3H1JD

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 69
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1jD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1jD02
1AOQA 3WFBC 2PCCB 1NMLA 1R0QA 1KX2A 2FYUD 3M97X 2GC7D 5DJQB 4AAOA 1DW3A 5CIHB 1ZRTD 1AOFA 5GTIV 1MG2D 4PW9B 1C52A 1C6RA 1BGYD 1N90A 1HJ3A 1CNOA 4K3IA 2KS1A 2D0SA 3ITKA 4EDFA 1HJ5A 2BCNB 4FANA 1SQQD 3GG2A 1LC2A 1NTKD 3ZOYA 4Y5RA 1KB9D 1CEDA 2CE0A 1A2SA 1CRYA 4L3HA 1DW0A 2RN0A 5CIDB 1CYJA 3ZOOA 3PHLA 1CORA 5E79V 1YEAA 4QAOA 1BE3D 4WQ7A 1S5LV 2B4ZA 2LIRA 1U74B 1H9XA 2YCCA 1SQBD 4FA4A 4PWAA 1CC5A 1CSUA 1DW2A 3H1ID 1AKKA 1JDLA 2KNCB 1L0ND 1M70A 3H1JD 1N9CA 3RN0A 1CIGA 1L9JC 1HZUA 1C2RA 2XTSB 1M60A 1FJ0A 1CIFA 5B6QA 3SJLA 2QJYB 1I8OA 1M6ZA 3DR0A 3RLMA 4EIEA 3TYIA 2ZOOA 1KYOW 3L74D 1RAPA 3SVWA 1J3SA 3WFDC 3SWSA 2AXTV 2Y0CA 2MTAC 5C9MA 1C7MA 1QN2A 1NTMD 1VYDA 3VRDA 3C2CA 3O1YA 1H9YA 3H1KD 5C0ZA 2V07A 3PLNA 2C2CA 2CE1A 3WC8A 4WQ9A 2YQBA 5CICB 3CP5A 3OCDA 4WQCA 1IRVA 3ZIYA 5CIGB 1CRIA 3L4MA 3O5CA 4JCGA 1GQ1A 3X39A 4A7PA 4O1WA 2B11B 2L91A 4RSZA 3CX5W 5KLIB 3ZOWA 2IBZD 1CCRA 1CHJA 4PD4D 1ETPA 1IO3A 5IY51 1LS9A 3L70D 5H2FV 1DT1A 5CIBB 1B7VA 1NIRA 3MK7B 3O0RC 2A06D 1A56A 1C75A 3L75D 3OCDB 4XXLA 2GB8B 1L0LD 2EXVA 1S6VB 3ORVA 1KX7A 4XYDB 4P4QB 4AAMA 4V2KA 2Q3EA 1E29A 3WU2V 3GW6A 1E8EA 1FI9A 3L4OA 1WVEC 1W5CT 1YFCA 3DP5A 1FCDC 3HQ9A 4WQDA 5KLVD 3OA8A 4LJIA 4H0JA 1NMIA 2GC4D 1I6EA 4L1QA 1HRCA 1HCMA 4H0KA 2C9XB 3VNWA 3CU4A 1KYOD 3WFEC 1U75B 3L72D 1CIEA 2C8SA 1H32A 1K3GA 1OAEA 2C1VA 3TGUD 3KHUA 1WEJF 4IL6V 1C2NA 1CSXA 4N0KA 1FI7A 2GIWA 3SLEA 1I6DA 1MG3D 351CA 5B5EV 3DMIA 1CSWA 4FB1A 4WQBA 2C1DA 1CRGA 3WFCC 1CYIA 4NFGB 2VHDA 2BPBB 4EIDA 3OA8B 4WQAA 4UB6V 2N3BA 1MZ4A 2DGEA 3CXHD 2N9YB 3PXSA 1CRHA 1RZ5A 4L3GA 1HROA 1I8PA 4WQEA 3CYTI 2BLFB 2QG4A 1HJ4A 1YEBA 1BL9A 3CX5D 1H32B 1CHHA 1QYZA 5TJHA 3HQ7A 2CXBA 2BCCD 3L73D 1H33A 3NWVA 1HZVA 2JTIB 3A0HV 1H31A 5DF5A 3ZBMA 1ZZHA 1H1OA 2CA3B 5KKZB 2FRCA 4KMGA 1I55A 2AI5A 1DIIC 4O1QA 1CTYA 1PP9D 3L71D 2N9JA 2Y0EA 2BH4X 4RJTA 3MK7C 4MU8A 4PJ0V 1FHBA 2JQRA 155CA 2CA4B 3A0BV 5CYTR 3VYMA 2C1UA 1H33B 4D6TD 4AALA 4U3FD 2AIUA 1QKSA 1CIHA 2HV4A 1H31B 4UB8V 1YNRA 1RZ6A 3RN1A 3PTZA 3PXTA 5KAIV 2MHMA 2N18B 4GEDB 1L9BC 1SQVD 3BCCD 1IRWA 3ZOXA 1NU1D 1K3HA 1GIWA 3H1HD 2N9IA 1COTA 3VMAA 2OZ1A 1CSVA 1NTZD 1CXCA 4DY9A 2Y0DA 1EB7A 3O20A 3TDKA 1YICA 1IZL0 5TISV 4FA1A 3CWBD 2N3YA 1CTZA 2LITA 5CIFB 4AANA 2FWLA 5B66V 1SQPD 1GJQA 2BGVX 3KZIV 1F1FA 3TF5A 1AYGA 1CRCA 1GKSA 3JBTB 2PACA 2RMZA 3H1LD 4GYDA 2BH5X 1RAQA 3ZCFA 5CIEB 5AURA 1CXAA 3PH2B 1N50A 1DW1A 1YTCA 2PCBB 2I8FA 2OZ1B 1C6SA 3FWLA 5EXQA 1LMSA 2ZXYA 1LC1A 2JWAA 2ZBOA 2YIUB 1OCDA 3PRJA 4J20A 2QJKB 4EIFA 1DIQC 4FA9A 2B10B 2ZONG 1KV9A 1A8CA 1NNOA 1DVVA 2K9JB 2ORLA 4AX3A 1FI3A 2ZZS1 1EZVD 2YK3A 3HQ6A 1CYCA 3NBTA 2L4DA 4EICA 4FA5A 1CTJA 1E2RA 451CA 2FYNB 1CO6A 2QJPB 1HH7A 1CRJA 1LFMA 2C1DB 1GU2A 1SQXD 1P84D 3HQ8A 1DVHA 1CHIA 3PXWA 2DVHA 5GTHV 2O3JA 1W2LA 4Q5PA 4YE1A 1I5TA 1YCCA 1KIBA 1BCCD 3SXTA 3WUIA 1QL3A 3RMZA 1CCHA 5DFSA 2N18C 1C6OA 2B12B 3NBSA 1F1CA 1GDVA 1YIQA 4WQ8A 4FAVA 1IQCA 2B0ZB 5DJQC 1QL4A 2V08A 1FOCA 1I54A 3CXHW 1N15A 1KB0A 5KAFV 3A9FA 2D0WA 1PPJD
chains in the Genus database with same CATH superfamily
2YMYA 1AOQA 3WFBC 1QEXA 5AVSB 1KX2A 5AW2B 3M97X 1Q90D 2FXOA 4AAOA 3CCEP 3CCRP 5CIHB 4ZMDA 2QA4P 1HVVA 1C52A 4OVNF 1LGHB 1JMMA 1G1IA 1N7SB 1U57A 2QRXA 1YTZT 1HJ5A 2NZ2A 3SWKA 1QVFO 2KNCA 3GG2A 1NTKD 1D7MA 2AXTH 5AW4B 2LXBA 3H1LE 5CIDB 2B87A 1PGQA 3PHLA 1CORA 1MFTA 1VF5B 5APYA 4JYBA 4EIJA 3R2PA 4QAOA 4D6TJ 1BE3D 4WQ7A 4U3FJ 1RQVA 3E1RA 2YCCA 2FY8A 1GW3A 3BRTB 1DW2A 3H1ID 2KNCB 5AVWB 3H1HJ 5L8RJ 3H1JD 3P7KA 2C9LY 2XTSB 4H13C 1FJ0A 1CIFA 1Y9BA 1VL2A 3SJLA 2ZYDA 1I8OA 1QX8A 4H44C 5APWA 1LWUA 2ZOOA 3L74D 1J3SA 4PV1B 4L74A 2E76C 2AXTV 1SQPJ 1OMIA 5KAFE 1RE4C 2NPSC 1C7MA 2N1TD 1VYDA 3VRDA 1QL2A 3A5TA 1H9YA 3H1KD 1JCDA 1JY2N 4IFDK 4U7JA 3MUDA 2P7JA 2M8RA 3L4MA 1L4AA 2OTLP 1SQVK 3D70A 3CCLP 1NU1K 1MZ9A 1NTZG 1LWUB 1OVRA 4RSZA 1NTZK 2MJZA 2IX7C 5KLIB 4N3YB 1BGYG 1OZHA 2WSFH 1N7SC 2VRSA 1QGKB 2AEMA 1JY2O 3M0DA 1XTCC 2E75B 3CC2P 1DT1A 5CIBB 1YJ9P 3ABVC 3MK7B 2FKWB 2OYHA 1A56A 2XZRA 4LGDE 2GB8B 1ZRTE 1OW7A 1SFCD 1S4XA 1YJNP 4AAMA 1K04A 3V6IA 4V2KA 1L4AB 3S4RA 1E29A 3WU2V 1FZEA 1N7LA 1VF5C 1VQ4P 2IYOA 3OA7A 1W5CT 3DP5A 1YITP 3OA8A 1SQQE 4H0JA 1T2KC 3B5NA 1ZOYC 1VQLP 3MGNA 5CCHD 1HRCA 1EQ7A 1HCMA 2OGUA 1KB9E 3A0HH 3VNWA 1AJYA 1KYOD 3Q1MA 2C8SA 1JUNA 1K3GA 3TGUD 1X22A 3KHUA 2C0XA 1CSXA 1AV1A 1QVGO 1FI7A 1SS1A 1VQ6P 1X8YA 3IAOA 2OARA 1MG3D 3LIDA 5AW6B 3DMIA 4PV1C 3VTPC 2LR2A 4LC1A 2V7QJ 2VHDA 3OA8B 4WQAA 3G9RA 4YXDC 2Z5IA 5CCGD 4GKGA 3D0WA 1ZV8A 1NJIQ 2DGEA 1NTMG 1CRHA 4L3GA 4JBZA 4WQEA 2WVRA 1BGYJ 2QG4A 4UB8H 3P8MC 2I8DA 1T3UA 2R44A 1CHHA 5TJHA 3NWVA 1Q2NA 3A0BE 1HZVA 3A0HV 1LWUC 1ZZHA 5K5GB 1RF1A 2K1AA 2WPRA 3RBXA 5KLIC 3SWYA 5KKZB 1IC2A 4O9BA 5KAIE 2IBZG 1I55A 1S5LX 4O1QA 1CTYA 2ZYGA 3L4FA 5B66H 2E75C 2N9JA 3S1KA 3T97A 4L76A 5AVRB 2J5UA 1BDDA 2B88A 2FYUK 3MK7C 1KB9I 1SQBJ 1FHBA 1FOSE 3MUDC 4YPCA 3JSVC 2C1UA 5EFWB 1L4AC 4I6MC 1CIHA 4UB8V 4PD4E 1GL2A 1MFZA 3RN1A 1FBMA 3L70E 1SQVD 1NU1D 1FJPA 1GIWA 3HD7A 3M0DC 1NTZD 1IFPA 3T97B 1KYOH 2Y0DA 1NTMJ 2OYHC 1KZUB 1YICA 1Y8AA 3KYQA 4FA1A 2N3YA 5CJ4A 2QEXP 4WWIA 3IF4A 5B66V 5KLVE 4QMAA 3AE8C 2QM7A 3B8EB 1P84I 4OWFA 3OAKA 3KZIV 2BASA 1QLED 3JBTB 1L0NG 1GL2B 4AQRD 3L72E 3B5NC 1L0NK 2FFDA 3P32A 3W67A 3HD7B 1C6SA 3FWLA 2Y9YA 1OIPA 2M5AA 3VYIA 2O1JA 2P67A 2JP3A 2YIUB 2OYOA 2PP6A 3Q5SA 3A0BH 4RO0A 3VMZA 2G8YA 4WY4D 2M0BA 1S3JA 3LW5J 3Q5PA 3CXHE 1NNOA 1FI3A 2ZZS1 1EZVD 5KKZC 5AVVB 3CX5E 2FFDB 1PV3A 1ZP0C 3AE3C 2L4DA 4EICA 3AE2C 4FA5A 1E2RA 5AVTB 2LKMA 2BCCE 2FYNB 3L73E 2C1DB 3EWKA 2KK7A 3PXWA 1MKMA 1HF9A 1AA0A 5GTHV 2BEQD 2O3JA 1I5TA 1LP1A 1HUCA 4H44D 1E79H 3II6A 3WUIA 1RF1C 3L71E 5DFSA 1A02J 2A06G 5AW9B 1NKNA 2NPSD 1QL1A 2CPSA 3W68A 5APVA 5DJQC 1GD2E 1QL4A 1KQGB 2V08A 3FGAD 1L0LK 2KUBA 1I54A 3CXHW 4NPEA 1N15A 1GW4A 1KILE 2ZT9C 5E79H 1SP4A 1PPJD 4NPFX 2PCCB 2N9BA 1DIPA 3K5BA 1S5LH 5AVUB 1FDMA 3RK3B 1A02F 2FYUD 1AVYA 3L75E 2OQQA 3CCVP 3BCCE 1LP1B 1MUUA 1AOFA 3OJAB 1GL2C 2H43A 3RL0B 1M7LA 2HPCA 4BWNA 2ZAEB 3H1LG 1N90A 1N7SD 3HD7C 1WRGA 4EDFA 3CWBE 1IFJA 1HTLC 1LC2A 4WBAA 4GOFA 1PP9J 2YIUC 5AW0B 2CE0A 3RGUA 1CRYA 1SVFA 2WMMA 5AW7B 4L3HA 1DW0A 2M3BA 2RN0A 1E5WA 1EDIA 3VP8A 3PH0A 1H0TA 1S72P 1VF5D 2I1KA 5E79V 4OH8B 2P10A 1YHQP 3TSIA 1T2KD 2HPCB 2AXTE 1S5LV 2LIRA 3TNUA 2FFDC 4PWAA 2KXPB 4RESB 2O01J 2IBZI 1L0ND 1R5SA 3C9IA 1N9CA 3RN0A 2WZ7A 2KZIA 3AEEC 1L9JC 1HZUA 4L73A 3MZWB 1CI6A 2PRRA 3PP5A 4IFFA 1EXJA 1M6ZA 3MD0A 3DR0A 4EIEA 3TYIA 1FDIA 1H0TB 4KT0J 1RAPA 4PV1D 3SWSA 1PGOA 2Y0CA 2FYZA 4H13B 5C9MA 1SQXE 5CHXA 3H1LJ 2YKOA 5BU5A 2C2CA 4WQ9A 2YQBA 2E76B 1BCCE 4CPGA 3RK3C 3V4QA 4DCKA 3ZIYA 2JJLA 3O5CA 4EOTA 1GQ1A 1FS0E 2I1JA 4O1WA 4I1LA 3RL0C 3M9HA 4C7RA 5CMZA 1NAFA 1CCRA 1R8EA 1SQPG 2E75D 4DOJA 1VQ8P 2AXCA 1KV4A 2WSCJ 1SQPK 3M9QA 2PAJA 3O0RC 3HTKA 2A06D 5DJUB 1L0LD 2EXVA 2JEEA 1FZGA 3E1IA 3NXSA 1JY3P 1L4AD 3JCUH 1M1JA 3GW6A 3L4OA 2Q1KA 4TLFA 3P8CD 4LJIA 2YKPA 1FZAA 1NTKE 1NMIA 3OW2O 1I6EA 4H0KA 2HFED 3O8ZA 1HWTC 3I55P 3HTKB 1WEJF 4IL6V 1C2NA 3H32A 1I6DA 1BE3E 1G2CA 1PIXA 1OXZA 3A0HE 1YTZI 4WQBA 1M1JB 2POHA 3D71A 3AEFC 3G4SP 2LXCB 2BPBB 3H1IE 3B5ND 4UB6V 3H1JE 2N3BA 3CLQA 5DJTB 1HROA 1I8PA 2B87B 4C7NA 1HJ4A 2YXRB 1BL9A 2WSEJ 4KHXA 3O6QA 3L74E 1SQQJ 2P58A 2H8PD 3H32B 3AE9C 4Y99B 3N4XA 3RK2B 1G2CB 3WU2H 1H31A 1H1OA 4GODA 2WITA 3CCUP 2ZJSE 3VP9A 4UB8E 3H1KE 4AUWA 2QSIA 5APTA 1PL5A 5AVZB 4KMGA 2SPZA 1FU1A 3Q2YA 1IZNB 3L70G 1K8AQ 3FX0A 4C7NB 1LJ2A 2BEZF 1W5CE 2QVAA 3VYMA 1M56D 1YQ3C 4D6TD 4AALA 1JO5A 3KXDA 4U3FD 3IR9A 5B66E 1QKSA 1H31B 1HJ0A 2Z4EA 1HBWA 2MHMA 4GEDB 1LTTC 2K9YA 5KLVG 2K88A 1IRWA 1LTBC 3G71P 3H1HD 1VPCA 1XTGB 1CSVA 2WT7A 1GK6A 3V5BA 2P2UA 1GU4A 4DY9A 1MV8A 3TDKA 1IZL0 3I56P 1IFNA 2E74B 1SQPD 1SQBG 1JM0A 3AE4C 1GJQA 3TF5A 1M1JC 1SQBK 2OYHB 1GL2D 1W2EA 2W83C 1KYOE 2YXQB 4XA4A 2BH5X 1KTMA 5AURA 3AECC 2KSJA 3AE6C 3PH2B 1YTCA 2PCBB 3HD7D 3TGUE 2I8FA 2A45G 3CCMP 2WT7B 3H25A 2KSEA 3KQGA 1YYCA 4GDOA 1PGPA 3S9OA 3F5HA 3L70J 3B5NB 4K35A 2QJKB 2BCCG 4Y99C 4EIFA 3RK2C 1FOSF 1NAYA 1USDA 2B10B 1NTMK 1KV9A 1HGZA 2J58A 1VQMP 2WPVB 4WB4A 1YI2P 1VQPP 2YK3A 5CJ0A 2KIKA 1N2DC 1H89A 3L71G 5KLVJ 3CC7P 1LT9A 1NWQA 1LFMA 1GU2A 1P84D 2KLVA 1DVHA 1CW5A 2W8ZA 1K9MQ 1LTGC 3L72J 5KTBA 5AW8B 5APUA 1RF0A 1KIBA 4JYCA 3SXTA 3KZIH 4K3AA 1QL3A 3AEDC 1RQUA 3AEBC 4H0LB 3FXEA 1C6OA 2IFMA 3L75G 1BSNA 2B0ZB 1KQSO 3B4SA 1FOCA 2G3AA 5KJ7D 2JDIH 1RF1B 1KB0A 1LT9B 3M06A 5KAFV 5M1BA 3A9FA 2CXBA 3I5CA 1NMLA 3VMYA 3RK3D 2E74C 5DJQB 1SQVE 4DJGA 1NU1E 3HUSA 2H7HA 3EQ2A 1ZLLA 2ZT9B 3H6PA 1FJKA 1VQ7P 2BCCJ 3L73J 3RL0D 5E79E 1NTZE 1ZR2A 1BGYD 1CNOA 4K3IA 2KS1A 1S5LE 1ZXGA 4FANA 4L75A 3CCQP 3PJSK 2AEJA 1OVUA 3ZOYA 2IZ1A 4XFJA 3L71J 3L35A 1CEDA 5GTHH 2CPBA 2QJKC 1YBKA 2GUVA 2WPSA 1LTAC 2IFNA 3D6YA 5APQA 1JCCA 1S1CX 2B4ZA 3HE4A 1U74B 1T6AA 1SQBD 2KS1B 1NOHA 3L75J 2ZXXA 1CSUA 3BCCJ 1AKKA 1JDLA 2R5BA 3LIEA 1M70A 1OW6A 1C2RA 4PD4I 4LLHA 1RY3A 1P84H 5B6QA 4YTPC 1S9KD 1VDFA 2H89C 3GLMA 1PP9G 1EZVE 3USSA 5H2FH 3RLMA 1BCCG 3U59A 4H0LC 2ZXEB 2M5AB 2YO3A 1LTJA 4H13D 4IL6X 3HE4B 1QN2A 1NTMD 3EFFK 1S2EA 3O1YA 5C0ZA 3CD6P 1GU5A 1LT9C 4N78D 2E76D 5CICB 3CP5A 1ZW0A 4WQCA 3KDPB 2W90A 2E5YA 4OGQB 3CMEP 2PFXA 2V7QH 1ZMEC 1RF0C 3IN6A 1EXIA 4A7PA 1RHZB 3V2RA 3CI9A 2L91A 3CX5W 2FBWC 3ZOWA 2IBZD 3RL0g 1LTJB 4I7ZB 1CHJA 3WMM0 2ITAA 1PPJE 5IY51 1LS9A 5H2FV 5B5EH 1TU3F 2UWJE 1B7VA 1X0TA 1NIRA 2FYUE 3BATA 1Q86Q 3CMAP 1DEEG 1EDLA 2E42A 1NTKG 3L75D 1JEKA 1FZCA 2A45I 1EC5A 4XXLA 3CXHI 1VQOP 2IPPA 1S6VB 3ORVA 1SQXJ 1PGJA 2QIWA 3CX5I 2Q3EA 3HUSC 1DEBA 5CBNA 1FI9A 4YXWH 1L2PA 1YFCA 1FCDC 3HQ9A 4WQDA 1BCCJ 1BE3G 2Y9ZA 3QH9A 3ZDMA 2GC4D 1T3JA 3GF3A 4WY4A 4L1QA 1J2JB 4UB6E 2C9XB 3JCUE 1CIEA 1OX3A 1KMIZ 3H1IG 4HB1A 5C39A 1OAEA 2C1VA 4N0KA 3SLEA 1M1KQ 3E7KA 351CA 5B5EV 4JQ0D 4FB1A 4PJ0H 4NFGB 1NKZB 4EIDA 1L0NE 1X79B 3WUVA 3MIWA 3CL3D 2N9YB 1RZ5A 2WSSH 2WSFJ 2QE7H 4R4LA 4OGQC 2WQYC 3M0AA 1KILA 3HQ7A 3TNUB 1H33A 1NTKJ 3RK2D 1NO4A 1JY2P 5DF5A 3ZBMA 5TISH 1LTJC 4I7ZC 1N73A 2YO2A 1CI6B 2ZVOB 2W6AA 1PP9D 2JWDA 1BE3J 2Y0EA 4XE5B 4R4MA 4RJTA 3WU2E 4PJ0V 3SWFA 1DD4A 1WT6A 2IYPA 1WMKA 2CA4B 4IL6H 1JTHA 1VQNP 3H1IJ 1KILB 2HR3A 5CYTR 1KFMA 1H33B 3TYYA 3H1JJ 1Y47A 3CPWO 4ASVA 4W80A 2Q6QA 2HV4A 1SQQG 1X9VA 1YNRA 1RZ6A 2R5DA 1VQKP 3PXTA 5CBOA 1SQQK 3ZOXA 4UB6H 1N73B 1K3HA 3A7OA 3L74J 1CSBA 2A06E 1FDOA 2E5TA 2KZJA 3IFMA 2JO1A 1PFIA 2OZ1A 1L0LE 1LNQA 4B86A 1CXCA 2W6BA 3D6ZA 2JKVA 5TISV 1FZCC 2R3SA 3H1KJ 3SFDC 3TGUG 5CIFB 1Q82Q 1JTHB 2FWLA 2E74D 3P8CE 1BSHA 2E43A 2BGVX 1F1FA 2OYIA 1AYGA 2Q5UA 4JPZB 2WWWA 2RMZA 3H1LD 1RAQA 4I2LC 2W27A 1N50A 1DW1A 3GF7A 4W7YA 4WY4C 1EDKA 2YKQA 2OZ1B 3R4YA 5AVXB 1RH5B 1LMSA 2ZXYA 2JWAA 2ZBOA 4MN4C 2KLUA 1AQ5A 2RH0A 1OCDA 3PRJA 1G1JA 4J20A 4TT3H 4HJGH 1DIQC 4FA9A 1M8OB 1UIXA 1U7MA 4NPDA 2ZONG 2OYIB 1VQ9P 1A8CA 2ORLA 4AX3A 2D2CB 2IDBA 1KC8Q 1BDCA 3NBTA 1IFIA 4GT1A 2XV5A 4EYYQ 1CTJA 2HYNA 1GDTA 1AFOA 2KI7B 2QJPB 1CRJA 5GTIH 1URQA 1IJDB 2H88C 5AW1B 1Q7YQ 1KILC 2DVHA 2XKMA 1W2LA 4YE1A 1H8AA 1YCCA 1IO4A 4IOIH 1U7JA 1NH4A 3TGUJ 4WVZA 3RMZA 3U1CA 2QM8A 2O1KA 4H0LD 1CCHA 2C9NY 3VOPA 3G3ZA 2Q9IA 2L5GB 2B12B 1IK9A 2O01H 3O6QB 1N73C 3NFQA 3NBSA 1SQVG 1F1CA 4WQ8A 4FAVA 1NU1G 3VMXA 4D6TE 3KZIE 1USEA 1JNMA 1URQB 1GK4A 4U3FE 1Q81Q 1R0QA 4W7ZA 3V2NA 5KLVK 2GC7D 1W2BO 1ZR4A 2AEFA 1DW3A 1N86A 3H1HE 2ZT9D 1ZRTD 3CCJP 3L72G 5GTIV 1MG2D 4PW9B 4HYTB 1C6RA 2K37A 2YNYA 2B89A 4Y28J 1HJ3A 2D0SA 1YIJP 3Q3DA 3ITKA 3M9BA 3BRVB 2BCNB 2Q3IA 1JY3N 1M90Q 1SQQD 1SQPE 3C1LA 2OTKE 4Y5RA 1KB9D 1N8RQ 1A2SA 3AE5C 2KP8A 4JF7A 3F89A 1CYJA 1OFCX 2W6JH 3ZOOA 1JB0J 2OYIC 2Q7CA 1YEAA 3KPEA 2D2CC 4ZKUA 3QWOC 2N1TA 1EZVG 1JY3O 3SFEC 1H9XA 3L73G 4FA4A 2WSCH 1H88A 5GTHE 1CC5A 1J1DB 1SQVJ 2QJPC 1NU1J 4IFMA 5KAFH 4ZKPA 1R5LA 1CIGA 2NRGA 1M60A 3M91A 3WUTA 1NTZJ 3A3YB 3VN0A 2QJYB 2FXMA 1PZQA 1T8ZA 3NTNA 5APXA 3SVWA 1KYOW 1LT1A 2ZFCA 3WFDC 2V4HA 3BASA 1J1EB 3Q5RA 2MTAC 2N1TB 1P84E 3C2CA 2B9BA 1KD1Q 2V07A 3PLNA 1GTWA 2CE1A 3WC8A 5H2FE 1JMBA 3MHVA 1URQC 3A2AA 3OCDA 1PPJG 3BCCG 1SFCA 4OGQD 1KYOI 1IRVA 1IK7A 2XNXA 5CIGB 1CRIA 2FYUG 3AE7C 4JCGA 1HH0A 3X39A 3UIAA 1CZQA 2B11B 2KB7P 3HRNA 1RE3A 3V2PA 2ZYAA 4BXLA 1KN7A 3CWBG 5CCHA 4PD4D 3GHGA 1ETPA 2WSEH 1IO3A 3AE1C 3L70D 3RK3E 4DZOA 2C0WA 4ASWA 1VQ5P 3HE5A 1C75A 3OCDB 2CK3H 1KX7A 1KB9H 4XYDB 4P4QB 1FZBA 1SFCB 5AVQB 1BGYE 1IFDA 5AW3B 1E8EA 5B5EE 1DD3A 1WVEC 1FC2C 3SSUA 4BRYA 5KLVD 2XNDH 5CCGA 2KYVA 1KFNA 1OW8A 2HODA 3TK1A 1HGVA 3GHGB 3L36A 1J1DC 3CU4A 2R3CA 3WFEC 3HUSB 3MP7B 1U75B 3L72D 2HG5D 5APSA 1KQLA 1H32A 3HE5B 2GM4A 1NGMB 2PGDA 2QJYC 1GMJA 1LTIC 2GIWA 4HH2A 1OVVA 2O01N 2Z5HA 1CSWA 1SQBE 2C1DA 1CRGA 2FYUJ 1J1EC 2J59M 3WFCC 1CYIA 1K73Q 1SQXG 4BRYB 1YQ4C 1M57D 2N1TC 1ZN5A 1IFMA 2HODB 3FXDA 1SQXK 1MZ4A 4GIFA 4RKUJ 3CXHD 3PXSA 1HJBA 3EFGA 3CWBJ 1S9KE 3CYTI 2BLFB 1NVOA 3C8VA 4Z1MH 3AEAC 1YEBA 2K3RA 1AVOA 3CX5D 5KAIH 1K05A 2YMKA 1H32B 1QYZA 4PJ0E 3B71A 2WPQA 4KJMA 2BCCD 3L73D 2P1JA 2JTIB 5KJ7A 3L37A 1NTME 4HKZH 1KQFB 1EDJA 1JOCA 2CA3B 4GOEA 1SLQA 2FRCA 4N78E 2AI5A 1DIIC 3L71D 3V4WA 4PD4H 3GMAA 2BH4X 4MU8A 2XDJA 2JQRA 155CA 3A0BV 5TISE 1L0LG 1SFCC 1KILD 1L0NJ 2R32A 2IBZE 2AIUA 1FAVA 4C46A 3CCSP 3PTZA 3G6EP 5KAIV 2N18B 1RE3C 1L9BC 3BCCD 1NTKK 5CCHC 1AQTA 4IL6E 2N9IA 1NYHA 3GHGC 1COTA 3VMAA 5BU8B 1EZVI 4M3LA 2DW3A 2M3EA 2HLOA 1EB7A 3O20A 3CWBD 1CTZA 2LITA 4ZNCA 4AANA 1DX7A 5AVYB 3AEGC 4EI2A 2WTYA 2MKVA 1CRCA 1GKSA 2K9JA 2PACA 3N7NA 3H1JG 3RBZA 4GYDA 1FZCB 3ZCFA 5CCGC 2GUSA 5CIEB 3WUUA 1CXAA 4DT0A 2JR8A 2A45H 3CXHH 5EXQA 3CC4P 2KOGA 1LC1A 3L74G 4N6JA 3BVHA 5BVZA 3FWNA 3CX5H 2OTJP 1GZLA 1LTSC 1OWAA 2ZVNB 4WY4B 3V2QA 3H1KG 1L0LJ 2FYNC 1NHLA 1DVVA 2K9JB 2D2CD 1UIIA 1RE4A 2NPSA 3HQ6A 1CYCA 1YJWP 2GA1A 451CA 1Z56A 1CO6A 1HH7A 1KORA 4AYCA 3JC22 1SQXD 3NMDA 3HQ8A 1CHIA 2IZ0A 1FE6A 3U1AA 2RKLA 4Q5PA 1FZFA 4H44B 1BCCD 4D6TG 5KJ7C 2XU6A 4U3FG 1PP9E 2FXPA 2N18C 1DH3A 5GTIE 2NPSB 1N7SA 1YIQA 1GDVA 1IQCA 3LW5H 3H1HG 5AW5B 3MTUE 1URQD 2D0WA
chains in the Genus database with same CATH topology
1AOQA 3WFBC 2PCCB 1NMLA 1R0QA 1KX2A 2FYUD 3M97X 2GC7D 5DJQB 4AAOA 1DW3A 5CIHB 1ZRTD 1AOFA 5GTIV 1MG2D 4PW9B 1C52A 1C6RA 1BGYD 1N90A 1HJ3A 1CNOA 4K3IA 2KS1A 2D0SA 3ITKA 4EDFA 1HJ5A 2BCNB 4FANA 1SQQD 3GG2A 1LC2A 1NTKD 3ZOYA 4Y5RA 1KB9D 1CEDA 2CE0A 1A2SA 1CRYA 4L3HA 1DW0A 2RN0A 5CIDB 1CYJA 3ZOOA 3PHLA 1CORA 5E79V 1YEAA 4QAOA 1BE3D 4WQ7A 1S5LV 2B4ZA 2LIRA 1U74B 1H9XA 2YCCA 1SQBD 4FA4A 4PWAA 1CC5A 1CSUA 1DW2A 3H1ID 1AKKA 1JDLA 2KNCB 1L0ND 1M70A 3H1JD 1N9CA 3RN0A 1CIGA 1L9JC 1HZUA 1C2RA 2XTSB 1M60A 1FJ0A 1CIFA 5B6QA 3SJLA 2QJYB 1I8OA 1M6ZA 3DR0A 3RLMA 4EIEA 3TYIA 2ZOOA 1KYOW 3L74D 1RAPA 3SVWA 1J3SA 3WFDC 3SWSA 2AXTV 2Y0CA 2MTAC 5C9MA 1C7MA 1QN2A 1NTMD 1VYDA 3VRDA 3C2CA 3O1YA 1H9YA 3H1KD 5C0ZA 2V07A 3PLNA 2C2CA 2CE1A 3WC8A 4WQ9A 2YQBA 5CICB 3CP5A 3OCDA 4WQCA 1IRVA 3ZIYA 5CIGB 1CRIA 3L4MA 3O5CA 4JCGA 1GQ1A 3X39A 4A7PA 4O1WA 2B11B 2L91A 4RSZA 3CX5W 5KLIB 3ZOWA 2IBZD 1CCRA 1CHJA 4PD4D 1ETPA 1IO3A 5IY51 1LS9A 3L70D 5H2FV 1DT1A 5CIBB 1B7VA 1NIRA 3MK7B 3O0RC 2A06D 1A56A 1C75A 3L75D 3OCDB 4XXLA 2GB8B 1L0LD 2EXVA 1S6VB 3ORVA 1KX7A 4XYDB 4P4QB 4AAMA 4V2KA 2Q3EA 1E29A 3WU2V 3GW6A 1E8EA 1FI9A 3L4OA 1WVEC 1W5CT 1YFCA 3DP5A 1FCDC 3HQ9A 4WQDA 5KLVD 3OA8A 4LJIA 4H0JA 1NMIA 2GC4D 1I6EA 4L1QA 1HRCA 1HCMA 4H0KA 2C9XB 3VNWA 3CU4A 1KYOD 3WFEC 1U75B 3L72D 1CIEA 2C8SA 1H32A 1K3GA 1OAEA 2C1VA 3TGUD 3KHUA 1WEJF 4IL6V 1C2NA 1CSXA 4N0KA 1FI7A 2GIWA 3SLEA 1I6DA 1MG3D 351CA 5B5EV 3DMIA 1CSWA 4FB1A 4WQBA 2C1DA 1CRGA 3WFCC 1CYIA 4NFGB 2VHDA 2BPBB 4EIDA 3OA8B 4WQAA 4UB6V 2N3BA 1MZ4A 2DGEA 3CXHD 2N9YB 3PXSA 1CRHA 1RZ5A 4L3GA 1HROA 1I8PA 4WQEA 3CYTI 2BLFB 2QG4A 1HJ4A 1YEBA 1BL9A 3CX5D 1H32B 1CHHA 1QYZA 5TJHA 3HQ7A 2CXBA 2BCCD 3L73D 1H33A 3NWVA 1HZVA 2JTIB 3A0HV 1H31A 5DF5A 3ZBMA 1ZZHA 1H1OA 2CA3B 5KKZB 2FRCA 4KMGA 1I55A 2AI5A 1DIIC 4O1QA 1CTYA 1PP9D 3L71D 2N9JA 2Y0EA 2BH4X 4RJTA 3MK7C 4MU8A 4PJ0V 1FHBA 2JQRA 155CA 2CA4B 3A0BV 5CYTR 3VYMA 2C1UA 1H33B 4D6TD 4AALA 4U3FD 2AIUA 1QKSA 1CIHA 2HV4A 1H31B 4UB8V 1YNRA 1RZ6A 3RN1A 3PTZA 3PXTA 5KAIV 2MHMA 2N18B 4GEDB 1L9BC 1SQVD 3BCCD 1IRWA 3ZOXA 1NU1D 1K3HA 1GIWA 3H1HD 2N9IA 1COTA 3VMAA 2OZ1A 1CSVA 1NTZD 1CXCA 4DY9A 2Y0DA 1EB7A 3O20A 3TDKA 1YICA 1IZL0 5TISV 4FA1A 3CWBD 2N3YA 1CTZA 2LITA 5CIFB 4AANA 2FWLA 5B66V 1SQPD 1GJQA 2BGVX 3KZIV 1F1FA 3TF5A 1AYGA 1CRCA 1GKSA 3JBTB 2PACA 2RMZA 3H1LD 4GYDA 2BH5X 1RAQA 3ZCFA 5CIEB 5AURA 1CXAA 3PH2B 1N50A 1DW1A 1YTCA 2PCBB 2I8FA 2OZ1B 1C6SA 3FWLA 5EXQA 1LMSA 2ZXYA 1LC1A 2JWAA 2ZBOA 2YIUB 1OCDA 3PRJA 4J20A 2QJKB 4EIFA 1DIQC 4FA9A 2B10B 2ZONG 1KV9A 1A8CA 1NNOA 1DVVA 2K9JB 2ORLA 4AX3A 1FI3A 2ZZS1 1EZVD 2YK3A 3HQ6A 1CYCA 3NBTA 2L4DA 4EICA 4FA5A 1CTJA 1E2RA 451CA 2FYNB 1CO6A 2QJPB 1HH7A 1CRJA 1LFMA 2C1DB 1GU2A 1SQXD 1P84D 3HQ8A 1DVHA 1CHIA 3PXWA 2DVHA 5GTHV 2O3JA 1W2LA 4Q5PA 4YE1A 1I5TA 1YCCA 1KIBA 1BCCD 3SXTA 3WUIA 1QL3A 3RMZA 1CCHA 5DFSA 2N18C 1C6OA 2B12B 3NBSA 1F1CA 1GDVA 1YIQA 4WQ8A 4FAVA 1IQCA 2B0ZB 5DJQC 1QL4A 2V08A 1FOCA 1I54A 3CXHW 1N15A 1KB0A 5KAFV 3A9FA 2D0WA 1PPJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOQ A;  3WFB C;  2PCC B;  1NML A;  1R0Q A;  1KX2 A;  2FYU D;  3M97 X;  2GC7 D;  5DJQ B;  4AAO A;  1DW3 A;  5CIH B;  1ZRT D;  1AOF A;  5GTI V;  1MG2 D;  4PW9 B;  1C52 A;  1C6R A;  1BGY D;  1N90 A;  1HJ3 A;  1CNO A;  4K3I A;  2KS1 A;  2D0S A;  3ITK A;  4EDF A;  1HJ5 A;  2BCN B;  4FAN A;  1SQQ D;  3GG2 A;  1LC2 A;  1NTK D;  3ZOY A;  4Y5R A;  1KB9 D;  1CED A;  2CE0 A;  1A2S A;  1CRY A;  4L3H A;  1DW0 A;  2RN0 A;  5CID B;  1CYJ A;  3ZOO A;  3PHL A;  1COR A;  5E79 V;  1YEA A;  4QAO A;  1BE3 D;  4WQ7 A;  1S5L V;  2B4Z A;  2LIR A;  1U74 B;  1H9X A;  2YCC A;  1SQB D;  4FA4 A;  4PWA A;  1CC5 A;  1CSU A;  1DW2 A;  3H1I D;  1AKK A;  1JDL A;  2KNC B;  1L0N D;  1M70 A;  3H1J D;  1N9C A;  3RN0 A;  1CIG A;  1L9J C;  1HZU A;  1C2R A;  2XTS B;  1M60 A;  1FJ0 A;  1CIF A;  5B6Q A;  3SJL A;  2QJY B;  1I8O A;  1M6Z A;  3DR0 A;  3RLM A;  4EIE A;  3TYI A;  2ZOO A;  1KYO W;  3L74 D;  1RAP A;  3SVW A;  1J3S A;  3WFD C;  3SWS A;  2AXT V;  2Y0C A;  2MTA C;  5C9M A;  1C7M A;  1QN2 A;  1NTM D;  1VYD A;  3VRD A;  3C2C A;  3O1Y A;  1H9Y A;  3H1K D;  5C0Z A;  2V07 A;  3PLN A;  2C2C A;  2CE1 A;  3WC8 A;  4WQ9 A;  2YQB A;  5CIC B;  3CP5 A;  3OCD A;  4WQC A;  1IRV A;  3ZIY A;  5CIG B;  1CRI A;  3L4M A;  3O5C A;  4JCG A;  1GQ1 A;  3X39 A;  4A7P A;  4O1W A;  2B11 B;  2L91 A;  4RSZ A;  3CX5 W;  5KLI B;  3ZOW A;  2IBZ D;  1CCR A;  1CHJ A;  4PD4 D;  1ETP A;  1IO3 A;  5IY5 1;  1LS9 A;  3L70 D;  5H2F V;  1DT1 A;  5CIB B;  1B7V A;  1NIR A;  3MK7 B;  3O0R C;  2A06 D;  1A56 A;  1C75 A;  3L75 D;  3OCD B;  4XXL A;  2GB8 B;  1L0L D;  2EXV A;  1S6V B;  3ORV A;  1KX7 A;  4XYD B;  4P4Q B;  4AAM A;  4V2K A;  2Q3E A;  1E29 A;  3WU2 V;  3GW6 A;  1E8E A;  1FI9 A;  3L4O A;  1WVE C;  1W5C T;  1YFC A;  3DP5 A;  1FCD C;  3HQ9 A;  4WQD A;  5KLV D;  3OA8 A;  4LJI A;  4H0J A;  1NMI A;  2GC4 D;  1I6E A;  4L1Q A;  1HRC A;  1HCM A;  4H0K A;  2C9X B;  3VNW A;  3CU4 A;  1KYO D;  3WFE C;  1U75 B;  3L72 D;  1CIE A;  2C8S A;  1H32 A;  1K3G A;  1OAE A;  2C1V A;  3TGU D;  3KHU A;  1WEJ F;  4IL6 V;  1C2N A;  1CSX A;  4N0K A;  1FI7 A;  2GIW A;  3SLE A;  1I6D A;  1MG3 D;  351C A;  5B5E V;  3DMI A;  1CSW A;  4FB1 A;  4WQB A;  2C1D A;  1CRG A;  3WFC C;  1CYI A;  4NFG B;  2VHD A;  2BPB B;  4EID A;  3OA8 B;  4WQA A;  4UB6 V;  2N3B A;  1MZ4 A;  2DGE A;  3CXH D;  2N9Y B;  3PXS A;  1CRH A;  1RZ5 A;  4L3G A;  1HRO A;  1I8P A;  4WQE A;  3CYT I;  2BLF B;  2QG4 A;  1HJ4 A;  1YEB A;  1BL9 A;  3CX5 D;  1H32 B;  1CHH A;  1QYZ A;  5TJH A;  3HQ7 A;  2CXB A;  2BCC D;  3L73 D;  1H33 A;  3NWV A;  1HZV A;  2JTI B;  3A0H V;  1H31 A;  5DF5 A;  3ZBM A;  1ZZH A;  1H1O A;  2CA3 B;  5KKZ B;  2FRC A;  4KMG A;  1I55 A;  2AI5 A;  1DII C;  4O1Q A;  1CTY A;  1PP9 D;  3L71 D;  2N9J A;  2Y0E A;  2BH4 X;  4RJT A;  3MK7 C;  4MU8 A;  4PJ0 V;  1FHB A;  2JQR A;  155C A;  2CA4 B;  3A0B V;  5CYT R;  3VYM A;  2C1U A;  1H33 B;  4D6T D;  4AAL A;  4U3F D;  2AIU A;  1QKS A;  1CIH A;  2HV4 A;  1H31 B;  4UB8 V;  1YNR A;  1RZ6 A;  3RN1 A;  3PTZ A;  3PXT A;  5KAI V;  2MHM A;  2N18 B;  4GED B;  1L9B C;  1SQV D;  3BCC D;  1IRW A;  3ZOX A;  1NU1 D;  1K3H A;  1GIW A;  3H1H D;  2N9I A;  1COT A;  3VMA A;  2OZ1 A;  1CSV A;  1NTZ D;  1CXC A;  4DY9 A;  2Y0D A;  1EB7 A;  3O20 A;  3TDK A;  1YIC A;  1IZL 0;  5TIS V;  4FA1 A;  3CWB D;  2N3Y A;  1CTZ A;  2LIT A;  5CIF B;  4AAN A;  2FWL A;  5B66 V;  1SQP D;  1GJQ A;  2BGV X;  3KZI V;  1F1F A;  3TF5 A;  1AYG A;  1CRC A;  1GKS A;  3JBT B;  2PAC A;  2RMZ A;  3H1L D;  4GYD A;  2BH5 X;  1RAQ A;  3ZCF A;  5CIE B;  5AUR A;  1CXA A;  3PH2 B;  1N50 A;  1DW1 A;  1YTC A;  2PCB B;  2I8F A;  2OZ1 B;  1C6S A;  3FWL A;  5EXQ A;  1LMS A;  2ZXY A;  1LC1 A;  2JWA A;  2ZBO A;  2YIU B;  1OCD A;  3PRJ A;  4J20 A;  2QJK B;  4EIF A;  1DIQ C;  4FA9 A;  2B10 B;  2ZON G;  1KV9 A;  1A8C A;  1NNO A;  1DVV A;  2K9J B;  2ORL A;  4AX3 A;  1FI3 A;  2ZZS 1;  1EZV D;  2YK3 A;  3HQ6 A;  1CYC A;  3NBT A;  2L4D A;  4EIC A;  4FA5 A;  1CTJ A;  1E2R A;  451C A;  2FYN B;  1CO6 A;  2QJP B;  1HH7 A;  1CRJ A;  1LFM A;  2C1D B;  1GU2 A;  1SQX D;  1P84 D;  3HQ8 A;  1DVH A;  1CHI A;  3PXW A;  2DVH A;  5GTH V;  2O3J A;  1W2L A;  4Q5P A;  4YE1 A;  1I5T A;  1YCC A;  1KIB A;  1BCC D;  3SXT A;  3WUI A;  1QL3 A;  3RMZ A;  1CCH A;  5DFS A;  2N18 C;  1C6O A;  2B12 B;  3NBS A;  1F1C A;  1GDV A;  1YIQ A;  4WQ8 A;  4FAV A;  1IQC A;  2B0Z B;  5DJQ C;  1QL4 A;  2V08 A;  1FOC A;  1I54 A;  3CXH W;  1N15 A;  1KB0 A;  5KAF V;  3A9F A;  2D0W A;  1PPJ D; 
#chains in the Genus database with same CATH topology
 2YMY A;  1AOQ A;  3WFB C;  1QEX A;  5AVS B;  1KX2 A;  5AW2 B;  3M97 X;  1Q90 D;  2FXO A;  4AAO A;  3CCE P;  3CCR P;  5CIH B;  4ZMD A;  2QA4 P;  1HVV A;  1C52 A;  4OVN F;  1LGH B;  1JMM A;  1G1I A;  1N7S B;  1U57 A;  2QRX A;  1YTZ T;  1HJ5 A;  2NZ2 A;  3SWK A;  1QVF O;  2KNC A;  3GG2 A;  1NTK D;  1D7M A;  2AXT H;  5AW4 B;  2LXB A;  3H1L E;  5CID B;  2B87 A;  1PGQ A;  3PHL A;  1COR A;  1MFT A;  1VF5 B;  5APY A;  4JYB A;  4EIJ A;  3R2P A;  4QAO A;  4D6T J;  1BE3 D;  4WQ7 A;  4U3F J;  1RQV A;  3E1R A;  2YCC A;  2FY8 A;  1GW3 A;  3BRT B;  1DW2 A;  3H1I D;  2KNC B;  5AVW B;  3H1H J;  5L8R J;  3H1J D;  3P7K A;  2C9L Y;  2XTS B;  4H13 C;  1FJ0 A;  1CIF A;  1Y9B A;  1VL2 A;  3SJL A;  2ZYD A;  1I8O A;  1QX8 A;  4H44 C;  5APW A;  1LWU A;  2ZOO A;  3L74 D;  1J3S A;  4PV1 B;  4L74 A;  2E76 C;  2AXT V;  1SQP J;  1OMI A;  5KAF E;  1RE4 C;  2NPS C;  1C7M A;  2N1T D;  1VYD A;  3VRD A;  1QL2 A;  3A5T A;  1H9Y A;  3H1K D;  1JCD A;  1JY2 N;  4IFD K;  4U7J A;  3MUD A;  2P7J A;  2M8R A;  3L4M A;  1L4A A;  2OTL P;  1SQV K;  3D70 A;  3CCL P;  1NU1 K;  1MZ9 A;  1NTZ G;  1LWU B;  1OVR A;  4RSZ A;  1NTZ K;  2MJZ A;  2IX7 C;  5KLI B;  4N3Y B;  1BGY G;  1OZH A;  2WSF H;  1N7S C;  2VRS A;  1QGK B;  2AEM A;  1JY2 O;  3M0D A;  1XTC C;  2E75 B;  3CC2 P;  1DT1 A;  5CIB B;  1YJ9 P;  3ABV C;  3MK7 B;  2FKW B;  2OYH A;  1A56 A;  2XZR A;  4LGD E;  2GB8 B;  1ZRT E;  1OW7 A;  1SFC D;  1S4X A;  1YJN P;  4AAM A;  1K04 A;  3V6I A;  4V2K A;  1L4A B;  3S4R A;  1E29 A;  3WU2 V;  1FZE A;  1N7L A;  1VF5 C;  1VQ4 P;  2IYO A;  3OA7 A;  1W5C T;  3DP5 A;  1YIT P;  3OA8 A;  1SQQ E;  4H0J A;  1T2K C;  3B5N A;  1ZOY C;  1VQL P;  3MGN A;  5CCH D;  1HRC A;  1EQ7 A;  1HCM A;  2OGU A;  1KB9 E;  3A0H H;  3VNW A;  1AJY A;  1KYO D;  3Q1M A;  2C8S A;  1JUN A;  1K3G A;  3TGU D;  1X22 A;  3KHU A;  2C0X A;  1CSX A;  1AV1 A;  1QVG O;  1FI7 A;  1SS1 A;  1VQ6 P;  1X8Y A;  3IAO A;  2OAR A;  1MG3 D;  3LID A;  5AW6 B;  3DMI A;  4PV1 C;  3VTP C;  2LR2 A;  4LC1 A;  2V7Q J;  2VHD A;  3OA8 B;  4WQA A;  3G9R A;  4YXD C;  2Z5I A;  5CCG D;  4GKG A;  3D0W A;  1ZV8 A;  1NJI Q;  2DGE A;  1NTM G;  1CRH A;  4L3G A;  4JBZ A;  4WQE A;  2WVR A;  1BGY J;  2QG4 A;  4UB8 H;  3P8M C;  2I8D A;  1T3U A;  2R44 A;  1CHH A;  5TJH A;  3NWV A;  1Q2N A;  3A0B E;  1HZV A;  3A0H V;  1LWU C;  1ZZH A;  5K5G B;  1RF1 A;  2K1A A;  2WPR A;  3RBX A;  5KLI C;  3SWY A;  5KKZ B;  1IC2 A;  4O9B A;  5KAI E;  2IBZ G;  1I55 A;  1S5L X;  4O1Q A;  1CTY A;  2ZYG A;  3L4F A;  5B66 H;  2E75 C;  2N9J A;  3S1K A;  3T97 A;  4L76 A;  5AVR B;  2J5U A;  1BDD A;  2B88 A;  2FYU K;  3MK7 C;  1KB9 I;  1SQB J;  1FHB A;  1FOS E;  3MUD C;  4YPC A;  3JSV C;  2C1U A;  5EFW B;  1L4A C;  4I6M C;  1CIH A;  4UB8 V;  4PD4 E;  1GL2 A;  1MFZ A;  3RN1 A;  1FBM A;  3L70 E;  1SQV D;  1NU1 D;  1FJP A;  1GIW A;  3HD7 A;  3M0D C;  1NTZ D;  1IFP A;  3T97 B;  1KYO H;  2Y0D A;  1NTM J;  2OYH C;  1KZU B;  1YIC A;  1Y8A A;  3KYQ A;  4FA1 A;  2N3Y A;  5CJ4 A;  2QEX P;  4WWI A;  3IF4 A;  5B66 V;  5KLV E;  4QMA A;  3AE8 C;  2QM7 A;  3B8E B;  1P84 I;  4OWF A;  3OAK A;  3KZI V;  2BAS A;  1QLE D;  3JBT B;  1L0N G;  1GL2 B;  4AQR D;  3L72 E;  3B5N C;  1L0N K;  2FFD A;  3P32 A;  3W67 A;  3HD7 B;  1C6S A;  3FWL A;  2Y9Y A;  1OIP A;  2M5A A;  3VYI A;  2O1J A;  2P67 A;  2JP3 A;  2YIU B;  2OYO A;  2PP6 A;  3Q5S A;  3A0B H;  4RO0 A;  3VMZ A;  2G8Y A;  4WY4 D;  2M0B A;  1S3J A;  3LW5 J;  3Q5P A;  3CXH E;  1NNO A;  1FI3 A;  2ZZS 1;  1EZV D;  5KKZ C;  5AVV B;  3CX5 E;  2FFD B;  1PV3 A;  1ZP0 C;  3AE3 C;  2L4D A;  4EIC A;  3AE2 C;  4FA5 A;  1E2R A;  5AVT B;  2LKM A;  2BCC E;  2FYN B;  3L73 E;  2C1D B;  3EWK A;  2KK7 A;  3PXW A;  1MKM A;  1HF9 A;  1AA0 A;  5GTH V;  2BEQ D;  2O3J A;  1I5T A;  1LP1 A;  1HUC A;  4H44 D;  1E79 H;  3II6 A;  3WUI A;  1RF1 C;  3L71 E;  5DFS A;  1A02 J;  2A06 G;  5AW9 B;  1NKN A;  2NPS D;  1QL1 A;  2CPS A;  3W68 A;  5APV A;  5DJQ C;  1GD2 E;  1QL4 A;  1KQG B;  2V08 A;  3FGA D;  1L0L K;  2KUB A;  1I54 A;  3CXH W;  4NPE A;  1N15 A;  1GW4 A;  1KIL E;  2ZT9 C;  5E79 H;  1SP4 A;  1PPJ D;  4NPF X;  2PCC B;  2N9B A;  1DIP A;  3K5B A;  1S5L H;  5AVU B;  1FDM A;  3RK3 B;  1A02 F;  2FYU D;  1AVY A;  3L75 E;  2OQQ A;  3CCV P;  3BCC E;  1LP1 B;  1MUU A;  1AOF A;  3OJA B;  1GL2 C;  2H43 A;  3RL0 B;  1M7L A;  2HPC A;  4BWN A;  2ZAE B;  3H1L G;  1N90 A;  1N7S D;  3HD7 C;  1WRG A;  4EDF A;  3CWB E;  1IFJ A;  1HTL C;  1LC2 A;  4WBA A;  4GOF A;  1PP9 J;  2YIU C;  5AW0 B;  2CE0 A;  3RGU A;  1CRY A;  1SVF A;  2WMM A;  5AW7 B;  4L3H A;  1DW0 A;  2M3B A;  2RN0 A;  1E5W A;  1EDI A;  3VP8 A;  3PH0 A;  1H0T A;  1S72 P;  1VF5 D;  2I1K A;  5E79 V;  4OH8 B;  2P10 A;  1YHQ P;  3TSI A;  1T2K D;  2HPC B;  2AXT E;  1S5L V;  2LIR A;  3TNU A;  2FFD C;  4PWA A;  2KXP B;  4RES B;  2O01 J;  2IBZ I;  1L0N D;  1R5S A;  3C9I A;  1N9C A;  3RN0 A;  2WZ7 A;  2KZI A;  3AEE C;  1L9J C;  1HZU A;  4L73 A;  3MZW B;  1CI6 A;  2PRR A;  3PP5 A;  4IFF A;  1EXJ A;  1M6Z A;  3MD0 A;  3DR0 A;  4EIE A;  3TYI A;  1FDI A;  1H0T B;  4KT0 J;  1RAP A;  4PV1 D;  3SWS A;  1PGO A;  2Y0C A;  2FYZ A;  4H13 B;  5C9M A;  1SQX E;  5CHX A;  3H1L J;  2YKO A;  5BU5 A;  2C2C A;  4WQ9 A;  2YQB A;  2E76 B;  1BCC E;  4CPG A;  3RK3 C;  3V4Q A;  4DCK A;  3ZIY A;  2JJL A;  3O5C A;  4EOT A;  1GQ1 A;  1FS0 E;  2I1J A;  4O1W A;  4I1L A;  3RL0 C;  3M9H A;  4C7R A;  5CMZ A;  1NAF A;  1CCR A;  1R8E A;  1SQP G;  2E75 D;  4DOJ A;  1VQ8 P;  2AXC A;  1KV4 A;  2WSC J;  1SQP K;  3M9Q A;  2PAJ A;  3O0R C;  3HTK A;  2A06 D;  5DJU B;  1L0L D;  2EXV A;  2JEE A;  1FZG A;  3E1I A;  3NXS A;  1JY3 P;  1L4A D;  3JCU H;  1M1J A;  3GW6 A;  3L4O A;  2Q1K A;  4TLF A;  3P8C D;  4LJI A;  2YKP A;  1FZA A;  1NTK E;  1NMI A;  3OW2 O;  1I6E A;  4H0K A;  2HFE D;  3O8Z A;  1HWT C;  3I55 P;  3HTK B;  1WEJ F;  4IL6 V;  1C2N A;  3H32 A;  1I6D A;  1BE3 E;  1G2C A;  1PIX A;  1OXZ A;  3A0H E;  1YTZ I;  4WQB A;  1M1J B;  2POH A;  3D71 A;  3AEF C;  3G4S P;  2LXC B;  2BPB B;  3H1I E;  3B5N D;  4UB6 V;  3H1J E;  2N3B A;  3CLQ A;  5DJT B;  1HRO A;  1I8P A;  2B87 B;  4C7N A;  1HJ4 A;  2YXR B;  1BL9 A;  2WSE J;  4KHX A;  3O6Q A;  3L74 E;  1SQQ J;  2P58 A;  2H8P D;  3H32 B;  3AE9 C;  4Y99 B;  3N4X A;  3RK2 B;  1G2C B;  3WU2 H;  1H31 A;  1H1O A;  4GOD A;  2WIT A;  3CCU P;  2ZJS E;  3VP9 A;  4UB8 E;  3H1K E;  4AUW A;  2QSI A;  5APT A;  1PL5 A;  5AVZ B;  4KMG A;  2SPZ A;  1FU1 A;  3Q2Y A;  1IZN B;  3L70 G;  1K8A Q;  3FX0 A;  4C7N B;  1LJ2 A;  2BEZ F;  1W5C E;  2QVA A;  3VYM A;  1M56 D;  1YQ3 C;  4D6T D;  4AAL A;  1JO5 A;  3KXD A;  4U3F D;  3IR9 A;  5B66 E;  1QKS A;  1H31 B;  1HJ0 A;  2Z4E A;  1HBW A;  2MHM A;  4GED B;  1LTT C;  2K9Y A;  5KLV G;  2K88 A;  1IRW A;  1LTB C;  3G71 P;  3H1H D;  1VPC A;  1XTG B;  1CSV A;  2WT7 A;  1GK6 A;  3V5B A;  2P2U A;  1GU4 A;  4DY9 A;  1MV8 A;  3TDK A;  1IZL 0;  3I56 P;  1IFN A;  2E74 B;  1SQP D;  1SQB G;  1JM0 A;  3AE4 C;  1GJQ A;  3TF5 A;  1M1J C;  1SQB K;  2OYH B;  1GL2 D;  1W2E A;  2W83 C;  1KYO E;  2YXQ B;  4XA4 A;  2BH5 X;  1KTM A;  5AUR A;  3AEC C;  2KSJ A;  3AE6 C;  3PH2 B;  1YTC A;  2PCB B;  3HD7 D;  3TGU E;  2I8F A;  2A45 G;  3CCM P;  2WT7 B;  3H25 A;  2KSE A;  3KQG A;  1YYC A;  4GDO A;  1PGP A;  3S9O A;  3F5H A;  3L70 J;  3B5N B;  4K35 A;  2QJK B;  2BCC G;  4Y99 C;  4EIF A;  3RK2 C;  1FOS F;  1NAY A;  1USD A;  2B10 B;  1NTM K;  1KV9 A;  1HGZ A;  2J58 A;  1VQM P;  2WPV B;  4WB4 A;  1YI2 P;  1VQP P;  2YK3 A;  5CJ0 A;  2KIK A;  1N2D C;  1H89 A;  3L71 G;  5KLV J;  3CC7 P;  1LT9 A;  1NWQ A;  1LFM A;  1GU2 A;  1P84 D;  2KLV A;  1DVH A;  1CW5 A;  2W8Z A;  1K9M Q;  1LTG C;  3L72 J;  5KTB A;  5AW8 B;  5APU A;  1RF0 A;  1KIB A;  4JYC A;  3SXT A;  3KZI H;  4K3A A;  1QL3 A;  3AED C;  1RQU A;  3AEB C;  4H0L B;  3FXE A;  1C6O A;  2IFM A;  3L75 G;  1BSN A;  2B0Z B;  1KQS O;  3B4S A;  1FOC A;  2G3A A;  5KJ7 D;  2JDI H;  1RF1 B;  1KB0 A;  1LT9 B;  3M06 A;  5KAF V;  5M1B A;  3A9F A;  2CXB A;  3I5C A;  1NML A;  3VMY A;  3RK3 D;  2E74 C;  5DJQ B;  1SQV E;  4DJG A;  1NU1 E;  3HUS A;  2H7H A;  3EQ2 A;  1ZLL A;  2ZT9 B;  3H6P A;  1FJK A;  1VQ7 P;  2BCC J;  3L73 J;  3RL0 D;  5E79 E;  1NTZ E;  1ZR2 A;  1BGY D;  1CNO A;  4K3I A;  2KS1 A;  1S5L E;  1ZXG A;  4FAN A;  4L75 A;  3CCQ P;  3PJS K;  2AEJ A;  1OVU A;  3ZOY A;  2IZ1 A;  4XFJ A;  3L71 J;  3L35 A;  1CED A;  5GTH H;  2CPB A;  2QJK C;  1YBK A;  2GUV A;  2WPS A;  1LTA C;  2IFN A;  3D6Y A;  5APQ A;  1JCC A;  1S1C X;  2B4Z A;  3HE4 A;  1U74 B;  1T6A A;  1SQB D;  2KS1 B;  1NOH A;  3L75 J;  2ZXX A;  1CSU A;  3BCC J;  1AKK A;  1JDL A;  2R5B A;  3LIE A;  1M70 A;  1OW6 A;  1C2R A;  4PD4 I;  4LLH A;  1RY3 A;  1P84 H;  5B6Q A;  4YTP C;  1S9K D;  1VDF A;  2H89 C;  3GLM A;  1PP9 G;  1EZV E;  3USS A;  5H2F H;  3RLM A;  1BCC G;  3U59 A;  4H0L C;  2ZXE B;  2M5A B;  2YO3 A;  1LTJ A;  4H13 D;  4IL6 X;  3HE4 B;  1QN2 A;  1NTM D;  3EFF K;  1S2E A;  3O1Y A;  5C0Z A;  3CD6 P;  1GU5 A;  1LT9 C;  4N78 D;  2E76 D;  5CIC B;  3CP5 A;  1ZW0 A;  4WQC A;  3KDP B;  2W90 A;  2E5Y A;  4OGQ B;  3CME P;  2PFX A;  2V7Q H;  1ZME C;  1RF0 C;  3IN6 A;  1EXI A;  4A7P A;  1RHZ B;  3V2R A;  3CI9 A;  2L91 A;  3CX5 W;  2FBW C;  3ZOW A;  2IBZ D;  3RL0 g;  1LTJ B;  4I7Z B;  1CHJ A;  3WMM 0;  2ITA A;  1PPJ E;  5IY5 1;  1LS9 A;  5H2F V;  5B5E H;  1TU3 F;  2UWJ E;  1B7V A;  1X0T A;  1NIR A;  2FYU E;  3BAT A;  1Q86 Q;  3CMA P;  1DEE G;  1EDL A;  2E42 A;  1NTK G;  3L75 D;  1JEK A;  1FZC A;  2A45 I;  1EC5 A;  4XXL A;  3CXH I;  1VQO P;  2IPP A;  1S6V B;  3ORV A;  1SQX J;  1PGJ A;  2QIW A;  3CX5 I;  2Q3E A;  3HUS C;  1DEB A;  5CBN A;  1FI9 A;  4YXW H;  1L2P A;  1YFC A;  1FCD C;  3HQ9 A;  4WQD A;  1BCC J;  1BE3 G;  2Y9Z A;  3QH9 A;  3ZDM A;  2GC4 D;  1T3J A;  3GF3 A;  4WY4 A;  4L1Q A;  1J2J B;  4UB6 E;  2C9X B;  3JCU E;  1CIE A;  1OX3 A;  1KMI Z;  3H1I G;  4HB1 A;  5C39 A;  1OAE A;  2C1V A;  4N0K A;  3SLE A;  1M1K Q;  3E7K A;  351C A;  5B5E V;  4JQ0 D;  4FB1 A;  4PJ0 H;  4NFG B;  1NKZ B;  4EID A;  1L0N E;  1X79 B;  3WUV A;  3MIW A;  3CL3 D;  2N9Y B;  1RZ5 A;  2WSS H;  2WSF J;  2QE7 H;  4R4L A;  4OGQ C;  2WQY C;  3M0A A;  1KIL A;  3HQ7 A;  3TNU B;  1H33 A;  1NTK J;  3RK2 D;  1NO4 A;  1JY2 P;  5DF5 A;  3ZBM A;  5TIS H;  1LTJ C;  4I7Z C;  1N73 A;  2YO2 A;  1CI6 B;  2ZVO B;  2W6A A;  1PP9 D;  2JWD A;  1BE3 J;  2Y0E A;  4XE5 B;  4R4M A;  4RJT A;  3WU2 E;  4PJ0 V;  3SWF A;  1DD4 A;  1WT6 A;  2IYP A;  1WMK A;  2CA4 B;  4IL6 H;  1JTH A;  1VQN P;  3H1I J;  1KIL B;  2HR3 A;  5CYT R;  1KFM A;  1H33 B;  3TYY A;  3H1J J;  1Y47 A;  3CPW O;  4ASV A;  4W80 A;  2Q6Q A;  2HV4 A;  1SQQ G;  1X9V A;  1YNR A;  1RZ6 A;  2R5D A;  1VQK P;  3PXT A;  5CBO A;  1SQQ K;  3ZOX A;  4UB6 H;  1N73 B;  1K3H A;  3A7O A;  3L74 J;  1CSB A;  2A06 E;  1FDO A;  2E5T A;  2KZJ A;  3IFM A;  2JO1 A;  1PFI A;  2OZ1 A;  1L0L E;  1LNQ A;  4B86 A;  1CXC A;  2W6B A;  3D6Z A;  2JKV A;  5TIS V;  1FZC C;  2R3S A;  3H1K J;  3SFD C;  3TGU G;  5CIF B;  1Q82 Q;  1JTH B;  2FWL A;  2E74 D;  3P8C E;  1BSH A;  2E43 A;  2BGV X;  1F1F A;  2OYI A;  1AYG A;  2Q5U A;  4JPZ B;  2WWW A;  2RMZ A;  3H1L D;  1RAQ A;  4I2L C;  2W27 A;  1N50 A;  1DW1 A;  3GF7 A;  4W7Y A;  4WY4 C;  1EDK A;  2YKQ A;  2OZ1 B;  3R4Y A;  5AVX B;  1RH5 B;  1LMS A;  2ZXY A;  2JWA A;  2ZBO A;  4MN4 C;  2KLU A;  1AQ5 A;  2RH0 A;  1OCD A;  3PRJ A;  1G1J A;  4J20 A;  4TT3 H;  4HJG H;  1DIQ C;  4FA9 A;  1M8O B;  1UIX A;  1U7M A;  4NPD A;  2ZON G;  2OYI B;  1VQ9 P;  1A8C A;  2ORL A;  4AX3 A;  2D2C B;  2IDB A;  1KC8 Q;  1BDC A;  3NBT A;  1IFI A;  4GT1 A;  2XV5 A;  4EYY Q;  1CTJ A;  2HYN A;  1GDT A;  1AFO A;  2KI7 B;  2QJP B;  1CRJ A;  5GTI H;  1URQ A;  1IJD B;  2H88 C;  5AW1 B;  1Q7Y Q;  1KIL C;  2DVH A;  2XKM A;  1W2L A;  4YE1 A;  1H8A A;  1YCC A;  1IO4 A;  4IOI H;  1U7J A;  1NH4 A;  3TGU J;  4WVZ A;  3RMZ A;  3U1C A;  2QM8 A;  2O1K A;  4H0L D;  1CCH A;  2C9N Y;  3VOP A;  3G3Z A;  2Q9I A;  2L5G B;  2B12 B;  1IK9 A;  2O01 H;  3O6Q B;  1N73 C;  3NFQ A;  3NBS A;  1SQV G;  1F1C A;  4WQ8 A;  4FAV A;  1NU1 G;  3VMX A;  4D6T E;  3KZI E;  1USE A;  1JNM A;  1URQ B;  1GK4 A;  4U3F E;  1Q81 Q;  1R0Q A;  4W7Z A;  3V2N A;  5KLV K;  2GC7 D;  1W2B O;  1ZR4 A;  2AEF A;  1DW3 A;  1N86 A;  3H1H E;  2ZT9 D;  1ZRT D;  3CCJ P;  3L72 G;  5GTI V;  1MG2 D;  4PW9 B;  4HYT B;  1C6R A;  2K37 A;  2YNY A;  2B89 A;  4Y28 J;  1HJ3 A;  2D0S A;  1YIJ P;  3Q3D A;  3ITK A;  3M9B A;  3BRV B;  2BCN B;  2Q3I A;  1JY3 N;  1M90 Q;  1SQQ D;  1SQP E;  3C1L A;  2OTK E;  4Y5R A;  1KB9 D;  1N8R Q;  1A2S A;  3AE5 C;  2KP8 A;  4JF7 A;  3F89 A;  1CYJ A;  1OFC X;  2W6J H;  3ZOO A;  1JB0 J;  2OYI C;  2Q7C A;  1YEA A;  3KPE A;  2D2C C;  4ZKU A;  3QWO C;  2N1T A;  1EZV G;  1JY3 O;  3SFE C;  1H9X A;  3L73 G;  4FA4 A;  2WSC H;  1H88 A;  5GTH E;  1CC5 A;  1J1D B;  1SQV J;  2QJP C;  1NU1 J;  4IFM A;  5KAF H;  4ZKP A;  1R5L A;  1CIG A;  2NRG A;  1M60 A;  3M91 A;  3WUT A;  1NTZ J;  3A3Y B;  3VN0 A;  2QJY B;  2FXM A;  1PZQ A;  1T8Z A;  3NTN A;  5APX A;  3SVW A;  1KYO W;  1LT1 A;  2ZFC A;  3WFD C;  2V4H A;  3BAS A;  1J1E B;  3Q5R A;  2MTA C;  2N1T B;  1P84 E;  3C2C A;  2B9B A;  1KD1 Q;  2V07 A;  3PLN A;  1GTW A;  2CE1 A;  3WC8 A;  5H2F E;  1JMB A;  3MHV A;  1URQ C;  3A2A A;  3OCD A;  1PPJ G;  3BCC G;  1SFC A;  4OGQ D;  1KYO I;  1IRV A;  1IK7 A;  2XNX A;  5CIG B;  1CRI A;  2FYU G;  3AE7 C;  4JCG A;  1HH0 A;  3X39 A;  3UIA A;  1CZQ A;  2B11 B;  2KB7 P;  3HRN A;  1RE3 A;  3V2P A;  2ZYA A;  4BXL A;  1KN7 A;  3CWB G;  5CCH A;  4PD4 D;  3GHG A;  1ETP A;  2WSE H;  1IO3 A;  3AE1 C;  3L70 D;  3RK3 E;  4DZO A;  2C0W A;  4ASW A;  1VQ5 P;  3HE5 A;  1C75 A;  3OCD B;  2CK3 H;  1KX7 A;  1KB9 H;  4XYD B;  4P4Q B;  1FZB A;  1SFC B;  5AVQ B;  1BGY E;  1IFD A;  5AW3 B;  1E8E A;  5B5E E;  1DD3 A;  1WVE C;  1FC2 C;  3SSU A;  4BRY A;  5KLV D;  2XND H;  5CCG A;  2KYV A;  1KFN A;  1OW8 A;  2HOD A;  3TK1 A;  1HGV A;  3GHG B;  3L36 A;  1J1D C;  3CU4 A;  2R3C A;  3WFE C;  3HUS B;  3MP7 B;  1U75 B;  3L72 D;  2HG5 D;  5APS A;  1KQL A;  1H32 A;  3HE5 B;  2GM4 A;  1NGM B;  2PGD A;  2QJY C;  1GMJ A;  1LTI C;  2GIW A;  4HH2 A;  1OVV A;  2O01 N;  2Z5H A;  1CSW A;  1SQB E;  2C1D A;  1CRG A;  2FYU J;  1J1E C;  2J59 M;  3WFC C;  1CYI A;  1K73 Q;  1SQX G;  4BRY B;  1YQ4 C;  1M57 D;  2N1T C;  1ZN5 A;  1IFM A;  2HOD B;  3FXD A;  1SQX K;  1MZ4 A;  4GIF A;  4RKU J;  3CXH D;  3PXS A;  1HJB A;  3EFG A;  3CWB J;  1S9K E;  3CYT I;  2BLF B;  1NVO A;  3C8V A;  4Z1M H;  3AEA C;  1YEB A;  2K3R A;  1AVO A;  3CX5 D;  5KAI H;  1K05 A;  2YMK A;  1H32 B;  1QYZ A;  4PJ0 E;  3B71 A;  2WPQ A;  4KJM A;  2BCC D;  3L73 D;  2P1J A;  2JTI B;  5KJ7 A;  3L37 A;  1NTM E;  4HKZ H;  1KQF B;  1EDJ A;  1JOC A;  2CA3 B;  4GOE A;  1SLQ A;  2FRC A;  4N78 E;  2AI5 A;  1DII C;  3L71 D;  3V4W A;  4PD4 H;  3GMA A;  2BH4 X;  4MU8 A;  2XDJ A;  2JQR A;  155C A;  3A0B V;  5TIS E;  1L0L G;  1SFC C;  1KIL D;  1L0N J;  2R32 A;  2IBZ E;  2AIU A;  1FAV A;  4C46 A;  3CCS P;  3PTZ A;  3G6E P;  5KAI V;  2N18 B;  1RE3 C;  1L9B C;  3BCC D;  1NTK K;  5CCH C;  1AQT A;  4IL6 E;  2N9I A;  1NYH A;  3GHG C;  1COT A;  3VMA A;  5BU8 B;  1EZV I;  4M3L A;  2DW3 A;  2M3E A;  2HLO A;  1EB7 A;  3O20 A;  3CWB D;  1CTZ A;  2LIT A;  4ZNC A;  4AAN A;  1DX7 A;  5AVY B;  3AEG C;  4EI2 A;  2WTY A;  2MKV A;  1CRC A;  1GKS A;  2K9J A;  2PAC A;  3N7N A;  3H1J G;  3RBZ A;  4GYD A;  1FZC B;  3ZCF A;  5CCG C;  2GUS A;  5CIE B;  3WUU A;  1CXA A;  4DT0 A;  2JR8 A;  2A45 H;  3CXH H;  5EXQ A;  3CC4 P;  2KOG A;  1LC1 A;  3L74 G;  4N6J A;  3BVH A;  5BVZ A;  3FWN A;  3CX5 H;  2OTJ P;  1GZL A;  1LTS C;  1OWA A;  2ZVN B;  4WY4 B;  3V2Q A;  3H1K G;  1L0L J;  2FYN C;  1NHL A;  1DVV A;  2K9J B;  2D2C D;  1UII A;  1RE4 A;  2NPS A;  3HQ6 A;  1CYC A;  1YJW P;  2GA1 A;  451C A;  1Z56 A;  1CO6 A;  1HH7 A;  1KOR A;  4AYC A;  3JC2 2;  1SQX D;  3NMD A;  3HQ8 A;  1CHI A;  2IZ0 A;  1FE6 A;  3U1A A;  2RKL A;  4Q5P A;  1FZF A;  4H44 B;  1BCC D;  4D6T G;  5KJ7 C;  2XU6 A;  4U3F G;  1PP9 E;  2FXP A;  2N18 C;  1DH3 A;  5GTI E;  2NPS B;  1N7S A;  1YIQ A;  1GDV A;  1IQC A;  3LW5 H;  3H1H G;  5AW5 B;  3MTU E;  1URQ D;  2D0W A; 
#chains in the Genus database with same CATH homology
 1AOQ A;  3WFB C;  2PCC B;  1NML A;  1R0Q A;  1KX2 A;  2FYU D;  3M97 X;  2GC7 D;  5DJQ B;  4AAO A;  1DW3 A;  5CIH B;  1ZRT D;  1AOF A;  5GTI V;  1MG2 D;  4PW9 B;  1C52 A;  1C6R A;  1BGY D;  1N90 A;  1HJ3 A;  1CNO A;  4K3I A;  2KS1 A;  2D0S A;  3ITK A;  4EDF A;  1HJ5 A;  2BCN B;  4FAN A;  1SQQ D;  3GG2 A;  1LC2 A;  1NTK D;  3ZOY A;  4Y5R A;  1KB9 D;  1CED A;  2CE0 A;  1A2S A;  1CRY A;  4L3H A;  1DW0 A;  2RN0 A;  5CID B;  1CYJ A;  3ZOO A;  3PHL A;  1COR A;  5E79 V;  1YEA A;  4QAO A;  1BE3 D;  4WQ7 A;  1S5L V;  2B4Z A;  2LIR A;  1U74 B;  1H9X A;  2YCC A;  1SQB D;  4FA4 A;  4PWA A;  1CC5 A;  1CSU A;  1DW2 A;  3H1I D;  1AKK A;  1JDL A;  2KNC B;  1L0N D;  1M70 A;  3H1J D;  1N9C A;  3RN0 A;  1CIG A;  1L9J C;  1HZU A;  1C2R A;  2XTS B;  1M60 A;  1FJ0 A;  1CIF A;  5B6Q A;  3SJL A;  2QJY B;  1I8O A;  1M6Z A;  3DR0 A;  3RLM A;  4EIE A;  3TYI A;  2ZOO A;  1KYO W;  3L74 D;  1RAP A;  3SVW A;  1J3S A;  3WFD C;  3SWS A;  2AXT V;  2Y0C A;  2MTA C;  5C9M A;  1C7M A;  1QN2 A;  1NTM D;  1VYD A;  3VRD A;  3C2C A;  3O1Y A;  1H9Y A;  3H1K D;  5C0Z A;  2V07 A;  3PLN A;  2C2C A;  2CE1 A;  3WC8 A;  4WQ9 A;  2YQB A;  5CIC B;  3CP5 A;  3OCD A;  4WQC A;  1IRV A;  3ZIY A;  5CIG B;  1CRI A;  3L4M A;  3O5C A;  4JCG A;  1GQ1 A;  3X39 A;  4A7P A;  4O1W A;  2B11 B;  2L91 A;  4RSZ A;  3CX5 W;  5KLI B;  3ZOW A;  2IBZ D;  1CCR A;  1CHJ A;  4PD4 D;  1ETP A;  1IO3 A;  5IY5 1;  1LS9 A;  3L70 D;  5H2F V;  1DT1 A;  5CIB B;  1B7V A;  1NIR A;  3MK7 B;  3O0R C;  2A06 D;  1A56 A;  1C75 A;  3L75 D;  3OCD B;  4XXL A;  2GB8 B;  1L0L D;  2EXV A;  1S6V B;  3ORV A;  1KX7 A;  4XYD B;  4P4Q B;  4AAM A;  4V2K A;  2Q3E A;  1E29 A;  3WU2 V;  3GW6 A;  1E8E A;  1FI9 A;  3L4O A;  1WVE C;  1W5C T;  1YFC A;  3DP5 A;  1FCD C;  3HQ9 A;  4WQD A;  5KLV D;  3OA8 A;  4LJI A;  4H0J A;  1NMI A;  2GC4 D;  1I6E A;  4L1Q A;  1HRC A;  1HCM A;  4H0K A;  2C9X B;  3VNW A;  3CU4 A;  1KYO D;  3WFE C;  1U75 B;  3L72 D;  1CIE A;  2C8S A;  1H32 A;  1K3G A;  1OAE A;  2C1V A;  3TGU D;  3KHU A;  1WEJ F;  4IL6 V;  1C2N A;  1CSX A;  4N0K A;  1FI7 A;  2GIW A;  3SLE A;  1I6D A;  1MG3 D;  351C A;  5B5E V;  3DMI A;  1CSW A;  4FB1 A;  4WQB A;  2C1D A;  1CRG A;  3WFC C;  1CYI A;  4NFG B;  2VHD A;  2BPB B;  4EID A;  3OA8 B;  4WQA A;  4UB6 V;  2N3B A;  1MZ4 A;  2DGE A;  3CXH D;  2N9Y B;  3PXS A;  1CRH A;  1RZ5 A;  4L3G A;  1HRO A;  1I8P A;  4WQE A;  3CYT I;  2BLF B;  2QG4 A;  1HJ4 A;  1YEB A;  1BL9 A;  3CX5 D;  1H32 B;  1CHH A;  1QYZ A;  5TJH A;  3HQ7 A;  2CXB A;  2BCC D;  3L73 D;  1H33 A;  3NWV A;  1HZV A;  2JTI B;  3A0H V;  1H31 A;  5DF5 A;  3ZBM A;  1ZZH A;  1H1O A;  2CA3 B;  5KKZ B;  2FRC A;  4KMG A;  1I55 A;  2AI5 A;  1DII C;  4O1Q A;  1CTY A;  1PP9 D;  3L71 D;  2N9J A;  2Y0E A;  2BH4 X;  4RJT A;  3MK7 C;  4MU8 A;  4PJ0 V;  1FHB A;  2JQR A;  155C A;  2CA4 B;  3A0B V;  5CYT R;  3VYM A;  2C1U A;  1H33 B;  4D6T D;  4AAL A;  4U3F D;  2AIU A;  1QKS A;  1CIH A;  2HV4 A;  1H31 B;  4UB8 V;  1YNR A;  1RZ6 A;  3RN1 A;  3PTZ A;  3PXT A;  5KAI V;  2MHM A;  2N18 B;  4GED B;  1L9B C;  1SQV D;  3BCC D;  1IRW A;  3ZOX A;  1NU1 D;  1K3H A;  1GIW A;  3H1H D;  2N9I A;  1COT A;  3VMA A;  2OZ1 A;  1CSV A;  1NTZ D;  1CXC A;  4DY9 A;  2Y0D A;  1EB7 A;  3O20 A;  3TDK A;  1YIC A;  1IZL 0;  5TIS V;  4FA1 A;  3CWB D;  2N3Y A;  1CTZ A;  2LIT A;  5CIF B;  4AAN A;  2FWL A;  5B66 V;  1SQP D;  1GJQ A;  2BGV X;  3KZI V;  1F1F A;  3TF5 A;  1AYG A;  1CRC A;  1GKS A;  3JBT B;  2PAC A;  2RMZ A;  3H1L D;  4GYD A;  2BH5 X;  1RAQ A;  3ZCF A;  5CIE B;  5AUR A;  1CXA A;  3PH2 B;  1N50 A;  1DW1 A;  1YTC A;  2PCB B;  2I8F A;  2OZ1 B;  1C6S A;  3FWL A;  5EXQ A;  1LMS A;  2ZXY A;  1LC1 A;  2JWA A;  2ZBO A;  2YIU B;  1OCD A;  3PRJ A;  4J20 A;  2QJK B;  4EIF A;  1DIQ C;  4FA9 A;  2B10 B;  2ZON G;  1KV9 A;  1A8C A;  1NNO A;  1DVV A;  2K9J B;  2ORL A;  4AX3 A;  1FI3 A;  2ZZS 1;  1EZV D;  2YK3 A;  3HQ6 A;  1CYC A;  3NBT A;  2L4D A;  4EIC A;  4FA5 A;  1CTJ A;  1E2R A;  451C A;  2FYN B;  1CO6 A;  2QJP B;  1HH7 A;  1CRJ A;  1LFM A;  2C1D B;  1GU2 A;  1SQX D;  1P84 D;  3HQ8 A;  1DVH A;  1CHI A;  3PXW A;  2DVH A;  5GTH V;  2O3J A;  1W2L A;  4Q5P A;  4YE1 A;  1I5T A;  1YCC A;  1KIB A;  1BCC D;  3SXT A;  3WUI A;  1QL3 A;  3RMZ A;  1CCH A;  5DFS A;  2N18 C;  1C6O A;  2B12 B;  3NBS A;  1F1C A;  1GDV A;  1YIQ A;  4WQ8 A;  4FAV A;  1IQC A;  2B0Z B;  5DJQ C;  1QL4 A;  2V08 A;  1FOC A;  1I54 A;  3CXH W;  1N15 A;  1KB0 A;  5KAF V;  3A9F A;  2D0W A;  1PPJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...