3H1JD

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 69
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1jD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1jD02
5B66V 1CXCA 2GB8B 1H32B 4WQDA 2GIWA 1GDVA 1A56A 3VMAA 1CIEA 2BGVX 2CE1A 4AANA 2IBZD 4AALA 1CTZA 4FA4A 5C9MA 2ZXYA 3HQ6A 1NMIA 4Q5PA 1E29A 2YQBA 1FCDC 1F1CA 1I5TA 2ZBOA 1FOCA 5KLVD 1A8CA 1CHJA 2K9JB 3L70D 1M60A 5IY51 4UB8V 3VYMA 1YCCA 1IQCA 5DFSA 3VRDA 1RZ5A 1I8OA 1H9XA 2C1UA 5GTIV 3WFDC 3M97X 3CYTI 3WFCC 4WQBA 3C2CA 1HZVA 3MK7C 1IZL0 1YEAA 3DP5A 5CIGB 3RLMA 1B7VA 1KX2A 1S6VB 2ORLA 2ZZS1 3A0HV 1KIBA 1CYIA 1HJ5A 1YIQA 4EIEA 3L74D 4EDFA 1SQPD 1KB0A 2N3BA 3OA8B 2JTIB 1H9YA 1DW1A 4IL6V 4L1QA 1ETPA 1HJ4A 2N3YA 3L75D 1PP9D 1QKSA 3PH2B 1DIIC 1CYJA 2AI5A 4MU8A 1BGYD 3PHLA 3ZOXA 1CIFA 2PACA 4FA5A 2L91A 1GKSA 2PCCB 2BPBB 1C6RA 5KAFV 3MK7B 1L9BC 1LC1A 4O1WA 1L0LD 2Q3EA 4GEDB 1H31B 1YICA 1IRVA 2BH4X 1N50A 3TYIA 2GC7D 3ITKA 5AURA 3L4OA 3SJLA 1CRHA 1H31A 1L9JC 4L3GA 3CP5A 4FB1A 4QAOA 2QJKB 1C6OA 3X39A 1RAQA 1LC2A 1L0ND 1WEJF 3FWLA 1NTZD 5TJHA 1YFCA 4FA9A 1CHIA 1YNRA 2KS1A 2FYNB 2L4DA 3HQ7A 2B12B 1CXAA 4L3HA 1KB9D 1I8PA 2PCBB 1CSWA 1H1OA 5TISV 4WQEA 3NBSA 1BCCD 2B0ZB 2I8FA 4NFGB 1H32A 1CIGA 5E79V 4YE1A 3L71D 3CWBD 3BCCD 2N9IA 1K3GA 155CA 1RAPA 1SQQD 1RZ6A 3DMIA 2Y0CA 3KZIV 4PJ0V 1DVVA 2Y0DA 3SLEA 3HQ8A 1MG3D 1NTMD 2MTAC 4RSZA 1CSXA 1BE3D 2BCNB 1ZZHA 1U74B 1GQ1A 351CA 1LMSA 3SVWA 2YK3A 3SWSA 2B11B 3L73D 3O20A 1GIWA 2ZOOA 1GU2A 1CRJA 3SXTA 1NU1D 1P84D 2CXBA 1W2LA 3O1YA 2HV4A 1QL4A 1C6SA 4D6TD 1HH7A 4WQ9A 1FI9A 2CA4B 5B5EV 2V07A 2B4ZA 2YIUB 4H0KA 1S5LV 1I6DA 3PXSA 1SQBD 3WFBC 1FI3A 2A06D 2CE0A 1QN2A 1DW2A 1NIRA 1HRCA 3H1LD 3GG2A 3OCDB 1LFMA 1JDLA 3OA8A 3RN1A 2DVHA 4FAVA 1FI7A 3TDKA 1WVEC 5CYTR 2RN0A 2MHMA 4FA1A 4EIFA 4UB6V 4JCGA 2XTSB 4PD4D 4U3FD 1CORA 1CYCA 2C1DB 1DW0A 1IO3A 4N0KA 1CSUA 1K3HA 1N15A 2QJYB 2GC4D 1CEDA 4O1QA 2BLFB 1AYGA 2OZ1B 3KHUA 1COTA 2JWAA 3ZOOA 1DW3A 1CCRA 4P4QB 1CRYA 5GTHV 1A2SA 3H1HD 1MG2D 1MZ4A 1CC5A 1EB7A 3DR0A 1SQXD 2CA3B 3PRJA 1DIQC 1QYZA 1LS9A 1YEBA 2RMZA 1M70A 1NNOA 3WU2V 1CHHA 3WC8A 1C2NA 2FYUD 2QG4A 5DJQC 1C7MA 1CRIA 1IRWA 3RMZA 2N18C 2ZONG 3ZIYA 1I54A 1E2RA 2C1VA 1I6EA 1KX7A 4GYDA 3NWVA 2KNCB 4K3IA 1N9CA 2LITA 1F1FA 4WQ8A 5CIEB 3VNWA 4XXLA 1BL9A 2C9XB 1CTJA 1H33B 4AAOA 1GJQA 5C0ZA 3A9FA 1CSVA 3ZBMA 1SQVD 3PTZA 1I55A 3CXHD 1H33A 4J20A 5CIFB 5H2FV 1C75A 2D0WA 2FWLA 2N9YB 3L72D 4A7PA 5DJQB 2N18B 3O0RC 3PLNA 5CIBB 5EXQA 1J3SA 3GW6A 2BCCD 2Y0EA 2JQRA 3ZCFA 5CIHB 3CX5W 3ORVA 2B10B 2BH5X 3L4MA 1M6ZA 1R0QA 2AIUA 1KYOW 1AOQA 451CA 5KAIV 4EICA 1CRGA 1NTKD 2C2CA 2O3JA 3ZOWA 4LJIA 3NBTA 1C2RA 4WQ7A 3CXHW 5DF5A 2YCCA 1QL3A 4DY9A 2C8SA 1CTYA 3TGUD 4KMGA 2D0SA 4V2KA 3RN0A 5KKZB 3WFEC 4AX3A 1C52A 5B6QA 1ZRTD 2LIRA 3PXTA 4AAMA 1HROA 2EXVA 1CRCA 1OCDA 4PW9B 5CIDB 1N90A 3OCDA 5KLIB 1HCMA 1KV9A 4H0JA 1EZVD 3H1ID 1DVHA 3TF5A 1CCHA 2AXTV 4WQCA 4RJTA 4EIDA 3O5CA 2C1DA 1W5CT 2QJPB 2V08A 1YTCA 4FANA 3HQ9A 1FHBA 1HJ3A 2VHDA 4XYDB 1CO6A 3H1JD 3WUIA 4PWAA 1U75B 3CU4A 3A0BV 1VYDA 1FJ0A 2OZ1A 1E8EA 1CNOA 1AKKA 4WQAA 3PXWA 3H1KD 1AOFA 1NMLA 3JBTB 3CX5D 2N9JA 1OAEA 2FRCA 4Y5RA 1HZUA 5CICB 1DT1A 1KYOD 2DGEA 1CIHA 1PPJD 3ZOYA
chains in the Genus database with same CATH superfamily
1QL1A 2KK7A 2NPSC 2V7QH 2CPBA 1L4AA 1GMJA 1L2PA 1KV4A 1H89A 2KB7P 1H32B 2GIWA 5APYA 5KLVG 2M0BA 4H13D 4PJ0H 2FXPA 4ZKUA 3ZDMA 2IBZD 1NTMG 1CTZA 5C9MA 2YKOA 2ZXYA 3HQ6A 2D2CC 1IFNA 4Q5PA 2E75B 1USEA 1F1CA 3L73G 1I5TA 4EIJA 1VQKP 4JYBA 2P58A 4W7ZA 5KLVD 3A5TA 1VQLP 2K9JB 1M60A 1VQ9P 1PGJA 2KXPB 4AQRD 1AVOA 2W6JH 1LTBC 4C7NB 3BCCE 5APSA 4D6TG 1KILC 1AA0A 1RZ5A 2HODB 3L74G 2G3AA 1SQPG 1WT6A 3SWFA 2GUVA 1YJNP 4WQBA 2A06G 4N78D 1YEAA 5CIGB 1PP9G 2B89A 1BE3E 3D6YA 2ORLA 1Q90D 2JDIH 2HFED 1KIBA 2N1TD 1HJ5A 2O1JA 1YIQA 3L74D 1OVUA 1SQPD 4YXDC 4U3FG 4YPCA 4DZOA 1SQBK 3NXSA 2YKPA 3H25A 1DW1A 1NU1E 4IL6V 3CD6P 2N3YA 3CCEP 1PP9D 3S1KA 2AXTH 1QKSA 1VQPP 4TT3H 1CSBA 1BGYD 1OX3A 4WVZA 1JY2P 1RHZB 3RK2D 2BPBB 2O01N 5KAFV 3MK7B 1SQBE 1NTZG 1LC1A 3HD7C 4GEDB 1YICA 1M1JA 3TYIA 2GC7D 4H44D 3H1LE 5AURA 3ITKA 1CRHA 3RBZA 1H31A 5AVUB 4L3GA 3TGUJ 1OIPA 2K1AA 1Z56A 4QAOA 2QJKB 1C6OA 1KQSO 3M0AA 2E42A 1NTZD 3P7KA 3F89A 2W6BA 4FA9A 3KPEA 2XNXA 3HQ7A 4L3HA 1IFDA 5H2FH 3S4RA 1QGKB 3OJAB 1BCCD 2LR2A 2B0ZB 1H32A 4UB8E 3HD7A 2N9IA 4RKUJ 5DJTB 5K5GB 1KB9I 2AEJA 4HH2A 1VQOP 4TLFA 1X8YA 3HQ8A 1CSXA 5KAIH 1NTKG 1ZZHA 1KB9H 4YXWH 3FWNA 1SQVE 3JC22 1NH4A 4C7NA 1SFCB 4HJGH 2ZOOA 2VRSA 4NPEA 3WUVA 1W2BO 1P84D 2HODA 4EYYQ 1HUCA 4I6MC 2HV4A 5BU5A 4WQ9A 2KZJA 3RK3E 2CA4B 5B5EV 2V07A 2J5UA 2IFMA 2YIUB 1G2CB 4H0KA 1U57A 2ZFCA 2YXRB 1MKMA 1LTJB 4IFFA 2LXBA 2WMMA 3G3ZA 3MP7B 1FI3A 4O9BA 2WQYC 1N8RQ 1QN2A 1DW2A 2E75D 2O01H 1HRCA 4EOTA 3GG2A 3OCDB 2I1KA 3B5NB 1S5LX 2ZAEB 1LP1A 4PV1B 1HBWA 4EIFA 4UB6V 1NTMJ 2XTSB 1SQXG 2KP8A 1LNQA 1VQMP 3VN0A 2QRXA 1EXIA 1IO3A 3CMAP 2R44A 4LGDE 1HH0A 2BEZF 1M57D 3L73J 2G8YA 1X0TA 1AYGA 3AEFC 3M9HA 2JWAA 1ZP0C 1CCRA 4P4QB 5GTHV 2Q6QA 1J1EC 4ZMDA 3H1HD 3DR0A 1SQXD 3LW5H 1DIQC 1QYZA 4KT0J 1CHHA 4D6TJ 1EZVE 1E79H 2QG4A 3E7KA 1IRWA 5B66H 3H32B 1E2RA 1J2JB 1FJKA 5CBNA 1OW8A 3A3YB 3NWVA 1MV8A 3VNWA 3L72G 1YBKA 1CTJA 3AE7C 5CCHC 5C0ZA 2BCCG 1GW4A 2QA4P 3ZBMA 3CCRP 3CX5E 1I55A 4U3FJ 3CXHD 1FOSE 2R5BA 5CIFB 1C75A 4C46A 3L70G 1LWUC 3CI9A 3L72D 1VQNP 1KYOE 4K35A 2N18B 1PPJE 5EXQA 1T3UA 2BCCD 1N7SD 4H0LB 5AVSB 3CMEP 3OW2O 3Q5SA 3ORVA 2KSJA 1YJWP 5GTIH 3L4MA 2IBZE 1ZOYC 1AOQA 1NTMK 1TU3F 3EFGA 2C2CA 2O3JA 3AE8C 3ZOWA 1JCDA 1X9VA 1VF5B 4WQ7A 3CXHW 5KLVE 2YO2A 1A02J 3HTKB 1CTYA 4N6JA 2ZYDA 2D0SA 4V2KA 1PL5A 1LWUA 4Z1MH 4DCKA 4AX3A 3VMYA 1G2CA 5CMZA 1ZRTD 1LTJA 4Y99B 3WUTA 2QSIA 1YYCA 1J1DB 1K04A 1HROA 2AEMA 3II6A 2EXVA 1CRCA 2NRGA 2LXCB 4UB6H 1SQPK 3RGUA 2YXQB 1N73B 3OCDA 1W5CE 3B5NA 1L0LG 1HCMA 4DJGA 3RK3C 1KV9A 4OGQB 1RE4A 4N78E 1JTHB 4RJTA 2QJPB 1SFCD 3L74E 2V08A 1GDTA 3M0DA 1YTCA 1SQPE 3HQ9A 2IPPA 1QL2A 2HG5D 1JY2N 4PWAA 1U75B 3CU4A 1DH3A 1NTKJ 3M91A 1AFOA 1IFPA 5L8RJ 1AKKA 1PP9E 3MTUE 4IFMA 3CC2P 3GLMA 1BGYE 5TISH 1DT1A 3H32A 4WY4B 1Y9BA 1FDOA 1T6AA 3ZOYA 3L71G 2E5TA 1JY3P 3CWBG 2ZYAA 1GL2B 1OVVA 4MN4C 3NMDA 1FDMA 2BGVX 1CI6B 3BRVB 4AANA 4IFDK 4AALA 2WITA 1NTZE 3MUDA 3AEEC 2WVRA 4LC1A 1E29A 1USDA 3ABVC 1FCDC 2WPSA 1FOCA 3H1JJ 5B5EE 1AQ5A 4HKZH 1A8CA 1CHJA 2NPSB 3V4WA 3CLQA 1BCCE 4UB8V 1R8EA 3VYMA 3HE5B 1YCCA 3F5HA 1IQCA 1CW5A 1JOCA 3VYIA 1NYHA 1NJIQ 1YQ4C 2CK3H 1H9XA 1S5LH 2Z5HA 2FXMA 1H88A 2D2CB 3CYTI 2IYOA 4H13C 1ZLLA 2PFXA 2WTYA 1PGQA 3A0HV 1NTKK 2PAJA 3AEDC 3KDPB 2GUSA 1EQ7A 1ZN5A 3NFQA 1KB0A 2B87B 4L75A 3RL0C 2PRRA 1KILB 1P84E 2Q5UA 5AVWB 1ETPA 1EXJA 3JSVC 1N73A 2P1JA 2AI5A 2KSEA 2FYNC 3PP5A 3B8EB 3L70J 4FA5A 2L91A 4GOEA 1C6RA 4IL6X 1JTHA 1FJPA 4DT0A 5C39A 4O1WA 2Q3EA 1OXZA 1H31B 1JUNA 3WU2H 5CCGD 1QVGO 1N50A 2FYUG 3L75E 3MGNA 1KQGB 5AVRB 2H7HA 2M5AB 3JCUE 2E5YA 4L73A 2KLUA 1L9JC 3CP5A 1RQUA 2J58A 5KJ7D 2ZT9B 1WEJF 3TYYA 1LTAC 3V2RA 3AEGC 1SQXK 2N1TC 1FDIA 2JO1A 2RKLA 1Y8AA 2WSCJ 4B86A 2B12B 1CXAA 1KB9D 4WY4A 1T2KC 1NAYA 3HD7B 2AXCA 3H1HE 1SQXE 1GL2A 3NBSA 1Q82Q 2I8FA 1CIGA 2HLOA 2V7QJ 2E74D 1SS1A 1CI6A 3AE2C 3V2QA 2Y0CA 2LKMA 1FZGA 3KZIV 4H44C 1L0LJ 2Y0DA 2XNDH 4JF7A 2XKMA 1NTMD 2YMYA 4C7RA 4RSZA 1URQC 3Q5PA 1OW7A 3V6IA 2BCNB 2QM7A 4BRYA 1GQ1A 2NPSA 4JBZA 1L4AD 1HWTC 2B11B 3L73D 1GU5A 3HE5A 1L0NJ 3CXHE 1YIJP 4ZNCA 2Y9YA 5CBOA 1GW3A 1S1CX 3L72E 1CRJA 1W2LA 3TK1A 2OTJP 1QL4A 1C6SA 2IZ0A 4D6TD 1QX8A 1HH7A 2BCCE 1FI9A 3R4YA 2Q1KA 2QJYC 1OVRA 1BDCA 3CC7P 4KJMA 1DEBA 2WZ7A 3WFBC 3VP9A 3L71J 3CWBJ 1LP1B 2J59M 2A06D 2CE0A 1LTIC 3LIEA 2OYHC 1SQQJ 3H1IG 2ZT9C 4XA4A 2B87A 1URQA 1NWQA 1JDLA 3CCVP 2DVHA 2H8PD 4K3AA 1WVEC 5CYTR 2MHMA 1KILA 4JCGA 4U3FD 3A0BH 4N0KA 1M1KQ 3CC4P 1CEDA 2GC4D 1ZRTE 1HJ0A 4GDOA 4OVNF 3H1KG 3KHUA 1COTA 3P8CD 5AVYB 3GF7A 1WRGA 1A2SA 1MG2D 2K88A 4PD4I 3QH9A 2CA3B 2FKWB 3PRJA 2M5AA 2RMZA 1NNOA 1L0LK 2ZVOB 3AE9C 3GMAA 5KTBA 1VQ6P 4L74A 5DJQC 2OYHA 2ZONG 2C1VA 3GF3A 2OTKE 1XTCC 3MIWA 4PD4H 1IC2A 1SP4A 4K3IA 2K9YA 2LITA 1F1FA 1FS0E 4PJ0E 4WQ8A 3O6QB 4ASWA 3G6EP 2PP6A 4AAOA 1E5WA 1EDJA 4JPZB 1J1EB 3MD0A 1CSVA 1JY3N 3PTZA 1JMMA 3CX5I 1FZEA 2JEEA 2FWLA 2H43A 1KYOI 3PLNA 3O0RC 5CIBB 1J3SA 5KKZC 1QEXA 1QLED 1RE3C 3GW6A 3CX5H 2E76D 2SPZA 3A0HE 2E43A 2OGUA 2HPCB 3WUUA 3HRNA 1M6ZA 1KYOH 1EDIA 1R0QA 1Q7YQ 2Z5IA 2FYUJ 1VQ4P 4W7YA 1YQ3C 1NTKD 5AVTB 3HD7D 1FZCC 1IFMA 1LWUB 3BATA 5M1BA 5DF5A 2YCCA 1FAVA 3KXDA 4DY9A 5AW1B 3V2NA 4L76A 2DW3A 3G9RA 2A45I 4IL6H 1Q86Q 5B6QA 1NHLA 2LIRA 5BVZA 1HGVA 1RE3A 1JEKA 3T97A 3M06A 3FXDA 4PW9B 1N90A 5KAFH 3H1JG 1N7SC 2A45H 3TGUE 4H0JA 2KOGA 2O01J 2WSFH 3USSA 3KQGA 3V4QA 3OAKA 1CCHA 1LTGC 4WQCA 1IFIA 2ZJSE 1ZXGA 5AW5B 4M3LA 1FZCA 4FANA 1D7MA 1X79B 1CO6A 3H1JD 1JY3O 2Q3IA 1KD1Q 1AOFA 3CCLP 1OZHA 3RK3B 2FRCA 1HJBA 3CCQP 2KS1B 2WSEH 2ZXXA 3LW5J 3KZIE 3SWYA 5H2FE 1CIHA 1G1JA 5CJ0A 3SWKA 1W2EA 1S3JA 1N7SA 1VPCA 2FYUK 2L5GB 3O6QA 1CXCA 2GB8B 3U1CA 4WQDA 1A56A 3VMAA 3MHVA 2CE1A 1IFJA 3H1IJ 1JO5A 4FA4A 1R5LA 3AECC 1RF0C 1BE3G 3EWKA 1NMIA 5KAIE 1H0TA 2KIKA 1KB9E 3P8MC 3Q3DA 2ZVNB 3L70D 1KQFB 3HE4B 1NU1G 3GHGC 1KFNA 2OYOA 2HPCA 1IK7A 3H1KJ 5DFSA 5CCHA 5B5EH 1G1IA 1I8OA 2IFNA 2C1UA 1AJYA 1FOSF 1NTME 3M97X 1JB0J 1GU4A 1IZL0 3DP5A 3RLMA 3H1LG 1B7VA 1S72P 1S6VB 2ZZS1 3IF4A 1PGOA 3L73E 4EDFA 2R3CA 3IFMA 4L1QA 1NKZB 2KZIA 3D71A 2WWWA 3PH0A 2QIWA 3KYQA 1QVFO 1DIIC 1CYJA 4D6TE 3E1RA 5AW2B 1PFIA 3ZOXA 5GTHH 2PACA 1GTWA 1L0NG 4H13B 1L0LD 1RF1C 2OTLP 1IRVA 2A06E 2IZ1A 2BH4X 1ZR2A 2FYZA 1ZR4A 2NZ2A 1RH5B 3FGAD 3L4OA 5B66E 3AEBC 3RL0B 1LT9C 1RAQA 1L0ND 4U3FE 3S9OA 3I55P 2FFDB 3B5ND 2M3BA 1ZV8A 3MZWB 2KS1A 2FYNB 1JCCA 1FZBA 1SQQG 5AVQB 4YTPC 4PV1D 1SQVG 2PCBB 1K9MQ 3P8CE 3CCMP 1LTTC 2YO3A 4WQEA 3OA7A 2XU6A 4NFGB 3L71D 1IK9A 1RF1A 3CWBD 1UIXA 1K3GA 1SQQD 1OW6A 2POHA 1RZ6A 4WBAA 5CCGC 5CJ4A 4PJ0V 2N1TB 4BRYB 2JR8A 3SLEA 2JKVA 1U7MA 2OYIC 1MG3D 5GTIE 2MTAC 1KORA 1FZAA 3FX0A 1WMKA 2KYVA 1MZ9A 2BASA 351CA 2W8ZA 2YK3A 3HE4A 3SSUA 2CPSA 3O20A 1GIWA 2Y9ZA 2MKVA 1HGZA 1IZNB 4JQ0D 1GU2A 1K05A 3AE1C 2CXBA 3O1YA 2IDBA 4H44B 3L37A 2B4ZA 2P7JA 2E74C 1URQB 1NOHA 3BCCJ 2JWDA 1EZVG 1A02F 3PJSK 4H0LD 1NTKE 2FFDC 1LTSC 1GD2E 3TDKA 2M8RA 4FA1A 4PD4D 1CORA 1DW0A 4JYCA 1BE3J 1L4AC 2QEXP 3AE3C 1K3HA 1N15A 2QJYB 4O1QA 1VF5D 2BLFB 2OZ1B 3V5BA 2YKQA 3Q1MA 1CRYA 1CC5A 1EB7A 1NU1J 2OYHB 5AW8B 3EQ2A 1LS9A 1YEBA 4I7ZC 1M70A 1PPJG 3WC8A 1C2NA 1PV3A 2FYUD 5E79E 1T8ZA 3ZIYA 1M56D 1I54A 2FFDA 1YI2P 1I6EA 3VMXA 1KX7A 3D70A 3L36A 2FY8A 3W67A 1N9CA 4OGQD 3H1JE 1VDFA 4XXLA 3H1LJ 1ZMEC 2C0WA 2GM4A 3RK2C 2KNCA 1MFTA 1OMIA 1BSHA 1OFCX 4GOFA 1H33A 4J20A 5H2FV 1AVYA 4UB8H 5DJQB 2A45G 2N1TA 1N86A 4AYCA 3CCSP 3N4XA 3RL0D 3ZCFA 3VTPC 5CIHB 1DX7A 2W83C 3CX5W 2FXOA 2B10B 4WY4D 1S5LE 5EFWB 4NPDA 4DOJA 1KYOW 1YTZI 1YHQP 451CA 5KAIV 1GL2D 5KLIC 3A0HH 3BASA 3NBTA 2P10A 1QL3A 1M1JC 2C8SA 3G71P 3L70E 4CPGA 5KKZB 3RN0A 1AQTA 3WFEC 1N2DC 5AVXB 1C52A 3T97B 1NU1K 1SQVJ 3PXTA 2WPQA 1BGYG 1OCDA 2NPSD 2E76C 1T2KD 1FZCB 5CHXA 3WU2E 3H1ID 2QE7H 4W80A 3TF5A 4QMAA 5BU8B 4EIDA 2C0XA 3O5CA 1W5CT 3BVHA 1H8AA 1KZUB 1PIXA 2D2CD 1HJ3A 2VHDA 1KMIZ 4WWIA 3UIAA 1HTLC 1JNMA 1VYDA 1FJ0A 2OZ1A 4GKGA 3SFDC 4AUWA 1CNOA 1EZVI 1JM0A 1DD4A 1AV1A 5APVA 3H1KD 3A2AA 1NMLA 1URQD 1N7SB 1OAEA 4R4LA 1PZQA 2AEFA 1HZUA 1VL2A 2E75C 4IOIH 1KILD 1BCCG 1L0LE 1L0NK 4EI2A 1XTGB 3RBXA 5AW9B 1KFMA 5B66V 3D0WA 3QWOC 1GDVA 3KZIH 4I2LC 1CIEA 3V2PA 1H0TB 2H89C 2I8DA 1L0NE 1YJ9P 2R3SA 2UWJE 1GZLA 2P2UA 3C1LA 2YQBA 1SQQK 2ZBOA 3BRTB 1SQVK 2ZT9D 2H88C 2WPVB 3IAOA 2IBZI 2IYPA 5IY51 1NGMB 4BWNA 2B9BA 3L71E 3CWBE 3C9IA 2K9JA 3B4SA 1SQQE 3VRDA 4GIFA 5GTIV 1FE6A 1RY3A 2K37A 3WFDC 1S9KD 3LIDA 1CZQA 3WFCC 1FZFA 3C2CA 4OH8B 1HZVA 3G4SP 3MK7C 2XDJA 3L75G 2IX7C 4LLHA 3B71A 2C9LY 1KX2A 2P67A 2AXTE 1U7JA 1CYIA 4EIEA 1Q2NA 3CPWO 2M3EA 2N3BA 3GHGB 3HUSB 3OA8B 2JTIB 2HYNA 1H9YA 2QJKC 1MUUA 3VP8A 1HJ4A 3A0BE 3L75D 2PGDA 1HVVA 1T3JA 5AW3B 3PH2B 5AVVB 5KLVJ 1Y47A 4MU8A 3PHLA 1CIFA 2XV5A 3AEAC 1GKSA 3H1HG 2PCCB 3I5CA 3H6PA 1RQVA 1L9BC 3W68A 2WSFJ 2W27A 2GA1A 2ITAA 3Q5RA 1KN7A 3O8ZA 3U59A 3SJLA 4ZKPA 3C8VA 4KHXA 1JMBA 4FB1A 3X39A 4PD4E 1LC2A 3FWLA 2ZYGA 1VQ8P 5TJHA 1YFCA 1CHIA 1YNRA 2WPRA 3BCCG 2L4DA 3L74J 1SQPJ 1M7LA 2MJZA 1I8PA 3K5BA 2WSEJ 1CSWA 1H1OA 1RF1B 1N7LA 3L35A 2N9BA 5TISV 1KQLA 2OQQA 3CCUP 3Q2YA 1PP9J 3AE4C 3CL3D 1SFCC 5E79V 4YE1A 2FBWC 3R2PA 2FYUE 3BCCD 1BGYJ 2JJLA 155CA 1RAPA 2KI7B 1LT1A 1LT9B 5APUA 3DMIA 3E1IA 3EFFK 3A7OA 1DVVA 1ZW0A 2YIUC 4XE5B 1LTJC 4Y28J 3HUSC 4GT1A 2B88A 1BE3D 1LGHB 1K73Q 1DD3A 1U74B 3WMM0 3SVWA 1LMSA 5DJUB 3SWSA 3B5NC 1NTZJ 5KLVK 1SQBG 4PV1C 1RE4C 3SXTA 1NU1D 5APQA 3TNUB 4IL6E 3N7NA 1RF0A 1SFCA 5APXA 3M0DC 2OYIB 5AW7B 3VOPA 3P32A 1S5LV 4U7JA 1BCCJ 1I6DA 3PXSA 1LJ2A 1SQBD 2YNYA 5KAFE 2Z4EA 1P84I 4I1LA 1NIRA 5AVZB 1EC5A 3U1AA 3H1LD 1PGPA 3M9QA 3GHGA 1LFMA 3HUSA 3OA8A 3RN1A 4FAVA 3SFEC 1FI7A 2RN0A 3AE6C 1VQ5P 1KC8Q 5CCHD 2WT7B 1CYCA 2C1DB 2QVAA 1P84H 4HB1A 1CSUA 1BDDA 2Q7CA 1HF9A 2E74B 2V4HA 2BEQD 3ZOOA 1DW3A 3MUDC 1MZ4A 2W90A 3WU2V 1S2EA 4RESB 1YITP 3H1IE 1OWAA 2OARA 3JCUH 1M8OB 1C7MA 1CRIA 3RMZA 2N18C 1R5SA 1DIPA 1L4AB 3AE5C 4H0LC 4GYDA 3L4FA 2KNCB 5CIEB 3L75J 1BL9A 1NTZK 2C9XB 1BSNA 5E79H 5APWA 1H33B 1GJQA 2W6AA 3A9FA 3H1KE 1SQVD 4I7ZB 2D0WA 1MFZA 2N9YB 1VF5C 1SVFA 1KILE 1VQ7P 1LT9A 4A7PA 2ZXEB 3D6ZA 1Q81Q 1UIIA 5KJ7C 2Y0EA 1SLQA 3RK3D 2JQRA 3TSIA 2KLVA 3FXEA 1IO4A 1NVOA 3H1HJ 1FU1A 1SQXJ 4Y99C 3CXHI 1J1DC 4XFJA 2BH5X 3I56P 2JP3A 3TGUG 3RK2B 2AIUA 4EICA 1N73C 1CRGA 2RH0A 4OGQC 1NO4A 4LJIA 3CXHH 1YTZT 1C2RA 3TNUA 2C9NY 1X22A 2QJPC 5CCGA 4UB6E 3TGUD 4KMGA 2HR3A 3RL0g 2OYIA 1S4XA 2O1KA 1KTMA 5AW6B 1EDLA 4RO0A 3HTKA 2WSSH 4AAMA 1DEEG 5KJ7A 3NTNA 1JY2O 1GK6A 4WB4A 3L72J 5CIDB 2Q9IA 2R5DA 3VMZA 1IJDB 5GTHE 2QM8A 1S9KE 5KLIB 2R32A 2XZRA 1GK4A 1NAFA 1EZVD 2BCCJ 3IR9A 4ASVA 1DVHA 2AXTV 4WY4C 2WT7A 2C1DA 2YMKA 1M1JB 1NKNA 4GODA 1GL2C 1FHBA 4R4MA 5AW4B 1M90Q 5AW0B 4XYDB 3M9BA 5TISE 3WUIA 3A0BV 5APTA 1E8EA 1EDKA 2K3RA 2I1JA 4WQAA 3IN6A 3PXWA 2WSCH 1FBMA 2KUBA 3JBTB 3CX5D 1FC2C 2N9JA 1SQBJ 2E76B 4Y5RA 5CICB 4HYTB 4BXLA 1K8AQ 4NPFX 2IBZG 1KYOD 2DGEA 4N3YB 3CCJP 1PPJD 4OWFA
chains in the Genus database with same CATH topology
5B66V 1CXCA 2GB8B 1H32B 4WQDA 2GIWA 1GDVA 1A56A 3VMAA 1CIEA 2BGVX 2CE1A 4AANA 2IBZD 4AALA 1CTZA 4FA4A 5C9MA 2ZXYA 3HQ6A 1NMIA 4Q5PA 1E29A 2YQBA 1FCDC 1F1CA 1I5TA 2ZBOA 1FOCA 5KLVD 1A8CA 1CHJA 2K9JB 3L70D 1M60A 5IY51 4UB8V 3VYMA 1YCCA 1IQCA 5DFSA 3VRDA 1RZ5A 1I8OA 1H9XA 2C1UA 5GTIV 3WFDC 3M97X 3CYTI 3WFCC 4WQBA 3C2CA 1HZVA 3MK7C 1IZL0 1YEAA 3DP5A 5CIGB 3RLMA 1B7VA 1KX2A 1S6VB 2ORLA 2ZZS1 3A0HV 1KIBA 1CYIA 1HJ5A 1YIQA 4EIEA 3L74D 4EDFA 1SQPD 1KB0A 2N3BA 3OA8B 2JTIB 1H9YA 1DW1A 4IL6V 4L1QA 1ETPA 1HJ4A 2N3YA 3L75D 1PP9D 1QKSA 3PH2B 1DIIC 1CYJA 2AI5A 4MU8A 1BGYD 3PHLA 3ZOXA 1CIFA 2PACA 4FA5A 2L91A 1GKSA 2PCCB 2BPBB 1C6RA 5KAFV 3MK7B 1L9BC 1LC1A 4O1WA 1L0LD 2Q3EA 4GEDB 1H31B 1YICA 1IRVA 2BH4X 1N50A 3TYIA 2GC7D 3ITKA 5AURA 3L4OA 3SJLA 1CRHA 1H31A 1L9JC 4L3GA 3CP5A 4FB1A 4QAOA 2QJKB 1C6OA 3X39A 1RAQA 1LC2A 1L0ND 1WEJF 3FWLA 1NTZD 5TJHA 1YFCA 4FA9A 1CHIA 1YNRA 2KS1A 2FYNB 2L4DA 3HQ7A 2B12B 1CXAA 4L3HA 1KB9D 1I8PA 2PCBB 1CSWA 1H1OA 5TISV 4WQEA 3NBSA 1BCCD 2B0ZB 2I8FA 4NFGB 1H32A 1CIGA 5E79V 4YE1A 3L71D 3CWBD 3BCCD 2N9IA 1K3GA 155CA 1RAPA 1SQQD 1RZ6A 3DMIA 2Y0CA 3KZIV 4PJ0V 1DVVA 2Y0DA 3SLEA 3HQ8A 1MG3D 1NTMD 2MTAC 4RSZA 1CSXA 1BE3D 2BCNB 1ZZHA 1U74B 1GQ1A 351CA 1LMSA 3SVWA 2YK3A 3SWSA 2B11B 3L73D 3O20A 1GIWA 2ZOOA 1GU2A 1CRJA 3SXTA 1NU1D 1P84D 2CXBA 1W2LA 3O1YA 2HV4A 1QL4A 1C6SA 4D6TD 1HH7A 4WQ9A 1FI9A 2CA4B 5B5EV 2V07A 2B4ZA 2YIUB 4H0KA 1S5LV 1I6DA 3PXSA 1SQBD 3WFBC 1FI3A 2A06D 2CE0A 1QN2A 1DW2A 1NIRA 1HRCA 3H1LD 3GG2A 3OCDB 1LFMA 1JDLA 3OA8A 3RN1A 2DVHA 4FAVA 1FI7A 3TDKA 1WVEC 5CYTR 2RN0A 2MHMA 4FA1A 4EIFA 4UB6V 4JCGA 2XTSB 4PD4D 4U3FD 1CORA 1CYCA 2C1DB 1DW0A 1IO3A 4N0KA 1CSUA 1K3HA 1N15A 2QJYB 2GC4D 1CEDA 4O1QA 2BLFB 1AYGA 2OZ1B 3KHUA 1COTA 2JWAA 3ZOOA 1DW3A 1CCRA 4P4QB 1CRYA 5GTHV 1A2SA 3H1HD 1MG2D 1MZ4A 1CC5A 1EB7A 3DR0A 1SQXD 2CA3B 3PRJA 1DIQC 1QYZA 1LS9A 1YEBA 2RMZA 1M70A 1NNOA 3WU2V 1CHHA 3WC8A 1C2NA 2FYUD 2QG4A 5DJQC 1C7MA 1CRIA 1IRWA 3RMZA 2N18C 2ZONG 3ZIYA 1I54A 1E2RA 2C1VA 1I6EA 1KX7A 4GYDA 3NWVA 2KNCB 4K3IA 1N9CA 2LITA 1F1FA 4WQ8A 5CIEB 3VNWA 4XXLA 1BL9A 2C9XB 1CTJA 1H33B 4AAOA 1GJQA 5C0ZA 3A9FA 1CSVA 3ZBMA 1SQVD 3PTZA 1I55A 3CXHD 1H33A 4J20A 5CIFB 5H2FV 1C75A 2D0WA 2FWLA 2N9YB 3L72D 4A7PA 5DJQB 2N18B 3O0RC 3PLNA 5CIBB 5EXQA 1J3SA 3GW6A 2BCCD 2Y0EA 2JQRA 3ZCFA 5CIHB 3CX5W 3ORVA 2B10B 2BH5X 3L4MA 1M6ZA 1R0QA 2AIUA 1KYOW 1AOQA 451CA 5KAIV 4EICA 1CRGA 1NTKD 2C2CA 2O3JA 3ZOWA 4LJIA 3NBTA 1C2RA 4WQ7A 3CXHW 5DF5A 2YCCA 1QL3A 4DY9A 2C8SA 1CTYA 3TGUD 4KMGA 2D0SA 4V2KA 3RN0A 5KKZB 3WFEC 4AX3A 1C52A 5B6QA 1ZRTD 2LIRA 3PXTA 4AAMA 1HROA 2EXVA 1CRCA 1OCDA 4PW9B 5CIDB 1N90A 3OCDA 5KLIB 1HCMA 1KV9A 4H0JA 1EZVD 3H1ID 1DVHA 3TF5A 1CCHA 2AXTV 4WQCA 4RJTA 4EIDA 3O5CA 2C1DA 1W5CT 2QJPB 2V08A 1YTCA 4FANA 3HQ9A 1FHBA 1HJ3A 2VHDA 4XYDB 1CO6A 3H1JD 3WUIA 4PWAA 1U75B 3CU4A 3A0BV 1VYDA 1FJ0A 2OZ1A 1E8EA 1CNOA 1AKKA 4WQAA 3PXWA 3H1KD 1AOFA 1NMLA 3JBTB 3CX5D 2N9JA 1OAEA 2FRCA 4Y5RA 1HZUA 5CICB 1DT1A 1KYOD 2DGEA 1CIHA 1PPJD 3ZOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 V;  1CXC A;  2GB8 B;  1H32 B;  4WQD A;  2GIW A;  1GDV A;  1A56 A;  3VMA A;  1CIE A;  2BGV X;  2CE1 A;  4AAN A;  2IBZ D;  4AAL A;  1CTZ A;  4FA4 A;  5C9M A;  2ZXY A;  3HQ6 A;  1NMI A;  4Q5P A;  1E29 A;  2YQB A;  1FCD C;  1F1C A;  1I5T A;  2ZBO A;  1FOC A;  5KLV D;  1A8C A;  1CHJ A;  2K9J B;  3L70 D;  1M60 A;  5IY5 1;  4UB8 V;  3VYM A;  1YCC A;  1IQC A;  5DFS A;  3VRD A;  1RZ5 A;  1I8O A;  1H9X A;  2C1U A;  5GTI V;  3WFD C;  3M97 X;  3CYT I;  3WFC C;  4WQB A;  3C2C A;  1HZV A;  3MK7 C;  1IZL 0;  1YEA A;  3DP5 A;  5CIG B;  3RLM A;  1B7V A;  1KX2 A;  1S6V B;  2ORL A;  2ZZS 1;  3A0H V;  1KIB A;  1CYI A;  1HJ5 A;  1YIQ A;  4EIE A;  3L74 D;  4EDF A;  1SQP D;  1KB0 A;  2N3B A;  3OA8 B;  2JTI B;  1H9Y A;  1DW1 A;  4IL6 V;  4L1Q A;  1ETP A;  1HJ4 A;  2N3Y A;  3L75 D;  1PP9 D;  1QKS A;  3PH2 B;  1DII C;  1CYJ A;  2AI5 A;  4MU8 A;  1BGY D;  3PHL A;  3ZOX A;  1CIF A;  2PAC A;  4FA5 A;  2L91 A;  1GKS A;  2PCC B;  2BPB B;  1C6R A;  5KAF V;  3MK7 B;  1L9B C;  1LC1 A;  4O1W A;  1L0L D;  2Q3E A;  4GED B;  1H31 B;  1YIC A;  1IRV A;  2BH4 X;  1N50 A;  3TYI A;  2GC7 D;  3ITK A;  5AUR A;  3L4O A;  3SJL A;  1CRH A;  1H31 A;  1L9J C;  4L3G A;  3CP5 A;  4FB1 A;  4QAO A;  2QJK B;  1C6O A;  3X39 A;  1RAQ A;  1LC2 A;  1L0N D;  1WEJ F;  3FWL A;  1NTZ D;  5TJH A;  1YFC A;  4FA9 A;  1CHI A;  1YNR A;  2KS1 A;  2FYN B;  2L4D A;  3HQ7 A;  2B12 B;  1CXA A;  4L3H A;  1KB9 D;  1I8P A;  2PCB B;  1CSW A;  1H1O A;  5TIS V;  4WQE A;  3NBS A;  1BCC D;  2B0Z B;  2I8F A;  4NFG B;  1H32 A;  1CIG A;  5E79 V;  4YE1 A;  3L71 D;  3CWB D;  3BCC D;  2N9I A;  1K3G A;  155C A;  1RAP A;  1SQQ D;  1RZ6 A;  3DMI A;  2Y0C A;  3KZI V;  4PJ0 V;  1DVV A;  2Y0D A;  3SLE A;  3HQ8 A;  1MG3 D;  1NTM D;  2MTA C;  4RSZ A;  1CSX A;  1BE3 D;  2BCN B;  1ZZH A;  1U74 B;  1GQ1 A;  351C A;  1LMS A;  3SVW A;  2YK3 A;  3SWS A;  2B11 B;  3L73 D;  3O20 A;  1GIW A;  2ZOO A;  1GU2 A;  1CRJ A;  3SXT A;  1NU1 D;  1P84 D;  2CXB A;  1W2L A;  3O1Y A;  2HV4 A;  1QL4 A;  1C6S A;  4D6T D;  1HH7 A;  4WQ9 A;  1FI9 A;  2CA4 B;  5B5E V;  2V07 A;  2B4Z A;  2YIU B;  4H0K A;  1S5L V;  1I6D A;  3PXS A;  1SQB D;  3WFB C;  1FI3 A;  2A06 D;  2CE0 A;  1QN2 A;  1DW2 A;  1NIR A;  1HRC A;  3H1L D;  3GG2 A;  3OCD B;  1LFM A;  1JDL A;  3OA8 A;  3RN1 A;  2DVH A;  4FAV A;  1FI7 A;  3TDK A;  1WVE C;  5CYT R;  2RN0 A;  2MHM A;  4FA1 A;  4EIF A;  4UB6 V;  4JCG A;  2XTS B;  4PD4 D;  4U3F D;  1COR A;  1CYC A;  2C1D B;  1DW0 A;  1IO3 A;  4N0K A;  1CSU A;  1K3H A;  1N15 A;  2QJY B;  2GC4 D;  1CED A;  4O1Q A;  2BLF B;  1AYG A;  2OZ1 B;  3KHU A;  1COT A;  2JWA A;  3ZOO A;  1DW3 A;  1CCR A;  4P4Q B;  1CRY A;  5GTH V;  1A2S A;  3H1H D;  1MG2 D;  1MZ4 A;  1CC5 A;  1EB7 A;  3DR0 A;  1SQX D;  2CA3 B;  3PRJ A;  1DIQ C;  1QYZ A;  1LS9 A;  1YEB A;  2RMZ A;  1M70 A;  1NNO A;  3WU2 V;  1CHH A;  3WC8 A;  1C2N A;  2FYU D;  2QG4 A;  5DJQ C;  1C7M A;  1CRI A;  1IRW A;  3RMZ A;  2N18 C;  2ZON G;  3ZIY A;  1I54 A;  1E2R A;  2C1V A;  1I6E A;  1KX7 A;  4GYD A;  3NWV A;  2KNC B;  4K3I A;  1N9C A;  2LIT A;  1F1F A;  4WQ8 A;  5CIE B;  3VNW A;  4XXL A;  1BL9 A;  2C9X B;  1CTJ A;  1H33 B;  4AAO A;  1GJQ A;  5C0Z A;  3A9F A;  1CSV A;  3ZBM A;  1SQV D;  3PTZ A;  1I55 A;  3CXH D;  1H33 A;  4J20 A;  5CIF B;  5H2F V;  1C75 A;  2D0W A;  2FWL A;  2N9Y B;  3L72 D;  4A7P A;  5DJQ B;  2N18 B;  3O0R C;  3PLN A;  5CIB B;  5EXQ A;  1J3S A;  3GW6 A;  2BCC D;  2Y0E A;  2JQR A;  3ZCF A;  5CIH B;  3CX5 W;  3ORV A;  2B10 B;  2BH5 X;  3L4M A;  1M6Z A;  1R0Q A;  2AIU A;  1KYO W;  1AOQ A;  451C A;  5KAI V;  4EIC A;  1CRG A;  1NTK D;  2C2C A;  2O3J A;  3ZOW A;  4LJI A;  3NBT A;  1C2R A;  4WQ7 A;  3CXH W;  5DF5 A;  2YCC A;  1QL3 A;  4DY9 A;  2C8S A;  1CTY A;  3TGU D;  4KMG A;  2D0S A;  4V2K A;  3RN0 A;  5KKZ B;  3WFE C;  4AX3 A;  1C52 A;  5B6Q A;  1ZRT D;  2LIR A;  3PXT A;  4AAM A;  1HRO A;  2EXV A;  1CRC A;  1OCD A;  4PW9 B;  5CID B;  1N90 A;  3OCD A;  5KLI B;  1HCM A;  1KV9 A;  4H0J A;  1EZV D;  3H1I D;  1DVH A;  3TF5 A;  1CCH A;  2AXT V;  4WQC A;  4RJT A;  4EID A;  3O5C A;  2C1D A;  1W5C T;  2QJP B;  2V08 A;  1YTC A;  4FAN A;  3HQ9 A;  1FHB A;  1HJ3 A;  2VHD A;  4XYD B;  1CO6 A;  3H1J D;  3WUI A;  4PWA A;  1U75 B;  3CU4 A;  3A0B V;  1VYD A;  1FJ0 A;  2OZ1 A;  1E8E A;  1CNO A;  1AKK A;  4WQA A;  3PXW A;  3H1K D;  1AOF A;  1NML A;  3JBT B;  3CX5 D;  2N9J A;  1OAE A;  2FRC A;  4Y5R A;  1HZU A;  5CIC B;  1DT1 A;  1KYO D;  2DGE A;  1CIH A;  1PPJ D;  3ZOY A; 
#chains in the Genus database with same CATH topology
 1QL1 A;  2KK7 A;  2NPS C;  2V7Q H;  2CPB A;  1L4A A;  1GMJ A;  1L2P A;  1KV4 A;  1H89 A;  2KB7 P;  1H32 B;  2GIW A;  5APY A;  5KLV G;  2M0B A;  4H13 D;  4PJ0 H;  2FXP A;  4ZKU A;  3ZDM A;  2IBZ D;  1NTM G;  1CTZ A;  5C9M A;  2YKO A;  2ZXY A;  3HQ6 A;  2D2C C;  1IFN A;  4Q5P A;  2E75 B;  1USE A;  1F1C A;  3L73 G;  1I5T A;  4EIJ A;  1VQK P;  4JYB A;  2P58 A;  4W7Z A;  5KLV D;  3A5T A;  1VQL P;  2K9J B;  1M60 A;  1VQ9 P;  1PGJ A;  2KXP B;  4AQR D;  1AVO A;  2W6J H;  1LTB C;  4C7N B;  3BCC E;  5APS A;  4D6T G;  1KIL C;  1AA0 A;  1RZ5 A;  2HOD B;  3L74 G;  2G3A A;  1SQP G;  1WT6 A;  3SWF A;  2GUV A;  1YJN P;  4WQB A;  2A06 G;  4N78 D;  1YEA A;  5CIG B;  1PP9 G;  2B89 A;  1BE3 E;  3D6Y A;  2ORL A;  1Q90 D;  2JDI H;  2HFE D;  1KIB A;  2N1T D;  1HJ5 A;  2O1J A;  1YIQ A;  3L74 D;  1OVU A;  1SQP D;  4YXD C;  4U3F G;  4YPC A;  4DZO A;  1SQB K;  3NXS A;  2YKP A;  3H25 A;  1DW1 A;  1NU1 E;  4IL6 V;  3CD6 P;  2N3Y A;  3CCE P;  1PP9 D;  3S1K A;  2AXT H;  1QKS A;  1VQP P;  4TT3 H;  1CSB A;  1BGY D;  1OX3 A;  4WVZ A;  1JY2 P;  1RHZ B;  3RK2 D;  2BPB B;  2O01 N;  5KAF V;  3MK7 B;  1SQB E;  1NTZ G;  1LC1 A;  3HD7 C;  4GED B;  1YIC A;  1M1J A;  3TYI A;  2GC7 D;  4H44 D;  3H1L E;  5AUR A;  3ITK A;  1CRH A;  3RBZ A;  1H31 A;  5AVU B;  4L3G A;  3TGU J;  1OIP A;  2K1A A;  1Z56 A;  4QAO A;  2QJK B;  1C6O A;  1KQS O;  3M0A A;  2E42 A;  1NTZ D;  3P7K A;  3F89 A;  2W6B A;  4FA9 A;  3KPE A;  2XNX A;  3HQ7 A;  4L3H A;  1IFD A;  5H2F H;  3S4R A;  1QGK B;  3OJA B;  1BCC D;  2LR2 A;  2B0Z B;  1H32 A;  4UB8 E;  3HD7 A;  2N9I A;  4RKU J;  5DJT B;  5K5G B;  1KB9 I;  2AEJ A;  4HH2 A;  1VQO P;  4TLF A;  1X8Y A;  3HQ8 A;  1CSX A;  5KAI H;  1NTK G;  1ZZH A;  1KB9 H;  4YXW H;  3FWN A;  1SQV E;  3JC2 2;  1NH4 A;  4C7N A;  1SFC B;  4HJG H;  2ZOO A;  2VRS A;  4NPE A;  3WUV A;  1W2B O;  1P84 D;  2HOD A;  4EYY Q;  1HUC A;  4I6M C;  2HV4 A;  5BU5 A;  4WQ9 A;  2KZJ A;  3RK3 E;  2CA4 B;  5B5E V;  2V07 A;  2J5U A;  2IFM A;  2YIU B;  1G2C B;  4H0K A;  1U57 A;  2ZFC A;  2YXR B;  1MKM A;  1LTJ B;  4IFF A;  2LXB A;  2WMM A;  3G3Z A;  3MP7 B;  1FI3 A;  4O9B A;  2WQY C;  1N8R Q;  1QN2 A;  1DW2 A;  2E75 D;  2O01 H;  1HRC A;  4EOT A;  3GG2 A;  3OCD B;  2I1K A;  3B5N B;  1S5L X;  2ZAE B;  1LP1 A;  4PV1 B;  1HBW A;  4EIF A;  4UB6 V;  1NTM J;  2XTS B;  1SQX G;  2KP8 A;  1LNQ A;  1VQM P;  3VN0 A;  2QRX A;  1EXI A;  1IO3 A;  3CMA P;  2R44 A;  4LGD E;  1HH0 A;  2BEZ F;  1M57 D;  3L73 J;  2G8Y A;  1X0T A;  1AYG A;  3AEF C;  3M9H A;  2JWA A;  1ZP0 C;  1CCR A;  4P4Q B;  5GTH V;  2Q6Q A;  1J1E C;  4ZMD A;  3H1H D;  3DR0 A;  1SQX D;  3LW5 H;  1DIQ C;  1QYZ A;  4KT0 J;  1CHH A;  4D6T J;  1EZV E;  1E79 H;  2QG4 A;  3E7K A;  1IRW A;  5B66 H;  3H32 B;  1E2R A;  1J2J B;  1FJK A;  5CBN A;  1OW8 A;  3A3Y B;  3NWV A;  1MV8 A;  3VNW A;  3L72 G;  1YBK A;  1CTJ A;  3AE7 C;  5CCH C;  5C0Z A;  2BCC G;  1GW4 A;  2QA4 P;  3ZBM A;  3CCR P;  3CX5 E;  1I55 A;  4U3F J;  3CXH D;  1FOS E;  2R5B A;  5CIF B;  1C75 A;  4C46 A;  3L70 G;  1LWU C;  3CI9 A;  3L72 D;  1VQN P;  1KYO E;  4K35 A;  2N18 B;  1PPJ E;  5EXQ A;  1T3U A;  2BCC D;  1N7S D;  4H0L B;  5AVS B;  3CME P;  3OW2 O;  3Q5S A;  3ORV A;  2KSJ A;  1YJW P;  5GTI H;  3L4M A;  2IBZ E;  1ZOY C;  1AOQ A;  1NTM K;  1TU3 F;  3EFG A;  2C2C A;  2O3J A;  3AE8 C;  3ZOW A;  1JCD A;  1X9V A;  1VF5 B;  4WQ7 A;  3CXH W;  5KLV E;  2YO2 A;  1A02 J;  3HTK B;  1CTY A;  4N6J A;  2ZYD A;  2D0S A;  4V2K A;  1PL5 A;  1LWU A;  4Z1M H;  4DCK A;  4AX3 A;  3VMY A;  1G2C A;  5CMZ A;  1ZRT D;  1LTJ A;  4Y99 B;  3WUT A;  2QSI A;  1YYC A;  1J1D B;  1K04 A;  1HRO A;  2AEM A;  3II6 A;  2EXV A;  1CRC A;  2NRG A;  2LXC B;  4UB6 H;  1SQP K;  3RGU A;  2YXQ B;  1N73 B;  3OCD A;  1W5C E;  3B5N A;  1L0L G;  1HCM A;  4DJG A;  3RK3 C;  1KV9 A;  4OGQ B;  1RE4 A;  4N78 E;  1JTH B;  4RJT A;  2QJP B;  1SFC D;  3L74 E;  2V08 A;  1GDT A;  3M0D A;  1YTC A;  1SQP E;  3HQ9 A;  2IPP A;  1QL2 A;  2HG5 D;  1JY2 N;  4PWA A;  1U75 B;  3CU4 A;  1DH3 A;  1NTK J;  3M91 A;  1AFO A;  1IFP A;  5L8R J;  1AKK A;  1PP9 E;  3MTU E;  4IFM A;  3CC2 P;  3GLM A;  1BGY E;  5TIS H;  1DT1 A;  3H32 A;  4WY4 B;  1Y9B A;  1FDO A;  1T6A A;  3ZOY A;  3L71 G;  2E5T A;  1JY3 P;  3CWB G;  2ZYA A;  1GL2 B;  1OVV A;  4MN4 C;  3NMD A;  1FDM A;  2BGV X;  1CI6 B;  3BRV B;  4AAN A;  4IFD K;  4AAL A;  2WIT A;  1NTZ E;  3MUD A;  3AEE C;  2WVR A;  4LC1 A;  1E29 A;  1USD A;  3ABV C;  1FCD C;  2WPS A;  1FOC A;  3H1J J;  5B5E E;  1AQ5 A;  4HKZ H;  1A8C A;  1CHJ A;  2NPS B;  3V4W A;  3CLQ A;  1BCC E;  4UB8 V;  1R8E A;  3VYM A;  3HE5 B;  1YCC A;  3F5H A;  1IQC A;  1CW5 A;  1JOC A;  3VYI A;  1NYH A;  1NJI Q;  1YQ4 C;  2CK3 H;  1H9X A;  1S5L H;  2Z5H A;  2FXM A;  1H88 A;  2D2C B;  3CYT I;  2IYO A;  4H13 C;  1ZLL A;  2PFX A;  2WTY A;  1PGQ A;  3A0H V;  1NTK K;  2PAJ A;  3AED C;  3KDP B;  2GUS A;  1EQ7 A;  1ZN5 A;  3NFQ A;  1KB0 A;  2B87 B;  4L75 A;  3RL0 C;  2PRR A;  1KIL B;  1P84 E;  2Q5U A;  5AVW B;  1ETP A;  1EXJ A;  3JSV C;  1N73 A;  2P1J A;  2AI5 A;  2KSE A;  2FYN C;  3PP5 A;  3B8E B;  3L70 J;  4FA5 A;  2L91 A;  4GOE A;  1C6R A;  4IL6 X;  1JTH A;  1FJP A;  4DT0 A;  5C39 A;  4O1W A;  2Q3E A;  1OXZ A;  1H31 B;  1JUN A;  3WU2 H;  5CCG D;  1QVG O;  1N50 A;  2FYU G;  3L75 E;  3MGN A;  1KQG B;  5AVR B;  2H7H A;  2M5A B;  3JCU E;  2E5Y A;  4L73 A;  2KLU A;  1L9J C;  3CP5 A;  1RQU A;  2J58 A;  5KJ7 D;  2ZT9 B;  1WEJ F;  3TYY A;  1LTA C;  3V2R A;  3AEG C;  1SQX K;  2N1T C;  1FDI A;  2JO1 A;  2RKL A;  1Y8A A;  2WSC J;  4B86 A;  2B12 B;  1CXA A;  1KB9 D;  4WY4 A;  1T2K C;  1NAY A;  3HD7 B;  2AXC A;  3H1H E;  1SQX E;  1GL2 A;  3NBS A;  1Q82 Q;  2I8F A;  1CIG A;  2HLO A;  2V7Q J;  2E74 D;  1SS1 A;  1CI6 A;  3AE2 C;  3V2Q A;  2Y0C A;  2LKM A;  1FZG A;  3KZI V;  4H44 C;  1L0L J;  2Y0D A;  2XND H;  4JF7 A;  2XKM A;  1NTM D;  2YMY A;  4C7R A;  4RSZ A;  1URQ C;  3Q5P A;  1OW7 A;  3V6I A;  2BCN B;  2QM7 A;  4BRY A;  1GQ1 A;  2NPS A;  4JBZ A;  1L4A D;  1HWT C;  2B11 B;  3L73 D;  1GU5 A;  3HE5 A;  1L0N J;  3CXH E;  1YIJ P;  4ZNC A;  2Y9Y A;  5CBO A;  1GW3 A;  1S1C X;  3L72 E;  1CRJ A;  1W2L A;  3TK1 A;  2OTJ P;  1QL4 A;  1C6S A;  2IZ0 A;  4D6T D;  1QX8 A;  1HH7 A;  2BCC E;  1FI9 A;  3R4Y A;  2Q1K A;  2QJY C;  1OVR A;  1BDC A;  3CC7 P;  4KJM A;  1DEB A;  2WZ7 A;  3WFB C;  3VP9 A;  3L71 J;  3CWB J;  1LP1 B;  2J59 M;  2A06 D;  2CE0 A;  1LTI C;  3LIE A;  2OYH C;  1SQQ J;  3H1I G;  2ZT9 C;  4XA4 A;  2B87 A;  1URQ A;  1NWQ A;  1JDL A;  3CCV P;  2DVH A;  2H8P D;  4K3A A;  1WVE C;  5CYT R;  2MHM A;  1KIL A;  4JCG A;  4U3F D;  3A0B H;  4N0K A;  1M1K Q;  3CC4 P;  1CED A;  2GC4 D;  1ZRT E;  1HJ0 A;  4GDO A;  4OVN F;  3H1K G;  3KHU A;  1COT A;  3P8C D;  5AVY B;  3GF7 A;  1WRG A;  1A2S A;  1MG2 D;  2K88 A;  4PD4 I;  3QH9 A;  2CA3 B;  2FKW B;  3PRJ A;  2M5A A;  2RMZ A;  1NNO A;  1L0L K;  2ZVO B;  3AE9 C;  3GMA A;  5KTB A;  1VQ6 P;  4L74 A;  5DJQ C;  2OYH A;  2ZON G;  2C1V A;  3GF3 A;  2OTK E;  1XTC C;  3MIW A;  4PD4 H;  1IC2 A;  1SP4 A;  4K3I A;  2K9Y A;  2LIT A;  1F1F A;  1FS0 E;  4PJ0 E;  4WQ8 A;  3O6Q B;  4ASW A;  3G6E P;  2PP6 A;  4AAO A;  1E5W A;  1EDJ A;  4JPZ B;  1J1E B;  3MD0 A;  1CSV A;  1JY3 N;  3PTZ A;  1JMM A;  3CX5 I;  1FZE A;  2JEE A;  2FWL A;  2H43 A;  1KYO I;  3PLN A;  3O0R C;  5CIB B;  1J3S A;  5KKZ C;  1QEX A;  1QLE D;  1RE3 C;  3GW6 A;  3CX5 H;  2E76 D;  2SPZ A;  3A0H E;  2E43 A;  2OGU A;  2HPC B;  3WUU A;  3HRN A;  1M6Z A;  1KYO H;  1EDI A;  1R0Q A;  1Q7Y Q;  2Z5I A;  2FYU J;  1VQ4 P;  4W7Y A;  1YQ3 C;  1NTK D;  5AVT B;  3HD7 D;  1FZC C;  1IFM A;  1LWU B;  3BAT A;  5M1B A;  5DF5 A;  2YCC A;  1FAV A;  3KXD A;  4DY9 A;  5AW1 B;  3V2N A;  4L76 A;  2DW3 A;  3G9R A;  2A45 I;  4IL6 H;  1Q86 Q;  5B6Q A;  1NHL A;  2LIR A;  5BVZ A;  1HGV A;  1RE3 A;  1JEK A;  3T97 A;  3M06 A;  3FXD A;  4PW9 B;  1N90 A;  5KAF H;  3H1J G;  1N7S C;  2A45 H;  3TGU E;  4H0J A;  2KOG A;  2O01 J;  2WSF H;  3USS A;  3KQG A;  3V4Q A;  3OAK A;  1CCH A;  1LTG C;  4WQC A;  1IFI A;  2ZJS E;  1ZXG A;  5AW5 B;  4M3L A;  1FZC A;  4FAN A;  1D7M A;  1X79 B;  1CO6 A;  3H1J D;  1JY3 O;  2Q3I A;  1KD1 Q;  1AOF A;  3CCL P;  1OZH A;  3RK3 B;  2FRC A;  1HJB A;  3CCQ P;  2KS1 B;  2WSE H;  2ZXX A;  3LW5 J;  3KZI E;  3SWY A;  5H2F E;  1CIH A;  1G1J A;  5CJ0 A;  3SWK A;  1W2E A;  1S3J A;  1N7S A;  1VPC A;  2FYU K;  2L5G B;  3O6Q A;  1CXC A;  2GB8 B;  3U1C A;  4WQD A;  1A56 A;  3VMA A;  3MHV A;  2CE1 A;  1IFJ A;  3H1I J;  1JO5 A;  4FA4 A;  1R5L A;  3AEC C;  1RF0 C;  1BE3 G;  3EWK A;  1NMI A;  5KAI E;  1H0T A;  2KIK A;  1KB9 E;  3P8M C;  3Q3D A;  2ZVN B;  3L70 D;  1KQF B;  3HE4 B;  1NU1 G;  3GHG C;  1KFN A;  2OYO A;  2HPC A;  1IK7 A;  3H1K J;  5DFS A;  5CCH A;  5B5E H;  1G1I A;  1I8O A;  2IFN A;  2C1U A;  1AJY A;  1FOS F;  1NTM E;  3M97 X;  1JB0 J;  1GU4 A;  1IZL 0;  3DP5 A;  3RLM A;  3H1L G;  1B7V A;  1S72 P;  1S6V B;  2ZZS 1;  3IF4 A;  1PGO A;  3L73 E;  4EDF A;  2R3C A;  3IFM A;  4L1Q A;  1NKZ B;  2KZI A;  3D71 A;  2WWW A;  3PH0 A;  2QIW A;  3KYQ A;  1QVF O;  1DII C;  1CYJ A;  4D6T E;  3E1R A;  5AW2 B;  1PFI A;  3ZOX A;  5GTH H;  2PAC A;  1GTW A;  1L0N G;  4H13 B;  1L0L D;  1RF1 C;  2OTL P;  1IRV A;  2A06 E;  2IZ1 A;  2BH4 X;  1ZR2 A;  2FYZ A;  1ZR4 A;  2NZ2 A;  1RH5 B;  3FGA D;  3L4O A;  5B66 E;  3AEB C;  3RL0 B;  1LT9 C;  1RAQ A;  1L0N D;  4U3F E;  3S9O A;  3I55 P;  2FFD B;  3B5N D;  2M3B A;  1ZV8 A;  3MZW B;  2KS1 A;  2FYN B;  1JCC A;  1FZB A;  1SQQ G;  5AVQ B;  4YTP C;  4PV1 D;  1SQV G;  2PCB B;  1K9M Q;  3P8C E;  3CCM P;  1LTT C;  2YO3 A;  4WQE A;  3OA7 A;  2XU6 A;  4NFG B;  3L71 D;  1IK9 A;  1RF1 A;  3CWB D;  1UIX A;  1K3G A;  1SQQ D;  1OW6 A;  2POH A;  1RZ6 A;  4WBA A;  5CCG C;  5CJ4 A;  4PJ0 V;  2N1T B;  4BRY B;  2JR8 A;  3SLE A;  2JKV A;  1U7M A;  2OYI C;  1MG3 D;  5GTI E;  2MTA C;  1KOR A;  1FZA A;  3FX0 A;  1WMK A;  2KYV A;  1MZ9 A;  2BAS A;  351C A;  2W8Z A;  2YK3 A;  3HE4 A;  3SSU A;  2CPS A;  3O20 A;  1GIW A;  2Y9Z A;  2MKV A;  1HGZ A;  1IZN B;  4JQ0 D;  1GU2 A;  1K05 A;  3AE1 C;  2CXB A;  3O1Y A;  2IDB A;  4H44 B;  3L37 A;  2B4Z A;  2P7J A;  2E74 C;  1URQ B;  1NOH A;  3BCC J;  2JWD A;  1EZV G;  1A02 F;  3PJS K;  4H0L D;  1NTK E;  2FFD C;  1LTS C;  1GD2 E;  3TDK A;  2M8R A;  4FA1 A;  4PD4 D;  1COR A;  1DW0 A;  4JYC A;  1BE3 J;  1L4A C;  2QEX P;  3AE3 C;  1K3H A;  1N15 A;  2QJY B;  4O1Q A;  1VF5 D;  2BLF B;  2OZ1 B;  3V5B A;  2YKQ A;  3Q1M A;  1CRY A;  1CC5 A;  1EB7 A;  1NU1 J;  2OYH B;  5AW8 B;  3EQ2 A;  1LS9 A;  1YEB A;  4I7Z C;  1M70 A;  1PPJ G;  3WC8 A;  1C2N A;  1PV3 A;  2FYU D;  5E79 E;  1T8Z A;  3ZIY A;  1M56 D;  1I54 A;  2FFD A;  1YI2 P;  1I6E A;  3VMX A;  1KX7 A;  3D70 A;  3L36 A;  2FY8 A;  3W67 A;  1N9C A;  4OGQ D;  3H1J E;  1VDF A;  4XXL A;  3H1L J;  1ZME C;  2C0W A;  2GM4 A;  3RK2 C;  2KNC A;  1MFT A;  1OMI A;  1BSH A;  1OFC X;  4GOF A;  1H33 A;  4J20 A;  5H2F V;  1AVY A;  4UB8 H;  5DJQ B;  2A45 G;  2N1T A;  1N86 A;  4AYC A;  3CCS P;  3N4X A;  3RL0 D;  3ZCF A;  3VTP C;  5CIH B;  1DX7 A;  2W83 C;  3CX5 W;  2FXO A;  2B10 B;  4WY4 D;  1S5L E;  5EFW B;  4NPD A;  4DOJ A;  1KYO W;  1YTZ I;  1YHQ P;  451C A;  5KAI V;  1GL2 D;  5KLI C;  3A0H H;  3BAS A;  3NBT A;  2P10 A;  1QL3 A;  1M1J C;  2C8S A;  3G71 P;  3L70 E;  4CPG A;  5KKZ B;  3RN0 A;  1AQT A;  3WFE C;  1N2D C;  5AVX B;  1C52 A;  3T97 B;  1NU1 K;  1SQV J;  3PXT A;  2WPQ A;  1BGY G;  1OCD A;  2NPS D;  2E76 C;  1T2K D;  1FZC B;  5CHX A;  3WU2 E;  3H1I D;  2QE7 H;  4W80 A;  3TF5 A;  4QMA A;  5BU8 B;  4EID A;  2C0X A;  3O5C A;  1W5C T;  3BVH A;  1H8A A;  1KZU B;  1PIX A;  2D2C D;  1HJ3 A;  2VHD A;  1KMI Z;  4WWI A;  3UIA A;  1HTL C;  1JNM A;  1VYD A;  1FJ0 A;  2OZ1 A;  4GKG A;  3SFD C;  4AUW A;  1CNO A;  1EZV I;  1JM0 A;  1DD4 A;  1AV1 A;  5APV A;  3H1K D;  3A2A A;  1NML A;  1URQ D;  1N7S B;  1OAE A;  4R4L A;  1PZQ A;  2AEF A;  1HZU A;  1VL2 A;  2E75 C;  4IOI H;  1KIL D;  1BCC G;  1L0L E;  1L0N K;  4EI2 A;  1XTG B;  3RBX A;  5AW9 B;  1KFM A;  5B66 V;  3D0W A;  3QWO C;  1GDV A;  3KZI H;  4I2L C;  1CIE A;  3V2P A;  1H0T B;  2H89 C;  2I8D A;  1L0N E;  1YJ9 P;  2R3S A;  2UWJ E;  1GZL A;  2P2U A;  3C1L A;  2YQB A;  1SQQ K;  2ZBO A;  3BRT B;  1SQV K;  2ZT9 D;  2H88 C;  2WPV B;  3IAO A;  2IBZ I;  2IYP A;  5IY5 1;  1NGM B;  4BWN A;  2B9B A;  3L71 E;  3CWB E;  3C9I A;  2K9J A;  3B4S A;  1SQQ E;  3VRD A;  4GIF A;  5GTI V;  1FE6 A;  1RY3 A;  2K37 A;  3WFD C;  1S9K D;  3LID A;  1CZQ A;  3WFC C;  1FZF A;  3C2C A;  4OH8 B;  1HZV A;  3G4S P;  3MK7 C;  2XDJ A;  3L75 G;  2IX7 C;  4LLH A;  3B71 A;  2C9L Y;  1KX2 A;  2P67 A;  2AXT E;  1U7J A;  1CYI A;  4EIE A;  1Q2N A;  3CPW O;  2M3E A;  2N3B A;  3GHG B;  3HUS B;  3OA8 B;  2JTI B;  2HYN A;  1H9Y A;  2QJK C;  1MUU A;  3VP8 A;  1HJ4 A;  3A0B E;  3L75 D;  2PGD A;  1HVV A;  1T3J A;  5AW3 B;  3PH2 B;  5AVV B;  5KLV J;  1Y47 A;  4MU8 A;  3PHL A;  1CIF A;  2XV5 A;  3AEA C;  1GKS A;  3H1H G;  2PCC B;  3I5C A;  3H6P A;  1RQV A;  1L9B C;  3W68 A;  2WSF J;  2W27 A;  2GA1 A;  2ITA A;  3Q5R A;  1KN7 A;  3O8Z A;  3U59 A;  3SJL A;  4ZKP A;  3C8V A;  4KHX A;  1JMB A;  4FB1 A;  3X39 A;  4PD4 E;  1LC2 A;  3FWL A;  2ZYG A;  1VQ8 P;  5TJH A;  1YFC A;  1CHI A;  1YNR A;  2WPR A;  3BCC G;  2L4D A;  3L74 J;  1SQP J;  1M7L A;  2MJZ A;  1I8P A;  3K5B A;  2WSE J;  1CSW A;  1H1O A;  1RF1 B;  1N7L A;  3L35 A;  2N9B A;  5TIS V;  1KQL A;  2OQQ A;  3CCU P;  3Q2Y A;  1PP9 J;  3AE4 C;  3CL3 D;  1SFC C;  5E79 V;  4YE1 A;  2FBW C;  3R2P A;  2FYU E;  3BCC D;  1BGY J;  2JJL A;  155C A;  1RAP A;  2KI7 B;  1LT1 A;  1LT9 B;  5APU A;  3DMI A;  3E1I A;  3EFF K;  3A7O A;  1DVV A;  1ZW0 A;  2YIU C;  4XE5 B;  1LTJ C;  4Y28 J;  3HUS C;  4GT1 A;  2B88 A;  1BE3 D;  1LGH B;  1K73 Q;  1DD3 A;  1U74 B;  3WMM 0;  3SVW A;  1LMS A;  5DJU B;  3SWS A;  3B5N C;  1NTZ J;  5KLV K;  1SQB G;  4PV1 C;  1RE4 C;  3SXT A;  1NU1 D;  5APQ A;  3TNU B;  4IL6 E;  3N7N A;  1RF0 A;  1SFC A;  5APX A;  3M0D C;  2OYI B;  5AW7 B;  3VOP A;  3P32 A;  1S5L V;  4U7J A;  1BCC J;  1I6D A;  3PXS A;  1LJ2 A;  1SQB D;  2YNY A;  5KAF E;  2Z4E A;  1P84 I;  4I1L A;  1NIR A;  5AVZ B;  1EC5 A;  3U1A A;  3H1L D;  1PGP A;  3M9Q A;  3GHG A;  1LFM A;  3HUS A;  3OA8 A;  3RN1 A;  4FAV A;  3SFE C;  1FI7 A;  2RN0 A;  3AE6 C;  1VQ5 P;  1KC8 Q;  5CCH D;  2WT7 B;  1CYC A;  2C1D B;  2QVA A;  1P84 H;  4HB1 A;  1CSU A;  1BDD A;  2Q7C A;  1HF9 A;  2E74 B;  2V4H A;  2BEQ D;  3ZOO A;  1DW3 A;  3MUD C;  1MZ4 A;  2W90 A;  3WU2 V;  1S2E A;  4RES B;  1YIT P;  3H1I E;  1OWA A;  2OAR A;  3JCU H;  1M8O B;  1C7M A;  1CRI A;  3RMZ A;  2N18 C;  1R5S A;  1DIP A;  1L4A B;  3AE5 C;  4H0L C;  4GYD A;  3L4F A;  2KNC B;  5CIE B;  3L75 J;  1BL9 A;  1NTZ K;  2C9X B;  1BSN A;  5E79 H;  5APW A;  1H33 B;  1GJQ A;  2W6A A;  3A9F A;  3H1K E;  1SQV D;  4I7Z B;  2D0W A;  1MFZ A;  2N9Y B;  1VF5 C;  1SVF A;  1KIL E;  1VQ7 P;  1LT9 A;  4A7P A;  2ZXE B;  3D6Z A;  1Q81 Q;  1UII A;  5KJ7 C;  2Y0E A;  1SLQ A;  3RK3 D;  2JQR A;  3TSI A;  2KLV A;  3FXE A;  1IO4 A;  1NVO A;  3H1H J;  1FU1 A;  1SQX J;  4Y99 C;  3CXH I;  1J1D C;  4XFJ A;  2BH5 X;  3I56 P;  2JP3 A;  3TGU G;  3RK2 B;  2AIU A;  4EIC A;  1N73 C;  1CRG A;  2RH0 A;  4OGQ C;  1NO4 A;  4LJI A;  3CXH H;  1YTZ T;  1C2R A;  3TNU A;  2C9N Y;  1X22 A;  2QJP C;  5CCG A;  4UB6 E;  3TGU D;  4KMG A;  2HR3 A;  3RL0 g;  2OYI A;  1S4X A;  2O1K A;  1KTM A;  5AW6 B;  1EDL A;  4RO0 A;  3HTK A;  2WSS H;  4AAM A;  1DEE G;  5KJ7 A;  3NTN A;  1JY2 O;  1GK6 A;  4WB4 A;  3L72 J;  5CID B;  2Q9I A;  2R5D A;  3VMZ A;  1IJD B;  5GTH E;  2QM8 A;  1S9K E;  5KLI B;  2R32 A;  2XZR A;  1GK4 A;  1NAF A;  1EZV D;  2BCC J;  3IR9 A;  4ASV A;  1DVH A;  2AXT V;  4WY4 C;  2WT7 A;  2C1D A;  2YMK A;  1M1J B;  1NKN A;  4GOD A;  1GL2 C;  1FHB A;  4R4M A;  5AW4 B;  1M90 Q;  5AW0 B;  4XYD B;  3M9B A;  5TIS E;  3WUI A;  3A0B V;  5APT A;  1E8E A;  1EDK A;  2K3R A;  2I1J A;  4WQA A;  3IN6 A;  3PXW A;  2WSC H;  1FBM A;  2KUB A;  3JBT B;  3CX5 D;  1FC2 C;  2N9J A;  1SQB J;  2E76 B;  4Y5R A;  5CIC B;  4HYT B;  4BXL A;  1K8A Q;  4NPF X;  2IBZ G;  1KYO D;  2DGE A;  4N3Y B;  3CCJ P;  1PPJ D;  4OWF A; 
#chains in the Genus database with same CATH homology
 5B66 V;  1CXC A;  2GB8 B;  1H32 B;  4WQD A;  2GIW A;  1GDV A;  1A56 A;  3VMA A;  1CIE A;  2BGV X;  2CE1 A;  4AAN A;  2IBZ D;  4AAL A;  1CTZ A;  4FA4 A;  5C9M A;  2ZXY A;  3HQ6 A;  1NMI A;  4Q5P A;  1E29 A;  2YQB A;  1FCD C;  1F1C A;  1I5T A;  2ZBO A;  1FOC A;  5KLV D;  1A8C A;  1CHJ A;  2K9J B;  3L70 D;  1M60 A;  5IY5 1;  4UB8 V;  3VYM A;  1YCC A;  1IQC A;  5DFS A;  3VRD A;  1RZ5 A;  1I8O A;  1H9X A;  2C1U A;  5GTI V;  3WFD C;  3M97 X;  3CYT I;  3WFC C;  4WQB A;  3C2C A;  1HZV A;  3MK7 C;  1IZL 0;  1YEA A;  3DP5 A;  5CIG B;  3RLM A;  1B7V A;  1KX2 A;  1S6V B;  2ORL A;  2ZZS 1;  3A0H V;  1KIB A;  1CYI A;  1HJ5 A;  1YIQ A;  4EIE A;  3L74 D;  4EDF A;  1SQP D;  1KB0 A;  2N3B A;  3OA8 B;  2JTI B;  1H9Y A;  1DW1 A;  4IL6 V;  4L1Q A;  1ETP A;  1HJ4 A;  2N3Y A;  3L75 D;  1PP9 D;  1QKS A;  3PH2 B;  1DII C;  1CYJ A;  2AI5 A;  4MU8 A;  1BGY D;  3PHL A;  3ZOX A;  1CIF A;  2PAC A;  4FA5 A;  2L91 A;  1GKS A;  2PCC B;  2BPB B;  1C6R A;  5KAF V;  3MK7 B;  1L9B C;  1LC1 A;  4O1W A;  1L0L D;  2Q3E A;  4GED B;  1H31 B;  1YIC A;  1IRV A;  2BH4 X;  1N50 A;  3TYI A;  2GC7 D;  3ITK A;  5AUR A;  3L4O A;  3SJL A;  1CRH A;  1H31 A;  1L9J C;  4L3G A;  3CP5 A;  4FB1 A;  4QAO A;  2QJK B;  1C6O A;  3X39 A;  1RAQ A;  1LC2 A;  1L0N D;  1WEJ F;  3FWL A;  1NTZ D;  5TJH A;  1YFC A;  4FA9 A;  1CHI A;  1YNR A;  2KS1 A;  2FYN B;  2L4D A;  3HQ7 A;  2B12 B;  1CXA A;  4L3H A;  1KB9 D;  1I8P A;  2PCB B;  1CSW A;  1H1O A;  5TIS V;  4WQE A;  3NBS A;  1BCC D;  2B0Z B;  2I8F A;  4NFG B;  1H32 A;  1CIG A;  5E79 V;  4YE1 A;  3L71 D;  3CWB D;  3BCC D;  2N9I A;  1K3G A;  155C A;  1RAP A;  1SQQ D;  1RZ6 A;  3DMI A;  2Y0C A;  3KZI V;  4PJ0 V;  1DVV A;  2Y0D A;  3SLE A;  3HQ8 A;  1MG3 D;  1NTM D;  2MTA C;  4RSZ A;  1CSX A;  1BE3 D;  2BCN B;  1ZZH A;  1U74 B;  1GQ1 A;  351C A;  1LMS A;  3SVW A;  2YK3 A;  3SWS A;  2B11 B;  3L73 D;  3O20 A;  1GIW A;  2ZOO A;  1GU2 A;  1CRJ A;  3SXT A;  1NU1 D;  1P84 D;  2CXB A;  1W2L A;  3O1Y A;  2HV4 A;  1QL4 A;  1C6S A;  4D6T D;  1HH7 A;  4WQ9 A;  1FI9 A;  2CA4 B;  5B5E V;  2V07 A;  2B4Z A;  2YIU B;  4H0K A;  1S5L V;  1I6D A;  3PXS A;  1SQB D;  3WFB C;  1FI3 A;  2A06 D;  2CE0 A;  1QN2 A;  1DW2 A;  1NIR A;  1HRC A;  3H1L D;  3GG2 A;  3OCD B;  1LFM A;  1JDL A;  3OA8 A;  3RN1 A;  2DVH A;  4FAV A;  1FI7 A;  3TDK A;  1WVE C;  5CYT R;  2RN0 A;  2MHM A;  4FA1 A;  4EIF A;  4UB6 V;  4JCG A;  2XTS B;  4PD4 D;  4U3F D;  1COR A;  1CYC A;  2C1D B;  1DW0 A;  1IO3 A;  4N0K A;  1CSU A;  1K3H A;  1N15 A;  2QJY B;  2GC4 D;  1CED A;  4O1Q A;  2BLF B;  1AYG A;  2OZ1 B;  3KHU A;  1COT A;  2JWA A;  3ZOO A;  1DW3 A;  1CCR A;  4P4Q B;  1CRY A;  5GTH V;  1A2S A;  3H1H D;  1MG2 D;  1MZ4 A;  1CC5 A;  1EB7 A;  3DR0 A;  1SQX D;  2CA3 B;  3PRJ A;  1DIQ C;  1QYZ A;  1LS9 A;  1YEB A;  2RMZ A;  1M70 A;  1NNO A;  3WU2 V;  1CHH A;  3WC8 A;  1C2N A;  2FYU D;  2QG4 A;  5DJQ C;  1C7M A;  1CRI A;  1IRW A;  3RMZ A;  2N18 C;  2ZON G;  3ZIY A;  1I54 A;  1E2R A;  2C1V A;  1I6E A;  1KX7 A;  4GYD A;  3NWV A;  2KNC B;  4K3I A;  1N9C A;  2LIT A;  1F1F A;  4WQ8 A;  5CIE B;  3VNW A;  4XXL A;  1BL9 A;  2C9X B;  1CTJ A;  1H33 B;  4AAO A;  1GJQ A;  5C0Z A;  3A9F A;  1CSV A;  3ZBM A;  1SQV D;  3PTZ A;  1I55 A;  3CXH D;  1H33 A;  4J20 A;  5CIF B;  5H2F V;  1C75 A;  2D0W A;  2FWL A;  2N9Y B;  3L72 D;  4A7P A;  5DJQ B;  2N18 B;  3O0R C;  3PLN A;  5CIB B;  5EXQ A;  1J3S A;  3GW6 A;  2BCC D;  2Y0E A;  2JQR A;  3ZCF A;  5CIH B;  3CX5 W;  3ORV A;  2B10 B;  2BH5 X;  3L4M A;  1M6Z A;  1R0Q A;  2AIU A;  1KYO W;  1AOQ A;  451C A;  5KAI V;  4EIC A;  1CRG A;  1NTK D;  2C2C A;  2O3J A;  3ZOW A;  4LJI A;  3NBT A;  1C2R A;  4WQ7 A;  3CXH W;  5DF5 A;  2YCC A;  1QL3 A;  4DY9 A;  2C8S A;  1CTY A;  3TGU D;  4KMG A;  2D0S A;  4V2K A;  3RN0 A;  5KKZ B;  3WFE C;  4AX3 A;  1C52 A;  5B6Q A;  1ZRT D;  2LIR A;  3PXT A;  4AAM A;  1HRO A;  2EXV A;  1CRC A;  1OCD A;  4PW9 B;  5CID B;  1N90 A;  3OCD A;  5KLI B;  1HCM A;  1KV9 A;  4H0J A;  1EZV D;  3H1I D;  1DVH A;  3TF5 A;  1CCH A;  2AXT V;  4WQC A;  4RJT A;  4EID A;  3O5C A;  2C1D A;  1W5C T;  2QJP B;  2V08 A;  1YTC A;  4FAN A;  3HQ9 A;  1FHB A;  1HJ3 A;  2VHD A;  4XYD B;  1CO6 A;  3H1J D;  3WUI A;  4PWA A;  1U75 B;  3CU4 A;  3A0B V;  1VYD A;  1FJ0 A;  2OZ1 A;  1E8E A;  1CNO A;  1AKK A;  4WQA A;  3PXW A;  3H1K D;  1AOF A;  1NML A;  3JBT B;  3CX5 D;  2N9J A;  1OAE A;  2FRC A;  4Y5R A;  1HZU A;  5CIC B;  1DT1 A;  1KYO D;  2DGE A;  1CIH A;  1PPJ D;  3ZOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...