3ZIYA

Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.01 a resolution
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
457
structure length
457
Chain Sequence
KLPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKMPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRAQPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 131
structure length 457
sequence length 457
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3ziyA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ziyA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ziyA02
1CHHA 2EXVA 1L9TA 155CA 3H1JD 3KW7A 5E9NA 1AG0A 3A0HV 1BCCD 5DJQB 1HFUA 3DIVA 2QT6A 3EH4B 5I5MA 1ZDSA 5CIGB 2C9XB 2YQBA 1AS8A 1IRVA 1OCCB 1DW2A 1YLBB 3WFCC 1C52A 1NMLA 1DYZA 1FI3A 4FANA 1QL3A 3AW5A 2BP8B 5I6LA 2AI5A 1QL4A 2MTAA 2BH5X 3C2CA 1I54A 1OCOB 1CSVA 1W8EA 1XMEB 2OZ1A 1CXCA 3BQVA 4YSUA 4RSZA 3GDCA 2XV3A 2XV0A 4PAZA 3TA4D 1AZRA 4DPCX 5B7FA 4CSPA 3L72D 2I7SA 4N8UA 4DPBX 2MRYA 5B66V 5KLVD 3NBTA 1PF3A 3VYMA 1SQXD 2BP0B 3CYTI 2CUAA 3NSFA 1DIIC 4GYDA 3T6WA 1WAEA 2GHZA 4E9VA 1AAJA 2JFCA 4FA7B 2HLEB 3A9FA 2FJSA 4HIPA 4U3FD 4P5RA 1V54B 2EIMB 5D4HA 1WS7A 3FYIB 2QPEB 5KAFV 1B7VA 1H1OA 1W6LA 2HRGA 3AG3B 4GP5B 2EILB 1JZIA 3NT0A 1A2SA 1NTDA 1CXAA 2AVFA 2DGEA 5B1BB 1A65A 2R7EB 1CRYA 1L9RA 3BVDB 1PZBA 1EZVD 1AR1B 2I85A 1DT1A 3X1GA 1XB6A 1L9BC 2ZONA 3ABGA 3WUIA 2B3IA 1RZ6A 4K9JA 1ZDQA 2WO2B 4G7RB 1GKSA 4WQ7A 5CIBB 1KDIA 2YAHA 1CC5A 1ZZHA 1W5CT 3L73D 1ID2A 4HZ1A 3ABMB 5FC9A 1AQ8A 2YAQA 3O0RC 3DR0A 1MZYA 1NIFA 3OMAB 3CG8A 2PCBB 1JZFA 5B7MA 1CIGA 4KOCA 1H33A 1NTKD 2IAAC 1GR7A 2XU9A 2IWKA 4EIFA 1M57B 1H9YA 3RN1A 2E86A 1CO6A 3MX0B 2XUWA 4YSEA 3CP5A 1H32B 4QAOA 1NIDA 3A0BV 4DP1X 1BQKA 1CIHA 1HH7A 2B10B 2L4DA 1AG6A 1N50A 4H0KA 4WQDA 2BWDA 4WQCA 3VNWA 2EIJB 2P80D 3OQRA 4G7QB 2PCYA 4YSPA 1CYJA 3OD3A 1OCZB 5E79V 5GTIV 5KLIB 2GC4D 3T6XA 1CSXA 2JXMA 2QDWA 3ORVA 1N9CA 1JZEA 5TISV 3CDZA 4AALA 3WFEC 2BLFB 2FTAA 6PAZA 1HZVA 1ETPA 4XXLA 3OCDA 1EHKB 1QKSA 4E9RA 2C2CA 4KNTA 1K3HA 1M70A 1E67A 2OCCB 1NDTA 4P5SA 1IKOP 1EB7A 4KOBA 3PAVA 1QHQA 2BHFA 3ASOB 1NICA 1J5CA 4ZK8A 1CIEA 3FS9A 2IBZD 4BWWA 7PCYA 3QJQB 3HQ6A 1SFHA 1MG2C 1MDAA 3ZOYA 1W2LA 1DVVA 2J55A 4YSTA 3L4OA 1JZHA 1L9OA 3CX5W 1H33B 4E9SA 1GU2A 3BCCD 4LJIA 1S6VB 1YFCA 3CX5D 4A2EA 2OJ1A 5I28A 3H1HD 3QJVB 3GXUB 3IBOA 3AG1B 2W8CA 2YCCA 1QLEB 3CVBA 2VSMB 3H1KD 2AFNA 2FQGA 2FNWA 4UB8V 3T6ZA 1ZIAA 2BO0A 4FA5A 3D12B 3ERXA 3FU8A 4DP4X 2VW7A 3JT2A 2HRHA 2JQRA 3SJLA 1A4BA 1CRIA 4PW9B 1NINA 4JKNA 4DP9X 4IL6V 1AZNA 4PJ0V 1J9RA 4YSOA 1ZIBA 1NTZD 3T9WA 2FYNB 1CCHA 3OCDB 1IUZA 4YVUA 3S3DB 1C6SA 3PXTA 2NRDA 1ASPA 4JHVA 3S3BB 1MG3C 1GS7A 3DMIA 5B1JC 1SQVD 4Q8BA 5AKRA 3UAAA 2UXTA 5CIHB 1FI9A 2Q5BA 9PCYA 8PAZA 2BP8A 1YCCA 3FPXA 1KV9A 1N70A 3WIAA 1E5ZA 1DVHA 3SWSA 1KYAA 1SHWA 1E2RA 1GY2A 3X1FA 1CUOA 1U75B 3FSVA 1KCBA 1J9QA 1C2RA 3CVCA 3NP3A 1X9RA 2UXGA 1I5TA 4K3IA 2JTIB 4FAVA 1QNIA 2R7EA 1GQ1A 2VN3A 1I55A 1SDDB 1U74B 2XX0A 3NBSA 3QJSB 3ZOOA 4AZUA 2GB8B 4YE1A 1GYCA 1WA0X 2GC4C 1M9WA 5TK4A 2QPDB 3RMZA 2YXVA 1BXUA 1KYOW 1PLAA 2N9IA 1C75A 3SVWA 4NERA 1CYCA 4UF7C 2XXGA 3L45A 2Y1AA 4F7KA 2YAOA 3S8GB 1DZ0A 3HQ9A 5CIEB 5I6PA 1FI7A 1YNRA 3X39A 1YTCA 1V10A 4UB6V 2W88A 1NIEA 3PLYA 4W9ZA 5A7EA 2J5WA 1JZJA 2IDFA 3AG4B 3PXSA 1JXGA 2MTAC 1CC3A 2B0ZB 1FHBA 1HZUA 1M6ZA 1CYWA 1VLXA 1BXVA 3SBQA 4E9TA 1NIAA 1LC2A 5ANHA 2PPCA 3QPKA 2HV4A 1ADWA 1H9XA 1KGYE 2CXBA 2AZUA 1GIWA 1GW0A 2DV6A 3NJNA 4JHUA 3X1EA 4YL4A 1CNOA 1PLCA 1AOZA 2C1VA 2H47C 1GJQA 3PXLA 1PLBA 2FT6A 1VYDA 2PPEA 2YAFA 5PCYA 2J56A 3M97X 3MBWB 4PWAA 4D6TD 2AZAA 1PY0A 2IH9A 4NFGB 1MZ4A 5C0ZA 5H2FV 2VMJA 3IE9A 2QDVA 1AZBA 4KO7A 1ET7A 1FOCA 3ASNB 1NIRA 4L3GA 1F56A 3NSDA 1YEBA 1L0ND 2DWSA 3KZIV 2DVHA 1H31A 2ZXWB 3L74D 2FQFA 2I7OA 1CCRA 4GEDB 1JZGA 3QJRB 3X1NA 1KDJA 3DTUB 3H56A 3SBPA 2FQDA 2BH4X 1BYOA 1I6DA 4H0JA 1L9SA 2XVBA 1M60A 3NYKA 2XWZA 2FQEA 2GBAA 3QJTB 5I6NA 1M56B 2JKWA 1CRHA 2OV0A 2ZWNA 2DYSB 4QLWA 1C6OA 3O20A 1MG3D 1NTMD 2B4ZA 2BGVX 1AKKA 2UXFA 1COTA 4FA1A 3EH5B 1CYXA 1I6EA 3TBCA 3FU7B 5DJQC 3NJLA 3NJGA 4TXVB 1WA1X 4EF3A 4NAJA 4FAAB 1RKRA 4P4QB 3AG2B 2B11B 4X4KA 6PCYA 2PP8A 2BP0A 1F1FA 3CVDA 3NJJA 1H32A 2BCNB 3DKHA 2HXAA 2HX7A 4PD4D 1PNDA 1GSKA 3S3CB 4G7SB 4A2FA 1X9UA 1PNCA 1ZV2A 3UADA 3NP4A 1IBYA 2H5UA 4AX3A 3H4HA 5AURA 4WQEA 1RCYA 2HZHA 1ASOA 2YXWA 3FQYA 7PAZA 1GY1A 3SQRA 3WNIA 2CCWA 1KX7A 2XXFA 3MK7C 2HX9A 4DP0X 4WTQA 4YSRA 1T5KA 4AKQA 4YSDA 5I6KA 2X87A 1CURA 2PP7A 1HROA 1BL9A 1AYGA 4KO9A 1E65A 3ZCFA 1MG2D 1A4AA 3ABKB 5EXQA 3QQXA 1HJ3A 4N4YB 1E5YA 3CXHW 1I53A 1YICA 2XLLA 4L0PB 1URIA 3TGUD 1ZPUA 2VM3A 1HJ4A 5I5IA 3T6VA 4GY4A 2ORLA 3ZIYA 2BZCA 3VRDA 2EIKB 1EZLA 1NWPA 1PCSA 2VM4A 4HHGA 2X88A 2OZ1B 2GC7C 1LMSA 2VW6A 4YSCA 1FFTB 2CJ3A 5I5JA 3JTBA 4KO5A 4YSQA 4BDVB 1XB8A 2A06D 3NWVA 1NWOA 2N18C 3NJKA 4A2HA 1JXFA 1QN2A 2Q9OA 2FRCA 3HQ8A 4GP8B 2QJKB 3ZOXA 1SFDA 2FWLB 1NMIA 3ABLB 2UX6A 1A56A 4AAMA 4A66A 2PCFA 4Q89A 3O1YA 5IY5B 2XYBA 1LC1A 1TKWA 4KO6A 1NIBA 3TYIA 2GIWA 2GI0A 1JVLA 2HX8A 2YAPA 3KW8A 1SQQD 1E30A 2IWEA 4V2KA 5D4JA 3UAEA 4QKTA 1SQPD 4HCGA 4WKXA 1OOWA 1SDDA 3FQ2A 3PPSA 4BXSV 5DF5A 3OA8B 1AANA 2YIUB 4YSSA 1RAPA 2VSKB 1RAQA 1NPNA 3NSYA 5LDUA 4O1QA 2MHMA 1A8CA 1KYOD 3NSCA 2J57A 1GS6X 1BAWA 3ZX1A 2N9JA 1XB3A 1HRCA 1N15A 1C7MA 1WS8A 3FSWA 3N55A 5D4IA 4YVNA 1RZ5A 1I8PA 4Q5PA 4M3HA 1YEAA 1OE1A 4EIDA 2IDUA 3WFBC 1BQRA 2WSDA 4DP8X 4BK5C 2BCCD 5B3SB 1CORA 3H1LD 4DY9A 1F1CA 4HCFA 4BDVA 5AFAA 2V08A 5GTHV 3X1BA 4HHWA 2XTSB 2EINB 3FQ1A 3NJHA 2GIMA 1KB9D 2PPDA 1MZZA 2FWLA 3N2JA 1UATA 1AZUA 2IWFA 3X2QB 1FJ0A 1S5LV 2A3TA 4PCYA 1A8ZA 1JVOA 2CALA 4WQ9A 2P80A 1CEDA 1PPJD 3TU6A 5I6MA 1NNOA 1YIQA 4BWTA 3OM3B 4F2EA 2AIUA 2CE0A 1A4CA 3PAZA 3CU4A 2V07A 1NU1D 5TK2A 3WC8A 1CHIA 3JBTB 3CZUB 2QJPB 1SF5A 2IH8A 3H4FA 4M4RB 2VW4A 1IRWA 2FT7A 1WEJF 2D0WA 4UAHA 3U25A 1JDLA 1IZL0 3TASA 1LFMA 1PMYA 4G72B 4DP2X 4AANA 1CIFA 4AAOA 1PZCA 2RACA 4DP7X 1OE2A 3UACA 1SQBD 2C1UA 3WG7B 1V55B 1DW3A 3OMNB 2VHDA 2ZONG 5CIDB 3RN0A 2ZZS1 1AZCA 1ASQA 2AXTV 3L71D 1A3ZA 2PPAA 1ET8A 3V9CA 1I8OA 3HB3B 1OCDA 3NJFA 1OCRB 1P84D 3PXWA 4HCIA 2ZOOA 3FSZA 2ZBOA 3L4MA 5CICB 3L75D 3EF4A 4E9QA 4E9YA 4KMGA 3UGEA 1L9QA 4YSAA 2XX1A 4BWUA 1CTYA 1OAEA 1J9SA 3V9EA 3IEAA 1HAWA 3PH2B 4NB7A 3T71A 4L1QA 4KNSA 2YARA 2N18B 3QJUB 1NZRA 4GP4B 3MK7B 4AKOA 3L70D 1ETJA 1CYIA 1GDVA 1E29A 2BW4A 4WQ8A 1BE3D 2C1DA 1JERA 1KB0A 1TU2A 1PAZA 1NPJA 5B7EA 4XYDB 4DP6X 1PZAA 1AACA 2IDTA 4DP5X 2PP9A 4EIEA 2BW5A 4Y5RA 2QJYB 2YAEA 4HAKA 4GXFA 4RH4A 1GS8A 3WNJA 4FA9A 5B1AB 5I6OA 2B08A 1K3GA 3GYRA 2FYUD 3OMIB 4W1TA 4E9XA 1FWXA 1N68A 1CTZA 1SF3A 4MU8A 3RLMA 4E9WA 3SXTA 3WU2V 1IC0A 1TEGA 1CSWA 3FU9A 4G70B 1N90A 3CDZB 5B1KA 1ZRTD 3G5WA 1CRJA 2GB2A 1CRGA 5DFSA 3IN0A 3SBRA 2CA3B 4DPAX 3WKPA 1KBWA 1OE3A 2TSBA 1PP9D 1TEFA 2WO3B 4L3HA 3HEIB 4AKPA 4BXVA 1C2NA 1JXDA 2PACA 1FCDC 1ILUA 1HJ5A 1C6RA 4FB1A 2N3YA 2CAKA 3ZDWA 2UX7A 2I8FA 1BEXA 3CWBD 1AS6A 3FSAA 1JOIA 1SHXA 1KIBA 1KBVA 3IN2A 5B5EV 451CA 1AS7A 1WVEC 2PCCB 4WQAA 4ENZA 1HCMA 1RZQA 1DIQC 2FT8A 1IO3A 1KCWA 2B12B 2C1DB 2GC7D 1LS9A 2DYRB 3NJMA 5CIFB 2BZ7A 1BYPA 1R1CA 3SLEA 2N0MA 1CRCA 2UXVA 4KNUA 1FA4A 4WQBA 2PPFA 2CA4B 3RYMA 3CXHD 5KAIV 5F7AA 1DW0A 1B3IA 2DY2A 4CSZA 2YK3A 3DP5A 2N3BA 2C8SA 5C9MA 4A67A 5KKZB 1E8EA 3ZBMA 5AZUA 5F7BA 3O5CA 4O1WA 3WKQA 4N0KA 2DWTA 2YAMA 4FA4A 3UABA 2PLTA 3NJIA 1SJMA 3AY2A 3PCYA 3TBBA 2CBPA 1ILSA 2AANA 1QYZA 4F2FA 3HQ7A 1H31B 4EICA 1L0LD 1RZPA 2LIRA 2XV2A 5B1JA 2GSMB 1L9JC 1J9TA 2LLNA 1KX2A 3FU7A 5EHFA 2TSAA 4A2GA 1J5DA 3PAUA 1AOFA 1CSUA 2D0SA 1CHJA 3ZOWA 1AOQA 1J3SA 1AIZA 1HAUA 1L9PA 2IDSA 1BGYD 2IDQA 3FT0A 4MFHA 1ET5A 5PAZA 3OA8A 4A2DA 4J20A 4UANA 3EH3B 2BPBB 4GYBA 1OF0A 5CYTR 4A68A 4HALA 2BWIA 1IQCA 1CTJA 1KV7A 3AZUA 3WI9A 3C75A 1IBZA 3S8FB 2LITA 1R0QA 1BXAA 1WA2X 5IY51 1DW1A 2H3XC 3EHBB 351CA 2CE1A 5I26A 4AI7A 2Y69B 3WFDC 5B6QA 1BQ5A 1W6WA 3FYEB 4G71B 1SNRA 1OV8A 2ZXYA 3H1ID 4JCGA 3FPYA
chains in the Genus database with same CATH superfamily
2YRZA 4O2CA 3VFUB 3R18A 1GGIL 5A2IH 4MA1B 1AI1L 2F19H 3MNVA 1FO0L 2DQCH 1EH9A 3QZWG 2MTAA 4HMDA 4PLOB 3LZRA 2BH5X 3A4AA 5HI5C 5T1LA 1K5NB 3PHOB 4Z7IA 2X09A 3GDCA 2Q8AL 4QHUA 1WHPA 2YO3A 4PI2A 1CBJA 1XEDA 3QC5X 3BUYA 1NC2A 4H5SA 4Z1PA 4GUOA 4WEBL 1A4KA 1YEDB 2ZYRA 3FQRB 1DVSA 3WDJA 2R1WA 4Q74A 1JZ3A 5D4HA 4CW1A 2D7PA 1G1KA 5DJDA 3O41A 5BNXD 4R0LB 2IADA 3DI2B 2AEQL 1WG3A 1JZIA 1DDHA 3ARGD 1FRGH 4G6MH 3GLZA 1BF2A 4PJGE 4Q97A 1T2JA 1P0SE 1OARH 2ZICA 3WCYA 5FLVA 3HLKA 4UDUB 3UIYA 1DT1A 3W38A 3ARBC 3HG4A 2H32H 3FT1A 2BVQA 2VR6A 3RWCB 1PY4A 4PJDB 4XXWA 2WBXA 3QPQC 5FC9A 3KPRB 4GPVA 3QQ9D 4JO2H 1NOLA 5ESVA 1WFNA 5IB1A 1ECYA 1XR9A 5KSBB 2WXJA 2EVGA 2NR6D 3T0WA 3LKSA 4JFYA 2P8PA 3VXNB 1S7QA 2GJ6A 3MLYL 3MCLL 3VXUD 3MUZ1 4NO5A 3MMEB 5J9PB 1U58B 2VH5H 1EDQA 1OAZH 2AQNA 3ES6B 3EUDA 4B97A 3LQAH 2MPAL 3BVVA 1BQKA 4Z3HA 1S3RA 5T1KA 3ELQA 2EIJB 3QWOB 4WHCA 1Y7VA 3HJEA 2PCYA 3IKCB 4BUHA 3GBMH 1IV8A 1Q0YL 1DUZA 4L8BB 3Q5YA 3IF1B 3H55A 2H26B 2DAVA 3FCSA 5B3NA 2YLKA 1LK2A 4MTMA 5HSFA 1O5DT 3CFJB 4LZKA 5I74B 3REWB 1GJUA 3U9PH 3QT2A 1NDTA 1D7FA 3L9RA 1MCCA 1SJHA 4G42B 3KPRD 2HA1A 1A3RL 4FABH 5BO0D 2Y2YA 2ZOUA 1W91A 2WBWB 3WENA 1NL0H 1ZTXH 4AEFA 4QJ4B 4CBPA 5I1GL 4TKWA 3SKOA 3CK0H 1KB5L 1CLZH 4GG8A 4MAZA 2XTSA 3F5WA 4H4NA 4KK6C 4PGCA 3A6CH 2YCCA 1LTXA 2BWQA 4RGOL 2FX8H 1JJUA 1VIWA 1OLLA 3JVFC 5C08A 3T0EB 4B7LA 5GS0D 2X28A 3A3YB 3T6ZA 1U8KA 1LM8V 4NQDB 1UXMA 3SY0A 5KTEL 4WHTA 1IAII 2ARWA 2VC2L 2AJVH 3FU8A 3OAZH 4GAJL 3R19A 1N59B 4WJKB 4YBLB 5EO0B 4AXWA 2V7HB 1BJ8A 4IL6V 1AZNA 4AEHL 4JUTA 2FJGB 3OXSA 1J9RA 1X4ZA 3RKPA 1DBML 4QO1B 3SPHA 3EYQC 5K59F 4H8WL 1JV2A 1DQQB 2FUTA 2NRDA 2JE8A 3IDUA 1C8QA 3FB5A 3BKYL 4UM8A 4EJ1C 1BLNB 3G6JA 5AKRA 1NGYA 2A6KB 2EDOA 4GRMA 1ZXQA 4WGKA 5FUZL 3ARDC 1LVEA 3QUXD 4MAYA 5I18H 2IQ9H 1EEZA 4LL9A 3LZQA 4WHYG 4PJBB 5DHVA 5EU7C 1AQDB 1I1AC 1G94A 3FL7A 1JF1B 1P69B 4XN4A 4HJ0C 2OXGB 1YN7A 3NTCH 4K3IA 4HWBA 2G0KA 2EICA 5DYOB 4YE1A 4HWZB 3KCWA 3LH9A 4UIMA 1IGFL 2YXVA 4EI5D 3MLVH 3LEYH 5GGRB 3SVWA 2WXQA 4MNQE 3I84A 4NP9A 3PQYB 2IEPA 4JZNB 3VI3E 5I6PA 2B4CH 2E59A 1YTCA 3GI9H 4KVNL 4QXGH 5DQJA 3GHBH 3O3AA 4WCYH 4QOKB 1DO6A 1HEZB 3VH8G 2NY4C 1YN6A 4M6MH 1M1SA 3FO0H 5ALBL 7FABH 1UCBL 2HN7B 4XO9A 1MCEA 2F7QA 1CPUA 2OYPA 2GEQA 3ZOAA 1MCFA 2GW5A 2WLKA 4J3BA 3QRBA 2NY5H 2X1XR 4PSPA 4GW1A 5C0ZA 1F18A 5HGDB 3QIWB 2RBLA 4A6YB 4KGJA 1L0YA 1CLOH 1JZ5A 5LAPA 2EXWC 1JZGA 4HKJB 5AZEH 2C9XA 2CLZA 4LDCA 4ZW3A 4G8GD 1BYOA 3FO1A 3RUGF 1KBKA 4B7IA 3BYTA 1NLDH 1I9RH 4PMEA 3B1TA 3TVMD 3QEHA 3LKRB 1EZVY 4LXFA 4PHZA 4B0MB 2DI8A 2FGWL 5DZVA 4ZMOA 1X6NA 3ZTJG 1MCNA 3VM5A 4QTIH 3X3GH 3X17A 1QG3A 2WXHA 4PJ9A 1QBAA 1NCTA 3DV6A 4GKZA 2A6JA 2YGNA 3MNZA 3IJHA 3HRPA 4JM4H 4UQ2A 4X8GA 2BNRE 2CO7B 4BHUA 3DWTA 3WO4B 1KIQB 4WKZB 3H4HA 4AGQA 4V2CB 2DD8L 2HYMA 1CYGA 1Q9LB 2Z35A 3FOMA 3STZA 1PG7X 1ZGLM 3FN3A 4RNRB 1KC5L 1AMXA 1IBFA 4LVOB 2Z4QB 5HDBE 3UTSE 3I2CH 3MRJA 3LDBB 1FGNH 3GSUA 1XGPA 1H3XA 1LO5B 5ESAA 2B9AA 1IBBA 5ALBH 1KN4H 3QB7C 5DVNA 3MRRA 3GSXA 4FNLL 3ZQXA 4EDXB 4Q9RH 4QRPA 4PJ7A 5I5IA 5MI0C 2PO6A 5C0EB 1CCZA 4Y2DD 4U4IA 4G82A 5E8OA 4P23A 1IGJA 4AYMC 4LDOB 1QKZL 3B9KC 1YY9D 1ZE3C 2CDGA 4WZ9A 3CH8A 1U8NA 5JHMA 4K5OA 3C5ZC 4B9CA 4W9JC 2BS71 2NX5A 3LEYL 4F9LA 2UX6A 2YUXA 1LL1A 1AR1C 3L9YA 1CK0H 2I9LA 1MDTA 1TVBB 3VWJC 4PRHD 1BJ1J 2X4NB 4Z5RA 4B9JA 1BYNA 4OD3H 1IM9B 4WENB 2Y1YA 3VFNA 1PY9A 2EE9A 3KYNA 3ZHNA 4AYFB 1GCFA 2BNRD 5F89A 1E5CA 2VLRA 4WRLA 4J3UA 4C56B 5MI0B 4YHKL 3RURA 2H7WA 3SOBL 1T6BX 2IQ9L 2OTUA 3CVHA 1TIUA 4G9FA 1MVUA 1Y6KR 3FCGA 5ETUB 2K78A 3MRPB 3WFBC 3BKYH 5TF1H 5KVEH 5TQ0H 1P7BA 4DY9A 1RZKC 4BDVA 4WWNA 5EORH 5DJ6B 1I9IH 4NO5B 4CC4A 4H8UA 1SPDA 1XR8B 2EACA 5CUSH 4PGJA 3S3SA 3WIIL 4O2FA 3AT8A 1P7HL 4ZW7A 5F2FA 5AAWA 1N5YL 2AQQA 1IARB 1JVOA 5KTEH 5IMKA 3H0TA 1NCBL 4LRNL 1JWMB 3PAZA 1AGCB 4G1EB 1RZ8A 1KB3A 3CZUB 4GFTB 5IW1B 3CH1B 4BSVA 4WW1A 1SF5A 2DLGA 1CLZL 2HLFC 2YXFA 3MV9B 4AT6A 4M7JL 2LAGB 4FA6A 2WZPA 3BGMA 3CMOH 4W68A 2ZNWA 5AVWB 1T7WA 1ZTXL 3L4XA 3MODL 4G72B 4I9WD 1G7IB 1EVUA 3ZT5A 4BQCA 3P4MB 1BMWA 1SQBD 5DJCB 2VHDA 1UD4A 2ZONG 3BWUC 4PJ9C 2AXTV 3B34A 5FX3A 5C0GB 3QNZA 5IMMA 3BP6A 1M7DB 5MEOB 5FM4A 5A6LA 4JPQA 4ELKB 3G6AA 2ZOOA 4WEMB 1IAIM 2OK0H 1P1VA 4E9YA 3F5WB 3EYUL 5EV7A 1OTUD 5IJDC 4UQIM 1NSNL 4O2EB 5E6IA 1F3DH 1YNKL 4FZEL 5FUOH 5FYLH 2X3BA 3ZLQC 4WHTB 5I23A 3MK7B 1ETJA 4N24A 2CXKA 2AJSL 3IPBA 3FT4B 3BFWA 2VH5L 3F84A 1UH3A 5MENE 3AXHA 2XG4B 5J12C 3MRBA 2WZAA 2YAEA 5D1QC 4K4KA 1MCWW 3PWPE 3FB8B 1ZA3A 2YSSB 4GQ9H 3LKNB 5D72L 3O9WA 4OF5A 5DLML 2B08A 3R4RA 1HXYB 2AVGA 2ENJA 1BFVL 3BT0A 3FMGH 2H41A 4N2KA 3VXME 4M6AA 4F7EA 2DTMH 1MW0A 3D05A 3I9AA 3P2TA 1NEUA 3SKJL 4JEGB 4XNUL 1LO3H 1VAHA 2WO3B 2HFFB 4AQ1A 5FYKD 2WLZA 4P2QD 2AABH 1TQCC 3U4EA 4YR6A 2Z9TA 2XWDA 2XRAH 4HX1B 3ZR6A 4FB1A 4DTGL 4IRSA 5F9WC 2EDKA 2K6WA 2WC7A 4M7KL 4Y8DC 2DQJL 2ZKXA 2FH8A 4J3XA 1KPUB 4FS0A 4N1CA 4YFLI 4ZMTA 3NZUA 1RZQA 4L1HA 3VXSD 1XF3B 2X1QA 1AZVA 4Q4IA 4NRXB 1NC4B 1WICA 5EU4B 3UCQA 4UZUA 2AQ2A 3NK4A 3QUKA 1CFTB 4ZOEA 2Q1EA 4MB4A 2D9QB 4L3FA 5SWSE 4JG9A 4LHUD 2XA8L 3KCPB 2UY7B 5J56B 5D93C 3G5VB 4KJQD 3IDYC 1E6OH 4GAGH 5F97E 3V0DA 1S78D 4WHDA 3RVWC 5E1QA 1X5FA 1JV5A 4YK4B 4U1JB 5FYJU 5B38G 1HTYA 2QPFA 1PLGH 3IJEA 1AI1H 2AANA 3WJJA 2E7MA 1YNLH 4MHHI 3SPJA 2VLME 3VXRE 3QQ9C 3SDXA 4AOFA 4OB5L 3LMJH 2Z34A 1RQ5A 2DMBA 3O6MH 1J1OL 3LN4A 1G7JA 1QRNA 2Y5QA 2ENSA 2IDQA 4K7FB 12E8H 1BDYA 3MLWH 4AVJA 4U6XA 2GY7B 2VMFA 4TSCL 3RWEB 5AYUH 2W0KA 4B9IA 1WA2X 3WEBA 4OLUH 3ZYZA 1EO7A 2QKIC 4N2FA 5B6QA 3DUHA 5DRXA 3C5JB 1W6WA 4MSWB 1I75A 3CBJB 3L16A 3I85A 4HGKC 5FAAA 2JK5A 5I8EB 1CXFA 2ED9A 1KGXA 3WFHA 3KW7A 4PRNB 4K9EL 2FLMA 2YQBA 3KPOA 1FI3A 4JFTA 1QL3A 5I1AA 3BVUA 4P3WA 4KMTL 3Q48A 2YD3A 3GMRB 4PR5B 3SDYH 4XP6H 3BN9D 1S7SA 1TEYA 4FNSA 5DTFA 3NIFB 3QDMA 5AB0A 3GRWL 2N7SA 5EC2A 2L04A 5B66V 4NM8L 4U1MB 1J8RA 2XN9D 1CL7L 3NSFA 3TBSA 2B2XH 1LLAA 1MLBB 4MMXC 1BWMA 2DQGL 2FJSA 1KY6A 3SDXF 5JPNB 3D07A 3ATAA 3QZMA 3IMBA 1CFMA 1MCKA 4FZ8H 3ZDZF 32C2A 4DEUA 5E70A 2GCYA 1ZLWK 4HUMB 2BC4B 3DC0A 2DGEA 1A8JH 2NY2B 3CHOA 3NA4A 5DQ9A 5LQBH 4OCRL 3HC3H 1R3KB 4G80A 3U0TB 1MJ7H 1QWUA 2HUHA 4MRBA 2VMEA 4GW4B 1KDIA 3GSWB 1QEWB 1AQ8A 1KBGL 3Q2VA 1BBDH 2ZCHH 4JRXD 1X3DA 3D2UA 2EAEA 3ZDYB 5CMAB 1GAFH 3P0GB 1XD0A 5TTRA 4HPOH 3HE6A 4X4ME 4LVEA 4NO2B 2IWKA 3EBIA 4FJZA 4NXKA 5AW5B 2ZKWA 1NLBL 3B7SA 4G7YL 3OHXB 1KLFA 4APQD 4QAOA 2DBLL 3IFNL 4S1SH 2L4DA 2F9BT 4LCCC 3IJ7A 3CBRA 3DJ9A 3RNQA 4XWOD 2ROXA 5GTIV 1P4IH 5KLIB 3LS4H 3BAXA 1JYNA 1QAWA 3QYCA 4PW9A 1OGAB 5HJBA 3RVTD 3OJDA 4BIKA 5D6CA 2BLFB 1E9PB 3BRGC 3NFSH 2JKIS 2VDMB 3M86A 4LLMB 2BSTB 5H37H 1F6AB 1LK3H 1EO8L 3QUML 5D1XC 4NQXB 3QJQB 1NAML 3FFCE 3LN9A 1SVCP 1MDAA 3B43A 3V6FB 4DUWA 4A39A 3QA3A 1NUNB 2DQJH 4WSGA 3H9YA 4L9LA 4M7KH 4PJHA 3RL1B 1QFWH 4Y2DC 4PJBE 1MWAH 2JH2A 1GZPA 1N64H 3J2PA 4WW1B 3RA7H 3H8NA 1ZE3H 1C5CL 2YRBA 2YZ8A 2VDNB 3JVGA 1BG1A 4W4NA 3SKJH 1ETZA 4X5PA 3G5ZB 5GSVA 5HJ3A 4MLIA 4Z77A 4PJ8D 4XMKL 2J7LA 4OGAD 3E9TA 4LLUA 1YG9A 3D48R 4RX4D 4CVUA 3QWRA 4N8CL 2FCBA 2Q7AA 3F7PC 4R3SA 4RZKA 2BCMA 2DQUL 4YHNA 1KEMH 2G5BB 3SDAD 3OCDB 5IOKA 4M93C 4FQJH 1A0QL 4P8QA 5J6HB 3K6DA 5E8DL 4GEJA 3Q05A 4LGSB 2VDOB 4J8RA 1NCIA 1SQVD 4MMXB 3UMTA 1QWHA 4PP2B 3K8LA 4U6TA 5CIHB 4KAQH 5JOFB 1K3ZA 1MHPH 2PMZA 2VLRD 3V5HA 2OTPA 2YEZA 4J2QA 2EEBA 4K3JH 5IESH 4FZEH 4V1DA 3FSVA 1KCBA 4XGZA 5ABAA 4R4BA 1NSNH 4EEEA 1AY1H 1RK1A 1FAIH 4MAYD 3BVWA 4XMPH 3OBAA 5CILL 2NMSA 3EYFA 1S5HA 1F4XH 4Y4HA 1O6TA 2CIIB 2QPDB 5DZAA 4J3OF 4N8VB 1PGRB 3NPZB 5K9KA 3CZGA 2BVPA 3MYJB 4D8PA 5EU3A 1BOGA 1I8KB 4F7TB 3KBFA 3QORD 4HIXL 4I18A 5DEFB 1CC3A 1M6ZA 4IJ3B 1UM6L 4JR9L 5E2TL 1RJYB 3AWEA 3DRQA 2OBGA 2PR9A 3EJRA 1H9XA 4EIUA 1KSRA 4NHUB 1OP5K 1PLCA 5GJSH 4NQQA 2XPZA 3ROLB 1RU9L 4P0DA 1WYJA 3M97X 1GZQA 1L0PA 2OXHA 4PWAA 1QP1A 1QPPA 1T0PB 3WIIH 3TBYB 5C0JB 1KJVB 5JOPD 1PY0A 4YXHH 2OL3H 3RY6C 2XT1B 4LB8A 5BPPA 5L6YL 2X10A 4OZ4B 3DTUB 3TV3H 1H6TA 2FQDA 4H0JA 1WWCA 5KBLA 4WI4A 3RPBA 2Z1KA 3TEWA 1CD0A 4JZJB 5F7LB 3H7BA 3IU4H 3GXIA 2YRPA 4HJJH 3FQXA 3OC8A 2R69L 5BQDA 1I6EA 3DX9B 1WA1X 4NAJA 4P4QB 1ZV5A 1AR2A 4ODWA 3PL6D 3VFSA 1A6ZA 1Y6NR 2A73A 2BIPA 1TFHA 1NCAL 4A2FA 1FH5L 3HPJA 3LZFL 2A5UA 2JJSC 2B1AL 1UCTA 3BPCB 4J3VA 4NKMB 2OJEA 3TT3L 5D2LF 2H5UA 3FQUB 4AL8L 3V0AC 5GJTL 1ASOA 4ZUVB 4LLQB 1G7LB 2BVYA 4BH7B 4NBZB 2K9UA 5J1AB 3DDGA 1T5KA 4WW2B 4XCCL 1HCVA 3EH2A 1E0OB 4NX0A 2CLRB 3WL9B 1KPVB 1U8JB 2Y7OA 3HS0A 4AXWB 1JNNH 5AVYB 4DP4X 1GYAA 3KXFD 3U4BL 1Q9KB 3EAKA 4HIHB 1GOGA 1EZLA 4HHGA 2IFFL 2XY2A 1LMSA 1SEBA 2SEBA 2WLNA 4XNQA 3PWUB 2LABA 4YSQA 4HDIA 2EEAA 1CBVL 1A5FL 1ZT7A 2AITA 3V8OA 5CSZB 3TN0C 2Q9OA 4G7VH 4R7DA 1UJ3B 4CMHC 2Y36L 5HVHC 5TDNB 1NMIA 3NPSC 3NACH 3QQ3B 2FD6H 4OGAC 3O1YA 5I1KH 1LC1A 4QRRE 2ICEC 1MLCB 4JFDD 4JM4L 2X4PB 1U3JA 3SQOL 3WN5C 5KZCB 4AQAB 4V2KA 4P3DB 1AQKH 3SYOA 3DYMA 5BV7B 4ZODA 5AW1B 3Q06A 4QTIL 2WYTA 3RDTB 1CZ8L 2ZZUT 4APQA 2DWXA 4N86A 4X42A 3ARUA 3HUJA 2V9QA 5DCCA 3PREA 4UNVA 2CM6A 2OYMA 2CKBB 2BY2A 4I1RA 4IS6A 1D5ZB 1X5YA 5IROD 2R9HD 3RGVB 1R5VA 1P7KA 1YUHA 2G4EA 3HI1A 3AY4C 3VE0A 3ZDXB 4X5LA 4D9RE 1JDDA 5A7BA 5IIEA 1C08B 3V5KA 5LVEA 3NACL 3EF7A 3AQZA 1YY8B 4HHWA 4PY7B 2VDQB 4X98B 2NQ3A 5DSCA 1NKGA 5I0XA 1MZZA 1A5FH 4WUUD 3N5AA 4GUPB 1XBRA 1EK3A 2CALA 1M6OA 4XNAA 4RGNB 4M6NH 5DO2C 3PDOA 1J0IA 4WI0B 2V17L 5E2UH 5IR1A 3VXMD 3O8XD 4UMSA 3NEOA 1U3NA 1NU1D 1YMHB 3WC8A 1QBLH 2VR4A 4X6CA 3W0WA 3S4SB 1DQTA 4ORZC 5ADPH 5TE6H 4KZEH 1CXHA 3TGXA 3ZU8A 3CFKB 5FA3A 3FTUA 4ZMVA 4JB9H 2B4CL 1MUJA 4YAQB 4DVRL 1IC7L 4JY6A 3QG6A 4X50A 5DJXA 2YQ3A 1C7TA 4A63A 4MB3A 5I9QC 4G83A 2C4FU 2J6WA 4FKKA 4W9CC 2ILLA 2CZNA 3CN4A 3JV6B 1IGFH 5IEHB 2R1WB 5B39B 2B1AH 3SDAA 5K9QI 4JN1L 4RBPK 4YC2C 3ZT6A 1O0VA 1Q0XH 3MRLA 5FYJH 4UBDC 4N2DA 1IC4L 3L5WB 2HT3D 3L9BA 5K1VA 5FWQA 3T3PE 3FUJA 3AU1A 2VDQL 4G8FA 1N6VA 4WO4C 2RA1A 1P6WA 3L81A 1TYRA 3T0EE 1NGZB 4MX7B 4I48B 1E29A 4L4TB 4PJDF 4NDMB 4WQ8A 1T1WB 1JERA 4IDJL 4JRXA 5FUZH 3LTVA 4GI6A 3OLIA 3VFRB 1A9EB 5DMIH 3S8WA 3MHZA 2VMCA 3CDGA 4PRPA 2OL3L 5D2NE 2WXNA 3CXDL 4YXHL 5J5EA 3HVDA 4W1TA 1N68A 1SF3A 5BV7L 4Z3TA 4MNHB 5D1QE 5C0BE 1ZKAA 3FU9A 2ZD0A 2AJVL 5C07A 2QQLH 5ADOL 3W9DA 1RU9H 2AQ1A 5EULV 5CN3A 3LS5L 1DQVA 3FO9B 1T83C 3E7JA 3KYMB 1KF9B 1QRKA 2VERA 3SGJC 3A6CL 4B9YA 3CE1A 2B4CC 3GJFB 1IQDA 2RQEA 2CAKA 3EJQA 3BFQG 1UM6H 3WN5A 3QUYC 1RLWA 3BAJA 1XL6A 2PWDA 4NN6B 2I9LB 5AVUB 1WVEC 5IHZA 3SN6N 2P52A 2C1DB 5DQDH 1LS9A 2AKRB 1M2VA 1ZSHA 4HLEA 5CIFB 4PGDA 4XVJL 5KVGL 2UVFA 2HH0L 2C1PA 3S2CA 3ZDYF 2Y4SA 2VT0A 3ZBMA 3ASWA 3G6DL 5F7BA 1FGVL 3ZXAC 4AL8C 1QFUL 2KUTA 2MFNA 1Q0YH 4MA7L 4E41A 3B3BA 3TNNB 1I7RB 1ZGLA 4F2FA 1OGSA 2J1XA 3KXFB 5IHUH 1HQ4B 3BGFB 1CVRA 4P4KD 2FLRT 3ULVD 3LQAL 1OAZL 2CPUA 4MS8C 1EBAA 2ITCA 3VWJA 1XZWA 2WGNB 1HAUA 1NUFA 4DK6A 3FT0A 3MLYH 5CYTR 3M6DA 3C09B 3MLZL 4P4RB 4NP4L 1MWAA 3MFGB 1L7TH 5IY51 3UJTH 1NEZB 3Q6GH 3RUGB 5E08H 4AGOA 5SX4I 1U8IB 3KGSA 2B15A 5KSVB 2PXYA 3O3DA 2BM3A 4NJ9L 2N01B 4NRZA 3TA3C 5D7IA 1C5CH 3L5HA 4M3JA 3RA7L 4EZMA 2F74A 5C2BH 4N2CA 3ETTA 4G6ML 4X6DE 3WFBL 3TZVC 2WXOA 4ZUUA 1AKPA 1T5XA 3GSNH 4JHAH 1AHWA 3I9GH 5E4EC 3V6OC 1XMEB 4Z7UE 1CXCA 1J8SA 2NQDA 3PF2A 5B7FA 1BBJB 3IGLA 4N8UA 4ONOA 1AE6H 5EPMB 3W0WE 1LK3L 4WDIA 1AKJD 1A9VA 2GSGA 5K5YA 3N41F 1NGQL 3G6JE 2AMGA 4OGYL 2BVTA 2Q8AH 2D7NA 1LNUB 3CZJA 5JQIB 1FZJA 1WBYA 1ZHNB 3FT2B 2QPEB 2WNKA 4IRZA 3NBNA 2DQCL 4O4YH 3ZE0B 1JTTA 1CDGA 3HI5L 4M1GL 1P4IL 3LS4L 5FV2A 3NT0A 2ZUQC 4FQ1L 3SKMB 4W9IC 4BK4A 2YD9A 4HIIB 5ILTH 5AYTA 5I75C 1GGIH 4Y19E 1Y0LA 1PZBA 1AR1B 3UO8B 2IDCA 3PWLB 4HXBL 4WUUE 4JHBA 4AQEA 3EZ8A 3V0WH 3GBLA 1CD9B 2WQWA 1A1OA 3EO9L 4PTTB 2IOIA 2PYFA 1SXNA 3ABMB 1UFUA 3VTAA 1QUPA 1NIFA 5C70A 1TCRB 4X8JB 2OMWA 5IROA 3AAZA 3QE5A 4CKVX 3CSBA 2DQIH 1CU4L 2P5ED 3ULVF 1WP6A 3MRFA 2GABA 4QHMB 1KBGH 2QEJA 1WBZA 3ESNA 4P3DA 1HHIA 1U3HA 2VIRB 4CAGA 4S10A 2GVYA 1J8HB 5BRZD 1H32B 3LKRA 1NIDA 2J8UB 4FTVB 5EU6E 4LOUC 1KYOJ 2V5TA 3FN0H 1X5IA 4HJ0D 4OCRH 3RP1A 4BJLA 5HVFB 5IVNA 5F7KC 2JKLA 4U33A 1SXAA 5E79V 1T6VN 2Z31D 3IMRA 1QI5A 4PJIA 2GTWA 3X12B 4N0FA 3W0WD 3EFOB 3R1GH 3CLEL 3CDZA 2IPUK 1URLA 1VB9A 3MN8A 5C0AA 2H3NA 2WMPA 5DZPA 1CGSL 4TNFA 5HGDA 3LYRA 1R5IB 1QSEB 1DBJH 2HJFA 5JLZB 1LEGA 3VGAB 3ULVH 4ALAH 3QO0A 3VA2C 3WHXB 5DD1H 1PDKA 5EBWB 3Q7JA 3K72B 2R27A 4Q4EA 1I1AB 3AROA 1JFQH 1CXKA 3ALWA 3SDXB 4YHPA 1A47A 3ZIMA 3I75B 1HXMB 1WK0A 3ESMA 4Z3GA 1NAMB 5I28A 3QJVB 2OA9A 1T3FA 4EIBA 1IGIH 2VDRB 1WBXB 4L37B 3QUMB 3QWRD 5ES4B 5E94B 2OZ4A 2BINA 3BUIA 1WFUA 2FNWA 4UOQA 2BSEA 3D12B 2CO6B 5G5DA 2QR0A 2X4SB 2QMJA 3PJNA 4NZ8A 4CC0A 5BVJA 3OTTA 4OLUL 1GKEA 2WBJB 5ENWB 2IH1B 1TVHB 1OK0A 4YLCA 4CMHB 1KTDB 4UV4H 1CFQA 2W0FA 3CX5K 3WFDL 1UASA 3S3DB 1QX1A 4MAUH 5D1XB 4WFFD 3NCJH 2RCSH 2M83A 1ASPA 3AB0C 1QABA 3EO9H 1ND0A 2EDXA 3PABB 3O6FC 1FI9A 4YGVA 4NKQB 1YCCA 3FPXA 3EADA 4GRWF 4ZFZB 1DVHA 4C56A 5J4MA 3RX9A 3ULUH 4RMWA 5LG6A 4P46C 4NDMA 2BSRA 2G60H 4Y1AD 1KGCE 5EIIG 2JNZA 1C2RA 1MVUB 3U0PA 4IBLT 1K5WA 1D9KB 4OF0A 3GM0A 3UCRA 4OFYA 3U30B 3FNKA 1U74B 2EEFA 5E99H 1C16B 5AVSB 1E27A 3DX3A 4DK5A 1NGQH 3H6JA 3EO0A 3IGAB 1IGTB 2CHXA 4UYPA 1THCA 5K33A 2XXMB 4UF7C 43C9A 5EDXA 2X3CA 1DZBA 4U1LB 4XVTH 1YNRA 3BWSA 5IQLA 3AG4B 4UT9A 1FHBA 1HZUA 3ARDB 4IHBA 3SBQA 3WFBH 2JQMA 4EMZA 1IQDB 1GIWA 1GW0A 3OX8A 1U8QA 2NYZA 4OFVA 3U30C 4HSAC 5FDYA 3CGTA 1Q38A 4RMTA 4WO0A 1DDTA 3V79C 3MO1A 3D85B 2ZTBA 4JQVA 5HYQB 1YEIL 5DI8A 4X8XA 1L7TL 3UZEA 1AO7B 2YJQA 1JK8B 1KN2H 3CN3A 4AZ8B 1Z5LA 1U21A 5I1LA 3BCDA 3IJSA 3NSDA 1L0ND 1OM3L 1OK8A 2DVHA 2NCEA 3I3BA 4WVRA 5AEAA 3KPLA 1CTOA 4WFEE 1Q1JL 2BOCB 3SBPA 4WU7B 2HUEA 4NZRL 1F86A 5T3XH 5LXGH 4M43L 3MCKB 2R2EB 2X6BA 2ZG1A 4IRJB 3H2QA 3TBTA 2V3DA 4BFEA 4JM2F 3BEVB 4OZFB 5CGBA 4Z7WF 3ARDD 1D9KC 5BQ7B 3GHPA 3EGXB 4Y4FA 4XP5H 4M1CC 3LEXB 3E2HB 4ALAC 4CDGC 2BCNB 3BQUB 2HXAA 1JZ4A 3E80A 5KJ4A 3Q2LA 5HYIA 3WNKA 1ZV2A 2C1OA 4Z78A 4RRPG 4PP1D 3KPQA 4XRCB 3TONA 5MEOA 2ED6A 4PD4K 4QT5A 1FNGA 5LCVL 3RAJL 5DQDL 1GZPB 1X5XA 4WO4A 1AO7D 3TBVB 1AJ7H 5CLZA 2AXGB 3VGBA 3MODH 4EI5C 2VLMD 3JWOL 3DA0A 2BERA 3D39A 3QCVH 2EYSB 2WBJC 1PVHA 3JWNG 1MG2D 4P2OB 4YXKL 3CXHW 5FO7A 5DMGD 3ZIYA 4K7PH 4KKAD 1NCBH 1MREH 5MEQA 3O6FA 2C9PA 2QQLL 5ADOH 3QWQB 2XG4A 4YFLF 1FFTB 2K8QA 4NRXA 2A06D 2N18C 2YPLA 1I9IL 3NCBB 2QJKB 5MEPA 5D7HA 1BG9A 1JNHA 4PHXA 5KVEL 3B9VA 1N0XH 2H32B 1R33A 2GIWA 3JWDL 5AOLA 2YAPA 4IDJH 3QPXH 3QUYA 4R2GC 3WKMH 2IWEA 3PDDA 4JDTL 4N2BA 5D4JA 4DNLA 1SQPD 3BAEH 3FQWB 3MACH 4WKXA 1LK2B 3SOBH 4BH8B 4YHKH 4WFED 4ZUSB 3S34L 1XH3B 1XGZA 2XTLA 2P5WD 3ZSSA 1DVZA 2XI9A 2MHMA 3NQKA 1A8CA 1G84A 1IAOB 2TRHA 2OSXA 5KOMC 3O4LA 5AVQB 2N9JA 1N15A 3IAGC 1D2OA 1R17A 4N85A 1NMBH 1OAJA 3MRNB 4N5ED 4FNUA 2CO3A 1R3IH 3T0BA 1OEZW 3FFCD 3S3PA 1S7QB 4J7RA 2WYZA 2D4DA 5JXEA 1IO4C 1GRWA 3PHSA 1Z2KA 2NSQA 5IB4B 3GRGA 2UWEA 4ORGA 4Y19B 3N40F 4JB9L 2JMRA 3ECUA 1PQZA 1AXTH 3FDWA 4YDLB 5HGAB 3CUPB 5J11B 1MFVA 1KGUA 4IOIA 3IPFA 1S9WB 4FEMA 2XQYG 1HSBA 5GZNA 1IZKA 4QR7A 4L4VD 4TUKH 5IMOA 1XXFC 3QFJB 3BRDA 3BXNA 3TZVB 2MJWA 1HOCB 1J1PL 4K2UH 4R4NC 2AGJH 1ZWIB 2QFPA 3TVMB 3I2CL 1U8CA 3RIAK 5BXFB 1KC5H 4UM8B 1I7TA 2A77L 4AAOA 4KJYB 2KL6A 2I5YL 4I18C 3IDGA 1YJDC 1KGCD 2ATKB 2QQQA 3TA3A 3LY6A 2X44D 4L8DB 1MFEL 4LSSH 3REVA 3V9CA 1OCRB 2Q76B 2QLVB 3DX7B 2WQRA 3DO7A 1FCGA 1XAUA 3UGEA 1T1XB 2UYLB 3KPTA 5HD8C 4LVNC 2Y6SC 2RHEA 3HFMH 3IS1X 3OXRA 1A6TB 1PKOA 3EJCA 4PRBB 2W38A 3QJUB 1CG9A 1NZRA 2YBRA 4UNIA 2E7DA 3SO3B 4KKCC 3FQ4A 1HESA 1MIEL 1I9JH 4PJGB 3V8CA 2XVGA 1RUKH 2WBJA 4MDIB 3TL5A 4DZBB 1QSVA 1IGYA 4AJYV 2XQYA 2P5EA 4EIEA 1CLOL 4K07A 4FFZH 5IOPA 3BISA 2A9NH 3KPRE 4G7VL 2MQ3A 4Q6KA 1HWHB 5C6TL 4HV8B 3KLAA 2ODHA 4CN1A 2X9ZA 3GZKA 3WIFA 3WAJA 2EIEA 1GA2A 1CRGA 2IFFH 4O51B 2X4QB 1HWGB 5E0QA 3LNEA 4Y5XB 3UDWC 3IDNB 1PP9D 2X42A 2EO9A 4XHJD 4RRPM 1JNNL 1C6RA 2XWJB 3WNPA 1PU0A 4U7KA 3CWBD 1YPZE 1FG2B 4OFDA 3MV01 1UM4H 2LE9A 4BA0A 2G9HB 1MLCA 2BSTA 3KYKH 3Q5OA 2P9RA 5D7LE 3N43F 5ID0A 5HXMA 2FH6A 2RTTA 2XN2A 4X0KB 1Q9OB 1HHHB 5E9DA 2ZOLB 3BVNA 1MJUL 2HWZL 4P5MA 3WEMA 1NEZG 1UXLA 3OGOE 1T21A 4KGLA 3HCVA 3RUGE 3TT3H 5KAIV 1DW0A 5A6MA 1FNEA 2ZUQB 4IHOA 2XZCH 4A67A 3CPLB 3MA7A 3JV4B 2GHWB 4HWUA 4LOFA 2A6IA 1KPRB 3H3KA 3QDJE 1GKOA 4GKSB 5CCKL 5CEZL 1YEGH 4XP4L 5JXEC 3NJIA 4DN4L 4XMXA 2R69H 2OMZA 3V5DB 5JA8B 3WS3B 2YD4A 1H31B 3IU4L 4HJJL 4PVMA 3VXRD 4TPRH 3RG1C 1E5AA 1MCDA 5I18L 3S98A 4HLZG 3F6LA 1UYWL 2KYIA 5D6DC 5GRZA 1KIPA 3FH5A 2DEWX 3MGTA 4OUUB 4PGBA 4S2SA 3CFDA 2R29H 2R69A 5CEZD 3G3LA 2DKUA 5J6HA 1YDPB 4GYBA 1RJLA 1SVZA 1UC6A 2W07B 3PDOB 2R4SL 2HVJA 3E6FB 1EPFA 1BLIA 4AEHH 5FO9B 1BXAA 2UZYA 5ISZE 4IKKA 2VDKH 3MLSL 2Z92A 2ZXDA 5ETUA 4IK6A 4GKZB 3BEVA 2FEDD 1QBMH 3Q8BA 3UBXI 4GKNB 3SYQA 3GXPA 2F54E 3H1JD 3I6LD 3KD4A 25C8H 3CFCL 3WTWA 2APSA 3APDA 3AADB 2X6MA 3A0HV 1E7VA 3H9SA 4TULL 2QT6A 5I2IB 5H37G 4A37A 1AS8A 3CCHA 2F6AA 1E4XH 3HE7A 3TP4A 3V9FA 5JHDB 3SPGA 1YEWA 4MJ6A 4WUKH 3QUXB 1CMOA 2OZ1A 2PYEB 4S1DD 4FABL 5K9OA 1SXSA 2MOGA 4BSWA 4ZD3L 1HNGA 1WZKA 1QW9A 1H3PH 1JWUA 5K1NA 1OAQL 2B14A 3A6OA 3WS6C 5DJ2B 1V3KA 4ZG1A 2HJLA 5FV1L 4KUZL 3A0OA 3OL2A 5KAFV 2HRGA 4K71B 3UZVB 4PJ5D 1NTDA 1FLTX 3QDGE 4HS6B 5B1BB 1A65A 2IPUG 3WFZA 1EZVD 2GTZB 3L2MA 2X6UA 1QLFA 1L9BC 3U9UB 2K4AA 1S5HB 4JDVA 4Y4HB 3HB3D 3ARGB 1R34A 1A7RL 1RZ6A 3T2QA 3SDAC 4GUQA 4PSRA 4M8VA 1Q1PA 5IUCA 3ULAB 2XFGB 3K6OA 1V7ML 3PFQA 4FQJL 4IW4C 5C07B 5BV7C 3BGAA 2R0KH 5FF6A 2BP5M 1AGDB 3NZ8A 1S7VA 1K5NA 1M42A 3PHOA 2O5ZL 4OTXH 4NPKA 3G08B 3ROOB 4N8CH 4AQ8A 4POYA 3IMSA 2YUWA 4P2YA 1MCLA 3U1PA 7TAAA 3MX0B 5T5NF 4DQOH 2DLFL 3MV9D 4H8WC 4KXZI 4MKTA 3CNKA 1ZVHA 4PWFA 2EDTA 4GSXA 2DWDB 5CNHA 2DMHA 5C0DA 4WQDA 4EN3C 4I77L 2JELL 1X5LA 1RZJC 1J11A 1CYJA 4P2AA 1Z3GH 5T3ZD 3W39A 2A73B 5I76A 3QZWA 5ANME 4PJ6A 4DK3A 3MSPA 5EIIA 5LUMA 3AACA 2VC2B 4BZYA 5EEWA 2VLJA 1NGWA 1FORH 4U7MA 3RDTC 1KACB 1UZ6F 3IXTA 3KHQA 4FQ2L 3HC0A 3TIDA 1J10A 4F80A 3B2VL 2E7BA 4P9HL 4P9MH 5HYSB 3HQ6A 4XX1E 4V11A 2P42B 4NS0A 3LKSB 4I5BB 1L9OA 2I07B 3CX5W 3UTSA 5ITBL 3ZRCC 3PGCA 1JWMA 2IBZX 4HK3N 1YFCA 4LHJB 1NC4A 4LU5L 2CR3A 2QVIA 3CVHH 4Q9BA 1T03H 3QFJA 5AKTA 1SJEA 2QJDA 1RURL 4MJJA 5AB1A 5JO5A 3UPRB 2NPLX 3ZE1F 3QXAA 1IBDA 1SEBB 3D7PA 4EXPX 3NABH 1JCVA 1ZA3B 4U49A 5EZPA 5C09B 3C8KB 1THAA 1A3LL 2XY1A 1RV6X 3DPBB 3PP3K 3ERXA 3QS3A 1ADQA 1ZHLA 4PRHB 2OX5B 5M94B 4OZIB 2WLJA 2J71A 5FB8A 1XXDC 3CZFB 4DGYH 1W80A 4JO1H 3HZMA 2BSCA 3GTNA 3IJYA 4PJAA 1XVSA 4TNVK 1GAFL 3C60C 3SZ6A 1IUZA 5IG7B 2MTPA 3H2WA 1S7UA 3FONA 4WK2B 4WFHE 1TJIL 1T1ZB 2X2UA 1OPOA 1QRNB 1LE9B 1DJIA 3ZE2B 1C5DA 5HHOD 1OB1A 9PCYA 5K9JH 4IIQB 1E7UA 1MFBH 1OTSD 2EXTA 4FERA 3DTDA 4TSBH 3ECWA 1HNYA 3ZRFC 3VI4E 1Z9MA 1P4LB 2B0SL 2V9TA 2J3SA 1CFSA 4KVCH 3NP3A 4PTUB 4ANWA 1FSKC 1X7QA 1IT9H 1I5TA 2VDLL 4XWGL 3QORB 5L2JB 5I0DA 3U2JA 1EHAA 4ZW8A 2GC4C 1XGYL 3WXWH 1JZ7A 3BJ91 5T5FL 4NM8H 3RVTC 1BQSA 1EEYA 2ZCZA 3LJ3A 4FQHB 1OSPH 4S1DC 4UILL 5LBSH 1TVDA 1U8MB 3NRPA 4KMTH 4OM0H 1TUPA 3P9WB 5JIQA 5BCAA 1ZANH 1CYWA 1REIA 4FP8H 3BD4A 4JQXA 4V1DD 2K70A 2HV4A 4TLKA 4JHUA 4MXQC 5HHVH 4PJCF 3I6KA 3EOAB 1WGOA 4BINA 3EFDH 1D5RA 1AQHA 2VDML 4WU5B 4HJUA 1UJ3C 2XIDA 5A6IA 3LRKA 4QNPE 2VLLA 2VXUH 2H3KA 5DSCB 2VMJA 3QQ4A 4KDVA 5AYUL 5D7JA 4UTAL 3T77A 1OSEA 3NH7H 4HWZA 4E0RB 2EH7H 4KV5F 3MRJB 1RUQL 2ZXWB 1PCXA 12E8L 5HYJE 4GEDB 5E7FA 4TNVF 1OLZA 2ADIA 2GQHA 2HB0A 1I6DA 1D5MA 2OSYA 4KJPD 2BFVL 1U3ZA 2XOTA 3QJTB 5E95B 1CRHA 1AGBA 2FUQA 4GMSL 3WNLA 1R5WA 3SODB 1YNLL 2WW8A 5HHPA 1JGIA 4JFEE 5GZOD 2DL9A 1MCSA 3IT8D 1SOSA 4OV5A 4PIBA 4YNYA 6PCYA 2IAMA 2BOLA 3CIQA 4GAGL 2XNAA 2HX7A 2YPLD 3AS0A 2WNGA 2GK0A 1VPOH 1O7VA 5M95B 2GITA 1JD7A 5A2FA 4HFWB 3NSJA 2C3GA 3NDZE 3K4ZA 1V7NL 1OQOA 4HJGB 1S7XB 2WKOF 3D9AL 5HYJA 4L1DA 1BD2A 2BVEA 3II1A 3UJJL 1JAEA 2MCG1 1B0GB 3QIBA 2AJYL 3JTTA 2X4SA 4LSUL 1UM5L 4N4YB 2NNXA 2QGBA 2DM2A 2XLLA 3K6IA 2NW3A 4FNTA 1EMTL 3T6VA 4XNUH 1BPVA 2X3AA 3VRDA 4KZCA 1W72B 4MQXD 5EWIL 1BZ8A 4F8TA 2OZ1B 2GC7C 4KK6D 3KH3A 4OFQA 4Z8FH 2AXFB 3BKJL 3VFPA 2V2WA 5T1MB 2VDLB 1QMUA 1BFVH 4P2RD 2ZKHL 1OAUL 2DQ6A 4XT1C 2F15A 2GCYB 4FFVD 3UP6A 4A66A 2NOYA 2Z3FA 2J43A 4ZT1A 4YBLC 1ZS8B 4PH8A 1KIUA 1SXZA 3UAEA 4QRFA 4HGWB 1OGAD 4HCGA 5IB5A 2KLSA 1T04B 2X40A 3GGWA 1UJTA 2EE6A 5EB9A 4MJHA 2A0LC 4NIKB 2JKTM 1JN6A 5L8KB 3MMEA 1MQKL 2W9EL 4WUUB 1GS6X 4FLOA 1DBAH 1NFAA 4AEIL 4X4ZA 4CNIB 1H5BA 4QY8B 1HCZA 4XB7A 5D4IA 5BUPA 1RZ5A 5EZOH 2ICWJ 2WQVA 1FZKB 4U1GB 1GHFH 5F96H 1L6XA 3EJPA 1RY7B 1CORA 2ZJSH 4HWBL 4IKJA 4APXA 3L4YA 3QQDB 5HI4D 3UMNA 1H9DA 4LVHB 4XB8A 1F3JB 4QHNB 2NX5B 3SSGA 3U1SL 2IWFA 4JO4L 4HPYH 2YA0A 2X0UA 4M7JH 1A6VL 3UTSD 2EO7A 2R2HA 3KM2A 1D5XA 3LN5B 3KPMA 3CU4A 2DLEA 2CK2A 3TEZA 3MRMA 2C9RA 4M93B 2AW2A 3H4FA 4M4RB 1FYTA 3ARYA 3BP4B 3K80A 3OB0H 2VW4A 1TF4A 5T1LB 1MCRA 3NRQA 2G75A 3HS9A 4E36A 5TDOA 3WE1A 4KPHL 4GLRI 1XF5A 4WY7H 2CGRH 2R2CA 1TQTA 1AZZC 5KSAA 1AXSA 3BLBA 5HY9A 1V55B 2AK4D 4CVZB 5CJOL 3B9KD 2VDNH 4HOMA 1Z32X 5FO8A 2OULB 3DOSA 2I07A 2LR4A 4KTEH 2VWEE 4XPAH 1I8OA 3M07A 4AJWA 1U95A 3GJEA 2Q3XA 3FJTA 4PWEA 2E4FA 3L4MA 5CICB 2AJXH 3ZYOA 5KJ7E 4NPYA 2JKXA 2F68X 4FULA 5IVXB 2E47A 2YEVB 5BZXA 5E1IA 2ZT9C 3IDMB 4ZUUB 3C6LB 3T71A 1G6RH 5ANMA 2CJSA 4KJPC 5EUKB 4RGMB 5FXCH 1JZ2A 4AKOA 5JR1L 3T0XA 1GOHA 3L70D 2VDOH 3VXNA 5BMFL 3B7RL 2ZUYA 4MMXA 1KG0B 2GYSA 1XR9B 4Y4FD 5EOQH 5FHBL 4DP6X 5KSBA 2GI7A 4PJCB 3L1OL 2IDTA 1CK0L 1HK6A 5EBMB 2Y7QB 3KPSE 4W9DC 1BVZA 1BXXA 3S5YA 3UO1H 4XCEA 1IILE 5IK3A 2QKIB 2Q6WB 2VAAB 5J9PA 1PZ3A 3OMIB 5FO7B 1FWXA 2PW2A 5LWYH 1IC0A 2HAZA 2NYKA 1PJ9A 1N90A 3IU3B 4G3YH 4NQDE 4XTRC 1U8PA 3BZ4A 3DTXB 4BEIA 5FO2A 3BSGA 3MJWA 4JRLA 4AKPA 1FIGL 3RWJB 4NWUL 5AOIA 3D39D 3SDDB 3OKOA 2X1WL 3DHJA 1SEQL 1IBGL 4OU3A 1A7NH 4AGMA 4HUCA 3ZDWA 4KBPA 1WHOA 1KFAL 4Q6IC 1KTJA 1I8KA 1OCWH 4F7TA 4QRRD 1IC5L 1QFWI 1U8JA 2FT8A 3HS0B 5CWSB 5TE7H 3RDJA 2VUOA 1EVTC 2DD8H 3QCTH 3HHMA 4Z7UF 5AALA 3JYBA 2GPZA 2L8AA 3MOBH 5DZ9A 1PEZA 1CRCA 3VFOA 1QQDA 4G8IA 2CA4B 2SEBB 4N0UB 4JG0H 4OGXH 2WAHA 4Z7OF 5J12B 4LP4A 1NJ9A 3P0VH 2OL3B 1MCOH 4MHHG 1CFVL 3KPOB 1QTPA 1F90L 1VEOA 3W9EA 3MV8A 4YDVB 5I73B 1UZ8B 3QUZD 1Z66A 3F58L 3QDGD 1KX2A 2ADFL 1WRFA 1J5DA 2Y07H 3G5XB 1F1DA 3V7AG 2A6KA 1OPGH 1KTDA 5IBTL 1N2RA 4A2DA 4P2CG 4UANA 1L6PA 2WSPA 2H6PA 2FSDA 1GSMA 3FB5B 4WFGD 3VI4A 4B60A 4OZ4A 2CKBA 1NCDH 4OLEA 4LNRA 1G7MB 4FLSA 1DL7H 4JFVA 2EZ0D 4NBYB 4KV5E 1DE4A 2EH8H 4YEEA 3IFOB 4ZUTB 1S7RB 2OSLB 2ZXYA 3FQXB 4NUQA 4AUJA 5LGJA 3H9HB 4DCQB 1UWGH 3RGBA 3EYSH 1RHFA 4OLWH 3AXLB 3X14A 5A1AA 4HG4K 3MRCA 1JRHH 4UINL 4WCYL 1OAXH 2FECL 4I0PA 4X7SH 4EIGB 4CKQA 1DR9A 2WIMA 2P24A 1FNAA 2HSIA 4LNVA 4K71C 3TA4D 3WO3B 4F3FB 4DPBX 1PJWA 1PF3A 3BPLC 2MNUA 2ADJB 4LSDA 3GNMH 4GYDA 4P5KA 4FA7B 5KN5B 5DQJB 2BIIA 1IGCH 1YC7A 4ZFZA 5KBNC 1MHCA 1MUJB 3S36L 1MFUA 2FZ3B 1YN6B 4HWNA 4XPBL 4FQCH 4YHZH 4AJVA 5LAXB 4Y4HC 2BNRB 4JREC 5K1JA 4F33B 5F0PB 3AGVA 1GXEA 2AQ3A 2VMDA 1FC2D 3OSVA 1XB6A 4MCZB 1UWXK 4YQXL 2LVCA 2MNWA 1CDHA 5F3BA 2AEPL 2CBTA 4LLDB 1E9OA 1CF8H 1I3UA 3O8XA 3T6XA 2VM9A 4L4VE 1MCPL 5GGRA 4GUPA 5AAMA 3DR0A 5KVFH 1JMXA 3AREA 4ONFL 5F9WB 4JQXC 4B0MM 4OCLC 1YPZA 2CDEB 5JUEH 3QJFA 4L3EB 1RUAH 2CKBH 5EA0L 2FO8A 1N8OE 3LKOA 2PTVA 4HAGA 1A6WH 1IKNC 1RULH 1EANA 3MXVL 4IIZA 4IS6B 2DQTL 4GNKB 4OCWL 3B6SA 1CIHA 1LQBC 5TE4H 2FX8L 3VNWA 3UBXG 3GWJA 2IAMD 4A6YL 2CH8A 3MJGX 4ICWA 3RY5A 4Y7MA 1KLUB 3MCYA 1N9CA 2WUBL 4XX5A 2EDJA 1NOAA 1W0YT 3OCDA 2YD7A 4UI2A 1KJMA 2C2CA 3V0GA 2YHGA 1SZNA 2A6IB 4PCTA 3FTZA 2DEXX 1F3JA 2J1WA 3VFGL 1ZJBA 2VDRL 3LZPA 4G6JL 2HJKA 1CIEA 2IBZD 4D94A 4ANVA 5C9JA 2J8UF 3RRQA 3T2PA 4XH2B 5T1JA 5GS1A 1WLHA 3KPMB 5GHWL 3BCCD 5C7XL 4A2EA 4KROB 4FDWA 3DSFL 3O11A 4ZFGH 3GXUB 3HG1B 3K2UH 2BX5A 3MNMA 5ICZB 1NCNA 3K81A 4LDEB 2EIZA 1HCFX 3KM1A 2FQGA 4CU8A 2FO4A 4PJFF 2MPAH 5FW8A 3P30L 3QJXA 4FNRA 3QEQE 5FOBB 1R24A 4RFNB 2ZXBA 1A4BA 4Z0BL 3TV8A 1KYUA 1SN0A 4NQCE 3RPIB 2BSBA 4OLVL 2I9TA 4CU7A 2P8MB 4HUWB 3TCLB 4MDRA 3WLWD 3LXCA 3DMIA 2PWEA 4JAMB 2UXTA 4N2MA 1PZ5B 3BYYA 4NAMA 3MRQA 5D6DA 2V9RA 4GQQA 2C34A 2XG5B 1LP9B 4URTB 5B8CA 3RL2A 1WFMA 2BNQB 3DX8B 4OCXL 1JPFB 4QOKD 4XPTL 1QPXA 1RHHB 4ZUWA 4D0DB 2ESVB 3U36B 2JTIB 4FAVA 4HS8L 2AS5M 1E42A 4AZUA 2XX0A 3CXFA 3FU6A 4GKOA 2DICA 2VZOA 5G4NA 4H8PA 5GSRA 3UXFA 1ZLUH 3QIUB 3N85L 4H88H 4AV0A 4YDLC 1NM9A 5IBUB 4HQQH 4PRAA 3IGKA 1UUSA 2P7TA 5F3BB 4KJWD 3QUYB 2QPUA 3N9GH 3TO2A 5IW1A 1E3ZA 1TSRA 1FL3B 5DVKA 1UT9A 3VFTB 1NFDA 2GFBB 1JPGB 2NY1C 3HN5A 4PGZA 1DSYA 4F8QA 2AK1L 1SY6A 1FO0H 1FE8L 3CVIL 1VLXA 2YC1B 5DJZB 4JFEB 5GGUA 5CFHA 3K0YA 3NOIA 5MENB 1ES0A 1JNLH 3GSVB 4GIAA 3B8SA 4FCAA 1ZWIA 4AV5A 5KBDA 2NY2D 3JZ7A 4NENB 4XOAA 2K3HA 5IVOA 3VYNA 1N12A 1O6VA 1CDBA 4M5YH 1JZ6A 2H0FA 35C8H 4XMLL 1T89A 4A7GA 4FEIA 2BMKA 4HAFA 3R7RA 2WAQA 2VABB 3DYPA 1NBQA 5FYJE 1U8IA 4WNQB 3SOTA 5JXAL 5FGRA 2ITEA 1PSKH 4NC1C 1FOCA 5C3IA 3W11D 3HZKA 4H2AA 3N43B 1L3WA 3L54A 1USQA 5EIQA 1RZ7H 3UYRL 4X9IA 3ARBA 3OLEA 3ZE2F 3O2WH 2FQEA 3D4GA 1UTDA 4GFXA 2D3VA 2DWYA 5GISL 2R0ZL 5BS0E 1A7QL 1F42A 1ZVSA 5T33L 4QHUB 1CIDA 1S9YA 1SYSA 5KJRH 4OY9A 1MIML 2PP8A 3MZGB 3QNXB 3KNBA 3SZKC 2NY6C 1FPTL 4ZX4A 3DBXB 1DUZB 1TQWA 5HI4C 1BZQK 4XPGL 3WIHH 2QADB 4C55A 2GBVA 5LN4A 5SX5H 1E5UI 2FECI 1P1ZB 4KX8A 4TV3A 1DQJA 5JORA 3HLAA 2R59A 3VFUA 1AO7E 1EX0A 4A7TA 2HZHA 2XN9E 2XQYK 3IFLL 5CJQH 2ZYSA 4BFFA 1B88A 4Z76B 1VGEL 2HX9A 4OLZL 3RX8A 2D73A 2VN4A 1UGNA 1ZMYA 4JREB 4YSDA 1VA9A 1MPAH 4DCQA 2PP7A 3BIBX 5ICXA 2G2NA 5CAYB 3P77B 3VWKC 2A4ZA 3D51A 4P2RA 5EPMA 1AQMA 1E8WA 4ILDA 1CFNB 1MLBA 2PKDA 4RISH 1QSFD 5CP7B 4XXCC 1FE8H 3CVIH 4U05A 2XWEA 5GRVL 5C08B 3T0EA 4Z7OE 4MCMA 2W94A 2JK5B 4LQFL 2BHZA 1C08A 1TTCA 3VXUA 4LASL 4IRJC 2PYEE 1G7HA 3DHPA 4OZHE 4WWID 5EU4A 1I82A 2F7OA 1H8SA 4Y5YA 4PB0H 1X7TA 1A56A 3HPJB 3PP3H 5D1ZC 5AENA 1ACXA 5DWUH 2VZVA 3MJ8A 3RVWD 4Z7NF 3HMXL 4KQ0A 2IGTA 1MJJB 4GLRH 1E30A 4UYQA 3B2MA 1DVYA 4TYUA 4YHML 5FYLE 3U4EB 5HHQA 3MAWA 1NGXB 4XPTH 3PGDB 4ZOBA 1JPTH 4NN5B 3FQNA 3QNYB 4ZAKD 1RAQA 3BSZH 4JFHD 2PTTA 1IGMH 2K9FB 2P43B 3AM8A 4YFDB 5D8JL 1R6VA 2WD0A 5DHVB 5E8PA 1BAWA 1HIMH 4FADA 1C7MA 4PN6A 1B2WL 2Z8SA 1I1AD 1N19A 3WKNA 1EJ8A 1JUFA 2VUYA 4LSRL 5SWSD 1KELH 3EYOB 1CXIA 2N1KA 3O3EB 5GTHV 4YPGB 3X1BA 3IETA 1XSJA 5JIKA 3DURA 4ABVA 4L29A 2VERN 2FWLA 3PYCA 3VX1A 1UATA 4AVKA 3DSNB 1E90A 1BIIA 4IGBB 4MBOA 3IS0X 1YIQA 4F2EA 2AIUA 3VXOA 5HHNA 3HC4H 5ENWA 1KLUA 2ENPA 2A9BA 2JXMB 3GS4A 3LV3B 4I3SH 2FIKB 3AGWA 3DSFH 4UAHA 3U25A 1JDLA 2EKJA 3QDMB 1AD0B 1I9EA 3N1FC 4LFHG 1GVIA 4ODVH 4JPKL 2MSPA 4DP7X 4ZFOA 2WCGA 1AIFB 1OAKL 1H8OA 1RLBA 4DN3L 1HQRA 5BJTA 3RVUC 2BNUA 2GIYA 4M5ZL 2ED8A 3Q8AA 4K3HA 4RQQB 4YHPB 3F12B 3DX9A 1PKQA 3OKMA 3SIKA 3GKWH 3L75D 1YN7B 1EUUA 1CLCA 1ZEAH 2GJPA 2DQDL 4KKBC 1FBIL 4KH9A 3UYPA 3BDBA 4DKFH 1BHGA 4B9ZA 3MJ7A 1E27B 1BF5A 2LU7A 1ONQB 2J73A 2F1AA 4R2GD 1YEJL 3QEHB 3QPQD 3FW6A 3CFNA 3DGGA 5TE4L 3SYPA 1B4LA 2PW1A 1GDVA 5DR5H 4POZC 3AFLA 4NOBA 3TJPA 1FFRA 1JD9A 5CGYD 3WXVL 1NGYB 1E8YA 1K72A 1RJZB 1Z5HA 2EE0A 4E42B 5FFOA 3RVXD 1KB9J 3K1DA 4BA8A 2X89A 4DP5X 1A3QA 1IC1A 1J0YA 4FHKA 1PD0A 4H7VA 4JFSA 4R90L 4RH4A 5DJ2A 4EUPG 1JHTA 2R9HC 4F37K 5EZLA 2IIJA 1CLYL 2GEEA 4KQ3L 2FEDC 5ALCH 1CTZA 2YOCA 3Q6FB 3VMOA 1CF8L 2AEPH 2N0KA 1ERNA 3HKFA 5KBMA 4HS6A 2QZQA 3FUEA 4RSYA 4DPAX 3MNWA 4X83A 1TEFA 3S96B 3WFEH 4HIEA 4XP1L 2BCKB 4JUSA 2WLYA 1SY6L 4GW4A 1MFDH 3UJIH 3CX5J 1HILA 1I8IB 2NT0A 2VL5B 4PV9B 4QRPB 1JOIA 3CZSA 3KLQA 4AUUA 1IGCL 1JGEB 4I8DA 1KCWA 5CLYA 1JGUL 3LH2H 1F6AA 4S1RL 2B12B 3C6SA 5ESAB 3B3IA 3M17A 5F7MC 4Z7VB 3GNML 1KYDA 2VO5A 3ZKNC 4L8BA 4P05A 3N41B 5MERA 4S0TD 4HGMA 3WJMB 4LL1A 4NKIH 3LIUA 5ITFA 4OZFA 3Q9PA 4Y2LA 1B3IA 1HL4A 1UKSA 3DX0A 2OLDA 4TOYH 1I3VA 1XT5A 2PXYD 4U2ZA 5D1ZD 2XPGB 3HS8A 4UTAA 1JK9A 4JN2A 3QYMA 2YKLH 5IFJA 2E46A 3AY2A 3IJHB 3IFPB 5IVXF 5INCB 2Z4TA 1JF5A 3MZTA 5KEZA 2HFGH 1AHWB 4HBCH 2XBTA 3Q44A 4NZFA 5H37A 5B1JA 1PL3A 4KFZC 5I1LB 4X6DA 4UOJA 3RTQA 4G6AC 4A2GA 3KG5A 3OLGA 4U3XA 3SD2A 2D0SA 4J2XA 1J3SA 4YHNB 2NNRA 5EO9A 1I8AA 4HUUB 3WHE0 3N0AA 5HYEA 4QF1B 3UFIA 5FFLA 2IXQB 1LWHA 3KLHC 2PO6D 4L9LC 1FQ9C 2GUYA 3CFBB 3TO4C 1KV7A 3AZUA 1UXWB 3WI9A 1UGKA 3PV6A 1IBZA 2H3XC 3N40P 4ONHA 3JV0A 5DHMC 3I02A 3L3GB 2OPCA 3MV7A 4NT6B 5JHDD 2AEOA 3P2BA 1XTMA 1DDHB 2PYED 4KK9C 2BNQD 2WVUA 2XBZA 4UDUA 4ELKA 3EZJB 1WAPA 1SYVB 5C0IA 3K0WA 1YAZA 3NAAL 4ZAKB 4N90E 2HFEB 3GK8H 4OD1H 4XNYH 1PTZA 2XHNA 3GXDA 4Z23A 2CM5A 4ODXA 3CFUA 1QL4A 2AXGA 4XNMA 5I75B 1I54A 5DRNB 4KJWC 4OLXH 4M00A 1OD9A 3Q1EA 3QUYD 1DLFL 5E5RB 2ICWI 5JHLH 4F1ZA 4PJXE 1MN4A 2F53A 2CRYA 2G5UA 4J3SA 5KLVD 2QQKL 2BSSB 4PY8J 4CGUB 1O6SB 1RVFH 3CYTI 1O7DC 1DIIC 5GQBA 3QCTL 2ZXQA 1Z9SA 2PO6B 5EC1A 4L3CB 4U3FD 1L5GA 5EUOA 5GRYA 1C5BH 4L5FL 5GIRB 4UIMB 5MP6H 1P4LA 2YD8A 2NY2C 2WCPA 1B7VA 1H1OA 1JI1A 1N0LA 1U8OA 4Y2DB 3H6AA 4ZUVA 3I6GA 3L5XH 1WAAE 3NAAH 3TIEA 1CRYA 2D7OA 2FHCA 2Y7QA 3BGFC 3ARSA 3L4WA 4NUPA 5FKPA 2P8LB 3SCMB 4BZ1A 1V27A 1MF2L 2B3IA 7CGTA 5LXVA 5F7EL 5IB4A 4R7NB 2YPVL 5KAQF 1DQDH 4YPJA 1T1XA 5LLIC 3K5RA 1WFIA 1NDMA 1ZZHA 2OFQA 4R7VA 5DD0H 5F88A 1P6FA 1U36A 3C08H 1OF2A 4GAFB 2Z93B 4X7CC 4O02H 1QUNA 4Q7DA 2DLIA 3J07A 3UO1L 1CIGA 1JZ8A 1NTKD 5FGCB 1ZLDA 3CSYB 4U3SB 4IRZH 5IBLD 2YR3A 3H42H 2ZQKA 1HXYA 2YN5A 4WJG3 3SPVB 4LCCB 2VDOL 4ODHL 1XH3A 4DP1X 1BZDA 2BXYA 5D5MA 3SKNA 4OZHB 4P48A 4HKZA 3UZEC 5CP3A 3ZHDA 5DZNA 5DO8A 1QYGL 4QYOA 3O9WC 2BFGA 5T1DL 2ATKA 3TA3B 4YDIH 4YZFE 4XNBA 2WINB 2CA4A 1EAPB 3STLA 4OT1H 3QC6X 4MD4A 4X99B 3ZYIA 4XXLA 2EKSA 3IMUA 5I17B 1W72L 4H25B 3ZUNC 1LDPH 3O3EA 4OZIF 15C8L 3MUGA 4KDWA 1U6AL 1ZLSH 2VYRE 1D5BA 1P4BH 4QCIB 5F1OB 5I1IH 2E9IA 4Y19A 3QI9A 5F72S 3G5YA 3K6SA 2JKSA 3DSNA 2JB6A 4Y16B 4P99A 3PV7A 4RAVA 5EZIL 3CQQA 2VKXA 1GTFA 3ZSTA 5FA4B 4CUCA 3P0YL 1S9WA 4LJIA 3P1VA 3CX5D 4C56D 4YGAB 5DC4B 3DOIA 3IBOA 3WUWA 5KVEE 1SM3L 3CVBA 3T0ED 4L9DA 4GI8A 3L4ZA 3JT0A 4KKPA 4J3OC 4LLWA 3IKCA 4HPYL 2WVVA 5T8IA 3W11C 1H8NA 2BHUA 1EFQA 1MRDL 1LXMA 1TZGH 5K39B 1YMHA 4KQ3H 3L95A 1HI6B 4RGNE 1I1FB 2HPOA 2OR9L 4IBTA 3F65A 3FH8A 3REWA 5E8NA 1ZOXA 3PXTA 3PGFL 4KKQA 4LLVB 3BAKA 3AABA 1ECZA 2IPKA 5LB1A 2J1YA 3JTTB 3D50A 2Y7NA 5HVGB 5L2KE 2XQBH 1YJDH 3Q8EA 5LGHL 2CCVA 2BP8A 2O6CA 3BX7C 4RFOL 5DR5L 3QDME 5D55A 1FFPB 1RJLB 2XN0A 4JGJA 3V0FA 2NY6D 3IDYB 5HDQL 2VJ8A 3VAEA 1SLUA 2XWXA 2FWUA 1U75B 4KK9D 1FBIH 3CVCA 4YDNA 3TBWA 3NMEA 2QTVA 3FBQA 3MA9L 2Y06L 4GW1B 5F9OL 4JO5A 2ZPKL 1FNEB 4IHOB 5CHNB 1GYCA 4I0PD 3MRDB 4WWKC 5IEKB 3L2NA 1P7QB 3RMZA 4FXGC 3ZGIA 3RQ3A 3EDFA 2FWOA 1GGUA 1FV1B 4YC2B 1ACYH 3QJZA 5IQ7H 5LGKA 2NUTA 1CDYA 2Y1AA 4I0KA 4NNYA 1HT6A 4UQCA 4UTBA 1A14L 4B3EA 1V10A 1F2XK 1CDJA 1EERB 2CDFB 3NIGE 4OFIA 4AIZA 3KZ8A 1JZJA 2Y1VA 3CSTA 3CLFL 5EWIH 4Z7NB 5IVZB 3IGFA 4OKVA 1M3JA 4HF5L 1HHHA 2CXBA 4LARH 3LEXA 2MQCA 2WKOA 5AZ2L 3GSQB 2J4WH 3HC4L 3LRMA 4EQ3A 4YMPA 4UU9B 2YLHA 1RZGA 3ECBB 1GJQA 2G9HA 3RWEA 3QHTC 5ID0B 2AJYH 1CGYA 3MBWB 4H1LA 4TVPE 2UZYB 4QWWC 4YIQA 2KQMA 4NXSA 2WXLA 4XRCA 4FCHA 3INOA 2AZAA 3P9LB 3BKCL 4MSWA 4RGNC 3WJMA 5IT2L 1KELL 3NFNA 4UBDD 3KZIV 3U9UA 2CR0A 1AFVH 1G0XA 2QSQA 3T1FB 1CWVA 3OGCA 1WGVA 2W1NA 1KYFA 2NLJB 1XMWA 1K3IA 3P02A 3BAYA 4ONGH 3NIDE 2UXFA 1XWVA 2OMUB 4K3DH 4RDBA 4LKXA 1LGVA 4XAKE 4TUJA 4Z7OB 5EBLB 3D1MC 2VDKB 4MA8H 4Y5VB 4FXKB 1XCQB 3VA6A 5I8OL 2WGXA 4K5LA 1BJ1H 4XMVA 1D3CA 1MFAH 4FTDA 2CK0L 1PNDA 1ETZB 5GSVB 1QASA 3TXAA 4LLYA 5EN2B 2CIKA 4P59H 3CAFA 2NNCA 4M56A 3SDAB 4PB0L 5FYKH 3SJVD 3ELAT 3UZQA 3DXAA 1F4WL 5E6ZA 3CSPA 1OT1A 5GGTA 1TO4A 4GIOA 4TQEL 3SGDI 2XXFA 1X5GA 3MK7C 4LASH 1WZ1L 3STBA 3B9AA 4HH9A 4EN3B 4LQFH 2K4WA 1Z9PA 2P5PA 3BH8A 3DO4A 1IU1A 2WWNA 4ISVA 2IQAB 4U1SA 2E9BA 4ZAKA 4IBZA 4L4TD 5L9DL 3EGDB 3SE4A 5BZDA 3MRHA 1YICA 5HHVL 4D0CB 1HJ4A 2ATPA 3B8YA 3RB7A 1BX2A 2DYPA 5H35B 4AGPA 3SCMC 3EJUA 1I3RA 3HE6D 1S9XB 5EBMA 4ZS7H 3MLRL 2P44B 2R23A 4I3RH 3NA9L 4OM0L 5D1ZI 4BDVB 3DGDA 1ZK9A 3NDYE 3AVEA 5D7IB 5J7CC 3IFLH 1LYQA 1LWJA 4GP8B 4FFYH 4ICXA 3BZ5A 4WW2C 4AAMA 4UQ2B 2F7RA 3IWUA 4J23A 2APWA 3K71B 2W60B 3NPSB 2YD6A 3P3RA 3GMOA 5T1LD 2BSRB 3UTOA 3WIHL 4HS3A 3WNOA 5K9KB 1X5AA 1TCRA 3VD5A 4FMKA 4UV7L 5F6IC 5CBAA 1MIMH 3IMWA 1JFHA 4TVUA 4XC3L 4NZTL 5KJRL 4MS8D 4OZGA 4JM2A 5GISH 2ITCB 1KYOD 2UY6B 3SKUD 3E8UH 5L0QC 3TO4D 2VOTA 4MCNA 3GB7A 4YVNA 4LAQH 4Y2OA 4EIDA 5TJWK 5CKAA 1BQRA 3DVFA 2H2SD 2NY7H 2KHAA 3WFCL 1VADB 5CU9A 1E5BA 2X9WA 5D7EA 5F7YC 1H3VA 1HXKA 3MV7D 1PSKL 1J0ZA 2IG2L 2YPLB 3C2SA 1MY5A 5H8DA 4GO6B 1ORSB 3MLRH 2CRIA 1T7VA 4MNGA 1RUML 1KWGA 2XN1A 3TU6A 5C09D 3LVTA 4QPEA 3MROB 2E7HA 3JZYA 3GO1L 4EUPH 1P2CB 2VLKD 3MUY1 2EABA 4Z9KB 5D70L 4LVOC 3Q2NA 4QYOB 4RGMC 3VVWA 4KRLB 3ZO9A 3ILQD 4PREB 3Q8FA 2WXFA 3L3JB 2VLJB 4LU5H 1LNUA 3ZKND 1VJSA 5DS8A 4BKLA 2RACA 2C9SA 2AK4E 4PGCB 4PJHE 3CVHB 4G9FB 4P9ML 5C0BD 2LOEA 5JHDE 3WG7B 1F1GA 4LPVA 4QUOA 3KDMB 1Q0EA 1T66D 4A1RA 2EDEA 1ASQA 1TZIA 3HR5B 2YGVA 5D7LD 2VITB 2CK0H 5L8JB 3CFJA 1OCDA 3HB3B 3I50L 4I2XA 3H3PL 1G9NC 3RPKA 1MFNA 1FL5A 4NQSB 1MH5B 2EDYA 4EUPA 5A2JH 2HRPL 3PNW<