C 5EPMA 5E4OA 2YXVA 2OZNA 3B9DA 3SJVE 1A6WL 5HJGA 2APVA 4NQDE 3TZVB 1TFPA 5EMYA 2DBLL 3CVHB 3LPPA 1CGSL 1OAQL 5DZOA 2WTRB 3AB0B 1RZPA 4OCXH 4OZ4A 4OKDA 1H9XA 4B96A 1J05B 4M6MH 4XN9A 4IRSD 2A9CA 4OUUA 5EEUA 1L0YA 3GB7A 1PAZA 4MCZB 3FFDA 4LHUB 1KYAA 2B5IB 3D2TA 3SWSA 4WK2B 2Y72A 2R56L 2FGZA 1I7UA 3OXRA 3BJLA 3JV6B 1N64L 1F8TL 1BEYL 4JZJB 3FB6B 1J8KA 2FLRT 4J8QA 1YNKH 1DQMH 4G6KH 3NCYS 3ZIYA 3WHXB 1ZT1B 3WSQL 4P23A 1OAEA 5E1AA 1NIRA 2IOOA 1X5GA 1JD9A 4QO1B 1HWHB 2C9VA 3EUDA 4J28A 3RQ3A 1F3JB 1CBVL 5IQOA 3WJMA 4KNQA 4NBXB 3IDIA 4F57H 1PJ9A 1JNHA 2J73A 1N12A 1S5IH 1VSCA 4GIAA 2JI2A 4R9HA 3JTBA 4HIPA 3KPRA 4BSJA 4X6FB 2VL4A 4AMXA 4Z77B 4I4WB 4JFFE 2EVJA 4BIKA 2EDWA 1PQZA 2ZKHH 3ZHNA 2Z8RA 3KVQA 3NBNA 1J18A 2OMTB 3ASWA 4PJIF 5DXWA 3ZKXC 1USZA 3N42F 4HETA 1IVLA 3IDGB 2AXFA 3UJTH 1ZHKB 2PYEA 3UTSD 2H8PA 3QEUB 3V4VL 3ZVVA 3UEZA 4ZMXA 6FABL 3TC9A 3BUIA 4JFOA 5ANMA 1SEQL 3A24A 4G3YL 3HBPA 3AMKA 3C6LB 3KW8A 5I71B 1IQCA 2EIDA 3JVFC 5IG7A 2MEJB 1CXHA 3NA4A 3UBGA 1I8MB 3TN0B 3QFDB 4M3JA 1FO0B 2BDNL 5TE7H 4Y19B 5J3HD 1GIWA 3NUKA 2Y7MA 1D9KC 1DE4B 1JK9A 3L2MA 4BSVB 2JJSC 4MB5A 3FHAA 2CKBA 1NSNH 3PL6D 1FAIH 2DAVA 1KY6A 2EDKA 2X4PA 4M62H 4HKXA 4Y5VA 4QUOA 2A0LC 3II1A 3NCFB 4KY2A 4PLJD 4EZJA 5BV7L 1QO3A 2R2BA 3WNLA 3GK8L 3MRQA 5JYLA 4PREB 4X6CF 2XQBL 1TEFA 1OM9A 2R8SL 3ZDZE 4I48A 1M1XB 3PH2B 4OI7A 5HJ3B 2PO6A 4W9FC 2AEOA 3OB0K 3T4YA 3WNNA 2DLGA 3GSNL 1AGBB 3H9YA 4BFRA 1WBZA 3RN1A 3KH3A 2LFEA 4OZFH 5D1ZD 4NO0D 3Q2NA 1PSKH 1MPAL 2OMXB 3B2VH 5HI3D 4G80B 3SE9L 4UOZA 4PJBB 4PTUA 1IC0A 2YAOA 4O5LH 5BOJA 1AS6A 5I8OL 1BD2B 1P4IL 5BRZD 3REVA 1ZE3C 3BKYL 5DEFB 4A2EA 4BCXA 3T5WA 1MFEL 1PW3A 5IFJA 4NOBA 3WNKA 1MFBH 4AAMA 1RUQL 3G04A 4KKAC 2FJGA 2R69H 1RCYA 5GS1A 3M17A 1UHVA 4FQLH 2BCKB 4PJGF 2F8XC 2ZKWA 4R5VA 4YEEA 4CVZA 3LH8A 3GDBA 1TJXA 2GJ6A 3QJXA 2I5YH 4TQPA 4WUUB 4X4ZA 2HN7A 3RG1C 3I6LD 3FUJA 5JHDA 3ZZ1A 4YHNA 4UTAH 3VXSD 1BOGB 1HZHL 1R3KB 2FO8A 5LUMA 3P73B 3K0WA 4XZUB 1TTAA 1XIWB 4F7EA 2GK0B 5GQBA 3A4FA 2V3FA 4CVXB 3NAAH 3K8KA 2EUVA 3A67L 3V6FA 1PZ5B 3QQ3A 3QNFA 1JPGB 2MHAB 3SOBL 4PJ5D 3GINA 2PCXA 4Z0XA 3Q6FA 4PBVC 4KKNA 3V0IA 4MCNA 3UEQA 3HMXL 4XVJH 1J0IA 3AQXA 2Z8SA 3QDGA 2LABA 3DX2A 2QGEA 3R1GL 5CMAA 1IBZA 4F27A 3IGLA 1P9MC 4ETQA 1J5IA 4HS8L 4QHMB 12E8L 4AGLA 5I6KA 3KXFA 3H6AA 1RZKL 3VD3A 3PXSA 1ED3A 1KZQA 3KPPB 4JO3H 4N2BA 5AQ0A 5JIKA 2H2SD 1SLUA 3B34A 4JAMB 1CRGA 4I0PD 4JGMA 3SGJC 4P9ML 3RY5A 1NLDH 4GO8A 1AXSB 2BHZA 3ML9A 2OL3L 3ILDA 2HTKD 1QTYT 3D52A 1JRHH 4DN4L 3UDWA 1PKQE 2KKQA 2PXYA 3RKPA 3P9LA 4PJAE 4CMMB 2Y1YA 4IGBA 4WSKA 3SPVA 2R0ZL 5EEXA 3ETBF 3D39E 1KIPB 4TNFA 1RIUH 4GXUN 4X9IA 3QZWB 2XTLA 3NZ8B 1ECZA 2IOIA 2JB5L 2XPZA 4LCCA 5H2BB 4K3GA 4K7PX 3SDAA 1FJ0A 1G7QA 3TBWA 2ALWA 2HG5A 3E0GA 4J3TA 3N40P 4LSSH 2NY0B 3U2SA 4PLKD 1RAPA 1FL3A 1HXYA 1SBSH 5DVLA 2QGDA 1CHIA 3FYIB 4K7FA 4DVBA 1NMAL 2JCCF 2TSBA 3QFJB 4H8VA 4JFQA 3L4OA 1AGDB 5HDBB 3L54A 2CU9A 4M6NH 1U6AL 1UCBL 5KYYA 2GSGB 3QCTH 2Q8BL 5I1AA 4HUUA 3SYAA 4LJIA 3C09C 2W9EH 3FQWA 4LCWB 3Q5YA 2Z34A 4UAOC 4YZFE 1DBKH 4YQXH 3VQ1C 2DN7A 5JQ6L 2PUQT 2YD8A 3WNJA 3BD3A 2P49B 5L9DL 5ESAB 3WY2A 4UQAA 3CN2A 1IBYA 3GKWL 4RMWA 4UUJA 4XH2A 2G30A 4TPRL 4ZZFA 3L72D 1USQA 3MLRL 3TO4C 3TJPA 1CSVA 1Z9OA 2FUTA 2ZF9A 1QABA 4TKWA 1PMYA 1AKKA 2JVUA 2JJUA 2UY6B 2WUCH 3AREC 3FH5A 5D7KE 1M7DB 4U1NB 1T04B 2E7DA 4JHWH 4JN2B 1RJLB 2NNAA 3O8XC 4RDQF 5IVXE 4YOKA 4PRIE 1LE5A 4R0LB 2X6AA 1A64A 3CVHH 4JO2L 3H42L 3NJVA 3OAUL 2QJDA 2QSTA 2FQFA 1BP3B 1KJ3H 1T1ZB 4LLMB 3S7GA 3X1EA 1PZ2A 3S5ZA 3OX8B 4JFDD 1VKXA 2JFCA 3TJHC 2YEVB 3NJHA 4PJ7F 2XC8A 1IQDA 3DUUB 5KUKA 2Y25A 4JQVC 2XFGB 1I8LA 4IKNA 2O5ZH 1NIAA 3JWNH 3ULSA 3CNKA 5FYKD 4I5BB 5FC9A 1KSRA 2UZYA 4ABUA 4OKVA 5CHNA 4ZOEA 4XP1H 1P2CA 4M8UA 3H54A 1EZVX 1PIGA 1RJYB 3O6ML 1CJYA 1E8WA 2DOCA 4EIEA 2W07A 5E9AA 3WFEH 1N5YL 1LE9B 4UINL 1IILE 3DYOA 5C9JB 1PZCA 2DH2A 2ZP9A 5HTSA 2BVQB 1OPOA 3NJMA 3C09B 3FTZA 2ADFL 5L8KB 1MCIA 4KRPC 1CFTB 4UAOB 5C0CD 2V08A 4YHKL 4NI3A 4X6BB 5FHBL 2AP2A 5CJ8A 1YMMD 4GAGH 3BISA 4L3AA 5DRXA 1GMIA 5D2NE 1NL0L 3U7WH 1H3WM 4MWFB 3BLBA 1MJ8L 3ECVA 2NY6C 4FANA 4P07A 1KYDA 3TO4B 4MFHA 5DEZA 2B2XH 4F2ME 1LL1A 5L4JA 4Y88A 2B59B 1IM9D 1X9UA 2VLRB 3OKMA 4D8OA 1VGKA 1ASOA 1OM3L 2V6HA 2X4RB 3H3PH 2H3NB 2GJZB 3QC5X 1FO0H 2H45A 2PYFA 1KBGH 2F15A 2VITB 4MJ5A 5D5MB 3O8XB 4MNGA 4MLIA 4ILDA 3S4SG 3Q3GA 1C08A 2NY5C 2OTWB 5GIRB 3ESPA 1AKJD 4Z7VE 1SVCP 3GSWA 3N0AA 5KBDA 4KITB 5IFHH 3NFNB 3ZLQC 3GHBH 3IDUA 1WIPA 1AQKL 2DMBA 4G8EA 4PJDB 2ZONG 3MRNA 3KLHD 2XI9A 1U8PA 1KELH 1LP9F 4GO9A 2E0PA 1YNTF 5DD6B 2BVOA 1CYXA 4JGUA 4XCYA 3CFEB 4RSYA 2ZT9C 3DMMA 3BUPA 1ETB1 1IEBA 1H15B 4AC4A 2XFXB 3QJTB 4JRFA 2WKOF 1WDAA 1YPZB 3VXRB 4N6QA 4WKXA 1XO8A 1PLBA 1GY1A 4GMTL 1TZIB 3WMSA 4P3CL 4WW1B 4ENZA 4YXLL 3GI8L 2OTUB 3C08L 2R4SH 1LM8V 2OI9C 4BKLB 2X40A 3VX1A 5CNHA 2YGQA 1N0XL 2R9HD 3OJDB 4WV1B 4GG8A 4QHPA 4KRPB 1GW6A 5B22A 3NSYA 4PMFA 3GJFB 1EO8L 2A9ML 5F8QC 3JWOC 1UT1A 3P77B 4MZ2A 3V0DA 4AVKA 3RL1A 1ZHBA 4OQ1A 1ET8A 1ZS2A 4JG9A 2LLLA 4ZFGH 3CSBA 1OWWA 3NDYE 3A9FA 3L4XA 1IB5A 2NY6B 4O1QA 3K4ZA 4I77H 4YE0A 2MIZA 3WTXA 4W70A 5GS0H 4S1QH 5FFLA 4F9LC 1CI5A 1W72A 2HTLD 3O0RL 5EZOH 1GKSA 1X5IA 4GW4A 3T9WA 5F6HJ 4FLRA 4CADA 2DQJH 4ZXBD 1FYTB 3CH1A 2Y4SA 3FOLB 1EA9C 2DB8A 4TV3A 2APTA 2DLEA 1AH1A 2O5NA 1LEKB 3ERXA 4NN7B 1WAPA 2YUWA 5BVPL 3DTDA 5IR1A 3DIFA 2CKBL 2CO6A 5I9QB 4HWNA 1PAMA 4MD0B 1LO5A 1C75A 5IMOB 1QAWA 4WO4C 4NQED 3EGDA 1KLGB 4PWEA 4QI3A 1IJ9A 1SOKA 4JPQA 3EJYD 5F1NB 5KVGL 4YBQD 2XYCA 3LXAA 3SDCC 3PIQB 3NSDA 3NZHH 4PG9B 3K2IA 4GB9A 3VH8B 4M8QA 1OT2A 1FVDB 4MDJB 3RHWK 3PXLA 3S5YA 4HV8B 2NY2D 3ZHKA 4XHJD 1F4YH 1X4XA 5T1DH 3BLKA 1LD9B 3LQMA 3ULUE 3LZFL 2UUDH 3LEVH 2Q3XA 3TA4D 3AFLA 4U3CA 3PHOA 1KPUA 1XF4B 2ZUXA 3QNZB 2DL2A 5K39B 3H7BA 5E8EA 4BFBD 1CE1H 2ITDB 3HRPA 2XN0A 4XAKE 4YR6B 5K69A 2O61A 1DEEB 1RIVL 5KAFV 1SJEB 5L0QC 4TTGA 1HH9B 3HE6D 1KMGA 4K3EL 2YGPA 4PWFA 5F0JB 3ATDA 3EH2A 2HB0A 4KRNA 1D5BB 1LO2H 3CHRA 2RH0A 1M4KA 3LZLA 3ZKND 5D7EA 3TBYB 1R3HB 2Z1KA 4D3CL 1BVNP 2A73B 1B7VA 1K9TA 5EOCH 4HS6A 5GTHV 1CXFA 2WWOA 2Z65C 4XVUD 3BT0A 4OCMC 3KLSA 4D9LH 3J7HA 4YK4C 4BFEA 1DBJH 1EEUA 4X5WA 3GTNA 2K7QA 2L7EA 1EK3A 3ZDWA 1CBJA 1CD1B 4X9GA 3HZMA 5I1KH 1IC5H 3AU1A 3NA9H 3WEOA 7TAAA 3VTMA 2OSYA 3ZYOA 5J13C 1BBDH 5K9OB 3VFRB 5KVDH 4XNBA 2GUOB 1MJUH 1W0WA 2CM5A 2FJHA 3ABGA 3NN8B 1AGCA 4LDLB 4QXUH 5EF2A 5DDHA 3W3BA 1QBLH 4POZC 4WO4B 3W9DA 2WLJA 4YSCA 1ZRUA 2ZZUT 3AY4A 2XKNB 3CU1A 1KB9K 3BVWA 5GZND 3V9FA 3MXVL 4ZMYA 4FP8H 2IV8A 3FCSA 4HKBA 3SDCB 4XGZA 3LH2L 2X89D 1VENA 2IDQA 2JKJA 4OF7A 3AM8C 3ESMA 2MSPA 5E51A 5JLZB 1FN4A 2P5EA 1DT1A 4PJHB 1S9WA 3IMTA 3BP6B 3HFFA 2YEZA 2JIXD 2H0EA 4MA3B 4YBLC 2DWYA 4F9PC 4Z3IA 3P2TA 1P7KB 1F11B 5C0GB 1J8HD 2G2NA 3NRPA 1JPFA 8FABA 4FQCL 1A3LH 4FXKB 2Y36H 4U6VH 2VL5B 4P2AA 5AAMA 2DQTH 4ZO8A 1ETPA 2YZ8A 3FS9A 5IB5B 5L0QB 4M1DH 4ZOCA 4JFPB 3MJ9A 4OIIH 3X3GH 3U0PA 1QSEA 4ZTOL 1J1PH 3MOBH 3IMWA 1U8NA 5CUSL 4U6HA 4X9HA 3G5XB 4L3FA 4Y9BA 3RPIA 3ATFA 3MBEA 3O9WC 3QUZC 4M3HA 1UT2A 4FG6C 5CU9A 4ZS6D 1YEIL 2BH4X 1GSMA 4FL4C 4L4VE 4UBDC 5D71H 1J7VR 1Q9LA 2WLZA 4FI8A 1WWAX 5B39B 3IE9A 3P0GB 1RZ8B 43C9A 1SFHA 3IPEA 3VCLB 2XVLA 1OK8A 4YK4B 4N0KA 4Z7OE 3BSHA 3L4CA 2OP4L 4U2YA 4KMGA 2GT9B 4HALA 5BO1H 3N9GH 5F6IC 3BH9B 2OXHA 3DBSA 3MQIA 4GT7A 2WBJC 2HKHH 3MLVH 5KYWB 3D09A 2CO4A 1OANA 4G7YL 1E27A 2H6PA 5HVGB 1SOXA 2NLJA 3GSXB 3ILPA 5D8JL 5DD5L 5AOMA 3WFHA 3SCMD 5CJXC 5INCA 5ETUB 1N59B 2DKSA 1I9JL 2B4CC 1DIQC 3L5IA 1X6NA 3WDHA 2QADB 4F37F 1T0NB 2HFGL 3NP4A 4LEOA 2ADGA 3OG6B 3KPSD 3OZ9L 1BFSA 4LMQE 5DVPA 5T8IA 1CF8H 1BLNA 3D3VE 4G5ZH 4XXWA 3PQYA 3HQ9A 2VXTL 1UD4A 4NC1E 3MV9B 4LARL 2HLEB 5EUOE 2WNGA 2OJZH 4DKEH 4QLRA 2CQVA 1NFAA 1F2QA 2D31B 4AIEA 1FNAA 1KYFA 3TNMA 2VT0A 5AOJA 2W0KA 5D1XE 3BQUA 2H1PL 1H8OA 5GRWA 5EC1A 1S6VB 4NO2A 3MRMB 3ZGIA 3HG3A 3EBGA 4J3OF 1X7TA 4YSSA 1TJIH 4A67A 4O58H 4JFHE 3GWJA 1AO7A 4NRZA 1AAJA 3HVDA 3PWLB 1WBXA 1LEIA 1KLUB 4U33A 3CZKA 4PVBA 3QXUA 1II4E 1F5WA 2OMVB 3O9WB 1OHZA 3QUZB 1UZ6E 1WSST 2B12B 1C16B 2CHZA 4FL4B 1KGCE 2VW6A 4OBRA 3RWGA 4JGNA 5I1JH 5L2JA 1RZJL 3B83A 4Y5XB 3HUJF 2QR0A 3T0EC 4QJ5B 2PWFA 1MFCL 3GJFH 2GUYA 1GW0A 2JJVA 5F6IB 3QIUC 2D7MA 5T1MA 1XF2A 4BFNA 3FYEB 3O1YA 2FJFB 1VADA 2WBJB 3UPAA 4X2UA 2NUTB 1B0GB 5SWZD 4D8PB 4QHNB 4KV5E 2GBVA 5I0YA 5EF3A 4X8GA 3E9TA 2Z91A 3SQOL 2VLJB 4CSTA 1HEHC 4JFWA 4OZFA 1SGKA 2WSPA 4QXGH 2X41A 4IIQA 3DBXB 2PABA 3RGBA 2YKLH 2WXRA 4NLAA 4FMKA 3ZZSA 1D6EB 3OGCA 3QZBA 1BIHA 1P4BH 1E2RA 1TLMA 4ZFFB 4TMPA 3D18B 3ZTJH 3O41B 2NY1C 5B38B 5JPNA 3QR0A 1FPTH 1OTTC 4YSDA 5C6TL 3FRPG 4KHTH 4C56B 3FSAA 5IVOA 4FABH 5LHDA 4LBAA 4JS7A 3ECWA 1G7LB 3OKKA 1HH6A 1HKLH 4XNYL 4I87A 3Q05A 2R69A 4H88L 1R19A 5E5MA 3NCWA 3BCCD 1OP5H 3U4EA 4HS3A 4C59B 3H2WA 3UTSE 4L3HA 4UIKL 4PVNA 4E41A 1OGTB 2XXFA 4PGJA 1KGJA 3CCHA 2J44A 3EDJA 4G7VL 2LR4A 4J5VA 1FZKA 1BA9A 5HI4D 1KF9B 4UTAA 5F7EH 4N0UE 1UT9A 4N3UA 5AYQA 2A83A 3GIZH 1RXLA 4WK4B 4TF4A 1XBRA 2UXGA 4WRLA 3RKDD 5CGYD 4KVCL 2PCFA 3LKNB 1KUMA 1TVDA 3NFPB 4HGMA 2HFFB 4FKHA 4JG1L 2M1KA 5KOMC 1U4EA 1H3TA 4XXCA 3GYRA 1MSPA 4H1LA 1L7TH 4HUWA 3BUYA 4MGXA 2XKSA 3BAEH 2DEYX 1EFXB 3RTQC 5DC0A 5C0RH 4XO9A 5BO0D 3E7JA 2DQIH 3T0EB 2V3EA 4G8IB 4YAQB 2HT3D 1Z5LB 2XZQH 1L5GB 2APBA 3WFCC 3QIUB 3DSFL 3NPZB 3IVKA 2D2OA 4C83B 2HJKA 2VDML 4PTTA 3UTTA 5EIIA 4AYGA 1M6OA 4HJGB 3VRIB 1CR9H 1NGPH 4YFLF 1RERA 1UATA 2KERA 3HG1A 5E2TL 4BINA 1KCKA 3KJ6H 1G0DA 1XF5A 1JGVH 3VMNA 2GJRA 3GZPA 3L3HB 1JZ3A 4YDVA 4HW6A 5BRZE 4DO6A 1GYVA 2APFA 1W72L 2E7LC 4CMHC 3BDYH 4XMPH 4S1SL 3U46B 4YSRA 2BWIA 2K8QA 3IKKA 4DZBB 2NY1B 4N8VG 4EI5A 4ADJA 2UUDK 1I7TB 4FHBD 3SJVB 5CN2A 3SGEI 1TZ8A 2DIAA 2MQCA 2AJXH 4MNQB 1KN2H 2CLZB 3QVAA 3LRSB 2VDKB 5GZOA 1W8EA 3L08A 3JUYA 2A74A 1E67A 3I6LE 2CIKA 2YWZA 3U9PL 5GJSL 3VXSE 1QZNA 4N0CD 3N44B 3CIAA 3EHBD 1KV9A 3SKJL 2X44D 1CB4A 4FTVE 3SY0B 5B7MA 1PX4A 4OZIA 5A16B 1ZLSL 2J6EH 4HD5A 1JTTA 3CG8A 3BEVA 5C7XL 3TT3H 4PJ5E 4LNRB 5HYJA 1AY1L 1D5XA 4XMKL 1QATA 4A2LA 1JZ6A 2DMCA 5EU6B 1YYCA 3FONB 1PZDA 4BQ9A 1OOAA 3STLB 1QA9A 1P4LA 4BELD 3MRJB 4QNPE 3HHSA 4QDGA 3GIVA 3V0VB 3FUHA 4JFEA 4B0MB 4YLCA 1NLBH 2CBOA 2NW3A 1QZ1A 3LHAA 3V95A 2LLGA 4JHZA 5EIVA 5CD5D 3AWFA 4GI9A 3NDZE 4FKKA 3TZVA 1AZRA 4JFFB 4XP5H 4U1HB 4LU5H 2ERJC 1MI5D 3CVHA 1A21A 1OSYA 43CAB 1IGJB 3CFIC 3KR3H 2K3TA 1J05A 3VA2C 2DICA 1IAIL 5ALCH 1TQCB 2O6EA 4WFFD 2H0JA 1A66A 4LHUA 1CDYA 3Q01A 1PY9A 4PJEF 3Q7JA 1Z6JT 5DZJA 3T4AB 1MCWW 3JV6A 4XT1C 5SWQB 1RIHH 3EYFB 3PABB 3BKMH 4JZJA 4QT5B 2CUIA 4WFED 5FYJH 1PP9D 4L18A 3WHXA 1ZT1A 1MAKA 5FM4A 3D30A 5M95B 3RWIB 3MLPA 4LBEB 4QO1A 2VJ8A 3L1OL 3MA7B 5I1CH 1F3JA 3BRFA 3HW7A 2PR4H 4F8OA 2E8YA 1NEZB 1QFWI 5G5DB 2ZIDA 4BBWA 3IFOB 4QMEA 1QKSA 5IZ7A 4HD9A 3ZT5A 1CGTA 4X6FA 4Z77A 5ICXB 1Y0LA 3ZE0F 2A06D 4JHAH 3NJGA 4FFZL 5H35A 2YXFA 5JNYB 3UO1H 2OMTA 3HI6H 4YDJB 2ZX6A 5IB3A 4UQIM 4HULB 3IDGA 1ZHKA 3QEUA 4GKOA 2K7PA 2D3VA 2BOCB 5DJDB 1MY5A 2KUTA 3C6LA 2DDQL 3MJ9L 4IBTA 3NBSA 5J11B 2Z4QB 3CVDA 3PJSB 4FYQA 5D7JC 1P1VA 4ZG1A 1I8MA 3FUDA 3TN0A 1FO0A 3ZTCC 4AKOA 5DMIL 1NEPA 2YPLA 3BX7C 1DE4A 1M3JA 2YRPA 5AW6B 4N5ED 4BSVA 1IAOB 2WQUA 1UOVA 2HLAB 4J1UB 4U1SB 2N3YA 4LSVL 4JFDE 4G59C 4OCXL 5T3ZH 4CJ0A 4M6ML 2WZPA 4KKCD 2CD0A 3G6JE 3V0HA 3H55A 1HE7A 2VE6B 2KHAA 3NCYP 1JZDC 4PREA 2VN6A 4QXTB 1M1XA 3U83A 5AD0B 1QL4A 1N7ML 5HJ3A 4MRCA 4PHXA 5FYKE 2EDEA 2PPFA 3MV01 4FAVA 2UX6A 3OM3B 3NQIA 1AGBA 3OJ2C 1Q8MA 1FCGA 4BKTC 3PXTA 5CEZD 4PR5B 3U6RB 3QHZL 4G6KL 4LP5A 2OMXA 5TFSH 4G80A 4NRYB 4G6FB 2F5BH 2NTFB 1SXAA 1DQLH 3DOHA 1W2LA 4PJBA 2AQSA 1CHHA 1BD2A 1OGAD 3DK2A 5EO9A 3P9MB 4PFEA 2D9QB 5DEFA 5K33A 3CHSA 1MCFA 1Z9LA 1YMME 1YEDB 3KL5A 2PCPB 5E7BA 3PHQB 3W38A 1U41A 4AY0A 2BCKA 3MMEB 1KG0B 3IRZA 4WUUA 2CBQA 4HIJB 1OW0A 4PJAB 2EH7L 3L5WB 5C71A 3GJFK 1G6RB 4JPVH 5E94B 4GSRA 1BOGA 4NQSB 1R3KA 4M5ZH 1CGXA 1M05B 4XZUA 1JVOA 1XIWA 3SN6N 1TTUA 2EECA 2YBGA 2CIIB 5D7JB 3RX9A 5L2KB 4PYGA 3DUSA 3VB9A 2OTPA 1JPGA 2MHAA 2UZIH 3P4LA 1EVUA 2I32A 3BPNC 2JJSA 4MMZC 1GPOH 1IARB 1CICC 2J56A 5LBSH 4JDEB 4X98B 2DJMA 1WWCA 1NSNL 3JWDC 1FAIL 1CLZH 4BK8A 4M62L 1WBYB 1GH7A 4N8UA 3KVPA 1SOSA 1KPVB 1BZ8A 4Q6IC 4QHMA 3M88A 1I5TA 4MAYD 3CZFB 4EDWL 4HDIB 3KPPA 4BV1A 1AD9B 5DJ2B 1EDHA 1E5CA 3U2JA 1MFUA 3S9DB 4AZ8B 3TURA 2HX8A 4PCTA 1OP5K 2FJUB 4ZAKC 3QHTC 4QPEA 2I69A 3QORD 2P8LB 4BE6A 4FNLH 1E50A 2DY2A 4XNMB 5D2NC 1RAQA 4CMMA 2ICEC 1H8NA 3E80A 1ID2A 1KIPA 1PSKL 1TTCA 4M61B 3BEWA 1NCBH 2Y06L 2YCCA 3B2VL 5IHBA 3QZWA 2XQYK 3NZ8A 1NIDA 1F6AB 3ABLB 5H2BA 3RIAK 1UJ3C 4OD2B 1E43A 1JG9A 2C1PB 3AQYA 3DJ9A 3SB3A 5I30H 4X4MA 2Z8VC 2DKUA 4FA6A 4Y9CA 5A40E 4PRIB 3LEXB 2JB6B 3GJEA 1MFBL 2ICWB 1Q0YH 2VDKH 1U91B 2MWCA 3MRRB 3WFDL 3QFJA 4ZUSB 1AGDA 2KDGA 2R69L 4GQRA 2O6CA 4HWZB 1G6VK 2GSGA 4KXZH 4XMLH 5E5RB 3CHXA 3GSRB 3BJ91 4PJ8C 3S5LA 4ZQTA 3VTTA 1H32B 1I1AD 2VXSH 1GIGH 2I5YL 5FM5M 4LCWA 3E8VA 4UI2A 4JQXC 3V4PL 1MJ7L 4JM2D 4FQQB 4LVHC 2VM4A 1CNOA 5ESAA 3NAAL 4MS8D 4YPGB 4RFOH 3BPNB 2NCEA 1P84D 2GSIB 2HX9A 1XCQB 2Q1EA 1A22B 1AJ7H 3AS1A 3L1EA 1ESOA 1CICB 4WFGE 3MYJB 3ZDXE 4ATTA 2BS71 3KYAA 4AQEB 4NQEE 4E36A 2QELA 3B3IB 4UZUA 1T7VA 4XVJL 1BXXA 1P9MA 1UZ8B 1U3HC 4NHUB 2XJKA 4LLWB 4U1NA 3BGMB 1T04A 2MTPA 2Q7AA 5I8KL 4LCIH 1R5WB 1I8IB 1RJLA 4JN2A 4PG2A 4N8CH 4MJJA 4R0LA 4ZBJA 4KX9A 3IDMB 3IU4H 1FL5B 2CCLA 3EJUA 4JO3L 4LAJH 1XH0A 2QPSA 2W9DL 3TONA 2DQUH 2PKDA 4OFYA 4QXVA 1T1ZA 3CFMA 3ARUA 4QRBA 5B21A 4LLMA 4M7LL 3CC1A 4JKNA 4HXAH 5D2NB 4U1KB 5KN5A 3OX8A 4ACPA 1OAYL 3V4LA 4MXQC 1JRHL 2ICEB 2TRHA 2VR8A 4B60A 4F2MB 3BN9D 4HWBH 3VFUB 3V0GA 3DUUA 1HSAB 2X28A 2DBJA 1RIUL 1VPOH 4KK9D 2EXSA 1UJ3B 3B5GA 1CQKA 4E5XG 1NKGA 1ZTXE 4I5BA 2VMCA 1W6LA 1RLBA 1HOEA 4JNXA 3MUY1 1OP3H 4Z7VB 4ZMQA 1RJYA 1G7PB 5TTRA 1SBSL 1NGQH 4EN3C 4YHML 1ET7A 1A7RL 2Y7NA 2NXYC 3GXDA 3LPFA 4FFYA 5E2WH 4YXKH 2X4UA 2FD6L 5C9JA 4X5XB 4PJ8B 2CGZA 3RBSA 3QCTL 4Y4HC 2BVQA 3TASA 4N1CA 2OAAA 2BW4A 1QQDB 1QKZH 1YMHB 3HC4H 5K5YA 4LRNL 4ZPTB 3RZCD 1ZIAA 4U7KA 1SQVD 4X6BA 3SDYH 3BD4A 1DBKL 2LU7A 4YQXL 4LVHB 3X39A 2K9UA 1GKOA 2VDNL 3ULUC 1KBBA 3D0WA 3WG7B 5JA8B 3Q8AA 4MWFA 1QBAA 5EWIH 5JMRA 2HYMA 1RSFA 3MFFB 3TO4A 2B59A 4KFZC 4WWKD 2VLRA 2NQDA 3ARXA 2P8PB 2VAAA 1FDLH 2GI7A 2CJTA 3WUIA 2X4RA 2F8IA 1U3HB 2GJZA 5B1AB 4JY4B 1SHMA 2WUCL 5HDQH 3U6XS 2VITA 4A37A 5I15H 3O8XA 5L88L 4J2XA 4JHWL 4BQBA 1EZLA 2OTWA 5FKAA 5GIRA 3ARDA 5F1IB 5DZLA 4OCWH 2WLNA 5FUOL 3CVHL 3NFNA 3TP4A 3LN5B 3E1F1 3AU0A 3F64A 4FEIA 5IEKB 1T5XB 5CZVH 3Q2CA 1AVAA 1J8HE 3ARYA 1KJ3L 1LK2B 4PJDA 1EEZB 1S7RB 1OAJA 3MDJA 4W68A 5AZ2L 5I28A 5J57B 1NIFA 4PRNB 1MCNA 1FI9A 4QWWD 4RH4A 3FDWA 4L37B 4HSCX 1AGEB 3ARBC 3MV8E 4JQVA 4J39A 2DKMA 4XB8A 3OGOE 5DD6A 4APQC 4QTIH 4BM7A 2D2CC 4HZAA 5HHOD 4Y5YC 1WS8A 3CFEA 1S7XB 3HKZA 2XFXA 4YFEA 3NIDF 1E4XL 3HAEG 1X3DA 3HS0C 1A1NB 1YPZA 4XOAA 3VXRA 5KSVB 4EN3B 2GJJA 1V05A 2AW2A 4ZW3A 4MQSB 3RLMA 2RB8A 1U92B 1N67A 2NXYB 4WW1A 2OTUA 5DZVA 4Y7OC 1S9XB 2PPCA 4BKLA 4CDHA 2ICCA 3OJDA 4WV1A 3L3DB 4ES9A 5IJVB 1ZDQA 3GJFA 1F2XK 1G94A 3FB8B 4XMWA 4NKQB 2AXWA 3P77A 5D93C 1AIZA 3QI9C 4JZOB 1TOXA 4W1TA 3SPIA 5BRQA 2XQ0A 4M9OA 5EG6C 3CLFH 3P4MB 4A2HA 4HUXB 1EXHA 3HMWH 2IAND 1C8PA 1IVTA 1W15A 1TSHA 1FFTB 4JFXB 1T66C 2DM2A 2V7NB 4TUJB 3OXSB 3WLWD 5ADOH 1AHWC 5HYSB 3MFGB 4WQCA 1CG9B 1ONQB 2IFFH 1FYTA 1FO0L 3FOLA 1JXGA 1TXKA 2DWDB 4YS4A 4KJWC 1T03L 1DL7H 1LEKA 3UGXA 3ETBJ 4POUB 3ZTNH 1JZ2A 4DGUA 1ZT4B 3AG2B 3KL3A 4I9WD 4MD0A 5IMOA 1I6DA 4HK3N 3SBPA 1JHKL 4YLQT 3X11B 1KLGA 1UM4H 1JGLH 2GC7D 3FCTB 3ULVD 3D85D 4XRCB 4ZX4A 1KELL 3PIQA 4APQB 4PG9A 3JUZA 2R0LH 2X7LB 3VH8A 4Y5YB 2IH1B 1FVDA 2YIUB 3QDJD 1WH0A 4HV8A 5DJQC 4YVUA 1GGCL 1LD9A 4MVBC 4FULA 3HS0B 2HA1A 4YNYB 4GP8B 3RYMA 1XF4A 3S3PA 3QNZA 1UYWH 5K39A 3QUXD 1R5VB 3S48A 5CIPH 3OKEB 2F7QA 4K07A 2ITDA 4R96B 4YR6A 1DEEA 4IBQA 1SJEA 1W0VB 2R4SL 2VERN 4ZUWB 1HH9A 4HQQH 4IJTA 4HJTA 4D94A 4QRQB 2P5PA 3LN9A 3WMQA 1GGYA 3L9YA 1H6UA 4MQXC 4WK0B 5C07E 5C0BB 1D5BA 5DMJB 4NC1C 3IRPX 5SWZE 3VDAA 1TEGA 4PWJA 3FT3B 1HHGB 4R8WH 4JG5A 4OVVA 5D93B 4RGNE 1IGFH 1COTA 3QI9B 5JIHA 2A73A 4DETA 4HX1B 2BO0A 5EEZA 5DO2D 3VFPB 1DJZA 4W9GC 3VXMD 4B5ZA 3N0PB 4I77L 4KNUA 4NZTH 5D1XC 4F8LA 2NSQA 2VERA 3H4FA 1SHXA 1TDQA 3NRFA 1AHWB 1CD1A 2V5TA 3FO0H 4TL5A 5EZOL 4NCDA 5FK9A 5D72L 1YJDH 1CDCA 2WVUA 2KPNA 3V7MA 5IW6B 4ZMNA 5IHZB 5K9OA 1J8RA 3VFRA 2GUOA 2NR6D 2J71A 2Q8AL 4AEHH 2V7HB 4P5TC 3NN8A 2MCG1 4IRSC 4L4VB 2ODIA 4WO4A 3APFA 4BRJA 1B4RA 2GBTA 5I8EB 2E8ZA 1KFAL 1NKOA 5I66B 1JPTL 1G7MB 4Z7OB 2WJ5A 3SDCA 3UYOD 2AC0A 4P5KB 5D7IE 1R34A 2F74B 4K94H 4PJCE 2YZ1A 3NZHL 2J6EA 5JLZA 5DJQB 4PJHA 3BP6A 2CR0A 3MRPB 3N43F 3UTZA 5K59F 4HXBH 1F4YL 4GSUA 4HFWB 2KH2B 5T1DL 4MA3A 3AQZA 3F7VA 2OMYB 5D6CA 1KEML 1P7KA 3QRBA 3V8OA 1F11A 5C0GA 4ACTA 2I25N 4FXKA 4TNWK 4Q6KA 2VL5A 3QB7C 4UF7C 5CCGE 1J48A 2IH3B 5IB5A 1CE1L 4JFPA 3PG2A 1MH5B 2BVEA 3DI2B 1JTOA 4U4BA 2AIUA 1A4KB 1BZQK 3D3VB 4EMZA 1KYOD 5G4OA 4DGVH 1QWHA 4ODSH 3UMTA 3QIBB 4L3GA 3G5XA 4WI4A 5F9OL 5AYTA 1LO2L 5EUOB 2FQEA 3RIKA 1MHPH 2I8FA 2M2DA 3IU3A 4K3IA 3OVUB 5B39A 5I74C 2QLVB 2QPFA 3VYOA 3H9SD 1RZ8A 1MJJB 3VCLA 1ASQA 1LILA 2DZEA 2JE8A 5FYLD 5IHLB 3DX7B 4KDWA 4D9LL 1WPCA 2GT9A 3D2UB 4QCIB 4S1RH 5FW6A 3EYSL 1DBJL 3BH9A 3I9PA 3O2DH 3SGEH 1ET5A 1GSKA 5CSGA 5AW3B 2VMEA 5I1LB 3CDGB 5L7XL 3IJSB 4J7RA 5J3HC 5I1KL 1IC5L 3DGDA 4GXFA 5ICYB 1BXAA 4S0SD 1P5UC 3PL6C 3GSXA 1BBDL 2VH5H 5KVDL 5ETUA 1MFVA 4IRSB 5FUCE 3KBHE 2N4IA 4WU7B 3BP7B 1HZVA 4YMPA 5IESL 1T0NA 4HSAC 4K8RC 1GHFL 1QBLL 4PLJC 4KTGA 2ZAIA 4K7PL 3WN5C 3LKOB 4OQTH 5CCJA 1UZGA 1L7IH 2YRZA 4RDQG 5LBVA 1DCEA 1ERNA 4JW3A 4OM1H 1RSYA 1KOAA 1IO3A 1TZOA 4UOJA 1IM3D 4X6DE 3I2CL 3MV9A 2EXVA 5ENWB 4L3ED 3L17A 1A4BA 5A2LH 1KXVC 2D31A 1PGRB 5D1ZC 2XIIA 4CVUA 3WN6A 2VQUA 4OGXH 4L4TD 1TQBC 2QDVA 3HR5B 4N20A 2XA3A 2QDWA 1XH1A 3LZQA 2BRQA 1P6AB 3IGKA 2ITEA 4U6VL 3MRMA 1G43A 4UT6H 4QRPA 4ORGB 4OIIL 5DRZB 3X3GL 3VW3H 4FQIH 3PWLA 1KLUA 5DEGB 1MI5E 3CXDL 4WEUD 2BY2A 3O9WA 2OMVA 1K8IA 1KTCA 1D7DA 3QUZA 5LCVL 3K2KA 2LTQC 2WQAA 5DZAA 1C16A 4MD4B 3GSOA 4WFFE 5I74B 1OP9A 4FFYL 4GBXD 1SRDA 4XOCA 1NJ9B 5DJAB 2JCWA 4G70B 4Y5XA 5D71L 1ODAA 3UTSB 3ZT6A 3KPTA 5AB9A 4P4QB 1HL9A 2BOLA 3AG3B 5TDPB 1NFKA 1IGIH 4ZUTB 2XWTA 4N0UB 4PJ6A 3N9GL 2FJFA 3H4HA 2R2EA 3OLDA 3NACH 5IQNA 1RUPL 4WFEE 2NUTA 4WI6A 3JVGC 3ZK0A 1B0GA 4CN1A 4QHNA 4D8PA 3ZO9A 5AYUL 3QDME 3NFSL 3PL6B 4IL6V 4DK3A 2VLJA 4TQIA 2BCNB 1P7BA 2DD8H 2Z31C 4FI6A 2XWRA 3U4BH 5CJXA 5KSBE 1RZQA 3STZB 4RMSA 1BFVH 2NZ9D 3KJ4C 4OF8A 1J9RA 5IB1B 2GAZB 1D6EA 4L8DB 5IBUG 3WN5B 4F33A 4ZFFA 4M93B 3D18A 1CIFA 1OCZB 3CQPA 3O41A 4N90D 5B38A 4BGLA 2BSRB 1GOGA 5HPOA 2E7HA 5C3IA 1CMOA 2H2SC 2Y6TE 4C56A 4P2OC 4I0PC 1XL4A 1KDIA 1NBCA 1G7LA 4GRLD 2CA4B 2NNXA 5D1ZB 1CS6A 1RPUA 2HTKC 4NO0B 4DKEL 1UM5H 4FQXD 4YHIA 5I18L 1TQBB 1Z3GH 1TKWB 1OGTA 1S7SB 2F7IA 3F05A 3VG0H 1T22B 1HX0A 2QPDB 2D0FA 1E4KC 5BRZB 1MAMH 1FC2D 4NJAL 3M86A 1KCRH 3CFJB 3VMOA 4AEEA 5BZWB 5E08L 4NFGB 4F92B 3OAWA 2CHWA 4JR9H 3HB3D 4XNQB 1TJIL 1JF1B 4O58L 4AUJA 3LKNA 3NFPA 2HFFA 1DVQA 3RHWF 2X3AA 3BKCL 2IG2H 2LTQB 2QZQA 3T2LA 5LBSA 1JZIA 1EFXA 2LW3A 1XGZA 2CO2A 1U75B 1KIUB 5I1JL 3T0EA 2YD0A 4G8IA 3VXSB 3GMQB 4YAQA 1Z5LA 2KZ1B 3SPJA 4PBWD 1L5GA 2CPUA 4NQUA 3HTLX 2X6MA 1DR9A 3QIUA 3RDJA 1JCVA 2ESVD 4N1EA 4M43L 2AI0H 3FTUA 2RAMA 1L3NA 4Z7WB 4C83A 4JFVA 1W8NA 4KROD 2EH8H 5IQLA 3VRIA 5CEZE 4M3KB 4PJ5B 2MNJB 4JL2A 1QHQA 4FRWA 5J1AB 3HG5A 2ZOLB 3L3HA 4QXGL 3KJ4B 5KVEE 1JDAA 1OGAE 5BQDA 1CL7I 1QSZA 2YKLL 3HBGA 3U46A 4O02B 1CIHA 4DZBA 4GMSH 1OAXH 3DV6B 4GAJH 4N24A 4Z76A 1CO1A 3DC0A 2DGEA 2NY5L 4NZRH 5IW1B 3SJVA 4AV0A 1EQWA 4GXVH 1U3YA 1I3UA 2OULB 4I0PB 4KOCA 4ZW6A 4MNQA 2CLZA 4N28A 5C09E 4KHTL 3VFVB 3LRSA 4FABL 5FECB 2NYZA 35C8H 2FLMA 3B7TA 1HKLL 1NPJA 3CPUA 4XWOD 1NBYA 1S3RA 4LB8A 1FBIH 4LPCA 1DFXA 3DJTA 3SY0A 5A16A 3B5HA 1MVUB 1HHJB 2OSWA 5D7LE 4MX7B 3ZHDA 1ZS8B 2DQDH 3OKOB 4LNRA 4E68A 2IFGA 1D5ZB 3KD4A 1W91A 1AXTH 5EU6A 2FWUA 3FONA 1ADQH 1EZSA 5F21B 1IBBA 2RQEA 3STLA 3ET9F 1HESA 5D1QE 1L7TL 4RDBA 5EBMB 4TOYH 4HJSA 3MRJA 3BAEL 3MOAH 1WTGT 2BNQD 3PPSA 4ZW7A 3V0VA 4OZIF 5FOJA 2DQIL 1XCWA 1XXFC 1BHGA 1CTZA 2XZQL 1S2EA 1MRCL 1U2CA 1QPKA 3JWOL 4JFFA 3ZT7A 2AXJA 4U1HA 3DOSB 2EDRA 4PV8B 43CAA 3IE4A 5HY9B 3MUGB 4IMKC 2EC9T 5KBPA 2CRMA 1CR9L 1WFJA 2ADYA 4PJ0V 4GS7B 2EIZB 3SQBB 3KJ6L 1QRND 5HHQB 5F3FA 4GRWE 2OKMA 1T2QH 4HWBA 1YEEL 1WFIA 3BDYL 1QASA 1AI1H 5C2UB 1XBDA 3T4AA 4LVNB 3LN4B 4L3CB 1CXAA 4JQIA 4L8BB 2UXTA 3PAZA 5SWQA 3L3OC 2XWXA 4DQAA 3EYFA 3PABA 4PJ9D 4QT5A 1A7OH 2Q10A 1TIUA 4L9LC 4BDVB 2AJXL 3VSVA 3H1ZA 3QJOA 4MXVE 4ODVL 5IQ9B 1PG7W 3BWUF 3RWIA 2W94A 4LBEA 4UILH 1MFMA 2WOBA 4JFDB 3W39A 2V17H 3IXTA 4RMTA 4PS4L 1NUDA 5FW7A 3WKMH 1NEZA 2ZSWA 2HAZA 4DK6A 5G5DA 3IFOA 2Q6WB 1RUML 2J20A 4EZLA 4XN8A 1HWGB 3UZQB 1H19A 5ICXA 1XF3B 1DVHA 3OAYH 4Z3HA 2J6EL 3OHXB 1CFBA 3AAZB 5JNYA 4MA7H 3TT3L 3RI5K 1NDGB 2VDOB 1HNFA 3BO8B 4LDEB 5BS0D 1FE8H 1ZT7B 2OS7A 4YDJA 3MNVA 1EAPB 2WINB 3MNZB 3ZBMA 4KXAA 4RX4A 1G1CA 3K2UL 2Z6FA 1DVUA 2BJML 2BOCA 1NCDL 5DJDA 3ZPDA 1T6BX 1OALA 2R9HC 4KQ4H 4GAAA 1XHHA 5CEXB 3PJSA 4IU2A 4M1GH 4RISL 1N26A 5DHYB 3TPKA 4X4XB 3ATAA 5C0CB 1NLBL 4LL1A 1E9OB 1O6SB 5GGVY 1JZ8A 2VN5A 1YMMB 5KSAD 4GG6F 1JCKA 3B1UA 3V4UH 1IAOA 2KDYA 2HLAA 4J1UA 1K3ZA 4MKMA 4XP5L 3IT8D 2AK4D 3T2NL 2EIKB 3KR3L 2Q0ZX 3L7EB 3O6KH 2FATH 1WZMA 4L05A 2Q5BA 32C2B 4PBDA 4CN4A 1IM9B 1UWGL 2HTLC 2VE6A 3D87B 4QXTA 2FB4H 3IK2A 4ZXBC 5T5NF 4AMWA 3WO3B 4RGMB 1M2VB 3S97C 3AG1B 2LOEA 4MASA 5FGCB 1AKJB 1NCCH 1PLGH 2ZUVA 5DUBA 5A2BA 4XMVA 1RIHL 2OXGB 2QTVA 2QL1A 4L9LB 2EDHA 5FYJL 2DEXX 1ZIBA 3U6RA 1MCEA 1UXLA 2Y5EA 4NRYA 2XA8H 1MHCB 2NTFA 3CMGA 3JTSB 2PNDA 2K70A 3KBPA 4N2LA 4UU9B 3VXPB 4EZMA 5I1CL 3OJMB 3EJYC 1MAJA 4U3HA 3P9MA 2EYSB 4WGKA 2B0SH 3ZUNC 2VDPB 2PR4L 1GU2A 2CH8A 1YN6A 1R24B 2XG5B 4P2RE 2G3ZA 3O3BB 3OLIA 2J6WA 3R19A 1E42A 1YEDA 3EADA 3FPXA 4G6AD 1H3XA 4NQTA 2CJUH 2PCPA 4PJXE 3AITA 1LDPH 2BWDA 5B66V 3LHPH 4Z0BL 3MMEA 2YLHA 4CA4A 1CIGA 4JM4H 3UO1L 1KG0A 5LAPA 3W2DH 4WI9A 4ZS7H 2TSAA 4PJAA 3E2HB 4KUZH 2YK1H 3HI6L 3L5WA 5TK2A 3L3GB 4UV7H 5E94A 3Q5OA 1JP5A 2FX8H 4NQSA 5FXCH 4F2EA 4M6AA 4NAMA 3HE6C 4DPBX 3DHUA 1M05A 2ZOWA 4FQHB 4J6RH 2CIIA 2QPEB 5L2KA 2CXGA 3OF6A 1UA3A 4R84A 1NFDE 4JZNB 3R8BB 1JZ4A 3ZKNC 2XIBA 1AKPA 4AJVA 1JPSH 4WQAA 4OJFH 4S1DD 5ACMA 2ITFA 3B2DC 1I8AA 3NVQA 4JDEA 4X98A 2N7SA 1C12B 3KCPB 3PE9A 4G6JH 4IBYA 4XAWH 4XVUC 1MCRA 1UOWA 1WBYA 4U7MA 1DVFD 5FO9B 1KPVA 2D7QA 2V37A 3TT1H 1U8JA 2Y1ZA 5CCKH 5HHOE 2BPBB 1PG7X 3J27A 4S0HA 4N2KA 5CLWA 5AB2A 4P4KD 4HDIA 4HYTB 2F1BA 1AD9A 5DJ2A 1NFIB 4ZXBB 4RAVA 5BUAA 1I85C 1PNCA 1H31A 5IVZB 4YSAA 5F9DC 1E9PB 4CBPA 5DJZB 4Z7NF 2P8LA 1Z2KA 2XWZA 4FQ1H 1RI8A 4LPWA 2B16A 4M61A 4NQEB 1DQVA 1RJZA 2HLFD 1L6PA 4O02H 4XO5A 1NM4A 1F6AA 2IC2A 1KY7A 2E9IA 4Y9GA 2BIPA 4HHAB 3UG4A 4ZQKA 2C1PA 2HRPH 4XPGH 3CVCA 4K4KA 4XOEA 5LKNA 3KWXA 2X3BA 4PRIA 3LEXA 2CDGB 2NY2B 4R26H 2ICWA 2VDRH 4M6OH 4CNIA 2VDQB 5D96B 4HC1L 1U91A 3MRRA 4GIPD 4ZUSA 3BPOC 4LFHD 4E9QA 4HWZA 1VZHA 5A2KH 4ONGL 1BVOA 3GSRA 2OCCB 5DVOA 1H32A 3KZ8A 3CBJB 1TPXC 4MNHA 2E27H 1BM3H 1MLCB 1UEYA 2O6PA 3HE6B 1QSFD 4JPVL 4TN9A 5E6ZA 4EOWL 1MCOH 1G9EA 4M5ZL 5ISZE 4FQQA 2BFGA 4CW1B 8CGTA 5DK0B 3PDDA 4YPGA 4M7JH 4ZJ9A 1R17A 1YNLH 4J8RB 2GSIA 4MMZA 1XCQA 4ZS6C 2UZIL 4ZYKB 1UVQB 4I9WE 4A39A 3MYJA 1GPOL 4AQEA 1ZGLB 3FU6A 3N1MC 2NX5D 4I3SL 1M2OA 4YZWA 4HWUA 5T3XD 3B3IA 4YWGL 2Q3AA 3ULVE 1UZ8A 3FCUB 2PF6A 4LLWA 3HRZB 4ZMZA 1R5WA 1I8IA 2LHAA 4P5MB 2E4TA 2L7UA 3QRLA 5TDNB 4JK0D 3IDMA 2NZ1A 5DZNA 1JTPA 4RZKA 4F58H 1GJWA 1FL5A 1AMYA 2YWYA 1X5YA 3MGAA 5ILTH 4BFOA 3GSUB 1DFBH 3QWRA 5A6MA 1QNZH 4L1TA 1P4UA 2C1DB 5D2NA 1K2DB 1F4HA 3SCMC 4U1KA 1H5BC 3HCVB 4FNLL 1RQ5A 2ICEA 5JW4N 4GRMA 3VQLA 4DT2A 4F2MA 3VFUA 3WELA 1HSAA 1X9RA 1I4FA 1NCBL 3D33A 3ECQA 4XCNB 3NMEA 1DDHB 2MPVA 3N41B 4AYFB 5MP6L 5I30L 2WYHA 1QEWB 3G6AB 5AKTA 5IHWA 2UWEE 2ZWKA 4GQPH 3T8XB 4NM4H 1G7PA 2JIXB 4DKDC 2VDKL 4B0MM 4TNGA 1TSRA 4U2ZA 3KPMA 3VXME 3WGUB 1RKRA 5GJTH 4P2YA 1VGEH 4X5XA 5AVTB 4XMLL 2VZOA 3T0AA 5LBGA 1D9KD 1QQDA 3NJFA 4N8VA 3MJ7B 1GIGL 4ZPTA 3KYMA 4JCLA 3KM1A 1AC0A 1AP2B 2N18C 3O2DA 3LQAC 3K6NA 2VDOH 4ECNA 2HT4D 2X2IA 2BSEA 4NS0A 1HYSD 3WE6B 1RULH 1TZHB 5LXVA 4RFNC 1L3WA 2QFPA 1AJ7L 3MFFA 2YAEA 2O6FA 4DOHE 1UWEH 4EVNB 5JXED 4BXVA 1U3HA 4NWTH 5E70A 4EJ1C 1O9VA 1I9RH 3AS0A 4FADA 1QFHA 1XAKA 2C3VB 4ELMA 3I74A 5FCUH 3WFCL 4OQTA 3WNPA 4FXTA 3HNTH 3QJVB 5CIEB 4LCIL 4N8CL 2VC2H 3SGKC 1SEBB 4TS6A 3WTUA 2I60H 3IU4L 4ZZKA 3LN5A 3WJJA 4C58B 2GTZA 5IEKA 1T5XA 4LSRH 1F4XL 3DROB 2CRIA 2DQUL 4RGNC 5IT2H 1A25A 3SDXE 1LK2A 1EEZA 1S7RA 3SCMB 1KULA 4HXAL 4HAGA 4PRNA 4JRXD 4QHLB 3ZMEA 3P0VL 4AM0A 4L37A 5DFSA 1AGEA 2EDFA 1EPFA 4FQJL 1OAZH 3KPSB 1U8OB 3R18A 4XPFH 4HGWB 2WZ0A 2FYUD 4KTDH 3TVMA 2C8SA 1HCVA 1VPOL 2E7BA 2IDTA 2EADA 4J3OD 3D0AA 4UT6A 4JQIL 1S7XA 2AF2A 3GBLA 4DEWA 1RUAH 1NM9A 4J4PD 2BGVX 2OZ4H 1A1NA 3WUWB 4YPJA 3MCKB 4WFHE 5KSVA 2BNRD 4EN3A 4E9VA 4YXHH 3WIHH 3H9SE 3KE0A 4HJ1A 1E7VA 1NGQL 1U92A 5FYLE 5D70H 2AJ3B 1FGNL 3NYKA 2VDPH 4YXKL 1S9XA 1ZSHA 5ECGA 4A7QA 5IQ7L 1X5AA 2Q2LA 5HI4C 3L3DA 4ANKA 3TIDB 1WFUA 2GW5A 3HC4L 5IJVA 1XB3A 2WTOA 4UANA 4LLUB 5D4JA 4FA8A 2HMID 1OZUA 1A0QL 2N18B 3FB8A 1QUPA 3UBXB 4B53A 1QI5A 2BOBB 4A04A 5I5IA 3SDYL 5DGQA 4JZOA 4IU3B 3IETB 4KBPA 2ZJSH 3P4MA 4XMXA 2MH4A 1UWXK 3IJEB 5EWIL 5D7SL 4OV5B 5CIFB 1R4XA 5HJDA 2UXVA 3S36H 1ID5I 4DH2A 4JFXA 1EIBA 2HT3C 4TUJA 3OXSA 5ACLA 5HYSA 2GTQA