3ZIYA

Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.01 a resolution
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
457
structure length
457
Chain Sequence
KLPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKMPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRAQPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
total genus 131
structure length 457
sequence length 457
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3ziyA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ziyA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ziyA02
4F2EA 5KAIV 1K3GA 3OA8B 1GS8A 1YLBB 3JTBA 3AG1B 451CA 4YSAA 2E86A 1KDJA 3PAVA 1A3ZA 4AAOA 2B4ZA 3PLYA 4ENZA 4N0KA 2CA4B 2DGEA 1MG3C 2C1DB 1ZRTD 4PW9B 1AZNA 2YXVA 3S3CB 4BXVA 5B6QA 1F1CA 3CVBA 3PCYA 3JBTB 1J3SA 2B3IA 1CIFA 1M60A 1W5CT 2LIRA 3CYTI 1J9SA 1RAQA 1GS7A 1ID2A 1NZRA 2UX6A 1A8CA 3T9WA 3T6ZA 2HZHA 3ZOXA 5CIFB 5KKZB 1BXVA 2FT6A 4U3FD 1DW2A 1L9QA 2N18B 3ABLB 2C9XB 4GP8B 5TISV 4TXVB 2PCBB 2YAOA 1DIQC 1OCDA 2HV4A 3DP5A 1AANA 2IDFA 5DFSA 1NMIA 4A67A 3OMNB 1CORA 2VM3A 4YSUA 2W8CA 5IY5B 4HCFA 2HLEB 3ZOWA 2BO0A 1OOWA 3WNJA 4E9RA 2UXVA 4DPAX 4G72B 4WQDA 1SQVD 4HHWA 2UX7A 4A68A 4AX3A 1CC3A 3IBOA 1E29A 1W2LA 5GTIV 1I55A 5KLIB 1AG6A 1X9RA 2MTAA 3OMAB 1CURA 3RLMA 2FNWA 5CIHB 3EF4A 5I5JA 1L9JC 3RYMA 1L9RA 1QL4A 3HB3B 1RZ6A 1AOFA 1TEGA 3TA4D 1H33A 4K9JA 3TBCA 1RAPA 2BHFA 4AKOA 5AZUA 3X1FA 3BCCD 2HX8A 3CU4A 1KGYE 1AQ8A 5B66V 3SBPA 3CXHW 2R7EA 1CRYA 2GC7C 3ZCFA 4YSRA 4PAZA 1AZBA 2YCCA 3PXSA 1PY0A 2EILB 3GYRA 4DP1X 1KX2A 4P5SA 1CO6A 1PZBA 3HQ9A 5AURA 1FI3A 1ET8A 5F7AA 3WC8A 4JHVA 2AI5A 2YAQA 3EH4B 3L72D 4LJIA 4WKXA 1OAEA 4RH4A 3WG7B 3WNIA 2AZUA 9PCYA 3L70D 1B7VA 4FA1A 2PPAA 2B11B 2H47C 1H32B 2N18C 4WQ8A 2D0WA 2EIJB 4KOCA 3X1BA 3WU2V 1AS6A 4EIDA 4YSPA 1GDVA 5B1JA 4A2EA 2QPEB 1AZUA 1PNCA 4IL6V 3HEIB 6PCYA 1HZVA 2B0ZB 4V2KA 3WKQA 3S8FB 1ZV2A 3GDCA 5I6MA 6PAZA 1CSXA 1NU1D 2ZXYA 4W9ZA 1ZZHA 2XXGA 2XXFA 1BXUA 1WA1X 1MZ4A 1NIBA 4FB1A 4NFGB 1U74B 1HCMA 1MZZA 3RN1A 1JXFA 5ANHA 3SBRA 3QJUB 1DW0A 1BYPA 1SHWA 1ZDSA 2VSMB 3CDZB 5E9NA 1YEBA 2IBZD 1OE1A 4WTQA 4FAAB 3IN0A 5B1BB 5I6PA 4MFHA 5B7FA 4EIFA 4KO6A 3QJRB 1GKSA 2Q9OA 1JZFA 1MG2D 2DYRB 2YAFA 4YSSA 1AAJA 1H33B 3BVDB 2UXFA 1L0LD 4WQCA 4A2FA 1QLEB 1YEAA 1FFTB 1A56A 1LC2A 3NJLA 1CHHA 2IWKA 1C2NA 3A9FA 3KZIV 2FT8A 4UB8V 2B10B 1DVVA 1ASOA 2B08A 3O20A 1JZEA 3RMZA 2FQGA 4E9QA 4PD4D 3FS9A 1L9OA 1RZQA 3OM3B 1AS8A 2CE1A 2V07A 5B5EV 2FQDA 2JFCA 3O0RC 2QJYB 3ZIYA 3SVWA 2IDUA 5CIDB 1VLXA 4G71B 1YTCA 3ORVA 1L9BC 1AG0A 3NJIA 4AKQA 4A2DA 1NIFA 3WFCC 4FAVA 3NJJA 4DP9X 2EIKB 1CTZA 3FSWA 2I7SA 3SQRA 1OE2A 4YSTA 3WIAA 4CSZA 2GC4C 2YXWA 2YQBA 1A4CA 1HJ5A 3WI9A 3VNWA 3VRDA 3H4HA 4DP5X 1M57B 2HXAA 3V9EA 1KV7A 1E5ZA 5B1KA 1I54A 5CICB 1K3HA 3TU6A 3NJNA 1CTJA 1GYCA 1WS7A 4FANA 3CZUB 2DY2A 3NJGA 4DP7X 4FA7B 1SQXD 2VM4A 4L3GA 3DIVA 5TK2A 4F2FA 3AG3B 5D4IA 3HQ8A 3KW8A 1IUZA 3H1KD 2V08A 2B12B 3TYIA 1E30A 1WA2X 3H1ID 4HIPA 2QT6A 1KCWA 4O1WA 2J55A 1PLCA 3IN2A 1HAWA 3NSFA 2C1VA 3UAEA 1PF3A 4AAMA 2N3BA 1DVHA 1GY2A 3FSAA 3NBSA 3MX0B 4UAHA 1BXAA 1LS9A 1CNOA 1CTYA 3H56A 1CRCA 3L73D 1NNOA 1E65A 1TU2A 1CC5A 5PAZA 2YAMA 3C75A 1NINA 4NAJA 3ZDWA 4WQAA 2MHMA 1JZIA 1AOQA 1CRGA 1PMYA 5I28A 1KCBA 1NIAA 2J5WA 4AKPA 2ORLA 1GR7A 3WFEC 1NIDA 2W88A 2X87A 3T6XA 1CXAA 1ZDQA 1JERA 2PLTA 2PP9A 5I5IA 3QJQB 2BP0B 3L45A 2H5UA 2GHZA 4YL4A 3PAZA 3NJKA 1CIEA 3FU9A 1CSWA 2XV2A 4YSQA 2BP8B 3ERXA 3WFBC 1CIHA 2XV3A 1IBYA 4L1QA 1SQPD 1BL9A 3S3BB 3S8GB 1LMSA 1ASQA 2PCFA 1FA4A 351CA 3O1YA 1CUOA 2XV0A 5I6KA 2EIMB 1NTZD 2N3YA 2OZ1B 1N15A 2CCWA 1LC1A 1MDAA 1L9TA 3MK7B 2VSKB 3NYKA 1ETJA 2PPFA 1IO3A 1WEJF 2P80A 2PP7A 1AR1B 4FA4A 2BH4X 4DP0X 4YSDA 2FWLB 4YVNA 2FT7A 3ZX1A 1DW1A 4O1QA 4GYBA 1HJ4A 1MZYA 2HX9A 3FPYA 4P4QB 1DW3A 1KIBA 2J57A 3WFDC 4CSPA 1V55B 2XLLA 2VW4A 4WQBA 4P5RA 3UABA 4PCYA 1ZIBA 3FU7A 1N9CA 1OCRB 1IRVA 1N90A 1F56A 3CXHD 1PLBA 4YSCA 1GW0A 1NIEA 2JXMA 1CYIA 3WUIA 1WA0X 2ZBOA 4A66A 1HJ3A 3L74D 1V54B 2CJ3A 1J9TA 2DWTA 3X2QB 4GEDB 4DPCX 5A7EA 3ASOB 3ABKB 5AKRA 2XU9A 2BWIA 5I6NA 1CXCA 3OCDA 2CA3B 1FCDC 2P80D 2RACA 2AIUA 3AZUA 3PXLA 1H31A 4Q89A 4EIEA 5CIEB 1BAWA 2JKWA 1PAZA 1SDDA 1UATA 4UF7C 3X1GA 2I7OA 1I8OA 1I5TA 2YAPA 5B1AB 2HRHA 3H4FA 1NWPA 5B7EA 2GIMA 1A2SA 1I6EA 1SF3A 2XX1A 3CVCA 1C6OA 3UACA 1WS8A 3FSZA 3G5WA 1PP9D 1QYZA 3DR0A 4QKTA 4BWUA 4DP8X 2ZXWB 4M4RB 3T6WA 2L4DA 3NJHA 4HHGA 5I26A 1BQ5A 3UGEA 2YK3A 1FJ0A 3NP4A 4NERA 4X4KA 4N4YB 4ZK8A 1RZPA 3L75D 1EZLA 2VMJA 2BZCA 1WVEC 4BXSV 4MU8A 2PPCA 1DT1A 4EICA 4QAOA 1C6SA 4G7QB 2GI0A 1KYAA 1ADWA 4N8UA 3AG2B 4BWTA 1FI9A 1KV9A 1X9UA 2R7EB 1E67A 3JT2A 4KO7A 2Y69B 5FC9A 2N9JA 4PJ0V 1EB7A 1BYOA 1GU2A 4BDVA 5I6LA 3QPKA 2DVHA 4Q5PA 1MG3D 2DYSB 1GY1A 3FU8A 5B7MA 2IWEA 2CAKA 2UXTA 1NTMD 1NICA 2DWSA 3NSDA 3UAAA 1KYOW 3X39A 1CCHA 1QKSA 1ZIAA 2Y1AA 3QJTB 1DIIC 3IE9A 2QDVA 3GXUB 3CWBD 1I6DA 1ET7A 3OCDB 1SFHA 1XB6A 2PP8A 4YSEA 1C2RA 1H31B 3OA8A 1RZ5A 2UXGA 1AYGA 1PZCA 2VW6A 5EHFA 1QHQA 2OJ1A 5H2FV 1A8ZA 2C1DA 3OQRA 2IH8A 3PXWA 3TASA 2LLNA 2XYBA 3ZOOA 4GP5B 1URIA 1A4AA 1W6LA 3PXTA 1H1OA 4KNTA 1OCCB 3V9CA 2CALA 2IDTA 2AVFA 4XYDB 2MRYA 4AALA 2XUWA 3QQXA 1N68A 2MTAC 1W6WA 3KW7A 1DZ0A 1U75B 5I6OA 1QL3A 3AY2A 2CUAA 3EH3B 1KBWA 2PPDA 1PPJD 4HZ1A 2GB8B 2H3XC 1CRIA 5DF5A 3ZBMA 2YARA 1HZUA 2VHDA 3UADA 7PCYA 2YAEA 2PPEA 3HQ7A 4XXLA 1RKRA 4DP4X 2BCNB 3NBTA 4PWAA 2ZONG 1CRHA 1S6VB 4DY9A 1KBVA 2WO3B 5EXQA 1M6ZA 4GYDA 3NP3A 1N70A 2X88A 1C7MA 4BDVB 2BW4A 1C75A 1ILSA 1C52A 1JZJA 4DP2X 4L0PB 1H9YA 2IAAC 2AANA 3CVDA 4WQ9A 2TSBA 2ZZS1 4H0KA 2FYUD 4KNUA 5E79V 5F7BA 4W1TA 2FYNB 2XVBA 1MG2C 3FYIB 4E9YA 3ASNB 1SF5A 5TK4A 3SBQA 3VYMA 4KO9A 3ABGA 1BCCD 1OE3A 1PLAA 1JZGA 3BQVA 4DP6X 2WO2B 2IDQA 1SJMA 3FPXA 1V10A 3OD3A 3H1JD 1AKKA 1IZL0 3L4OA 5GTHV 3MBWB 4GP4B 5B1JC 5I5MA 1AOZA 4FA9A 3OMIB 1F1FA 1J9QA 1BQKA 2QDWA 2JQRA 2VN3A 2QPDB 2Q5BA 2NRDA 1E8EA 4NB7A 2FQFA 1B3IA 1CYXA 3U25A 1COTA 5C0ZA 2IWFA 1S5LV 3CP5A 4AANA 3NT0A 1NPNA 2WSDA 5D4HA 2EXVA 1M9WA 3WKPA 2OCCB 4E9WA 1L9SA 3CX5W 1H32A 3ZOYA 1JVOA 4GXFA 1NWOA 4F7KA 2BZ7A 1YCCA 3CX5D 1L0ND 2BWDA 4YVUA 2ZWNA 3EHBB 1SQQD 1ASPA 2IDSA 3SWSA 1JXGA 1GS6X 4E9XA 2C2CA 1CSVA 5C9MA 1HFUA 4G7SB 1N50A 1VYDA 1NDTA 1OF0A 4KNSA 1HROA 5CYTR 1IBZA 1CHJA 3D12B 1J5CA 3RN0A 1CYWA 5PCYA 1T5KA 3CDZA 3NSYA 2N0MA 2CXBA 4WQEA 2PCCB 2PACA 1TKWA 1NMLA 1DYZA 4HAKA 5DJQB 2J56A 1RCYA 5LDUA 2ZOOA 3L4MA 4YE1A 1NPJA 3SLEA 2HX7A 2CBPA 1E2RA 1IC0A 2XX0A 4H0JA 1OV8A 1XB3A 5CIBB 2ZONA 3PH2B 3IEAA 1H9XA 1SNRA 3T6VA 3NJMA 2GC4D 5KAFV 3DTUB 2GB2A 3C2CA 4UANA 2TSAA 2GSMB 2GIWA 3FQ1A 1YNRA 2DV6A 2BW5A 4RSZA 4HCGA 1R1CA 3MK7C 3QJVB 1AACA 1HRCA 1HAUA 1BE3D 3S3DB 4QLWA 4JCGA 3SXTA 4EF3A 4JHUA 2AZAA 1NTDA 2EINB 2C8SA 1IRWA 1CYCA 3O5CA 1FOCA 2GBAA 3SJLA 3T71A 4E9SA 1J9RA 2FRCA 4Q8BA 3PAUA 1GJQA 1L9PA 3FQ2A 1JVLA 2A3TA 2HRGA 4AZUA 4E9VA 1EHKB 4WQ7A 1CSUA 1ILUA 3HQ6A 1SFDA 2AXTV 3ABMB 3QJSB 1CYJA 2D0SA 4KOBA 1P84D 3A0BV 2VW7A 3FU7B 1PCSA 1GQ1A 1AZCA 4BK5C 3TBBA 1I8PA 2CE0A 4L3HA 1KX7A 4G7RB 3FYEB 2A06D 1JZHA 3PPSA 4G70B 1QN2A 3DMIA 1C6RA 3FT0A 1CRJA 5CIGB 155CA 4A2HA 2OV0A 1W8EA 2QJPB 3H1LD 1OCZB 1XMEB 5IY51 1CHIA 1KYOD 1SQBD 2FQEA 5AFAA 2XTSB 4YSOA 1CCRA 5DJQC 1TEFA 4Y5RA 3TGUD 1ET5A 4KMGA 3L71D 1BQRA 1J5DA 1R0QA 1GSKA 1JOIA 1SDDB 3CG8A 1NTKD 2I8FA 4AI7A 1CIGA 1LFMA 4K3IA 4UB6V 1SHXA 1YICA 2JTIB 3FQYA 1M70A 2QJKB 2I85A 4A2GA 4D6TD 1IQCA 2BH5X 3H1HD 3FSVA 3M97X 1NIRA 1PNDA 3A0HV 4HALA 1I53A 4KO5A 2C1UA 1IKOP 2YIUB 1FWXA 1KB9D 2PCYA 4DPBX 2BCCD 2LITA 4FA5A 1FHBA 1YFCA 2N9IA 1M56B 1OCOB 4HCIA 5B3SB 1YIQA 8PAZA 2BP0A 2FJSA 1CEDA 1A65A 1AZRA 3NJFA 3NSCA 1KDIA 3EH5B 1EZVD 1FI7A 2BP8A 3NWVA 1KB0A 1QNIA 2BLFB 2BPBB 1AIZA 5D4JA 2AFNA 3N2JA 2BGVX 4JKNA 1JDLA 2OZ1A 2IH9A 3DKHA 2YAHA 3X1NA 1AS7A 4J20A 1WAEA 1BEXA 3N55A 3AW5A 1PZAA 4GY4A 2GC7D 4BWWA 4E9TA 3AG4B 1ETPA 3X1EA 1HH7A 4M3HA 2XWZA 1JXDA 1XB8A 2FWLA 1A4BA 5KLVD 1BGYD 1E5YA 1GIWA 7PAZA 1ZPUA 2FTAA
chains in the Genus database with same CATH superfamily
1JWUB 1E7VA 2ZCKL 3HFMH 2MSPA 5JIHA 1CG9B 5D7SH 1RP8A 2R1XB 5FOBB 1KPVA 5EUKB 2AJVH 3ENEA 1KJMA 3F7VA 1MJJB 3N0PB 2YXVA 5MENB 4AENB 2UWEF 3MRLA 5FXCH 3E2HC 5CO1A 5TE7H 5F3BA 1DFXA 4PU2A 1CIFA 3CYTI 1NZRA 2ICES 3O2DH 4XH2B 4FQQA 5I15H 4W9DC 1UT1A 3D85A 2WLLA 3W0WE 5HHVH 2YR3A 1NBZA 2CA3A 1Z9NA 1F97A 3BESR 4JVUA 5TE4L 4RZCA 3OJMB 1NUGA 3STBA 1RVFH 3TA3D 3VD2A 5DDHA 3TFKC 5DS8A 4NXKA 2QR0A 5CINL 1F58H 1SJVA 5CSZB 3R7QA 1ADQA 1WZKA 3ZL1A 3WEXB 4YDKH 1L6XA 1K8IA 2J20A 4HHWA 5CCGE 2QELA 1ZTMA 3FUHA 2V33A 3IT8D 5FM5M 4ODVH 2AJYL 3B9DA 4K94C 4CVXA 1I55A 5JIPA 3IK2A 4IBYA 4RWYL 2D7OA 5IZ7A 1MH5B 3D85D 2DB8A 3H53A 3RVUC 4JFWA 1AO7B 1WAAA 4PY7A 3WJMB 4XOCA 3WY1A 5IT2H 3ILPB 3P54A 3S3PA 1JWSB 1UUSA 1WD8A 4H8WL 3VGDA 4PAZA 2A1WH 1O7DC 4P5SA 2WCGA 2Z7ZA 3K4DA 2Y4SA 5AURA 5HHQB 1I1YA 4LNRA 1FL6B 4JHVA 3UAJA 4AV4A 1T2QL 4NQTA 5EO0B 4LJIA 4HBCL 3KWXA 4QXGH 4FA1A 5EF2A 1TTGA 3FB7B 5JZ7D 4XVSH 4XXWA 2FO4A 5KVDL 2AQQA 2ZCZA 2QPEB 1I9JH 3MODL 3NA4A 3QUKB 4WCYH 5A16A 3KCPA 3LIUA 1IFHH 4FG6C 2XQBL 5IB4A 2WWMC 2OP4H 3SKMA 5IV2B 4TNWK 1C1EH 3FH8A 3QEGH 1LP9B 3UBHA 3RAJH 3WFHB 3LPPA 1OE1A 1UEMA 2CM6A 2Q9OA 3AQYA 2R0LH 1F90H 1BX2A 1F11A 2K6WA 3A0OA 3UAJD 4Z3TA 3VE0A 1I8LC 4HWZB 2IOIA 4WQCA 1FFTB 4CVUA 3DARA 1ULVA 3NJLA 3ETTA 2IWKA 4OFYD 4BKSC 3GGWA 4LSTH 5CKAA 4J3TA 3V0JA 2K78A 1MSPA 1OO2A 3DXAA 3O20A 4PY8I 5EU7C 3UEQA 3EUUA 2XKNA 4YFDB 2GK0B 4FG0A 4PGZA 5BZXA 1IJNA 4G6AC 1XF2B 1MJUL 5AB9A 4MMZC 3TO4C 1OT4A 4GAGL 2F74B 5DHEA 1MF2H 2GKIA 3U30B 1NFIA 4WV1B 1J05A 1JWMA 4E36A 5KVFE 4CVZA 3TIDA 3KPMB 1IC4L 3FT3A 1SXBA 3UC0L 3X11B 4G42A 4WI5A 1EXUA 1AE6H 4Q2ZA 1WIUA 4QEGA 1I54A 4LFHG 1FFNB 1A1OA 2LFGA 3LPWA 3II2A 4LPUA 4XB3A 3D4YA 3DXAD 3L4TA 3HS0B 3NIGF 3H1ZA 4L3GA 4JHAH 5EULV 3TV3L 2MMXA 3KW8A 5L7XH 3OXRB 4NWTL 3ME0B 5E94A 3SKOB 1KJVB 3IN2A 5IW3A 2C1VA 2XY2A 3P11L 2OI9B 1O6SB 4UAHA 5LWYH 2ZX7A 4XCCH 1U8IB 3FUDA 3K8KA 1JNLL 4P4KC 4OLXL 3P0VH 4TVPL 3H7BB 5ABDE 3FFDA 5D2NC 3DIFA 2WOYA 5DURB 1G7IB 3BW9A 3BZ4A 3MYZA 1V27A 3WN5A 4D9QD 1FH5L 1GYUA 3OKOA 2X38A 3HG0A 1OPGH 1A3RH 3CSPA 4BYHA 4ELKA 3QXDB 4ETQB 3WDIA 1HC1A 3MGAA 2W9EH 4TLSA 4GBXC 3D0LA 5ERWB 1ONQA 3BKML 1ORQA 3L81A 4AQ1A 2DD8H 1BL9A 1LMSA 4OH2A 4WU5A 1HSBA 3DX2A 4AL8L 2E3VA 2BNUB 3EO0A 3IFPA 4I2XA 4PGBB 4QTHB 3LIZA 1QD0A 4KKCC 4WTZA 4BA0A 2PPFA 2PP7A 2VSCA 5C9KA 1VGKB 4JL2A 3KVDD 1YNKH 3L5HA 5CJBA 5AVYB 2R2EA 4KROB 3FPYA 4KI5C 4HIHA 2Z31A 5IROD 4XCYA 5KW9L 3L7EA 1UWXH 2NZIA 2VW4A 1OEZW 3AB0C 3QFJE 3WE1A 2OL3H 2ZX9A 1CL7L 1A22B 3IXTA 4RA0C 3NPSB 3OHXC 3DOSA 1EAPB 1CYIA 2P24B 4FMKA 3L74D 1V54B 5HVFB 2I9LA 5DZPA 5C0IA 1FN4B 2Y7QA 2BERA 4U6VH 1JNNH 1ZHLB 2CKBB 2FBJL 4GUQA 4TQIA 4P9HC 5FYLL 4KRNA 1LO2H 5E5RB 3X1GA 4P59L 1DFBH 3W9EB 2Z31D 1LEIB 1SF3A 2CK0L 2D73A 3C5ZC 5F44A 1YEEL 5IP4A 2H4EA 3KYMB 1S7VA 5DD3H 4L5FE 2FZ3A 2XICA 5DRZA 3G5WA 4M43L 1UQSA 4M6AA 4RISL 3HZMA 4OLYH 4ZQKB 4X6CA 4HHGA 4N6QA 4PJBA 2GJ6B 3VRJA 1S3RA 4RGMB 5FUCC 4K7PL 1RZPA 3WD5H 4QHLA 3NPZB 4QJ3B 4JQIA 3E6HA 4CJ0A 2W60B 1T22B 1U3HC 5DFVC 3LEXA 5F7NC 5H94B 2W94A 2H2PC 1IGJA 2MWCA 2WM0A 2PR9A 2MPVA 1UT2A 3LZQA 4PBDA 2IWEA 5I1EH 5AYUL 2HLFD 2OM5A 1XCQA 3GXUB 2E7HA 2PP8A 4C83B 3RFZC 4K3JH 1ZS2A 2B0SL 4K5PA 3TN0A 4IOIA 1D6EB 2FK9A 4JCLA 1OSZA 4WJ5A 3T4YA 2DEXX 1E3ZA 2IH8A 3NIGE 4UQ9A 4WDIB 1OGPA 3TBTB 2PXYA 1A4AA 4PGEA 4AQAA 1CU4L 5AOZA 5D1XE 4WUKL 4TMPA 2DBLH 1BFSA 2OYMA 2X4OA 4OLVL 4I18C 1CFSA 5SX4H 3D0WA 5D6DA 4ZUTB 5CZVL 4R5TA 1FZKB 4CA4A 4F92B 3A4FA 1DE4B 3MRBB 3RX5A 1CRIA 1HL4A 3AFLA 1H8NA 1QMUA 1G1YA 1EQWA 1JZDC 2N59A 4U3SA 1CF8H 1LE5A 3TN0D 1JZ8A 4PJCA 1ZAGA 4KPHL 4L0PB 4PJIB 4LCCC 3UZQB 3S98A 1L0XA 1NCBH 4C4KO 5CLWA 5EU7E 1KCSH 4GKNA 4GRMA 2PXYD 1A47A 1ITCA 2GT9B 2HJLA 5EF3A 2BCMA 3BSHA 3H55A 3GJFA 1E5UI 1HYSD 3V95A 3SCMA 3L9YA 3DBXA 3ZQXA 3ELQA 3SE8L 1IL1A 1PQZB 4HISA 2QDWA 4A63A 2GJRA 5AVRB 3NZ8B 3ZJAA 4RGND 1NGYA 3G5ZA 2PCPB 3FHEA 1PYWA 1AMYA 3EFFB 5K33A 1COTA 5DEFB 5IBTL 1DVXA 4EDXB 2NW2B 5D4HA 1A7PH 2VR7A 3MKGA 4XP1H 2FJFA 1MFMA 5D6CB 4RFEB 1LQSR 2RD0A 3QUYB 1TTCA 3SY0A 2KQNA 1I8KA 4YHZL 2CLRA 3QHZH 2ZG1A 1YMMA 3K72A 3SCMD 4JPIA 5AW6B 2JQAA 4OM0H 3HFFA 1AMXA 1CSVA 2Y06H 1DCEA 2A83A 4BFFA 1K4CA 4J27A 4YXHH 3CZEA 4ABVA 4QIRA 3CXFA 3DK2A 1QEXA 4M48H 4D0BA 2NUPA 1E8WA 3R4RA 2Y25A 4ZT1A 3ECQA 2GPZA 2L7UA 1MCJA 1NMLA 5D2NE 2NTSP 2DMBA 1OK0A 3PPEA 2ODIA 2ZOOA 1D6VH 1SJEA 2WWKT 3BYYA 1IC0A 1XB3A 3M1OA 4WEBL 4ZDHA 5JXEC 4NZTH 4PYHA 3OAYK 4WI3A 4MSWB 1CGSH 3BIKB 1YMMD 2G9HB 3QISA 4JFTA 3D3VE 4W4NA 2R69H 4PRBB 2FEDD 3S3DB 2ZX5A 1Y1UA 5AKVA 1G9EA 3LXAA 4MQ7A 5ANMA 3LD8C 4IM8A 3VFSA 3VWKC 4Y9GA 1R9FA 1M71B 2OZ4L 3GSVA 5EBMA 2BJML 3VG9C 5FB8B 3TJHD 4Q8BA 4MXQC 3CVHL 5M94B 4AZUA 1MJ8L 1QO3B 1YNLH 4P2RA 1KJ2L 4RIRB 4N68A 5KYNA 1P84D 1Y18B 1BZ7B 2Q6WA 4PJDF 4IDLA 3K8MA 5EU5B 2XWJA 2B77A 4P04A 2IMNA 1TQTA 3VO0A 1JGIA 5H2BA 5I23A 1EZUA 5EC1A 1CDCA 3FB6B 5I1JH 2J21A 2QJPB 3H1LD 5HHNA 3NOIA 1CHIA 2OSYA 1J1PH 1AJ7L 2QQQA 4X6DA 4UT6H 2YSSB 1GSKA 5CU9A 1BQRA 4Z3EA 3ZE0E 2SODB 2SEBB 3NESA 1CT8B 1JFQL 2V7HB 4UNIA 2N7SA 2I5YH 1Z9MA 1S78D 4GQQA 4KAQL 2F1BA 2BH5X 2ADJA 3ULVC 1GZHA 2X9YA 2JIXB 3FRPB 4P2RD 2NNRA 4YHIB 4ZI8A 3JYBA 1B4LA 1EBAA 5F70A 3SY6A 3S97C 3C6LC 3CCHA 2EH8L 4IIQB 2F9BT 5T3ZL 1CIUA 1UXWB 1EJFA 1G0YR 1SLUA 1A4JA 1H6EA 4IBSA 1FVEA 2IQ9L 1NSNH 8PAZA 5B3SB 1WRFA 1BQHB 4AGMA 4IMLB 4WHCA 3ZYIA 2GJZA 3DIDA 4NKDB 1V3MA 3VXTB 3DETC 4NBXB 5BNXD 5CILH 3QQ4A 5AW8B 4GAYA 4WNQA 3WS6A 1ODUA 3T3ME 2O5YL 4ZFOL 5C6TL 2C3GA 5JHDA 3MCYA 2WQAA 2F61A 1HQ4B 5FLUA 1I8MA 3LXBA 4HF5H 4ELMA 3G6DL 1A4BA 4M1CC 1T0NB 3NIDF 5D8JL 1GIWA 3UGEA 1CE6A 1KBPA 4NSKA 5KAIV 3GBNL 1YLBB 4YIQA 5LXVA 3PAVA 3EH2A 3MCLH 4HS6A 1CXFA 2WBJA 2C1DB 2I60L 3PWNA 1ZRTD 3EOTH 4M7KH 5IKCA 3BGFB 4J1UA 4E41B 2Y7MA 1W5CT 3CQQA 3U0WH 2UX6A 3NN8A 2IO5A 3K0WA 4KHTH 4BZ2H 1GZPB 2YRBA 3HE7C 4OCWH 5TQ2H 3V52H 3W11C 3CN3A 2GAZB 1BIIB 1AHWC 5JHDD 1J87A 4YWGH 1FFRA 3MV7B 1UWEL 1B6DA 5FW8A 1B0GA 2EDJA 1ZGLA 3R7RA 5F7YC 3L3OA 3SDDB 3DP5A 1DBJL 5EZIL 2EIDA 2NZ9C 2X12A 4FEMA 3S37X 1CORA 1MEXH 3F6JA 3IAPA 2XWBB 4L29A 5KG9A 2A9NL 1IAIH 4L8DA 2WBJD 1J5OL 4TTDD 3X13B 3EGDA 1MLCB 4AX3A 1UVQA 1R5VB 1E29A 3N1MC 3NFNB 1OAXL 1GOGA 1D9KC 3C8KA 1N9PA 1RIHL 3HAEG 4TULL 2FNWA 3EF4A 3EGXB 1DQKA 4A7GF 4JG1L 3K81A 1JE6A 4PBWD 2V3DA 2BIOA 1FCGA 4GQ9L 4HH9A 4ZSOA 5KOVC 1D5ZA 3WFDL 4R4BB 3GI9L 4DN3H 3ULUD 2FUTA 5LCVA 3T04D 4D9RD 3K5RA 5BVJA 2QGEA 3CXHW 2EDDA 3TBSA 1H5BA 2ICCA 1IAOA 3UBXA 1BEYH 2CJSA 3RUGB 3BUDA 3HQ9A 3FCTA 3TX4A 1GRWA 2ICWJ 5F7AA 3WC8A 3SDAC 2XBDA 3H0TA 2AZUA 2EEBA 4N0YH 1ACYH 3FN0L 1GJIA 4MDRA 1E90A 1OAYH 4ATWA 4G5ZL 2V17H 3WTSA 1X7QA 2V5MA 3LS5H 2G30A 3QHFH 3HEIB 3MA7B 4XP5L 4PRPA 2H9GB 1BM3H 3S7GA 2WVVB 1A1NB 3CZFB 4GUCA 5K59F 1BXUA 4XMLH 5E0QA 1LM8V 5DD0L 3B3IB 3EJTA 4NKOA 2D03L 4LPVA 3CLFL 4HUCA 2XA8H 4JO3H 2BVOB 5B1BB 5J9PA 3EO1A 2FB4L 2Q8BH 2VDPL 2X05A 5C71A 5JXAH 3TA3C 1GL4B 4EQ2A 4PJFF 3BVDB 3KYOB 4DETA 4HLZH 3E7JA 5C0BA 1YEAA 4AXWA 2XY1A 1U92B 5ACMA 1KB5B 4BHUA 4K7PY 5CUSH 2QHRH 4UB8V 4HXBH 1CFQA 2Y36H 3QEQB 4PRPD 5DJYA 5AB2A 3P4OA 3NIFB 1WWCA 2WBXA 1YTCA 3QUXB 2RAMA 4XVJL 2OR9L 3BH9A 1CL7I 1LEKB 2DPKA 5F9OH 5KVGE 4KTDL 4NN6C 4DNLA 1A4CA 1C5BH 3VNWA 1IAKA 1MCOL 1OT2A 3MFFB 5E9DA 4BFIA 5BRQA 1UHVA 4Q0XH 5C0BD 2OMYB 5KN5A 2IPKB 3MPCA 5CICB 4FXGB 2E74C 1OP4A 5JOPE 1DUZB 1VIWA 2MOVA 4R7VA 2DY2A 1D5XB 3UDWA 3WXWH 4HIIA 2CXGA 3QDJA 1WE5A 3PWJB 4PI2A 5F9WB 1U95A 3K5SA 4O2EB 2ZCKH 1FNLA 2L7QA 3KS0J 1JNHA 4I5BB 3QIUA 2GI7A 4NJ9H 1DN2A 2LT9A 5AVWB 3L3IA 1CTMA 4N0UB 1PDKA 5DQJA 3OAYH 5GISH 1TF4A 4LL4A 4B7IA 1FL5A 1NNOA 4U6YA 5E9DD 3VXQA 4JNXA 2MOGA 2APSA 5EU3A 2ZAIA 2Z64C 3FTUA 2A6JB 3ULVE 4TTGA 1U8HA 3I9GH 3WFEC 1XBDA 4KMTL 4U1HB 4ES9A 3MRCB 1N8OE 3J2PA 3KBPA 4NM8L 3JWDC 1TZIA 5TE4H 2B9AA 3D7PA 3QDJD 4X8XA 3CPLA 3L4ZA 5C09A 3HZKB 5INDB 3RWIA 2ARJB 4YDIL 3C5SA 2APVA 2B1AH 2BNRE 2GBUA 2YKKA 1ES0A 5DHVB 1T7ZA 3T3PF 2YPLB 2GSIA 2Y23A 1VA9A 1UJ3B 2FRGP 3MV01 1GAFH 1OB1A 2AJYH 4X4ZA 2DQHL 5EBLA 3C09C 3U1PA 4AVHA 2CDGA 3QCUL 5L6YH 3QULA 4RWYH 1YDPB 3CFKA 1AXSB 4JRXA 5J3HC 3CUPA 2J4WL 1GC1L 4U1JB 3S37L 1JYWA 3IJEB 1U8PA 3RPIB 1A7QL 1QBLH 4QCIB 4DVBB 4ZMLA 1R75A 5I6XB 5C09D 1TVHB 5HGAB 5E1IA 5H4YA 1HI6A 3KWUA 5A7BA 3QCVL 4JFXA 2IF7A 4FQIL 5IG7A 4JPVH 2OMXA 2XBZA 1WA0X 1XH0A 2JE8A 4DFHA 2RALA 2DWTA 2FSEB 2FX7H 4K5OA 1G1OA 1ZANH 4J3SA 1FZJB 1T1ZB 5KVDH 4QJ5B 5I1AB 3MREA 3DRTA 5FHBL 4Q89A 4JRXD 5K59E 1MRDL 1SM3H 3PWPA 4YFEA 4ORGA 2XQBH 3VG0H 4JN1L 5B7EA 2VMCA 1WCBA 2DMGA 1QQDA 1RZIB 1GTFA 2GTZA 2WXFA 4CNIA 1BFTA 3IJSB 1WISA 1F1GA 5K39A 1AKPA 2GCYB 3HZ3A 4BWUA 1ANUA 4PJ8A 5HXMA 4GAJH 3O2DA 1C8QA 2A9AA 4F7EB 3RY6A 4HKJB 2C9RA 3VYPA 2CKNA 4L3AA 1XR8B 3NABL 5BS0B 3IJHA 3CFEA 1G0DA 1R47A 3BN9C 3CH1B 4L9LB 4YPGB 1BQSA 1Q1PA 1N12A 1XFPA 2YD6A 3CH8A 3NA9L 5SV4A 1W16A 4J3UA 2K3TA 1KYAA 4FCHA 4C56B 4QRPE 3U4KA 3VTAA 3PWPD 1UZ8B 1FI9A 2X42A 3BC9A 1SBSH 3LKOB 2JXMB 3QJFB 1NICA 3B2UC 1MCFA 4WTZG 4GAGH 3KG5A 1K3ZA 1OW0A 4PJ8D 2NQ3A 4XO5A 5F89B 1ET7A 5HGBB 3L1OL 1TEYA 1YEFL 1TQVA 1TCRB 1Z66A 2QQLL 1IC4H 3QQ3A 1A5FL 3UC0H 1TSHA 4QRQB 2LLLA 3D0VA 3H2QA 2V2TA 1S2EA 2OJEB 1E5CA 3F12B 1DQVA 3T09A 1EERB 1XX9C 3ZOOA 1N6UA 4LLQB 3WEOA 1KWGA 3VGAB 2VXQL 2VDMH 2PR4L 1O9ZA 3TV3H 4AKOA 1PU0A 1U36A 2AVFA 2MRYA 4PMFA 2MTAC 4HJJH 4P23B 3KLKA 4NWTH 1IU1A 3LKQB 1IQWL 2NNAA 5I0VA 1J10A 4ODXB 3IM1A 1BZ8A 1ZT7A 4JE0A 2N56A 1JNLH 3L4UA 3BDXA 3OKYA 3RWEA 3VRLE 1XGTB 3FCSB 4HD9A 1X5JA 4FZEH 2NY6D 1H9YA 3PS6A 4QHNA 5D5MF 4FADA 5I30H 4HUMB 5KVMC 4H0KA 2XFXB 3EOYG 3M46A 4UQAA 3VAEA 2MKLC 5I73C 2CD0A 1BFVL 1FH5H 3HRZA 1U9KA 1XIWC 3HG2A 4J8QA 4PYGA 4HA1A 1NL0L 3MNDA 1HNYA 5DWUH 5B39B 2EXWD 3JWNC 2Q3XA 4J4PA 4OZIA 4OFQA 4P07A 5CNHA 2IDQA 4J39A 3BKMH 2EIZA 3KLDA 4ZPVA 1S7WB 1YYMH 2DRUA 3QZBA 4LIQL 3RZCC 4F8LA 1TJIL 2BWQA 1X6NA 4JKPL 4AL8H 1NUFA 1QWUA 1A3QA 2JQRA 3CFBA 1DVZA 4JRYD 4EKXA 2LW3A 4P99A 3KAAA 3FOLA 2VERN 4EDWL 2KS0A 5F93C 4KKZA 1SN2A 3VFRA 1CTNA 1DBBH 4HD5A 1NLDH 1PS3A 3Q8FA 2EYTA 1H32A 5KW9H 4GIPD 4IHBA 4YE0A 2P9RA 1PLGL 4J4PD 2CU9A 2W65B 3AMKA 3MC0A 4AGQA 2VQUA 5FM8A 1WAAE 4MKMA 4PR5B 4ZYKA 1N50A 4OV5B 4EXPX 2VQTA 1S5IL 1X5KA 3BAWA 2DLTA 1OHQA 2AGJL 5GGQL 1N2RB 5FOJA 1M7UA 3CC5A 5TD4A 5KBPA 3FQRA 3IDNA 2FBJH 2MNJB 3FTYA 1KIRB 4P3WA 3O9WA 2LU4A 4X5PA 4JO2L 4NC1E 4NRZA 1OY3B 5DJQB 1W15A 2WHVA 3P9LA 4P59H 4UTBL 5SWQB 3TEXA 3L9RA 1CZ8L 3TN0C 2K70A 4GRWB 3OGCA 4B9PA 2GJPA 2XX0A 4S1QL 1LP9F 2YC1A 5CJOL 1H9XA 3ZN6A 5DHYB 3ARDA 1YEEH 3LKNB 4JFVA 2VDNB 4OZHF 3K71B 1JUFA 4RISH 4TNVF 5LBSL 2CGRL 4LSVL 4POUB 1BWWA 3KPOB 1BD2A 1HRCA 1EWHA 2KI6A 5A6MA 4K7PH 4OZGA 5BQ7A 1YMHA 2WNGA 4YZFF 3H54A 1JL8A 4E9SA 2BSRA 2YPVL 1KLUA 3RGVC 3O9WD 1JVLA 3HI6L 1GPOL 4WQ7A 4XX1E 2HKHL 1MQKL 1FVCA 3AGWA 4WI8A 3GUFA 2ZXBA 3ARDD 3O6FA 1L7IH 3PPSA 2PYEB 1C6RA 3DXAE 4AQ8C 1KG0B 2ZQKA 2WXLA 4ACPA 1CI3M 4KXAA 1BD2D 4HMDA 3TNNA 4OFKA 5FV1L 3D33A 2ILLA 2B0SH 2DEYX 3OSVA 1PCXA 3HA0A 5G5DA 1R3JA 2YUVA 2NDFA 4HQQH 4KXCA 3SE3C 3FN3A 4NQDA 4OUUA 3KMDA 3HPLA 5FM4A 5L4JA 1CU4H 2OL3A 3UYPB 4HK3J 1FIGL 2XKSA 4QNPE 1PKOA 5DUBB 3D69A 5FA3B 4KKAD 5CZVH 4LEEA 4PJ7A 6TAAA 2Q87A 3O6FD 4Z0BL 5BZDB 4XXCA 3O0RL 5ALCL 2ITCA 4D9QE 4KDTA 3MRKA 1BOYA 1A65A 3KJ4C 1EMTH 1OL0A 1DBKL 5IBLC 1FI7A 5FGCB 2VDLB 5FO7B 1TZGH 3S96A 4KPHH 4M6OH 4NQDD 4BJLA 1P6AB 3U0TA 2J88L 3L4WA 3O2WH 3VFMB 3N55A 5DJ6A 4S1DD 3GMMB 5FO9A 5LGKA 1OTUC 4F8QA 1H15B 5D72L 1AKJA 5GGTL 3NZSA 4MZRA 3FUJA 2E9GA 3OWRA 3JTBA 3ESPA 4FCAA 2E86A 3L3DA 3H9YA 3U6RA 2JB5L 1NDMB 2X70A 3C5JB 3A6BH 1MAJA 1CGYA 4P5KA 4Y19B 1RPUA 4PW9B 1RK1B 1NEPA 3AT9A 4UTCA 3H6JA 3M17B 5CXPA 3QPQC 1J3SA 3PRZA 5IBTH 2R23A 4IBUA 4XCNB 4ZTEA 3IDYC 5D7KD 1OALA 4W70A 3S36X 4I2XE 5KKZB 1BXVA 2WUCH 3P40A 4Z77A 2IBZY 4UILL 5TH2B 4U3FD 4YHZH 1AR1D 1PY4A 4FG2A 3QZWB 2IBBA 1AKJD 4Z7OF 1RK0A 4MAYA 2IAMC 2IDFA 2HG0A 1U8JA 2KQMA 3MBEB 3HC2A 4X6BA 4ZZKA 2EVJA 4GFXA 4KQ0A 2BC4A 2H6UA 3UROR 2XPYA 3K6DA 4OZ4B 1X5ZA 5DJDA 3GO1L 3QUGA 4FHKA 5KUMA 1VERA 3GWJA 4LAJH 5IJCC 4WQDA 4A68A 5IFJA 1QPPA 5J12C 1XH3A 1VRSA 2ODHA 5JPMC 5B38A 4PGCB 2KLRA 2NY5C 4AQEB 3I50L 5JMOC 3LRGA 3VFVB 3AQZA 1RZ6A 2DL2A 1G5AA 1JPFB 4WEBH 3LRHA 4K9JA 3PWLB 1MVYA 2BHFA 3KPSA 3L4XA 4FXKB 4JAMB 4XO9A 1TJHL 3BCCD 3QFDA 3VMOA 4F33B 3PDDA 4H7VA 4IW4C 4S0TD 5AAMC 4MAYD 1GZHC 1RZ7L 2R83A 5I1GL 4MCZB 3FAWA 1NCAH 2WTOA 5AUMB 2K7PA 1S8DB 1QX1A 1ET8A 1OWWA 4LSSL 3C87A 2OZ4H 3RVXC 2AI5A 2BJMH 5AW9B 3BMVA 1KTDA 4YUEL 3CVHH 4LCUA 3TT1L 4EUPG 1ZGLP 4PJBE 3B2MA 2D0FA 3ZZ1A 2OMZB 1J8HB 3K6SB 4XTRD 3LEVL 2E7MA 3DV6A 3Q8EA 1J12A 5IMOA 5I6MA 3KPSD 1EVUA 3ZDYE 5I1KH 4ONGL 1MZ4A 2R15A 2NXYB 3ESNA 4LCWA 4X5RA 5C0JB 1RUML 1HCMA 5DA0B 3KGUA 3SPVA 3ZTJH 2NSQA 3LPFA 4HYTB 5AWNL 1T0OA 1AGCB 2HJKA 1ZJAA 1L0LD 2BSSB 4CADB 5I2IA 3IPEA 1A56A 4KAQH 3OTTA 4Q9BA 4QHMB 5AW2B 3T0DA 2V2WA 2XIBA 2VXTL 3OZLA 3GMLB 4TTDC 4DO5A 3ZVVA 2EDRA 3PGDA 4CBZA 1ASOA 4JZJA 5T3ZH 3QWNA 3FS9A 1L9OA 3SSGA 3NUKA 1T5XB 2Q7NA 4L18A 4MRCA 1EEYB 2IQ9H 3VQLA 2FQDA 2R1WB 4LCWD 4RRPM 1BQLH 1ACZA 2DIAA 5DLML 2X4RA 4D8PA 3O45A 4D0DB 4FQHA 2WAQA 1P5UB 2CUMA 2RTTA 1U8CB 1PG7X 2YQBA 4G9FB 2YS4A 3AS2A 1KACB 1MKFA 4DP5X 1F8TL 3LKRB 4R0LA 4J2QA 4H1LH 3IGUA 1E5ZA 1PSKL 4X50A 4GG6B 4RGNE 2O5YH 4M7LL 1FZMA 1RZJC 3AREB 5EUOA 4FANA 5L8LB 3NJGA 3DTXB 5T33L 5DSCB 2C4FT 1J0JA 3G6DH 1N5AA 2OSXA 5D8JH 4YDZA 2ZX6A 4GJTB 5D4IA 5HPOA 2CDFB 3TYIA 4FQLL 1BOGB 3NCMA 1JZ4A 3TESA 2Y24A 2NPLX 3FQNB 1KTBA 3EJQA 2XRAL 3KGRA 4LVHB 4NENB 4M5TA 3NBSA 3KD4A 3MLWH 2VLMD 2Z93B 4W6YB 5FM5O 3DSNB 3N44F 2ZF8A 5KUKA 1AI1L 2FATH 1H5BC 2F19L 1NINA 4AEEA 5AEAA 5DQ9A 4LKCA 2NY1D 4RQQB 5AW4B 1A9EB 5K93A 2VQ4A 1ZDQA 1Y1DA 1UWEH 1XTMA 3QJQB 1UM6L 4LAQL 4TUJA 5G4NA 4G43B 3E6FB 2W0PA 1KPUA 4UT6A 4UCFA 1CIEA 3FU9A 4FTVB 3Q2CA 3MV9B 3ERXA 4LSPL 1HNFA 3F7YB 1NC4B 5T8IA 2ZG3A 3WIHL 4PJ9B 2A9NH 1J5OH 4I3GA 5J7CC 4AK1A 1PX3A 2KHAA 2Y6TE 3U2IA 3EHBD 1NTZD 1FDLL 1YMME 3UTTA 5IOPA 2GITA 5ICXB 3ALPA 1IC7H 4ANKA 1OAXH 3SDYL 4TULH 3NYKA 4HUVA 3ZDXB 1WEJF 2GK2A 4JFEB 4JG1H 4P2OA 2QVFB 4QXUL 4UMGA 3ZYOA 4GNKB 1SVCP 1WDAA 1I1AA 3LNHA 4JUTA 1Q0YL 4GQ9H 1CJYA 2IIJA 3WFDH 1S4IA 2HFFB 3GI9H 4OT1L 4FLQA 3TZVB 2E27L 4XZUB 1ZE3C 2DLIA 4LEOB 3U36B 4U4IA 4EO5A 2P42B 5FECB 4MD5B 4LPYA 2VAJA 2FGWL 3UTTD 3LNDA 5A7EA 1H9VA 4E5XB 2D0GA 3EZ8A 4G5ZH 5DJXB 1CXCA 3BKJL 3K6OA 1CGUA 4I0PA 1H31A 5ANME 1TITA 3RHWF 1I1AD 4NUJB 4EI5A 4PV8A 1SHSA 1NWPA 4UQIM 3DURA 3R19A 4X4YA 1PZ5B 3B1TA 1SJHA 5DD0H 3M7OA 2D03H 2F54B 5IJVB 4P2RE 4FC3E 1HXKA 3ZSTA 1U8QA 3CLFH 1SQMA 2CHZA 1X4XA 4HUXA 3IJ8A 3RI5K 4BZ2A 1MCBA 2BFGA 3U1SH 1N3NA 4PJXB 1FJ0A 4G6ML 2X44D 5KVFL 1XZ0A 2RGSA 3IWVA 2QPUA 3QIUC 2VMJA 3V79C 4WF7A 4BXSV 1JXKA 2V9QA 3QORB 1UXMA 2CE6A 3K46A 3C8DA 1MCDA 1R3LA 4JY5H 4X6DE 4URKA 4KI1A 3STLA 2BLFA 1XD1A 1BHGA 5FC9A 4EI5D 1WC7B 3BT2L 3GS7A 3BE1H 1RV6X 1AIFA 3FU8A 1I9IL 3C08L 4XVJH 3KR3H 1TZHB 5JA9A 1FG2B 1A1MB 1XR9B 2YJLA 5A1AA 3US1A 2JK5B 3HCVA 3GEWB 1H3GA 2QDVA 2K9UA 1HOCB 5CR1A 4O4YL 1C2RA 3SGDI 1MCOH 3PWVB 2DQTL 1XF5B 2VZOA 3UPRB 2N3JA 3ZKMC 1ZSDA 3ARBA 1OAQL 5F1OB 1MI5A 4JO5A 2AXFB 2PMZA 4BSWA 2FVNA 1TTUA 1URIA 3SGKC 2ED9A 5CCKH 1OSYA 2IDTA 3VB8A 1DR9A 3D9AH 1QL3A 1INQB 1PG7L 4O02L 3HLKA 5JHDE 2GB8B 2NY4D 1GA2A 5F6IC 3ZO9A 3TCLB 1HXYA 1XGQA 1HZUA 3MCKA 5EF0A 4ELME 5E6SB 3VXMA 2HVBA 4PJAF 3OKKA 4HXAL 3MLUL 4I9WD 3NCYP 3QNZA 4NBZB 4AY0A 1SN0A 4NDMB 3ARBD 2HTKD 4A7UA 4KKLC 4BH7A 5E2VL 1C52A 5E8EA 1MI5D 4DCQA 2BVPB 4IK6A 3WL9A 2XWTB 4KMTH 3REVA 4MB4A 1NCIA 3AY4A 5KWYC 5MEPA 4NM8H 3F83A 3CE1A 4K8RL 1GGIL 1SF5A 3SBQA 4EXKA 3S88L 2V0AA 3ZSSA 2YA0A 4YDIH 3BQVA 3QDGD 3ARGB 3FBKA 1GYWA 3WBDA 3ULUE 5AENA 4D9RE 2M1KA 3VXMD 1B0RA 4NB7A 2F0CA 3QCUH 2OMVB 1A2YA 4Z5RA 2J2ZB 1KY6A 4HWUA 4XNYH 1L6PA 1UM4L 1QSEB 2J4WH 2X28A 3RY6C 5ISZB 4QO1B 3MZGB 3S37H 4OF7A 3TBVA 1S7XA 2VAAA 1OGAB 1A7QH 3ARSA 1HN1A 2J25A 3JTSB 2W1NA 1YCCA 1AZVA 3WXVL 2Z9TA 3RUGF 3QCVH 1H0DB 4TUKL 2C2CA 2IG2L 4FQIH 4L5FL 4ZSOE 2VLKB 2OSWA 4G7SB 2WP3T 4MJ2A 3VNYA 5FGRA 4G1EA 1CHJA 1F86A 5HHOB 2GTQA 4ZTOH 2N0MA 4K94L 3QJHB 5M95B 5E24E 4BKLA 3BEWA 2NQDA 2MEJB 1G7LA 4GKOA 5IUCA 1GGYA 4JN1H 2O61B 1E27A 1NMAL 4TSBL 2PW2B 4N2EA 3MJ8B 3LS4L 4RESB 3VFUA 3T6VA 1AC6A 3NJMA 1N59B 1DZBA 3C2CA 4PRPE 4WWKA 3VXOB 1Q9LA 3QQDB 3FOMA 2EXWC 5D70L 3ISYA 1QHOA 1CD9B 5J0BA 2F1AA 3JV6A 2VXSL 4LSDA 3O5CA 4WHTB 2BCKB 3NA9H 3GMNA 2FRCA 4HOMA 1CFMA 4NFDA 3RNQA 4KKRA 2DICA 1BAFH 3IMWA 3FF8A 3VYOA 4H5SB 4AK2A 3KPRB 4YGVB 1A3LH 5IW1B 1KB9K 4H88H 4JFOA 5C0BE 1GQ1A 2X7LA 5DFTA 5EZPA 3D39B 3F7RA 1SLWA 1JZHA 1VSCA 4UAOC 4XNQB 4JM4L 3II1A 4UWQB 3RL1B 1R3KA 2OXHA 4WWKD 1ICTA 4GRLB 2AF2A 3DROA 4LASL 4X7CC 2RBLA 2NX5B 1LMIA 1OCZB 1YEFH 2HPTA 2A99A 1OLLA 2OSLA 4F20A 3PDGA 4XPTL 1JGUH 4ZXBC 4Y5RA 1HKFA 3GBML 2IPTL 1GVIA 2DDQL 1A7NL 1JAEA 2JI2A 2NYKA 3AM8C 1CIGA 3VXSA 2CCLA 3MRFB 4MD0B 4U31A 2HFEB 3GBEA 4AV0A 2E9BA 2J5LB 4B3VA 2V5RA 4XCFL 1TPXC 4NQSB 4XNMB 2PR4H 4FI8A 5E9DE 5L4IA 4OGYL 4R7DB 3T2OA 4DPBX 2KUTA 1IQWH 4YBLB 3SJVB 3MACH 3BI9X 2UYLB 2NLJB 3WNMA 2Y7LA 4LCIL 5C07B 3QDJE 5GGRA 1RJZB 3NSCA 3LV3B 2VMDA 1IE4A 3DX1A 4Y4HA 4K73A 1G7HB 1I3RA 4LL9A 2ICWI 2VIRB 3MOAL 2XJLA 4WUUB 2CR6A 3VXSD 5EZLA 2CWRA 1BFVH 2ZYHA 1KXHA 5HI4C 2XWXA 1NL0H 3G04B 3HNVL 1NCCL 1H6TA 2HT2C 2WW8A 4N8CL 1VEPA 3IDUA 1AQKL 1ETB1 4YR6A 1AD9B 1E5YA 3NFPA 4LIQH 5EOTA 4EPSA 4GXUM 5CJQL 3SDXB 1B9KA 1A3ZA 1AO7A 4JDTL 5C09E 1EJ8A 1MCKA 1OGSA 4GKZA 5I0ZA 4U6HB 5HGGS 3VW3L 3B9KB 3CAFA 4P3CH 2MPAL 1W0WA 4Y4HD 5AVZB 4EDWH 4FXLA 1BYNA 3GXNA 2LIRA 2ESVB 3L2NA 1B90A 5HDWA 1TJMA 5D1ZC 2NSXA 3Q06A 5AAWA 3DRQB 3VGFA 1SY6L 4XBPB 5BMFH 1ZLWK 4WNSA 4GEIA 1PLGH 4YL9A 5DMIL 3LMJH 4JRXE 4TXVB 4IBQA 4ZMTA 2ADFL 5DVPA 5HY9B 3FU6A 5IY5B 5AD0B 3W56A 5J89A 2X40A 3SGDH 1AO7D 1ERNA 3CDCA 2AGJH 5GGQH 1D5MA 5IV2A 4UT9H 3MBXL 2DQCH 3IBOA 3V9FA 5D96C 4CRPA 1CURA 1HEZA 4UTBH 5C6WH 4AQZA 1CZ8H 4HGMA 3GI8L 4M1DL 3HB3B 3VCLB 5B39G 4Y2DC 4DQAA 4JGMA 1YRKA 3RPKA 4N25A 1IM9B 5CWSB 2D2OA 1E3FA 3OXSB 3MUUA 3PWPE 2R56L 3D25B 5LGJB 2R1YB 2DQGL 3D05A 4S1DC 2AS5M 1BF8A 1YN7B 4P5MA 3WHXA 1D5BB 4MDJA 4JFZL 2WJ7A 4NQEB 4WO4C 4DSYA 1J8SA 1GKOA 4ACTA 2YPVH 1TQBB 2PN5A 4KDTC 4NP4H 4MX7B 3VFWA 3X1BA 3EYQD 3HI6H 2H3NB 2F74A 2D0WA 1Z1WA 1Q0EA 3ET9F 4P9HL 4PD4K 1MQKH 1PNCA 1WV7T 4Z7UB 2AK4A 4Q9RH 4L9DA 1FI8C 4JY6B 4ONFL 1S7RB 2NY2C 2PUQT 4LSUL 3ZE0B 5F8QC 2F5AL 2X4TA 2ZXGA 3JVGA 4PVLA 3VU1A 1JGLH 1SHWA 2H1PL 2VLRB 3APCA 3PHQB 1TKWB 3BO8A 3WAJA 3CLWA 2YBGA 3ROOB 1EK3A 2DKUA 3SKOA 4TSCH 1O6SA 3LNFA 5AW1B 2OK0L 2FQGA 1U8IA 2AK4D 5LXGL 4HSCX 3AJ7A 5D9SB 2XPZA 4Z0BH 4ZS6D 3O0RH 1WSST 4PJHA 5DXWA 4L4VB 1EHNA 5BVPL 1LQBC 4HIJA 1QFOA 4V2CB 2R8SH 2Z7YA 3BWAB 2IADB 3KXFA 5K1JA 3WFCC 1DBKH 4ANXA 5B38G 2NR6A 4YLBA 4X6FA 3ARQA 3SQRA 3PIQA 3GXDA 2X1PA 3FHQA 4CSZA 4ETQA 3WV0A 3BCFA 2CLZA 4RRPG 2ZCHL 2VDKL 2QFPA 2C9SA 2KZWA 2J88H 4GKSB 1K3HA 1R3IH 4JRYE 4OCYL 4PIRF 4QI3A 4EJ1C 3FMGL 4Y5YC 5D71L 4IBVA 5C3TA 1RFDL 3UTSB 5JA8B 2VRKA 1FLTX 4FHJA 5FUZL 3QIWB 3HG4A 4B9GA 5JQHC 2JB5H 1ZHBB 5I66B 1U21A 3NSFA 3KXFD 3DWTA 3LN4B 4AAMA 4Q4IA 5CGYD 5GGVL 4OZIE 3BZ5A 3HUJB 2NR6D 4MXVE 4IKKA 3RZWA 2WYIA 3FU5A 2DKMA 4MB1A 2EO9A 4FQ2H 3IS0X 3ZDWA 4QYOB 2CGZA 3O81A 1T7YA 2C4FU 5I28A 4AKPA 4NN5C 4KRMB 3GHBH 2APXA 3SD5A 1UB5A 1ZHLA 3L45A 1RL1A 1FJ1B 1DVYA 1O7VA 2R9HC 4JFPB 1UH3A 3CN0A 4NUPA 1KJ2B 2BZDA 1OLZA 3FW6A 2BP8B 1WH0A 4L8BB 4BCZA 1GGCL 2FL5A 2WTRB 3J27A 3L8QA 4XNBA 2O30A 4PJ5A 3LVTA 3W9EA 1XMWA 1LEIA 2BY3A 2PCFA 3B7UX 5D93C 1JDAA 3ARFA 3E9TA 3MRIA 4NM4L 2DQJL 3FONB 1MDAA 4LLMB 4JZOB 4ZW3A 1DJZA 5EO9B 5LN4A 4YHNA 4GRWF 1H8OA 3I50H 2WLHA 2EACA 3AITA 4J3OG 4NZDA 5FYKU 4XNDA 1DW1A 1KYDA 3MXVL 1TJHH 2B16A 4H25B 1JDCA 4FFWC 3ZT6A 1RZ7H 5I1GH 4WQBA 4RCAA 4PG2A 3W37A 1RZKL 2A9MH 4KX8A 5L0QC 1I31A 1NEUA 4NNXA 4PJ5D 4LSSH 4XNUL 4M7ZC 3OPUA 3ARFD 2X4SA 2Y7SA 4YDLB 4QXTB 1IGTA 3MLYH 4RSVA 1BD2E 3T0VA 1E5AA 3GSQB 4KKBD 1M05A 2QV2A 3U7AA 1KC5L 5HDBE 3WGVB 4OZGE 2YAPA 1I5TA 3QZWG 2XG4A 5B1AB 1D6EA 1EZVY 3E38A 1OTTC 4ONGH 1NKOA 4IJ3B 2NY1C 2XX1A 1R5IA 1RUMH 2NTFA 1C6OA 3FK3A 5D7LB 5EV7A 4F9PC 1MRCH 3RA7L 3SODB 4M61B 1N19A 4K71C 1U41A 2IH1B 4LSQL 4X0NA 3EJZC 2FR4B 2W9LA 3NP4A 5JW4M 2V6HA 2G4EA 5FGBC 4ANWA 1RXLA 2A0LC 2B39A 2VXTH 1XXDC 1DT1A 1ZWIB 5E00B 2GEQA 4M1GL 2Q2EB 4TNWF 4GAFB 2QPFA 5KYYB 1ACCA 3BXNB 3I9IA 2EIEA 2Y69B 2N9JA 3RWCA 1BYOA 4NQDE 5I71B 4L3CA 4PJIA 4EMZA 2YLKA 3O4LB 4NGHL 1D7BA 1UKQA 4M7LT 3AGVA 5E95B 4MTMA 4AMXA 1J0IA 2KZBA 1ZLWH 5HYQB 4PJ7E 1UKTA 4JKWA 1ZVYA 1J8KA 3MUHL 3IDIA 1F8TH 1JYVA 3U2SA 1PSKH 2BSCA 4H26B 1XF3B 1PQZA 1HH6A 4J3OF 3G6JB 2F1EA 4X8JA 5F8RC 3Q05A 4QT5A 2HCZX 3ULVL 3JV5A 3PGFH 4KNTA 2QQKL 5E2WL 2BIQA 1UOLA 1E9PA 1D3CA 4PCSA 4FQLH 4P2OC 5DEFA 5D7KE 4YOKA 3GMQB 1UH2A 1DZ0A 1KZQA 1MHCA 5D7IA 3UJTL 1I1AC 2XRAH 3CVHA 5D6CA 3ZGHA 4ALAL 5IB1B 1Q9WA 2PABA 3KHOA 3UZVA 1AI1H 1OARL 2WK2A 1CRHA 1HQRB 5J57B 3G3LA 5GS2H 1IBGH 2D3NA 1DTUA 2G2RB 1JZJA 1FZOB 1URLA 5CD3A 4JY4B 4NN7B 2X4NB 4FJ6A 2CIIA 1UM6H 4LAQH 3JUYA 3ROLA 1Q9KA 2HH0L 4L8CA 1ZSHA 2WWOA 5HI5D 1OE3A 1PLAA 1JZGA 2PWFA 3J7HA 4DP6X 4I0PC 4P5TC 3WIHH 3FPXA 5IFHH 1P84J 4KZCA 4QRSB 1EHLH 2ENJA 1WICA 4JKMA 3QRGL 3SYQA 2W38A 3C60B 3CFTA 4YN3A 4DO4A 1FDLH 3S36H 2BVQB 2WZ6A 2D7PA 2QPDB 3SDYH 4L23A 2F8OA 1DSYA 4WY7H 2ERJC 1JRHL 3FO2A 1K6QL 2YO3A 4QXUH 2IWFA 3WNKA 5HD8C 2VDPB 4BH8B 2EXVA 1Q0YH 4Z7QE 2GBVA 3Q6GH 4E9WA 3DX0A 1NFDB 4XHQA 5B8CA 4OT1H 3X12B 3VXRB 1SOSA 2APFA 3GQFA 2MQGA 3GSRA 3T0EC 3GLAA 3MRPB 2Y6SD 1ASPA 1OQOA 1G1KA 1Y18A 3NFSL 3KPSE 4D3CH 1QRNB 1TU2B 3QA3B 2FGWH 4AGOA 1RZGB 5I0YA 3ISRA 3D12B 4LU5H 1OT1A 4I77L 1T1WA 3BMWA 4M56A 3P1VA 4X9IA 4KK6C 5DO8A 3BKJH 2PACA 4LHUA 5KTEL 3DX4A 4HAKA 3JVFC 1CE1H 2GVYA 1RCYA 1QPKA 3FO9A 4DO6A 5BJTA 3RKPA 1SGKA 3RWGA 1VPOL 4AYFA 4BZ1L 1CT8A 1PFCA 2VUKA 5EIQA 3RTQB 5T1LA 4HFWB 2LAGB 3SDCD 1LWHA 5JO5B 1K72A 3D4ZA 1LTXA 2GSMB 5DK3A 5DO2C 3S2AA 2NQCA 4NX0A 3SD2A 3BAJA 3GSXA 7CGTA 1KUMA 1USZA 4PMEA 5DI8B 4IGBB 1UXWA 4A37A 2WKOA 3SXTA 4LCWE 1P7KA 2VL4A 4N2MA 5DHXB 3ZR6A 3SPIA 3ZDZE 3HR5A 1HHJB 3P3TA 4KHXL 1IRWA 4Y5XA 3T71A 3CZSA 3PAUA 4IMLA 4LHUD 3T77B 5CBAB 2IOMA 4KXZI 1DVQA 4HWBH 3BVXA 2YIHA 2EO7A 4HLZG 1EIBA 4F27A 3KCWA 1RUQH 3B5GA 5HHPB 3G6AB 5T1LD 2Q3ZA 4TN9A 1YEHH 5HHMB 2B4CH 5DZOA 3DPBA 1KYOD 4TQPA 5J1AB 4E5XG 1TEFA 4WU7A 3MTXA 4ZUSB 4GG6F 3FCBA 2VQ1B 5F0MB 1MHHA 2ATKB 3QIBA 1LFMA 4AYMC 2GFBA 2YMOA 4Y4FA 2VLME 1JG9A 3AXLB 1UD4A 3OQ3B 4UNVA 1PG7H 3D51A 4EN3A 5BW7C 2LITA 2EYSB 2AV7B 5ESQB 5EUOE 1GMEA 4AIOA 1IILE 4QRTB 4ZFZA 1BIIA 4OJDH 3ARVA 1CEDA 2YOCA 3MV7A 3EH5B 4HK0A 2AKRA 3LSOB 4NHCH 5ESVB 3MLUH 1QNIA 2Y5QA 4IU3A 3SDDA 1JV2B 1IBDA 4LGPB 1GGBL 3QIBD 4LLAA 5E2VH 2WIIB 1ADQL 4Y4FD 5GGSY 3X13A 3HKFA 5ACZA 2EVIA 4J20A 1GGIH 1MLCA 1WAEA 3BH4A 3KH4A 3EJCA 5DD6A 3BUBA 3S88H 3Q7JA 3NFNA 2E7DA 3TO2B 3MDJA 5IEHB 1MRFL 2IPUG 4EN3D 5HPMA 5TGBB 2HX8A 1AY1L 4F2EA 1FGVL 451CA 1YAZA 2B4ZA 1S9WB 4MJ5A 3MV7D 5DMGC 3ZDXF 2DQIL 3PJSB 5EC2A 2AEPH 4PLJD 1N0XL 5GGVY 2ZSVB 3SDDD 4GQRA 4WTWA 2EP6A 1XCWA 2B3IA 2LQRA 1M60A 1UM4H 4PJGB 1UENA 1KCKA 5BUAA 2KT6A 3UTTE 1A8CA 1E4WL 3TYFB 3ZOXA 5CIFB 1U58B 3MRQB 3UO1L 2DLGA 3HG3A 2HUHA 3WFEL 1Y0LA 4I9XA 4YDVB 3WXVH 3JWDL 4X83A 2F08A 2IG2H 1EV2E 4ZFQA 4BINA 4ADIA 3E80A 3FC8A 1J11A 4FQCL 3CZFA 5KS9A 1OOWA 1QR1B 3KPQB 4S2SA 3WUWB 4L8SC 5F7FA 2UX7A 4K5NA 2Z3FA 4K94H 2GTWB 1LDPH 1BBDH 2W9DL 2FNBA 2P8LB 3M07A 1DP0A 3NMEA 4KK5D 1NMAH 1H6FA 1CDGA 3IJ9A 1E9OB 1T66D 1JGEA 3KYOA 3OG4B 4N2IA 4X4MA 2NCMA 4F15B 2MHAB 4JLRB 1KB5A 4GMTL 3TURA 3LQAC 3KNBB 4GG8A 1F6AA 2FX8L 4CBPA 4P46B 4PP1D 4PJXF 5LUMA 1B2WL 2VCOA 2JKSA 4OF3A 4IOSA 4DKEH 3VD9A 3CD4A 4PV9B 3JV4B 2VXSH 3CV5A 2W80C 3L72D 1P5VA 2YXMA 3I74A 2EXYD 4RNRB 3S34L 4X99B 3VQ1C 3OR7B 4X98A 2EUZA 1JHLL 5MHSD 4EIDA 4KKNA 3O3BA 3R8QA 2XVLA 2VITA 2HB0A 1TTAA 2YD5A 3VXPB 2IPKA 4W9CC 2O6CA 3GXPA 2WPGA 4JM4H 3OAZH 3U7YL 1DUZA 1YAIA 3DX7A 1TMQA 3GLEA 2VSMB 4HPYL 4IOSD 2IBZD 2VNCA 4WSKA 4XPTH 2HVKA 1E2ZA 2J73A 1SJXA 2IPTH 5F9JB 3SGJC 1A7NH 3HG1A 3FRUA 4YSSA 1R5WB 4JRLA 3CFCL 1NLBL 4XCFH 4XPAL 1HIML 1KIUB 1C2NA 3KZIV 2ZOKB 4I9WE 4KXBA 2VMFA 5FF6A 2B08A 4OGYH 6CGTA 4PS7A 1WFMA 3VI4F 4OLWL 1MI5E 1AS8A 5AAWC 2CE1A 3FTXA 5B5EV 3MNWB 1MVUB 4WI0B 1WZAA 5D1QB 3L17A 3ORVA 4FDWA 4FG4A 3VXNB 4I48B 1DO5A 1AGFB 2EIKB 3BAKA 2X4PA 3HZKA 3QDGE 4HIEB 5INDA 3ZE2B 1TVDA 1TYEB 1N8ZA 3H4HA 2FSDA 3HG1D 4RBPK 4ZW5A 2WQVA 5GZNA 1CIDA 2YPLA 2JELH 3PREA 4XX5A 4P3DB 1IKNC 3VXME 5JHLL 1UJ3A 2LV4A 3HNVH 1NCCH 3NJNA 4OZFB 2FX9L 4PTUB 2WSPA 2UZYB 5KOMC 3HPJB 3LIZL 5L8JB 3TWCL 1AQKH 2Y5TA 1YDPA 4EZMA 1TIUA 4S1RL 3EH1A 2L04A 3H1ID 3AXHA 2WZPA 2ICEB 3GSUA 1CCZA 3VW3H 1OHZA 1I1FA 5D7HA 1PW3A 2P48B 2HP4A 2P5WA 5DHMC 1A7BA 1CC5A 3EYFB 4FX5A 1XGRB 1XH2A 5GZND 2YPLD 3IGFA 4ANVA 1HHGB 1SY6H 3O6LL 2HTLD 2R2HA 1JP5A 3M7FB 3ES6B 2Y07L 1QTPA 5AOLA 2PLTA 4LHJB 3ZE1E 4JFQA 4UNTA 2ADFH 4WV1C 5F6HI 3U30C 2FH8A 1BF2A 3P0YL 2P5ED 3I3EA 2ZX8A 3VSUA 2Z4QB 4AC4A 1Y6MR 2XV3A 3VFPB 2AV1A 3BPCA 4FQJL 2WZPD 1ZVSA 5I6KA 4JG5A 4OQTA 1TTFA 2ID5A 2CCWA 1HEHC 4FYTA 1A0QL 2P5WD 3HS0C 4E42A 4XMTA 4KJWC 2VC2B 2X41A 2P44B 4F7EA 4DP0X 3FF7A 2DAVA 3ZPDA 1FIEA 2DJMA 4U1MB 2G5BA 3BP6B 1XR8A 1BP3B 3LN9A 3ZX1A 2MKWA 4XHJC 1VACB 4L9LA 3CH1A 5SWZB 4EAEA 2R29H 4Y9FA 2CRIA 2OI9C 2XPGA 2R56H 4GAAA 4JQIL 1K9TA 3L5WB 4ADGA 1ZK5A 1RI8A 5EA0L 2X1WL 3D2UB 5IMKA 1BA9A 5CBEB 5GIRB 1OK8A 2JXMA 2R4SL 3QJFA 4NRXB 1NGXA 3DVFA 4U0QB 2NSMA 4MJ4A 5FW6A 3EFOB 5AKRA 5I6NA 1GCYA 4UM9A 5F89A 2J44A 4ENED 3AZUA 4P9HH 1TCRA 5C0EA 2ZWSA 2JKWA 1WWAX 1SDDA 1NBYA 1ZLDA 4ONFH 4IKLA 3POCA 3VGHA 2A2QT 3O3DA 2J6EA 3LRKA 1HKLL 3F12A 3ZTNH 3CVCA 2F5AH 4Z7NF 1JK9B 3QC6X 3QXAB 3BHBA 3KL5A 2X9XA 4NQXA 4BA8A 4L1DA 2F7OA 1DEEB 3QC5X 4M4RB 5DD1H 1BFOA 3FCGA 3RVVD 3CFMA 5DRXB 2B2XL 3RIAK 1I8UA 1QLRA 4KROC 5KYUA 4ZK8A 2EVFA 1JRHI 1AGBB 2BZCA 2EE6A 2LVCA 3B7RL 4YHPA 5TPWL 2V3FA 3AQDA 4UM9D 1ZXKA 5A2LH 2C26A 5E1HB 3VI4E 5E2TL 2OK0H 5LXGH 5CJXC 5CU5A 3ECWA 3QEUB 3VXSE 2UZXA 1C5DA 3NPSC 4OFIA 5LNGA 5DEGB 3RY4A 5BVPH 4ODBD 4UT9A 2XFXA 1S7QB 4MXWL 1QKSA 3QJTB 4PREA 3TONA 3TBWB 1MPAH 1UZGA 1B88A 4P48A 4UTBA 3ZO0A 2C9UA 2H8PB 3UERA 2ZCHH 2B15A 1AYGA 1WPCA 3H85A 3WDJA 2W59A 3FMGH 3PXWA 2LLNA 2XYBA 5D71H 3WKNA 1TCMA 4F1SA 4HLEA 1P7BA 3CNKA 3SDXF 3BOVA 1DLHB 5FUOH 5DJCB 5MERB 5E6ID 4RGMC 1YY9D 5GGVH 4HZ1A 2YPVA 4LOUD 4XOEA 3I02B 2E6PA 2RH0A 1FFPA 1QEWB 1DQLL 4JFYB 4NHUB 5IJBC 1GSMA 4GIOA 1AO7E 4IEFA 4Y1SA 1FPTL 4HKZA 3SKNB 3UIYA 4J5VA 4BGDA 1O6TA 3BT0A 5FDWA 4JO4H 5F7BA 3MV8A 2ICWB 4FS0A 4WHDA 3S2CA 4TLTA 1G7MB 2WB1A 2Z7UA 4X4XA 1HS6A 2BXYA 4PG9A 5GSRA 4B5EA 1KIRA 2JI1A 2NNXA 3HI5H 5FO8A 4A04A 3UCRA 5EU6B 3OD3A 5SWQA 3L4OA 5C7ZA 4XB8A 2WWKO 2D9QB 3KWWB 5K5YA 5DHYA 4NM4H 4RMRA 3ULSB 4LDCA 3GSWA 4O51B 3WOVA 3K71A 3W57A 4X9GA 1SMDA 3BFQG 4NNYB 5IVNA 1H3WM 3CFJA 2EE3A 3CU1A 3MR9A 4PRAB 3ECBB 2C1OB 3MXVH 4YAQB 1HNGA 3QAQA 3MV8D 3EG9A 4OD3L 4Y2NA 3VDAA 5C0FB 1CN4A 1JHTB 1O0VA 4YBHA 1JVOA 1QSVA 3V6OA 4DESA 3GUTB 1MIEL 4ZUVB 3FT2B 3QZOA 1R3HA 1L0ND 5DQDH 3H7LA 3UJJL 3IS1X 1MAMH 3GB7B 2H6PB 1XL6A 4MNQB 4P2QB 3RX9A 3Q2LA 3MRGA 4ISVA 1RIUH 2GSGA 4XNUH 3SE4C 2YEVB 3D30A 2IANA 5IWLC 4B27A 3D0AA 5GSVB 3KM2A 4LZKA 1AGEA 4GB9A 1GZQB 4ZX5A 4MJIA 2YRZA 2J56A 1SBBA 2IV8A 2NY5L 2C1PB 1UCBL 2XXMB 1FFOA 1T7XA 1NOFA 1S7SB 5CIBB 4UM8B 4RBPH 2G3MA 3RA7H 3AC0A 3EYVB 3PNWA 1PEZA 2AK4E 5JQIB 4BUQA 1ZLUK 3HC4H 1KIPA 4LSQH 5BZWA 4XO4A 1FAKT 5FA3A 3SO3C 1XCTB 2OPCA 2IAND 5G4OA 3ATEA 5I1CL 5ENWB 4CDGC 3CFDA 2GBAA 3PE9A 1HH9B 4G9DB 5C0GA 3QUYC 3HE6B 4N22A 4M1GH 3CZGA 2BS71 4MJID 4J6RL 1QSFA 3W9DB 5CGTA 5FO7A 1HWGB 1IC5L 1R0AH 4EZJA 5LLIC 1RULL 2RFXB 4QRRD 2XFGB 1P4UA 3NCXA 4NGHH 1ORSA 1KX7A 4PB0L 2LFEA 3BP4A 5HYEA 3MNMA 3AT8A 3RJOA 5DJ0A 4N5ED 1YECH 1F41A 1H15A 1YZZA 3DPDA 2ITEA 2ZUVA 4M00A 2YKLL 4B3EA 4PJHE 4BQ9A 2CHDA 4JHZA 4OSUL 3KXFE 1EZSA 2PWEA 1PIGA 4Y19A 1TO5A 2JTIB 3V0DA 4A2GA 1BZ9B 5FS5A 2BIMA 5I1DA 1X5MA 3ULVH 3M97X 1M7IA 1NIRA 1QSFD 2QQKH 3DX3A 3L16A 3LXCA 3MVSA 3M17A 5E2WH 1HJBC 1FQ9C 1JNJA 1I53A 2YIUB 4H1LG 4M3KB 1KB9D 3VWJC 4XBGA 3VTMA 2OZNA 2D31A 2XC8A 3ZKXB 3QUZC 4U1LB 5I0WA 1OARH 1TJXA 1KCLA 1JPTL 4PWHA 3TV8A 4HC1L 5ITFB 4I0KA 3LEYL 4YO0A 3BLPX 5FX3A 5JOFB 3AU1A 5KSAB 4JKNA 4OZ4A 4Y19D 2ZUYA 3B7SA 1DVFA 4IU2A 3UG4A 1P4IH 1RZJL 1NANH 1QYGH 1U6AL 2GC7D 3DMMA 1CFNB 1H6UA 3BVNA 4UDTB 3TEYA 4KGLA 4N0FB 5KLVD 4KJYA 4OV6F 4W81A 4DGYH 1UXSA 4P57B 3QRGH 5F97E 4ZBJA 3VFTB 3PWLA 4JAMA 3O3AB 3WENA 4ENZA 3VNZA 4YX2L 5IQ7L 3HRPA 3E8VA 1BZOA 1JRHH 3P4MB 3R18A 4IOFC 4L05A 3NCFB 1K6QH 3T8MA 4MCZA 4PJ5E 1J9SA 2KZ1B 4IIQC 3FT4B 1QP1A 3V4PB 1LHZA 4ZO7A 3UGXA 5I8KL 1IVTA 1DVFD 3K80A 4Q6IB 1HCVA 4TQEL 1HXMA 3DMMD 1C08B 2D4FA 2C9XB 4GP8B 3G7TA 2OMZA 1J8HA 4HH8A 4HV8B 1OCDA 3NFSH 2XN9B 4F5CA 5IVXA 2C3HA 1MWAB 4KV5E 3BEVB 4JDEA 1TLKA 3WNJA 1JTPA 3QGVA 1X6LA 4I77H 1SQVD 2CR3A 1BVZA 4UQ2A 3VFOA 4PVBA 4PY8J 4LSRL 2TRHA 1VPOH 4BZ1H 1RSYA 2C7FA 1AGCA 4RAVA 3TBCA 3WY3A 4CADA 4KVCL 3ZXAC 4JG0L 4QHMA 1KGYE 5IB5A 2A4CA 3WHE0 1AVAA 2DI7A 1J8HD 2R7EA 3BGFC 4KH9A 4I85A 1AZBA 2EILB 5A2KH 1T5XA 2MCAA 3IMVA 1NA8A 2QTVA 5H37A 1NCHA 3WTWA 1FNFA 4KHXH 3QR1A 3OPZL 4O02B 1IGYA 1DQTA 1QFWL 1H3XA 1F4YL 3HMWL 5JYLA 1OSPL 1A14L 1JXJA 1P5UA 3WIHA 1E9QB 5DMKA 3BGMB 1S9VB 3RIFK 3WKQA 4MS8C 3T4AB 1CSXA 3ETBF 1ZZHA 4GO9A 4HU8A 5C2BL 4L1LA 4G6JH 3ZLQC 4MLSA 4FLHA 1U74B 3CHXA 1JXFA 4YHLL 5AOKA 3DTXA 1LYQA 4OD2B 5GS2D 1OM3H 1LD9B 1WBXA 4Z7VA 1DDTA 3GSNH 2YMXL 4PJIE 1DSFL 3N04A 5I76A 5IMMA 2PTVA 2Y3NA 4UTAA 5LB1A 3GSOA 3QFJB 2JF1A 3FQNA 2HLAB 4Y4KA 3OB0K 2HRPL 4FLOA 4N86A 2AEOA 2A5UA 3HLAB 4LVEA 5ICZA 2FT8A 3GLZA 3V7AE 1XGPA 4ZUWB 3LZFH 3P30L 4PD4D 1BM7A 4MJHA 4PV1C 2C7UB 1HU8A 3SQBA 5GZOA 4WI6A 2V07A 1QA9A 1KZYA 3ZHDA 4IRSA 3SVWA 1VLXA 3O41B 4Z78A 2IC2A 4KY1L 4A2DA 1Z0MA 1OAZL 4G6FB 3FULA 5JDJA 1ROCA 2Y2WA 4AW4A 4G43A 3E6FA 1HE7A 5D7IE 3N9GL 3WS3A 1FO0L 2YXWA 4G7YL 4I87A 3WI9A 4PGDB 1DN0A 1GGBH 4PP1C 4B6ZA 3F7YA 5CS7A 5CMAA 4G83A 4F7MA 4Y4KD 4V1DB 4WW2B 1ADQH 3CVIL 4JR9L 5EIIB 1M57B 3CQFA 3QNFA 1BF5A 1U91B 1MFUA 1MAKA 2ALWA 2FBOJ 4UBDD 4LCYA 2PO6A 2CDEB 3MN8A 4E68A 1MRFH 5TK2A 43C9A 2KDYA 2WN3A 4GSUA 1HSAB 4U1KA 5GZOD 1NGPH 4IRSD 4PP2A 4GXUN 5C8JB 4KRPD 3LH9A 5BRPA 1PF3A 1G9MC 3OHMB 1N0XH 1AQHA 1KYUA 4HWBA 1RAMA 1O9VA 3H56A 3ILQC 1ZVHA 2YAMA 4JVPA 1TZAA 4HUNB 1NFDF 2F5BL 1E4WH 3UO1H 5ES4B 4UINL 3WFEH 4HPOL 3QUXC 2W88A 1MLBB 3T6XA 4LDOB 3JWDH 4BCYA 3TEZA 2O5ZH 2PO6D 1BCIA 1W72B 3D18A 2A74B 4G80B 1KENL 3G5VB 1CXIA 3NIGB 4HWEL 4HKBB 3MXWL 5C0DB 4FQCH 2L7JA 4FMFA 1ZHNA 4X7SL 4B96A 1G7PA 1KLGA 5D1XB 2DJUA 5J6GB 5E08L 4FXGC 4Z76B 1I8AA 5EPMB 1N15A 3SPCA 1LC1A 1TFHA 2PWDA 2W9DH 3HVNA 1ETJA 1IO3A 5F9WC 1L4IA 3O2DL 5AG8A 1YN6A 2FYYB 4ZX6A 3FQTA 4NJAL 2HX9A 3QG6B 3FO0L 2VDQH 4HUWA 2NY0B 5HHVL 4GMTH 3QORA 4Q9QH 3OWEA 2FX8H 3IVKB 5F21B 1X5YA 4X6EA 4FQXB 1RPQA 4HS8H 1HCFX 1KWKA 1P69B 1OCRB 3DVGB 1KIQB 3F85A 3FSOA 4MB3A 3VH8A 1NIEA 4YDKL 1I8IB 1IEAB 3KGTA 4ODVL 3NK4A 3BDYL 1JHLH 1VGEH 2RACA 1UH4A 1O7SA 4G6KL 5CIEB 1M3JA 2FUQA 1PAZA 4UF7C 3UPRA 2HVJA 2VDRB 4APQB 3N5AA 3LN5A 5JYMA 5KBKA 3CZLA 3QORD 1I6EA 2EECA 4DAGL 3MGTA 3ZIMA 1OTSC 1WS8A 5IT2L 1UJ3C 4HPYH 1PP9D 1QYZA 4AW7A 3PFQA 3C5XA 3WUWG 2A1WL 4JX0A 2L4DA 1SOQA 1AOHA 1D7CA 4L3ED 3UMNA 4FERA 5IF0B 4N4YB 4G8FB 1NLBH 2OULB 2WN2A 1T2XA 1HIMH 4FNSA 4AYID 4ZMZA 2PPCA 5FW7A 5I6XC 2V7NB 2QZQA 3FFCA 3I75A 2MJWA 4BWTA 1J1XL 4L4JA 1FNEA 2FEJA 4OLWH 5C3IA 1GU2A 1YQVH 4PTTA 5I6LA 1LE9B 1IFHL 1NOLA 1GY1A 3KYNB 2F53A 5B7MA 2UXTA 2OFQA 3FU3A 2VJXA 1C1EL 3QEGL 2Y1AA 3RAJL 3IE9A 4EZKA 3TH3T 2QTEA 1UOVA 2B59B 3ARGA 3OA8A 5I75B 2R0LL 3WTVA 2OMUB 3CQPA 3CBJB 5JHLH 1GGTA 3MV7E 2OMBA 3D3VB 2FX9H 1R24A 2KLTA 3FFCD 3LIZH 5IVZB 5JIIA 1T7WA 3X17A 1SXSA 3TWCH 2EC8A 4P06A 3HI1A 1IBFA 4UDUA 2CALA 4DZ8B 4S1RH 1KXQA 3WO4B 5JW5A 1U75B 2F53D 4XPGL 1SXAA 5T1DL 4J12A 4L9LC 1UD6A 2MQCA 2ZOUA 4Y1AA 4XCEA 4NPYB 4PJGF 4ZS7H 4Z0XB 1M7DB 3ARGD 3RVUD 4K4KA 4CSPA 1HESA 1ILSA 1MIMH 1JPGB 4XT1C 4FNRA 1B0WA 2XWDA 3IE4A 3IGAA 5I8OH 2Y07H 1EX0A 4U7MA 3MLPA 3P3SA 3C8HA 3CX5K 4LLUB 1CS6A 3AAZA 3JWNH 4QF1B 4XC1L 3KLAB 3P0YH 4MD4B 4KFZC 5L7XL 4GP4B 1I8LA 3PDOB 3LH2L 4ODWB 3WNNA 3MJ8A 1G7QA 5DMJB 2YEQA 3T1WA 4IYKA 4Y1AD 4JPSA 5LWYL 3VGAC 4G8EB 2BMKB 2PTTB 4FG6D 2A6IB 4JJ5B 2WINB 5KS9E 2WWMD 4NI6A 4OZFG 4YH6A 4NZRL 1F1AA 1VFAB 4P23C 1NC2A 2WSDA 5DHDA 1M9WA 3PWUB 4OJAA 4DN4L 3B2DC 4TS6A 3CBRA 3QXUA 2QMKA 1A9BB 4MMZA 3AS1A 5GS3A 5J13B 4JQIH 1OD7A 5MHSE 3RRQA 3OB0H 1A3RL 3F5WB 1HILA 2W9EL 2XHNA 5BXFA 1CBVH 4R7XA 2R4SH 2DD8L 3TBYB 4XC3L 1I7RB 1W2KT 3ARTA 4X7EC 1D7DA 3IMSA 3RQ3A 4GRLA 2GIYA 3CPUA 8FABB 4UQCA 2YMTA 3NIFE 3BN3B 2V5TA 1ZHKB 1YNKL 3O2VH 1NC2D 5I8CB 5LDUA 4YE1A 4G6AD 4G8GA 3OJDA 1LDSA 2CBPA 2VDKB 2WYTA 5GGSB 3OKLA 5IBUG 3MRFA 5A2BA 3ATAA 1SNRA 4FNLL 4XRCA 5DUMH 4O2CB 5KAFV 3WEAA 3QG7H 4P4KA 5C0RH 3DUUB 3FQ1A 4TF4A 2OL3L 4UOQA 3TC9A 4Y16B 5EU4B 1AACA 1HAUA 3G08A 1SY6A 2EXSA 2B2XH 3X14A 5ID1A 3IB4A 4EF3A 3FQ4A 4U6XB