3ZIYA

Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.01 a resolution
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
457
structure length
457
Chain Sequence
KLPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKMPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRAQPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 131
structure length 457
sequence length 457
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3ziyA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ziyA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ziyA02
1M9WA 4HZ1A 4WQ9A 4MFHA 1HJ5A 1NMIA 1AACA 2C2CA 4GXFA 4BXSV 1IQCA 2FT8A 1NU1D 4YL4A 5GTIV 2AVFA 1XB3A 4FA9A 3FSWA 4E9QA 1CYIA 2HRHA 1AYGA 2CA4B 4A2HA 3KW8A 3SVWA 3CYTI 2GC4C 3BVDB 1TEFA 3RN0A 3ABKB 4WQ8A 2B08A 2BH4X 4BK5C 2VMJA 1NICA 2PPCA 2YAQA 1FI9A 4JHUA 3S8FB 2CA3B 5IY5B 2IH8A 1AZUA 1CYXA 4O1QA 1CYCA 1E67A 2BPBB 3CXHW 2IAAC 2DV6A 3DIVA 3T6XA 1HROA 3H4HA 2QJPB 3NSFA 1IKOP 1HCMA 1GS7A 1N50A 1ZRTD 4N4YB 4V2KA 3IN0A 3QJQB 4YSQA 2TSAA 1GSKA 1NTKD 3H1ID 3N2JA 1M57B 1GS8A 2BP0A 2BW4A 1CRYA 4GYBA 1OCCB 2NRDA 1A8CA 2BHFA 3FQ1A 4UF7C 3UAEA 451CA 4YSDA 4RH4A 2GB8B 1H32A 1BL9A 3CXHD 3L4OA 3TYIA 2FQGA 2VN3A 1KDIA 3FSZA 2L4DA 1EZVD 5H2FV 3PCYA 3PLYA 2ZXYA 3SWSA 1GYCA 3PXSA 2VM3A 3TASA 7PCYA 1WA0X 1C2RA 1CHIA 1C2NA 3L73D 1C6SA 1I6EA 2QPDB 3SJLA 1K3GA 5B1KA 5I26A 1NIDA 1HZUA 4XXLA 1X9RA 1GDVA 1J9TA 3M97X 2DY2A 1A4BA 3WUIA 1C7MA 4DP9X 1ZDQA 2BO0A 1DT1A 1HJ3A 1TEGA 3NJMA 1PPJD 1BXUA 2CJ3A 1L9PA 1OE1A 1OCDA 2E86A 2V07A 3NP3A 1PLAA 1WEJF 2YXVA 3AY2A 1KCWA 1MG3C 1YFCA 3C2CA 1GIWA 2PCYA 2BCCD 2N0MA 2PLTA 4WTQA 5EXQA 4EIFA 1CEDA 3AG2B 1CRIA 5I5JA 4FB1A 1FA4A 1F1FA 2QJYB 1BXAA 1VYDA 5DJQB 3O1YA 3H1JD 3IE9A 3TGUD 2V08A 2VHDA 4PJ0V 2XV3A 3UGEA 3MX0B 2N9JA 155CA 3T6ZA 1I8OA 1KB0A 4NERA 4E9VA 3PPSA 2BP0B 4GYDA 2QJKB 1SF5A 2XX0A 4WQDA 5D4IA 1NZRA 3T9WA 2CAKA 4BWUA 1EB7A 4YSAA 4CSZA 5I5MA 1ILUA 1WA2X 2PPFA 4GP5B 1CSWA 1S6VB 4QKTA 3WG7B 2OJ1A 1AS8A 1RZPA 4FA7B 3CDZA 1OOWA 3GYRA 1WS7A 1OF0A 5IY51 1URIA 5DF5A 1CSUA 1CIGA 2HRGA 2CBPA 1ETPA 2UXTA 5LDUA 3TA4D 4DP8X 4E9SA 1CUOA 4G7RB 1RZQA 4Q5PA 1NPJA 3JT2A 5GTHV 5TISV 2OCCB 1MG3D 1V55B 2QT6A 1CYWA 1BGYD 1JZJA 1NWPA 4KNTA 1AZBA 1CNOA 2HX8A 2XTSB 1OV8A 2OZ1B 1A2SA 1M6ZA 3MBWB 1CORA 4AZUA 4CSPA 4F7KA 1L9SA 1MG2D 3DR0A 4E9RA 3BQVA 2ORLA 1BXVA 3SQRA 2P80A 2FQFA 1CIHA 3FYEB 1ZZHA 1DIQC 1H33A 1W8EA 1AOQA 3IBOA 2PP9A 2AZAA 5B6QA 2P80D 1M70A 5AKRA 5B66V 1DW1A 3TU6A 1BCCD 2CUAA 4HCGA 1CURA 4AALA 3O20A 5KAIV 3WU2V 3OMNB 1CXCA 3SLEA 5PCYA 1R0QA 1BQRA 1NIFA 2BWDA 1T5KA 4M3HA 1KBVA 4DP7X 2MHMA 4G7QB 8PAZA 3QJRB 3FU8A 3N55A 1M56B 1C6OA 5I6LA 3ZBMA 1W6WA 2N18C 2H3XC 6PCYA 1CTJA 1RAQA 2RACA 2FWLA 3C75A 1GR7A 4BDVA 2GIMA 3T71A 1ILSA 2XV0A 1PZBA 2Q9OA 4FAVA 1EHKB 1J5CA 1L0LD 2YAFA 2ZXWB 1U74B 1LFMA 2X88A 3NJLA 2MRYA 3WKPA 3AZUA 4U3FD 2PP7A 1WAEA 5B5EV 1WS8A 4P5SA 2EIJB 5I6MA 2WSDA 3ABGA 3EH4B 2WO3B 3CG8A 1DVHA 1N15A 1E5YA 3OMIB 2BZCA 5TK4A 1EZLA 1QKSA 5TK2A 3WFBC 2X87A 1KDJA 1NIBA 2UXFA 2PPAA 5PAZA 3RN1A 2HX7A 1HRCA 2YIUB 4A2FA 1PLBA 3CVCA 2GC7C 4EICA 3OCDB 5AURA 1MZ4A 2IDUA 2EIMB 2DYSB 1AZCA 4BXVA 4DP6X 1C6RA 1U75B 1MZYA 3S3BB 4F2FA 4FAAB 3ASOB 3DMIA 2HLEB 2JTIB 2UXGA 2ZONA 3HQ8A 2VSKB 2N18B 3CX5W 3NJHA 4Q89A 4GP8B 4WQEA 4WQBA 4AX3A 1AIZA 1AZRA 1YEBA 3GXUB 4A2GA 3CVBA 1KB9D 1JOIA 1ZDSA 3WFEC 2PPDA 3L75D 4P5RA 4K9JA 1JVOA 1NTDA 1E2RA 4KO5A 3H1LD 1E30A 4DPCX 1A56A 1CXAA 4EIDA 1GJQA 1JDLA 2IWKA 4JCGA 5I6PA 4FA4A 1FJ0A 3X1EA 3KZIV 3CX5D 2XXGA 3H56A 5CIEB 1P84D 1JZFA 1CSVA 2CCWA 4G71B 1KV9A 3L70D 3NJGA 3SBRA 4BWWA 3A9FA 1GU2A 1SJMA 1HJ4A 1L9QA 3HB3B 3IEAA 3BCCD 1AZNA 2I7SA 1YEAA 3ZOYA 1KX2A 3FT0A 1LS9A 1V10A 2XUWA 1I5TA 3OCDA 3X1GA 3QJSB 1RZ5A 5C9MA 5DFSA 1I53A 2XWZA 1NINA 4DP1X 1I6DA 1GW0A 2AXTV 2BGVX 1ID2A 4L1QA 2UX7A 4G72B 2IDSA 1H31B 2IWEA 3UAAA 2ZZS1 3O0RC 2JKWA 3NSDA 4YVNA 5I5IA 1L9JC 3OA8A 4GEDB 1OCZB 4KO7A 2CXBA 5B3SB 1OE2A 1SQPD 1YCCA 5B1JC 2FTAA 1OCOB 2B4ZA 2FYUD 2I8FA 2H47C 4YSSA 1BQ5A 2I85A 3DP5A 4QLWA 1CRCA 2N3BA 1PF3A 4KOCA 3NP4A 1NTZD 3WIAA 1CRGA 3CDZB 1N70A 1H9YA 4NFGB 1KV7A 1CYJA 2YAHA 3UACA 4YE1A 4UB6V 4Q8BA 1V54B 1FI7A 1ZIBA 2I7OA 3KW7A 1DZ0A 2XXFA 351CA 1OE3A 1AR1B 3WKQA 2Y1AA 4YSPA 2JFCA 1NIRA 1AAJA 2OV0A 2EILB 1PLCA 3WNIA 1NWOA 1FHBA 1BEXA 1XB6A 1J3SA 1KIBA 5CIHB 3S3DB 5I6KA 3VYMA 1J9RA 5EHFA 1HAWA 2IDTA 5D4HA 1H31A 1AANA 5I6NA 1BYOA 1DW0A 1GY2A 2PCBB 5B1BB 1OCRB 2BW5A 2Y69B 1AG0A 4K3IA 3VRDA 2BP8A 2FT7A 2B11B 2BH5X 1H32B 1JZHA 2XLLA 4HIPA 4TXVB 3X1FA 4A2DA 1CC5A 1LMSA 3X1BA 3O5CA 2CE0A 1SFHA 1SF3A 2HV4A 1CIFA 5KAFV 4YSRA 2FYNB 1JZIA 3HQ9A 2GBAA 4XYDB 1SNRA 3AG3B 4A2EA 4H0JA 5CYTR 4BWTA 1AS7A 1ASPA 1AG6A 4G70B 2GC4D 3RYMA 1K3HA 2FNWA 3ORVA 5A7EA 1SHXA 4NB7A 3NYKA 3OMAB 2A06D 2GIWA 2A3TA 3FQYA 2D0WA 3S3CB 5CIGB 1DIIC 2C1DB 1IBZA 2GB2A 4Y5RA 2J57A 1JXDA 3ZDWA 1FOCA 3ERXA 2N9IA 3V9EA 1CIEA 4DPBX 2VSMB 4YVUA 1GY1A 1SQVD 2C1UA 1KGYE 1FCDC 2IWFA 3NWVA 1HH7A 5CIDB 2TSBA 3NBTA 1ET7A 2FQDA 4X4KA 1YNRA 3L4MA 4YSUA 1I55A 2OZ1A 1PNDA 3WI9A 1MG2C 4ZK8A 4DP0X 2J5WA 2XX1A 3OA8B 2VM4A 1MDAA 3CP5A 1NIAA 4L3HA 3CWBD 1XMEB 2DVHA 5CIFB 5B7EA 1KYAA 4DP5X 1WVEC 1FI3A 1I54A 3HQ7A 1YTCA 1PAZA 3PAVA 1J9SA 5F7BA 2AIUA 2VW6A 1AQ8A 1F1CA 2DGEA 4DP4X 3WFDC 3ABLB 4AAOA 1IRWA 1YLBB 2IDFA 5E9NA 3NBSA 2C1DA 1GS6X 1B7VA 4IL6V 3A0BV 1E8EA 1IUZA 2B12B 2MTAC 5CICB 1CO6A 1PMYA 4J20A 1KCBA 1R1CA 2QDWA 2R7EA 4ENZA 2D0SA 3H4FA 6PAZA 1PCSA 4KNSA 1JXFA 3WFCC 1B3IA 1PNCA 2ZWNA 3NSYA 1L9BC 1H1OA 2B0ZB 4L3GA 1IC0A 2N3YA 1MZZA 3EH3B 4D6TD 4E9WA 5AFAA 1FFTB 4HHWA 3PAZA 4HAKA 4WQCA 1RAPA 1SQBD 4PWAA 4DY9A 1GKSA 4MU8A 3A0HV 1L9OA 1QNIA 2IDQA 2Q5BA 3FSAA 4HCIA 3V9CA 4PCYA 3L71D 4QAOA 1H9XA 2YK3A 1AS6A 5F7AA 3ZOXA 3PXTA 1UATA 4LJIA 5KKZB 2HZHA 2YAOA 1TKWA 3CVDA 3FQ2A 1RCYA 1X9UA 2YAEA 1JXGA 5DJQC 1CC3A 2JXMA 2PP8A 2FT6A 3EF4A 3OM3B 1NMLA 2VW7A 3RLMA 4YSOA 2DYRB 3QJTB 4AKOA 5B7FA 2GC7D 1KYOW 3JTBA 1E5ZA 3SBQA 2FRCA 4M4RB 3UABA 1AOFA 2XVBA 2CALA 2W8CA 1BE3D 3MK7B 2W88A 4A68A 4O1WA 1W5CT 3RMZA 4JKNA 1H33B 2AZUA 1N9CA 1DW2A 2HXAA 4DP2X 4HCFA 4N8UA 3NJJA 5KLIB 3NT0A 4W9ZA 5KLVD 1A4CA 2QPEB 1CCHA 1QYZA 3PXLA 9PCYA 3ZCFA 3L72D 3HEIB 4GP4B 1NDTA 1TU2A 2EINB 1DYZA 1JVLA 4G7SB 2LIRA 2FJSA 2JQRA 3AG4B 5I6OA 1IZL0 3FU7A 1CSXA 2WO2B 4E9XA 1N90A 3CU4A 2BP8B 1L9RA 4A66A 4AKQA 1ASOA 2ZOOA 3H1HD 2HX9A 3EH5B 4UANA 3SXTA 3FPYA 1YICA 2IH9A 3OQRA 1DW3A 1NIEA 1QLEB 2B3IA 1E29A 3ASNB 1ZIAA 4BDVB 1W6LA 3EHBB 5B1JA 1A3ZA 2GHZA 2J55A 1IO3A 4YSEA 2UXVA 4E9TA 4UB8V 1HZVA 4W1TA 3ABMB 2BWIA 1QN2A 1KYOD 3JBTB 1E65A 2XV2A 1GQ1A 2C9XB 2AFNA 3D12B 4A67A 1AOZA 4EIEA 5D4JA 1A8ZA 4FA1A 1L9TA 1CTZA 3ZIYA 1QL4A 4AAMA 1ET8A 1FWXA 3CZUB 4KO6A 1PZAA 2AI5A 1J5DA 1C52A 2EIKB 2H5UA 3L45A 3WC8A 2GI0A 3DTUB 1KX7A 1COTA 2C8SA 2LLNA 2MTAA 3DKHA 3IN2A 3U25A 4PD4D 3QJUB 4N0KA 1SDDA 5AZUA 2ZBOA 3PXWA 2BLFB 1HFUA 2YARA 1CTYA 4AANA 1XB8A 3PH2B 3L74D 2XU9A 2UX6A 3FSVA 3NSCA 3QQXA 1SDDB 5CIBB 2BZ7A 1CRHA 3X1NA 4EF3A 4F2EA 2J56A 1IBYA 1CHJA 2IBZD 1A4AA 3ZOWA 1PY0A 2AANA 4FANA 2PCFA 4E9YA 5I28A 1CRJA 1NNOA 1ET5A 1HAUA 3FU7B 1ETJA 1JZGA 1RKRA 3G5WA 4HHGA 4KO9A 3FU9A 1CHHA 4WQAA 3QPKA 1SQQD 1JZEA 2DWTA 2PCCB 1SFDA 2R7EB 1NPNA 3PAUA 4PAZA 1SQXD 1PZCA 4L0PB 1VLXA 3T6WA 4WQ7A 3WNJA 5B7MA 1C75A 4AKPA 1A65A 4NAJA 3FYIB 4RSZA 1YIQA 1ADWA 1N68A 2PPEA 4KNUA 1SHWA 4AI7A 2DWSA 3FPXA 4WKXA 1W2LA 3S8GB 3OD3A 5C0ZA 1QHQA 3SBPA 1WA1X 1L0ND 2CE1A 4P4QB 3H1KD 1BYPA 2EXVA 1ZPUA 3ZOOA 3NJNA 4HALA 3X39A 1KBWA 1IRVA 1NTMD 4YSTA 1M60A 1PP9D 3ZX1A 3NJIA 4UAHA 2YAPA 2BCNB 1F56A 3GDCA 2C1VA 7PAZA 2VW4A 2YCCA 2YQBA 2FWLB 1I8PA 2FQEA 2QDVA 2GSMB 2YAMA 3NJKA 5B1AB 2LITA 1ASQA 3HQ6A 3TBBA 3NJFA 2PACA 4YSCA 3UADA 3AW5A 3QJVB 1BAWA 4KMGA 1JERA 4GY4A 1S5LV 4DPAX 2XYBA 5E79V 1J9QA 2ZONG 3T6VA 3AG1B 3MK7C 4FA5A 1LC2A 1CCRA 1OAEA 4H0KA 3FS9A 4JHVA 5ANHA 1AKKA 1QL3A 1BQKA 2B10B 5FC9A 1LC1A 2YXWA 3TBCA 4KOBA 1ZV2A 4PW9B 3VNWA 1DVVA 1RZ6A 3X2QB
chains in the Genus database with same CATH superfamily
4Y7MA 4LHUB 1MCDA 4WQ9A 3P2DA 3TC9A 5EEYA 1DJIA 1NMIA 3FB8A 2C2CA 1DN0A 1N8ZA 1N5YH 4APQB 2KPWA 4PUBH 4YL4A 3UYRH 4F20A 3LIUA 3L4YA 4BFRA 1CGSL 3SKOA 3RWHB 5DTFB 5BZWB 3T3PF 3CHSA 3ZTDC 3SGDH 4ZAKB 4DTGH 2ED9A 4BFBD 5K9OB 3ET9F 4ZBJA 1EHLL 5E8EA 1H15A 3GHBH 3WNMA 3QYMA 3C87A 3POHA 4TLSA 3DSFH 5E6ZA 5LCVA 1CFVH 4AJVA 4GAFB 3Q44A 4V2KA 3IN0A 1A3LH 5F1NB 1SN2A 4LRIA 5FO8A 1X9QA 1NTKD 4U1MA 1FCGA 5AOZA 2XV6B 1M57B 2ITCA 1GS8A 2ZYHA 1O7DC 5DJCA 4CJ0A 2Z0UA 2X4OA 3FRUB 3Q1SL 3TV3H 451CA 1DZBA 1NCHA 4PJHB 4ACTA 2UVEA 4R2GB 1H32A 3IFOB 1IBHA 2ZCLL 3KJ4B 3PLYA 3TASA 4HPOH 4IU2B 4X7TB 7PCYA 3FN0H 3CE1A 1WCBB 3OKNB 1C2NA 2DQEH 1RUML 1XCXA 2VJ8A 3QIWC 4LLQA 1GDVA 5ID1B 2NW2B 2YBRA 1U91B 2BSEA 1WLHA 5JHMA 1DT1A 1OT1A 3II1A 3SQBB 1T5WB 4K7PY 2DKUA 4XX1E 2VUKA 5C0GA 1E3XA 1RZKH 4JFYA 4Z0BH 2N0MA 1IKNC 4KTDH 5EXQA 2V2XB 1GGBH 3MLZH 5DVMA 2Z31C 5E6IC 4JDVB 3STZB 2BJMH 1M6OB 1SXZA 4G80B 5JIPA 4IHOB 4CVWA 3TGUD 2ICEC 5L4IA 4ZYKB 2A77H 5I23A 2V2TB 3T6ZA 2O5XH 5ILTL 4E9VA 2VC2B 4WIQA 2BP0B 2EEDA 4GYDA 2GJRA 4IIZA 4WI4A 2AKRA 5B39G 5C6PB 5CEYA 4ONHA 2HLFD 1WA2X 3QDGA 4V2CB 1CSWA 3FFOA 3CH8A 2Z7ZA 1FC1A 1I1FB 3F62A 5CU9A 1UWGL 5HHOB 1ZJAA 4RAVB 4Y5YC 4B9ZA 4W9CC 5L4FA 3VFPB 1KXVA 2LOEA 4I3RH 5H37H 1UADC 2X4QA 2CU9A 5EC2A 4OCLC 1WAPA 2VDNB 3MRDB 3DV4A 4TN9A 5DJYB 4MXQC 3NFNB 3DR0A 3HG5A 4LRIC 4Q52A 2ORLA 1NCCH 1UCBH 2WXRA 1NOFA 4FXKC 5E95B 3SE4A 3IKCB 3GSOB 2F0CA 1NM4A 3FYEB 3KDPB 1ZZHA 1IB5A 4GIOA 3T77B 2NY1D 1DBJH 5B66V 4PBWD 3TU6A 1K72A 3HI1A 4AALA 5DZNA 5MP6L 3BOVA 4FMVA 3LKNA 1F6FB 1GZHC 1NL0L 3ZT5A 2WQ8A 1QA9A 2F1AA 2VERN 3MOBL 2F74A 4X9IA 1Q9OB 5AZ2L 3VFRA 1EEZA 2VDRH 4Y19E 4AEIL 4A7GA 8PAZA 2DICA 1GGUA 4JG9A 4GMTL 3IGFA 5AVRB 3BVVA 2N18C 5I6LA 5IFHH 3RGVA 5KVFE 1JI2A 1CDIA 3HRPA 5FLVA 2WIMA 1JPEA 3PDGA 4WGKA 3CFNA 3HNSH 4PVNA 1L0LD 4X9YA 4JMXA 1IKNA 4LAJH 1B9ZA 4QYOA 3FN9A 4ZQKB 1CDGA 3SE8L 1ZTXL 4LLWB 5DR5H 3E6FA 2F5BH 3VXUE 2AXGA 1SN0A 2DI8A 2GIYA 5AW4B 3ARFA 1CXEA 4HS6A 2Y7LA 1IL1A 3F58L 2KL6A 2ESVE 3DX9A 3GIZL 1I7UA 5D96C 3TH4T 1I1AC 2FNBA 2H8PB 4EICA 2NY0B 4PY8J 5J3HD 4RMQA 5BZZA 1QSEB 3M7FB 2GW5A 4FFYH 3WXWH 2BHUA 3PWPA 5HY9B 2J8UF 5C9KA 5IBTH 3D1MC 3HQ8A 4GAAA 1XXDC 3NJHA 4QTIL 3IWVA 3EGSA 2B9AA 1J5HA 3GJFA 1MJ7H 1YNTF 3NA9H 1NAML 3MYJB 2R1YA 3NMEA 4EZLA 4N3UA 5DURD 4HUXA 5DA0B 3NZUA 1E28B 4ODWA 2D7QA 4RBPH 4OI9A 4EXKA 1N6UA 1N2RB 4LMQE 4U1GC 3WTUA 5KS9A 3QEQD 5JZ7D 5CIEB 1IM3B 4Y88A 1HJCA 3FTVA 1Q4NX 3NJGA 3SBRA 1S9VB 4QAMB 5JHBA 1FZOB 1B0IA 1CFQA 5AW1B 2VDLB 5I1IL 4QRPE 4S1DD 4P5TA 4HMEA 2AJXL 2EVFA 3LDBC 5T1KB 1UZ8A 5FA4A 4OZIE 5JPMC 1ZANL 2XWZA 4LK4A 2ORBL 2VDML 3MRCB 4EUPG 3A6CL 5C0BD 3ZHNA 2BGVX 3H3PH 4C4KT 1JFHA 5GZND 4UOW0 4EN3A 1NANI 4PIRF 2VOTA 3FT3B 1SY6L 3NFSL 3I74A 1OE2A 4UV4L 4B5ZA 3GBML 1MCBA 35C8H 4EBQH 3DVGA 3UDWA 3UC0H 3VWKA 3CBKB 2ITDB 2X3CA 1GA2A 1D5IH 4D9RE 4TUJA 1CE6B 2XWJA 2H0EA 3TNNB 3UCRA 1VEMA 1IBFA 1UWEL 2P47B 4ODXA 5GSVA 5C7XL 2L7JA 1JRHH 1FNHA 1CYGA 1D5XB 5L4JA 3LN9A 4L4VA 1KJVB 1KUMA 5EWIL 3ECQA 4PHZA 3GZPA 1WIUA 2BP3A 4YHIA 4JUTA 1J3SA 2M83A 3LQAC 4NI3A 4XBGB 3RWIA 1J9RA 5K5YA 4KI5D 3SKJH 2HB0A 3DVNB 4OCYH 4U1IB 1OCRB 1ZHLB 4NN6B 1XR9A 3RG1C 5AD0A 3TX4A 2FT7A 5BOJA 3RY6A 1GYUA 2I5YL 2H6UA 3BH9B 3TF7C 2VQUA 1GOFA 2J8UA 4XMKL 3APNA 1BEYL 4YEEA 2MQCA 1W72H 2AI0H 1AG6A 3HE7A 2GC4D 4IJ3B 4DUVA 4ODXB 4HMCA 3BC9A 3SHSA 4Y1AA 3ZRCC 2H32H 1WZAA 3G5VA 1CIEA 1CFNB 4HU8A 4G8GE 2JSFA 4YGVA 2FGZA 4Z7VA 2CHWA 1FCDC 2EAEA 4CC4A 1IGTB 1ET7A 2Q20A 3BE1H 3J8F7 3WI9A 4KXZH 1SXSA 5MHSD 4ZK8A 1F42A 1VFAB 2BHYA 2QGEA 2D8KA 2ZX5A 2H2PD 3PWJB 5D7IE 1OQXA 1VFMA 4KK9D 5CIFB 1KYAA 3NEXA 5HGHA 3BRDA 3DPDA 5D72H 3FMGH 2J5LC 2FSEA 2XN9A 4YLQT 4DP4X 3RWGA 1BM7A 1R5IA 3UDWC 3MCYA 2Y3NA 3VRIA 1G1YA 4HKBA 5IJKC 5E9NA 1BD2B 4JFHD 1ZK5A 2VLKA 1YEIH 2EYTA 3Q8FA 1U8QA 1T04B 4Z7QE 2IVFC 4ENZA 4XVTL 4P23A 1KXQA 4S1SH 4M5YH 3V5KB 5CZVL 1S4IA 3KYMA 4UQBA 2ZWNA 3TO4B 3W5NA 4PVLA 2IPKB 4HVBA 4PWAA 1A6WL 4GOSA 1AXIB 3VXRA 2CO7A 2NXYD 1AS6A 1EK3A 4IGBC 5HBBA 1LEGA 3B5GA 3VD7A 1RJLB 2QTEA 3NRQA 4ZTPL 5KBMA 4PRPD 5C70A 3FQ2A 3GJFB 2C9QA 2E7HA 1HHIA 2JB6B 3LZLA 4Y2DB 5E2VH 1NMLA 4X7CC 4OZ4A 1C16B 5IEHB 3HI5H 2DEXX 3FCGA 4PJBE 4Y4KA 4NUPA 4UM9B 2CK0L 4EI5D 1RUKH 2LR4A 4LEBA 3BGFC 2O1AA 5KEZA 1OAUH 2VXSH 3GO1H 3P4MB 4YGAB 4JRWA 1VZHA 4A68A 1JYXA 1W5CT 1VESA 1DCEA 3MV9B 5JPNC 1I82A 4HG4J 4MMXA 4LQFL 3C5SB 3BEWB 1CCHA 2JIXD 5I9QC 4BZ2H 4LP8A 5CN2A 4IMLA 4DVBA 5B3NA 5HYQB 1QFWL 3Q9QA 4DT2A 4TL4A 1SVZA 3H9ZA 4WHYG 5D7IB 1NCTA 1EGJA 5KZCB 4XRCB 1A5FH 5BV7C 4JRYD 4X6EB 2F5BL 2FHFA 5DS8B 2XWBA 3N41F 3ARZA 5HHOA 5DF0A 2CBOA 1J86A 4TQHA 2EVHA 1J7VR 4M61B 3QO0A 2QSVA 3O2VL 3JBTB 4GBXA 4ZW7A 3QIWB 2R9HD 3V0GA 4EIEA 5CHNA 1PS3A 1WG3A 4YLBA 1L9TA 4EDXB 1OAQL 2WQXA 2RD0A 2JMRA 2YS4A 5DD5H 1B4LA 4GW1A 3QGVA 4OJEH 1ZTMA 3CFJA 2QADC 1JS4A 4RIRB 4Z3EA 2YARA 2CR3A 3BAWA 4QTHB 4E41D 4XNDA 3CN4A 1ES0A 1AFVH 2BZ7A 3RHWK 3FU0A 1AJ7H 2AQQA 2FZ3B 1BM3H 1TFHA 3D07A 3O6KH 2BNQE 4GLRH 3ZOWA 3I9IA 4O9HL 4R26L 3RIAK 5ICYA 3FU7B 3U6RA 3FUMA 2RFXB 2VIRB 3OR6A 3VFUA 2ZNWA 3P4NA 3QQ4B 1U8QB 1KPVB 4TNWK 2Y6SC 1DVFB 5BV7H 2E4FA 4QXGH 1SJHA 1H6TA 2WWMC 4L0PB 3T6WA 3RVWD 4J3XA 3CSYA 2DWSA 4JGJA 3RU8H 1XL4A 3UTSE 5J9PB 2YOAA 3M17A 3WAKA 1QHQA 1L0ND 3B9EA 4PRBB 3DJ9A 4K55A 3DTDA 5IB2A 5JPNA 3JXAA 5DQ9A 3ULSA 5F1IB 2C7UB 3CFUA 3ROOA 4A1RA 2QPFA 5C09D 3H9YA 1WUZA 5D1ZI 2DYPD 2DQTH 3HE6D 3MHZA 4JB9L 3RQ3A 3QORB 1P84K 3MQIA 2IH3B 2YQBA 1KZYA 4PJAB 3L3JA 2FQEA 4MYPA 3MXVL 1I8LC 5EU4B 4AVKA 1X3DA 5JLZB 1HEZA 4YE0A 5IV2B 1BW8A 5FYJE 4KMGA 1L5GA 4G42B 4YHNB 1T6WA 4BFGA 2JNZA 5E79V 3BFWA 2ZONG 3MLWH 1MCEA 3D4CA 3UPRA 2WBJB 4DHLA 4LCWA 3K46A 3PWVB 4LCUB 1MXGA 2IWGA 3HJEA 4NBXB 4OZFH 1S2EA 3D6GA 2KLRA 4JPKH 5SX4H 1EJ6A 3UTTD 4LHUA 5GS1A 1XQ4A 3O9WA 5EF0A 3VXME 3HI5L 3ZKSD 4PRIA 1MRFL 3P0VH 4OD3H 4CDGC 5DRWA 4K8RC 4E9QA 1F00I 4KVCL 4NNPH 3ULVE 3CYTI 1K5NA 3QHZL 3GLZA 1XCTB 4TF4A 5E9DA 5AVYB 1GH7A 4NP4H 3UYPA 1OGTB 2ZOWA 4O02B 1HYRC 4WI8A 2B4CH 2WGXA 1OP9A 4B0MM 3ML9A 3S5YA 4BZ2L 2XPZA 3QZWG 5HYJD 1CYXA 1WFUA 2IBZY 1UJTA 5C3IA 1HROA 1FFQA 1V5JA 2XVLA 1FRGH 1A2YA 3M88A 4NHCL 3WD5L 3TVMA 1XF3A 3TESA 2OYKA 1H3TA 2J88L 4Z5RB 4KFMA 4HGWA 4EN3B 2EICA 3R06B 4PWJA 3VXMA 2XIBA 1OLLA 4K5OA 4RH4A 1TR7A 1BL9A 4KRNA 1W0VA 3LKQB 1JWMA 1PD0A 2ZPKL 1TTCA 2RR3A 3FO1A 3V0FA 1CHIA 3KWXA 1V27A 5I1DA 1FP5A 4FRWA 1VFOA 3GT6A 4QHKJ 4X6BA 43C9B 3M97X 1MRDH 3INOA 4X8JA 1GHFL 1QPKA 1PU0A 2YQ2A 1BLNB 3IYLW 3GGWB 4NC0B 4X6CE 2J1WA 2E8YA 4OY9A 1BLNA 1GSMA 4Z1PA 1PLAA 3BZ4B 3FBKA 5CJBA 1A1NA 1I9JH 2N59A 3IS0X 3RDJA 2FYYB 2WXPA 1G7QA 3RAJH 2X6AA 2FWSA 4KJPC 3NABH 1TZOA 3H0TA 4MQTB 3APCA 4NQDA 4TSCH 1CZ8L 3IE9A 5IJBC 4PG9B 2N9JA 3O0LA 4ZZFA 3PPSA 5EF1A 2QJKB 2QKIB 3UJTH 4IK7A 4X9HA 1OK0A 4JG0L 2Y2TA 4PJXE 4DKTA 1T7VA 1EZVY 1AS8A 3Q5YA 3LEVL 3KGSA 3F00A 1HQRA 2E9GA 5HDWA 4MGXA 2BS8A 5KSUB 2CBPA 2QFPA 1ZK9A 3HS9A 1GPOL 4YDJA 5B21A 2OCCB 1HHKB 4IRSB 5TGBB 4APXA 2WCPA 3KPRE 4L9DA 2BVEA 3NCYP 3U1SH 1JZJA 4LQFH 4UINL 2EC8A 2YRPA 1FH2A 5F7KC 5DJZB 1IU1A 4CSPA 1OARH 3BQVA 3VG0L 3HMWL 1J9CT 5E08H 3F04A 1NBVL 2J25A 2GKIA 3FTSA 3NCFB 3PV7A 2JJTA 4N20A 2CR6A 2AZAA 2F9BT 3U2SB 4DVRH 1Z5YD 2R8SL 3M46A 3P11L 4RAUB 1Z3RA 2GCYB 1QA9B 3MV9E 1XF3B 2G0LA 1XBDA 3PGCA 4JPKL 4YHNA 5C0JB 3U6XA 4WTZA 3EYUH 2DQ6A 5FO9B 4DP7X 1R3LB 3ZTCC 1QOKA 5DDHA 4DKEH 2Y06L 5IR1B 3U2SA 3FU8A 3GBEA 4PRPB 4OD1H 1G4MA 4O5LL 2GQHA 4H88H 3T71A 4PFEA 4UB0H 1HHGA 1XL6A 2F15A 1DQTA 2OI9C 3QARA 3QFJD 2VR3A 2MCPH 4XNZB 2BDNH 1PD6A 1UG9A 5HD8D 1IJ9A 4FFYA 1MSPA 4ODSL 3X11B 5KVFL 1N6QH 3C8KA 3ESOA 4L8SC 1YMME 4NBYB 4YL9A 1E5YA 1OP3K 1QKSA 2MHAA 4XX5A 2FRGP 2OS7A 1NIBA 5E2UH 3RWJB 3TBYA 3L1OL 5EN2B 1KCRH 1LM8V 2DQHL 3KWVA 4PUBL 5D2NA 2IDUA 2WMPB 1Q1JH 4A7QA 2QSTA 2X4SB 1C6RA 2OZ4L 3FO2A 4KDWA 4M1GL 4FKHA 1UUSA 4J2XA 3LN4B 4U7KA 3F7KA 5MEQB 3FH8A 2B59B 1MQKH 4WQBA 2DJ4A 5GRYA 5KBNC 2XZAH 3FBQA 4UZSA 1OP3H 3V0DA 3Q6FB 3L7FA 3QXUA 1SMOA 4Z7NF 3KYNB 5HHPA 4ZUSB 1QTSA 3O6FB 4OZGB 2IWKA 5JHDD 3Q9PA 3QUZA 1UOWA 2VMFA 5I6PA 3BZ4A 3FCUB 2F8VA 3RTLA 4RNRB 2CCWA 4ISVB 1JGUL 4MXWH 3ARDC 4DIXA 1CTNA 3HAEA 3QIWA 5C07B 4JO1L 4ABUA 5CGMA 3SDYL 5DMJB 1D3CA 3VXQB 3DGGB 2FECI 1E50A 2GAZA 1SJEB 2J1YA 4WUUA 1VACA 4JM0A 5JMOC 3MV7A 4IDJL 4GKZA 3DX7A 4S1SL 5CZVH 3TIDB 2UX7A 1EA9C 2M8XA 5F89A 5FYLE 5HYJE 1H31B 2R51A 2VMEA 3RVXC 1K3ZA 1V8HA 2KPNA 4GEDB 3I75A 2DWYA 3L5XL 4JPQA 1MN4A 5F9DC 5FYJU 4AM0A 1UJ3B 1D6EA 3LEVH 3EDFA 4FXKB 4YMPA 4LIQE 2CDFB 4I88A 5DI8B 5E6SB 1NFDA 2Z4QB 4L3EA 4NGHH 4PJ9D 4R7DA 3PG2A 5BOPA 5T3XL 3LB6D 5AAMC 1S9KC 3ULUC 1KEMH 2E9IA 5K9JL 1IARB 4ZW5A 3L3HB 1T22B 2V3EA 5EV7A 3TBTB 3U7WH 5JORB 1SLVA 4HKZB 2NPLX 3BWUF 1MWOA 1OE3A 3MUJA 2QVKA 1WK0A 3GK8H 3GMLB 2B14A 3KNBB 1NIRA 1CLOL 2DLIA 4KKCD 1VSCA 2IGLA 5I2IB 3OHXB 4NHCH 1SBBA 4ESKA 5D6DA 4CBZA 4FEIA 3VH8B 1F86A 1G1OA 4BFEA 3HB3C 1HAWA 4KK5C 4F7TA 1KXVC 4ZQTA 1U3HD 3N42F 3CZSA 5IJCC 2A7BA 1KXHA 2P45B 3ZE1F 1BX2A 1JK9B 1HJBC 3O8XA 1HSBB 3MXWL 4TXVB 3B2UC 3WTSA 5FDWB 4OFKA 3BPNC 4WI6A 3O5CA 5KYYB 1CO1A 3EBAA 5C1MB 2HV4A 4UZGA 5FB8A 2GBAA 1SNRA 3A22A 3S97C 3JQOB 4ZUWA 1F1DA 3SKJL 2QJDA 4G70B 4KAQH 1P4BH 1PYWB 4WNSA 3RYMA 4Y89A 4M7JH 2C4XA 4HIJB 4U3SB 4B27A 3IS1X 4KKAC 4Y5RA 1XGPA 2I69A 1U8MA 3UMTA 4DAGL 4GW5B 5FKPA 4QTIH 4WI7A 3OXRA 3GF8A 1GVIA 5D1QA 2ZWYA 3PYCA 3WFHB 1U8JA 1F90L 4YPGB 1I55A 1A6ZB 5A40E 5J1SC 1NBZB 4J4PC 2WLHA 5H4ZA 5JQ6L 1BCIA 3AC0A 4KU1A 4UBDD 1SOQA 4GW4A 1M7IA 2CIKA 5C3LD 3VD3A 5CGYD 4JZNA 1PAZA 3GXTA 4JY4A 3O0RL 5SX5K 1OT2A 3OB0K 1KJ2L 4ZTOH 4W6XB 5DEFA 3QNYB 4I0PA 1IRWA 4U05A 1TQWA 5IHZA 5CMAA 1VB9A 2Z65C 3JZ7A 1HHJB 2QDWA 1QLFA 1ZVHA 4YPJA 1QSFE 3A6CH 1PCSA 3T2PA 1ZV5A 1P1VA 1QI5A 2R2BA 2Y5QA 3MO1A 3QUHA 4LPWA 5FWRA 5AYUL 4XZUB 3RU8L 1T2XA 3OKEA 1E6OL 3FSAA 2HT2D 4UI2A 1JNNL 3S5LG 3LHPH 4MJ6A 4RRPA 4M6NH 5F7AA 5IB1A 3DO7B 1Y6KR 4F58L 3HIZA 3QPXL 4OLZH 4AH2A 5L2JB 3KPRB 3T0EB 2HG0A 1FFPB 2BVUA 2PYEE 1YY8B 3O4LB 4G8GB 4PP1C 3EF4A 8FABB 4MD5A 4RVBA 3G5XB 3RLMA 5FV1L 15C8H 1X5KA 5CHNB 4KXBA 3L7EB 3GTNA 3S98A 5IQ7L 1XF4B 1AXSB 2FLMA 1NAMH 2UYLB 1X7TA 3A4DA 3MK7B 3H85A 2HN7A 3J07A 2E4TA 5FHBL 2IFGA 4H8PA 3RAJL 4DEUA 4NPJA 5F3HB 1H33B 5DU7A 3REVA 1J0JA 2Y3AA 1JN6B 1JIBA 4N8UA 3RX7A 2BXZA 1AO7B 4DERA 2D4FA 1XF4A 1W9XA 2QPEB 3MJ8B 1ESOA 3ULUE 3MNZB 1NDTA 3F5WB 2FJHB 2FX9L 4FL4C 5KOVC 1ECYA 5AB1A 3MNZA 3FT3A 2HUEA 4WU7A 4HKJA 3IE4A 1KJ2B 4AH2B 3B1TA 2VDOB 3A47A 4EN3C 2QGBA 5EDSA 5L2JA 1K8IA 1CLYL 1TJHL 1KTDA 5F2FA 1ZGLA 4OCNC 4UWQB 2FB4L 2W07A 3C5JA 5FGCB 2EDBA 4YSEA 1USZA 3NFSH 3L7EA 4DK3A 3DETC 4ZFFA 3DI2B 1CGYA 5I16B 5E6IA 5D4JA 1E9QA 3UC0L 4WO4C 5H35B 5B22A 2VE6B 4I0PC 5EG6C 1Y6MR 2FWOA 3BE1L 1FYTA 1RP8A 2NSQA 4Q9RH 1AY1H 4WO4B 4R3SB 1SDDA 4N9GA 5AZUA 1FV1A 3QG6A 2ALWA 2WSKA 2EKJA 1MLBB 1PGRB 3FSVA 4JY4B 1F3RB 3NIGE 1R3HA 5T5NG 4GG6E 2DD8H 4YHKL 1IM9B 5C71A 4JKMA 5DFWH 3EFOA 4KROD 1MH5B 3SDCD 2D2OA 1QLFB 4YDVA 3UBXI 5FM5M 2DWTA 5DD3L 1OM3L 3MA9L 1PZCA 1MI5A 2GHWB 3UZEA 1I3VA 3P9LB 4L8SB 4F37K 4KNUA 1NUFA 5D7JC 2WCGA 4MA3B 1H9VA 4HUWB 3GZOA 3P9MA 5DC4B 2VQTA 3MGOB 2ZOUA 2QVTA 1TJGL 3OD3A 4FQPA 4L3ED 3KPOB 2EADA 4TKWA 1S3KH 5DCCA 2K8MA 3D0VA 4G7YL 2W80C 3KR3L 4BUHA 1KBWA 2OMUA 4MDJB 1NTMD 3FQUB 1LP9B 3O6ML 4G9FE 2DQDH 3AACA 4ELDA 4Q97A 3D06A 4WSGA 3K72B 5DJ2B 4M9PA 4XC3H 3H9SD 2L4OA 3FTXA 3QB7C 2VW4A 2BOBB 3C6LA 2QDVA 4Y2DC 4MAUL 2C4FT 3LS4H 1DJYA 1V7NL 3LZFH 3RGVC 4PJ8A 4X5RA 2JQMA 2EIZA 5E2JA 3T6VA 2JQAA 4AW7A 5CGBA 4CW1A 4LCVA 3VB8A 3RVXD 3OV6A 4OF3A 1LTXA 3NAAH 5TQ2L 3ZLQC 3MJ9A 2YWYA 4X50A 2OQJB 4EIBA 4K7PL 3HG3A 1IC5H 5EMYA 3MLWL 4MS8C 5DJ6A 4N0YL 5L0QC 3MRDA 2ILLA 2XWRA 2KZ1B 5DJYA 2E5EA 1WIPA 2P24A 5EC1A 4XOBA 5HHVL 2CA4B 3BAIA 1WO2A 4PBDA 4QRTB 1IRAY 3LIZL 3CC1A 2Z1PA 1HNFA 3RJQB 1QBAA 4KRMB 2KUTA 1I85A 1N59A 3WEBA 1XGQB 1VACB 4RFOH 5AYUH 5ITFB 3V95A 4GUPB 4M9OA 3CFKB 3EBIA 4KKCC 5DD5L 5B8CA 3N40P 4LSTH 2HRLA 4NQDD 5I1GH 1XH3B 2V9RA 3JV0A 4NQVA 2ITDA 3UZEC 2XY2A 5C08E 2E6PA 3S34L 2BP0A 1NCBH 1FGVH 1MKFA 4R4BB 4YSDA 4D0CA 1V3MA 4X6FB 3CXHD 1IAKB 2R59A 2XYCA 5SWSE 1C5BL 2K8QA 3MGTB 2FAUA 1O9VA 1YJDH 1ZSHA 4XOAA 1PSKL 4NUMA 1UXLA 2IEPA 3L73D 2GUOA 1DO6A 3ZRFC 1DEEA 3ILEA 1F11B 3MLSH 1A6TB 2ZG3A 3CCHA 2EDEA 3STBA 3WUIA 3ZKQD 2OJZL 4X5WA 2EDMA 5B1CA 1X9LA 5ISZA 5J1AA 4HWBL 4K94C 2OA9A 5IVXF 4I18A 1MG3C 5C0ND 1GIWA 2EYRA 5G5DA 4XCCH 1ZT4B 5IVOA 2JCCE 2KZBA 1MFDH 2R0LL 5GRUH 4K5PA 4P2AA 5C08A 4HDIB 4YXHH 5IQ9A 1BXAA 3QISA 2OL3H 5DJQB 1YN6A 3HZYA 4HV8A 3JWDH 4EIUA 2VHDA 3FQWB 3VTTA 4EIGB 2BNQB 3D85D 5CLZA 1WZMA 1KB9K 2ITCB 2Y22A 3I6LD 4F8LA 3EO0B 5IIEB 3MV8E 3L4TA 2A83B 1CS6A 3MXVH 1A7NL 1YYMH 2IGFL 4HCRA 2AJUH 4FLQA 2IOIA 3K5SA 2Y4SA 3NIDE 1HQRB 1E40A 3QZWA 4L8BB 4O51B 1MIEL 2X2YA 5IHHA 5IMKA 1GKEA 4PJBB 2Q86A 2DWEA 5B39B 4CVZA 3RURA 3QFDA 5TISV 1SHMA 5AYQA 1ADQH 3K8MA 1DO5A 5A7BA 5I0ZA 2O4EA 1FNFA 1NAKL 3NIFF 4LRNH 3S4SG 1M6ZA 4PJHE 4JEGB 5HYSG 3T09A 3B2UD 1MG2D 2Z3FA 2BLFA 4LLYB 2YPKB 4ORZC 4CMMA 3CDFA 3BPOC 5EU3B 1X7QB 2JELL 5CJOL 1LE5A 4PJFB 2EDQA 1CBVH 1WZ1H 2P80D 2QQLH 4LLAA 1DW1A 4FX5A 2IFFH 2YSSA 3O20A 3TZVD 4JFQA 1F8TH 3SLEA 1NCIA 4HCRH 2YD4A 2ZXCA 1F3DH 2OMZB 2BVOB 3PL6B 4I2XB 4P2OD 4RGNB 1MPAL 3KPQB 2MNWA 1FYHB 3ZBMA 4FCAA 2VH5H 3LZQA 4M6NL 4IRZA 3IPEA 2H3KA 1AD9B 2GIMA 3MRIA 4CA4A 2O5YL 1ZCRA 3SQOH 2N7BA 4YDMA 3EJZC 3FCSB 3PWUA 2XIIA 4U1JA 4I1RA 3IETB 4FYQA 2J3SA 3I85A 4LVHB 5B5EV 4TSAL 5EO0A 3VXMD 2EO7A 3DX0A 4ES8A 1TFPA 2BX5A 4J3BA 2L0DA 3E6HA 3L9BA 4PB9H 2FX7H 1KG0B 1MCPL 4HP5A 3BFQG 1D2PA 5I1HH 1HILA 1WFTA 3IDXH 1U58A 2UXFA 2FO8A 5TDNA 5DHEA 4I48B 4O02A 2WO4A 1PLBA 1MF2H 4TMPA 4URTB 5ABAA 1MZ4A 1A0QH 5IROD 4I4WB 3S3BB 5BRZB 3GMNA 4JL1A 1A7OL 4IGBA 2HLEB 4L9LB 3MODH 4IIQC 2EEXA 2VSKB 2N18B 1EJOL 5A16B 4GMTH 3RJDA 3UGUA 4WQEA 3UP6A 4HWUA 3GS4A 1AZRA 3ARBD 3ESMA 4OUUB 4KXAA 3K2UH 3WO4B 5CFHA 1RZ7H 2KH2B 4O2FB 4ODVH 2H3NB 4OCSL 3CN0A 4DPCX 1O7VA 1GJQA 1G7MB 4IU3B 3KPLB 3QI9C 4GRWB 2NNRA 5F0LB 3KZIV 1N5AB 5ALBH 5I1AA 4ONGH 1JZFA 4L5FH 1SXNA 4X5XB 1MEXH 3ULVC 4I4WA 4WFGE 2OR9L 2CE6A 2HT3D 3KCWA 3O45B 3GBNH 3HI6L 4JM2D 5IB3A 3RDTC 2BOCB 1DBML 1HTYA 1IAOB 5C9MA 4Z18A 3GSNB 1LGVA 5BS0A 1TZIB 5CZXD 3D0LB 3NCCB 3QA3B 2JKWA 4MXWL 3ROOB 5I5IA 1DVYA 3UO8B 3OWRA 3SJVB 5L9DL 1NCJA 5D7JB 3V6BR 2J1KA 4OCMC 3RVTD 4CAGA 3FFDA 2MWCA 5FYLL 2B4ZA 5T5FH 1WITA 4OVUA 2HKHH 1B88A 4WFED 3EO1A 4PJGE 2FD6H 4QPEA 3QZWB 3D51A 4QRPA 3QWRA 4YN3A 2YAHA 3PL6A 4I2XA 3GMOB 5F7FA 3A3YB 1UM5L 2LVEA 1FL5A 1C12A 2Y1AA 4LBAA 4OZGE 2NUPA 4NUQA 4H26A 4HPYH 1ZOXA 3QXTA 4LSTL 1V3KA 1O9ZA 4YE4L 1CGWA 3CHRA 4QRPD 3WIHL 5JLZA 2ZE0A 1GYVA 3M1BB 1NCDH 1SLUA 3JV6B 2IH3A 4WI0A 3MREA 4XBMA 3KZ8A 2IDTA 5D4HA 4CJ1A 2BFGA 1DW0A 1C08A 1WBXB 4ZW8A 1ZVNA 2YPKA 4TSBH 4NRYB 1RUPL 3MREB 4JZOA 1NL0H 1OW0C 1VRSA 3G7TA 4RGOH 5KVDL 5CCJA 1S46A 2XZCH 5TH2A 2VXQL 4E41A 3X1FA 3ETBF 1SFHA 1CDCA 2E74C 4WHTB 4QHNA 1NMBH 2MFNA 3MI6A 1DSFL 4B3EA 3AG3B 4PRBA 4UV7L 1XH2A 4Z7OE 1ASPA 1HKLL 1CDBA 2ZXAA 1QVOA 3HAEG 4RFEB 3NYKA 4QRPB 1URLA 3RILA 4NRZB 4Y5XB 4JJ5A 4WCYH 4YXLL 3B4NA 2XWBB 5CJQH 4IBVA 4BK8A 4YZWA 3D34A 1DJGA 3AQYA 3R1GH 3GDBA 4P4RB 1VERA 4G8IA 1PNDA 1D5BB 4NS0A 1MG2C 4G9FD 1DVFD 3DSNB 1IEBB 4MQ7B 5D1ZB 3VYNA 5JYLA 1S78C 4H8WH 1GYWA 4KGJA 4YZFE 1F58H 2OMWA 5HYEA 4HDIA 4RIRA 3V6FB 2IANB 3ZQXA 1I9EA 1A3RL 2WVTA 1RJZB 2CUHA 4LNVA 4PV8B 5LGHH 3B8SA 4IS6A 4Y19A 4K23L 4YUEL 1E8EA 1EJOH 2HFGH 1RY7B 4P2OC 4FFZL 2QKIA 3T0AA 1MFEL 1WZLA 2J8HA 2I25N 5LBGA 4C56A 4LQ1A 5KBPA 3K4ZA 4D6TD 4Y9EA 3HPJA 1JZ4A 1GKSA 1DR9A 4DY9A 2XN1A 4J3OH 3TGXA 3V9CA 5CN3A 1GJIA 3WL9A 3BHBB 1MELA 1H9XA 1H0DB 3HC0A 4A04A 4GG8B 4ACPA 3T4YB 1IAKA 2PABA 1G7JB 2HZHA 2Q6WB 1TQBB 3TJPA 2I32A 1JXGA 1MHEB 2OJZH 3BH8A 3ZVVA 1IBBA 2R1WB 4YFEA 1OW0A 1WZ1L 3ARBB 3GGWA 4BEIA 4HK0B 3INUL 4M4RB 4BFNA 3QPXH 4OLZL 2MQ0A 4YDIH 2DDQL 1BE3D 1LNUB 2G75A 4U3XA 4N1HB 5FW8A 4AQAB 3I9PA 5IB5A 2Z92B 4PJCF 3ETTA 1L6XA 4QD2E 2AJYH 2E9BA 2WUBL 1WAAA 4I5BB 4N8VG 4PJIA 1IIKA 1DUYB 3S0PA 2PXYC 3BVNA 5CZKA 3P40A 1MH5A 1S7XA 3LJ3A 1OL0A 1IC7L 3OGOE 3QJOA 4E36A 1MLCB 1NH6A 3LKPA 3BO8B 4PRAA 3TYGH 3CHQA 2V8LA 1ACXA 2DMHA 3D39D 4GKOA 4Q0XH 2YGVA 1CFNA 1FDLL 4XNMA 2MCAA 4L8CA 1QLEB 2B3IA 4PJAF 4UT6L 4PJBA 5EUOB 4PJCA 1JF6A 4HHAA 5F96H 1WHPA 3FRPB 1RZ8B 3KBEA 4B96A 1QN2A 1E65A 4YLCA 3KG5A 5GQBA 3HR5A 3W38A 1CXIA 2P1YA 2XDHA 3ZIYA 1ET8A 4PU2A 1FG9C 4IBTA 5CKGA 3EOTH 2EIKB 2NY4C 1RXLA 2BNRB 1CT8A 5LAXA 3S96B 5AVQB 5CBEB 1R5IB 4B5EA 4ZFZB 1CTYA 3EYFB 1SVBA 5F6IC 1A66A 1BEYH 2BS71 2E7MA 4FANA 1QSVA 3HC3H 1AHWB 5IG7B 3MRGB 3WE1A 2ZF8A 5D96B 5GGVH 3LNDA 3QPKA 1SQQD 1YQVL 3OPZH 2J2ZA 3IMTA 1JZEA 1S78D 3PAUA 5HI4C 5ICUA 3NIFE 4WI9A 5DQJA 3AXLB 3SOTA 4F2MB 3RFZC 4F1SA 4KH2A 2AV1A 2Z34A 3BP6A 2FUQA 5BO1L 4OT1H 3NCJH 2CO6A 1JZ7A 3B8YA 3CGTA 3P3SA 1RHFA 5DQJB 1I7TA 3MBXL 4D8PB 5DVPA 1IC4L 2F1BA 3IF1A 1F6AA 3OKDB 2AK4D 3IJ8A 1G9MH 4FQLL 4Z7VE 3JVGA 4PH8A 3HPLB 4QR7A 2DLFL 3FF7A 3EBGA 3NGBC 1PJWA 1IRVA 4MXQD 1J8HD 3ZHKA 5ANMA 3DK2A 3NJIA 1F56A 4K71B 3P73A 1BD2D 2HKHL 3GFUA 3N41B 3SN6N 1K8DA 2WXOA 5B1AB 2WLLB 2GSIB 2VISB 3SGEH 4N28A 2WUCH 3L9YA 1ZVSB 2WXQA 4MNGB 3ARVA 3RFZB 4XCFH 3ZDXB 5IVXE 3O4LA 3WY1A 3W0WE 4BQCA 2GJ6E 4P9HC 5J6GA 2R15A 1QZ1A 1BX2B 3GXFA 3CVIH 1SYSB 4H5SA 1KJ2A 4HZ1A 5ANMB 3U1PA 5IHBA 4C83A 4LU5H 3BT2H 2Z91B 1XGRA 3QE5A 1NU1D 4F7MB 4PJXA 2BSTA 3EYOB 1QD0A 2FJFB 3GMLA 2JJWA 4WQ8A 2EACA 3CK0H 1JPTL 1KIPB 3JTTA 3RJOA 1AMYA 2R2CA 5DRXA 4R7NA 4NJ9L 2HN7B 4G6KL 4NQEA 5JR1H 2YC1B 4FG4A 1H3WM 3EH2A 3HLAA 3NSFA 1AY1L 5GSRA 2NZ9D 5C9JA 2CJUL 3QJQB 3BJLA 1ULVA 3QDME 1GSKA 3QIUC 1X5JA 4FXKA 4PRAB 4LVOC 2NQDA 4BSWA 3VUAA 5DWPA 4NEHB 2GB8B 1PY4A 4U1NB 1WISA 4P59L 2JV6A 5H2FV 1N4XH 2CCVA 1U33A 2WWNA 2XBDA 4ELMB 3JVGC 4MA3A 1I6EA 4QDGA 1K3GA 4RMBA 4HFWA 1RP9A 2QBWA 4MDIA 3ARGA 5C0CB 5EU6D 1HK6A 4CMHC 4BE6A 5F6HJ 2EDKA 2CJ3A 3O2WH 1DLFL 1DDHB 1JGVH 2ZKWA 2A0LD 3GRWH 3V5DA 3VDCA 3U0PA 1O6SB 3JWNG 3O81A 3PJSB 4LKXA 5D2LB 4KTYA 2WLYA 5IFHL 3WS3A 1UWFA 4I85A 1TMCB 3AG2B 4EUPA 1WWAX 4GRWH 4JFWA 1DBAL 2VLRE 1AQMA 4LFHG 4U1NA 1LK2A 4NIYE 1FV1B 3EGSB 3QG6B 4BD4A 5BV7L 3VH8G 2B59A 2QPUA 4FI8A 4WVRA 1ZHNA 1G6RL 4Q74A 4EIZC 1W0YT 3LS4L 4ODVL 1YY9D 1Z1WA 1OY3B 4YAQB 2ZPKH 1J1PL 1JFQH 2OJ1A 5LBVA 1WS7A 3GXIA 3ARGD 4M7LL 5ADPH 1CIGA 1IQDB 4Y5XA 2AKRB 1NPJA 3NIDB 3F84A 3H2QA 3UZVA 1JPSL 3FB5A 4P9MH 4X6DF 1T7XA 4RMSA 2Z31B 2OCFD 4J12A 3PY9A 4U0QB 4KNTA 3FT1A 4ZFQA 1AZBA 4ZYKA 4JPVL 1C8QA 2NSMA 1DUZB 3UG4A 3HZMA 3ECBA 1M6OA 4G80A 3U83A 3VFMB 4WW2C 3KYNA 4JGNA 1JF1B 5KSVA 1SJEA 3QRBA 15C8L 1YMMA 2PW2B 2Z8VC 1H3GA 4UT9A 2DIAA 2EXTA 5DO8A 2VSDA 5EORL 5EPMA 4G5ZH 3ZU8A 4GG6A 1E4WL 4KK8D 1N0XL 3AT9A 5CEZE 4YHLH 1FZKA 2WLLA 3BH9A 1A6WH 4IOSD 4M3HA 3RY5A 2K9FB 1Y0LA 3AXIA 1QRKA 3C75A 2Y7QA 3D5OF 5CWSB 1CFTB 4MJ6B 4GNKB 3V4PH 5IW6B 2DJSA 3UPAA 2CDFA 4K8RH 5F7HA 4DKFL 3ROLB 3UH8A 4JHAH 4AM0B 1WAEA 4XOCA 2YWZA 3INUH 4P2RD 3DX4A 5TF1H 4U0RB 4NT6B 2WO3B 3ZOAA 3U4AA 1MIML 3CFMA 4Y1AD 1F4WL 1KDJA 5E1AA 4TQEL 5FECB 5T1DH 2PPAA 4HJGA 1X6NA 3DHUA 2Q3ZA 1H15B 3VI4B 4HJJL 4XPAH 4NQSB 4RX4D 1A25A 1I8IB 1IFRA 1IGYB 2D3LA 4KROB 3QDJA 2HMIC 1U75B 4GG6F 3F7QA 5EWIH 1URZA 4JO4L 1AGEA 3TBSA 5F1KC 1JD7A 4KH9A 4FAAB 3H7BB 4L23A 5IMOB 2JTIB 2RBLA 3B5HA 2NDGA 4ZOBA 3R1GL 3MBXH 1MF2L 3QEUA 2GJZA 1EHLH 4ONFH 1U8JB 3ARRA 2ODIA 1I3RA 3VXSB 5JHLL 3U7AA 4IU2A 3LZNA 2W94A 1MREL 1WICA 1NTDA 5EIIG 1YYML 1S3RA 4IK6A 5I30L 5I6XC 4OCWH 1JGDA 2AJUL 2QPSA 3MO1B 2NR6A 3NK4A 5LBSL 3BKMH 1JDLA 3QUYA 4HG4K 5IFJA 3MA9H 1FJ0A 5EOCJ 2Y1VA 4PGEA 5IF0A 3EHBC 5J11C 3IJYB 3ZKMD 2YEZA 1NMAH 3WN6A 1E2WA 2K6WA 3IRZA 3WXVL 5ID1A 3RHWF 3QNYA 3CZFB 2WWMD 3OKMB 5FDWA 1AQHA 1I5TA 2D0GA 3V0WH 4OAWA 3X1GA 3N3EA 4X98B 2WJ5A 5ACZA 3NG5A 1YEGL 3V7AE 2IDCA 4NN5C 2IWEA 2QGDA 2XKSA 1ADQA 2PO6C 4G8AC 3NDYE 3BUIA 1OCZB 5B3SB 1NGQH 3OPZL 4AK2A 1CU4L 3U7YL 5JOFA 4NWTH 2F6AA 3F12B 3ORJA 5FK9A 5B1JC 3CZGA 3F85A 4AMKH 3HCVA 4MCYA 3FQRA 2CLVA 3C5XA 2QQKH 1KXTA 1T3FA 1T80A 4HCRL 4D7BA 4U2ZA 4P46D 1XGPB 4QLWA 1PF3A 4LZKA 3RL2A 1NTZD 2IV9A 1WH0A 1WWWX 3QZBA 4LLVB 2OL3A 5TQ0L 4BZ2A 4MB5A 1SLXA 3R4RA 4Q8BA 3RL2B 2YZ8A 2A77L 3RNQA 1CL7I 3D48R 4PW4A 4NENA 3EZJB 4E0RB 5AKTA 4F9LA 1NGXB 4N0FB 2QLYA 2VABB 4OI8A 1U8HB 3DRTB 3WY4A 1UXWB 1B4TA 4AXWA 4U6TA 2EDXA 2FEEL 3OAUH 1CDJA 5K93A 5ALCH 1FFNA 3C9NA 3SGJA 5JXEA 5JYMA 3E8VA 1MCSA 1PEWA 3DX7B 3WHE0 4WDIA 2FX7L 2Y7MA 1I7ZB 2BNUB 3KXFA 2XLLA 4D2NA 3KPQA 3IWUA 1QFHA 5J57B 1CC5A 3BN3B 1N26A 4KFZC 5C07D 1OB0A 5I75B 3UCQA 4ZS7H 2OMZA 5C0DB 3SD2A 5DRNA 4DK6A 4AW4A 3K2MC 3FQNA 3ZY7A 3CX5K 4ZFGH 4NB7A 4OGAD 3FQYA 1J1XH 4ZMZA 4IJ3C 4KJWC 1YDPB 1CGXA 1Q0XH 4LHJB 4XB3A 2PWFA 3KCPB 4K3GA 1KPRB 3L08A 1BBJB 1K6QH 2CO1A 2VDPB 3EOTL 3ZT6A 5BVJA 4XP9L 2Z35A 4OZHE 4P2QD 1HH9B 4L05A 3S4SB 3VE0B 4NUJB 1MCLA 3RIFF 5DK2A 4J8RB 3L5IA 1KIQB 4EO5A 2HKFL 3SOBH 1I54A 3HQ7A 2N0KA 2EXYC 1YTCA 5FWQA 1SXCA 4PJ8C 4GBXC 3GKWL 5DGRA 5AALA 3HG0A 4FQJH 3V8CA 5D1XC 1AO7E 3DX6B 3Q8CA 4XMTA 4KITB 5FYJD 1AZZC 2IAMA 1LJMA 4AGPA 4U6VH 4FQ1L 2IANE 2XG5A 4Q4IA 3VA6A 3K8KA 1T0PB 1ZS2A 1U3HB 2FUTA 3GINA 3E0GA 2J20A 4E9WA 2VXVL 5IVZA 4HHWA 4OQTA 2OL3L 1T2QL 3CSTA 3NVQA 1NJ9B 4I3GA 5E94B 4NN7B 3VD5A 5D8JH 1G7LA 5ACLA 3A24A 4D0DA 1KGUA 4Z77B 3ZXAC 2J71A 3A67L 5DO2C 1SY6A 5BMFL 3TTYA 5DJQC 1LQBC 2OMYA 4S1RH 2DYRB 3QJTB 3U0TA 3UTSD 3SGKA 3KJ6L 4KDTC 5CM1A 5KBDA 3ZPDA 5FUCC 1P2CA 3QORA 3QDGD 2NUTA 5IFAL 4O1WA 3R7QA 5E5MA 4JKNA 4AV4A 3HE7C 3DTXA 5FXCH 4XCFL 4N0RA 2C9UA 2P49B 3PWLB 2H0FA 4AIZB 4KZEH 1OHQA 1Z32X 5IIEA 3OZLA 2YUVA 2VLRB 1N90A 1II4E 2WYHA 1BVNT 3HNVL 4AKQA 2ZP8A 1ASOA 2ZOOA 4JB9H 3C5SA 4N22A 1WBZA 3APMA 3ME0A 5GS1B 3JWOC 4M7LH 4DFHA 1G1CA 3ASNB 3RX5A 4LCUA 3EHBB 2XJKA 2CK2A 3VI4F 4EVNA 4E9TA 1MVUA 3IDYB 3UTTE 1HYSD 2C9XB 4A67A 1QBBA 4G6FD 3OL2A 3AGVA 2WXJA 3AQXA 4IBZA 1QL4A 2HT4D 3WE6A 1LVEA 2H5UA 4Z7OB 2LU7A 5IOKA 4ZOAA 3KXFB 4F33A 1BQHG 4KI5F 3BGMA 1TYRA 4EF3A 2YK1L 2JK5A 1QUPA 2UX6A 2XU9A 5IESL 3X12B 1SBSL 1SPDA 4JY5H 5EN3A 3LRHA 1CHJA 2IBZD 5DUML 3K0YA 3LZPA 1QR4A 5E7FA 4AXWB 4E9YA 2VDNL 4JPWH 1MCPH 1ETJA 2G5BA 3PQYA 3W39A 1X5ZA 5C0AB 6PAZA 5E6YA 3O2DA 4OGXH 1MFBL 2DTSA 4MSWA 3RVUD 4JFFB 1C1EL 1I9IH 2V5YA 2XZCL 5DS8A 3EH1A 4P4KD 3JYBA 4FABH 2QR0B 1W2LA 3PHOB 4G11A 4MLIA 3HC4L 4P3DA 3V0WL 2J88H 1KIQA 2DJUA 1FLTX 1P7QA 4HULB 2D7PA 3L9RB 2CA4A 3C5ZC 2Z35B 4BHUA 2VN5A 1P4UA 1TQVA 5F7EH 4WJG3 3R8BB 2H3NA 3F7LA 4WENB 1TQCB 3MCKA 4MMXB 5E23A 5JW3L 1HOCA 5I1KL 1I8KB 3ES6A 2O6CA 4YHOH 3L1OH 2Q2EB 1H19A 4TNFA 2BPBA 5F0JB 4GSQA 4AMKL 3HC2A 4G3YL 3M8OH 2FE0A 4XXCC 4D8OA 3ZGHA 4BKTC 4RMTA 1GC1H 3IAPA 1U21A 3L13A 4GBXB 5C07E 4NO3A 2O72A 5E24E 4NNYB 4HX1A 1IM9A 5GS2H 3QNFA 4UNUA 4E5XG 1OAEA 2WANA 3FUEA 4G6JL 4B9KC 3IVKB 2I24N 1DLHB 3T8MA 3PXJA 3NABL 2QKIC 5A2LH 1HILB 1N10A 4H5SB 3QQ3A 1KB9J 1U93B 4JDEA 2B5IC 4MFHA 1XVSA 1HJ5A 1JDCA 3BSHA 1JV2A 4P57A 1JGLH 5J13C 3BX7C 1ZLUK 6FABH 2VR8A 4FOMA 1CF8L 1JNHB 1LDSA 2Q7AA 3O4OC 3Q48A 2J4WL 3QQDB 2HVJB 2I9LA 2O26U 4NENB 5EZJA 4BE5A 5KANI 2KQMA 2X05A 1H9DA 3TM6A 2B08A 4NQXB 4C8XA 4UQ2A 3DX8A 4MD4A 4XC3L 5JA8B 1SMDA 1XEDA 1E7UA 4FTVE 2Y5EA 5JOEA 3OKMA 4NPYA 1HCMA 5EBMB 4B0MB 4BZ1A 4DCQB 5D7LD 4YDVB 4A38A 5IEHA 3BUDA 3L3DA 5E8PB 5ENWB 4AG4L 4UINH 1Q94B 1IBDA 2GEQA 3G04A 4QRAA 5IB2B 5AZEL 5KSBA 1U8KA 3QI9A 5CZXC 5T3XH 2C1PB 2OP4L 3ZYZA 4K2UH 3G6JE 5JXAH 2MPAH 1N7ML 5AQ0A 2YD7A 3GI8L 3HG1E 2UZYA 1J9TA 2DY2A 3OJVC 1JD9A 2Y36H 3FB7B 4QHMB 3TA3D 3NIDF 4FD0A 3TYFB 4RGNE 4JO3L 1MCOL 4IOIA 1G94A 2E86A 1O5PA 5E8NA 3TYGL 2WQAA 2NT0A 5I8CA 1NUNB 3WUWA 1GIGH 2JI2A 5A2JH 2B1OA 1ZHBB 4U1SB 1EMTL 1EUUA 3D3VB 3MV8B 4UB0L 2JKTM 1C5DA 4XMPL 3TVMD 3TN0C 4K7FB 2XOTA 4M6AA 4G6AD 3D50A 2K78A 4OGXL 4YHZH 2GT9A 2X89D 4FS0A 4EQ2A 4X4YA 2YUXA 5FKAA 1HL9A 2G4EA 3S5ZA 3P0VL 5CFAA 1XH3A 1A4KB 2N1KA 1EFXB 1MREH 1JV5A 3HKFA 4P9HH 3STLA 4LAQL 5HSFA 1QATA 1V7ML 1ND0B 2X5PA 1C7SA 1QHOA 2PPFA 3QO0B 4HJIA 5ECGA 2TRYA 2WXFA 1YECL 1OOWA 3WUWB 3BP6B 1CSUA 3LSOA 4QMEA 1AGBA 1ITCA 4JRYB 2P8LB 2PYFA 3EJCA 3US1A 1RZQA 2FR4A 3AS3A 3D0AA 1BFSA 3ZE1E 3BO8A 3KLKA 1BDYA 5C6TH 4ALAC 1A6AB 4AZ8B 3B2MA 1WZKA 1BGYD 1A6TA 3CCHB 1EHAA 1I3GH 2DN7A 3TBVB 2FZ3A 1FO0A 4YQXH 3TVMC 1KBBA 3LEXA 2ZUXA 1B9KA 5CCHE 3NCJL 4FQJL 2FL5B 5CILL 1DIQC 4GW1B 2I07B 2ZSVB 4NWUH 3FTZA 4GO6B 3SDCC 3VG9B 2O5XL 4JANB 2JCCB 3BEVB 5C0FB 3QYCA 1HCZA 2Q8BH 4M61A 3FUHA 5AEAA 5EBLA 3V6OC 2GPZA 4JL2A 1AGCA 1CTJA 3AS2A 5E4EC 1PD1A 4Z7WF 4M93C 2MTPA 2ZCKL 1ILSA 2EDJA 2X4TB 2XN0A 3HC0B 3IJ7A 3QS3A 4QTFA 4AYFA 4GJTB 3VXRB 4OZHB 1JCKA 1PZSA 2NY2D 3I9GH 4XN5A 1D5MA 5ANME 2OZ4A 3V8OA 3VH8A 3GLEA 2KDYA 3TBVA 1KBKA 3ILPB 5I2IA 2BOLA 3WUZA 1PZ5A 1XSJA 1YPZF 4QJ5B 1DVXA 3ILPA 1FNGA 1R3IH 3ABGA 3GBLA 3RUGF 2VDNH 3SYAA 2AJSH 2VLRD 4LARH 3SCMB 5DQDL 5C9JB 5TK2A 3WFBC 2P9RA 3VCLB 5D5ME 5GIRB 3AXHA 4NQEB 3PQYE 4B97A 1WVZA 1I7UB 3DX9B 2CA3A 1QHPA 1AHWC 1FNEA 1K9TA 5C0AD 1FG2A 4NNYA 5BRZD 4JM2C 3H9SA 3JWNE 4YH6A 1R3KA 3EJZD 1EHXA 2QZQA 4OBSA 4WNJA 2UXGA 3P4LA 4X4YB 2YBGA 3UBXG 4MDIB 3GXDA 1RZIA 1THAA 1KCRL 3CDGA 3OKOB 3QRGL 5J0BA 4AYFB 3S5LA 2PCFB 5C2BL 2IG2H 2EZ0D 1XXFC 3ISRA 4G5AA 4E2OA 3QIUA 1CWVA 2OMNA 3MYJA 5CF3A 2FB4H 4QCIB 4P5RA 4RQQB 4K9JA 3IFLH 3RVVD 4LDOB 3FHAA 3O4OB 3Q6FA 4G6FB 3FO0H 2A9AA 4KO5A 4LO9A 4Z6AT 1J1PH 4BINA 1CXAA 3KPPB 3FNKA 3OHXA 2WTOA 4FFVC 3LTVA 1P84D 4BWWA 2XI9A 5IWLA 5KYNA 4N24A 3UTQA 4POZC 4ZUVA 3HB3B 5DMYA 5FOBB 3VI3B 2C9XA 3UERA 3FHEA 5B3JE 5IROC 1YEAA 1AGBB 5HHME 3NESA 3KBPA 3WKMH 1QI4A 2YO3A 4OD1L 1DQQA 3V6FA 4WHCA 2YXMA 5KYXA 2AXTV 3UAAA 5JA9A 3V6OA 2ZZS1 1FO0B 3WXVH 1U8KB 1JV5B 1L9JC 1CD8A 3W39B 2X3AA 1G43A 1JF5A 1KYDA 2VQ1B 4XAKE 4WHDA 4B9GA 3LN4A 5MEQA 1MCWW 1Q90A 5I8EB 1I7TB 3S37X 1RD6A 2AEIT 4AENB 2EUVA 4NIKB 4G5ZL 3O3BA 1TO5A 1UOLA 3K2UL 4ZUTA 5I76A 4PMEA 3AQZA 1NDGB 5GSVB 1S5IL 3MROA 4MJIE 3RIFK 2UYLA 5I8CB 4S1DC 4UAOB 2GITB 5D1XB 5C0GB 1C7TA 4BA8A 2YZ1A 3WKQA 3AU1B 2V5SA 1BZ9A 3DGDA 4M1GH 1FPTH 2AXFB 2D73A 4WV1A 3ZDXF 4BKSC 2HVJA 2I9LB 1AHWA 2PYED 4PJGB 1BEXA 4A2MA 4BK4A 5ES4B 4Y5YA 5CIHB 1DN0B 2FBJL 2X9ZA 4C47A 2XSKA 4HSAC 4KTEL 4UDTB 4DZBA 2Q0ZX 4PWGA 3SY6A 4ZJ9A 2FBOJ 4HKJB 1MIMH 1ZE3H 2V7NA 3NIGB 2JI3A 2C34A 2BZDA 3RFZA 2R2BB 3GPSA 3M86A 1QFOA 2HLAB 2HYMA 4B6ZA 4HIIA 1CIFA 1JPTH 2A74B 3BRGC 3CTTA 3Q05A 2MOGA 3LN5B 2FWUA 1AE6L 2J21A 1EAPA 5DYOB 1HEHC 4ZUUA 3GWJA 1MHPH 4G2AA 4HGKC 4P49A 1HXMA 5DUPH 3VI3F 3L5HA 2C1DB 3MOAL 3H3BC 3ZDWA 3V9EA 1DCLA 2VSMB 2UWEB 1GY1A 1FFOB 3NWVA 4A7SA 1EMTH 4ZFGL 3MCG1 3L4MA 2OZ1A 3P0YH 1TCRA 1KB5H 4FXGC 5DK2B 1A6ZA 1DQMH 4ZSOA 4C57C 3CP5A 3U9PH 4APQA 5D1QB 4DP5X 3VD9A 2AQ3A 2GTQA 1OPGH 2BIOA 5G4MA 4JPWL 5ITBH 1JDAA 4ZS6C 1AQ8A 1H6EA 1F1CA 2W0KA 1RMFL 5E8EB 1ML0A 2VXQH 3DDFA 4JG5A 4PP2A 4MMZB 2Z6FA 3DX8B 3TPUA 2BNRA 1HE7A 3K74B 3LD8B 3DYOA 1R3LA 3MODL 2AK1H 1DVSA 1R24B 2BCKB 4ODSH 1JPST 5DLMH 5KVFH 3FUDA 4OV5A 1HHHA 1SUJA 1FGVL 2EE6A 2FLRT 2MMXA 3WN5C 5IG7A 1GTFA 1WD8A 1KFGA 2IPTL 5KVMC 3KS0J 3EH3B 1HSBA 1YYLL 2G5UA 3FRPA 4XP6L 3A0HV 1QNIA 4WCYL 3OX8B 4HF5L 4HJJH 1OSPL 3D39E 4LEXH 4F7TB 4UYQA 5J5EA 3EIFA 2PO6B 4EDWL 1PFCA 2OR9H 1H3XA 3TCLA 3ZE0F 3VFOA 3TA3A 3V2AR 1DBKL 2ZCHL 3KYKL 3VFSB 2D4DA 1ODAA 1WTLA 2X38A 3LPFA 4X80L 2NX5E 4JFXB 5B38B 3UABA 1ORQB 4YXHL 4H1LA 4I2XE 4OCRL 2F7QA 4ZMYA 1G0YR 1IL1B 1IGJB 2PNDA 2QEJA 3FONA 4DP2X 5M95B 2XETA 2YPLB 1SOSA 5KLIB 3TN0A 2WC7A 3THMH 2ENSA 1BV8A 2C9VA 4MCZA 3SDAB 2UWEF 4H44C 5LBSA 4M5YL 4WFHE 3L3OB 1BQUA 5FLUA 1PDKA 3QXAB 4GEIA 1P6FA 3T8XB 1L9RA 2OR7A 4QRUA 2YJLA 2PO6A 3ELAT 2ENQA 4KUCF 5J89A 1TTRA 3LMJL 1ZIAA 4JFFA 3TWCH 3B7SA 5ICXB 3ALWA 1MFCL 3Q7JA 3WFCL 1WHOA 4DGYL 4ZTOL 1QR1A 2F7PA 3ZJAA 1ADQL 4L0ZA 3WDHA 2AFNA 4RNRA 4MNQE 4V11A 5D7KE 4BZ1H 3ZL4H 3HS0C 4DW2L 3EO9L 3OB0H 4KO6A 1AGDB 3TTSA 3OXSA 4K8RL 3QJUB 2HPTA 4XB8A 4G8FB 4KZ0A 2JK5B 1XB8A 3QVAA 2EDNA 2D9CA 1ZLVH 4P48A 3SDAD 1TXKA 1NQBA 4UV7H 2DM3A 1A4AA 1PY0A 3POCA 3EYSH 4Z7UE 5GGUB 5IKCA 3IK2A 4GRLA 4EOWL 1E3ZA 1QW9A 3OJ2C 4C56B 2Z0BA 3G5WA 3VFNB 4PRDB 2QV2A 4KO9A 4QRRD 1CGSH 1CICC 1F4WH 3C12A 2QSCH 3VFPA 1XV8A 4NZJA 5B8CC 5IESH 2ZAIA 2XQ0A 5C08D 5ACZB 3W1ZA 1TO4A 1UA6L 3QDJB 1Z5LB 3BKJL 3DECA 4KJWD 1SMAA 2V9TA 1UVQB 2ICWI 2ZWZA 3M6DA 3QWOA 5JHDA 3EGDA 1OSZB 3CZJA 1MFAL 3HAEB 2F53D 1TSRA 1TZ8A 1IQWH 3SDAC 4H25A 4HMDA 1TETH 3JV4B 1MHCB 3X11A 3QH3A 1CTMA 4D3CL 1D5RA 4CL7A 5JPNB 4XCNA 2J6EL 5TD4A 3VFNA 1NC4A 1OB1B 1WGOA 3FQWA 5IQLA 4CSSA 4HSCX 4K23H 1GZHA 4N0CD 1KPUA 1KIUA 2DQEL 2ZXBA 3H2PA 3QDJD 3ZDXE 3QEUB 1KCSH 5C08B 2PWDA 4FLRA 4JFEE 5K9OA 4QRRE 2VN6A 4QY8A 1FLRL 4N2IA 4X6CA 3NJFA 3PGCB 3SQBA 5JW3H 1MWAB 3SB3A 4CGTA 5JZ7C 4G42A 3MJ7A 1RPKA 2AQRA 1VHPA 4M4PA 4QRBA 4WFFE 5DFTA 3KLHD 2ID5A 2CPUA 3OLGA 1EHNA 1BQHA 4FQQB 5ANHA 1FPTL 1BQKA 3ZTJH 1VGKB 4KX9A 3X13A 5I76B 3VNWA 5EU6B 4LVNB 4N2AA 1RFDH 3WN5B 1M9WA 2ZICA 3V79C 5IK3B 1CD9B 3B9KD 1U3JA 5EOQH 2OXGA 3A23A 3C8KB 4ONGL 4GSDH 1DUZA 3CH1A 1T5XA 1XB3A 2VABA 4H26B 5FV2A 4MJHA 3Q2CA 1A7NH 2B0SL 4ZS6D 2O30A 3U30C 2AJVH 5L7XH 5IW6A 5K69A 3LKRB 3DVFA 4E9LA 3L3IB 1UKQA 4FNQA 5IB4B 1KJMB 1WPCA 3BIKA 1JGLL 2A0LC 3FONB 1T1WA 2H45A 3A67H 2J72A 4CC0A 2QJPB 1DQDH 3SO5A 3T8XA 2TSAA 1AGFA 5LWYH 5A2KH 4GG6B 4MAZA 1P69B 4XNQA 5JOFB 2PCPA 1BQLH 3JBG7 4GEJA 2BHFA 2XVKA 3FQ1A 3KPSA 3C8DA 4L4TA 4MCZB 3SDAA 5B1KA 2L4DA 2ZXYA 3MOQA 2C3WA 1PG7W 1JNLL 4TULH 1X5LA 2V3FA 2R69H 4AYGA 5IQMA 2EYSA 5LCVL 3X3FL 2AJSL 2FX9H 5AZEH 2VR6A 2XZZA 2NY3B 5JPMA 5L2KA 3T0BA 3K0WA 2OP4H 1C16A 3LKOA 4NO0A 2K1MA 1ZGLM 4IMKA 1PX4A 4O4YL 4OUOA 1QLRB 2PCYA 3CLFH 4WTQA 1RIHH 1KGCE 4UQ9A 5LNGA 4XNYH 3G6DH 1K6QL 3RUGE 1NAMA 4HBQA 4Z23A 2F2HA 1IE4A 1NOAA 4D9LL 3Q0HA 2XV3A 4G6AC 3ZSSA 4IGBB 1INEH 1Z9PA 5E2WL 1HKLH 1TVHB 1FH5L 2R1XA 3EJYC 5BV7B 4RSVA 2IAMD 4BSWB 4XPTL 1KLFA 4GP5B 4W9HC 4FE9A 3DO4A 1AGCB 2GJPA 4X5PA 1D7BA 3T3MF 1U30A 5DMKA 5I18L 2AW2A 3RKPA 1JZ2A 3HCVB 1I85C 3NZHL 4JO5A 2JVUA 3UTZA 4KQ4L 3D0WA 1P84J 2VNCA 43CAA 4JNXA 4ZSOB 2PKDA 1R5VA 4V1DB 5C0CA 3BIAX 2BNQA 2A73B 4FG0A 2OZ1B 3VRJA 1IGFH 3QUYB 4JKKA 5F7UA 2CGRH 1GJWA 5E1GA 2IXQA 2ADJA 1HC1A 3N0AA 1A3RH 4JM4L 1KCVH 4RMWA 4JJHA 4X98A 3W11D 5D7LE 1PSKH 3CZFA 1U8HA 1XSKA 3DRTA 2IQAB 4G1MB 2X70A 3WMSA 2Q76A 3LMJH 3LQMA 4LOVA 3WU2V 3NACL 3KWTA 1RHHA 4OFYD 1TSHA 3H7BA 5IMOA 3W9DA 1H8LA 1OVZA 2OSLA 3UJTL 2ZSWA 3DUSA 3KR3H 3WGVB 1NIFA 2ZYIA 1QQDB 5I1CL 1N8OE 1R24A 2QFRA 2Z1KA 2XQYK 3GIVA 4GRMA 2EH8H 3U9WA 3KVPA 3VQMA 2NDFA 4UILH 1ZANH 4XCCL 1TVDA 4JW3A 5JXED 4BDVA 2LFGA 4FXGB 2R4SH 2FSEB 2XN9B 4WEMB 3VXTA 2NY2B 3FQRB 3ATEA 2CJTA 2NTSP 2ZXWB 5L88H 4YHMH 3QEGL 1LFMA 2X88A 3ULSB 5K9KA 3AZUA 3O6FD 2N01B 3ARWA 5I6MA 3D39B 5GS1C 1GZPB 3FJTA 5J6SA 5B39A 3HZYB 2BZCA 4ALAH 3PL6C 4HJSA 1TMQA 1C5DB 1E5AA 4F15B 3REVB 3MRCA 4UTBL 1YUHB 2AF2A 5EU5A 5JUEL 4KV5E 4XCYA 5BNXD 1R34A 2EIMB 1A9EB 4XR8C 3L95A 1MI5E 4F2FA 1EEQA 5BCAA 4YE4H 2YA0A 3WIHH 5KAQG 3DVGB 1VGEH 4I3RL 3V0AC 4KRLB 2VQ1A 5F7NC 3QXVA 4KKLD 3RPIA 2UZYB 2EH7H 4XWOD 1H8SA 2GI7A 2PTTB 1ZHLA 1DJXA 4NGHL 2XHNA 1FN4B 1TZHB 3RPIB 2BIHA 4UIKL 4HK3N 1MFBH 1Q9KB 3MR9A 1N6QL 3CX5D 4TYUA 1FZOA 1OO2A 5I5RA 1OPGL 1E43A 5CINL 3HRZA 3UYRL 43CAB 3PNWB 1HJ4A 3QUZD 4FQXC 4HUUB 1DEEB 2X3BA 3IEAA 2FO4B 4WI3A 3NZ8A 1A14H 2FEDC 4YXLH 3TT1L 1FO0L 4J5VA 3VSUA 1A9BB 4LP4A 4XGZB 3E2HB 4DH2A 2LE9A 4BH8B 4N2CA 2V5TA 3QK0A 4TRPL 2NTFA 2CDGA 5D7IA 2GJJA 5DD6B 4B9CA 3DRQA 4NKIH 3FB6B 4PG2C 4PGZA 4YDLC 4C59B 3O8XD 1MJ8L 2W0FA 3PFQA 1YCCA 1DSYA 3PREA 3HZKA 1G6RA 4P2YA 1DFBH 3SPVB 2Z8SA 4PGCB 5ICYB 3MUY1 1UA6H 4JUSA 4EKJA 1CFTA 1ACCA 1JZ5A 1U6AL 4PW9A 1B6UA 2ZCLH 3B83A 1T83C 1DJSA 3CDZB 1RU9H 3SKUD 5I30H 3IBEA 2CWRA 3OAYH 4S10A 3C08H 5D7KD 3H1ZA 1CK0L 3RGVB 3UACA 5AYTA 4HX1B 3VWJD 1LNUA 2G75B 4LCWD 5HHNA 3W9EB 5FA3A 3ARFB 2FIKB 4MJIB 3T0DA 2NY4D 2WNXA 2FJFA 4ZO9A 1P5UA 5HGAB 4ZW6A 4BIKA 5HDBE 2FK9A 5CAYB 2YSTA 4PJ9A 5M94B 2W0PA 4Z7OF 5I6KA 2G0KA 3LH8A 3ZDYB 5JOPE 5EHFA 3TURA 2CDGB 2ZKMX 5E1IA 1GTNA 1YMHB 1ZHKB 2IXQB 1P1ZA 2BW5A 2SEBB 3DNKA 3GMRB 2CD0A 1OSYA 4K3IA 3VRDA 2AQPA 2EE2A 4N9GB 3RZWA 1FLRH 3D4YA 5IJVA 2GABA 4NQCA 4BH7B 3V4LA 2Q8AL 3ARQA 3KXFE 2DMCA 4H0JA 2Q7NA 5LQBH 1BVLA 4OGYL 2VLKB 1UGNA 2EYTB 2UZIH 3LRGA 3MRPA 4R84A 4X2UA 3LS5H 2XPGA 4Y4KD 4HOMA 4LMQI 4KVPA 1DIIC 2PXYA 4YHYB 2GB2A 2F58L 4JHAL 1X5XA 4ZODA 1FOCA 1Z3GH 4HXBL 4ONOA 4AIOA 3ZTEA 4TLKA 2EEBA 2WUBH 3D9AL 1RIHL 5CO1A 3FC8A 2C3XA 3O2DH 4HS6B 1Q72L 4RZKA 3QQ9D 4G9DA 1AYRA 5I0XA 3C09B 4HJEA 4UQ3B 1R46A 2VM4A 1UB5B 2DQCH 4JR9H 1B0GB 2HTLC 5F7WC 2AQNA 4B3VA 3I50L 3D25A 4QXUH 3GRBA 4UT6H 2XWTB 4KQ3L 4K7FA 1NCCL 1UCBL 2VLKD 1KOAA 4ECNA 3GJEB 5EA0H 5EUKA 4DO5A 5F93C 3NEOA 3QORD 4FTVA 1I1YA 5D7SL 2BIIA 3LNIA 1JL8A 4DEPC 3P30H 1A4KA 1IJNA 1T83A 5DC2A 3WFCC 1A21A 1OHZA 5D5MF 3FB7A 1RJZA 3MJ9H 1SQBD 4BA0A 2ZSVA 4ZUSA 2CRIA 2PTTA 4NFDA 1SQ2N 1SN5A 2V33A 4OZFG 1MFMA 3B6SA 3GMPB 3MTRA 4DGVL 2DBJA 3HPLA 1UXSA 3EYVB 1D5BA 4X6DA 5E6RB 1NMBL 3JTBA 3TYFA 1X5AA 1B90A 4D8PA 3L3DB 2WQWA 5E8PA 5ENWA 6CGTA 1DJWA 2P8PA 3WFEH 2XVBA 5EIQA 3PIQA 4Q9R<