3H1JD

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 69
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1jD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1jD02
3MK7C 3DMIA 4FA5A 2Y0DA 1GJQA 3O5CA 3PTZA 1IZL0 3ZBMA 1I5TA 3H1HD 3M97X 3WC8A 1WVEC 4P4QB 4NFGB 4QAOA 3O1YA 1N90A 3H1LD 1A56A 3WFDC 5CICB 3HQ7A 4WQEA 1B7VA 3CXHW 1E2RA 1S5LV 1CHHA 4AALA 2JTIB 3H1KD 1BGYD 1CTYA 1R0QA 5CIEB 1IO3A 1FJ0A 1E8EA 2GB8B 2DVHA 4FA1A 3NWVA 1YEBA 2ZOOA 5TISV 1F1CA 2L4DA 4FANA 3X39A 1L9BC 3OA8A 3ZIYA 1CIHA 1NMIA 4FA9A 1HJ5A 5C9MA 3VYMA 1KIBA 1LC1A 3H1ID 2Q3EA 1N50A 1H33A 1H9XA 4WQ7A 1C7MA 3GW6A 1CSUA 1WEJF 1SQPD 2QG4A 1SQBD 5DF5A 4WQ9A 1CSVA 3WUIA 2B11B 2JWAA 2V07A 1KX2A 1L0LD 5CIDB 3VRDA 2N18B 1H32A 1I54A 1CXAA 1DW0A 3CU4A 2O3JA 2B10B 1OAEA 2CA3B 1KB9D 4H0KA 5B66V 1HJ3A 1QN2A 1RAQA 1CCHA 3CX5D 1LMSA 2ZBOA 2CXBA 2YCCA 4JCGA 2AI5A 1CIFA 1CHIA 2L91A 2PCBB 4RJTA 1I8PA 1DVVA 2OZ1B 2VHDA 3WFBC 3SXTA 4FA4A 1MG2D 1CIGA 1PP9D 1H33B 1NMLA 4PD4D 1YTCA 1N9CA 4FB1A 4IL6V 3ITKA 2ZONG 5EXQA 1L9JC 1GIWA 3PLNA 1NU1D 1C52A 1QL3A 1RZ5A 3H1JD 1LC2A 2KS1A 2MTAC 1CIEA 4AANA 2MHMA 1M70A 1NTKD 1FI7A 2DGEA 2YQBA 4AX3A 2A06D 2AIUA 1AYGA 1QKSA 1K3GA 4A7PA 1CORA 3ZOXA 5KKZB 4U3FD 3JBTB 1HZUA 2YK3A 3OA8B 4UB8V 1CRYA 1I8OA 1W2LA 1N15A 2C9XB 3NBSA 1YFCA 5CIBB 4EIDA 3L74D 3SWSA 2RN0A 1I55A 4D6TD 4RSZA 1A8CA 2CE1A 3NBTA 4L1QA 2LIRA 1CYJA 2QJYB 3O20A 1FCDC 4LJIA 2C1DA 3PRJA 2XTSB 3RN1A 1CTZA 3A9FA 5TJHA 2CE0A 2FYUD 2BCNB 1NTZD 1MG3D 2BGVX 4K3IA 1CSWA 3ORVA 1DIIC 3CX5W 3O0RC 2IBZD 1YNRA 1CCRA 4FAVA 1SQXD 2GC7D 3ZOOA 1U75B 1HJ4A 1E29A 1CC5A 1FI3A 3RLMA 3KZIV 2B0ZB 1LFMA 3VNWA 2C2CA 4GYDA 1ZRTD 2Y0CA 1EZVD 3WU2V 3PXWA 4WQ8A 2Y0EA 2LITA 3DR0A 5CYTR 3BCCD 1QYZA 4DY9A 2I8FA 1CRHA 4J20A 4V2KA 3HQ8A 4PW9B 1I6EA 1YCCA 5AURA 3CWBD 3TYIA 3WFEC 4WQBA 4XYDB 3SLEA 3TGUD 2ZXYA 1DW3A 4PJ0V 5CIHB 1J3SA 4EDFA 1HH7A 3ZOWA 1H1OA 1CTJA 1DW1A 2EXVA 1JDLA 2C1VA 3A0HV 2BCCD 3L72D 4Y5RA 5CIFB 2N9JA 4KMGA 1NTMD 1HRCA 4AAMA 5IY51 2N9IA 1A2SA 1C2RA 1HCMA 1CSXA 1KV9A 1H31B 3PXSA 5KLIB 5GTHV 5GTIV 1K3HA 1M60A 3CYTI 2N3BA 2FRCA 3GG2A 1S6VB 1IQCA 3C2CA 2ORLA 1CRJA 1QL4A 1CHJA 1H31A 4EICA 1C6OA 2FWLA 1AOQA 3ZOYA 1IRWA 1FOCA 1DT1A 3TF5A 1RZ6A 3A0BV 1P84D 2QJKB 1I6DA 1CNOA 2HV4A 5KLVD 3PXTA 1W5CT 2CA4B 1IRVA 1L0ND 3L73D 1H32B 1BE3D 3CXHD 1FHBA 1CRCA 1COTA 2D0WA 3WFCC 1CEDA 3KHUA 3L4MA 1HROA 1YEAA 1CYCA 2PACA 1RAPA 2BLFB 5KAFV 2B12B 3PHLA 4MU8A 2ZZS1 4WQDA 5C0ZA 2C1UA 5DFSA 5E79V 1U74B 3HQ6A 3SVWA 4GEDB 1EB7A 2K9JB 1HZVA 2N3YA 2OZ1A 1SQVD 4O1WA 1CRIA 351CA 5CIGB 1PPJD 3HQ9A 1CO6A 1SQQD 1CRGA 3TDKA 1H9YA 1GQ1A 3FWLA 1BL9A 2BH4X 2N18C 1AKKA 1DIQC 3L70D 4PWAA 1NIRA 1VYDA 1OCDA 1ZZHA 2RMZA 2C1DB 2YIUB 1YIQA 2QJPB 4WQAA 3PH2B 1CXCA 2D0SA 3ZCFA 1CYIA 4EIEA 3CP5A 3DP5A 1FI9A 3L4OA 1AOFA 4L3HA 4N0KA 1ETPA 2JQRA 4EIFA 3RN0A 1NNOA 451CA 2GC4D 2FYNB 5DJQB 1KYOW 4Q5PA 1MZ4A 4YE1A 3SJLA 1C75A 3L75D 5H2FV 1DVHA 3MK7B 4L3GA 3RMZA 1KX7A 1KYOD 1M6ZA 2BH5X 1GDVA 2B4ZA 4AAOA 2BPBB 1F1FA 1C6RA 1YICA 2AXTV 4O1QA 1GU2A 1BCCD 2GIWA 5KAIV 4WQCA 4H0JA 2V08A 3OCDA 1C2NA 3OCDB 2KNCB 2N9YB 1DW2A 2PCCB 1GKSA 1C6SA 5DJQC 155CA 4UB6V 3VMAA 4XXLA 3L71D 5B6QA 1KB0A 1LS9A 5B5EV 2C8SA
chains in the Genus database with same CATH superfamily
3MK7C 3DMIA 2E74D 3L36A 2Y0DA 2IBZE 3O5CA 2UWJE 1Y8AA 1KC8Q 3CLQA 5B5EH 1I5TA 3H1HD 3M97X 3WC8A 2FXPA 4P4QB 2Q7CA 1FZBA 1HBWA 1J1DC 1MFTA 1A56A 2M5AA 3CC2P 2B9BA 3BATA 2LR2A 5TISH 1CHHA 1FDMA 4MN4C 4YXWH 5APYA 2E75C 5AVTB 1KILE 1FU1A 5CIEB 1IO3A 3BCCG 3USSA 2ZOOA 1F1CA 3B5NB 4OGQC 1L0NE 3CC4P 3CWBE 2OARA 1VQMP 1HJ5A 1Y47A 3H1LG 4GT1A 1N7LA 1GD2E 1PIXA 1KYOI 4KT0J 1SQPD 2N1TA 2QG4A 1SQBD 4I7ZC 4OGQD 2WVRA 2NPSA 1AJYA 1SFCB 2B11B 2V07A 1KX2A 5CIDB 1RH5B 2K9JA 3RK3D 3BASA 4I1LA 1OAEA 2CA3B 1OVVA 3JCUE 1YYCA 1NU1J 1JNMA 1HJ3A 3CI9A 3CX5D 3CXHH 2Q3IA 4JBZA 2ZBOA 4JCGA 1QL2A 2AI5A 1CHIA 1HH0A 1BGYJ 4K3AA 1DD4A 1QLED 1GK6A 1W2BO 5APUA 3W68A 3L73G 2OZ1B 3HE5B 2VHDA 3WFBC 4H13B 1SQXG 2FYNC 2OTKE 1CIGA 3L73J 3H1HE 1YTCA 1W5CE 1IJDB 2B87A 3ITKA 2ZONG 1L9JC 1GIWA 3PLNA 2IYPA 1QL3A 1RF0C 5KTBA 3H1JD 3VTPC 4UB6E 2J5UA 2KS1A 1NTKD 1XTCC 1FI7A 3CCJP 4ASVA 1N7SA 2AIUA 1AYGA 1L0NK 2WSEJ 1HVVA 3H1IE 2QM7A 1QKSA 1K04A 1KB9E 4U3FD 3OA8B 1LWUA 1DD3A 1LTSC 1I8OA 1N15A 2C9XB 3NBSA 1RQVA 2G8YA 1YFCA 2KNCA 5CIBB 4OVNF 2YKOA 5KAIH 3L74D 2H7HA 1NTKK 3L70J 3Q3DA 2WMMA 2HFED 3P7KA 4L1QA 2LIRA 3L72G 2QJYB 3O20A 2D2CD 1BGYE 3NFQA 1E5WA 2OTJP 3A9FA 3CCLP 2KSJA 3KXDA 2C0XA 3E1RA 3O0RC 4HH2A 3KZIH 2IBZD 2I1KA 1CCRA 2YKQA 3H1KJ 1U75B 1X8YA 4NPEA 1CC5A 2WT7B 1NTKJ 1A02F 1FI3A 1ZMEC 3RLMA 3KZIV 2B0ZB 1FAVA 1URQB 3SSUA 3RL0B 3WU2V 1S3JA 4M3LA 1FJPA 1VQ9P 5KLVJ 1S4XA 5CYTR 2GUVA 1OIPA 1CRHA 1HGZA 2H8PD 1FZAA 3WU2E 3HQ8A 1OW7A 5DJUB 1SQVG 1YCCA 3OJAB 2IZ1A 3A0HH 3CWBD 1SQXJ 2BEZF 3WFEC 1NAFA 4XYDB 3SLEA 3TGUD 2BEQD 4PJ0E 1DW3A 5CIHB 2KZIA 4WY4A 4EDFA 2XNXA 1DW1A 1N73C 4UB6H 3A0HV 2OYHC 4OGQB 3B5NC 1SQQJ 5CIFB 1M7LA 2IBZI 3FGAD 4KMGA 4JQ0D 1N2DC 1KQSO 5GTHH 1J1DB 4AAMA 5IY51 1JM0A 1MFZA 3D6YA 4IFDK 1QL1A 1KD1Q 2OGUA 1S2EA 3MIWA 2YNYA 1H8AA 3PXSA 4U7JA 2YXQB 3IAOA 2YXRB 2QJYC 2N3BA 5C39A 1KILA 1PP9J 5KJ7D 2FRCA 3O6QA 3GG2A 3C8VA 4AQRD 1S6VB 1SP4A 2OYIA 4UB8E 1QL4A 2E5TA 1CHJA 3RK3B 3T97A 4HKZH 1SQBK 4H44C 1KQFB 4H0LB 3ZOYA 4KHXA 1IRWA 1N86A 1X9VA 2FBWC 3RK3C 1K73Q 1PPJG 5KLVD 3HD7D 1SLQA 2JO1A 4BRYA 2W27A 4H44B 1L0ND 2G3AA 1BE3D 3CX5H 3CXHD 1IK9A 1E79H 2D0WA 4PD4E 1PL5A 3A2AA 3TGUJ 4YPCA 2QVAA 1LTTC 2ZZS1 4N78D 2C1UA 1U74B 3HQ6A 1LTAC 3RK2B 1J2JB 1HZVA 2OZ1A 1SQVD 351CA 1KILC 1VQNP 1PPJD 2RKLA 1CO6A 3NMDA 1CRGA 2J58A 3H6PA 2IYOA 1ZLLA 1N73B 2GM4A 1NGMB 4XE5B 1OCDA 3JCUH 3FXEA 1KMIZ 4YTPC 2W90A 3Q1MA 1WRGA 2KK7A 5KAFE 2D0SA 1SFCC 1MV8A 1VF5D 3MGNA 3CP5A 2FYUJ 1HTLC 3RL0C 4ASWA 3AE4C 3L74J 1VQKP 1U57A 5DJQB 1KYOW 3V4QA 4Q5PA 1MZ4A 1KQGB 3BRTB 4B86A 4ZKPA 4L3GA 1NTMG 1HJ0A 3A5TA 1J1EC 1NAYA 1C6RA 1OZHA 4C7RA 3V6IA 1GU2A 1BCCD 4N78E 2ZT9C 5CJ0A 3B5NA 4L75A 2WSSH 2ZVOB 2LXCB 2N9YB 3HUSB 3IN6A 1SQQG 1HJBA 1USDA 4DCKA 155CA 4XXLA 1EZVE 2C8SA 4H13D 4FA5A 3Q5PA 1RE3A 2QA4P 5AW9B 4PV1D 2Z5IA 3TNUB 3C1LA 1IZL0 3ZBMA 3CXHE 5CBOA 3U1AA 4NFGB 4QAOA 1PFIA 3WFDC 1SQBE 3HQ7A 4WQEA 1B7VA 1E2RA 2IPPA 5AVYB 4DJGA 1PGJA 3H1KD 2QEXP 1VQLP 2HPCA 1FJ0A 2ZVNB 1FZCC 4FA1A 2R3CA 1K8AQ 3H1KG 4EOTA 2VRSA 4D6TE 5AVXB 3ZIYA 2WPRA 1NMIA 4FA9A 2OQQA 1GTWA 1FZFA 3VYMA 1WMKA 1LC1A 3AE9C 2Q3EA 3MHVA 1AQ5A 1C7MA 4H13C 5KLIC 5DF5A 4WQ9A 1JY2P 2IBZG 2AXTE 1SQBJ 3GHGC 5KJ7A 3U1CA 2JR8A 3L70E 1L0LD 1M57D 3VRDA 4H0LD 2O3JA 5AW3B 1YI2P 2FFDC 3M9HA 1KB9D 1GW3A 1SQQK 1KTMA 2ZT9B 1JMMA 2CXBA 1L4AB 1RF1B 1OXZA 2L91A 1VQOP 5AW7B 2KIKA 4C7NB 1L0NG 3CWBG 1LT9A 3ZDMA 1Y9BA 4L76A 5KJ7C 3SXTA 1GZLA 1MG2D 2KYVA 1PP9D 3A3YB 1NMLA 1M1JB 1RE4C 4RKUJ 5EXQA 3QWOC 3HTKB 1C52A 2P1JA 2ZYDA 2MTAC 1CIEA 2R3SA 2ZXXA 4L73A 1M70A 2DGEA 2YQBA 4IL6H 3A0BE 3MUDC 1P84I 3UIAA 1P84H 2IX7C 1RY3A 2A06D 2NRGA 5AVZB 1ZRTE 5APWA 1K3GA 1CORA 3BRVB 3JBTB 1NU1E 1W2LA 1USEA 2Q6QA 4U3FJ 3GF3A 4EIDA 2PFXA 4LLHA 1BE3E 2K1AA 3KDPB 3G6EP 2CE1A 2ZXEB 4GOEA 1N8RQ 1G2CA 2B89A 1FCDC 4LJIA 2H88C 2C1DA 3PRJA 2XTSB 5AW1B 1SQVJ 5TJHA 2QJPC 2LXBA 2CE0A 5M1BA 1MG3D 2BGVX 4K3IA 3EFGA 5B66E 2KP8A 1JY3N 1NVOA 1WT6A 1Q90D 1MZ9A 4C46A 1QGKB 4FAVA 1SQXD 1SQBG 3CWBJ 1KFNA 2AXCA 3U59A 4DOJA 1DEEG 3ZOOA 1HJ4A 4R4MA 2HR3A 3MUDA 1KILD 2OYHA 4H0LC 4OWFA 3H1IJ 3Q5SA 1SS1A 3V2NA 2C2CA 1LJ2A 1ZRTD 1EZVD 3MZWB 2A06E 2D2CC 1T3JA 2Y0EA 3DR0A 3SWFA 1LT1A 3BCCD 2I8FA 2GA1A 4PJ0H 1IO4A 3AEFC 1N73A 1KB9I 2A45I 4IFFA 2N1TD 1L4AC 4RO0A 4HJGH 4PJ0V 2XDJA 3K5BA 4W7YA 4KJMA 1J3SA 1KYOE 1BDDA 3PH0A 5K5GB 2Z4EA 3ZOWA 1PP9E 1H1OA 2EXVA 5KLVK 2FFDB 1HWTC 1HF9A 2BCCD 3L72D 4Y5RA 3C9IA 1JY3O 2XU6A 3Q5RA 1GL2C 4BXLA 3D71A 1HRCA 3L75G 1M56D 5AW4B 2AEFA 1A2SA 1CSXA 2KUBA 2W6JH 1H31B 4L74A 2DW3A 2BCCE 1N7SB 2J59M 4TT3H 5KLIB 5GTIV 1ZV8A 2WQYC 1K3HA 1L4AD 2R5DA 2P7JA 3G71P 1QEXA 3L37A 4PV1C 1UIIA 1GU4A 1LWUB 3JC22 4WVZA 1OW8A 3HUSA 1G1JA 1R5SA 2ORLA 3IR9A 1CRJA 1S9KE 1H31A 4EICA 3MD0A 4IFMA 5APQA 1AOQA 3AE3C 4GODA 5KAIE 2KB7P 3TF5A 3A0BV 2KZJA 1P84D 2ZT9D 1BGYG 1VDFA 2FYUG 2XV5A 2OYIC 1IRVA 3AEGC 3V2RA 1FHBA 3A0BH 1JO5A 3AEAC 2ZAEB 1CEDA 2KXPB 3G9RA 3KHUA 3L4MA 3RK2C 1K9MQ 2PACA 3V5BA 3M0DA 5KAFV 3PHLA 3L71E 5E79V 1LTJB 2L5GB 2QE7H 4GEDB 3L74G 3MP7B 4NPFX 3RBZA 4AYCA 1YTZI 3F5HA 5CIGB 5KAFH 2M3EA 3KZIE 1Q7YQ 5CCGD 5E79H 1H9YA 1GQ1A 2JKVA 3M0DC 1ZP0C 4NPDA 3H1LJ 2N18C 1DIQC 1IC2A 3L70D 5AW5B 5GTHE 1NIRA 1VYDA 3VN0A 2YIUB 3KQGA 1PPJE 2O01N 1YIQA 4QMAA 3I5CA 3ZCFA 2P58A 3DP5A 2WPQA 1FI9A 3N4XA 3L4OA 2C9LY 4L3HA 4N0KA 1ETPA 3RN0A 3A0HE 1QX8A 2FYNB 3QH9A 3SJLA 3L75D 3EWKA 1KX7A 5CMZA 3CPWO 1M6ZA 1GDVA 2B4ZA 4AAOA 3B4SA 1URQA 2BPBB 1ZW0A 4O1QA 3AE6C 5KAIV 1PV3A 1FOSE 1DX7A 1KILB 2CPBA 2ZFCA 2KNCB 3TSIA 1GL2A 4N6JA 2PRRA 4EI2A 3GHGB 1NTKE 3T97B 1VQ6P 3N7NA 1GJQA 1ZOYC 2M3BA 2WSCJ 3TNUA 3BCCE 4BRYB 1N90A 3H1LD 1IFIA 3ABVC 3TK1A 1KORA 1ZR4A 5CICB 2CPSA 1CZQA 1S5LV 2Y9ZA 2P67A 3AE7C 1BGYD 1NTME 2V7QJ 2IFNA 2W6AA 4GDOA 1YEBA 3AE1C 2L4DA 3CD6P 4Y99C 2Q5UA 4FANA 3OA8A 1CIHA 3FX0A 1LT9B 1CW5A 5CCGC 2YMYA 1KIBA 3H1ID 1H9XA 4WQ7A 1K05A 3GW6A 1YJNP 5CCHC 4U3FE 3RL0D 3GLMA 2JDIH 2POHA 3E7KA 1L0LG 1H89A 1RQUA 3AEBC 3L71G 2WSFJ 2K9YA 1GDTA 1CXAA 1DW0A 2K3RA 2O01H 5AVQB 3V2PA 3CU4A 2B10B 2NPSC 4H0KA 1U7JA 3L72J 1M1KQ 1CCHA 1LMSA 2O1KA 4EYYQ 1EDLA 2NZ2A 1S5LE 3M9BA 1CIFA 3WMM0 1S9KD 2OYOA 1M8OB 3HE4B 4IL6X 2YKPA 4JYBA 2HODA 4FA4A 1EC5A 1KQLA 1H33B 4PD4D 1ZN5A 1N9CA 3AE8C 2CK3H 4ZMDA 3B71A 4FB1A 1KFMA 4IL6V 1OW6A 1YBKA 3HTKA 1EZVG 2E74C 3RGUA 2E76C 1SQVK 1RZ5A 1LC2A 1NH4A 1SQXE 1JUNA 2HODB 3L70G 1GK4A 1KB9H 1FBMA 2A45H 4A7PA 1PGPA 3ZOXA 5H2FH 3A7OA 1HZUA 4WWIA 2LKMA 3SFEC 4GIFA 2GUSA 1HGVA 2HPCB 1I55A 4UB8H 2E76D 4I7ZB 3NBTA 4D6TJ 2Q1KA 2A45G 2H89C 4R4LA 1LP1B 4D6TG 2YIUC 3R4YA 3V4WA 1T2KC 3RN1A 1CTZA 3G4SP 3P8CE 1NTZD 3ORVA 2WPSA 1DH3A 2XKMA 1DIIC 3Q2YA 3D6ZA 3B8EB 5KKZC 2M0BA 3LW5H 2GC7D 2C9NY 3M9QA 3VYIA 4N3YB 2MKVA 1E29A 1OWAA 1S5LX 3E1IA 2R5BA 1LTJA 3P32A 3II6A 3VNWA 5CCGA 2Y0CA 1NU1G 4PD4H 3VMZA 4WQ8A 2LITA 3CCMP 1NHLA 1QYZA 3H32A 1SFCD 4J20A 4V2KA 3CC7P 4PW9B 1I6EA 1GMJA 1LT9C 3KPEA 5AURA 1AQTA 4W80A 1RF1A 3TYIA 1AFOA 1KN7A 3SWYA 1H0TB 1HH7A 1CTJA 1MUUA 2ZYGA 4JYCA 1JDLA 2C1VA 5CJ4A 5TISE 1YITP 1NU1K 1L2PA 1J1EB 1SQVE 1H88A 4I2LC 1NTMD 3VMXA 5GTIH 3TGUG 2N9IA 1C2RA 1HCMA 3JSVC 3L71J 1LWUC 2WITA 1L0LJ 1M60A 1S5LH 3CYTI 2A06G 1VQPP 1AVYA 3VP8A 5B5EE 4JPZB 4HB1A 2R44A 3RK3E 1L4AA 3C2CA 1JMBA 5AVRB 3FXDA 4WY4C 1NTMK 4Y28J 1VL2A 5AW6B 4EIJA 2E75B 2Y9YA 1FOCA 1DT1A 1RZ6A 3CL3D 2WSCH 1YIJP 1PP9G 1I6DA 3G3ZA 1RE3C 1CNOA 1NJIQ 1W5CT 1YQ4C 5APSA 1BCCJ 1IFDA 3AEDC 3EQ2A 1X22A 5APVA 3WFCC 2QRXA 1FZEA 1G1IA 1YEAA 1PGOA 2BLFB 2B12B 4MU8A 1M90Q 3HD7C 4WQDA 2BASA 5DFSA 3IFMA 3SVWA 3CCUP 1LP1A 1X0TA 1OVRA 4O1WA 3HRNA 1FZCB 1YTZT 3PJSK 1BCCE 1SQQD 3TDKA 3FWLA 3OW2O 2H43A 3AE2C 1S72P 3CMAP 3S9OA 1AKKA 1NTMJ 2Q9IA 1GW4A 1JEKA 1LTGC 1IK7A 4PWAA 2V7QH 2NPSB 1ZZHA 1LTJC 2RMZA 5KLVE 2C1DB 1JCDA 5E79E 5CCHD 1JTHB 2FYUE 2QJPB 3NTNA 4YXDC 3PH2B 2YO3A 2IFMA 1CYIA 1NKZB 4EIEA 1Q81Q 1AOFA 2JQRA 4EIFA 5L8RJ 2FY8A 3L75E 3CXHI 3H32B 4HYTB 2AXTH 2XNDH 2OYIB 3L75J 1SQQE 4O9BA 1C75A 5H2FV 1DVHA 1EDKA 3RMZA 1KYOD 1SVFA 2BH5X 4XFJA 5CBNA 1A02J 2E5YA 3WUUA 4CPGA 1F1FA 2JEEA 2AXTV 3CCQP 1SQXK 2GIWA 1EXJA 4WQCA 2ITAA 2V08A 3OCDA 1VQ8P 1T2KD 2PCCB 1GKSA 2I1JA 2IDBA 1C6SA 2O1JA 5DJQC 2B87B 4UB6V 3VMAA 2WTYA 1OMIA 5B6QA 1KB0A 1LS9A 3OA7A 1AV1A 2KS1B 5CHXA 3AE5C 2WWWA 3VOPA 1FDOA 3PTZA 2Z5HA 1NWQA 2WSFH 3H1IG 5AW2B 5APXA 5DJTB 1WVEC 1FJKA 2P10A 2JWDA 2BCCJ 3O1YA 1N7SC 3CCVP 2JJLA 3VMYA 1FZCA 1IFJA 2QJKC 2HYNA 3KYQA 3CXHW 2W6BA 1IFPA 3L4FA 1BSNA 4AALA 2JTIB 1NTZJ 3CCEP 1OX3A 1CTYA 4WB4A 1R0QA 1L0LK 1E8EA 2GB8B 2DVHA 4H44D 3NWVA 5TISV 2WSEH 3L72E 1BDCA 3L73E 3X39A 1L9BC 2QIWA 4IOIH 1OVUA 4TLFA 5AVUB 1LGHB 1JTHA 5C9MA 4XA4A 3H1HG 2E76B 1N50A 1H33A 3CX5I 2ZYAA 3PP5A 3AECC 2QSIA 1CSUA 1WEJF 1NTZE 3AEEC 3RK2D 1CSVA 2KLUA 3LW5J 3WUIA 2K37A 2JWAA 1SFCA 3LIDA 3RBXA 3SWKA 5AVWB 2N18B 1H32A 1I54A 5CCHA 2FXOA 1Q2NA 5B66V 1QN2A 1RAQA 4W7ZA 1BCCG 1IFNA 4WBAA 3CCRP 2YCCA 2ZJSE 1IFMA 1YQ3C 1EZVI 1UIXA 3HE4A 2PCBB 1VF5B 5B66H 1H0TA 4RJTA 1I8PA 1DVVA 1PGQA 3D0WA 3R2PA 5KLVG 3CCSP 1L0NJ 1BE3J 3BCCJ 2HLOA 3BVHA 3GHGA 3H1JJ 1NTKG 1NU1D 1SQPK 2OTLP 2YMKA 4AANA 1P84E 1L0LE 2MHMA 2W83C 1KYOH 2B88A 4AX3A 3GF7A 2R32A 2FFDA 3P8CD 1G2CB 2NPSD 5BU8B 5KKZB 2YK3A 5B5EV 4UB8V 1CRYA 1LTBC 2XZRA 4Z1MH 3B5ND 1YHQP 1FC2C 5AVSB 4PV1B 5BU5A 3SWSA 3LIEA 1SQPG 2RN0A 1T6AA 4D6TD 4RSZA 1VQ5P 1A8CA 3EFFK 1CYJA 4K35A 1Q82Q 1QVGO 1PZQA 3H1JG 3CMEP 1GL2B 4OH8B 2FYUD 1BE3G 3O8ZA 2BCNB 2E75D 1CSWA 1RF1C 2FYZA 4WY4D 3CX5W 4U3FG 1RF0A 1YNRA 4LGDE 1MKMA 2HG5D 4I6MC 5BVZA 1YJWP 1D7MA 2I8DA 4ZNCA 2WT7A 1LFMA 1FE6A 4C7NA 1HUCA 1JY2N 3H1HJ 3H25A 1T3UA 2WZ7A 4GYDA 3WUTA 3PXWA 2YO2A 1AVOA 2E74B 3I56P 2V4HA 1VPCA 1QVFO 4DY9A 3D70A 1VF5C 2E43A 2JP3A 1NYHA 3WUVA 2KSEA 1X79B 2K88A 1W2EA 3NXSA 4WQBA 1YJ9P 1NTZG 2ZXYA 3FWNA 4IL6E 2BCCG 2MJZA 1JY3P 4GKGA 1EQ7A 1OFCX 4LC1A 1NKNA 1GU5A 1S1CX 2N9JA 3HD7A 4GOFA 1NO4A 1RHZB 3V2QA 1KV9A 1BSHA 2PAJA 5GTHV 2FYUK 2C0WA 1JCCA 2KLVA 2W8ZA 1EDIA 1VQ7P 1T8ZA 3GMAA 1IQCA 3S1KA 1FDIA 1C6OA 2FWLA 1FOSF 4PD4I 2FKWB 2PGDA 4Y99B 3HE5A 3HUSC 4DZOA 1DIPA 2QJKB 5AW0B 1AA0A 2HV4A 3H1LE 3PXTA 2OYHB 2CA4B 4RESB 2SPZA 3L73D 3OAKA 1LTIC 1H32B 3L74E 3L35A 2PP6A 1CRCA 1Z56A 3MTUE 1COTA 1R5LA 1URQD 3IF4A 1VQ4P 1HROA 1CYCA 1RAPA 1JOCA 1M1JC 5EFWB 2WPVB 3M06A 1SQPE 1NTZK 1FS0E 3VP9A 5C0ZA 4DT0A 3I55P 1EB7A 3O6QB 2K9JB 2N3YA 4JF7A 1CRIA 1URQC 3F89A 2FXMA 3HQ9A 3H1JE 1U7MA 1EXIA 1XTGB 1M1JA 5APTA 1BL9A 2BH4X 2KI7B 1GL2D 1KV4A 2E42A 5GTIE 1FZGA 2M8RA 5AVVB 4WY4B 4AUWA 3M0AA 2RH0A 1IZNB 1ZR2A 4WQAA 1LNQA 1CXCA 3SFDC 3CX5E 4ZKUA 1RE4A 3S4RA 2N1TB 1NNOA 451CA 2GC4D 3TGUE 1CSBA 5H2FE 2D2CB 3TYYA 4YE1A 3WU2H 1ZXGA 2AEMA 1KZUB 3MK7B 1CI6B 2P2UA 2KOGA 3H1KE 1YICA 1Q86Q 2N9BA 1R8EA 1JY2O 1NOHA 3P8MC 4H0JA 4BWNA 1C2NA 2QM8A 2O01J 3OCDB 5AW8B 3W67A 1DEBA 1DW2A 1EDJA 2IZ0A 2AEJA 3M91A 1SQPJ 3HD7B 1TU3F 1JB0J 1N7SD 3L71D 2M5AB 3RL0g 2N1TC 1CI6A
chains in the Genus database with same CATH topology
3MK7C 3DMIA 4FA5A 2Y0DA 1GJQA 3O5CA 3PTZA 1IZL0 3ZBMA 1I5TA 3H1HD 3M97X 3WC8A 1WVEC 4P4QB 4NFGB 4QAOA 3O1YA 1N90A 3H1LD 1A56A 3WFDC 5CICB 3HQ7A 4WQEA 1B7VA 3CXHW 1E2RA 1S5LV 1CHHA 4AALA 2JTIB 3H1KD 1BGYD 1CTYA 1R0QA 5CIEB 1IO3A 1FJ0A 1E8EA 2GB8B 2DVHA 4FA1A 3NWVA 1YEBA 2ZOOA 5TISV 1F1CA 2L4DA 4FANA 3X39A 1L9BC 3OA8A 3ZIYA 1CIHA 1NMIA 4FA9A 1HJ5A 5C9MA 3VYMA 1KIBA 1LC1A 3H1ID 2Q3EA 1N50A 1H33A 1H9XA 4WQ7A 1C7MA 3GW6A 1CSUA 1WEJF 1SQPD 2QG4A 1SQBD 5DF5A 4WQ9A 1CSVA 3WUIA 2B11B 2JWAA 2V07A 1KX2A 1L0LD 5CIDB 3VRDA 2N18B 1H32A 1I54A 1CXAA 1DW0A 3CU4A 2O3JA 2B10B 1OAEA 2CA3B 1KB9D 4H0KA 5B66V 1HJ3A 1QN2A 1RAQA 1CCHA 3CX5D 1LMSA 2ZBOA 2CXBA 2YCCA 4JCGA 2AI5A 1CIFA 1CHIA 2L91A 2PCBB 4RJTA 1I8PA 1DVVA 2OZ1B 2VHDA 3WFBC 3SXTA 4FA4A 1MG2D 1CIGA 1PP9D 1H33B 1NMLA 4PD4D 1YTCA 1N9CA 4FB1A 4IL6V 3ITKA 2ZONG 5EXQA 1L9JC 1GIWA 3PLNA 1NU1D 1C52A 1QL3A 1RZ5A 3H1JD 1LC2A 2KS1A 2MTAC 1CIEA 4AANA 2MHMA 1M70A 1NTKD 1FI7A 2DGEA 2YQBA 4AX3A 2A06D 2AIUA 1AYGA 1QKSA 1K3GA 4A7PA 1CORA 3ZOXA 5KKZB 4U3FD 3JBTB 1HZUA 2YK3A 3OA8B 4UB8V 1CRYA 1I8OA 1W2LA 1N15A 2C9XB 3NBSA 1YFCA 5CIBB 4EIDA 3L74D 3SWSA 2RN0A 1I55A 4D6TD 4RSZA 1A8CA 2CE1A 3NBTA 4L1QA 2LIRA 1CYJA 2QJYB 3O20A 1FCDC 4LJIA 2C1DA 3PRJA 2XTSB 3RN1A 1CTZA 3A9FA 5TJHA 2CE0A 2FYUD 2BCNB 1NTZD 1MG3D 2BGVX 4K3IA 1CSWA 3ORVA 1DIIC 3CX5W 3O0RC 2IBZD 1YNRA 1CCRA 4FAVA 1SQXD 2GC7D 3ZOOA 1U75B 1HJ4A 1E29A 1CC5A 1FI3A 3RLMA 3KZIV 2B0ZB 1LFMA 3VNWA 2C2CA 4GYDA 1ZRTD 2Y0CA 1EZVD 3WU2V 3PXWA 4WQ8A 2Y0EA 2LITA 3DR0A 5CYTR 3BCCD 1QYZA 4DY9A 2I8FA 1CRHA 4J20A 4V2KA 3HQ8A 4PW9B 1I6EA 1YCCA 5AURA 3CWBD 3TYIA 3WFEC 4WQBA 4XYDB 3SLEA 3TGUD 2ZXYA 1DW3A 4PJ0V 5CIHB 1J3SA 4EDFA 1HH7A 3ZOWA 1H1OA 1CTJA 1DW1A 2EXVA 1JDLA 2C1VA 3A0HV 2BCCD 3L72D 4Y5RA 5CIFB 2N9JA 4KMGA 1NTMD 1HRCA 4AAMA 5IY51 2N9IA 1A2SA 1C2RA 1HCMA 1CSXA 1KV9A 1H31B 3PXSA 5KLIB 5GTHV 5GTIV 1K3HA 1M60A 3CYTI 2N3BA 2FRCA 3GG2A 1S6VB 1IQCA 3C2CA 2ORLA 1CRJA 1QL4A 1CHJA 1H31A 4EICA 1C6OA 2FWLA 1AOQA 3ZOYA 1IRWA 1FOCA 1DT1A 3TF5A 1RZ6A 3A0BV 1P84D 2QJKB 1I6DA 1CNOA 2HV4A 5KLVD 3PXTA 1W5CT 2CA4B 1IRVA 1L0ND 3L73D 1H32B 1BE3D 3CXHD 1FHBA 1CRCA 1COTA 2D0WA 3WFCC 1CEDA 3KHUA 3L4MA 1HROA 1YEAA 1CYCA 2PACA 1RAPA 2BLFB 5KAFV 2B12B 3PHLA 4MU8A 2ZZS1 4WQDA 5C0ZA 2C1UA 5DFSA 5E79V 1U74B 3HQ6A 3SVWA 4GEDB 1EB7A 2K9JB 1HZVA 2N3YA 2OZ1A 1SQVD 4O1WA 1CRIA 351CA 5CIGB 1PPJD 3HQ9A 1CO6A 1SQQD 1CRGA 3TDKA 1H9YA 1GQ1A 3FWLA 1BL9A 2BH4X 2N18C 1AKKA 1DIQC 3L70D 4PWAA 1NIRA 1VYDA 1OCDA 1ZZHA 2RMZA 2C1DB 2YIUB 1YIQA 2QJPB 4WQAA 3PH2B 1CXCA 2D0SA 3ZCFA 1CYIA 4EIEA 3CP5A 3DP5A 1FI9A 3L4OA 1AOFA 4L3HA 4N0KA 1ETPA 2JQRA 4EIFA 3RN0A 1NNOA 451CA 2GC4D 2FYNB 5DJQB 1KYOW 4Q5PA 1MZ4A 4YE1A 3SJLA 1C75A 3L75D 5H2FV 1DVHA 3MK7B 4L3GA 3RMZA 1KX7A 1KYOD 1M6ZA 2BH5X 1GDVA 2B4ZA 4AAOA 2BPBB 1F1FA 1C6RA 1YICA 2AXTV 4O1QA 1GU2A 1BCCD 2GIWA 5KAIV 4WQCA 4H0JA 2V08A 3OCDA 1C2NA 3OCDB 2KNCB 2N9YB 1DW2A 2PCCB 1GKSA 1C6SA 5DJQC 155CA 4UB6V 3VMAA 4XXLA 3L71D 5B6QA 1KB0A 1LS9A 5B5EV 2C8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MK7 C;  3DMI A;  4FA5 A;  2Y0D A;  1GJQ A;  3O5C A;  3PTZ A;  1IZL 0;  3ZBM A;  1I5T A;  3H1H D;  3M97 X;  3WC8 A;  1WVE C;  4P4Q B;  4NFG B;  4QAO A;  3O1Y A;  1N90 A;  3H1L D;  1A56 A;  3WFD C;  5CIC B;  3HQ7 A;  4WQE A;  1B7V A;  3CXH W;  1E2R A;  1S5L V;  1CHH A;  4AAL A;  2JTI B;  3H1K D;  1BGY D;  1CTY A;  1R0Q A;  5CIE B;  1IO3 A;  1FJ0 A;  1E8E A;  2GB8 B;  2DVH A;  4FA1 A;  3NWV A;  1YEB A;  2ZOO A;  5TIS V;  1F1C A;  2L4D A;  4FAN A;  3X39 A;  1L9B C;  3OA8 A;  3ZIY A;  1CIH A;  1NMI A;  4FA9 A;  1HJ5 A;  5C9M A;  3VYM A;  1KIB A;  1LC1 A;  3H1I D;  2Q3E A;  1N50 A;  1H33 A;  1H9X A;  4WQ7 A;  1C7M A;  3GW6 A;  1CSU A;  1WEJ F;  1SQP D;  2QG4 A;  1SQB D;  5DF5 A;  4WQ9 A;  1CSV A;  3WUI A;  2B11 B;  2JWA A;  2V07 A;  1KX2 A;  1L0L D;  5CID B;  3VRD A;  2N18 B;  1H32 A;  1I54 A;  1CXA A;  1DW0 A;  3CU4 A;  2O3J A;  2B10 B;  1OAE A;  2CA3 B;  1KB9 D;  4H0K A;  5B66 V;  1HJ3 A;  1QN2 A;  1RAQ A;  1CCH A;  3CX5 D;  1LMS A;  2ZBO A;  2CXB A;  2YCC A;  4JCG A;  2AI5 A;  1CIF A;  1CHI A;  2L91 A;  2PCB B;  4RJT A;  1I8P A;  1DVV A;  2OZ1 B;  2VHD A;  3WFB C;  3SXT A;  4FA4 A;  1MG2 D;  1CIG A;  1PP9 D;  1H33 B;  1NML A;  4PD4 D;  1YTC A;  1N9C A;  4FB1 A;  4IL6 V;  3ITK A;  2ZON G;  5EXQ A;  1L9J C;  1GIW A;  3PLN A;  1NU1 D;  1C52 A;  1QL3 A;  1RZ5 A;  3H1J D;  1LC2 A;  2KS1 A;  2MTA C;  1CIE A;  4AAN A;  2MHM A;  1M70 A;  1NTK D;  1FI7 A;  2DGE A;  2YQB A;  4AX3 A;  2A06 D;  2AIU A;  1AYG A;  1QKS A;  1K3G A;  4A7P A;  1COR A;  3ZOX A;  5KKZ B;  4U3F D;  3JBT B;  1HZU A;  2YK3 A;  3OA8 B;  4UB8 V;  1CRY A;  1I8O A;  1W2L A;  1N15 A;  2C9X B;  3NBS A;  1YFC A;  5CIB B;  4EID A;  3L74 D;  3SWS A;  2RN0 A;  1I55 A;  4D6T D;  4RSZ A;  1A8C A;  2CE1 A;  3NBT A;  4L1Q A;  2LIR A;  1CYJ A;  2QJY B;  3O20 A;  1FCD C;  4LJI A;  2C1D A;  3PRJ A;  2XTS B;  3RN1 A;  1CTZ A;  3A9F A;  5TJH A;  2CE0 A;  2FYU D;  2BCN B;  1NTZ D;  1MG3 D;  2BGV X;  4K3I A;  1CSW A;  3ORV A;  1DII C;  3CX5 W;  3O0R C;  2IBZ D;  1YNR A;  1CCR A;  4FAV A;  1SQX D;  2GC7 D;  3ZOO A;  1U75 B;  1HJ4 A;  1E29 A;  1CC5 A;  1FI3 A;  3RLM A;  3KZI V;  2B0Z B;  1LFM A;  3VNW A;  2C2C A;  4GYD A;  1ZRT D;  2Y0C A;  1EZV D;  3WU2 V;  3PXW A;  4WQ8 A;  2Y0E A;  2LIT A;  3DR0 A;  5CYT R;  3BCC D;  1QYZ A;  4DY9 A;  2I8F A;  1CRH A;  4J20 A;  4V2K A;  3HQ8 A;  4PW9 B;  1I6E A;  1YCC A;  5AUR A;  3CWB D;  3TYI A;  3WFE C;  4WQB A;  4XYD B;  3SLE A;  3TGU D;  2ZXY A;  1DW3 A;  4PJ0 V;  5CIH B;  1J3S A;  4EDF A;  1HH7 A;  3ZOW A;  1H1O A;  1CTJ A;  1DW1 A;  2EXV A;  1JDL A;  2C1V A;  3A0H V;  2BCC D;  3L72 D;  4Y5R A;  5CIF B;  2N9J A;  4KMG A;  1NTM D;  1HRC A;  4AAM A;  5IY5 1;  2N9I A;  1A2S A;  1C2R A;  1HCM A;  1CSX A;  1KV9 A;  1H31 B;  3PXS A;  5KLI B;  5GTH V;  5GTI V;  1K3H A;  1M60 A;  3CYT I;  2N3B A;  2FRC A;  3GG2 A;  1S6V B;  1IQC A;  3C2C A;  2ORL A;  1CRJ A;  1QL4 A;  1CHJ A;  1H31 A;  4EIC A;  1C6O A;  2FWL A;  1AOQ A;  3ZOY A;  1IRW A;  1FOC A;  1DT1 A;  3TF5 A;  1RZ6 A;  3A0B V;  1P84 D;  2QJK B;  1I6D A;  1CNO A;  2HV4 A;  5KLV D;  3PXT A;  1W5C T;  2CA4 B;  1IRV A;  1L0N D;  3L73 D;  1H32 B;  1BE3 D;  3CXH D;  1FHB A;  1CRC A;  1COT A;  2D0W A;  3WFC C;  1CED A;  3KHU A;  3L4M A;  1HRO A;  1YEA A;  1CYC A;  2PAC A;  1RAP A;  2BLF B;  5KAF V;  2B12 B;  3PHL A;  4MU8 A;  2ZZS 1;  4WQD A;  5C0Z A;  2C1U A;  5DFS A;  5E79 V;  1U74 B;  3HQ6 A;  3SVW A;  4GED B;  1EB7 A;  2K9J B;  1HZV A;  2N3Y A;  2OZ1 A;  1SQV D;  4O1W A;  1CRI A;  351C A;  5CIG B;  1PPJ D;  3HQ9 A;  1CO6 A;  1SQQ D;  1CRG A;  3TDK A;  1H9Y A;  1GQ1 A;  3FWL A;  1BL9 A;  2BH4 X;  2N18 C;  1AKK A;  1DIQ C;  3L70 D;  4PWA A;  1NIR A;  1VYD A;  1OCD A;  1ZZH A;  2RMZ A;  2C1D B;  2YIU B;  1YIQ A;  2QJP B;  4WQA A;  3PH2 B;  1CXC A;  2D0S A;  3ZCF A;  1CYI A;  4EIE A;  3CP5 A;  3DP5 A;  1FI9 A;  3L4O A;  1AOF A;  4L3H A;  4N0K A;  1ETP A;  2JQR A;  4EIF A;  3RN0 A;  1NNO A;  451C A;  2GC4 D;  2FYN B;  5DJQ B;  1KYO W;  4Q5P A;  1MZ4 A;  4YE1 A;  3SJL A;  1C75 A;  3L75 D;  5H2F V;  1DVH A;  3MK7 B;  4L3G A;  3RMZ A;  1KX7 A;  1KYO D;  1M6Z A;  2BH5 X;  1GDV A;  2B4Z A;  4AAO A;  2BPB B;  1F1F A;  1C6R A;  1YIC A;  2AXT V;  4O1Q A;  1GU2 A;  1BCC D;  2GIW A;  5KAI V;  4WQC A;  4H0J A;  2V08 A;  3OCD A;  1C2N A;  3OCD B;  2KNC B;  2N9Y B;  1DW2 A;  2PCC B;  1GKS A;  1C6S A;  5DJQ C;  155C A;  4UB6 V;  3VMA A;  4XXL A;  3L71 D;  5B6Q A;  1KB0 A;  1LS9 A;  5B5E V;  2C8S A; 
#chains in the Genus database with same CATH topology
 3MK7 C;  3DMI A;  2E74 D;  3L36 A;  2Y0D A;  2IBZ E;  3O5C A;  2UWJ E;  1Y8A A;  1KC8 Q;  3CLQ A;  5B5E H;  1I5T A;  3H1H D;  3M97 X;  3WC8 A;  2FXP A;  4P4Q B;  2Q7C A;  1FZB A;  1HBW A;  1J1D C;  1MFT A;  1A56 A;  2M5A A;  3CC2 P;  2B9B A;  3BAT A;  2LR2 A;  5TIS H;  1CHH A;  1FDM A;  4MN4 C;  4YXW H;  5APY A;  2E75 C;  5AVT B;  1KIL E;  1FU1 A;  5CIE B;  1IO3 A;  3BCC G;  3USS A;  2ZOO A;  1F1C A;  3B5N B;  4OGQ C;  1L0N E;  3CC4 P;  3CWB E;  2OAR A;  1VQM P;  1HJ5 A;  1Y47 A;  3H1L G;  4GT1 A;  1N7L A;  1GD2 E;  1PIX A;  1KYO I;  4KT0 J;  1SQP D;  2N1T A;  2QG4 A;  1SQB D;  4I7Z C;  4OGQ D;  2WVR A;  2NPS A;  1AJY A;  1SFC B;  2B11 B;  2V07 A;  1KX2 A;  5CID B;  1RH5 B;  2K9J A;  3RK3 D;  3BAS A;  4I1L A;  1OAE A;  2CA3 B;  1OVV A;  3JCU E;  1YYC A;  1NU1 J;  1JNM A;  1HJ3 A;  3CI9 A;  3CX5 D;  3CXH H;  2Q3I A;  4JBZ A;  2ZBO A;  4JCG A;  1QL2 A;  2AI5 A;  1CHI A;  1HH0 A;  1BGY J;  4K3A A;  1DD4 A;  1QLE D;  1GK6 A;  1W2B O;  5APU A;  3W68 A;  3L73 G;  2OZ1 B;  3HE5 B;  2VHD A;  3WFB C;  4H13 B;  1SQX G;  2FYN C;  2OTK E;  1CIG A;  3L73 J;  3H1H E;  1YTC A;  1W5C E;  1IJD B;  2B87 A;  3ITK A;  2ZON G;  1L9J C;  1GIW A;  3PLN A;  2IYP A;  1QL3 A;  1RF0 C;  5KTB A;  3H1J D;  3VTP C;  4UB6 E;  2J5U A;  2KS1 A;  1NTK D;  1XTC C;  1FI7 A;  3CCJ P;  4ASV A;  1N7S A;  2AIU A;  1AYG A;  1L0N K;  2WSE J;  1HVV A;  3H1I E;  2QM7 A;  1QKS A;  1K04 A;  1KB9 E;  4U3F D;  3OA8 B;  1LWU A;  1DD3 A;  1LTS C;  1I8O A;  1N15 A;  2C9X B;  3NBS A;  1RQV A;  2G8Y A;  1YFC A;  2KNC A;  5CIB B;  4OVN F;  2YKO A;  5KAI H;  3L74 D;  2H7H A;  1NTK K;  3L70 J;  3Q3D A;  2WMM A;  2HFE D;  3P7K A;  4L1Q A;  2LIR A;  3L72 G;  2QJY B;  3O20 A;  2D2C D;  1BGY E;  3NFQ A;  1E5W A;  2OTJ P;  3A9F A;  3CCL P;  2KSJ A;  3KXD A;  2C0X A;  3E1R A;  3O0R C;  4HH2 A;  3KZI H;  2IBZ D;  2I1K A;  1CCR A;  2YKQ A;  3H1K J;  1U75 B;  1X8Y A;  4NPE A;  1CC5 A;  2WT7 B;  1NTK J;  1A02 F;  1FI3 A;  1ZME C;  3RLM A;  3KZI V;  2B0Z B;  1FAV A;  1URQ B;  3SSU A;  3RL0 B;  3WU2 V;  1S3J A;  4M3L A;  1FJP A;  1VQ9 P;  5KLV J;  1S4X A;  5CYT R;  2GUV A;  1OIP A;  1CRH A;  1HGZ A;  2H8P D;  1FZA A;  3WU2 E;  3HQ8 A;  1OW7 A;  5DJU B;  1SQV G;  1YCC A;  3OJA B;  2IZ1 A;  3A0H H;  3CWB D;  1SQX J;  2BEZ F;  3WFE C;  1NAF A;  4XYD B;  3SLE A;  3TGU D;  2BEQ D;  4PJ0 E;  1DW3 A;  5CIH B;  2KZI A;  4WY4 A;  4EDF A;  2XNX A;  1DW1 A;  1N73 C;  4UB6 H;  3A0H V;  2OYH C;  4OGQ B;  3B5N C;  1SQQ J;  5CIF B;  1M7L A;  2IBZ I;  3FGA D;  4KMG A;  4JQ0 D;  1N2D C;  1KQS O;  5GTH H;  1J1D B;  4AAM A;  5IY5 1;  1JM0 A;  1MFZ A;  3D6Y A;  4IFD K;  1QL1 A;  1KD1 Q;  2OGU A;  1S2E A;  3MIW A;  2YNY A;  1H8A A;  3PXS A;  4U7J A;  2YXQ B;  3IAO A;  2YXR B;  2QJY C;  2N3B A;  5C39 A;  1KIL A;  1PP9 J;  5KJ7 D;  2FRC A;  3O6Q A;  3GG2 A;  3C8V A;  4AQR D;  1S6V B;  1SP4 A;  2OYI A;  4UB8 E;  1QL4 A;  2E5T A;  1CHJ A;  3RK3 B;  3T97 A;  4HKZ H;  1SQB K;  4H44 C;  1KQF B;  4H0L B;  3ZOY A;  4KHX A;  1IRW A;  1N86 A;  1X9V A;  2FBW C;  3RK3 C;  1K73 Q;  1PPJ G;  5KLV D;  3HD7 D;  1SLQ A;  2JO1 A;  4BRY A;  2W27 A;  4H44 B;  1L0N D;  2G3A A;  1BE3 D;  3CX5 H;  3CXH D;  1IK9 A;  1E79 H;  2D0W A;  4PD4 E;  1PL5 A;  3A2A A;  3TGU J;  4YPC A;  2QVA A;  1LTT C;  2ZZS 1;  4N78 D;  2C1U A;  1U74 B;  3HQ6 A;  1LTA C;  3RK2 B;  1J2J B;  1HZV A;  2OZ1 A;  1SQV D;  351C A;  1KIL C;  1VQN P;  1PPJ D;  2RKL A;  1CO6 A;  3NMD A;  1CRG A;  2J58 A;  3H6P A;  2IYO A;  1ZLL A;  1N73 B;  2GM4 A;  1NGM B;  4XE5 B;  1OCD A;  3JCU H;  3FXE A;  1KMI Z;  4YTP C;  2W90 A;  3Q1M A;  1WRG A;  2KK7 A;  5KAF E;  2D0S A;  1SFC C;  1MV8 A;  1VF5 D;  3MGN A;  3CP5 A;  2FYU J;  1HTL C;  3RL0 C;  4ASW A;  3AE4 C;  3L74 J;  1VQK P;  1U57 A;  5DJQ B;  1KYO W;  3V4Q A;  4Q5P A;  1MZ4 A;  1KQG B;  3BRT B;  4B86 A;  4ZKP A;  4L3G A;  1NTM G;  1HJ0 A;  3A5T A;  1J1E C;  1NAY A;  1C6R A;  1OZH A;  4C7R A;  3V6I A;  1GU2 A;  1BCC D;  4N78 E;  2ZT9 C;  5CJ0 A;  3B5N A;  4L75 A;  2WSS H;  2ZVO B;  2LXC B;  2N9Y B;  3HUS B;  3IN6 A;  1SQQ G;  1HJB A;  1USD A;  4DCK A;  155C A;  4XXL A;  1EZV E;  2C8S A;  4H13 D;  4FA5 A;  3Q5P A;  1RE3 A;  2QA4 P;  5AW9 B;  4PV1 D;  2Z5I A;  3TNU B;  3C1L A;  1IZL 0;  3ZBM A;  3CXH E;  5CBO A;  3U1A A;  4NFG B;  4QAO A;  1PFI A;  3WFD C;  1SQB E;  3HQ7 A;  4WQE A;  1B7V A;  1E2R A;  2IPP A;  5AVY B;  4DJG A;  1PGJ A;  3H1K D;  2QEX P;  1VQL P;  2HPC A;  1FJ0 A;  2ZVN B;  1FZC C;  4FA1 A;  2R3C A;  1K8A Q;  3H1K G;  4EOT A;  2VRS A;  4D6T E;  5AVX B;  3ZIY A;  2WPR A;  1NMI A;  4FA9 A;  2OQQ A;  1GTW A;  1FZF A;  3VYM A;  1WMK A;  1LC1 A;  3AE9 C;  2Q3E A;  3MHV A;  1AQ5 A;  1C7M A;  4H13 C;  5KLI C;  5DF5 A;  4WQ9 A;  1JY2 P;  2IBZ G;  2AXT E;  1SQB J;  3GHG C;  5KJ7 A;  3U1C A;  2JR8 A;  3L70 E;  1L0L D;  1M57 D;  3VRD A;  4H0L D;  2O3J A;  5AW3 B;  1YI2 P;  2FFD C;  3M9H A;  1KB9 D;  1GW3 A;  1SQQ K;  1KTM A;  2ZT9 B;  1JMM A;  2CXB A;  1L4A B;  1RF1 B;  1OXZ A;  2L91 A;  1VQO P;  5AW7 B;  2KIK A;  4C7N B;  1L0N G;  3CWB G;  1LT9 A;  3ZDM A;  1Y9B A;  4L76 A;  5KJ7 C;  3SXT A;  1GZL A;  1MG2 D;  2KYV A;  1PP9 D;  3A3Y B;  1NML A;  1M1J B;  1RE4 C;  4RKU J;  5EXQ A;  3QWO C;  3HTK B;  1C52 A;  2P1J A;  2ZYD A;  2MTA C;  1CIE A;  2R3S A;  2ZXX A;  4L73 A;  1M70 A;  2DGE A;  2YQB A;  4IL6 H;  3A0B E;  3MUD C;  1P84 I;  3UIA A;  1P84 H;  2IX7 C;  1RY3 A;  2A06 D;  2NRG A;  5AVZ B;  1ZRT E;  5APW A;  1K3G A;  1COR A;  3BRV B;  3JBT B;  1NU1 E;  1W2L A;  1USE A;  2Q6Q A;  4U3F J;  3GF3 A;  4EID A;  2PFX A;  4LLH A;  1BE3 E;  2K1A A;  3KDP B;  3G6E P;  2CE1 A;  2ZXE B;  4GOE A;  1N8R Q;  1G2C A;  2B89 A;  1FCD C;  4LJI A;  2H88 C;  2C1D A;  3PRJ A;  2XTS B;  5AW1 B;  1SQV J;  5TJH A;  2QJP C;  2LXB A;  2CE0 A;  5M1B A;  1MG3 D;  2BGV X;  4K3I A;  3EFG A;  5B66 E;  2KP8 A;  1JY3 N;  1NVO A;  1WT6 A;  1Q90 D;  1MZ9 A;  4C46 A;  1QGK B;  4FAV A;  1SQX D;  1SQB G;  3CWB J;  1KFN A;  2AXC A;  3U59 A;  4DOJ A;  1DEE G;  3ZOO A;  1HJ4 A;  4R4M A;  2HR3 A;  3MUD A;  1KIL D;  2OYH A;  4H0L C;  4OWF A;  3H1I J;  3Q5S A;  1SS1 A;  3V2N A;  2C2C A;  1LJ2 A;  1ZRT D;  1EZV D;  3MZW B;  2A06 E;  2D2C C;  1T3J A;  2Y0E A;  3DR0 A;  3SWF A;  1LT1 A;  3BCC D;  2I8F A;  2GA1 A;  4PJ0 H;  1IO4 A;  3AEF C;  1N73 A;  1KB9 I;  2A45 I;  4IFF A;  2N1T D;  1L4A C;  4RO0 A;  4HJG H;  4PJ0 V;  2XDJ A;  3K5B A;  4W7Y A;  4KJM A;  1J3S A;  1KYO E;  1BDD A;  3PH0 A;  5K5G B;  2Z4E A;  3ZOW A;  1PP9 E;  1H1O A;  2EXV A;  5KLV K;  2FFD B;  1HWT C;  1HF9 A;  2BCC D;  3L72 D;  4Y5R A;  3C9I A;  1JY3 O;  2XU6 A;  3Q5R A;  1GL2 C;  4BXL A;  3D71 A;  1HRC A;  3L75 G;  1M56 D;  5AW4 B;  2AEF A;  1A2S A;  1CSX A;  2KUB A;  2W6J H;  1H31 B;  4L74 A;  2DW3 A;  2BCC E;  1N7S B;  2J59 M;  4TT3 H;  5KLI B;  5GTI V;  1ZV8 A;  2WQY C;  1K3H A;  1L4A D;  2R5D A;  2P7J A;  3G71 P;  1QEX A;  3L37 A;  4PV1 C;  1UII A;  1GU4 A;  1LWU B;  3JC2 2;  4WVZ A;  1OW8 A;  3HUS A;  1G1J A;  1R5S A;  2ORL A;  3IR9 A;  1CRJ A;  1S9K E;  1H31 A;  4EIC A;  3MD0 A;  4IFM A;  5APQ A;  1AOQ A;  3AE3 C;  4GOD A;  5KAI E;  2KB7 P;  3TF5 A;  3A0B V;  2KZJ A;  1P84 D;  2ZT9 D;  1BGY G;  1VDF A;  2FYU G;  2XV5 A;  2OYI C;  1IRV A;  3AEG C;  3V2R A;  1FHB A;  3A0B H;  1JO5 A;  3AEA C;  2ZAE B;  1CED A;  2KXP B;  3G9R A;  3KHU A;  3L4M A;  3RK2 C;  1K9M Q;  2PAC A;  3V5B A;  3M0D A;  5KAF V;  3PHL A;  3L71 E;  5E79 V;  1LTJ B;  2L5G B;  2QE7 H;  4GED B;  3L74 G;  3MP7 B;  4NPF X;  3RBZ A;  4AYC A;  1YTZ I;  3F5H A;  5CIG B;  5KAF H;  2M3E A;  3KZI E;  1Q7Y Q;  5CCG D;  5E79 H;  1H9Y A;  1GQ1 A;  2JKV A;  3M0D C;  1ZP0 C;  4NPD A;  3H1L J;  2N18 C;  1DIQ C;  1IC2 A;  3L70 D;  5AW5 B;  5GTH E;  1NIR A;  1VYD A;  3VN0 A;  2YIU B;  3KQG A;  1PPJ E;  2O01 N;  1YIQ A;  4QMA A;  3I5C A;  3ZCF A;  2P58 A;  3DP5 A;  2WPQ A;  1FI9 A;  3N4X A;  3L4O A;  2C9L Y;  4L3H A;  4N0K A;  1ETP A;  3RN0 A;  3A0H E;  1QX8 A;  2FYN B;  3QH9 A;  3SJL A;  3L75 D;  3EWK A;  1KX7 A;  5CMZ A;  3CPW O;  1M6Z A;  1GDV A;  2B4Z A;  4AAO A;  3B4S A;  1URQ A;  2BPB B;  1ZW0 A;  4O1Q A;  3AE6 C;  5KAI V;  1PV3 A;  1FOS E;  1DX7 A;  1KIL B;  2CPB A;  2ZFC A;  2KNC B;  3TSI A;  1GL2 A;  4N6J A;  2PRR A;  4EI2 A;  3GHG B;  1NTK E;  3T97 B;  1VQ6 P;  3N7N A;  1GJQ A;  1ZOY C;  2M3B A;  2WSC J;  3TNU A;  3BCC E;  4BRY B;  1N90 A;  3H1L D;  1IFI A;  3ABV C;  3TK1 A;  1KOR A;  1ZR4 A;  5CIC B;  2CPS A;  1CZQ A;  1S5L V;  2Y9Z A;  2P67 A;  3AE7 C;  1BGY D;  1NTM E;  2V7Q J;  2IFN A;  2W6A A;  4GDO A;  1YEB A;  3AE1 C;  2L4D A;  3CD6 P;  4Y99 C;  2Q5U A;  4FAN A;  3OA8 A;  1CIH A;  3FX0 A;  1LT9 B;  1CW5 A;  5CCG C;  2YMY A;  1KIB A;  3H1I D;  1H9X A;  4WQ7 A;  1K05 A;  3GW6 A;  1YJN P;  5CCH C;  4U3F E;  3RL0 D;  3GLM A;  2JDI H;  2POH A;  3E7K A;  1L0L G;  1H89 A;  1RQU A;  3AEB C;  3L71 G;  2WSF J;  2K9Y A;  1GDT A;  1CXA A;  1DW0 A;  2K3R A;  2O01 H;  5AVQ B;  3V2P A;  3CU4 A;  2B10 B;  2NPS C;  4H0K A;  1U7J A;  3L72 J;  1M1K Q;  1CCH A;  1LMS A;  2O1K A;  4EYY Q;  1EDL A;  2NZ2 A;  1S5L E;  3M9B A;  1CIF A;  3WMM 0;  1S9K D;  2OYO A;  1M8O B;  3HE4 B;  4IL6 X;  2YKP A;  4JYB A;  2HOD A;  4FA4 A;  1EC5 A;  1KQL A;  1H33 B;  4PD4 D;  1ZN5 A;  1N9C A;  3AE8 C;  2CK3 H;  4ZMD A;  3B71 A;  4FB1 A;  1KFM A;  4IL6 V;  1OW6 A;  1YBK A;  3HTK A;  1EZV G;  2E74 C;  3RGU A;  2E76 C;  1SQV K;  1RZ5 A;  1LC2 A;  1NH4 A;  1SQX E;  1JUN A;  2HOD B;  3L70 G;  1GK4 A;  1KB9 H;  1FBM A;  2A45 H;  4A7P A;  1PGP A;  3ZOX A;  5H2F H;  3A7O A;  1HZU A;  4WWI A;  2LKM A;  3SFE C;  4GIF A;  2GUS A;  1HGV A;  2HPC B;  1I55 A;  4UB8 H;  2E76 D;  4I7Z B;  3NBT A;  4D6T J;  2Q1K A;  2A45 G;  2H89 C;  4R4L A;  1LP1 B;  4D6T G;  2YIU C;  3R4Y A;  3V4W A;  1T2K C;  3RN1 A;  1CTZ A;  3G4S P;  3P8C E;  1NTZ D;  3ORV A;  2WPS A;  1DH3 A;  2XKM A;  1DII C;  3Q2Y A;  3D6Z A;  3B8E B;  5KKZ C;  2M0B A;  3LW5 H;  2GC7 D;  2C9N Y;  3M9Q A;  3VYI A;  4N3Y B;  2MKV A;  1E29 A;  1OWA A;  1S5L X;  3E1I A;  2R5B A;  1LTJ A;  3P32 A;  3II6 A;  3VNW A;  5CCG A;  2Y0C A;  1NU1 G;  4PD4 H;  3VMZ A;  4WQ8 A;  2LIT A;  3CCM P;  1NHL A;  1QYZ A;  3H32 A;  1SFC D;  4J20 A;  4V2K A;  3CC7 P;  4PW9 B;  1I6E A;  1GMJ A;  1LT9 C;  3KPE A;  5AUR A;  1AQT A;  4W80 A;  1RF1 A;  3TYI A;  1AFO A;  1KN7 A;  3SWY A;  1H0T B;  1HH7 A;  1CTJ A;  1MUU A;  2ZYG A;  4JYC A;  1JDL A;  2C1V A;  5CJ4 A;  5TIS E;  1YIT P;  1NU1 K;  1L2P A;  1J1E B;  1SQV E;  1H88 A;  4I2L C;  1NTM D;  3VMX A;  5GTI H;  3TGU G;  2N9I A;  1C2R A;  1HCM A;  3JSV C;  3L71 J;  1LWU C;  2WIT A;  1L0L J;  1M60 A;  1S5L H;  3CYT I;  2A06 G;  1VQP P;  1AVY A;  3VP8 A;  5B5E E;  4JPZ B;  4HB1 A;  2R44 A;  3RK3 E;  1L4A A;  3C2C A;  1JMB A;  5AVR B;  3FXD A;  4WY4 C;  1NTM K;  4Y28 J;  1VL2 A;  5AW6 B;  4EIJ A;  2E75 B;  2Y9Y A;  1FOC A;  1DT1 A;  1RZ6 A;  3CL3 D;  2WSC H;  1YIJ P;  1PP9 G;  1I6D A;  3G3Z A;  1RE3 C;  1CNO A;  1NJI Q;  1W5C T;  1YQ4 C;  5APS A;  1BCC J;  1IFD A;  3AED C;  3EQ2 A;  1X22 A;  5APV A;  3WFC C;  2QRX A;  1FZE A;  1G1I A;  1YEA A;  1PGO A;  2BLF B;  2B12 B;  4MU8 A;  1M90 Q;  3HD7 C;  4WQD A;  2BAS A;  5DFS A;  3IFM A;  3SVW A;  3CCU P;  1LP1 A;  1X0T A;  1OVR A;  4O1W A;  3HRN A;  1FZC B;  1YTZ T;  3PJS K;  1BCC E;  1SQQ D;  3TDK A;  3FWL A;  3OW2 O;  2H43 A;  3AE2 C;  1S72 P;  3CMA P;  3S9O A;  1AKK A;  1NTM J;  2Q9I A;  1GW4 A;  1JEK A;  1LTG C;  1IK7 A;  4PWA A;  2V7Q H;  2NPS B;  1ZZH A;  1LTJ C;  2RMZ A;  5KLV E;  2C1D B;  1JCD A;  5E79 E;  5CCH D;  1JTH B;  2FYU E;  2QJP B;  3NTN A;  4YXD C;  3PH2 B;  2YO3 A;  2IFM A;  1CYI A;  1NKZ B;  4EIE A;  1Q81 Q;  1AOF A;  2JQR A;  4EIF A;  5L8R J;  2FY8 A;  3L75 E;  3CXH I;  3H32 B;  4HYT B;  2AXT H;  2XND H;  2OYI B;  3L75 J;  1SQQ E;  4O9B A;  1C75 A;  5H2F V;  1DVH A;  1EDK A;  3RMZ A;  1KYO D;  1SVF A;  2BH5 X;  4XFJ A;  5CBN A;  1A02 J;  2E5Y A;  3WUU A;  4CPG A;  1F1F A;  2JEE A;  2AXT V;  3CCQ P;  1SQX K;  2GIW A;  1EXJ A;  4WQC A;  2ITA A;  2V08 A;  3OCD A;  1VQ8 P;  1T2K D;  2PCC B;  1GKS A;  2I1J A;  2IDB A;  1C6S A;  2O1J A;  5DJQ C;  2B87 B;  4UB6 V;  3VMA A;  2WTY A;  1OMI A;  5B6Q A;  1KB0 A;  1LS9 A;  3OA7 A;  1AV1 A;  2KS1 B;  5CHX A;  3AE5 C;  2WWW A;  3VOP A;  1FDO A;  3PTZ A;  2Z5H A;  1NWQ A;  2WSF H;  3H1I G;  5AW2 B;  5APX A;  5DJT B;  1WVE C;  1FJK A;  2P10 A;  2JWD A;  2BCC J;  3O1Y A;  1N7S C;  3CCV P;  2JJL A;  3VMY A;  1FZC A;  1IFJ A;  2QJK C;  2HYN A;  3KYQ A;  3CXH W;  2W6B A;  1IFP A;  3L4F A;  1BSN A;  4AAL A;  2JTI B;  1NTZ J;  3CCE P;  1OX3 A;  1CTY A;  4WB4 A;  1R0Q A;  1L0L K;  1E8E A;  2GB8 B;  2DVH A;  4H44 D;  3NWV A;  5TIS V;  2WSE H;  3L72 E;  1BDC A;  3L73 E;  3X39 A;  1L9B C;  2QIW A;  4IOI H;  1OVU A;  4TLF A;  5AVU B;  1LGH B;  1JTH A;  5C9M A;  4XA4 A;  3H1H G;  2E76 B;  1N50 A;  1H33 A;  3CX5 I;  2ZYA A;  3PP5 A;  3AEC C;  2QSI A;  1CSU A;  1WEJ F;  1NTZ E;  3AEE C;  3RK2 D;  1CSV A;  2KLU A;  3LW5 J;  3WUI A;  2K37 A;  2JWA A;  1SFC A;  3LID A;  3RBX A;  3SWK A;  5AVW B;  2N18 B;  1H32 A;  1I54 A;  5CCH A;  2FXO A;  1Q2N A;  5B66 V;  1QN2 A;  1RAQ A;  4W7Z A;  1BCC G;  1IFN A;  4WBA A;  3CCR P;  2YCC A;  2ZJS E;  1IFM A;  1YQ3 C;  1EZV I;  1UIX A;  3HE4 A;  2PCB B;  1VF5 B;  5B66 H;  1H0T A;  4RJT A;  1I8P A;  1DVV A;  1PGQ A;  3D0W A;  3R2P A;  5KLV G;  3CCS P;  1L0N J;  1BE3 J;  3BCC J;  2HLO A;  3BVH A;  3GHG A;  3H1J J;  1NTK G;  1NU1 D;  1SQP K;  2OTL P;  2YMK A;  4AAN A;  1P84 E;  1L0L E;  2MHM A;  2W83 C;  1KYO H;  2B88 A;  4AX3 A;  3GF7 A;  2R32 A;  2FFD A;  3P8C D;  1G2C B;  2NPS D;  5BU8 B;  5KKZ B;  2YK3 A;  5B5E V;  4UB8 V;  1CRY A;  1LTB C;  2XZR A;  4Z1M H;  3B5N D;  1YHQ P;  1FC2 C;  5AVS B;  4PV1 B;  5BU5 A;  3SWS A;  3LIE A;  1SQP G;  2RN0 A;  1T6A A;  4D6T D;  4RSZ A;  1VQ5 P;  1A8C A;  3EFF K;  1CYJ A;  4K35 A;  1Q82 Q;  1QVG O;  1PZQ A;  3H1J G;  3CME P;  1GL2 B;  4OH8 B;  2FYU D;  1BE3 G;  3O8Z A;  2BCN B;  2E75 D;  1CSW A;  1RF1 C;  2FYZ A;  4WY4 D;  3CX5 W;  4U3F G;  1RF0 A;  1YNR A;  4LGD E;  1MKM A;  2HG5 D;  4I6M C;  5BVZ A;  1YJW P;  1D7M A;  2I8D A;  4ZNC A;  2WT7 A;  1LFM A;  1FE6 A;  4C7N A;  1HUC A;  1JY2 N;  3H1H J;  3H25 A;  1T3U A;  2WZ7 A;  4GYD A;  3WUT A;  3PXW A;  2YO2 A;  1AVO A;  2E74 B;  3I56 P;  2V4H A;  1VPC A;  1QVF O;  4DY9 A;  3D70 A;  1VF5 C;  2E43 A;  2JP3 A;  1NYH A;  3WUV A;  2KSE A;  1X79 B;  2K88 A;  1W2E A;  3NXS A;  4WQB A;  1YJ9 P;  1NTZ G;  2ZXY A;  3FWN A;  4IL6 E;  2BCC G;  2MJZ A;  1JY3 P;  4GKG A;  1EQ7 A;  1OFC X;  4LC1 A;  1NKN A;  1GU5 A;  1S1C X;  2N9J A;  3HD7 A;  4GOF A;  1NO4 A;  1RHZ B;  3V2Q A;  1KV9 A;  1BSH A;  2PAJ A;  5GTH V;  2FYU K;  2C0W A;  1JCC A;  2KLV A;  2W8Z A;  1EDI A;  1VQ7 P;  1T8Z A;  3GMA A;  1IQC A;  3S1K A;  1FDI A;  1C6O A;  2FWL A;  1FOS F;  4PD4 I;  2FKW B;  2PGD A;  4Y99 B;  3HE5 A;  3HUS C;  4DZO A;  1DIP A;  2QJK B;  5AW0 B;  1AA0 A;  2HV4 A;  3H1L E;  3PXT A;  2OYH B;  2CA4 B;  4RES B;  2SPZ A;  3L73 D;  3OAK A;  1LTI C;  1H32 B;  3L74 E;  3L35 A;  2PP6 A;  1CRC A;  1Z56 A;  3MTU E;  1COT A;  1R5L A;  1URQ D;  3IF4 A;  1VQ4 P;  1HRO A;  1CYC A;  1RAP A;  1JOC A;  1M1J C;  5EFW B;  2WPV B;  3M06 A;  1SQP E;  1NTZ K;  1FS0 E;  3VP9 A;  5C0Z A;  4DT0 A;  3I55 P;  1EB7 A;  3O6Q B;  2K9J B;  2N3Y A;  4JF7 A;  1CRI A;  1URQ C;  3F89 A;  2FXM A;  3HQ9 A;  3H1J E;  1U7M A;  1EXI A;  1XTG B;  1M1J A;  5APT A;  1BL9 A;  2BH4 X;  2KI7 B;  1GL2 D;  1KV4 A;  2E42 A;  5GTI E;  1FZG A;  2M8R A;  5AVV B;  4WY4 B;  4AUW A;  3M0A A;  2RH0 A;  1IZN B;  1ZR2 A;  4WQA A;  1LNQ A;  1CXC A;  3SFD C;  3CX5 E;  4ZKU A;  1RE4 A;  3S4R A;  2N1T B;  1NNO A;  451C A;  2GC4 D;  3TGU E;  1CSB A;  5H2F E;  2D2C B;  3TYY A;  4YE1 A;  3WU2 H;  1ZXG A;  2AEM A;  1KZU B;  3MK7 B;  1CI6 B;  2P2U A;  2KOG A;  3H1K E;  1YIC A;  1Q86 Q;  2N9B A;  1R8E A;  1JY2 O;  1NOH A;  3P8M C;  4H0J A;  4BWN A;  1C2N A;  2QM8 A;  2O01 J;  3OCD B;  5AW8 B;  3W67 A;  1DEB A;  1DW2 A;  1EDJ A;  2IZ0 A;  2AEJ A;  3M91 A;  1SQP J;  3HD7 B;  1TU3 F;  1JB0 J;  1N7S D;  3L71 D;  2M5A B;  3RL0 g;  2N1T C;  1CI6 A; 
#chains in the Genus database with same CATH homology
 3MK7 C;  3DMI A;  4FA5 A;  2Y0D A;  1GJQ A;  3O5C A;  3PTZ A;  1IZL 0;  3ZBM A;  1I5T A;  3H1H D;  3M97 X;  3WC8 A;  1WVE C;  4P4Q B;  4NFG B;  4QAO A;  3O1Y A;  1N90 A;  3H1L D;  1A56 A;  3WFD C;  5CIC B;  3HQ7 A;  4WQE A;  1B7V A;  3CXH W;  1E2R A;  1S5L V;  1CHH A;  4AAL A;  2JTI B;  3H1K D;  1BGY D;  1CTY A;  1R0Q A;  5CIE B;  1IO3 A;  1FJ0 A;  1E8E A;  2GB8 B;  2DVH A;  4FA1 A;  3NWV A;  1YEB A;  2ZOO A;  5TIS V;  1F1C A;  2L4D A;  4FAN A;  3X39 A;  1L9B C;  3OA8 A;  3ZIY A;  1CIH A;  1NMI A;  4FA9 A;  1HJ5 A;  5C9M A;  3VYM A;  1KIB A;  1LC1 A;  3H1I D;  2Q3E A;  1N50 A;  1H33 A;  1H9X A;  4WQ7 A;  1C7M A;  3GW6 A;  1CSU A;  1WEJ F;  1SQP D;  2QG4 A;  1SQB D;  5DF5 A;  4WQ9 A;  1CSV A;  3WUI A;  2B11 B;  2JWA A;  2V07 A;  1KX2 A;  1L0L D;  5CID B;  3VRD A;  2N18 B;  1H32 A;  1I54 A;  1CXA A;  1DW0 A;  3CU4 A;  2O3J A;  2B10 B;  1OAE A;  2CA3 B;  1KB9 D;  4H0K A;  5B66 V;  1HJ3 A;  1QN2 A;  1RAQ A;  1CCH A;  3CX5 D;  1LMS A;  2ZBO A;  2CXB A;  2YCC A;  4JCG A;  2AI5 A;  1CIF A;  1CHI A;  2L91 A;  2PCB B;  4RJT A;  1I8P A;  1DVV A;  2OZ1 B;  2VHD A;  3WFB C;  3SXT A;  4FA4 A;  1MG2 D;  1CIG A;  1PP9 D;  1H33 B;  1NML A;  4PD4 D;  1YTC A;  1N9C A;  4FB1 A;  4IL6 V;  3ITK A;  2ZON G;  5EXQ A;  1L9J C;  1GIW A;  3PLN A;  1NU1 D;  1C52 A;  1QL3 A;  1RZ5 A;  3H1J D;  1LC2 A;  2KS1 A;  2MTA C;  1CIE A;  4AAN A;  2MHM A;  1M70 A;  1NTK D;  1FI7 A;  2DGE A;  2YQB A;  4AX3 A;  2A06 D;  2AIU A;  1AYG A;  1QKS A;  1K3G A;  4A7P A;  1COR A;  3ZOX A;  5KKZ B;  4U3F D;  3JBT B;  1HZU A;  2YK3 A;  3OA8 B;  4UB8 V;  1CRY A;  1I8O A;  1W2L A;  1N15 A;  2C9X B;  3NBS A;  1YFC A;  5CIB B;  4EID A;  3L74 D;  3SWS A;  2RN0 A;  1I55 A;  4D6T D;  4RSZ A;  1A8C A;  2CE1 A;  3NBT A;  4L1Q A;  2LIR A;  1CYJ A;  2QJY B;  3O20 A;  1FCD C;  4LJI A;  2C1D A;  3PRJ A;  2XTS B;  3RN1 A;  1CTZ A;  3A9F A;  5TJH A;  2CE0 A;  2FYU D;  2BCN B;  1NTZ D;  1MG3 D;  2BGV X;  4K3I A;  1CSW A;  3ORV A;  1DII C;  3CX5 W;  3O0R C;  2IBZ D;  1YNR A;  1CCR A;  4FAV A;  1SQX D;  2GC7 D;  3ZOO A;  1U75 B;  1HJ4 A;  1E29 A;  1CC5 A;  1FI3 A;  3RLM A;  3KZI V;  2B0Z B;  1LFM A;  3VNW A;  2C2C A;  4GYD A;  1ZRT D;  2Y0C A;  1EZV D;  3WU2 V;  3PXW A;  4WQ8 A;  2Y0E A;  2LIT A;  3DR0 A;  5CYT R;  3BCC D;  1QYZ A;  4DY9 A;  2I8F A;  1CRH A;  4J20 A;  4V2K A;  3HQ8 A;  4PW9 B;  1I6E A;  1YCC A;  5AUR A;  3CWB D;  3TYI A;  3WFE C;  4WQB A;  4XYD B;  3SLE A;  3TGU D;  2ZXY A;  1DW3 A;  4PJ0 V;  5CIH B;  1J3S A;  4EDF A;  1HH7 A;  3ZOW A;  1H1O A;  1CTJ A;  1DW1 A;  2EXV A;  1JDL A;  2C1V A;  3A0H V;  2BCC D;  3L72 D;  4Y5R A;  5CIF B;  2N9J A;  4KMG A;  1NTM D;  1HRC A;  4AAM A;  5IY5 1;  2N9I A;  1A2S A;  1C2R A;  1HCM A;  1CSX A;  1KV9 A;  1H31 B;  3PXS A;  5KLI B;  5GTH V;  5GTI V;  1K3H A;  1M60 A;  3CYT I;  2N3B A;  2FRC A;  3GG2 A;  1S6V B;  1IQC A;  3C2C A;  2ORL A;  1CRJ A;  1QL4 A;  1CHJ A;  1H31 A;  4EIC A;  1C6O A;  2FWL A;  1AOQ A;  3ZOY A;  1IRW A;  1FOC A;  1DT1 A;  3TF5 A;  1RZ6 A;  3A0B V;  1P84 D;  2QJK B;  1I6D A;  1CNO A;  2HV4 A;  5KLV D;  3PXT A;  1W5C T;  2CA4 B;  1IRV A;  1L0N D;  3L73 D;  1H32 B;  1BE3 D;  3CXH D;  1FHB A;  1CRC A;  1COT A;  2D0W A;  3WFC C;  1CED A;  3KHU A;  3L4M A;  1HRO A;  1YEA A;  1CYC A;  2PAC A;  1RAP A;  2BLF B;  5KAF V;  2B12 B;  3PHL A;  4MU8 A;  2ZZS 1;  4WQD A;  5C0Z A;  2C1U A;  5DFS A;  5E79 V;  1U74 B;  3HQ6 A;  3SVW A;  4GED B;  1EB7 A;  2K9J B;  1HZV A;  2N3Y A;  2OZ1 A;  1SQV D;  4O1W A;  1CRI A;  351C A;  5CIG B;  1PPJ D;  3HQ9 A;  1CO6 A;  1SQQ D;  1CRG A;  3TDK A;  1H9Y A;  1GQ1 A;  3FWL A;  1BL9 A;  2BH4 X;  2N18 C;  1AKK A;  1DIQ C;  3L70 D;  4PWA A;  1NIR A;  1VYD A;  1OCD A;  1ZZH A;  2RMZ A;  2C1D B;  2YIU B;  1YIQ A;  2QJP B;  4WQA A;  3PH2 B;  1CXC A;  2D0S A;  3ZCF A;  1CYI A;  4EIE A;  3CP5 A;  3DP5 A;  1FI9 A;  3L4O A;  1AOF A;  4L3H A;  4N0K A;  1ETP A;  2JQR A;  4EIF A;  3RN0 A;  1NNO A;  451C A;  2GC4 D;  2FYN B;  5DJQ B;  1KYO W;  4Q5P A;  1MZ4 A;  4YE1 A;  3SJL A;  1C75 A;  3L75 D;  5H2F V;  1DVH A;  3MK7 B;  4L3G A;  3RMZ A;  1KX7 A;  1KYO D;  1M6Z A;  2BH5 X;  1GDV A;  2B4Z A;  4AAO A;  2BPB B;  1F1F A;  1C6R A;  1YIC A;  2AXT V;  4O1Q A;  1GU2 A;  1BCC D;  2GIW A;  5KAI V;  4WQC A;  4H0J A;  2V08 A;  3OCD A;  1C2N A;  3OCD B;  2KNC B;  2N9Y B;  1DW2 A;  2PCC B;  1GKS A;  1C6S A;  5DJQ C;  155C A;  4UB6 V;  3VMA A;  4XXL A;  3L71 D;  5B6Q A;  1KB0 A;  1LS9 A;  5B5E V;  2C8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...