3H1JD

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
total genus 69
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1jD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1jD02
1H31A 1CHIA 1AKKA 1KB0A 2AXTV 3H1ID 1CRGA 3OCDB 4EIFA 2BGVX 1CRJA 4O1WA 3PTZA 1P84D 2PCCB 1ZZHA 1CTYA 2N3YA 2ZOOA 3SWSA 5DJQB 3WC8A 1OAEA 5CICB 1YCCA 2D0SA 4RJTA 3TF5A 1CSWA 1CSUA 3GG2A 1CXCA 2BH5X 1BL9A 4L3HA 1C2NA 1EZVD 3DP5A 1R0QA 4H0JA 1WEJF 3ZOWA 1CO6A 3WUIA 4WQAA 1BE3D 3C2CA 1KX7A 3O1YA 2QG4A 3VMAA 5C0ZA 2MHMA 3L4MA 4J20A 2ZZS1 2V07A 1GDVA 1I8PA 2JQRA 3L70D 4MU8A 4WQDA 1LFMA 5B66V 2OZ1A 1H32B 2PCBB 4GEDB 5CIDB 5GTHV 1I8OA 1EB7A 1CSVA 1GKSA 2RN0A 2QJKB 4PW9B 4WQ7A 1F1CA 1U75B 1CCHA 2Y0EA 1FI7A 1HJ5A 1CYIA 1S6VB 1E8EA 3SVWA 1IRVA 5TISV 2OZ1B 1I55A 1GQ1A 1YICA 3WU2V 4AALA 3CYTI 1C52A 1N9CA 1YTCA 2PACA 2Y0CA 5AURA 2GC7D 4NFGB 3RLMA 1HROA 1DW2A 2YK3A 3A0BV 1K3GA 5KLIB 1CCRA 1W5CT 3OCDA 1QL4A 2C8SA 3H1KD 3H1HD 3KZIV 1IQCA 5CIGB 1CYCA 5H2FV 1QYZA 1FJ0A 3VYMA 3KHUA 1MG3D 3PHLA 4EDFA 1ZRTD 3L72D 2JTIB 1C6RA 1C2RA 3CP5A 3WFDC 5DJQC 2V08A 3PH2B 1N90A 1RAQA 4AX3A 1C6OA 3M97X 3RN0A 1H1OA 5B6QA 3L73D 1CRYA 4FA5A 1FHBA 351CA 2AIUA 1LC2A 2CXBA 4AANA 1U74B 1C7MA 1A56A 1AOFA 2N9IA 1KV9A 3O20A 1KYOD 1M60A 1CIFA 3RMZA 1DIQC 1LMSA 1L0LD 2B11B 1J3SA 1CIGA 1DVVA 1HCMA 3CWBD 3L4OA 1HRCA 1GIWA 2BCNB 1I6DA 1H32A 1E29A 1CIHA 2L91A 2EXVA 3TYIA 2LITA 1DW3A 2GC4D 3BCCD 2C1DB 2A06D 1DVHA 1I5TA 2YIUB 2FYUD 4Y5RA 3H1JD 3NBTA 1ETPA 4WQBA 5CIFB 3ZOXA 4PWAA 3PXWA 2CA3B 4PD4D 2I8FA 4PJ0V 1QKSA 1NMIA 1B7VA 1DW0A 1YEAA 5KAFV 1A8CA 1L0ND 1RZ5A 5CYTR 4QAOA 2JWAA 2GB8B 1NMLA 3CXHW 2IBZD 3TDKA 1IZL0 4D6TD 4AAOA 2L4DA 1GJQA 2N9JA 4YE1A 5DFSA 2FRCA 2K9JB 1I6EA 4WQ8A 3OA8B 1F1FA 1E2RA 3PRJA 1KYOW 1MZ4A 2D0WA 5KLVD 4EIEA 2VHDA 1PP9D 3CU4A 4WQ9A 2BH4X 1YFCA 1CNOA 1GU2A 1AOQA 5C9MA 4EICA 4XYDB 1H33A 1NIRA 4RSZA 3WFBC 2CE0A 1DW1A 3FWLA 1KX2A 2LIRA 2GIWA 1NTZD 451CA 1CXAA 2XTSB 2B4ZA 3NWVA 2AI5A 2DGEA 3TGUD 1HJ3A 3VNWA 3HQ6A 1N15A 2BLFB 4K3IA 2CA4B 3CXHD 1H33B 1COTA 4AAMA 1CHJA 3JBTB 4UB6V 1WVEC 5KKZB 1CRHA 4GYDA 3ITKA 1YEBA 2C1DA 2YCCA 1CRCA 3NBSA 2ZXYA 1RAPA 1CC5A 4KMGA 3RN1A 3DR0A 4FB1A 1HH7A 1BGYD 1MG2D 3O0RC 4IL6V 4UB8V 1IO3A 1IRWA 3SJLA 2N9YB 1L9BC 3O5CA 5GTIV 1PPJD 3H1LD 2KS1A 2C2CA 3HQ9A 1SQQD 4WQCA 1C75A 1S5LV 1HZVA 2B10B 2HV4A 2QJPB 3HQ8A 1JDLA 4JCGA 2DVHA 4LJIA 3ZCFA 1SQVD 3L75D 4XXLA 3WFEC 2YQBA 5CIEB 2FWLA 1BCCD 1DIIC 3A0HV 1H31B 2B0ZB 1NTKD 3L74D 2Q3EA 1NNOA 3OA8A 1NU1D 1CSXA 1C6SA 1SQPD 3CX5D 3ZOOA 3ZOYA 3GW6A 4WQEA 1CTZA 2Y0DA 1CORA 1K3HA 5E79V 2FYNB 1M70A 3L71D 5B5EV 1H9XA 1AYGA 1NTMD 4O1QA 1FCDC 2BPBB 3MK7C 1DT1A 2KNCB 2N3BA 4EIDA 5IY51 2ORLA 2C1UA 1I54A 4DY9A 2BCCD 1HJ4A 1VYDA 3WFCC 1OCDA 2O3JA 5TJHA 1QN2A 2N18C 3HQ7A 1N50A 5CIBB 1YNRA 4L1QA 3MK7B 1A2SA 3X39A 3SXTA 2CE1A 155CA 4L3GA 4FA9A 1YIQA 3VRDA 1CEDA 4V2KA 2QJYB 1CYJA 2ZBOA 1SQBD 1FI3A 4U3FD 2C1VA 5DF5A 2N18B 1FI9A 1CHHA 1QL3A 3ZIYA 5KAIV 4FANA 1RZ6A 1KB9D 1W2LA 1H9YA 1SQXD 2MTAC 2ZONG 1KIBA 4FA4A 5CIHB 4FAVA 1LC1A 4Q5PA 4A7PA 3PXSA 1CTJA 1CRIA 3ORVA 4N0KA 3CX5W 4H0KA 3PXTA 3PLNA 2RMZA 1LS9A 4P4QB 3SLEA 4FA1A 1CIEA 2C9XB 1HZUA 3DMIA 3ZBMA 1L9JC 1M6ZA 5EXQA 1FOCA 3A9FA 2B12B
chains in the Genus database with same CATH superfamily
1GL2C 4BXLA 1RE4A 4HH2A 3NXSA 3OCDB 1LT1A 1BCCE 1CRJA 3M9BA 2E75B 1P84D 2IYOA 2B9BA 4NPEA 3L74E 1CTYA 1ZP0C 2QE7H 5DJQB 3WC8A 4U3FG 2H43A 3HTKB 1SQPE 2FBWC 1LP1B 2K3RA 1J1EB 3GG2A 1CXCA 1EZVD 3V4WA 3KZIE 1DEBA 3NFQA 4H0LC 1IFDA 1CO6A 1G1JA 3C2CA 1DD3A 2O1KA 5CCGA 5KJ7C 3IN6A 4J20A 2E74C 1GDVA 1I8PA 2JQRA 1NGMB 1LFMA 2HLOA 2P67A 5H2FE 2OZ1A 1AQTA 3C8VA 3AE1C 5KLVJ 3I5CA 2Z5IA 2RN0A 4WWIA 2FYUK 1YITP 2E75D 1YJWP 1F1CA 3QH9A 3P8CD 4C7NA 3CX5I 3W68A 1CYIA 1JCDA 1W5CE 1E8EA 1FJKA 1LTJA 1IZNB 4DZOA 1WT6A 3OAKA 1JMBA 3CPWO 4H13B 3RLMA 4U7JA 3CCVP 2YNYA 1DW2A 2HODB 2YK3A 1W2EA 2WT7A 1QX8A 5AW3B 2JEEA 4PJ0E 2D2CB 3L70G 4IFMA 3H1HD 1XTGB 1IQCA 5CIGB 2WZ7A 4I2LC 4YPCA 2HPCA 1R5LA 2YMKA 1MG3D 1RF1A 4YXDC 3L72D 2YXQB 4ASVA 1EXJA 3Q2YA 2I1JA 3WUUA 1GL2A 5DJQC 2W6BA 3KYQA 3RBZA 3CLQA 1N7SA 3PH2B 1L0LJ 1BDDA 2JKVA 1C6OA 1JNMA 4PV1D 5B6QA 1JY2N 4FA5A 1FHBA 2CXBA 2E5TA 3AE2C 1HUCA 3Q1MA 2N9IA 3WU2E 3O20A 1SQBG 4UB6H 3H1JJ 1LT9B 1EZVE 1R5SA 1FBMA 4IFFA 3L75J 2QEXP 4MN4C 2ZT9D 1CIGA 4H13D 1DVVA 1FZAA 1HCMA 3CWBD 3A0BE 2YO3A 1HRCA 2BCNB 4HJGH 1I6DA 1GU4A 3H1KG 2YIUB 4UB8H 4Y5RA 4XA4A 2FY8A 5CIFB 2GM4A 1SFCB 1JY2O 2ZVNB 2CA3B 3E7KA 3PJSK 1DD4A 2E76B 1OVRA 1U7MA 1DW0A 2GUVA 1NTMJ 3P8CE 2FYZA 1A8CA 1VQ4P 1RZ5A 1EDIA 2JWAA 2GB8B 3CI9A 1OWAA 2CPBA 3CCRP 3L73G 3VMYA 1IZL0 3V2QA 1IFMA 2ZYAA 4D6TD 4B86A 3AE7C 3LIDA 5DFSA 1MV8A 3CL3D 4I1LA 1ZMEC 4WQ8A 1Y8AA 1KYOW 1KILC 2D0WA 1IFNA 3V6IA 3CU4A 4WQ9A 2E5YA 1SQPK 2D2CC 4W80A 1VQ8P 1FDMA 3H1HE 5B5EH 4EICA 1PGOA 1OX3A 3K5BA 3HE5B 2WITA 2CE0A 3BVHA 3L72E 1E5WA 1LWUB 3FWLA 1KX2A 1NTZD 2WWWA 2E76D 2QIWA 1YHQP 1KORA 2QM7A 1HJ3A 1HF9A 1G2CB 2KP8A 3VNWA 4K35A 4K3IA 4TT3H 2HG5D 3JBTB 1BGYJ 4Y28J 2N1TB 3H1LJ 3G6EP 3CWBE 1YEBA 1Q90D 1SQQJ 2YCCA 3E1RA 5KLVG 1JM0A 1CRCA 3VMZA 1K8AQ 1RAPA 1QL1A 1H88A 2K37A 1M7LA 2QJPC 2YIUC 4L75A 2JR8A 1SFCC 1IRWA 3SJLA 3MTUE 1FAVA 2KS1A 4ZNCA 1UIXA 3M9HA 4WQCA 1NU1J 1LTIC 1C75A 4K3AA 2B10B 2J5UA 4JCGA 4OGQD 2DVHA 3ZCFA 4XXLA 1EQ7A 3RK2D 3OA7A 3D0WA 3A0HV 1PL5A 4D6TE 5CBNA 2FYNC 3OA8A 2A45G 4GOEA 2N1TD 1C6SA 3GHGC 1KB9H 1Y9BA 2ZXEB 5AW8B 2BCCJ 2N9BA 3UIAA 1CORA 2W90A 1FZFA 3B5NB 1H8AA 5AVZB 1KILA 3IAOA 3Q5PA 1AYGA 2OYHC 4IL6E 1L0LG 3TYYA 3MK7C 1AVOA 2V7QH 2C1UA 5AW7B 1I54A 1NTZE 4U3FJ 2O3JA 1KQFB 3AECC 4Z1MH 5TJHA 1VL2A 1PGQA 1QN2A 2A06G 3Q5SA 5B66H 1PGPA 1NJIQ 5APQA 2WPSA 3L75G 4TLFA 1A02J 2Z5HA 1YJNP 1SQBD 4M3LA 4DOJA 1FI9A 2B87A 1KB9D 1SQXD 5AVSB 3VMXA 5TISH 1LC1A 4C7NB 1CRIA 1JMMA 3CX5W 5E79E 1LTJB 3PXTA 3B5ND 5B5EE 3Q3DA 1LS9A 2LR2A 1NTMG 2WPRA 5BU5A 3EFGA 5GTHE 1M6ZA 4LGDE 1FOCA 5H2FV 1Z56A 3KZIH 3RK3C 4JQ0D 1H31A 3AE6C 1CHIA 3CCJP 3GF3A 2GUSA 1CRGA 4EIFA 2BGVX 2JJLA 3PTZA 1RE4C 1IK7A 1BDCA 3IF4A 1ZZHA 2O01J 1RF1B 2A45I 2FYUJ 1JEKA 5CICB 1GL2B 4RJTA 2QSIA 2NZ2A 3H6PA 1N7SB 2XV5A 2IFNA 3GHGA 3V2NA 1VF5C 1S4XA 1W2BO 1BL9A 3B71A 1C2NA 1R0QA 4LLHA 4R4MA 5AW9B 1QLED 2CPSA 4GT1A 2VRSA 3RGUA 1AVYA 2QG4A 3II6A 1PP9E 2I1KA 2RH0A 2J59M 2ZZS1 2OYHA 1JUNA 4WQDA 1OW6A 5CCGC 2Q5UA 1FE6A 3U59A 1BGYG 2PCBB 4H0LB 1HJBA 1I8OA 3H1IG 1EB7A 1PPJG 1CSVA 3CMEP 1IFPA 4PJ0H 4RESB 2QJKB 1GD2E 2NPSC 4PW9B 4WQ7A 4IFDK 4JF7A 2B89A 4EI2A 3CCUP 2ZYDA 1CCHA 3GLMA 3WUTA 1L2PA 1GL2D 1KB9E 1SQXE 1M57D 1NOHA 1P84H 1T2KC 1I55A 1GQ1A 5APVA 3HE4A 3WU2V 1C52A 1Q7YQ 1X79B 1URQA 3ABVC 2GC7D 4NFGB 2W8ZA 3HD7A 4I7ZB 3FX0A 3A0BV 1BE3G 2LKMA 3WU2H 1GDTA 2OTLP 2WVRA 5AVVB 1GZLA 1QL4A 2C8SA 4C7RA 3L73J 1NYHA 5KAFE 1CYCA 3BATA 4EIJA 1QYZA 4H0LD 3P32A 3O6QB 1IFJA 2AXCA 5KJ7D 1EDLA 2E74D 3C9IA 1JY3P 3M0DA 1AV1A 2R3CA 2ZYGA 3CC2P 4AX3A 3M97X 2WSFJ 1SQVE 1NTZK 1MUUA 2PGDA 2DW3A 2QA4P 2OARA 1N7SC 3F89A 1C7MA 3MIWA 5TISE 1FZGA 2R3SA 1NTKE 1AQ5A 4L74A 1VQ7P 2YKPA 1NH4A 1KYOD 3N7NA 1CIFA 1DIQC 1LMSA 1L0LD 2G8YA 1BCCJ 3FWNA 5AW5B 3L4OA 1GIWA 2P2UA 2R5DA 1H32A 1Q82Q 2EXVA 1AA0A 1DW3A 2ZVOB 2PFXA 3SWKA 2A06D 2C9LY 2Y9ZA 1DVHA 1SQPJ 3EQ2A 2K9YA 3CD6P 3H1JD 3NBTA 1ETPA 4PWAA 4OWFA 1Q2NA 1M8OB 2I8FA 2YXRB 2QJKC 3B8EB 1FJPA 2WSEJ 2KS1B 2K1AA 3LW5H 1YTZT 5CYTR 2P58A 4JYBA 2IBZD 2NPSA 3S9OA 1RF0C 3U1CA 3CXHH 4W7ZA 4ZMDA 4WY4A 1DIPA 1IC2A 3E1IA 4I7ZC 1KV4A 1I6EA 2FXMA 4GOFA 3OA8B 1F1FA 1E2RA 1MZ4A 2KSJA 4WBAA 2BEZF 1L0NK 2BH4X 1YFCA 1CNOA 2MJZA 1GU2A 1AOQA 2Q7CA 3TGUJ 2Q9IA 5C9MA 3AE9C 2FYUG 4XYDB 1YBKA 1N2DC 4RSZA 1AFOA 4Y99B 3WFBC 1KILB 2GIWA 2JWDA 1G1IA 2B4ZA 5CCHC 3NWVA 2WPQA 2AI5A 4WVZA 3A2AA 3BRTB 2FFDA 2DGEA 1L0NG 3V2RA 4H44B 2WSCJ 1P84E 3VP9A 3CXHD 1H33B 1KYOE 4BRYB 4UB6V 1QVFO 1WVEC 4EYYQ 1L0LE 1CRHA 3NMDA 5KAIH 2YO2A 2C1DA 2B87B 2KB7P 3NBSA 2FKWB 1CC5A 4KMGA 3A5TA 2A06E 1FS0E 1HH7A 1BGYD 1MG2D 4IL6V 4UB8V 3H1JE 4GKGA 1L9BC 1PPJD 3CCMP 3H1LD 1LJ2A 3HQ9A 1SQQD 3I56P 1OZHA 1USDA 3D6YA 1VDFA 2D2CD 2QJPB 1JDLA 4IL6X 4IL6H 2J58A 2XU6A 2AXTH 2IBZE 5DJUB 1DIIC 1H31B 2B0ZB 1N8RQ 2Q3EA 1NNOA 1AJYA 1NU1D 2ZAEB 1RF0A 3CX5D 2BEQD 3HUSC 3ZOYA 1LTSC 3GW6A 1CTZA 1SQVK 1HJ0A 2HR3A 2IDBA 1K3HA 5E79V 2KSEA 1OW7A 2FYNB 1M70A 3L71D 5B5EV 1K05A 4PV1C 3AE5C 1NTKK 4O1QA 3F5HA 1FCDC 2C0XA 3GHGB 1DT1A 2R32A 4Y99C 2P7JA 2H89C 4PD4I 2C0WA 5GTIE 2BCCD 1HJ4A 1OCDA 5E79H 2OQQA 2N18C 3HQ7A 4LC1A 1N50A 3AE8C 1KTMA 5AVQB 2OYHB 4JYCA 1ZXGA 4H44C 3MK7B 5GTHH 4IOIH 1SFCD 1JTHA 2WMMA 1BCCG 5CCHA 1EDKA 4FA9A 3Q5RA 3TSIA 4GODA 3VRDA 3CXHE 1LTBC 2AEJA 2ZBOA 3L74G 3H1HJ 3W67A 1FI3A 4U3FD 1NAFA 1ZLLA 1CHHA 1QL3A 1RY3A 4XFJA 1RH5B 1SQPG 2ZFCA 3A3YB 3V5BA 4Q5PA 1CTJA 3WUVA 3ORVA 4AQRD 1H0TB 3CCQP 2RMZA 3H1IJ 3SLEA 3HE4B 1HZUA 3DMIA 1URQB 3SSUA 3H1LE 1KMIZ 1SQQE 5EXQA 3KXDA 3A9FA 2Y9YA 2KLVA 5KTBA 1AKKA 1KB0A 1KB9I 1NHLA 5AW0B 3JSVC 3R4YA 2PCCB 2N3YA 2ZOOA 4HYTB 1M1KQ 1NU1E 1S1CX 1OAEA 3RK3B 1IJDB 1BE3J 3TGUG 2WTYA 3CX5E 3H25A 1KQGB 1GMJA 1HVVA 5KAIE 1L4AC 1CSWA 1QL2A 3CCEP 1JY2P 3HUSA 3L71E 2PRRA 3DP5A 1WEJF 2MKVA 3WUIA 3M9QA 1KX7A 4D6TJ 1ZN5A 1VQ9P 1HWTC 5C0ZA 2BCCE 3L4MA 2V07A 1KC8Q 3L70D 1VF5B 1NVOA 4HKZH 1IFIA 5B66V 1H32B 1PZQA 2KOGA 3T97A 2AXTE 1FC2C 2R5BA 5EFWB 3JCUE 1GKSA 1K04A 3M06A 3G71P 4ZKPA 2KK7A 3RL0C 2JP3A 2PAJA 4JBZA 4U3FE 1KFNA 1U75B 5KAFH 3MUDC 2HFED 4BWNA 4ZKUA 1HJ5A 3RK3D 2E42A 1T3UA 3V4QA 1IRVA 5TISV 3VP8A 2OZ1B 2OTJP 5K5GB 1MFTA 4XE5B 1YICA 5AVWB 4YTPC 4AALA 2NPSB 5KLIC 4GDOA 1N9CA 1YTCA 5DJTB 4OGQC 2Y0CA 2UWJE 4DCKA 1SLQA 3ZDMA 1HROA 1JY3N 1URQC 3HD7C 1GU5A 1T6AA 1K3GA 1VQOP 1PFIA 1UIIA 4N3YB 3H1KD 1VF5D 1VPCA 3KZIV 2KUBA 1USEA 4EDFA 3L35A 2JTIB 1C6RA 3CP5A 3WFDC 2WT7B 1RAQA 5CCGD 3RN0A 3L73D 1CRYA 1PIXA 351CA 3M0DC 1LC2A 4AANA 1U74B 1A56A 2HPCB 2M8RA 3BCCJ 1KV9A 1M60A 1L4AA 1KD1Q 2OTKE 3MZWB 1SVFA 2B11B 1J3SA 4HB1A 3H32A 1OW8A 1YJ9P 3L36A 1OIPA 1KFMA 2JO1A 1T2KD 1E29A 1IO4A 1K9MQ 2L91A 3TYIA 3L70E 4DJGA 1L0NJ 2C1DB 1RQVA 3H1HG 1I5TA 3G9RA 3ZOXA 1QVGO 1P84I 3L72G 4PJ0V 1NMIA 2Q3IA 1B7VA 1S5LH 1YEAA 2KI7B 3AEDC 1GK4A 5CMZA 1J2JB 1D7MA 1PP9J 3CCSP 3D71A 1VQNP 3MUDA 1X9VA 4AAOA 1FZCA 1SQBE 1GJQA 2H8PD 4YE1A 1EZVI 2P10A 3HE5A 2XNXA 2M0BA 3TK1A 4WY4C 3EWKA 2KIKA 3CWBG 4NPFX 1N7SD 2E43A 2OYOA 5KLVD 4EIEA 3AE4C 2VHDA 5APSA 2C9NY 1EDJA 3JC22 1KYOH 5CJ0A 3H1KE 3KDPB 2W6AA 1KQLA 1T3JA 1N86A 2IBZI 3AE3C 1NIRA 1VQMP 1FZEA 1DW1A 2N1TA 2LIRA 451CA 3CC4P 3A7OA 3TGUD 1U7JA 3L73E 2PP6A 2V7QJ 1N15A 2FFDC 2CA4B 4D6TG 3V2PA 4AAMA 1PV3A 1JB0J 1CW5A 3U1AA 1JTHB 3IFMA 1MFZA 1JO5A 2IPPA 5KKZB 5AVTB 2M5AA 2ZXYA 1SQVJ 2K88A 2I8DA 3O0RC 1J1DC 1K73Q 4C46A 1QEXA 1IO3A 5GTIV 2V4HA 1NTKJ 2AEFA 3L74J 4I6MC 3CXHI 1M56D 1NTZG 2HV4A 3TNUA 2G3AA 3L75D 1PGJA 1BSHA 1RE3A 2YQBA 2FWLA 3B5NA 5GTIH 5CHXA 2CK3H 2K9JA 2GA1A 3KQGA 3GF7A 1NKZB 3MGNA 3G3ZA 5CCHD 2YMYA 1GTWA 2XKMA 1OVVA 4WQEA 2NRGA 5KLVE 3MP7B 3CMAP 5BU8B 1LTAC 1NTMD 2BPBB 1OXZA 5APWA 3HUSB 3IR9A 2OYIA 1RQUA 4ASWA 2ORLA 5AW4B 3SFDC 2ITAA 5CBOA 3BCCG 1S5LE 5CIBB 4PV1B 3MHVA 3I55P 3TGUE 3SWYA 1A2SA 2IYPA 3O8ZA 3SXTA 2W6JH 2CE1A 2RKLA 4N6JA 1YIQA 2HYNA 2QJYB 3T97B 1CYJA 2C1VA 5DF5A 1YQ4C 2M3BA 2N18B 4OH8B 5KKZC 2OGUA 3FXEA 2ZT9B 1N73C 5KAIV 1RZ6A 1W2LA 1NO4A 2MTAC 1M1JA 4FA4A 4FAVA 3R2PA 5APTA 4CPGA 4N0KA 2SPZA 1ZW0A 3PLNA 1LNQA 3VOPA 4AYCA 4P4QB 4FA1A 3CX5H 1CIEA 1CZQA 3QWOC 2KZIA 1SQBK 3AEEC 3D70A 2R44A 3HRNA 2FXOA 1OVUA 3M0AA 2E75C 1L9JC 3L4FA 1PP9G 2P1JA 4EOTA 1SQXK 3BASA 2IZ1A 1FU1A 1GW3A 1FDOA 5APYA 2AXTV 3L75E 3H1ID 4QMAA 3AEGC 4O1WA 1KILD 1J1EC 3SWSA 1YCCA 2D0SA 3BRVB 1IK9A 4RO0A 4H44D 1SQXG 3JCUH 3TF5A 3CC7P 2ZJSE 1S3JA 1HGZA 1CSUA 2KNCA 2BH5X 4L3HA 1VQPP 4H0JA 1EC5A 3KPEA 2IFMA 1NTME 5KJ7A 1GW4A 3ZOWA 5APUA 4WQAA 1BE3D 2Q6QA 1L4AB 5APXA 3O1YA 3EFFK 3VMAA 2MHMA 2O01N 3H32B 4MU8A 1HGVA 2O1JA 1X0TA 4O9BA 4GEDB 1U57A 5CIDB 1ZR4A 5GTHV 4YXWH 1ZV8A 1VQ6P 2QVAA 5AVRB 4GIFA 1EXIA 2QJYC 3PH0A 2B88A 1OMIA 2Y0EA 2ZT9C 3D6ZA 1FI7A 4H13C 1SQVG 1S6VB 1YTZI 3SVWA 2KZJA 3RL0B 1NTKG 1HBWA 4AUWA 1N73A 3CYTI 3LW5J 1CI6A 2PACA 1T8ZA 5AURA 3MD0A 3O6QA 1FZCB 3L72J 3VN0A 1RHZB 1L4AD 5KLIB 2O01H 1CCRA 1W5CT 3OCDA 2POHA 4OGQB 1BGYE 5KLVK 5AW6B 1FJ0A 3H1IE 3VYMA 3KHUA 3RK2B 3PHLA 1PPJE 2H88C 2IX7C 1ZRTD 2LXBA 3HD7B 1KILE 1NAYA 4PD4H 1VQKP 3HTKA 2QRXA 1SS1A 1C2RA 1LP1A 3NTNA 2V08A 1WMKA 1LT9C 1N90A 1VQ5P 1H1OA 3CWBJ 4KT0J 4W7YA 2AIUA 2WQYC 1SP4A 1YIJP 1OFCX 1AOFA 2KLUA 3RL0D 3RMZA 1FOSE 3S4RA 1WRGA 1BE3E 1N7LA 1KZUB 1FOSF 1LGHB 2E76C 1H89A 3C1LA 1Q86Q 1CIHA 2LITA 1Y47A 2GC4D 3BCCD 4NPDA 2M5AB 1X22A 2FYUD 3M91A 4WQBA 4L73A 5AW2B 3PXWA 5AVUB 4PD4D 1URQD 1M90Q 1L0LK 3HD7D 3VYIA 1QKSA 3B4SA 3VTPC 3L71J 1DH3A 5KAFV 4UB6E 1L0ND 4QAOA 1NMLA 3CXHW 3AEAC 4DT0A 4N78D 3TDKA 3TNUB 3AEFC 3A0HH 1S2EA 1ZOYC 2L4DA 2W83C 2HODA 2N9JA 2FRCA 2K9JB 1FZCC 2Z4EA 4UB8E 1MKMA 3CCLP 2WSSH 3PRJA 1NTZJ 1LWUC 1PP9D 1LTGC 1S9KD 2FXPA 1EZVG 1A02F 2WSFH 3RK2C 3H1JG 4WY4B 1H33A 1BSNA 4BRYA 1ZRTE 1NTMK 1CXAA 2XTSB 1Q81Q 2OYIB 1HTLC 2N1TC 2JDIH 3PP5A 2IBZG 3HQ6A 2KXPB 2BLFB 1LT9A 3FXDA 1COTA 1X8YA 1CHJA 1KQSO 1DEEG 2BASA 4L76A 4GYDA 1JOCA 3ITKA 1VQLP 1JY3O 5L8RJ 1HH0A 2FFDB 3OW2O 1M1JB 1NKNA 1SFCA 2M3EA 2LXCB 2NPSD 3BCCE 2IZ0A 5BVZA 3RN1A 3DR0A 2WSEH 4FB1A 1TU3F 2FYUE 1DX7A 2N9YB 4WY4D 3O5CA 5M1BA 2AEMA 4PD4E 2C2CA 4WB4A 3L37A 1S5LV 1HZVA 1NWQA 4R4LA 5H2FH 3SFEC 3HQ8A 1ZR2A 1L0NE 4LJIA 1J1DB 1SQVD 3WFEC 1FZBA 5CIEB 4N78E 1BCCD 1R8EA 1NTKD 3L70J 5C39A 3L74D 1RE3C 1KYOI 3B5NC 1S5LX 1CSXA 3AEBC 3S1KA 3RK3E 1SQQK 2YKQA 1SQPD 3ZOOA 4RKUJ 2WPVB 2XNDH 3RBXA 2Y0DA 1FDIA 3RL0g 1S9KE 4OVNF 2A45H 1H9XA 1LWUA 5CJ4A 1JCCA 2KNCB 3FGAD 2N3BA 4EIDA 1NU1K 2WSCH 5IY51 1YI2P 2H7HA 1KN7A 1QGKB 4DY9A 3H1LG 2Q1KA 4KHXA 3P8MC 1SQBJ 3WFCC 1VYDA 1MZ9A 2E74B 1SQQG 3GMAA 1G2CA 2OYIC 1YYCA 1SQXJ 1YNRA 4L1QA 1YQ3C 1H0TA 1GK6A 5AVYB 3X39A 3P7KA 155CA 4L3GA 4KJMA 3LIEA 3A0HE 1CEDA 4JPZB 4V2KA 1E79H 3H1KJ 1LTJC 1NU1G 3ZIYA 1LTTC 5AVXB 4FANA 1H9YA 1CSBA 2ZONG 5AW1B 1KIBA 5CIHB 2KYVA 3N4XA 2ZXXA 2L5GB 3USSA 4A7PA 1S72P 3PXSA 2QM8A 1M1JC 2YKOA 4H0KA 2XDJA 3L71G 5B66E 1N73B 2W27A 2C9XB 3WMM0 3ZBMA 3A0BH 2XZRA 1CI6B 3SWFA 3OJAB 3G4SP 2BCCG 1XTCC 1RF1C 2B12B
chains in the Genus database with same CATH topology
1H31A 1CHIA 1AKKA 1KB0A 2AXTV 3H1ID 1CRGA 3OCDB 4EIFA 2BGVX 1CRJA 4O1WA 3PTZA 1P84D 2PCCB 1ZZHA 1CTYA 2N3YA 2ZOOA 3SWSA 5DJQB 3WC8A 1OAEA 5CICB 1YCCA 2D0SA 4RJTA 3TF5A 1CSWA 1CSUA 3GG2A 1CXCA 2BH5X 1BL9A 4L3HA 1C2NA 1EZVD 3DP5A 1R0QA 4H0JA 1WEJF 3ZOWA 1CO6A 3WUIA 4WQAA 1BE3D 3C2CA 1KX7A 3O1YA 2QG4A 3VMAA 5C0ZA 2MHMA 3L4MA 4J20A 2ZZS1 2V07A 1GDVA 1I8PA 2JQRA 3L70D 4MU8A 4WQDA 1LFMA 5B66V 2OZ1A 1H32B 2PCBB 4GEDB 5CIDB 5GTHV 1I8OA 1EB7A 1CSVA 1GKSA 2RN0A 2QJKB 4PW9B 4WQ7A 1F1CA 1U75B 1CCHA 2Y0EA 1FI7A 1HJ5A 1CYIA 1S6VB 1E8EA 3SVWA 1IRVA 5TISV 2OZ1B 1I55A 1GQ1A 1YICA 3WU2V 4AALA 3CYTI 1C52A 1N9CA 1YTCA 2PACA 2Y0CA 5AURA 2GC7D 4NFGB 3RLMA 1HROA 1DW2A 2YK3A 3A0BV 1K3GA 5KLIB 1CCRA 1W5CT 3OCDA 1QL4A 2C8SA 3H1KD 3H1HD 3KZIV 1IQCA 5CIGB 1CYCA 5H2FV 1QYZA 1FJ0A 3VYMA 3KHUA 1MG3D 3PHLA 4EDFA 1ZRTD 3L72D 2JTIB 1C6RA 1C2RA 3CP5A 3WFDC 5DJQC 2V08A 3PH2B 1N90A 1RAQA 4AX3A 1C6OA 3M97X 3RN0A 1H1OA 5B6QA 3L73D 1CRYA 4FA5A 1FHBA 351CA 2AIUA 1LC2A 2CXBA 4AANA 1U74B 1C7MA 1A56A 1AOFA 2N9IA 1KV9A 3O20A 1KYOD 1M60A 1CIFA 3RMZA 1DIQC 1LMSA 1L0LD 2B11B 1J3SA 1CIGA 1DVVA 1HCMA 3CWBD 3L4OA 1HRCA 1GIWA 2BCNB 1I6DA 1H32A 1E29A 1CIHA 2L91A 2EXVA 3TYIA 2LITA 1DW3A 2GC4D 3BCCD 2C1DB 2A06D 1DVHA 1I5TA 2YIUB 2FYUD 4Y5RA 3H1JD 3NBTA 1ETPA 4WQBA 5CIFB 3ZOXA 4PWAA 3PXWA 2CA3B 4PD4D 2I8FA 4PJ0V 1QKSA 1NMIA 1B7VA 1DW0A 1YEAA 5KAFV 1A8CA 1L0ND 1RZ5A 5CYTR 4QAOA 2JWAA 2GB8B 1NMLA 3CXHW 2IBZD 3TDKA 1IZL0 4D6TD 4AAOA 2L4DA 1GJQA 2N9JA 4YE1A 5DFSA 2FRCA 2K9JB 1I6EA 4WQ8A 3OA8B 1F1FA 1E2RA 3PRJA 1KYOW 1MZ4A 2D0WA 5KLVD 4EIEA 2VHDA 1PP9D 3CU4A 4WQ9A 2BH4X 1YFCA 1CNOA 1GU2A 1AOQA 5C9MA 4EICA 4XYDB 1H33A 1NIRA 4RSZA 3WFBC 2CE0A 1DW1A 3FWLA 1KX2A 2LIRA 2GIWA 1NTZD 451CA 1CXAA 2XTSB 2B4ZA 3NWVA 2AI5A 2DGEA 3TGUD 1HJ3A 3VNWA 3HQ6A 1N15A 2BLFB 4K3IA 2CA4B 3CXHD 1H33B 1COTA 4AAMA 1CHJA 3JBTB 4UB6V 1WVEC 5KKZB 1CRHA 4GYDA 3ITKA 1YEBA 2C1DA 2YCCA 1CRCA 3NBSA 2ZXYA 1RAPA 1CC5A 4KMGA 3RN1A 3DR0A 4FB1A 1HH7A 1BGYD 1MG2D 3O0RC 4IL6V 4UB8V 1IO3A 1IRWA 3SJLA 2N9YB 1L9BC 3O5CA 5GTIV 1PPJD 3H1LD 2KS1A 2C2CA 3HQ9A 1SQQD 4WQCA 1C75A 1S5LV 1HZVA 2B10B 2HV4A 2QJPB 3HQ8A 1JDLA 4JCGA 2DVHA 4LJIA 3ZCFA 1SQVD 3L75D 4XXLA 3WFEC 2YQBA 5CIEB 2FWLA 1BCCD 1DIIC 3A0HV 1H31B 2B0ZB 1NTKD 3L74D 2Q3EA 1NNOA 3OA8A 1NU1D 1CSXA 1C6SA 1SQPD 3CX5D 3ZOOA 3ZOYA 3GW6A 4WQEA 1CTZA 2Y0DA 1CORA 1K3HA 5E79V 2FYNB 1M70A 3L71D 5B5EV 1H9XA 1AYGA 1NTMD 4O1QA 1FCDC 2BPBB 3MK7C 1DT1A 2KNCB 2N3BA 4EIDA 5IY51 2ORLA 2C1UA 1I54A 4DY9A 2BCCD 1HJ4A 1VYDA 3WFCC 1OCDA 2O3JA 5TJHA 1QN2A 2N18C 3HQ7A 1N50A 5CIBB 1YNRA 4L1QA 3MK7B 1A2SA 3X39A 3SXTA 2CE1A 155CA 4L3GA 4FA9A 1YIQA 3VRDA 1CEDA 4V2KA 2QJYB 1CYJA 2ZBOA 1SQBD 1FI3A 4U3FD 2C1VA 5DF5A 2N18B 1FI9A 1CHHA 1QL3A 3ZIYA 5KAIV 4FANA 1RZ6A 1KB9D 1W2LA 1H9YA 1SQXD 2MTAC 2ZONG 1KIBA 4FA4A 5CIHB 4FAVA 1LC1A 4Q5PA 4A7PA 3PXSA 1CTJA 1CRIA 3ORVA 4N0KA 3CX5W 4H0KA 3PXTA 3PLNA 2RMZA 1LS9A 4P4QB 3SLEA 4FA1A 1CIEA 2C9XB 1HZUA 3DMIA 3ZBMA 1L9JC 1M6ZA 5EXQA 1FOCA 3A9FA 2B12B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H31 A;  1CHI A;  1AKK A;  1KB0 A;  2AXT V;  3H1I D;  1CRG A;  3OCD B;  4EIF A;  2BGV X;  1CRJ A;  4O1W A;  3PTZ A;  1P84 D;  2PCC B;  1ZZH A;  1CTY A;  2N3Y A;  2ZOO A;  3SWS A;  5DJQ B;  3WC8 A;  1OAE A;  5CIC B;  1YCC A;  2D0S A;  4RJT A;  3TF5 A;  1CSW A;  1CSU A;  3GG2 A;  1CXC A;  2BH5 X;  1BL9 A;  4L3H A;  1C2N A;  1EZV D;  3DP5 A;  1R0Q A;  4H0J A;  1WEJ F;  3ZOW A;  1CO6 A;  3WUI A;  4WQA A;  1BE3 D;  3C2C A;  1KX7 A;  3O1Y A;  2QG4 A;  3VMA A;  5C0Z A;  2MHM A;  3L4M A;  4J20 A;  2ZZS 1;  2V07 A;  1GDV A;  1I8P A;  2JQR A;  3L70 D;  4MU8 A;  4WQD A;  1LFM A;  5B66 V;  2OZ1 A;  1H32 B;  2PCB B;  4GED B;  5CID B;  5GTH V;  1I8O A;  1EB7 A;  1CSV A;  1GKS A;  2RN0 A;  2QJK B;  4PW9 B;  4WQ7 A;  1F1C A;  1U75 B;  1CCH A;  2Y0E A;  1FI7 A;  1HJ5 A;  1CYI A;  1S6V B;  1E8E A;  3SVW A;  1IRV A;  5TIS V;  2OZ1 B;  1I55 A;  1GQ1 A;  1YIC A;  3WU2 V;  4AAL A;  3CYT I;  1C52 A;  1N9C A;  1YTC A;  2PAC A;  2Y0C A;  5AUR A;  2GC7 D;  4NFG B;  3RLM A;  1HRO A;  1DW2 A;  2YK3 A;  3A0B V;  1K3G A;  5KLI B;  1CCR A;  1W5C T;  3OCD A;  1QL4 A;  2C8S A;  3H1K D;  3H1H D;  3KZI V;  1IQC A;  5CIG B;  1CYC A;  5H2F V;  1QYZ A;  1FJ0 A;  3VYM A;  3KHU A;  1MG3 D;  3PHL A;  4EDF A;  1ZRT D;  3L72 D;  2JTI B;  1C6R A;  1C2R A;  3CP5 A;  3WFD C;  5DJQ C;  2V08 A;  3PH2 B;  1N90 A;  1RAQ A;  4AX3 A;  1C6O A;  3M97 X;  3RN0 A;  1H1O A;  5B6Q A;  3L73 D;  1CRY A;  4FA5 A;  1FHB A;  351C A;  2AIU A;  1LC2 A;  2CXB A;  4AAN A;  1U74 B;  1C7M A;  1A56 A;  1AOF A;  2N9I A;  1KV9 A;  3O20 A;  1KYO D;  1M60 A;  1CIF A;  3RMZ A;  1DIQ C;  1LMS A;  1L0L D;  2B11 B;  1J3S A;  1CIG A;  1DVV A;  1HCM A;  3CWB D;  3L4O A;  1HRC A;  1GIW A;  2BCN B;  1I6D A;  1H32 A;  1E29 A;  1CIH A;  2L91 A;  2EXV A;  3TYI A;  2LIT A;  1DW3 A;  2GC4 D;  3BCC D;  2C1D B;  2A06 D;  1DVH A;  1I5T A;  2YIU B;  2FYU D;  4Y5R A;  3H1J D;  3NBT A;  1ETP A;  4WQB A;  5CIF B;  3ZOX A;  4PWA A;  3PXW A;  2CA3 B;  4PD4 D;  2I8F A;  4PJ0 V;  1QKS A;  1NMI A;  1B7V A;  1DW0 A;  1YEA A;  5KAF V;  1A8C A;  1L0N D;  1RZ5 A;  5CYT R;  4QAO A;  2JWA A;  2GB8 B;  1NML A;  3CXH W;  2IBZ D;  3TDK A;  1IZL 0;  4D6T D;  4AAO A;  2L4D A;  1GJQ A;  2N9J A;  4YE1 A;  5DFS A;  2FRC A;  2K9J B;  1I6E A;  4WQ8 A;  3OA8 B;  1F1F A;  1E2R A;  3PRJ A;  1KYO W;  1MZ4 A;  2D0W A;  5KLV D;  4EIE A;  2VHD A;  1PP9 D;  3CU4 A;  4WQ9 A;  2BH4 X;  1YFC A;  1CNO A;  1GU2 A;  1AOQ A;  5C9M A;  4EIC A;  4XYD B;  1H33 A;  1NIR A;  4RSZ A;  3WFB C;  2CE0 A;  1DW1 A;  3FWL A;  1KX2 A;  2LIR A;  2GIW A;  1NTZ D;  451C A;  1CXA A;  2XTS B;  2B4Z A;  3NWV A;  2AI5 A;  2DGE A;  3TGU D;  1HJ3 A;  3VNW A;  3HQ6 A;  1N15 A;  2BLF B;  4K3I A;  2CA4 B;  3CXH D;  1H33 B;  1COT A;  4AAM A;  1CHJ A;  3JBT B;  4UB6 V;  1WVE C;  5KKZ B;  1CRH A;  4GYD A;  3ITK A;  1YEB A;  2C1D A;  2YCC A;  1CRC A;  3NBS A;  2ZXY A;  1RAP A;  1CC5 A;  4KMG A;  3RN1 A;  3DR0 A;  4FB1 A;  1HH7 A;  1BGY D;  1MG2 D;  3O0R C;  4IL6 V;  4UB8 V;  1IO3 A;  1IRW A;  3SJL A;  2N9Y B;  1L9B C;  3O5C A;  5GTI V;  1PPJ D;  3H1L D;  2KS1 A;  2C2C A;  3HQ9 A;  1SQQ D;  4WQC A;  1C75 A;  1S5L V;  1HZV A;  2B10 B;  2HV4 A;  2QJP B;  3HQ8 A;  1JDL A;  4JCG A;  2DVH A;  4LJI A;  3ZCF A;  1SQV D;  3L75 D;  4XXL A;  3WFE C;  2YQB A;  5CIE B;  2FWL A;  1BCC D;  1DII C;  3A0H V;  1H31 B;  2B0Z B;  1NTK D;  3L74 D;  2Q3E A;  1NNO A;  3OA8 A;  1NU1 D;  1CSX A;  1C6S A;  1SQP D;  3CX5 D;  3ZOO A;  3ZOY A;  3GW6 A;  4WQE A;  1CTZ A;  2Y0D A;  1COR A;  1K3H A;  5E79 V;  2FYN B;  1M70 A;  3L71 D;  5B5E V;  1H9X A;  1AYG A;  1NTM D;  4O1Q A;  1FCD C;  2BPB B;  3MK7 C;  1DT1 A;  2KNC B;  2N3B A;  4EID A;  5IY5 1;  2ORL A;  2C1U A;  1I54 A;  4DY9 A;  2BCC D;  1HJ4 A;  1VYD A;  3WFC C;  1OCD A;  2O3J A;  5TJH A;  1QN2 A;  2N18 C;  3HQ7 A;  1N50 A;  5CIB B;  1YNR A;  4L1Q A;  3MK7 B;  1A2S A;  3X39 A;  3SXT A;  2CE1 A;  155C A;  4L3G A;  4FA9 A;  1YIQ A;  3VRD A;  1CED A;  4V2K A;  2QJY B;  1CYJ A;  2ZBO A;  1SQB D;  1FI3 A;  4U3F D;  2C1V A;  5DF5 A;  2N18 B;  1FI9 A;  1CHH A;  1QL3 A;  3ZIY A;  5KAI V;  4FAN A;  1RZ6 A;  1KB9 D;  1W2L A;  1H9Y A;  1SQX D;  2MTA C;  2ZON G;  1KIB A;  4FA4 A;  5CIH B;  4FAV A;  1LC1 A;  4Q5P A;  4A7P A;  3PXS A;  1CTJ A;  1CRI A;  3ORV A;  4N0K A;  3CX5 W;  4H0K A;  3PXT A;  3PLN A;  2RMZ A;  1LS9 A;  4P4Q B;  3SLE A;  4FA1 A;  1CIE A;  2C9X B;  1HZU A;  3DMI A;  3ZBM A;  1L9J C;  1M6Z A;  5EXQ A;  1FOC A;  3A9F A;  2B12 B; 
#chains in the Genus database with same CATH topology
 1GL2 C;  4BXL A;  1RE4 A;  4HH2 A;  3NXS A;  3OCD B;  1LT1 A;  1BCC E;  1CRJ A;  3M9B A;  2E75 B;  1P84 D;  2IYO A;  2B9B A;  4NPE A;  3L74 E;  1CTY A;  1ZP0 C;  2QE7 H;  5DJQ B;  3WC8 A;  4U3F G;  2H43 A;  3HTK B;  1SQP E;  2FBW C;  1LP1 B;  2K3R A;  1J1E B;  3GG2 A;  1CXC A;  1EZV D;  3V4W A;  3KZI E;  1DEB A;  3NFQ A;  4H0L C;  1IFD A;  1CO6 A;  1G1J A;  3C2C A;  1DD3 A;  2O1K A;  5CCG A;  5KJ7 C;  3IN6 A;  4J20 A;  2E74 C;  1GDV A;  1I8P A;  2JQR A;  1NGM B;  1LFM A;  2HLO A;  2P67 A;  5H2F E;  2OZ1 A;  1AQT A;  3C8V A;  3AE1 C;  5KLV J;  3I5C A;  2Z5I A;  2RN0 A;  4WWI A;  2FYU K;  1YIT P;  2E75 D;  1YJW P;  1F1C A;  3QH9 A;  3P8C D;  4C7N A;  3CX5 I;  3W68 A;  1CYI A;  1JCD A;  1W5C E;  1E8E A;  1FJK A;  1LTJ A;  1IZN B;  4DZO A;  1WT6 A;  3OAK A;  1JMB A;  3CPW O;  4H13 B;  3RLM A;  4U7J A;  3CCV P;  2YNY A;  1DW2 A;  2HOD B;  2YK3 A;  1W2E A;  2WT7 A;  1QX8 A;  5AW3 B;  2JEE A;  4PJ0 E;  2D2C B;  3L70 G;  4IFM A;  3H1H D;  1XTG B;  1IQC A;  5CIG B;  2WZ7 A;  4I2L C;  4YPC A;  2HPC A;  1R5L A;  2YMK A;  1MG3 D;  1RF1 A;  4YXD C;  3L72 D;  2YXQ B;  4ASV A;  1EXJ A;  3Q2Y A;  2I1J A;  3WUU A;  1GL2 A;  5DJQ C;  2W6B A;  3KYQ A;  3RBZ A;  3CLQ A;  1N7S A;  3PH2 B;  1L0L J;  1BDD A;  2JKV A;  1C6O A;  1JNM A;  4PV1 D;  5B6Q A;  1JY2 N;  4FA5 A;  1FHB A;  2CXB A;  2E5T A;  3AE2 C;  1HUC A;  3Q1M A;  2N9I A;  3WU2 E;  3O20 A;  1SQB G;  4UB6 H;  3H1J J;  1LT9 B;  1EZV E;  1R5S A;  1FBM A;  4IFF A;  3L75 J;  2QEX P;  4MN4 C;  2ZT9 D;  1CIG A;  4H13 D;  1DVV A;  1FZA A;  1HCM A;  3CWB D;  3A0B E;  2YO3 A;  1HRC A;  2BCN B;  4HJG H;  1I6D A;  1GU4 A;  3H1K G;  2YIU B;  4UB8 H;  4Y5R A;  4XA4 A;  2FY8 A;  5CIF B;  2GM4 A;  1SFC B;  1JY2 O;  2ZVN B;  2CA3 B;  3E7K A;  3PJS K;  1DD4 A;  2E76 B;  1OVR A;  1U7M A;  1DW0 A;  2GUV A;  1NTM J;  3P8C E;  2FYZ A;  1A8C A;  1VQ4 P;  1RZ5 A;  1EDI A;  2JWA A;  2GB8 B;  3CI9 A;  1OWA A;  2CPB A;  3CCR P;  3L73 G;  3VMY A;  1IZL 0;  3V2Q A;  1IFM A;  2ZYA A;  4D6T D;  4B86 A;  3AE7 C;  3LID A;  5DFS A;  1MV8 A;  3CL3 D;  4I1L A;  1ZME C;  4WQ8 A;  1Y8A A;  1KYO W;  1KIL C;  2D0W A;  1IFN A;  3V6I A;  3CU4 A;  4WQ9 A;  2E5Y A;  1SQP K;  2D2C C;  4W80 A;  1VQ8 P;  1FDM A;  3H1H E;  5B5E H;  4EIC A;  1PGO A;  1OX3 A;  3K5B A;  3HE5 B;  2WIT A;  2CE0 A;  3BVH A;  3L72 E;  1E5W A;  1LWU B;  3FWL A;  1KX2 A;  1NTZ D;  2WWW A;  2E76 D;  2QIW A;  1YHQ P;  1KOR A;  2QM7 A;  1HJ3 A;  1HF9 A;  1G2C B;  2KP8 A;  3VNW A;  4K35 A;  4K3I A;  4TT3 H;  2HG5 D;  3JBT B;  1BGY J;  4Y28 J;  2N1T B;  3H1L J;  3G6E P;  3CWB E;  1YEB A;  1Q90 D;  1SQQ J;  2YCC A;  3E1R A;  5KLV G;  1JM0 A;  1CRC A;  3VMZ A;  1K8A Q;  1RAP A;  1QL1 A;  1H88 A;  2K37 A;  1M7L A;  2QJP C;  2YIU C;  4L75 A;  2JR8 A;  1SFC C;  1IRW A;  3SJL A;  3MTU E;  1FAV A;  2KS1 A;  4ZNC A;  1UIX A;  3M9H A;  4WQC A;  1NU1 J;  1LTI C;  1C75 A;  4K3A A;  2B10 B;  2J5U A;  4JCG A;  4OGQ D;  2DVH A;  3ZCF A;  4XXL A;  1EQ7 A;  3RK2 D;  3OA7 A;  3D0W A;  3A0H V;  1PL5 A;  4D6T E;  5CBN A;  2FYN C;  3OA8 A;  2A45 G;  4GOE A;  2N1T D;  1C6S A;  3GHG C;  1KB9 H;  1Y9B A;  2ZXE B;  5AW8 B;  2BCC J;  2N9B A;  3UIA A;  1COR A;  2W90 A;  1FZF A;  3B5N B;  1H8A A;  5AVZ B;  1KIL A;  3IAO A;  3Q5P A;  1AYG A;  2OYH C;  4IL6 E;  1L0L G;  3TYY A;  3MK7 C;  1AVO A;  2V7Q H;  2C1U A;  5AW7 B;  1I54 A;  1NTZ E;  4U3F J;  2O3J A;  1KQF B;  3AEC C;  4Z1M H;  5TJH A;  1VL2 A;  1PGQ A;  1QN2 A;  2A06 G;  3Q5S A;  5B66 H;  1PGP A;  1NJI Q;  5APQ A;  2WPS A;  3L75 G;  4TLF A;  1A02 J;  2Z5H A;  1YJN P;  1SQB D;  4M3L A;  4DOJ A;  1FI9 A;  2B87 A;  1KB9 D;  1SQX D;  5AVS B;  3VMX A;  5TIS H;  1LC1 A;  4C7N B;  1CRI A;  1JMM A;  3CX5 W;  5E79 E;  1LTJ B;  3PXT A;  3B5N D;  5B5E E;  3Q3D A;  1LS9 A;  2LR2 A;  1NTM G;  2WPR A;  5BU5 A;  3EFG A;  5GTH E;  1M6Z A;  4LGD E;  1FOC A;  5H2F V;  1Z56 A;  3KZI H;  3RK3 C;  4JQ0 D;  1H31 A;  3AE6 C;  1CHI A;  3CCJ P;  3GF3 A;  2GUS A;  1CRG A;  4EIF A;  2BGV X;  2JJL A;  3PTZ A;  1RE4 C;  1IK7 A;  1BDC A;  3IF4 A;  1ZZH A;  2O01 J;  1RF1 B;  2A45 I;  2FYU J;  1JEK A;  5CIC B;  1GL2 B;  4RJT A;  2QSI A;  2NZ2 A;  3H6P A;  1N7S B;  2XV5 A;  2IFN A;  3GHG A;  3V2N A;  1VF5 C;  1S4X A;  1W2B O;  1BL9 A;  3B71 A;  1C2N A;  1R0Q A;  4LLH A;  4R4M A;  5AW9 B;  1QLE D;  2CPS A;  4GT1 A;  2VRS A;  3RGU A;  1AVY A;  2QG4 A;  3II6 A;  1PP9 E;  2I1K A;  2RH0 A;  2J59 M;  2ZZS 1;  2OYH A;  1JUN A;  4WQD A;  1OW6 A;  5CCG C;  2Q5U A;  1FE6 A;  3U59 A;  1BGY G;  2PCB B;  4H0L B;  1HJB A;  1I8O A;  3H1I G;  1EB7 A;  1PPJ G;  1CSV A;  3CME P;  1IFP A;  4PJ0 H;  4RES B;  2QJK B;  1GD2 E;  2NPS C;  4PW9 B;  4WQ7 A;  4IFD K;  4JF7 A;  2B89 A;  4EI2 A;  3CCU P;  2ZYD A;  1CCH A;  3GLM A;  3WUT A;  1L2P A;  1GL2 D;  1KB9 E;  1SQX E;  1M57 D;  1NOH A;  1P84 H;  1T2K C;  1I55 A;  1GQ1 A;  5APV A;  3HE4 A;  3WU2 V;  1C52 A;  1Q7Y Q;  1X79 B;  1URQ A;  3ABV C;  2GC7 D;  4NFG B;  2W8Z A;  3HD7 A;  4I7Z B;  3FX0 A;  3A0B V;  1BE3 G;  2LKM A;  3WU2 H;  1GDT A;  2OTL P;  2WVR A;  5AVV B;  1GZL A;  1QL4 A;  2C8S A;  4C7R A;  3L73 J;  1NYH A;  5KAF E;  1CYC A;  3BAT A;  4EIJ A;  1QYZ A;  4H0L D;  3P32 A;  3O6Q B;  1IFJ A;  2AXC A;  5KJ7 D;  1EDL A;  2E74 D;  3C9I A;  1JY3 P;  3M0D A;  1AV1 A;  2R3C A;  2ZYG A;  3CC2 P;  4AX3 A;  3M97 X;  2WSF J;  1SQV E;  1NTZ K;  1MUU A;  2PGD A;  2DW3 A;  2QA4 P;  2OAR A;  1N7S C;  3F89 A;  1C7M A;  3MIW A;  5TIS E;  1FZG A;  2R3S A;  1NTK E;  1AQ5 A;  4L74 A;  1VQ7 P;  2YKP A;  1NH4 A;  1KYO D;  3N7N A;  1CIF A;  1DIQ C;  1LMS A;  1L0L D;  2G8Y A;  1BCC J;  3FWN A;  5AW5 B;  3L4O A;  1GIW A;  2P2U A;  2R5D A;  1H32 A;  1Q82 Q;  2EXV A;  1AA0 A;  1DW3 A;  2ZVO B;  2PFX A;  3SWK A;  2A06 D;  2C9L Y;  2Y9Z A;  1DVH A;  1SQP J;  3EQ2 A;  2K9Y A;  3CD6 P;  3H1J D;  3NBT A;  1ETP A;  4PWA A;  4OWF A;  1Q2N A;  1M8O B;  2I8F A;  2YXR B;  2QJK C;  3B8E B;  1FJP A;  2WSE J;  2KS1 B;  2K1A A;  3LW5 H;  1YTZ T;  5CYT R;  2P58 A;  4JYB A;  2IBZ D;  2NPS A;  3S9O A;  1RF0 C;  3U1C A;  3CXH H;  4W7Z A;  4ZMD A;  4WY4 A;  1DIP A;  1IC2 A;  3E1I A;  4I7Z C;  1KV4 A;  1I6E A;  2FXM A;  4GOF A;  3OA8 B;  1F1F A;  1E2R A;  1MZ4 A;  2KSJ A;  4WBA A;  2BEZ F;  1L0N K;  2BH4 X;  1YFC A;  1CNO A;  2MJZ A;  1GU2 A;  1AOQ A;  2Q7C A;  3TGU J;  2Q9I A;  5C9M A;  3AE9 C;  2FYU G;  4XYD B;  1YBK A;  1N2D C;  4RSZ A;  1AFO A;  4Y99 B;  3WFB C;  1KIL B;  2GIW A;  2JWD A;  1G1I A;  2B4Z A;  5CCH C;  3NWV A;  2WPQ A;  2AI5 A;  4WVZ A;  3A2A A;  3BRT B;  2FFD A;  2DGE A;  1L0N G;  3V2R A;  4H44 B;  2WSC J;  1P84 E;  3VP9 A;  3CXH D;  1H33 B;  1KYO E;  4BRY B;  4UB6 V;  1QVF O;  1WVE C;  4EYY Q;  1L0L E;  1CRH A;  3NMD A;  5KAI H;  2YO2 A;  2C1D A;  2B87 B;  2KB7 P;  3NBS A;  2FKW B;  1CC5 A;  4KMG A;  3A5T A;  2A06 E;  1FS0 E;  1HH7 A;  1BGY D;  1MG2 D;  4IL6 V;  4UB8 V;  3H1J E;  4GKG A;  1L9B C;  1PPJ D;  3CCM P;  3H1L D;  1LJ2 A;  3HQ9 A;  1SQQ D;  3I56 P;  1OZH A;  1USD A;  3D6Y A;  1VDF A;  2D2C D;  2QJP B;  1JDL A;  4IL6 X;  4IL6 H;  2J58 A;  2XU6 A;  2AXT H;  2IBZ E;  5DJU B;  1DII C;  1H31 B;  2B0Z B;  1N8R Q;  2Q3E A;  1NNO A;  1AJY A;  1NU1 D;  2ZAE B;  1RF0 A;  3CX5 D;  2BEQ D;  3HUS C;  3ZOY A;  1LTS C;  3GW6 A;  1CTZ A;  1SQV K;  1HJ0 A;  2HR3 A;  2IDB A;  1K3H A;  5E79 V;  2KSE A;  1OW7 A;  2FYN B;  1M70 A;  3L71 D;  5B5E V;  1K05 A;  4PV1 C;  3AE5 C;  1NTK K;  4O1Q A;  3F5H A;  1FCD C;  2C0X A;  3GHG B;  1DT1 A;  2R32 A;  4Y99 C;  2P7J A;  2H89 C;  4PD4 I;  2C0W A;  5GTI E;  2BCC D;  1HJ4 A;  1OCD A;  5E79 H;  2OQQ A;  2N18 C;  3HQ7 A;  4LC1 A;  1N50 A;  3AE8 C;  1KTM A;  5AVQ B;  2OYH B;  4JYC A;  1ZXG A;  4H44 C;  3MK7 B;  5GTH H;  4IOI H;  1SFC D;  1JTH A;  2WMM A;  1BCC G;  5CCH A;  1EDK A;  4FA9 A;  3Q5R A;  3TSI A;  4GOD A;  3VRD A;  3CXH E;  1LTB C;  2AEJ A;  2ZBO A;  3L74 G;  3H1H J;  3W67 A;  1FI3 A;  4U3F D;  1NAF A;  1ZLL A;  1CHH A;  1QL3 A;  1RY3 A;  4XFJ A;  1RH5 B;  1SQP G;  2ZFC A;  3A3Y B;  3V5B A;  4Q5P A;  1CTJ A;  3WUV A;  3ORV A;  4AQR D;  1H0T B;  3CCQ P;  2RMZ A;  3H1I J;  3SLE A;  3HE4 B;  1HZU A;  3DMI A;  1URQ B;  3SSU A;  3H1L E;  1KMI Z;  1SQQ E;  5EXQ A;  3KXD A;  3A9F A;  2Y9Y A;  2KLV A;  5KTB A;  1AKK A;  1KB0 A;  1KB9 I;  1NHL A;  5AW0 B;  3JSV C;  3R4Y A;  2PCC B;  2N3Y A;  2ZOO A;  4HYT B;  1M1K Q;  1NU1 E;  1S1C X;  1OAE A;  3RK3 B;  1IJD B;  1BE3 J;  3TGU G;  2WTY A;  3CX5 E;  3H25 A;  1KQG B;  1GMJ A;  1HVV A;  5KAI E;  1L4A C;  1CSW A;  1QL2 A;  3CCE P;  1JY2 P;  3HUS A;  3L71 E;  2PRR A;  3DP5 A;  1WEJ F;  2MKV A;  3WUI A;  3M9Q A;  1KX7 A;  4D6T J;  1ZN5 A;  1VQ9 P;  1HWT C;  5C0Z A;  2BCC E;  3L4M A;  2V07 A;  1KC8 Q;  3L70 D;  1VF5 B;  1NVO A;  4HKZ H;  1IFI A;  5B66 V;  1H32 B;  1PZQ A;  2KOG A;  3T97 A;  2AXT E;  1FC2 C;  2R5B A;  5EFW B;  3JCU E;  1GKS A;  1K04 A;  3M06 A;  3G71 P;  4ZKP A;  2KK7 A;  3RL0 C;  2JP3 A;  2PAJ A;  4JBZ A;  4U3F E;  1KFN A;  1U75 B;  5KAF H;  3MUD C;  2HFE D;  4BWN A;  4ZKU A;  1HJ5 A;  3RK3 D;  2E42 A;  1T3U A;  3V4Q A;  1IRV A;  5TIS V;  3VP8 A;  2OZ1 B;  2OTJ P;  5K5G B;  1MFT A;  4XE5 B;  1YIC A;  5AVW B;  4YTP C;  4AAL A;  2NPS B;  5KLI C;  4GDO A;  1N9C A;  1YTC A;  5DJT B;  4OGQ C;  2Y0C A;  2UWJ E;  4DCK A;  1SLQ A;  3ZDM A;  1HRO A;  1JY3 N;  1URQ C;  3HD7 C;  1GU5 A;  1T6A A;  1K3G A;  1VQO P;  1PFI A;  1UII A;  4N3Y B;  3H1K D;  1VF5 D;  1VPC A;  3KZI V;  2KUB A;  1USE A;  4EDF A;  3L35 A;  2JTI B;  1C6R A;  3CP5 A;  3WFD C;  2WT7 B;  1RAQ A;  5CCG D;  3RN0 A;  3L73 D;  1CRY A;  1PIX A;  351C A;  3M0D C;  1LC2 A;  4AAN A;  1U74 B;  1A56 A;  2HPC B;  2M8R A;  3BCC J;  1KV9 A;  1M60 A;  1L4A A;  1KD1 Q;  2OTK E;  3MZW B;  1SVF A;  2B11 B;  1J3S A;  4HB1 A;  3H32 A;  1OW8 A;  1YJ9 P;  3L36 A;  1OIP A;  1KFM A;  2JO1 A;  1T2K D;  1E29 A;  1IO4 A;  1K9M Q;  2L91 A;  3TYI A;  3L70 E;  4DJG A;  1L0N J;  2C1D B;  1RQV A;  3H1H G;  1I5T A;  3G9R A;  3ZOX A;  1QVG O;  1P84 I;  3L72 G;  4PJ0 V;  1NMI A;  2Q3I A;  1B7V A;  1S5L H;  1YEA A;  2KI7 B;  3AED C;  1GK4 A;  5CMZ A;  1J2J B;  1D7M A;  1PP9 J;  3CCS P;  3D71 A;  1VQN P;  3MUD A;  1X9V A;  4AAO A;  1FZC A;  1SQB E;  1GJQ A;  2H8P D;  4YE1 A;  1EZV I;  2P10 A;  3HE5 A;  2XNX A;  2M0B A;  3TK1 A;  4WY4 C;  3EWK A;  2KIK A;  3CWB G;  4NPF X;  1N7S D;  2E43 A;  2OYO A;  5KLV D;  4EIE A;  3AE4 C;  2VHD A;  5APS A;  2C9N Y;  1EDJ A;  3JC2 2;  1KYO H;  5CJ0 A;  3H1K E;  3KDP B;  2W6A A;  1KQL A;  1T3J A;  1N86 A;  2IBZ I;  3AE3 C;  1NIR A;  1VQM P;  1FZE A;  1DW1 A;  2N1T A;  2LIR A;  451C A;  3CC4 P;  3A7O A;  3TGU D;  1U7J A;  3L73 E;  2PP6 A;  2V7Q J;  1N15 A;  2FFD C;  2CA4 B;  4D6T G;  3V2P A;  4AAM A;  1PV3 A;  1JB0 J;  1CW5 A;  3U1A A;  1JTH B;  3IFM A;  1MFZ A;  1JO5 A;  2IPP A;  5KKZ B;  5AVT B;  2M5A A;  2ZXY A;  1SQV J;  2K88 A;  2I8D A;  3O0R C;  1J1D C;  1K73 Q;  4C46 A;  1QEX A;  1IO3 A;  5GTI V;  2V4H A;  1NTK J;  2AEF A;  3L74 J;  4I6M C;  3CXH I;  1M56 D;  1NTZ G;  2HV4 A;  3TNU A;  2G3A A;  3L75 D;  1PGJ A;  1BSH A;  1RE3 A;  2YQB A;  2FWL A;  3B5N A;  5GTI H;  5CHX A;  2CK3 H;  2K9J A;  2GA1 A;  3KQG A;  3GF7 A;  1NKZ B;  3MGN A;  3G3Z A;  5CCH D;  2YMY A;  1GTW A;  2XKM A;  1OVV A;  4WQE A;  2NRG A;  5KLV E;  3MP7 B;  3CMA P;  5BU8 B;  1LTA C;  1NTM D;  2BPB B;  1OXZ A;  5APW A;  3HUS B;  3IR9 A;  2OYI A;  1RQU A;  4ASW A;  2ORL A;  5AW4 B;  3SFD C;  2ITA A;  5CBO A;  3BCC G;  1S5L E;  5CIB B;  4PV1 B;  3MHV A;  3I55 P;  3TGU E;  3SWY A;  1A2S A;  2IYP A;  3O8Z A;  3SXT A;  2W6J H;  2CE1 A;  2RKL A;  4N6J A;  1YIQ A;  2HYN A;  2QJY B;  3T97 B;  1CYJ A;  2C1V A;  5DF5 A;  1YQ4 C;  2M3B A;  2N18 B;  4OH8 B;  5KKZ C;  2OGU A;  3FXE A;  2ZT9 B;  1N73 C;  5KAI V;  1RZ6 A;  1W2L A;  1NO4 A;  2MTA C;  1M1J A;  4FA4 A;  4FAV A;  3R2P A;  5APT A;  4CPG A;  4N0K A;  2SPZ A;  1ZW0 A;  3PLN A;  1LNQ A;  3VOP A;  4AYC A;  4P4Q B;  4FA1 A;  3CX5 H;  1CIE A;  1CZQ A;  3QWO C;  2KZI A;  1SQB K;  3AEE C;  3D70 A;  2R44 A;  3HRN A;  2FXO A;  1OVU A;  3M0A A;  2E75 C;  1L9J C;  3L4F A;  1PP9 G;  2P1J A;  4EOT A;  1SQX K;  3BAS A;  2IZ1 A;  1FU1 A;  1GW3 A;  1FDO A;  5APY A;  2AXT V;  3L75 E;  3H1I D;  4QMA A;  3AEG C;  4O1W A;  1KIL D;  1J1E C;  3SWS A;  1YCC A;  2D0S A;  3BRV B;  1IK9 A;  4RO0 A;  4H44 D;  1SQX G;  3JCU H;  3TF5 A;  3CC7 P;  2ZJS E;  1S3J A;  1HGZ A;  1CSU A;  2KNC A;  2BH5 X;  4L3H A;  1VQP P;  4H0J A;  1EC5 A;  3KPE A;  2IFM A;  1NTM E;  5KJ7 A;  1GW4 A;  3ZOW A;  5APU A;  4WQA A;  1BE3 D;  2Q6Q A;  1L4A B;  5APX A;  3O1Y A;  3EFF K;  3VMA A;  2MHM A;  2O01 N;  3H32 B;  4MU8 A;  1HGV A;  2O1J A;  1X0T A;  4O9B A;  4GED B;  1U57 A;  5CID B;  1ZR4 A;  5GTH V;  4YXW H;  1ZV8 A;  1VQ6 P;  2QVA A;  5AVR B;  4GIF A;  1EXI A;  2QJY C;  3PH0 A;  2B88 A;  1OMI A;  2Y0E A;  2ZT9 C;  3D6Z A;  1FI7 A;  4H13 C;  1SQV G;  1S6V B;  1YTZ I;  3SVW A;  2KZJ A;  3RL0 B;  1NTK G;  1HBW A;  4AUW A;  1N73 A;  3CYT I;  3LW5 J;  1CI6 A;  2PAC A;  1T8Z A;  5AUR A;  3MD0 A;  3O6Q A;  1FZC B;  3L72 J;  3VN0 A;  1RHZ B;  1L4A D;  5KLI B;  2O01 H;  1CCR A;  1W5C T;  3OCD A;  2POH A;  4OGQ B;  1BGY E;  5KLV K;  5AW6 B;  1FJ0 A;  3H1I E;  3VYM A;  3KHU A;  3RK2 B;  3PHL A;  1PPJ E;  2H88 C;  2IX7 C;  1ZRT D;  2LXB A;  3HD7 B;  1KIL E;  1NAY A;  4PD4 H;  1VQK P;  3HTK A;  2QRX A;  1SS1 A;  1C2R A;  1LP1 A;  3NTN A;  2V08 A;  1WMK A;  1LT9 C;  1N90 A;  1VQ5 P;  1H1O A;  3CWB J;  4KT0 J;  4W7Y A;  2AIU A;  2WQY C;  1SP4 A;  1YIJ P;  1OFC X;  1AOF A;  2KLU A;  3RL0 D;  3RMZ A;  1FOS E;  3S4R A;  1WRG A;  1BE3 E;  1N7L A;  1KZU B;  1FOS F;  1LGH B;  2E76 C;  1H89 A;  3C1L A;  1Q86 Q;  1CIH A;  2LIT A;  1Y47 A;  2GC4 D;  3BCC D;  4NPD A;  2M5A B;  1X22 A;  2FYU D;  3M91 A;  4WQB A;  4L73 A;  5AW2 B;  3PXW A;  5AVU B;  4PD4 D;  1URQ D;  1M90 Q;  1L0L K;  3HD7 D;  3VYI A;  1QKS A;  3B4S A;  3VTP C;  3L71 J;  1DH3 A;  5KAF V;  4UB6 E;  1L0N D;  4QAO A;  1NML A;  3CXH W;  3AEA C;  4DT0 A;  4N78 D;  3TDK A;  3TNU B;  3AEF C;  3A0H H;  1S2E A;  1ZOY C;  2L4D A;  2W83 C;  2HOD A;  2N9J A;  2FRC A;  2K9J B;  1FZC C;  2Z4E A;  4UB8 E;  1MKM A;  3CCL P;  2WSS H;  3PRJ A;  1NTZ J;  1LWU C;  1PP9 D;  1LTG C;  1S9K D;  2FXP A;  1EZV G;  1A02 F;  2WSF H;  3RK2 C;  3H1J G;  4WY4 B;  1H33 A;  1BSN A;  4BRY A;  1ZRT E;  1NTM K;  1CXA A;  2XTS B;  1Q81 Q;  2OYI B;  1HTL C;  2N1T C;  2JDI H;  3PP5 A;  2IBZ G;  3HQ6 A;  2KXP B;  2BLF B;  1LT9 A;  3FXD A;  1COT A;  1X8Y A;  1CHJ A;  1KQS O;  1DEE G;  2BAS A;  4L76 A;  4GYD A;  1JOC A;  3ITK A;  1VQL P;  1JY3 O;  5L8R J;  1HH0 A;  2FFD B;  3OW2 O;  1M1J B;  1NKN A;  1SFC A;  2M3E A;  2LXC B;  2NPS D;  3BCC E;  2IZ0 A;  5BVZ A;  3RN1 A;  3DR0 A;  2WSE H;  4FB1 A;  1TU3 F;  2FYU E;  1DX7 A;  2N9Y B;  4WY4 D;  3O5C A;  5M1B A;  2AEM A;  4PD4 E;  2C2C A;  4WB4 A;  3L37 A;  1S5L V;  1HZV A;  1NWQ A;  4R4L A;  5H2F H;  3SFE C;  3HQ8 A;  1ZR2 A;  1L0N E;  4LJI A;  1J1D B;  1SQV D;  3WFE C;  1FZB A;  5CIE B;  4N78 E;  1BCC D;  1R8E A;  1NTK D;  3L70 J;  5C39 A;  3L74 D;  1RE3 C;  1KYO I;  3B5N C;  1S5L X;  1CSX A;  3AEB C;  3S1K A;  3RK3 E;  1SQQ K;  2YKQ A;  1SQP D;  3ZOO A;  4RKU J;  2WPV B;  2XND H;  3RBX A;  2Y0D A;  1FDI A;  3RL0 g;  1S9K E;  4OVN F;  2A45 H;  1H9X A;  1LWU A;  5CJ4 A;  1JCC A;  2KNC B;  3FGA D;  2N3B A;  4EID A;  1NU1 K;  2WSC H;  5IY5 1;  1YI2 P;  2H7H A;  1KN7 A;  1QGK B;  4DY9 A;  3H1L G;  2Q1K A;  4KHX A;  3P8M C;  1SQB J;  3WFC C;  1VYD A;  1MZ9 A;  2E74 B;  1SQQ G;  3GMA A;  1G2C A;  2OYI C;  1YYC A;  1SQX J;  1YNR A;  4L1Q A;  1YQ3 C;  1H0T A;  1GK6 A;  5AVY B;  3X39 A;  3P7K A;  155C A;  4L3G A;  4KJM A;  3LIE A;  3A0H E;  1CED A;  4JPZ B;  4V2K A;  1E79 H;  3H1K J;  1LTJ C;  1NU1 G;  3ZIY A;  1LTT C;  5AVX B;  4FAN A;  1H9Y A;  1CSB A;  2ZON G;  5AW1 B;  1KIB A;  5CIH B;  2KYV A;  3N4X A;  2ZXX A;  2L5G B;  3USS A;  4A7P A;  1S72 P;  3PXS A;  2QM8 A;  1M1J C;  2YKO A;  4H0K A;  2XDJ A;  3L71 G;  5B66 E;  1N73 B;  2W27 A;  2C9X B;  3WMM 0;  3ZBM A;  3A0B H;  2XZR A;  1CI6 B;  3SWF A;  3OJA B;  3G4S P;  2BCC G;  1XTC C;  1RF1 C;  2B12 B; 
#chains in the Genus database with same CATH homology
 1H31 A;  1CHI A;  1AKK A;  1KB0 A;  2AXT V;  3H1I D;  1CRG A;  3OCD B;  4EIF A;  2BGV X;  1CRJ A;  4O1W A;  3PTZ A;  1P84 D;  2PCC B;  1ZZH A;  1CTY A;  2N3Y A;  2ZOO A;  3SWS A;  5DJQ B;  3WC8 A;  1OAE A;  5CIC B;  1YCC A;  2D0S A;  4RJT A;  3TF5 A;  1CSW A;  1CSU A;  3GG2 A;  1CXC A;  2BH5 X;  1BL9 A;  4L3H A;  1C2N A;  1EZV D;  3DP5 A;  1R0Q A;  4H0J A;  1WEJ F;  3ZOW A;  1CO6 A;  3WUI A;  4WQA A;  1BE3 D;  3C2C A;  1KX7 A;  3O1Y A;  2QG4 A;  3VMA A;  5C0Z A;  2MHM A;  3L4M A;  4J20 A;  2ZZS 1;  2V07 A;  1GDV A;  1I8P A;  2JQR A;  3L70 D;  4MU8 A;  4WQD A;  1LFM A;  5B66 V;  2OZ1 A;  1H32 B;  2PCB B;  4GED B;  5CID B;  5GTH V;  1I8O A;  1EB7 A;  1CSV A;  1GKS A;  2RN0 A;  2QJK B;  4PW9 B;  4WQ7 A;  1F1C A;  1U75 B;  1CCH A;  2Y0E A;  1FI7 A;  1HJ5 A;  1CYI A;  1S6V B;  1E8E A;  3SVW A;  1IRV A;  5TIS V;  2OZ1 B;  1I55 A;  1GQ1 A;  1YIC A;  3WU2 V;  4AAL A;  3CYT I;  1C52 A;  1N9C A;  1YTC A;  2PAC A;  2Y0C A;  5AUR A;  2GC7 D;  4NFG B;  3RLM A;  1HRO A;  1DW2 A;  2YK3 A;  3A0B V;  1K3G A;  5KLI B;  1CCR A;  1W5C T;  3OCD A;  1QL4 A;  2C8S A;  3H1K D;  3H1H D;  3KZI V;  1IQC A;  5CIG B;  1CYC A;  5H2F V;  1QYZ A;  1FJ0 A;  3VYM A;  3KHU A;  1MG3 D;  3PHL A;  4EDF A;  1ZRT D;  3L72 D;  2JTI B;  1C6R A;  1C2R A;  3CP5 A;  3WFD C;  5DJQ C;  2V08 A;  3PH2 B;  1N90 A;  1RAQ A;  4AX3 A;  1C6O A;  3M97 X;  3RN0 A;  1H1O A;  5B6Q A;  3L73 D;  1CRY A;  4FA5 A;  1FHB A;  351C A;  2AIU A;  1LC2 A;  2CXB A;  4AAN A;  1U74 B;  1C7M A;  1A56 A;  1AOF A;  2N9I A;  1KV9 A;  3O20 A;  1KYO D;  1M60 A;  1CIF A;  3RMZ A;  1DIQ C;  1LMS A;  1L0L D;  2B11 B;  1J3S A;  1CIG A;  1DVV A;  1HCM A;  3CWB D;  3L4O A;  1HRC A;  1GIW A;  2BCN B;  1I6D A;  1H32 A;  1E29 A;  1CIH A;  2L91 A;  2EXV A;  3TYI A;  2LIT A;  1DW3 A;  2GC4 D;  3BCC D;  2C1D B;  2A06 D;  1DVH A;  1I5T A;  2YIU B;  2FYU D;  4Y5R A;  3H1J D;  3NBT A;  1ETP A;  4WQB A;  5CIF B;  3ZOX A;  4PWA A;  3PXW A;  2CA3 B;  4PD4 D;  2I8F A;  4PJ0 V;  1QKS A;  1NMI A;  1B7V A;  1DW0 A;  1YEA A;  5KAF V;  1A8C A;  1L0N D;  1RZ5 A;  5CYT R;  4QAO A;  2JWA A;  2GB8 B;  1NML A;  3CXH W;  2IBZ D;  3TDK A;  1IZL 0;  4D6T D;  4AAO A;  2L4D A;  1GJQ A;  2N9J A;  4YE1 A;  5DFS A;  2FRC A;  2K9J B;  1I6E A;  4WQ8 A;  3OA8 B;  1F1F A;  1E2R A;  3PRJ A;  1KYO W;  1MZ4 A;  2D0W A;  5KLV D;  4EIE A;  2VHD A;  1PP9 D;  3CU4 A;  4WQ9 A;  2BH4 X;  1YFC A;  1CNO A;  1GU2 A;  1AOQ A;  5C9M A;  4EIC A;  4XYD B;  1H33 A;  1NIR A;  4RSZ A;  3WFB C;  2CE0 A;  1DW1 A;  3FWL A;  1KX2 A;  2LIR A;  2GIW A;  1NTZ D;  451C A;  1CXA A;  2XTS B;  2B4Z A;  3NWV A;  2AI5 A;  2DGE A;  3TGU D;  1HJ3 A;  3VNW A;  3HQ6 A;  1N15 A;  2BLF B;  4K3I A;  2CA4 B;  3CXH D;  1H33 B;  1COT A;  4AAM A;  1CHJ A;  3JBT B;  4UB6 V;  1WVE C;  5KKZ B;  1CRH A;  4GYD A;  3ITK A;  1YEB A;  2C1D A;  2YCC A;  1CRC A;  3NBS A;  2ZXY A;  1RAP A;  1CC5 A;  4KMG A;  3RN1 A;  3DR0 A;  4FB1 A;  1HH7 A;  1BGY D;  1MG2 D;  3O0R C;  4IL6 V;  4UB8 V;  1IO3 A;  1IRW A;  3SJL A;  2N9Y B;  1L9B C;  3O5C A;  5GTI V;  1PPJ D;  3H1L D;  2KS1 A;  2C2C A;  3HQ9 A;  1SQQ D;  4WQC A;  1C75 A;  1S5L V;  1HZV A;  2B10 B;  2HV4 A;  2QJP B;  3HQ8 A;  1JDL A;  4JCG A;  2DVH A;  4LJI A;  3ZCF A;  1SQV D;  3L75 D;  4XXL A;  3WFE C;  2YQB A;  5CIE B;  2FWL A;  1BCC D;  1DII C;  3A0H V;  1H31 B;  2B0Z B;  1NTK D;  3L74 D;  2Q3E A;  1NNO A;  3OA8 A;  1NU1 D;  1CSX A;  1C6S A;  1SQP D;  3CX5 D;  3ZOO A;  3ZOY A;  3GW6 A;  4WQE A;  1CTZ A;  2Y0D A;  1COR A;  1K3H A;  5E79 V;  2FYN B;  1M70 A;  3L71 D;  5B5E V;  1H9X A;  1AYG A;  1NTM D;  4O1Q A;  1FCD C;  2BPB B;  3MK7 C;  1DT1 A;  2KNC B;  2N3B A;  4EID A;  5IY5 1;  2ORL A;  2C1U A;  1I54 A;  4DY9 A;  2BCC D;  1HJ4 A;  1VYD A;  3WFC C;  1OCD A;  2O3J A;  5TJH A;  1QN2 A;  2N18 C;  3HQ7 A;  1N50 A;  5CIB B;  1YNR A;  4L1Q A;  3MK7 B;  1A2S A;  3X39 A;  3SXT A;  2CE1 A;  155C A;  4L3G A;  4FA9 A;  1YIQ A;  3VRD A;  1CED A;  4V2K A;  2QJY B;  1CYJ A;  2ZBO A;  1SQB D;  1FI3 A;  4U3F D;  2C1V A;  5DF5 A;  2N18 B;  1FI9 A;  1CHH A;  1QL3 A;  3ZIY A;  5KAI V;  4FAN A;  1RZ6 A;  1KB9 D;  1W2L A;  1H9Y A;  1SQX D;  2MTA C;  2ZON G;  1KIB A;  4FA4 A;  5CIH B;  4FAV A;  1LC1 A;  4Q5P A;  4A7P A;  3PXS A;  1CTJ A;  1CRI A;  3ORV A;  4N0K A;  3CX5 W;  4H0K A;  3PXT A;  3PLN A;  2RMZ A;  1LS9 A;  4P4Q B;  3SLE A;  4FA1 A;  1CIE A;  2C9X B;  1HZU A;  3DMI A;  3ZBM A;  1L9J C;  1M6Z A;  5EXQ A;  1FOC A;  3A9F A;  2B12 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...