3H1JD

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 69
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1jD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1jD02
3L70D 1CXCA 1NU1D 1CHHA 1N90A 5C0ZA 4WQCA 4EIEA 3L4MA 3ORVA 5C9MA 4UB6V 3VNWA 2RMZA 3VYMA 3H1HD 3WFCC 2IBZD 1B7VA 4D6TD 2PCCB 2ZBOA 1SQQD 4FA1A 1CSXA 1RZ6A 1CRYA 1AOQA 1YNRA 2QJPB 2YCCA 4PD4D 4UB8V 5B6QA 3GG2A 3ZOWA 1A2SA 1L9JC 1WVEC 1IRWA 1HJ4A 1AKKA 1JDLA 4L3GA 1CIGA 2D0SA 4PWAA 2N9JA 2C1DB 1FOCA 3PHLA 2GC7D 3CP5A 1CRJA 1L0ND 3JBTB 3ZIYA 2AI5A 2YK3A 1AOFA 1SQBD 4WQ8A 1NTMD 4N0KA 4V2KA 451CA 4PJ0V 4EICA 2PACA 2GB8B 1F1FA 2CA3B 1HZUA 3TF5A 2Y0CA 1COTA 1MZ4A 2B12B 1ZRTD 1FI7A 1WEJF 1H33A 4RSZA 2O3JA 1LC2A 3SLEA 351CA 1CYCA 2YIUB 1CEDA 1DW2A 3ZCFA 1QYZA 3OA8B 3WFDC 3CXHW 1YTCA 1FHBA 1DIQC 3CX5W 1QL4A 1HJ3A 1YEBA 2BH5X 1NTZD 4WQAA 5TISV 4L1QA 1QL3A 2FYNB 1IQCA 1W2LA 3CU4A 5B66V 2GIWA 1KB0A 1U74B 4FA5A 4QAOA 5GTIV 1C7MA 2BPBB 3O1YA 3WC8A 1VYDA 3KHUA 2YQBA 5TJHA 2BH4X 4U3FD 4P4QB 1CHIA 1IRVA 5DJQB 3SXTA 1CCHA 1CIHA 3HQ9A 3M97X 3BCCD 4AAOA 1CSVA 3PLNA 4YE1A 4J20A 3SVWA 4AAMA 2HV4A 2N9YB 4JCGA 3NWVA 4DY9A 3CYTI 1NMIA 4H0KA 4PW9B 5IY51 2PCBB 2N3BA 2K9JB 2AIUA 4WQ7A 1KB9D 1QKSA 3SWSA 3ZBMA 3OCDB 1CHJA 1CYJA 3L72D 1I5TA 1RZ5A 1CRCA 1C2RA 3L74D 1CSUA 3WFBC 2KS1A 5CIHB 1HROA 5DJQC 2N9IA 2ORLA 2BLFB 2DVHA 1K3HA 2Q3EA 1AYGA 3CXHD 3CX5D 1U75B 4FB1A 2JQRA 1DVVA 1KX2A 4O1QA 3A9FA 1CRIA 3RLMA 2CXBA 1HH7A 2LITA 1C6RA 5KAFV 2QJKB 2XTSB 1N15A 1A56A 2CA4B 3OCDA 1H33B 3L4OA 155CA 1CTYA 1NMLA 1S6VB 5DF5A 1DW0A 1GJQA 3PTZA 3TYIA 1DT1A 5CIBB 3H1LD 2ZOOA 3H1ID 1L9BC 2B0ZB 3L71D 1CNOA 1P84D 3O20A 2Y0DA 4RJTA 1H32B 1BL9A 2B4ZA 2CE1A 4AALA 1FI9A 1HZVA 3MK7B 3RN0A 1C2NA 2FWLA 1K3GA 2C1UA 3ZOXA 1SQVD 2EXVA 4Q5PA 3PH2B 1H9YA 1HJ5A 5H2FV 4K3IA 2ZONG 3TGUD 1ETPA 2A06D 1HCMA 1C75A 1H31B 5CICB 1GKSA 1YEAA 3PXTA 1I6DA 1CIFA 3H1JD 5GTHV 3HQ8A 4Y5RA 1ZZHA 4AX3A 5KLIB 5EXQA 3X39A 2FRCA 3L73D 1IO3A 3C2CA 1A8CA 3TDKA 1NTKD 2N3YA 4H0JA 2MTAC 1I8OA 3HQ7A 3A0BV 3ZOOA 3PXSA 4L3HA 2AXTV 2GC4D 1DW3A 1EZVD 1CSWA 2ZZS1 2C8SA 2VHDA 5AURA 1NNOA 1C52A 1YFCA 1CXAA 2N18B 3ZOYA 3SJLA 1EB7A 3DMIA 3OA8A 1S5LV 1H31A 1H9XA 1KX7A 4WQEA 5CIDB 2QJYB 5B5EV 2L4DA 1OCDA 3WUIA 2BGVX 5CIEB 1CTJA 2BCNB 1R0QA 2OZ1B 1KYOD 3RMZA 4MU8A 2V08A 3L75D 1I6EA 3VMAA 2FYUD 5KLVD 5CIFB 3O0RC 1CTZA 3RN1A 1N9CA 1MG3D 1GIWA 1KYOW 2N18C 1I55A 1KV9A 3NBTA 5KAIV 1HRCA 3NBSA 1J3SA 1CO6A 1FJ0A 1CRGA 3GW6A 1GQ1A 4GEDB 1DW1A 4FA4A 1CCRA 1GU2A 1SQXD 2CE0A 1M60A 1C6OA 2C2CA 1OAEA 2Y0EA 4WQ9A 3WFEC 1NIRA 2L91A 1BCCD 5CIGB 4WQBA 5KKZB 4NFGB 1FCDC 2I8FA 1LS9A 1H1OA 2B10B 4EIFA 1MG2D 1QN2A 1LFMA 2JWAA 1CC5A 2V07A 3PXWA 2D0WA 1CRHA 4EIDA 2MHMA 4LJIA 3WU2V 3A0HV 4FANA 1E29A 1YCCA 1M6ZA 2RN0A 5CYTR 1FI3A 1PPJD 2B11B 1RAQA 2LIRA 1E2RA 1DIIC 2JTIB 3VRDA 1M70A 1CORA 5DFSA 1DVHA 3KZIV 1PP9D 4GYDA 1LC1A 2ZXYA 1F1CA 3DP5A 3FWLA 1W5CT 1CYIA 1BE3D 3CWBD 3ITKA 1CIEA 1H32A 2DGEA 4IL6V 4AANA 2C9XB 4O1WA 4A7PA 1N50A 1YICA 4FAVA 2OZ1A 4FA9A 4EDFA 1GDVA 3MK7C 4XXLA 1IZL0 4WQDA 1L0LD 1LMSA 5E79V 1KIBA 3H1KD 2QG4A 2BCCD 2C1VA 1RAPA 1YIQA 1I54A 4XYDB 2KNCB 1E8EA 4KMGA 1BGYD 1C6SA 1I8PA 3PRJA 3DR0A 3O5CA 2C1DA 3HQ6A 1SQPD
chains in the Genus database with same CATH superfamily
5APVA 1H89A 4IFMA 2E75D 5C0ZA 3L4MA 3AE4C 4L76A 5TISE 2J58A 1PGOA 3W67A 3WU2E 2E75B 3H1HD 5AW2B 2FYZA 3MTUE 2IBZD 1JY2P 3V2QA 4D6TD 2ZBOA 4FA1A 1CSXA 1AVYA 1NH4A 1TU3F 4PD4D 2H7HA 1OW6A 1OXZA 2LKMA 3ZOWA 1SVFA 4UB8H 3JCUE 1IC2A 3H1JG 2P10A 4PWAA 3KZIE 2B89A 1L0ND 1NO4A 2CK3H 3JBTB 3ZIYA 1AOFA 1FZBA 2XKMA 4GDOA 4Y99C 1R8EA 4HYTB 1NWQA 4PJ0V 2PACA 1F1FA 1L4AD 2KOGA 4JQ0D 1JMMA 4EI2A 1HGVA 3RL0g 2N1TA 3A0HH 1GMJA 1WEJF 2M0BA 4U7JA 1EC5A 1RE3A 3EFFK 1JO5A 1PL5A 1LC2A 1QVGO 4OGQB 1CYCA 1UIXA 2YIUB 3H1JE 1NAYA 1CEDA 3CXHW 3MHVA 1YEBA 2IFNA 4UB6E 2FFDA 1EDJA 1NTZD 2ZT9B 2FYNB 1M7LA 3R2PA 3M0DC 1W2LA 5B66V 2GIWA 1KB0A 4FA5A 4UB8E 5AVWB 1SQXE 3L72J 3CMEP 1C7MA 2Q6QA 4NPEA 1EQ7A 3M0AA 1AFOA 1GL2C 2BH4X 2E42A 1CHIA 2H43A 5CBOA 4C7NB 5DJQB 3SXTA 4W7ZA 1JOCA 2IBZG 3HQ9A 4W80A 2W6BA 4AAOA 1CSVA 2ZYAA 4AAMA 1OW7A 3HD7B 4JCGA 3CYTI 2I8DA 2QRXA 2RH0A 1KB9D 1X79B 3CCRP 5AVSB 1U7JA 3L74J 1OMIA 5CCGC 1CYJA 1C2RA 1N7SD 3AE3C 3WFBC 3KDPB 1LNQA 5CIHB 1IFMA 2C9NY 1E5WA 1L2PA 3V4QA 2Q3EA 1GL2D 1OFCX 2CXBA 4BRYB 2KB7P 3GLMA 4UB6H 3WUUA 3H6PA 4PD4H 1JY2O 3L4OA 1S5LH 1NMLA 4HH2A 4PJ0E 1LGHB 4PJ0H 3AE9C 3PTZA 3VTPC 2PP6A 1FZEA 3PH0A 5CIBB 1L9BC 1KC8Q 3V4WA 1P84D 1VQ6P 5AW0B 4AALA 1CSBA 1FI9A 2NPSB 3ABVC 1DEEG 3BRVB 2FWLA 1SQPE 1KILD 1SQVG 1K3GA 3BCCJ 2C1UA 3P32A 3C1LA 1KYOE 2EXVA 3PH2B 3CCSP 4NPFX 3L37A 4PV1C 4LGDE 4JPZB 2GUSA 4N6JA 4OH8B 1C75A 5CICB 3TGUE 3PXTA 1NU1G 5GTHV 3HQ8A 4Y5RA 1ZZHA 1EZVE 1FZFA 1JUNA 1EDLA 1HGZA 1KFMA 1L4AC 3AE5C 1Q90D 1LT9B 2N1TB 1I8OA 3USSA 3IAOA 3ZOOA 3GHGB 2WPQA 2AXTV 5CBNA 1CSWA 2VHDA 1SQQJ 2N18B 2Q9IA 1YBKA 2FXMA 3H32A 4OVNF 1H9XA 3VOPA 1YIJP 3S9OA 1T6AA 1X8YA 1BDDA 1OCDA 4I7ZB 1CTJA 1VQ5P 3CC4P 3CXHE 1KYOD 1NTKK 1PZQA 2E76B 4IFDK 3QWOC 3L4FA 3E7KA 5KLVD 3L75G 4K3AA 5AW8B 1JCCA 1N9CA 2IDBA 1N7SB 3NTNA 1KB9E 1HRCA 1KB9H 3NBSA 3S1KA 3AEAC 1CRGA 3GW6A 5B66H 5AVQB 4M3LA 2CE0A 3R4YA 1C6OA 2XV5A 2KZIA 2L91A 1BCCD 4I2LC 1JTHB 4WQBA 3RK3B 2UWJE 4EIFA 1MG2D 2K9JA 1QN2A 2HPCB 2Q7CA 3RL0B 1FZCC 1LFMA 1IFPA 3VMYA 1CRHA 3PJSK 1BSNA 3WU2H 3A0BE 4L73A 5APSA 1S5LX 2A06E 3BCCE 2KS1B 1YTZT 2E43A 1S1CX 1ZV8A 1T8ZA 4BRYA 1KZUB 2KUBA 2JO1A 2XZRA 3B5NB 3CCLP 5GTIH 2KP8A 5GTHE 3CWBJ 1FAVA 3IFMA 1BSHA 4JBZA 2JJLA 3DP5A 3FWLA 2AXTH 1BCCJ 2DGEA 3RK3D 1JEKA 4O1WA 3V2RA 2E74B 2DW3A 3AECC 4FAVA 2OZ1A 1VL2A 1PV3A 2BEZF 3P8CE 1VF5B 2PFXA 4C7RA 3RK2B 1G2CA 1IZL0 1KIBA 5B5EE 2BCCJ 3GHGC 1LJ2A 1S4XA 2B87A 1RAPA 1YIQA 3LW5J 2MKVA 3L75J 1E8EA 2JDIH 1C6SA 5CHXA 3O5CA 1CI6B 2C1DA 2CA3B 2FXOA 2HODA 5BU5A 1OVUA 1IK9A 4EIEA 4DT0A 3L70G 2FYUK 3ORVA 5C9MA 1PGQA 2OYHA 2RMZA 3AE7C 2H88C 2D2CC 3L71J 2OYIB 5APTA 3TNUA 2E74D 3LIEA 1SQQD 3P8MC 3V6IA 1RZ6A 2PRRA 1K8AQ 5APYA 2KZJA 5B6QA 2HODB 3RGUA 1A2SA 1WVEC 1IRWA 4WVZA 4L3GA 3T97B 2W27A 1T2KD 3CD6P 1FOCA 2GM4A 3CP5A 2YKPA 1N73B 5BVZA 3V2PA 2YK3A 3VMZA 2C9LY 1GU4A 1SQBD 1FBMA 5APXA 4KT0J 451CA 5KLVJ 2GB8B 2FYUJ 5AVXB 4WB4A 1S9KE 3TF5A 4IL6X 1ZRTD 1GL2B 1R5SA 4H44C 3V5BA 3T97A 4RSZA 2O3JA 1L4AB 351CA 2O01N 3N7NA 1E79H 3CMAP 2N1TC 5CMZA 2ZT9C 3ZCFA 2JR8A 1QYZA 3B4SA 1P84H 1PPJE 1YTCA 1NTZG 3HD7C 4H13B 3H1LG 5AW6B 3I56P 1L0NK 1SQBJ 1WMKA 3CWBE 3U1CA 5TISV 4XA4A 3L35A 3CCEP 2ZYGA 3CU4A 4QAOA 3G9RA 3OJAB 5GTIV 2BPBB 1YI2P 3O1YA 1RF0A 2QSIA 3CL3D 4P4QB 1H8AA 1SFCD 3G6EP 2Z5IA 2Q3IA 3M97X 3BCCD 1G1JA 1VF5C 2HV4A 1J1EB 4RKUJ 3F5HA 3NWVA 3H1JJ 2IFMA 4WQ7A 2W8ZA 4BXLA 3KXDA 3L73G 1QLED 2W90A 3FX0A 1I5TA 1BCCE 1CRCA 1KILA 2M8RA 1CSUA 1NTKG 3KQGA 3NXSA 1IFIA 1SQBG 1LWUC 1X0TA 2LR2A 2ITAA 1HROA 1Y8AA 4AUWA 1N7SC 1SQBK 2BLFB 1L0NJ 3VYIA 3CX5D 1U75B 2JWDA 4FB1A 2JQRA 1DVVA 2A45H 1AJYA 1N86A 4WY4C 1KQSO 2J59M 3A9FA 3O6QA 3CC7P 3Q2YA 2KK7A 2LITA 5KAFV 5K5GB 2QJKB 4WY4B 1N15A 2CA4B 1H33B 3AE2C 155CA 5DF5A 1DW0A 3JCUH 1GJQA 1NVOA 3TYIA 1KQGB 1GK6A 3H1LD 3RBZA 1NTMK 1DD3A 3M9QA 1VPCA 1KILC 1BL9A 2B4ZA 4ZKPA 3AE1C 3RN0A 3L71E 2XNXA 2FKWB 5AVTB 1C2NA 3L70J 3B5ND 2BEQD 2E5YA 4Q5PA 2A45G 2OGUA 1H9YA 4K3IA 2ZONG 4TLFA 3OAKA 3BCCG 2G3AA 2ZXEB 3IN6A 4JF7A 3K5BA 3SSUA 1M90Q 2P58A 4Y28J 1SQXG 1GKSA 1YEAA 2AEFA 4WY4D 3S4RA 5AW3B 1CIFA 3H1JD 1IK7A 4K35A 4AX3A 4W7YA 3L73D 3MP7B 5APUA 4QMAA 3TDKA 1NYHA 1NTKD 1Q86Q 2MTAC 1BGYJ 4OGQD 5AVVB 3Q5SA 4L3HA 4U3FE 3EFGA 3W68A 1WRGA 1NTMJ 2ZZS1 5AURA 1ZOYC 1JY3P 4XE5B 1CXAA 2O01H 3E1IA 3SJLA 1EZVI 1EB7A 5KLVK 3H1HJ 3HE5B 4AYCA 1PP9G 2WSEH 3TSIA 4RO0A 1NTKE 1GZLA 1KB9I 1UIIA 2YIUC 2R3CA 3RMZA 1MFTA 2B87B 4MU8A 3L75D 1I6EA 3VMAA 1FJKA 2FYUD 1YJNP 5B66E 1K73Q 4R4LA 1RF1A 1Q82Q 2I1KA 1H88A 2P1JA 2JEEA 1KYOW 3CX5H 1I55A 1KV9A 3FGAD 2OTLP 1S2EA 1FJ0A 1R5LA 1RHZB 2YKOA 2N1TD 1M60A 2QE7H 4N78E 2XNDH 3N4XA 2BCCE 5KKZB 5AW4B 1FCDC 2P67A 1SQPG 2R44A 2WSFH 2YMKA 4U3FG 2I1JA 4KHXA 2WPSA 1U57A 2NRGA 2V07A 3PXWA 2D0WA 1JY3N 2M3EA 2FFDC 1SQXJ 2QVAA 5KJ7A 2ZYDA 4LJIA 1N7SA 4FANA 3HTKB 5AW7B 4XFJA 1D7MA 1M6ZA 3SFEC 5CYTR 2FYUE 3HRNA 1PFIA 2Q1KA 5AVUB 1RAQA 1E2RA 3Q1MA 1DIIC 3A2AA 1YITP 5GTHH 1GL2A 3V2NA 2JTIB 1M70A 1CORA 1PP9D 1LC1A 2ZXYA 1VQ4P 2WSSH 3H1IJ 2E74C 1L0NG 1LP1B 3AEDC 3HTKA 1BE3G 2CPBA 3CWBG 2XU6A 4GOEA 2W83C 1SQPK 3MUDA 2C9XB 3H1LE 3L70E 1JCDA 3IF4A 1RE4A 4AQRD 1RQUA 4FA9A 3C8VA 1GDVA 3MK7C 1Q7YQ 5E79V 3U59A 1HWTC 1SQQK 3B5NA 2KIKA 3Q5PA 4GODA 2C1VA 2FY8A 4XYDB 2YNYA 4KMGA 1RY3A 3PRJA 4CPGA 3L70D 4PV1B 1IFJA 3B5NC 1CXCA 4HKZH 3Q3DA 1NU1D 1CHHA 4WQCA 5C39A 3VNWA 1KV4A 3WFCC 1PIXA 4OGQC 3G71P 1B7VA 2WT7B 1G2CB 3H1KJ 1YJWP 5CCGA 1CRYA 4IFFA 1AOQA 1YNRA 1LT9C 2QJPB 2IBZE 2IZ0A 5KAIE 2YCCA 1PGJA 4UB8V 2V4HA 2AXCA 1QEXA 4YTPC 1SQVJ 3HE4A 2D0SA 2Y9YA 3VP9A 2N9JA 2C1DB 4H13C 4LC1A 2QM8A 2OYHB 3LW5H 1QL1A 4JYCA 1NTZK 1CW5A 2FYNC 1GK4A 1M56D 1YHQP 1LTSC 1VQ7P 1HZUA 1FZGA 1XTCC 1JY2N 1MZ4A 5AVYB 2B12B 1HH0A 2M5AB 4YXDC 2K1AA 3CXHH 1A02J 4I7ZC 2KI7B 3M9HA 1L0NE 3OA8B 2OTKE 1FHBA 1DIQC 1L0LK 1ZRTE 2O1JA 3L74E 3WUTA 1HJ3A 3UIAA 1M1JB 2BH5X 3F89A 3IR9A 1S9KD 1N73A 2QIWA 1QL3A 4R4MA 1IQCA 4LLHA 1U74B 1S72P 1LTBC 1HTLC 2IYPA 1KYOH 3P8CD 1Z56A 3WC8A 1JTHA 1VYDA 3KHUA 3RK3C 1FDMA 3FXEA 1IRVA 1J1DB 2ZFCA 3L72E 1CIHA 5H2FH 3GF7A 4J20A 1LTGC 4DY9A 3C9IA 1SFCB 1BGYE 5CCHD 2PCBB 2N3BA 2LXCB 2AIUA 4U3FJ 5KTBA 3G3ZA 3SWSA 1GTWA 3OCDB 1GU5A 1LTJC 1CHJA 1NOHA 4DJGA 1RZ5A 3VP8A 1IJDB 1KMIZ 3BVHA 1H0TB 5DJQC 1K05A 2N9IA 1JNMA 2ORLA 1EZVG 3TYYA 1G1IA 4MN4C 2DVHA 1K3HA 1URQD 2YO2A 1AYGA 1HVVA 3CXHD 1PPJG 1MUUA 2GA1A 1KX2A 4O1QA 5CCHC 1HH7A 2XDJA 1C6RA 4N3YB 2XTSB 1Q81Q 1CTYA 2WITA 1NTME 5BU8B 3RK2C 2GUVA 1HF9A 4NPDA 1DT1A 4EOTA 1VQPP 3H1ID 2B0ZB 1AVOA 3L71D 2WPVB 3H1HE 3SWYA 2C0XA 2WSCH 2AEJA 1CNOA 2HYNA 1OIPA 3O20A 4RJTA 2OYOA 1H32B 1KQLA 2FFDB 2CE1A 1HZVA 5KLVE 3MUDC 2H89C 3ZOXA 3L75E 4DCKA 3I5CA 1HJ5A 1QL2A 3CCJP 3KZIH 5H2FV 3TGUD 1ETPA 1S3JA 5APWA 3VN0A 1HUCA 2OYIC 1GW3A 2A06D 4D6TJ 3CPWO 1H31B 5E79E 1EDIA 4L74A 1ZXGA 1I6DA 2K37A 1BCCG 2QJKC 5DJUB 4ZKUA 5EXQA 3X39A 2P7JA 3AEGC 1USEA 3AEEC 2IYOA 1GDTA 3C2CA 3L36A 3O8ZA 3D0WA 4GIFA 5AW1B 2N3YA 3HQ7A 4Y99B 5KJ7C 3PXSA 5AW5B 1OVVA 1VDFA 4ZNCA 2GC4D 1EZVD 2KNCA 2R5BA 1LTIC 3A7OA 2Q5UA 3OA8A 2WMMA 1S5LV 3RK3E 4HB1A 2OYHC 1N73C 2N9BA 4WQEA 1L4AA 3MZWB 2MJZA 2POHA 3AE8C 2L4DA 1S5LE 5TISH 2OZ1B 1W2BO 3Q5RA 1EDKA 3JSVC 1FS0E 4H44B 2O1KA 3L71G 2A45I 1X9VA 1URQB 3B8EB 2R3SA 3O0RC 5KAFE 1CTZA 2YXQB 3ZDMA 3RN1A 3H1KG 1KYOI 3HE5A 2FBWC 3II6A 3E1RA 5KAIV 2KLVA 4PD4I 1CI6A 1GQ1A 1W5CE 4EYYQ 1DW1A 1LWUA 1GU2A 3CI9A 2PGDA 2C2CA 1OAEA 1NU1J 4WQ9A 1URQA 3O6QB 5CIGB 1T3JA 3HUSA 3H1KE 1RE3C 4B86A 1LS9A 1RF1C 3U1AA 1ZR2A 1CZQA 1KN7A 1SQBE 3WMM0 1NTZJ 2JWAA 1RF1B 4H0LD 4ASVA 1GW4A 3QH9A 2E76C 3CXHI 4GOFA 1DH3A 5CCHA 1N8RQ 3WU2V 5CCGD 3A3YB 3A0HV 3BATA 4RESB 1E29A 1YCCA 1SQQG 1K9MQ 2Z4EA 2RKLA 4ZMDA 1FI3A 2B11B 2LIRA 3MD0A 3CC2P 2HFED 1MFZA 1JM0A 1DVHA 1YYCA 2WZ7A 2Y9ZA 3D6ZA 3KZIV 1FZCA 1NTMG 1W5CT 1BE3D 3CWBD 1A02F 2YMYA 3ITKA 1CIEA 1QX8A 1H32A 2NPSD 1ZMEC 4WBAA 2V7QH 1LTJA 5KLVG 4TT3H 5KKZC 2OQQA 4A7PA 3FXDA 1J2JB 3M06A 1YICA 2QA4P 4EDFA 2D2CB 2VRSA 1FZCB 3G4SP 1L0LD 1LMSA 4I6MC 3M9BA 2WPRA 3H1KD 2K88A 4DZOA 2BASA 5KAIH 5M1BA 1LTJB 1I54A 1WT6A 1LTTC 3DR0A 1NTKJ 2HG5D 1MV8A 3HQ6A 1BGYG 1AKKA 4H44D 1N90A 1T3UA 4JYBA 1SLQA 1Q2NA 1IO4A 4UB6V 3VYMA 5KLIC 1FDOA 1L0LE 1NHLA 3H1HG 2PCCB 1Y9BA 1NKZB 2QJYC 2IBZI 2KYVA 1FC2C 2L5GB 3BASA 3GG2A 4H13D 1KTMA 1L9JC 1Y47A 2LXBA 4EIJA 1AQ5A 1HJ4A 1JDLA 3AE6C 1CIGA 1BE3E 3SWKA 4N78D 3PHLA 3L74G 2GC7D 1LT9A 3CLQA 1M1KQ 1CRJA 1QVFO 2AI5A 2M3BA 2WTYA 4WQ8A 1NTMD 4N0KA 4V2KA 2K3RA 1IZNB 1SQQE 4EICA 5APQA 1GD2E 1NTZE 2Y0CA 3M0DA 1COTA 3A0HE 1JY3O 1FI7A 1H33A 2O01J 3L73J 3CCVP 1YTZI 1J1DC 1RF0C 3SLEA 1AV1A 1M1JC 2ZVNB 1DW2A 3OA7A 1L0LG 2WSCJ 3D71A 3WFDC 3CX5W 1QL4A 3BRTB 4YPCA 3CCMP 4WQAA 2W6AA 4L1QA 2WQYC 4GKGA 4O9BA 4HJGH 3A0BH 1HBWA 1VQLP 3RBXA 1DIPA 5CJ0A 2H8PD 2YQBA 2P2UA 5TJHA 4Z1MH 1BDCA 4U3FD 3GMAA 1OZHA 2R32A 1SS1A 1LP1A 5CJ4A 1CCHA 3RL0D 2OARA 3PLNA 4YE1A 3SVWA 1M1JA 1PP9E 1OW8A 1VQMP 2N9YB 2IZ1A 3TNUB 4H0KA 1NMIA 4PW9B 5IY51 3AEBC 4IOIH 1VQ9P 2K9JB 4DOJA 1QKSA 1MKMA 3ZBMA 1K04A 3P7KA 1YQ3C 1URQC 2C0WA 2QEXP 3L72D 5KJ7D 3L74D 1VQNP 1VF5D 1NU1E 2KS1A 4YXWH 1LTAC 1M57D 5B5EH 1N7LA 2E76D 1RH5B 5GTIE 4C46A 3VMXA 1U7MA 1DEBA 3SWFA 1SP4A 4L75A 1T2KC 5AVZB 2NPSA 1RE4C 2WWWA 3A5TA 3RLMA 1CRIA 1SFCA 1KORA 3TGUJ 1A56A 2ZJSE 1FU1A 1NKNA 3OCDA 5KAFH 1X22A 3H1LJ 1S6VB 1KQFB 3CX5I 2AEMA 2JKVA 1KILE 1USDA 2OTJP 1HJBA 1FOSF 3M91A 3KYQA 2ZOOA 2ZT9D 4WWIA 1H0TA 1NGMB 1SFCC 3HE4B 2Y0DA 2J5UA 3MK7B 1JB0J 1L0LJ 1NAFA 1N2DC 2ZVOB 1SQVD 1YJ9P 3GHGA 1DD4A 1P84I 2K9YA 4D6TE 3TGUG 2NPSC 2WSFJ 3MGNA 3B71A 3KPEA 3RK2D 3OW2O 2KSJA 4OWFA 2A06G 2WT7A 3H32B 5EFWB 1HCMA 3H25A 2ZXXA 2QJPC 1IFNA 4C7NA 2IX7C 2OYIA 5KLIB 2FRCA 1IO3A 2E5TA 3L72G 1A8CA 2FXPA 4H0JA 3HD7A 1FZAA 4H0LC 1VQOP 3A0BV 3JC22 1KILB 1DW3A 2YXRB 2C8SA 2KSEA 4GT1A 1JMBA 1NNOA 5AVRB 1C52A 1YFCA 2JP3A 2E75C 3ZOYA 2KLUA 3DMIA 1H31A 3D6YA 1KX7A 2V7QJ 2Z5HA 5CIDB 2QJYB 5B5EV 1AQTA 1P84E 3RL0C 4PD4E 3WUIA 2BGVX 5CIEB 2BCNB 1R0QA 1SQVE 1KFNA 3EWKA 3WUVA 4ASWA 1NU1K 2IPPA 1BE3J 2V08A 2W6JH 1NJIQ 2HPCA 5CIFB 1EXIA 3NMDA 1VQ8P 4I1LA 1MG3D 1GIWA 2N18C 4BWNA 1LT1A 3NBTA 2BCCG 3AEFC 1DX7A 2WSEJ 1J3SA 1CO6A 5AW9B 5DJTB 4GEDB 4IL6H 4FA4A 1SQVK 1CCRA 1OX3A 1M8OB 1SQXD 2R5DA 1FE6A 1IFDA 4KJMA 2Y0EA 1RQVA 3WFEC 1J1EC 1NIRA 1SQPJ 3EQ2A 1OWAA 3PP5A 1ZR4A 4NFGB 2KXPB 3SFDC 2I8FA 1H1OA 2YKQA 2CPSA 2B10B 1MZ9A 1ZLLA 1PGPA 1ZW0A 1HJ0A 4D6TG 1CC5A 1XTGB 4EIDA 1FOSE 1FJPA 2G8YA 3LIDA 1W2EA 3GF3A 2HLOA 2D2CD 2MHMA 1ZP0C 1LWUB 1QGKB 5L8RJ 1ZN5A 1KD1Q 2RN0A 2HR3A 3MIWA 3CCQP 3HUSC 3H1IE 1SQXK 1PPJD 1PP9J 1AA0A 1OVRA 3I55P 3VRDA 5DFSA 3NFQA 4GYDA 3HUSB 1F1CA 2B9BA 5E79H 1CYIA 2QM7A 1EXJA 1VQKP 4IL6V 2FYUG 4AANA 3H1IG 2M5AA 1N50A 2PAJA 3CCUP 4WY4A 3FWNA 2SPZA 2AXTE 4XXLA 4WQDA 1YQ4C 4H0LB 4IL6E 2NZ2A 2QG4A 4PV1D 2BCCD 3D70A 3CX5E 2YO3A 2WVRA 3HD7D 3L73E 2B88A 2ZAEB 5H2FE 3TK1A 2KNCB 1BGYD 1I8PA 1FDIA 1SQPD
chains in the Genus database with same CATH topology
3L70D 1CXCA 1NU1D 1CHHA 1N90A 5C0ZA 4WQCA 4EIEA 3L4MA 3ORVA 5C9MA 4UB6V 3VNWA 2RMZA 3VYMA 3H1HD 3WFCC 2IBZD 1B7VA 4D6TD 2PCCB 2ZBOA 1SQQD 4FA1A 1CSXA 1RZ6A 1CRYA 1AOQA 1YNRA 2QJPB 2YCCA 4PD4D 4UB8V 5B6QA 3GG2A 3ZOWA 1A2SA 1L9JC 1WVEC 1IRWA 1HJ4A 1AKKA 1JDLA 4L3GA 1CIGA 2D0SA 4PWAA 2N9JA 2C1DB 1FOCA 3PHLA 2GC7D 3CP5A 1CRJA 1L0ND 3JBTB 3ZIYA 2AI5A 2YK3A 1AOFA 1SQBD 4WQ8A 1NTMD 4N0KA 4V2KA 451CA 4PJ0V 4EICA 2PACA 2GB8B 1F1FA 2CA3B 1HZUA 3TF5A 2Y0CA 1COTA 1MZ4A 2B12B 1ZRTD 1FI7A 1WEJF 1H33A 4RSZA 2O3JA 1LC2A 3SLEA 351CA 1CYCA 2YIUB 1CEDA 1DW2A 3ZCFA 1QYZA 3OA8B 3WFDC 3CXHW 1YTCA 1FHBA 1DIQC 3CX5W 1QL4A 1HJ3A 1YEBA 2BH5X 1NTZD 4WQAA 5TISV 4L1QA 1QL3A 2FYNB 1IQCA 1W2LA 3CU4A 5B66V 2GIWA 1KB0A 1U74B 4FA5A 4QAOA 5GTIV 1C7MA 2BPBB 3O1YA 3WC8A 1VYDA 3KHUA 2YQBA 5TJHA 2BH4X 4U3FD 4P4QB 1CHIA 1IRVA 5DJQB 3SXTA 1CCHA 1CIHA 3HQ9A 3M97X 3BCCD 4AAOA 1CSVA 3PLNA 4YE1A 4J20A 3SVWA 4AAMA 2HV4A 2N9YB 4JCGA 3NWVA 4DY9A 3CYTI 1NMIA 4H0KA 4PW9B 5IY51 2PCBB 2N3BA 2K9JB 2AIUA 4WQ7A 1KB9D 1QKSA 3SWSA 3ZBMA 3OCDB 1CHJA 1CYJA 3L72D 1I5TA 1RZ5A 1CRCA 1C2RA 3L74D 1CSUA 3WFBC 2KS1A 5CIHB 1HROA 5DJQC 2N9IA 2ORLA 2BLFB 2DVHA 1K3HA 2Q3EA 1AYGA 3CXHD 3CX5D 1U75B 4FB1A 2JQRA 1DVVA 1KX2A 4O1QA 3A9FA 1CRIA 3RLMA 2CXBA 1HH7A 2LITA 1C6RA 5KAFV 2QJKB 2XTSB 1N15A 1A56A 2CA4B 3OCDA 1H33B 3L4OA 155CA 1CTYA 1NMLA 1S6VB 5DF5A 1DW0A 1GJQA 3PTZA 3TYIA 1DT1A 5CIBB 3H1LD 2ZOOA 3H1ID 1L9BC 2B0ZB 3L71D 1CNOA 1P84D 3O20A 2Y0DA 4RJTA 1H32B 1BL9A 2B4ZA 2CE1A 4AALA 1FI9A 1HZVA 3MK7B 3RN0A 1C2NA 2FWLA 1K3GA 2C1UA 3ZOXA 1SQVD 2EXVA 4Q5PA 3PH2B 1H9YA 1HJ5A 5H2FV 4K3IA 2ZONG 3TGUD 1ETPA 2A06D 1HCMA 1C75A 1H31B 5CICB 1GKSA 1YEAA 3PXTA 1I6DA 1CIFA 3H1JD 5GTHV 3HQ8A 4Y5RA 1ZZHA 4AX3A 5KLIB 5EXQA 3X39A 2FRCA 3L73D 1IO3A 3C2CA 1A8CA 3TDKA 1NTKD 2N3YA 4H0JA 2MTAC 1I8OA 3HQ7A 3A0BV 3ZOOA 3PXSA 4L3HA 2AXTV 2GC4D 1DW3A 1EZVD 1CSWA 2ZZS1 2C8SA 2VHDA 5AURA 1NNOA 1C52A 1YFCA 1CXAA 2N18B 3ZOYA 3SJLA 1EB7A 3DMIA 3OA8A 1S5LV 1H31A 1H9XA 1KX7A 4WQEA 5CIDB 2QJYB 5B5EV 2L4DA 1OCDA 3WUIA 2BGVX 5CIEB 1CTJA 2BCNB 1R0QA 2OZ1B 1KYOD 3RMZA 4MU8A 2V08A 3L75D 1I6EA 3VMAA 2FYUD 5KLVD 5CIFB 3O0RC 1CTZA 3RN1A 1N9CA 1MG3D 1GIWA 1KYOW 2N18C 1I55A 1KV9A 3NBTA 5KAIV 1HRCA 3NBSA 1J3SA 1CO6A 1FJ0A 1CRGA 3GW6A 1GQ1A 4GEDB 1DW1A 4FA4A 1CCRA 1GU2A 1SQXD 2CE0A 1M60A 1C6OA 2C2CA 1OAEA 2Y0EA 4WQ9A 3WFEC 1NIRA 2L91A 1BCCD 5CIGB 4WQBA 5KKZB 4NFGB 1FCDC 2I8FA 1LS9A 1H1OA 2B10B 4EIFA 1MG2D 1QN2A 1LFMA 2JWAA 1CC5A 2V07A 3PXWA 2D0WA 1CRHA 4EIDA 2MHMA 4LJIA 3WU2V 3A0HV 4FANA 1E29A 1YCCA 1M6ZA 2RN0A 5CYTR 1FI3A 1PPJD 2B11B 1RAQA 2LIRA 1E2RA 1DIIC 2JTIB 3VRDA 1M70A 1CORA 5DFSA 1DVHA 3KZIV 1PP9D 4GYDA 1LC1A 2ZXYA 1F1CA 3DP5A 3FWLA 1W5CT 1CYIA 1BE3D 3CWBD 3ITKA 1CIEA 1H32A 2DGEA 4IL6V 4AANA 2C9XB 4O1WA 4A7PA 1N50A 1YICA 4FAVA 2OZ1A 4FA9A 4EDFA 1GDVA 3MK7C 4XXLA 1IZL0 4WQDA 1L0LD 1LMSA 5E79V 1KIBA 3H1KD 2QG4A 2BCCD 2C1VA 1RAPA 1YIQA 1I54A 4XYDB 2KNCB 1E8EA 4KMGA 1BGYD 1C6SA 1I8PA 3PRJA 3DR0A 3O5CA 2C1DA 3HQ6A 1SQPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 D;  1CXC A;  1NU1 D;  1CHH A;  1N90 A;  5C0Z A;  4WQC A;  4EIE A;  3L4M A;  3ORV A;  5C9M A;  4UB6 V;  3VNW A;  2RMZ A;  3VYM A;  3H1H D;  3WFC C;  2IBZ D;  1B7V A;  4D6T D;  2PCC B;  2ZBO A;  1SQQ D;  4FA1 A;  1CSX A;  1RZ6 A;  1CRY A;  1AOQ A;  1YNR A;  2QJP B;  2YCC A;  4PD4 D;  4UB8 V;  5B6Q A;  3GG2 A;  3ZOW A;  1A2S A;  1L9J C;  1WVE C;  1IRW A;  1HJ4 A;  1AKK A;  1JDL A;  4L3G A;  1CIG A;  2D0S A;  4PWA A;  2N9J A;  2C1D B;  1FOC A;  3PHL A;  2GC7 D;  3CP5 A;  1CRJ A;  1L0N D;  3JBT B;  3ZIY A;  2AI5 A;  2YK3 A;  1AOF A;  1SQB D;  4WQ8 A;  1NTM D;  4N0K A;  4V2K A;  451C A;  4PJ0 V;  4EIC A;  2PAC A;  2GB8 B;  1F1F A;  2CA3 B;  1HZU A;  3TF5 A;  2Y0C A;  1COT A;  1MZ4 A;  2B12 B;  1ZRT D;  1FI7 A;  1WEJ F;  1H33 A;  4RSZ A;  2O3J A;  1LC2 A;  3SLE A;  351C A;  1CYC A;  2YIU B;  1CED A;  1DW2 A;  3ZCF A;  1QYZ A;  3OA8 B;  3WFD C;  3CXH W;  1YTC A;  1FHB A;  1DIQ C;  3CX5 W;  1QL4 A;  1HJ3 A;  1YEB A;  2BH5 X;  1NTZ D;  4WQA A;  5TIS V;  4L1Q A;  1QL3 A;  2FYN B;  1IQC A;  1W2L A;  3CU4 A;  5B66 V;  2GIW A;  1KB0 A;  1U74 B;  4FA5 A;  4QAO A;  5GTI V;  1C7M A;  2BPB B;  3O1Y A;  3WC8 A;  1VYD A;  3KHU A;  2YQB A;  5TJH A;  2BH4 X;  4U3F D;  4P4Q B;  1CHI A;  1IRV A;  5DJQ B;  3SXT A;  1CCH A;  1CIH A;  3HQ9 A;  3M97 X;  3BCC D;  4AAO A;  1CSV A;  3PLN A;  4YE1 A;  4J20 A;  3SVW A;  4AAM A;  2HV4 A;  2N9Y B;  4JCG A;  3NWV A;  4DY9 A;  3CYT I;  1NMI A;  4H0K A;  4PW9 B;  5IY5 1;  2PCB B;  2N3B A;  2K9J B;  2AIU A;  4WQ7 A;  1KB9 D;  1QKS A;  3SWS A;  3ZBM A;  3OCD B;  1CHJ A;  1CYJ A;  3L72 D;  1I5T A;  1RZ5 A;  1CRC A;  1C2R A;  3L74 D;  1CSU A;  3WFB C;  2KS1 A;  5CIH B;  1HRO A;  5DJQ C;  2N9I A;  2ORL A;  2BLF B;  2DVH A;  1K3H A;  2Q3E A;  1AYG A;  3CXH D;  3CX5 D;  1U75 B;  4FB1 A;  2JQR A;  1DVV A;  1KX2 A;  4O1Q A;  3A9F A;  1CRI A;  3RLM A;  2CXB A;  1HH7 A;  2LIT A;  1C6R A;  5KAF V;  2QJK B;  2XTS B;  1N15 A;  1A56 A;  2CA4 B;  3OCD A;  1H33 B;  3L4O A;  155C A;  1CTY A;  1NML A;  1S6V B;  5DF5 A;  1DW0 A;  1GJQ A;  3PTZ A;  3TYI A;  1DT1 A;  5CIB B;  3H1L D;  2ZOO A;  3H1I D;  1L9B C;  2B0Z B;  3L71 D;  1CNO A;  1P84 D;  3O20 A;  2Y0D A;  4RJT A;  1H32 B;  1BL9 A;  2B4Z A;  2CE1 A;  4AAL A;  1FI9 A;  1HZV A;  3MK7 B;  3RN0 A;  1C2N A;  2FWL A;  1K3G A;  2C1U A;  3ZOX A;  1SQV D;  2EXV A;  4Q5P A;  3PH2 B;  1H9Y A;  1HJ5 A;  5H2F V;  4K3I A;  2ZON G;  3TGU D;  1ETP A;  2A06 D;  1HCM A;  1C75 A;  1H31 B;  5CIC B;  1GKS A;  1YEA A;  3PXT A;  1I6D A;  1CIF A;  3H1J D;  5GTH V;  3HQ8 A;  4Y5R A;  1ZZH A;  4AX3 A;  5KLI B;  5EXQ A;  3X39 A;  2FRC A;  3L73 D;  1IO3 A;  3C2C A;  1A8C A;  3TDK A;  1NTK D;  2N3Y A;  4H0J A;  2MTA C;  1I8O A;  3HQ7 A;  3A0B V;  3ZOO A;  3PXS A;  4L3H A;  2AXT V;  2GC4 D;  1DW3 A;  1EZV D;  1CSW A;  2ZZS 1;  2C8S A;  2VHD A;  5AUR A;  1NNO A;  1C52 A;  1YFC A;  1CXA A;  2N18 B;  3ZOY A;  3SJL A;  1EB7 A;  3DMI A;  3OA8 A;  1S5L V;  1H31 A;  1H9X A;  1KX7 A;  4WQE A;  5CID B;  2QJY B;  5B5E V;  2L4D A;  1OCD A;  3WUI A;  2BGV X;  5CIE B;  1CTJ A;  2BCN B;  1R0Q A;  2OZ1 B;  1KYO D;  3RMZ A;  4MU8 A;  2V08 A;  3L75 D;  1I6E A;  3VMA A;  2FYU D;  5KLV D;  5CIF B;  3O0R C;  1CTZ A;  3RN1 A;  1N9C A;  1MG3 D;  1GIW A;  1KYO W;  2N18 C;  1I55 A;  1KV9 A;  3NBT A;  5KAI V;  1HRC A;  3NBS A;  1J3S A;  1CO6 A;  1FJ0 A;  1CRG A;  3GW6 A;  1GQ1 A;  4GED B;  1DW1 A;  4FA4 A;  1CCR A;  1GU2 A;  1SQX D;  2CE0 A;  1M60 A;  1C6O A;  2C2C A;  1OAE A;  2Y0E A;  4WQ9 A;  3WFE C;  1NIR A;  2L91 A;  1BCC D;  5CIG B;  4WQB A;  5KKZ B;  4NFG B;  1FCD C;  2I8F A;  1LS9 A;  1H1O A;  2B10 B;  4EIF A;  1MG2 D;  1QN2 A;  1LFM A;  2JWA A;  1CC5 A;  2V07 A;  3PXW A;  2D0W A;  1CRH A;  4EID A;  2MHM A;  4LJI A;  3WU2 V;  3A0H V;  4FAN A;  1E29 A;  1YCC A;  1M6Z A;  2RN0 A;  5CYT R;  1FI3 A;  1PPJ D;  2B11 B;  1RAQ A;  2LIR A;  1E2R A;  1DII C;  2JTI B;  3VRD A;  1M70 A;  1COR A;  5DFS A;  1DVH A;  3KZI V;  1PP9 D;  4GYD A;  1LC1 A;  2ZXY A;  1F1C A;  3DP5 A;  3FWL A;  1W5C T;  1CYI A;  1BE3 D;  3CWB D;  3ITK A;  1CIE A;  1H32 A;  2DGE A;  4IL6 V;  4AAN A;  2C9X B;  4O1W A;  4A7P A;  1N50 A;  1YIC A;  4FAV A;  2OZ1 A;  4FA9 A;  4EDF A;  1GDV A;  3MK7 C;  4XXL A;  1IZL 0;  4WQD A;  1L0L D;  1LMS A;  5E79 V;  1KIB A;  3H1K D;  2QG4 A;  2BCC D;  2C1V A;  1RAP A;  1YIQ A;  1I54 A;  4XYD B;  2KNC B;  1E8E A;  4KMG A;  1BGY D;  1C6S A;  1I8P A;  3PRJ A;  3DR0 A;  3O5C A;  2C1D A;  3HQ6 A;  1SQP D; 
#chains in the Genus database with same CATH topology
 5APV A;  1H89 A;  4IFM A;  2E75 D;  5C0Z A;  3L4M A;  3AE4 C;  4L76 A;  5TIS E;  2J58 A;  1PGO A;  3W67 A;  3WU2 E;  2E75 B;  3H1H D;  5AW2 B;  2FYZ A;  3MTU E;  2IBZ D;  1JY2 P;  3V2Q A;  4D6T D;  2ZBO A;  4FA1 A;  1CSX A;  1AVY A;  1NH4 A;  1TU3 F;  4PD4 D;  2H7H A;  1OW6 A;  1OXZ A;  2LKM A;  3ZOW A;  1SVF A;  4UB8 H;  3JCU E;  1IC2 A;  3H1J G;  2P10 A;  4PWA A;  3KZI E;  2B89 A;  1L0N D;  1NO4 A;  2CK3 H;  3JBT B;  3ZIY A;  1AOF A;  1FZB A;  2XKM A;  4GDO A;  4Y99 C;  1R8E A;  4HYT B;  1NWQ A;  4PJ0 V;  2PAC A;  1F1F A;  1L4A D;  2KOG A;  4JQ0 D;  1JMM A;  4EI2 A;  1HGV A;  3RL0 g;  2N1T A;  3A0H H;  1GMJ A;  1WEJ F;  2M0B A;  4U7J A;  1EC5 A;  1RE3 A;  3EFF K;  1JO5 A;  1PL5 A;  1LC2 A;  1QVG O;  4OGQ B;  1CYC A;  1UIX A;  2YIU B;  3H1J E;  1NAY A;  1CED A;  3CXH W;  3MHV A;  1YEB A;  2IFN A;  4UB6 E;  2FFD A;  1EDJ A;  1NTZ D;  2ZT9 B;  2FYN B;  1M7L A;  3R2P A;  3M0D C;  1W2L A;  5B66 V;  2GIW A;  1KB0 A;  4FA5 A;  4UB8 E;  5AVW B;  1SQX E;  3L72 J;  3CME P;  1C7M A;  2Q6Q A;  4NPE A;  1EQ7 A;  3M0A A;  1AFO A;  1GL2 C;  2BH4 X;  2E42 A;  1CHI A;  2H43 A;  5CBO A;  4C7N B;  5DJQ B;  3SXT A;  4W7Z A;  1JOC A;  2IBZ G;  3HQ9 A;  4W80 A;  2W6B A;  4AAO A;  1CSV A;  2ZYA A;  4AAM A;  1OW7 A;  3HD7 B;  4JCG A;  3CYT I;  2I8D A;  2QRX A;  2RH0 A;  1KB9 D;  1X79 B;  3CCR P;  5AVS B;  1U7J A;  3L74 J;  1OMI A;  5CCG C;  1CYJ A;  1C2R A;  1N7S D;  3AE3 C;  3WFB C;  3KDP B;  1LNQ A;  5CIH B;  1IFM A;  2C9N Y;  1E5W A;  1L2P A;  3V4Q A;  2Q3E A;  1GL2 D;  1OFC X;  2CXB A;  4BRY B;  2KB7 P;  3GLM A;  4UB6 H;  3WUU A;  3H6P A;  4PD4 H;  1JY2 O;  3L4O A;  1S5L H;  1NML A;  4HH2 A;  4PJ0 E;  1LGH B;  4PJ0 H;  3AE9 C;  3PTZ A;  3VTP C;  2PP6 A;  1FZE A;  3PH0 A;  5CIB B;  1L9B C;  1KC8 Q;  3V4W A;  1P84 D;  1VQ6 P;  5AW0 B;  4AAL A;  1CSB A;  1FI9 A;  2NPS B;  3ABV C;  1DEE G;  3BRV B;  2FWL A;  1SQP E;  1KIL D;  1SQV G;  1K3G A;  3BCC J;  2C1U A;  3P32 A;  3C1L A;  1KYO E;  2EXV A;  3PH2 B;  3CCS P;  4NPF X;  3L37 A;  4PV1 C;  4LGD E;  4JPZ B;  2GUS A;  4N6J A;  4OH8 B;  1C75 A;  5CIC B;  3TGU E;  3PXT A;  1NU1 G;  5GTH V;  3HQ8 A;  4Y5R A;  1ZZH A;  1EZV E;  1FZF A;  1JUN A;  1EDL A;  1HGZ A;  1KFM A;  1L4A C;  3AE5 C;  1Q90 D;  1LT9 B;  2N1T B;  1I8O A;  3USS A;  3IAO A;  3ZOO A;  3GHG B;  2WPQ A;  2AXT V;  5CBN A;  1CSW A;  2VHD A;  1SQQ J;  2N18 B;  2Q9I A;  1YBK A;  2FXM A;  3H32 A;  4OVN F;  1H9X A;  3VOP A;  1YIJ P;  3S9O A;  1T6A A;  1X8Y A;  1BDD A;  1OCD A;  4I7Z B;  1CTJ A;  1VQ5 P;  3CC4 P;  3CXH E;  1KYO D;  1NTK K;  1PZQ A;  2E76 B;  4IFD K;  3QWO C;  3L4F A;  3E7K A;  5KLV D;  3L75 G;  4K3A A;  5AW8 B;  1JCC A;  1N9C A;  2IDB A;  1N7S B;  3NTN A;  1KB9 E;  1HRC A;  1KB9 H;  3NBS A;  3S1K A;  3AEA C;  1CRG A;  3GW6 A;  5B66 H;  5AVQ B;  4M3L A;  2CE0 A;  3R4Y A;  1C6O A;  2XV5 A;  2KZI A;  2L91 A;  1BCC D;  4I2L C;  1JTH B;  4WQB A;  3RK3 B;  2UWJ E;  4EIF A;  1MG2 D;  2K9J A;  1QN2 A;  2HPC B;  2Q7C A;  3RL0 B;  1FZC C;  1LFM A;  1IFP A;  3VMY A;  1CRH A;  3PJS K;  1BSN A;  3WU2 H;  3A0B E;  4L73 A;  5APS A;  1S5L X;  2A06 E;  3BCC E;  2KS1 B;  1YTZ T;  2E43 A;  1S1C X;  1ZV8 A;  1T8Z A;  4BRY A;  1KZU B;  2KUB A;  2JO1 A;  2XZR A;  3B5N B;  3CCL P;  5GTI H;  2KP8 A;  5GTH E;  3CWB J;  1FAV A;  3IFM A;  1BSH A;  4JBZ A;  2JJL A;  3DP5 A;  3FWL A;  2AXT H;  1BCC J;  2DGE A;  3RK3 D;  1JEK A;  4O1W A;  3V2R A;  2E74 B;  2DW3 A;  3AEC C;  4FAV A;  2OZ1 A;  1VL2 A;  1PV3 A;  2BEZ F;  3P8C E;  1VF5 B;  2PFX A;  4C7R A;  3RK2 B;  1G2C A;  1IZL 0;  1KIB A;  5B5E E;  2BCC J;  3GHG C;  1LJ2 A;  1S4X A;  2B87 A;  1RAP A;  1YIQ A;  3LW5 J;  2MKV A;  3L75 J;  1E8E A;  2JDI H;  1C6S A;  5CHX A;  3O5C A;  1CI6 B;  2C1D A;  2CA3 B;  2FXO A;  2HOD A;  5BU5 A;  1OVU A;  1IK9 A;  4EIE A;  4DT0 A;  3L70 G;  2FYU K;  3ORV A;  5C9M A;  1PGQ A;  2OYH A;  2RMZ A;  3AE7 C;  2H88 C;  2D2C C;  3L71 J;  2OYI B;  5APT A;  3TNU A;  2E74 D;  3LIE A;  1SQQ D;  3P8M C;  3V6I A;  1RZ6 A;  2PRR A;  1K8A Q;  5APY A;  2KZJ A;  5B6Q A;  2HOD B;  3RGU A;  1A2S A;  1WVE C;  1IRW A;  4WVZ A;  4L3G A;  3T97 B;  2W27 A;  1T2K D;  3CD6 P;  1FOC A;  2GM4 A;  3CP5 A;  2YKP A;  1N73 B;  5BVZ A;  3V2P A;  2YK3 A;  3VMZ A;  2C9L Y;  1GU4 A;  1SQB D;  1FBM A;  5APX A;  4KT0 J;  451C A;  5KLV J;  2GB8 B;  2FYU J;  5AVX B;  4WB4 A;  1S9K E;  3TF5 A;  4IL6 X;  1ZRT D;  1GL2 B;  1R5S A;  4H44 C;  3V5B A;  3T97 A;  4RSZ A;  2O3J A;  1L4A B;  351C A;  2O01 N;  3N7N A;  1E79 H;  3CMA P;  2N1T C;  5CMZ A;  2ZT9 C;  3ZCF A;  2JR8 A;  1QYZ A;  3B4S A;  1P84 H;  1PPJ E;  1YTC A;  1NTZ G;  3HD7 C;  4H13 B;  3H1L G;  5AW6 B;  3I56 P;  1L0N K;  1SQB J;  1WMK A;  3CWB E;  3U1C A;  5TIS V;  4XA4 A;  3L35 A;  3CCE P;  2ZYG A;  3CU4 A;  4QAO A;  3G9R A;  3OJA B;  5GTI V;  2BPB B;  1YI2 P;  3O1Y A;  1RF0 A;  2QSI A;  3CL3 D;  4P4Q B;  1H8A A;  1SFC D;  3G6E P;  2Z5I A;  2Q3I A;  3M97 X;  3BCC D;  1G1J A;  1VF5 C;  2HV4 A;  1J1E B;  4RKU J;  3F5H A;  3NWV A;  3H1J J;  2IFM A;  4WQ7 A;  2W8Z A;  4BXL A;  3KXD A;  3L73 G;  1QLE D;  2W90 A;  3FX0 A;  1I5T A;  1BCC E;  1CRC A;  1KIL A;  2M8R A;  1CSU A;  1NTK G;  3KQG A;  3NXS A;  1IFI A;  1SQB G;  1LWU C;  1X0T A;  2LR2 A;  2ITA A;  1HRO A;  1Y8A A;  4AUW A;  1N7S C;  1SQB K;  2BLF B;  1L0N J;  3VYI A;  3CX5 D;  1U75 B;  2JWD A;  4FB1 A;  2JQR A;  1DVV A;  2A45 H;  1AJY A;  1N86 A;  4WY4 C;  1KQS O;  2J59 M;  3A9F A;  3O6Q A;  3CC7 P;  3Q2Y A;  2KK7 A;  2LIT A;  5KAF V;  5K5G B;  2QJK B;  4WY4 B;  1N15 A;  2CA4 B;  1H33 B;  3AE2 C;  155C A;  5DF5 A;  1DW0 A;  3JCU H;  1GJQ A;  1NVO A;  3TYI A;  1KQG B;  1GK6 A;  3H1L D;  3RBZ A;  1NTM K;  1DD3 A;  3M9Q A;  1VPC A;  1KIL C;  1BL9 A;  2B4Z A;  4ZKP A;  3AE1 C;  3RN0 A;  3L71 E;  2XNX A;  2FKW B;  5AVT B;  1C2N A;  3L70 J;  3B5N D;  2BEQ D;  2E5Y A;  4Q5P A;  2A45 G;  2OGU A;  1H9Y A;  4K3I A;  2ZON G;  4TLF A;  3OAK A;  3BCC G;  2G3A A;  2ZXE B;  3IN6 A;  4JF7 A;  3K5B A;  3SSU A;  1M90 Q;  2P58 A;  4Y28 J;  1SQX G;  1GKS A;  1YEA A;  2AEF A;  4WY4 D;  3S4R A;  5AW3 B;  1CIF A;  3H1J D;  1IK7 A;  4K35 A;  4AX3 A;  4W7Y A;  3L73 D;  3MP7 B;  5APU A;  4QMA A;  3TDK A;  1NYH A;  1NTK D;  1Q86 Q;  2MTA C;  1BGY J;  4OGQ D;  5AVV B;  3Q5S A;  4L3H A;  4U3F E;  3EFG A;  3W68 A;  1WRG A;  1NTM J;  2ZZS 1;  5AUR A;  1ZOY C;  1JY3 P;  4XE5 B;  1CXA A;  2O01 H;  3E1I A;  3SJL A;  1EZV I;  1EB7 A;  5KLV K;  3H1H J;  3HE5 B;  4AYC A;  1PP9 G;  2WSE H;  3TSI A;  4RO0 A;  1NTK E;  1GZL A;  1KB9 I;  1UII A;  2YIU C;  2R3C A;  3RMZ A;  1MFT A;  2B87 B;  4MU8 A;  3L75 D;  1I6E A;  3VMA A;  1FJK A;  2FYU D;  1YJN P;  5B66 E;  1K73 Q;  4R4L A;  1RF1 A;  1Q82 Q;  2I1K A;  1H88 A;  2P1J A;  2JEE A;  1KYO W;  3CX5 H;  1I55 A;  1KV9 A;  3FGA D;  2OTL P;  1S2E A;  1FJ0 A;  1R5L A;  1RHZ B;  2YKO A;  2N1T D;  1M60 A;  2QE7 H;  4N78 E;  2XND H;  3N4X A;  2BCC E;  5KKZ B;  5AW4 B;  1FCD C;  2P67 A;  1SQP G;  2R44 A;  2WSF H;  2YMK A;  4U3F G;  2I1J A;  4KHX A;  2WPS A;  1U57 A;  2NRG A;  2V07 A;  3PXW A;  2D0W A;  1JY3 N;  2M3E A;  2FFD C;  1SQX J;  2QVA A;  5KJ7 A;  2ZYD A;  4LJI A;  1N7S A;  4FAN A;  3HTK B;  5AW7 B;  4XFJ A;  1D7M A;  1M6Z A;  3SFE C;  5CYT R;  2FYU E;  3HRN A;  1PFI A;  2Q1K A;  5AVU B;  1RAQ A;  1E2R A;  3Q1M A;  1DII C;  3A2A A;  1YIT P;  5GTH H;  1GL2 A;  3V2N A;  2JTI B;  1M70 A;  1COR A;  1PP9 D;  1LC1 A;  2ZXY A;  1VQ4 P;  2WSS H;  3H1I J;  2E74 C;  1L0N G;  1LP1 B;  3AED C;  3HTK A;  1BE3 G;  2CPB A;  3CWB G;  2XU6 A;  4GOE A;  2W83 C;  1SQP K;  3MUD A;  2C9X B;  3H1L E;  3L70 E;  1JCD A;  3IF4 A;  1RE4 A;  4AQR D;  1RQU A;  4FA9 A;  3C8V A;  1GDV A;  3MK7 C;  1Q7Y Q;  5E79 V;  3U59 A;  1HWT C;  1SQQ K;  3B5N A;  2KIK A;  3Q5P A;  4GOD A;  2C1V A;  2FY8 A;  4XYD B;  2YNY A;  4KMG A;  1RY3 A;  3PRJ A;  4CPG A;  3L70 D;  4PV1 B;  1IFJ A;  3B5N C;  1CXC A;  4HKZ H;  3Q3D A;  1NU1 D;  1CHH A;  4WQC A;  5C39 A;  3VNW A;  1KV4 A;  3WFC C;  1PIX A;  4OGQ C;  3G71 P;  1B7V A;  2WT7 B;  1G2C B;  3H1K J;  1YJW P;  5CCG A;  1CRY A;  4IFF A;  1AOQ A;  1YNR A;  1LT9 C;  2QJP B;  2IBZ E;  2IZ0 A;  5KAI E;  2YCC A;  1PGJ A;  4UB8 V;  2V4H A;  2AXC A;  1QEX A;  4YTP C;  1SQV J;  3HE4 A;  2D0S A;  2Y9Y A;  3VP9 A;  2N9J A;  2C1D B;  4H13 C;  4LC1 A;  2QM8 A;  2OYH B;  3LW5 H;  1QL1 A;  4JYC A;  1NTZ K;  1CW5 A;  2FYN C;  1GK4 A;  1M56 D;  1YHQ P;  1LTS C;  1VQ7 P;  1HZU A;  1FZG A;  1XTC C;  1JY2 N;  1MZ4 A;  5AVY B;  2B12 B;  1HH0 A;  2M5A B;  4YXD C;  2K1A A;  3CXH H;  1A02 J;  4I7Z C;  2KI7 B;  3M9H A;  1L0N E;  3OA8 B;  2OTK E;  1FHB A;  1DIQ C;  1L0L K;  1ZRT E;  2O1J A;  3L74 E;  3WUT A;  1HJ3 A;  3UIA A;  1M1J B;  2BH5 X;  3F89 A;  3IR9 A;  1S9K D;  1N73 A;  2QIW A;  1QL3 A;  4R4M A;  1IQC A;  4LLH A;  1U74 B;  1S72 P;  1LTB C;  1HTL C;  2IYP A;  1KYO H;  3P8C D;  1Z56 A;  3WC8 A;  1JTH A;  1VYD A;  3KHU A;  3RK3 C;  1FDM A;  3FXE A;  1IRV A;  1J1D B;  2ZFC A;  3L72 E;  1CIH A;  5H2F H;  3GF7 A;  4J20 A;  1LTG C;  4DY9 A;  3C9I A;  1SFC B;  1BGY E;  5CCH D;  2PCB B;  2N3B A;  2LXC B;  2AIU A;  4U3F J;  5KTB A;  3G3Z A;  3SWS A;  1GTW A;  3OCD B;  1GU5 A;  1LTJ C;  1CHJ A;  1NOH A;  4DJG A;  1RZ5 A;  3VP8 A;  1IJD B;  1KMI Z;  3BVH A;  1H0T B;  5DJQ C;  1K05 A;  2N9I A;  1JNM A;  2ORL A;  1EZV G;  3TYY A;  1G1I A;  4MN4 C;  2DVH A;  1K3H A;  1URQ D;  2YO2 A;  1AYG A;  1HVV A;  3CXH D;  1PPJ G;  1MUU A;  2GA1 A;  1KX2 A;  4O1Q A;  5CCH C;  1HH7 A;  2XDJ A;  1C6R A;  4N3Y B;  2XTS B;  1Q81 Q;  1CTY A;  2WIT A;  1NTM E;  5BU8 B;  3RK2 C;  2GUV A;  1HF9 A;  4NPD A;  1DT1 A;  4EOT A;  1VQP P;  3H1I D;  2B0Z B;  1AVO A;  3L71 D;  2WPV B;  3H1H E;  3SWY A;  2C0X A;  2WSC H;  2AEJ A;  1CNO A;  2HYN A;  1OIP A;  3O20 A;  4RJT A;  2OYO A;  1H32 B;  1KQL A;  2FFD B;  2CE1 A;  1HZV A;  5KLV E;  3MUD C;  2H89 C;  3ZOX A;  3L75 E;  4DCK A;  3I5C A;  1HJ5 A;  1QL2 A;  3CCJ P;  3KZI H;  5H2F V;  3TGU D;  1ETP A;  1S3J A;  5APW A;  3VN0 A;  1HUC A;  2OYI C;  1GW3 A;  2A06 D;  4D6T J;  3CPW O;  1H31 B;  5E79 E;  1EDI A;  4L74 A;  1ZXG A;  1I6D A;  2K37 A;  1BCC G;  2QJK C;  5DJU B;  4ZKU A;  5EXQ A;  3X39 A;  2P7J A;  3AEG C;  1USE A;  3AEE C;  2IYO A;  1GDT A;  3C2C A;  3L36 A;  3O8Z A;  3D0W A;  4GIF A;  5AW1 B;  2N3Y A;  3HQ7 A;  4Y99 B;  5KJ7 C;  3PXS A;  5AW5 B;  1OVV A;  1VDF A;  4ZNC A;  2GC4 D;  1EZV D;  2KNC A;  2R5B A;  1LTI C;  3A7O A;  2Q5U A;  3OA8 A;  2WMM A;  1S5L V;  3RK3 E;  4HB1 A;  2OYH C;  1N73 C;  2N9B A;  4WQE A;  1L4A A;  3MZW B;  2MJZ A;  2POH A;  3AE8 C;  2L4D A;  1S5L E;  5TIS H;  2OZ1 B;  1W2B O;  3Q5R A;  1EDK A;  3JSV C;  1FS0 E;  4H44 B;  2O1K A;  3L71 G;  2A45 I;  1X9V A;  1URQ B;  3B8E B;  2R3S A;  3O0R C;  5KAF E;  1CTZ A;  2YXQ B;  3ZDM A;  3RN1 A;  3H1K G;  1KYO I;  3HE5 A;  2FBW C;  3II6 A;  3E1R A;  5KAI V;  2KLV A;  4PD4 I;  1CI6 A;  1GQ1 A;  1W5C E;  4EYY Q;  1DW1 A;  1LWU A;  1GU2 A;  3CI9 A;  2PGD A;  2C2C A;  1OAE A;  1NU1 J;  4WQ9 A;  1URQ A;  3O6Q B;  5CIG B;  1T3J A;  3HUS A;  3H1K E;  1RE3 C;  4B86 A;  1LS9 A;  1RF1 C;  3U1A A;  1ZR2 A;  1CZQ A;  1KN7 A;  1SQB E;  3WMM 0;  1NTZ J;  2JWA A;  1RF1 B;  4H0L D;  4ASV A;  1GW4 A;  3QH9 A;  2E76 C;  3CXH I;  4GOF A;  1DH3 A;  5CCH A;  1N8R Q;  3WU2 V;  5CCG D;  3A3Y B;  3A0H V;  3BAT A;  4RES B;  1E29 A;  1YCC A;  1SQQ G;  1K9M Q;  2Z4E A;  2RKL A;  4ZMD A;  1FI3 A;  2B11 B;  2LIR A;  3MD0 A;  3CC2 P;  2HFE D;  1MFZ A;  1JM0 A;  1DVH A;  1YYC A;  2WZ7 A;  2Y9Z A;  3D6Z A;  3KZI V;  1FZC A;  1NTM G;  1W5C T;  1BE3 D;  3CWB D;  1A02 F;  2YMY A;  3ITK A;  1CIE A;  1QX8 A;  1H32 A;  2NPS D;  1ZME C;  4WBA A;  2V7Q H;  1LTJ A;  5KLV G;  4TT3 H;  5KKZ C;  2OQQ A;  4A7P A;  3FXD A;  1J2J B;  3M06 A;  1YIC A;  2QA4 P;  4EDF A;  2D2C B;  2VRS A;  1FZC B;  3G4S P;  1L0L D;  1LMS A;  4I6M C;  3M9B A;  2WPR A;  3H1K D;  2K88 A;  4DZO A;  2BAS A;  5KAI H;  5M1B A;  1LTJ B;  1I54 A;  1WT6 A;  1LTT C;  3DR0 A;  1NTK J;  2HG5 D;  1MV8 A;  3HQ6 A;  1BGY G;  1AKK A;  4H44 D;  1N90 A;  1T3U A;  4JYB A;  1SLQ A;  1Q2N A;  1IO4 A;  4UB6 V;  3VYM A;  5KLI C;  1FDO A;  1L0L E;  1NHL A;  3H1H G;  2PCC B;  1Y9B A;  1NKZ B;  2QJY C;  2IBZ I;  2KYV A;  1FC2 C;  2L5G B;  3BAS A;  3GG2 A;  4H13 D;  1KTM A;  1L9J C;  1Y47 A;  2LXB A;  4EIJ A;  1AQ5 A;  1HJ4 A;  1JDL A;  3AE6 C;  1CIG A;  1BE3 E;  3SWK A;  4N78 D;  3PHL A;  3L74 G;  2GC7 D;  1LT9 A;  3CLQ A;  1M1K Q;  1CRJ A;  1QVF O;  2AI5 A;  2M3B A;  2WTY A;  4WQ8 A;  1NTM D;  4N0K A;  4V2K A;  2K3R A;  1IZN B;  1SQQ E;  4EIC A;  5APQ A;  1GD2 E;  1NTZ E;  2Y0C A;  3M0D A;  1COT A;  3A0H E;  1JY3 O;  1FI7 A;  1H33 A;  2O01 J;  3L73 J;  3CCV P;  1YTZ I;  1J1D C;  1RF0 C;  3SLE A;  1AV1 A;  1M1J C;  2ZVN B;  1DW2 A;  3OA7 A;  1L0L G;  2WSC J;  3D71 A;  3WFD C;  3CX5 W;  1QL4 A;  3BRT B;  4YPC A;  3CCM P;  4WQA A;  2W6A A;  4L1Q A;  2WQY C;  4GKG A;  4O9B A;  4HJG H;  3A0B H;  1HBW A;  1VQL P;  3RBX A;  1DIP A;  5CJ0 A;  2H8P D;  2YQB A;  2P2U A;  5TJH A;  4Z1M H;  1BDC A;  4U3F D;  3GMA A;  1OZH A;  2R32 A;  1SS1 A;  1LP1 A;  5CJ4 A;  1CCH A;  3RL0 D;  2OAR A;  3PLN A;  4YE1 A;  3SVW A;  1M1J A;  1PP9 E;  1OW8 A;  1VQM P;  2N9Y B;  2IZ1 A;  3TNU B;  4H0K A;  1NMI A;  4PW9 B;  5IY5 1;  3AEB C;  4IOI H;  1VQ9 P;  2K9J B;  4DOJ A;  1QKS A;  1MKM A;  3ZBM A;  1K04 A;  3P7K A;  1YQ3 C;  1URQ C;  2C0W A;  2QEX P;  3L72 D;  5KJ7 D;  3L74 D;  1VQN P;  1VF5 D;  1NU1 E;  2KS1 A;  4YXW H;  1LTA C;  1M57 D;  5B5E H;  1N7L A;  2E76 D;  1RH5 B;  5GTI E;  4C46 A;  3VMX A;  1U7M A;  1DEB A;  3SWF A;  1SP4 A;  4L75 A;  1T2K C;  5AVZ B;  2NPS A;  1RE4 C;  2WWW A;  3A5T A;  3RLM A;  1CRI A;  1SFC A;  1KOR A;  3TGU J;  1A56 A;  2ZJS E;  1FU1 A;  1NKN A;  3OCD A;  5KAF H;  1X22 A;  3H1L J;  1S6V B;  1KQF B;  3CX5 I;  2AEM A;  2JKV A;  1KIL E;  1USD A;  2OTJ P;  1HJB A;  1FOS F;  3M91 A;  3KYQ A;  2ZOO A;  2ZT9 D;  4WWI A;  1H0T A;  1NGM B;  1SFC C;  3HE4 B;  2Y0D A;  2J5U A;  3MK7 B;  1JB0 J;  1L0L J;  1NAF A;  1N2D C;  2ZVO B;  1SQV D;  1YJ9 P;  3GHG A;  1DD4 A;  1P84 I;  2K9Y A;  4D6T E;  3TGU G;  2NPS C;  2WSF J;  3MGN A;  3B71 A;  3KPE A;  3RK2 D;  3OW2 O;  2KSJ A;  4OWF A;  2A06 G;  2WT7 A;  3H32 B;  5EFW B;  1HCM A;  3H25 A;  2ZXX A;  2QJP C;  1IFN A;  4C7N A;  2IX7 C;  2OYI A;  5KLI B;  2FRC A;  1IO3 A;  2E5T A;  3L72 G;  1A8C A;  2FXP A;  4H0J A;  3HD7 A;  1FZA A;  4H0L C;  1VQO P;  3A0B V;  3JC2 2;  1KIL B;  1DW3 A;  2YXR B;  2C8S A;  2KSE A;  4GT1 A;  1JMB A;  1NNO A;  5AVR B;  1C52 A;  1YFC A;  2JP3 A;  2E75 C;  3ZOY A;  2KLU A;  3DMI A;  1H31 A;  3D6Y A;  1KX7 A;  2V7Q J;  2Z5H A;  5CID B;  2QJY B;  5B5E V;  1AQT A;  1P84 E;  3RL0 C;  4PD4 E;  3WUI A;  2BGV X;  5CIE B;  2BCN B;  1R0Q A;  1SQV E;  1KFN A;  3EWK A;  3WUV A;  4ASW A;  1NU1 K;  2IPP A;  1BE3 J;  2V08 A;  2W6J H;  1NJI Q;  2HPC A;  5CIF B;  1EXI A;  3NMD A;  1VQ8 P;  4I1L A;  1MG3 D;  1GIW A;  2N18 C;  4BWN A;  1LT1 A;  3NBT A;  2BCC G;  3AEF C;  1DX7 A;  2WSE J;  1J3S A;  1CO6 A;  5AW9 B;  5DJT B;  4GED B;  4IL6 H;  4FA4 A;  1SQV K;  1CCR A;  1OX3 A;  1M8O B;  1SQX D;  2R5D A;  1FE6 A;  1IFD A;  4KJM A;  2Y0E A;  1RQV A;  3WFE C;  1J1E C;  1NIR A;  1SQP J;  3EQ2 A;  1OWA A;  3PP5 A;  1ZR4 A;  4NFG B;  2KXP B;  3SFD C;  2I8F A;  1H1O A;  2YKQ A;  2CPS A;  2B10 B;  1MZ9 A;  1ZLL A;  1PGP A;  1ZW0 A;  1HJ0 A;  4D6T G;  1CC5 A;  1XTG B;  4EID A;  1FOS E;  1FJP A;  2G8Y A;  3LID A;  1W2E A;  3GF3 A;  2HLO A;  2D2C D;  2MHM A;  1ZP0 C;  1LWU B;  1QGK B;  5L8R J;  1ZN5 A;  1KD1 Q;  2RN0 A;  2HR3 A;  3MIW A;  3CCQ P;  3HUS C;  3H1I E;  1SQX K;  1PPJ D;  1PP9 J;  1AA0 A;  1OVR A;  3I55 P;  3VRD A;  5DFS A;  3NFQ A;  4GYD A;  3HUS B;  1F1C A;  2B9B A;  5E79 H;  1CYI A;  2QM7 A;  1EXJ A;  1VQK P;  4IL6 V;  2FYU G;  4AAN A;  3H1I G;  2M5A A;  1N50 A;  2PAJ A;  3CCU P;  4WY4 A;  3FWN A;  2SPZ A;  2AXT E;  4XXL A;  4WQD A;  1YQ4 C;  4H0L B;  4IL6 E;  2NZ2 A;  2QG4 A;  4PV1 D;  2BCC D;  3D70 A;  3CX5 E;  2YO3 A;  2WVR A;  3HD7 D;  3L73 E;  2B88 A;  2ZAE B;  5H2F E;  3TK1 A;  2KNC B;  1BGY D;  1I8P A;  1FDI A;  1SQP D; 
#chains in the Genus database with same CATH homology
 3L70 D;  1CXC A;  1NU1 D;  1CHH A;  1N90 A;  5C0Z A;  4WQC A;  4EIE A;  3L4M A;  3ORV A;  5C9M A;  4UB6 V;  3VNW A;  2RMZ A;  3VYM A;  3H1H D;  3WFC C;  2IBZ D;  1B7V A;  4D6T D;  2PCC B;  2ZBO A;  1SQQ D;  4FA1 A;  1CSX A;  1RZ6 A;  1CRY A;  1AOQ A;  1YNR A;  2QJP B;  2YCC A;  4PD4 D;  4UB8 V;  5B6Q A;  3GG2 A;  3ZOW A;  1A2S A;  1L9J C;  1WVE C;  1IRW A;  1HJ4 A;  1AKK A;  1JDL A;  4L3G A;  1CIG A;  2D0S A;  4PWA A;  2N9J A;  2C1D B;  1FOC A;  3PHL A;  2GC7 D;  3CP5 A;  1CRJ A;  1L0N D;  3JBT B;  3ZIY A;  2AI5 A;  2YK3 A;  1AOF A;  1SQB D;  4WQ8 A;  1NTM D;  4N0K A;  4V2K A;  451C A;  4PJ0 V;  4EIC A;  2PAC A;  2GB8 B;  1F1F A;  2CA3 B;  1HZU A;  3TF5 A;  2Y0C A;  1COT A;  1MZ4 A;  2B12 B;  1ZRT D;  1FI7 A;  1WEJ F;  1H33 A;  4RSZ A;  2O3J A;  1LC2 A;  3SLE A;  351C A;  1CYC A;  2YIU B;  1CED A;  1DW2 A;  3ZCF A;  1QYZ A;  3OA8 B;  3WFD C;  3CXH W;  1YTC A;  1FHB A;  1DIQ C;  3CX5 W;  1QL4 A;  1HJ3 A;  1YEB A;  2BH5 X;  1NTZ D;  4WQA A;  5TIS V;  4L1Q A;  1QL3 A;  2FYN B;  1IQC A;  1W2L A;  3CU4 A;  5B66 V;  2GIW A;  1KB0 A;  1U74 B;  4FA5 A;  4QAO A;  5GTI V;  1C7M A;  2BPB B;  3O1Y A;  3WC8 A;  1VYD A;  3KHU A;  2YQB A;  5TJH A;  2BH4 X;  4U3F D;  4P4Q B;  1CHI A;  1IRV A;  5DJQ B;  3SXT A;  1CCH A;  1CIH A;  3HQ9 A;  3M97 X;  3BCC D;  4AAO A;  1CSV A;  3PLN A;  4YE1 A;  4J20 A;  3SVW A;  4AAM A;  2HV4 A;  2N9Y B;  4JCG A;  3NWV A;  4DY9 A;  3CYT I;  1NMI A;  4H0K A;  4PW9 B;  5IY5 1;  2PCB B;  2N3B A;  2K9J B;  2AIU A;  4WQ7 A;  1KB9 D;  1QKS A;  3SWS A;  3ZBM A;  3OCD B;  1CHJ A;  1CYJ A;  3L72 D;  1I5T A;  1RZ5 A;  1CRC A;  1C2R A;  3L74 D;  1CSU A;  3WFB C;  2KS1 A;  5CIH B;  1HRO A;  5DJQ C;  2N9I A;  2ORL A;  2BLF B;  2DVH A;  1K3H A;  2Q3E A;  1AYG A;  3CXH D;  3CX5 D;  1U75 B;  4FB1 A;  2JQR A;  1DVV A;  1KX2 A;  4O1Q A;  3A9F A;  1CRI A;  3RLM A;  2CXB A;  1HH7 A;  2LIT A;  1C6R A;  5KAF V;  2QJK B;  2XTS B;  1N15 A;  1A56 A;  2CA4 B;  3OCD A;  1H33 B;  3L4O A;  155C A;  1CTY A;  1NML A;  1S6V B;  5DF5 A;  1DW0 A;  1GJQ A;  3PTZ A;  3TYI A;  1DT1 A;  5CIB B;  3H1L D;  2ZOO A;  3H1I D;  1L9B C;  2B0Z B;  3L71 D;  1CNO A;  1P84 D;  3O20 A;  2Y0D A;  4RJT A;  1H32 B;  1BL9 A;  2B4Z A;  2CE1 A;  4AAL A;  1FI9 A;  1HZV A;  3MK7 B;  3RN0 A;  1C2N A;  2FWL A;  1K3G A;  2C1U A;  3ZOX A;  1SQV D;  2EXV A;  4Q5P A;  3PH2 B;  1H9Y A;  1HJ5 A;  5H2F V;  4K3I A;  2ZON G;  3TGU D;  1ETP A;  2A06 D;  1HCM A;  1C75 A;  1H31 B;  5CIC B;  1GKS A;  1YEA A;  3PXT A;  1I6D A;  1CIF A;  3H1J D;  5GTH V;  3HQ8 A;  4Y5R A;  1ZZH A;  4AX3 A;  5KLI B;  5EXQ A;  3X39 A;  2FRC A;  3L73 D;  1IO3 A;  3C2C A;  1A8C A;  3TDK A;  1NTK D;  2N3Y A;  4H0J A;  2MTA C;  1I8O A;  3HQ7 A;  3A0B V;  3ZOO A;  3PXS A;  4L3H A;  2AXT V;  2GC4 D;  1DW3 A;  1EZV D;  1CSW A;  2ZZS 1;  2C8S A;  2VHD A;  5AUR A;  1NNO A;  1C52 A;  1YFC A;  1CXA A;  2N18 B;  3ZOY A;  3SJL A;  1EB7 A;  3DMI A;  3OA8 A;  1S5L V;  1H31 A;  1H9X A;  1KX7 A;  4WQE A;  5CID B;  2QJY B;  5B5E V;  2L4D A;  1OCD A;  3WUI A;  2BGV X;  5CIE B;  1CTJ A;  2BCN B;  1R0Q A;  2OZ1 B;  1KYO D;  3RMZ A;  4MU8 A;  2V08 A;  3L75 D;  1I6E A;  3VMA A;  2FYU D;  5KLV D;  5CIF B;  3O0R C;  1CTZ A;  3RN1 A;  1N9C A;  1MG3 D;  1GIW A;  1KYO W;  2N18 C;  1I55 A;  1KV9 A;  3NBT A;  5KAI V;  1HRC A;  3NBS A;  1J3S A;  1CO6 A;  1FJ0 A;  1CRG A;  3GW6 A;  1GQ1 A;  4GED B;  1DW1 A;  4FA4 A;  1CCR A;  1GU2 A;  1SQX D;  2CE0 A;  1M60 A;  1C6O A;  2C2C A;  1OAE A;  2Y0E A;  4WQ9 A;  3WFE C;  1NIR A;  2L91 A;  1BCC D;  5CIG B;  4WQB A;  5KKZ B;  4NFG B;  1FCD C;  2I8F A;  1LS9 A;  1H1O A;  2B10 B;  4EIF A;  1MG2 D;  1QN2 A;  1LFM A;  2JWA A;  1CC5 A;  2V07 A;  3PXW A;  2D0W A;  1CRH A;  4EID A;  2MHM A;  4LJI A;  3WU2 V;  3A0H V;  4FAN A;  1E29 A;  1YCC A;  1M6Z A;  2RN0 A;  5CYT R;  1FI3 A;  1PPJ D;  2B11 B;  1RAQ A;  2LIR A;  1E2R A;  1DII C;  2JTI B;  3VRD A;  1M70 A;  1COR A;  5DFS A;  1DVH A;  3KZI V;  1PP9 D;  4GYD A;  1LC1 A;  2ZXY A;  1F1C A;  3DP5 A;  3FWL A;  1W5C T;  1CYI A;  1BE3 D;  3CWB D;  3ITK A;  1CIE A;  1H32 A;  2DGE A;  4IL6 V;  4AAN A;  2C9X B;  4O1W A;  4A7P A;  1N50 A;  1YIC A;  4FAV A;  2OZ1 A;  4FA9 A;  4EDF A;  1GDV A;  3MK7 C;  4XXL A;  1IZL 0;  4WQD A;  1L0L D;  1LMS A;  5E79 V;  1KIB A;  3H1K D;  2QG4 A;  2BCC D;  2C1V A;  1RAP A;  1YIQ A;  1I54 A;  4XYD B;  2KNC B;  1E8E A;  4KMG A;  1BGY D;  1C6S A;  1I8P A;  3PRJ A;  3DR0 A;  3O5C A;  2C1D A;  3HQ6 A;  1SQP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...