3WFDC

Reduced and acetaldoxime-bound cytochrome c-dependent nitric oxide reductase (cnor) from pseudomonas aeruginosa in complex with antibody fragment
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
142
structure length
142
Chain Sequence
FTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAMSAAVVRGKLVWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMKIQPLNVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment light chain
publication title Structures of reduced and ligand-bound nitric oxide reductase provide insights into functional differences in respiratory enzymes
pubmed doi rcsb
molecule tags Immune system/oxidoreductase
total genus 51
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3wfdC00
2C9XB 1PP9D 1BL9A 4WQAA 1C52A 4AAOA 2LIRA 2C8SA 3VRDA 1E29A 1F1FA 1CNOA 3TYIA 1A2SA 3HQ8A 1ETPA 2V08A 5CIDB 5DF5A 3MK7C 1S5LV 1R0QA 5KAIV 1DVHA 4LJIA 3WUIA 4FAVA 1N15A 1HJ4A 1H31A 3CWBD 4XYDB 4IL6V 1FOCA 2XTSB 5KLVD 2QJPB 1I5TA 1YFCA 2LITA 1COTA 4QAOA 2D0SA 1OAEA 1W2LA 1DT1A 3RLMA 1DW0A 3ORVA 2DGEA 5E79V 3H1ID 1AOQA 3OCDA 3WFCC 1KYOD 1L0LD 4WQCA 1NNOA 1C6OA 5C0ZA 1CRHA 2ZONG 2BPBB 1BCCD 5CIBB 1GKSA 4EIDA 1CO6A 1CTJA 3TGUD 1MG2D 2CA3B 3WFEC 1C2NA 1J3SA 1CRGA 2ZOOA 2C2CA 4AALA 1CYJA 4WQ8A 4AANA 4FANA 3H1JD 2B10B 5GTIV 3ZOYA 351CA 1A8CA 1GIWA 5B5EV 1N90A 5DJQC 1I8OA 1L9BC 1CYIA 5CYTR 3SWSA 2MTAC 4AX3A 1K3HA 3ZCFA 2CE0A 3ZOOA 5CIFB 1H1OA 1SQQD 2IBZD 3JBTB 3O0RC 3ZOXA 5H2FV 1PPJD 4O1WA 2FRCA 1HJ3A 3L70D 2B0ZB 1YCCA 1EZVD 2OZ1B 1I6DA 1FCDC 2A06D 1ZRTD 1IO3A 1KX7A 1H32B 3HQ7A 1YICA 2N18B 4Y5RA 1NTMD 1FI9A 4EICA 1LC1A 1YEAA 2N9IA 1KX2A 3HQ9A 2VHDA 1KIBA 2EXVA 2N3YA 1LC2A 5KLIB 3A9FA 1NIRA 1S6VB 2GC4D 1NMIA 4UB8V 3A0BV 1M6ZA 1EB7A 1GQ1A 1A56A 1CSWA 1KB9D 2MHMA 5B6QA 4AAMA 4NFGB 1YEBA 1C6RA 3H1HD 1MZ4A 1HJ5A 5TISV 3ZIYA 2BLFB 3CU4A 1JDLA 1RZ5A 1HZUA 4MU8A 4P4QB 3DMIA 1CHHA 1M60A 2CE1A 1P84D 1CRIA 4Q5PA 4D6TD 3RN0A 1CRCA 4PD4D 2L4DA 3O1YA 1RAQA 3PXSA 3L72D 5C9MA 3WFDC 3L73D 3SXTA 2QJYB 3ZOWA 1L0ND 3O5CA 2FWLA 2N18C 1CIEA 1CYCA 4UB6V 1C2RA 4V2KA 3BCCD 2C1VA 1QYZA 1RZ6A 1MG3D 1QN2A 1SQPD 1QKSA 1CHJA 1SQXD 1C6SA 1N9CA 4DY9A 2B12B 3M97X 1H33A 4EIEA 1CRYA 2OZ1A 2GIWA 4YE1A 5KAFV 1F1CA 1H32A 2BCNB 2N3BA 1AOFA 1CCRA 2B4ZA 1AYGA 3CX5W 1GU2A 3DR0A 3OA8A 4PW9B 2C1DB 1KV9A 4FA1A 2AI5A 3CX5D 1DIIC 3SVWA 1LFMA 4U3FD 3MK7B 4L3HA 3L75D 1YIQA 4RSZA 3VYMA 2AIUA 1DW1A 2BH5X 4WQDA 1H33B 1K3GA 1CORA 2PCCB 3NBSA 4PJ0V 1FI3A 1DW3A 3L74D 5CIEB 5EXQA 1HH7A 4GEDB 5IY51 5GTHV 1CIGA 3L4OA 4N0KA 1CC5A 1I6EA 1HCMA 3RMZA 1FI7A 1H9XA 3CXHW 1YTCA 3OA8B 1IZL0 1N50A 3KZIV 2FYUD 1NMLA 1CIFA 3O20A 1B7VA 2JTIB 2DVHA 3SJLA 3CXHD 2GB8B 3A0HV 5KKZB 2ZXYA 2GC7D 1C75A 1CTYA 1DIQC 2ORLA 1HZVA 1CHIA 1SQBD 5CIGB 1QL4A 4H0KA 4J20A 1DVVA 1CRJA 1CCHA 1NTKD 2CA4B 5CICB 4K3IA 1LS9A 3H1LD 2I8FA 1HROA 2YK3A 1CTZA 1NTZD 4EIFA 4L3GA 1FHBA 1L9JC 1CXCA 5CIHB 4FA5A 2B11B 2D0WA 2JQRA 4PWAA 4H0JA 5B66V 1NU1D 3HQ6A 5DJQB 1CIHA 1KYOW 2PACA 3L71D 1IRWA 1U75B 2C1DA 451CA 3PXWA 3WC8A 1WEJF 1CSVA 4FA4A 5AURA 3WFBC 3NWVA 1H31B 2PCBB 1WVEC 4WQ7A 1QL3A 5DFSA 1BE3D 1CSXA 2YCCA 1VYDA 3DP5A 155CA 3WU2V 1C7MA 1OCDA 3SLEA 1CSUA 2N9JA 1SQVD 2YQBA 1E8EA 1RAPA 2HV4A 4WQBA 2CXBA 4FB1A 2BH4X 3C2CA 1I8PA 4XXLA 4KMGA 2AXTV 3OCDB 1DW2A 2V07A 1LMSA 3CP5A 1YNRA 1I54A 4L1QA 3RN1A 1GJQA 2YIUB 1W5CT 4GYDA 3PXTA 3VNWA 1CEDA 1I55A 1KB0A 1IQCA 4WQEA 1E2RA 2ZBOA 1U74B 1FJ0A 3X39A 3PH2B 2ZZS1 1H9YA 3NBTA 1AKKA 4FA9A 3CYTI 1HRCA 1CXAA 4WQ9A 2BGVX 3ZBMA 1IRVA 1M70A 1GDVA 3H1KD 2C1UA 4JCGA 2BCCD 3L4MA 4O1QA 2QJKB 2FYNB 1ZZHA 1BGYD
chains in the Genus database with same CATH superfamily
2C9XB 1PP9D 1BL9A 4WQAA 1C52A 4AAOA 2LIRA 2C8SA 3VRDA 1E29A 1F1FA 1CNOA 3TYIA 1A2SA 3HQ8A 1ETPA 2V08A 5CIDB 5DF5A 3MK7C 1S5LV 1R0QA 5KAIV 1DVHA 4LJIA 3WUIA 4FAVA 1N15A 1HJ4A 1H31A 3CWBD 4XYDB 4IL6V 1FOCA 2XTSB 5KLVD 2QJPB 1I5TA 1YFCA 2LITA 3D0WA 1COTA 4QAOA 2D0SA 1OAEA 1W2LA 1DT1A 3RLMA 1DW0A 3ORVA 2DGEA 5E79V 3H1ID 1AOQA 3OCDA 3WFCC 1KYOD 1L0LD 4WQCA 1NNOA 1C6OA 5C0ZA 1CRHA 2ZONG 2BPBB 1BCCD 5CIBB 1GKSA 4EIDA 1CO6A 1CTJA 3TGUD 1MG2D 2CA3B 3WFEC 1C2NA 1J3SA 1CRGA 2ZOOA 2C2CA 4AALA 1CYJA 4WQ8A 4AANA 4FANA 3H1JD 2B10B 5GTIV 3ZOYA 351CA 1A8CA 1GIWA 5B5EV 1N90A 5DJQC 1I8OA 1L9BC 1CYIA 5CYTR 3SWSA 2MTAC 4AX3A 1K3HA 3ZCFA 2CE0A 3ZOOA 5CIFB 1H1OA 1SQQD 2IBZD 3JBTB 3O0RC 3ZOXA 5H2FV 1PPJD 4O1WA 2FRCA 1HJ3A 3L70D 2B0ZB 1YCCA 1EZVD 2OZ1B 1I6DA 1FCDC 2A06D 1ZRTD 1IO3A 1KX7A 1H32B 3HQ7A 1YICA 2N18B 4Y5RA 1NTMD 1FI9A 4EICA 1LC1A 1YEAA 2N9IA 1KX2A 3HQ9A 2VHDA 1KIBA 2EXVA 2N3YA 1LC2A 5KLIB 3A9FA 1NIRA 1S6VB 2GC4D 1NMIA 4UB8V 3A0BV 1M6ZA 1EB7A 1GQ1A 1A56A 1CSWA 1KB9D 2MHMA 5B6QA 4AAMA 4NFGB 1YEBA 1C6RA 3H1HD 1MZ4A 1HJ5A 5TISV 3ZIYA 2BLFB 3CU4A 1JDLA 1RZ5A 1HZUA 4MU8A 4P4QB 3DMIA 1CHHA 1M60A 2CE1A 1P84D 1CRIA 4Q5PA 4D6TD 3RN0A 1CRCA 4PD4D 2L4DA 3O1YA 1RAQA 3PXSA 3L72D 5C9MA 3WFDC 3L73D 3SXTA 2QJYB 3ZOWA 1L0ND 3O5CA 2FWLA 2N18C 1CIEA 1CYCA 4UB6V 1C2RA 4V2KA 3BCCD 2C1VA 1QYZA 1RZ6A 1MG3D 1QN2A 1SQPD 1QKSA 1CHJA 1SQXD 1C6SA 1N9CA 4DY9A 2B12B 3M97X 1H33A 4EIEA 1CRYA 2OZ1A 2GIWA 4YE1A 5KAFV 1F1CA 1H32A 2BCNB 2N3BA 1AOFA 1CCRA 2B4ZA 1AYGA 3CX5W 1GU2A 3DR0A 3OA8A 4PW9B 2C1DB 1KV9A 4FA1A 2AI5A 3CX5D 1DIIC 3SVWA 1LFMA 4U3FD 3MK7B 4L3HA 3L75D 1YIQA 4RSZA 3VYMA 2AIUA 1DW1A 2BH5X 4WQDA 1H33B 1K3GA 1CORA 2PCCB 3NBSA 4PJ0V 1FI3A 1DW3A 3L74D 5CIEB 5EXQA 1HH7A 4GEDB 5IY51 5GTHV 1CIGA 3L4OA 4N0KA 1CC5A 1I6EA 1HCMA 3RMZA 1FI7A 1H9XA 3CXHW 1YTCA 3OA8B 1IZL0 1N50A 3KZIV 2FYUD 1NMLA 1CIFA 3O20A 1B7VA 2JTIB 2DVHA 3SJLA 3CXHD 2GB8B 3A0HV 5KKZB 2ZXYA 2GC7D 1C75A 1CTYA 1DIQC 2ORLA 1HZVA 1CHIA 1SQBD 5CIGB 1QL4A 4H0KA 4J20A 1DVVA 1CRJA 1CCHA 1NTKD 2CA4B 5CICB 4K3IA 1LS9A 3H1LD 2I8FA 1HROA 2YK3A 1CTZA 1NTZD 4EIFA 4L3GA 1FHBA 1L9JC 1CXCA 5CIHB 4FA5A 2B11B 2D0WA 2JQRA 4PWAA 4H0JA 5B66V 1NU1D 3HQ6A 5DJQB 1CIHA 1KYOW 2PACA 3L71D 1IRWA 1U75B 2C1DA 451CA 3PXWA 3WC8A 1WEJF 1CSVA 4FA4A 5AURA 3WFBC 3NWVA 1H31B 2PCBB 1WVEC 4WQ7A 1QL3A 5DFSA 1BE3D 1CSXA 2YCCA 1VYDA 3DP5A 155CA 3WU2V 1C7MA 1OCDA 3SLEA 1CSUA 2N9JA 1SQVD 2YQBA 1E8EA 1RAPA 2HV4A 4WQBA 2CXBA 4FB1A 2BH4X 3C2CA 1I8PA 4XXLA 4KMGA 2AXTV 3OCDB 1DW2A 2V07A 1LMSA 3CP5A 1YNRA 1I54A 4L1QA 3RN1A 1GJQA 2YIUB 1W5CT 4GYDA 3PXTA 3VNWA 1CEDA 1I55A 1KB0A 1IQCA 4WQEA 1E2RA 2ZBOA 1U74B 1FJ0A 3X39A 3PH2B 2ZZS1 1H9YA 3NBTA 1AKKA 4FA9A 3CYTI 1HRCA 1CXAA 4WQ9A 2BGVX 3ZBMA 1IRVA 1M70A 1GDVA 3H1KD 2C1UA 4JCGA 2BCCD 3L4MA 4O1QA 2QJKB 2FYNB 1ZZHA 1BGYD
chains in the Genus database with same CATH topology
2C9XB 1PP9D 1BL9A 4WQAA 1C52A 4AAOA 2LIRA 2C8SA 3VRDA 1E29A 1F1FA 1CNOA 3TYIA 1A2SA 3HQ8A 1ETPA 2V08A 5CIDB 5DF5A 3MK7C 1S5LV 1R0QA 5KAIV 1DVHA 4LJIA 3WUIA 4FAVA 1N15A 1HJ4A 1H31A 3CWBD 4XYDB 4IL6V 1FOCA 2XTSB 5KLVD 2QJPB 1I5TA 1YFCA 2LITA 1COTA 4QAOA 2D0SA 1OAEA 1W2LA 1DT1A 3RLMA 1DW0A 3ORVA 2DGEA 5E79V 3H1ID 1AOQA 3OCDA 3WFCC 1KYOD 1L0LD 4WQCA 1NNOA 1C6OA 5C0ZA 1CRHA 2ZONG 2BPBB 1BCCD 5CIBB 1GKSA 4EIDA 1CO6A 1CTJA 3TGUD 1MG2D 2CA3B 3WFEC 1C2NA 1J3SA 1CRGA 2ZOOA 2C2CA 4AALA 1CYJA 4WQ8A 4AANA 4FANA 3H1JD 2B10B 5GTIV 3ZOYA 351CA 1A8CA 1GIWA 5B5EV 1N90A 5DJQC 1I8OA 1L9BC 1CYIA 5CYTR 3SWSA 2MTAC 4AX3A 1K3HA 3ZCFA 2CE0A 3ZOOA 5CIFB 1H1OA 1SQQD 2IBZD 3JBTB 3O0RC 3ZOXA 5H2FV 1PPJD 4O1WA 2FRCA 1HJ3A 3L70D 2B0ZB 1YCCA 1EZVD 2OZ1B 1I6DA 1FCDC 2A06D 1ZRTD 1IO3A 1KX7A 1H32B 3HQ7A 1YICA 2N18B 4Y5RA 1NTMD 1FI9A 4EICA 1LC1A 1YEAA 2N9IA 1KX2A 3HQ9A 2VHDA 1KIBA 2EXVA 2N3YA 1LC2A 5KLIB 3A9FA 1NIRA 1S6VB 2GC4D 1NMIA 4UB8V 3A0BV 1M6ZA 1EB7A 1GQ1A 1A56A 1CSWA 1KB9D 2MHMA 5B6QA 4AAMA 4NFGB 1YEBA 1C6RA 3H1HD 1MZ4A 1HJ5A 5TISV 3ZIYA 2BLFB 3CU4A 1JDLA 1RZ5A 1HZUA 4MU8A 4P4QB 3DMIA 1CHHA 1M60A 2CE1A 1P84D 1CRIA 4Q5PA 4D6TD 3RN0A 1CRCA 4PD4D 2L4DA 3O1YA 1RAQA 3PXSA 3L72D 5C9MA 3WFDC 3L73D 3SXTA 2QJYB 3ZOWA 1L0ND 3O5CA 2FWLA 2N18C 1CIEA 1CYCA 4UB6V 1C2RA 4V2KA 3BCCD 2C1VA 1QYZA 1RZ6A 1MG3D 1QN2A 1SQPD 1QKSA 1CHJA 1SQXD 1C6SA 1N9CA 4DY9A 2B12B 3M97X 1H33A 4EIEA 1CRYA 2OZ1A 2GIWA 4YE1A 5KAFV 1F1CA 1H32A 2BCNB 2N3BA 1AOFA 1CCRA 2B4ZA 1AYGA 3CX5W 1GU2A 3DR0A 3OA8A 4PW9B 2C1DB 1KV9A 4FA1A 2AI5A 3CX5D 1DIIC 3SVWA 1LFMA 4U3FD 3MK7B 4L3HA 3L75D 1YIQA 4RSZA 3VYMA 2AIUA 1DW1A 2BH5X 4WQDA 1H33B 1K3GA 1CORA 2PCCB 3NBSA 4PJ0V 1FI3A 1DW3A 3L74D 5CIEB 5EXQA 1HH7A 4GEDB 5IY51 5GTHV 1CIGA 3L4OA 4N0KA 1CC5A 1I6EA 1HCMA 3RMZA 1FI7A 1H9XA 3CXHW 1YTCA 3OA8B 1IZL0 1N50A 3KZIV 2FYUD 1NMLA 1CIFA 3O20A 1B7VA 2JTIB 2DVHA 3SJLA 3CXHD 2GB8B 3A0HV 5KKZB 2ZXYA 2GC7D 1C75A 1CTYA 1DIQC 2ORLA 1HZVA 1CHIA 1SQBD 5CIGB 1QL4A 4H0KA 4J20A 1DVVA 1CRJA 1CCHA 1NTKD 2CA4B 5CICB 4K3IA 1LS9A 3H1LD 2I8FA 1HROA 2YK3A 1CTZA 1NTZD 4EIFA 4L3GA 1FHBA 1L9JC 1CXCA 5CIHB 4FA5A 2B11B 2D0WA 2JQRA 4PWAA 4H0JA 5B66V 1NU1D 3HQ6A 5DJQB 1CIHA 1KYOW 2PACA 3L71D 1IRWA 1U75B 2C1DA 451CA 3PXWA 3WC8A 1WEJF 1CSVA 4FA4A 5AURA 3WFBC 3NWVA 1H31B 2PCBB 1WVEC 4WQ7A 1QL3A 5DFSA 1BE3D 1CSXA 2YCCA 1VYDA 3DP5A 155CA 3WU2V 1C7MA 1OCDA 3SLEA 1CSUA 2N9JA 1SQVD 2YQBA 1E8EA 1RAPA 2HV4A 4WQBA 2CXBA 4FB1A 2BH4X 3C2CA 1I8PA 4XXLA 4KMGA 2AXTV 3OCDB 1DW2A 2V07A 1LMSA 3CP5A 1YNRA 1I54A 4L1QA 3RN1A 1GJQA 2YIUB 1W5CT 4GYDA 3PXTA 3VNWA 1CEDA 1I55A 1KB0A 1IQCA 4WQEA 1E2RA 2ZBOA 1U74B 1FJ0A 3X39A 3PH2B 2ZZS1 1H9YA 3NBTA 1AKKA 4FA9A 3CYTI 1HRCA 1CXAA 4WQ9A 2BGVX 3ZBMA 1IRVA 1M70A 1GDVA 3H1KD 2C1UA 4JCGA 2BCCD 3L4MA 4O1QA 2QJKB 2FYNB 1ZZHA 1BGYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C9X B;  1PP9 D;  1BL9 A;  4WQA A;  1C52 A;  4AAO A;  2LIR A;  2C8S A;  3VRD A;  1E29 A;  1F1F A;  1CNO A;  3TYI A;  1A2S A;  3HQ8 A;  1ETP A;  2V08 A;  5CID B;  5DF5 A;  3MK7 C;  1S5L V;  1R0Q A;  5KAI V;  1DVH A;  4LJI A;  3WUI A;  4FAV A;  1N15 A;  1HJ4 A;  1H31 A;  3CWB D;  4XYD B;  4IL6 V;  1FOC A;  2XTS B;  5KLV D;  2QJP B;  1I5T A;  1YFC A;  2LIT A;  1COT A;  4QAO A;  2D0S A;  1OAE A;  1W2L A;  1DT1 A;  3RLM A;  1DW0 A;  3ORV A;  2DGE A;  5E79 V;  3H1I D;  1AOQ A;  3OCD A;  3WFC C;  1KYO D;  1L0L D;  4WQC A;  1NNO A;  1C6O A;  5C0Z A;  1CRH A;  2ZON G;  2BPB B;  1BCC D;  5CIB B;  1GKS A;  4EID A;  1CO6 A;  1CTJ A;  3TGU D;  1MG2 D;  2CA3 B;  3WFE C;  1C2N A;  1J3S A;  1CRG A;  2ZOO A;  2C2C A;  4AAL A;  1CYJ A;  4WQ8 A;  4AAN A;  4FAN A;  3H1J D;  2B10 B;  5GTI V;  3ZOY A;  351C A;  1A8C A;  1GIW A;  5B5E V;  1N90 A;  5DJQ C;  1I8O A;  1L9B C;  1CYI A;  5CYT R;  3SWS A;  2MTA C;  4AX3 A;  1K3H A;  3ZCF A;  2CE0 A;  3ZOO A;  5CIF B;  1H1O A;  1SQQ D;  2IBZ D;  3JBT B;  3O0R C;  3ZOX A;  5H2F V;  1PPJ D;  4O1W A;  2FRC A;  1HJ3 A;  3L70 D;  2B0Z B;  1YCC A;  1EZV D;  2OZ1 B;  1I6D A;  1FCD C;  2A06 D;  1ZRT D;  1IO3 A;  1KX7 A;  1H32 B;  3HQ7 A;  1YIC A;  2N18 B;  4Y5R A;  1NTM D;  1FI9 A;  4EIC A;  1LC1 A;  1YEA A;  2N9I A;  1KX2 A;  3HQ9 A;  2VHD A;  1KIB A;  2EXV A;  2N3Y A;  1LC2 A;  5KLI B;  3A9F A;  1NIR A;  1S6V B;  2GC4 D;  1NMI A;  4UB8 V;  3A0B V;  1M6Z A;  1EB7 A;  1GQ1 A;  1A56 A;  1CSW A;  1KB9 D;  2MHM A;  5B6Q A;  4AAM A;  4NFG B;  1YEB A;  1C6R A;  3H1H D;  1MZ4 A;  1HJ5 A;  5TIS V;  3ZIY A;  2BLF B;  3CU4 A;  1JDL A;  1RZ5 A;  1HZU A;  4MU8 A;  4P4Q B;  3DMI A;  1CHH A;  1M60 A;  2CE1 A;  1P84 D;  1CRI A;  4Q5P A;  4D6T D;  3RN0 A;  1CRC A;  4PD4 D;  2L4D A;  3O1Y A;  1RAQ A;  3PXS A;  3L72 D;  5C9M A;  3WFD C;  3L73 D;  3SXT A;  2QJY B;  3ZOW A;  1L0N D;  3O5C A;  2FWL A;  2N18 C;  1CIE A;  1CYC A;  4UB6 V;  1C2R A;  4V2K A;  3BCC D;  2C1V A;  1QYZ A;  1RZ6 A;  1MG3 D;  1QN2 A;  1SQP D;  1QKS A;  1CHJ A;  1SQX D;  1C6S A;  1N9C A;  4DY9 A;  2B12 B;  3M97 X;  1H33 A;  4EIE A;  1CRY A;  2OZ1 A;  2GIW A;  4YE1 A;  5KAF V;  1F1C A;  1H32 A;  2BCN B;  2N3B A;  1AOF A;  1CCR A;  2B4Z A;  1AYG A;  3CX5 W;  1GU2 A;  3DR0 A;  3OA8 A;  4PW9 B;  2C1D B;  1KV9 A;  4FA1 A;  2AI5 A;  3CX5 D;  1DII C;  3SVW A;  1LFM A;  4U3F D;  3MK7 B;  4L3H A;  3L75 D;  1YIQ A;  4RSZ A;  3VYM A;  2AIU A;  1DW1 A;  2BH5 X;  4WQD A;  1H33 B;  1K3G A;  1COR A;  2PCC B;  3NBS A;  4PJ0 V;  1FI3 A;  1DW3 A;  3L74 D;  5CIE B;  5EXQ A;  1HH7 A;  4GED B;  5IY5 1;  5GTH V;  1CIG A;  3L4O A;  4N0K A;  1CC5 A;  1I6E A;  1HCM A;  3RMZ A;  1FI7 A;  1H9X A;  3CXH W;  1YTC A;  3OA8 B;  1IZL 0;  1N50 A;  3KZI V;  2FYU D;  1NML A;  1CIF A;  3O20 A;  1B7V A;  2JTI B;  2DVH A;  3SJL A;  3CXH D;  2GB8 B;  3A0H V;  5KKZ B;  2ZXY A;  2GC7 D;  1C75 A;  1CTY A;  1DIQ C;  2ORL A;  1HZV A;  1CHI A;  1SQB D;  5CIG B;  1QL4 A;  4H0K A;  4J20 A;  1DVV A;  1CRJ A;  1CCH A;  1NTK D;  2CA4 B;  5CIC B;  4K3I A;  1LS9 A;  3H1L D;  2I8F A;  1HRO A;  2YK3 A;  1CTZ A;  1NTZ D;  4EIF A;  4L3G A;  1FHB A;  1L9J C;  1CXC A;  5CIH B;  4FA5 A;  2B11 B;  2D0W A;  2JQR A;  4PWA A;  4H0J A;  5B66 V;  1NU1 D;  3HQ6 A;  5DJQ B;  1CIH A;  1KYO W;  2PAC A;  3L71 D;  1IRW A;  1U75 B;  2C1D A;  451C A;  3PXW A;  3WC8 A;  1WEJ F;  1CSV A;  4FA4 A;  5AUR A;  3WFB C;  3NWV A;  1H31 B;  2PCB B;  1WVE C;  4WQ7 A;  1QL3 A;  5DFS A;  1BE3 D;  1CSX A;  2YCC A;  1VYD A;  3DP5 A;  155C A;  3WU2 V;  1C7M A;  1OCD A;  3SLE A;  1CSU A;  2N9J A;  1SQV D;  2YQB A;  1E8E A;  1RAP A;  2HV4 A;  4WQB A;  2CXB A;  4FB1 A;  2BH4 X;  3C2C A;  1I8P A;  4XXL A;  4KMG A;  2AXT V;  3OCD B;  1DW2 A;  2V07 A;  1LMS A;  3CP5 A;  1YNR A;  1I54 A;  4L1Q A;  3RN1 A;  1GJQ A;  2YIU B;  1W5C T;  4GYD A;  3PXT A;  3VNW A;  1CED A;  1I55 A;  1KB0 A;  1IQC A;  4WQE A;  1E2R A;  2ZBO A;  1U74 B;  1FJ0 A;  3X39 A;  3PH2 B;  2ZZS 1;  1H9Y A;  3NBT A;  1AKK A;  4FA9 A;  3CYT I;  1HRC A;  1CXA A;  4WQ9 A;  2BGV X;  3ZBM A;  1IRV A;  1M70 A;  1GDV A;  3H1K D;  2C1U A;  4JCG A;  2BCC D;  3L4M A;  4O1Q A;  2QJK B;  2FYN B;  1ZZH A;  1BGY D; 
#chains in the Genus database with same CATH topology
 2C9X B;  1PP9 D;  1BL9 A;  4WQA A;  1C52 A;  4AAO A;  2LIR A;  2C8S A;  3VRD A;  1E29 A;  1F1F A;  1CNO A;  3TYI A;  1A2S A;  3HQ8 A;  1ETP A;  2V08 A;  5CID B;  5DF5 A;  3MK7 C;  1S5L V;  1R0Q A;  5KAI V;  1DVH A;  4LJI A;  3WUI A;  4FAV A;  1N15 A;  1HJ4 A;  1H31 A;  3CWB D;  4XYD B;  4IL6 V;  1FOC A;  2XTS B;  5KLV D;  2QJP B;  1I5T A;  1YFC A;  2LIT A;  3D0W A;  1COT A;  4QAO A;  2D0S A;  1OAE A;  1W2L A;  1DT1 A;  3RLM A;  1DW0 A;  3ORV A;  2DGE A;  5E79 V;  3H1I D;  1AOQ A;  3OCD A;  3WFC C;  1KYO D;  1L0L D;  4WQC A;  1NNO A;  1C6O A;  5C0Z A;  1CRH A;  2ZON G;  2BPB B;  1BCC D;  5CIB B;  1GKS A;  4EID A;  1CO6 A;  1CTJ A;  3TGU D;  1MG2 D;  2CA3 B;  3WFE C;  1C2N A;  1J3S A;  1CRG A;  2ZOO A;  2C2C A;  4AAL A;  1CYJ A;  4WQ8 A;  4AAN A;  4FAN A;  3H1J D;  2B10 B;  5GTI V;  3ZOY A;  351C A;  1A8C A;  1GIW A;  5B5E V;  1N90 A;  5DJQ C;  1I8O A;  1L9B C;  1CYI A;  5CYT R;  3SWS A;  2MTA C;  4AX3 A;  1K3H A;  3ZCF A;  2CE0 A;  3ZOO A;  5CIF B;  1H1O A;  1SQQ D;  2IBZ D;  3JBT B;  3O0R C;  3ZOX A;  5H2F V;  1PPJ D;  4O1W A;  2FRC A;  1HJ3 A;  3L70 D;  2B0Z B;  1YCC A;  1EZV D;  2OZ1 B;  1I6D A;  1FCD C;  2A06 D;  1ZRT D;  1IO3 A;  1KX7 A;  1H32 B;  3HQ7 A;  1YIC A;  2N18 B;  4Y5R A;  1NTM D;  1FI9 A;  4EIC A;  1LC1 A;  1YEA A;  2N9I A;  1KX2 A;  3HQ9 A;  2VHD A;  1KIB A;  2EXV A;  2N3Y A;  1LC2 A;  5KLI B;  3A9F A;  1NIR A;  1S6V B;  2GC4 D;  1NMI A;  4UB8 V;  3A0B V;  1M6Z A;  1EB7 A;  1GQ1 A;  1A56 A;  1CSW A;  1KB9 D;  2MHM A;  5B6Q A;  4AAM A;  4NFG B;  1YEB A;  1C6R A;  3H1H D;  1MZ4 A;  1HJ5 A;  5TIS V;  3ZIY A;  2BLF B;  3CU4 A;  1JDL A;  1RZ5 A;  1HZU A;  4MU8 A;  4P4Q B;  3DMI A;  1CHH A;  1M60 A;  2CE1 A;  1P84 D;  1CRI A;  4Q5P A;  4D6T D;  3RN0 A;  1CRC A;  4PD4 D;  2L4D A;  3O1Y A;  1RAQ A;  3PXS A;  3L72 D;  5C9M A;  3WFD C;  3L73 D;  3SXT A;  2QJY B;  3ZOW A;  1L0N D;  3O5C A;  2FWL A;  2N18 C;  1CIE A;  1CYC A;  4UB6 V;  1C2R A;  4V2K A;  3BCC D;  2C1V A;  1QYZ A;  1RZ6 A;  1MG3 D;  1QN2 A;  1SQP D;  1QKS A;  1CHJ A;  1SQX D;  1C6S A;  1N9C A;  4DY9 A;  2B12 B;  3M97 X;  1H33 A;  4EIE A;  1CRY A;  2OZ1 A;  2GIW A;  4YE1 A;  5KAF V;  1F1C A;  1H32 A;  2BCN B;  2N3B A;  1AOF A;  1CCR A;  2B4Z A;  1AYG A;  3CX5 W;  1GU2 A;  3DR0 A;  3OA8 A;  4PW9 B;  2C1D B;  1KV9 A;  4FA1 A;  2AI5 A;  3CX5 D;  1DII C;  3SVW A;  1LFM A;  4U3F D;  3MK7 B;  4L3H A;  3L75 D;  1YIQ A;  4RSZ A;  3VYM A;  2AIU A;  1DW1 A;  2BH5 X;  4WQD A;  1H33 B;  1K3G A;  1COR A;  2PCC B;  3NBS A;  4PJ0 V;  1FI3 A;  1DW3 A;  3L74 D;  5CIE B;  5EXQ A;  1HH7 A;  4GED B;  5IY5 1;  5GTH V;  1CIG A;  3L4O A;  4N0K A;  1CC5 A;  1I6E A;  1HCM A;  3RMZ A;  1FI7 A;  1H9X A;  3CXH W;  1YTC A;  3OA8 B;  1IZL 0;  1N50 A;  3KZI V;  2FYU D;  1NML A;  1CIF A;  3O20 A;  1B7V A;  2JTI B;  2DVH A;  3SJL A;  3CXH D;  2GB8 B;  3A0H V;  5KKZ B;  2ZXY A;  2GC7 D;  1C75 A;  1CTY A;  1DIQ C;  2ORL A;  1HZV A;  1CHI A;  1SQB D;  5CIG B;  1QL4 A;  4H0K A;  4J20 A;  1DVV A;  1CRJ A;  1CCH A;  1NTK D;  2CA4 B;  5CIC B;  4K3I A;  1LS9 A;  3H1L D;  2I8F A;  1HRO A;  2YK3 A;  1CTZ A;  1NTZ D;  4EIF A;  4L3G A;  1FHB A;  1L9J C;  1CXC A;  5CIH B;  4FA5 A;  2B11 B;  2D0W A;  2JQR A;  4PWA A;  4H0J A;  5B66 V;  1NU1 D;  3HQ6 A;  5DJQ B;  1CIH A;  1KYO W;  2PAC A;  3L71 D;  1IRW A;  1U75 B;  2C1D A;  451C A;  3PXW A;  3WC8 A;  1WEJ F;  1CSV A;  4FA4 A;  5AUR A;  3WFB C;  3NWV A;  1H31 B;  2PCB B;  1WVE C;  4WQ7 A;  1QL3 A;  5DFS A;  1BE3 D;  1CSX A;  2YCC A;  1VYD A;  3DP5 A;  155C A;  3WU2 V;  1C7M A;  1OCD A;  3SLE A;  1CSU A;  2N9J A;  1SQV D;  2YQB A;  1E8E A;  1RAP A;  2HV4 A;  4WQB A;  2CXB A;  4FB1 A;  2BH4 X;  3C2C A;  1I8P A;  4XXL A;  4KMG A;  2AXT V;  3OCD B;  1DW2 A;  2V07 A;  1LMS A;  3CP5 A;  1YNR A;  1I54 A;  4L1Q A;  3RN1 A;  1GJQ A;  2YIU B;  1W5C T;  4GYD A;  3PXT A;  3VNW A;  1CED A;  1I55 A;  1KB0 A;  1IQC A;  4WQE A;  1E2R A;  2ZBO A;  1U74 B;  1FJ0 A;  3X39 A;  3PH2 B;  2ZZS 1;  1H9Y A;  3NBT A;  1AKK A;  4FA9 A;  3CYT I;  1HRC A;  1CXA A;  4WQ9 A;  2BGV X;  3ZBM A;  1IRV A;  1M70 A;  1GDV A;  3H1K D;  2C1U A;  4JCG A;  2BCC D;  3L4M A;  4O1Q A;  2QJK B;  2FYN B;  1ZZH A;  1BGY D; 
#chains in the Genus database with same CATH homology
 2C9X B;  1PP9 D;  1BL9 A;  4WQA A;  1C52 A;  4AAO A;  2LIR A;  2C8S A;  3VRD A;  1E29 A;  1F1F A;  1CNO A;  3TYI A;  1A2S A;  3HQ8 A;  1ETP A;  2V08 A;  5CID B;  5DF5 A;  3MK7 C;  1S5L V;  1R0Q A;  5KAI V;  1DVH A;  4LJI A;  3WUI A;  4FAV A;  1N15 A;  1HJ4 A;  1H31 A;  3CWB D;  4XYD B;  4IL6 V;  1FOC A;  2XTS B;  5KLV D;  2QJP B;  1I5T A;  1YFC A;  2LIT A;  1COT A;  4QAO A;  2D0S A;  1OAE A;  1W2L A;  1DT1 A;  3RLM A;  1DW0 A;  3ORV A;  2DGE A;  5E79 V;  3H1I D;  1AOQ A;  3OCD A;  3WFC C;  1KYO D;  1L0L D;  4WQC A;  1NNO A;  1C6O A;  5C0Z A;  1CRH A;  2ZON G;  2BPB B;  1BCC D;  5CIB B;  1GKS A;  4EID A;  1CO6 A;  1CTJ A;  3TGU D;  1MG2 D;  2CA3 B;  3WFE C;  1C2N A;  1J3S A;  1CRG A;  2ZOO A;  2C2C A;  4AAL A;  1CYJ A;  4WQ8 A;  4AAN A;  4FAN A;  3H1J D;  2B10 B;  5GTI V;  3ZOY A;  351C A;  1A8C A;  1GIW A;  5B5E V;  1N90 A;  5DJQ C;  1I8O A;  1L9B C;  1CYI A;  5CYT R;  3SWS A;  2MTA C;  4AX3 A;  1K3H A;  3ZCF A;  2CE0 A;  3ZOO A;  5CIF B;  1H1O A;  1SQQ D;  2IBZ D;  3JBT B;  3O0R C;  3ZOX A;  5H2F V;  1PPJ D;  4O1W A;  2FRC A;  1HJ3 A;  3L70 D;  2B0Z B;  1YCC A;  1EZV D;  2OZ1 B;  1I6D A;  1FCD C;  2A06 D;  1ZRT D;  1IO3 A;  1KX7 A;  1H32 B;  3HQ7 A;  1YIC A;  2N18 B;  4Y5R A;  1NTM D;  1FI9 A;  4EIC A;  1LC1 A;  1YEA A;  2N9I A;  1KX2 A;  3HQ9 A;  2VHD A;  1KIB A;  2EXV A;  2N3Y A;  1LC2 A;  5KLI B;  3A9F A;  1NIR A;  1S6V B;  2GC4 D;  1NMI A;  4UB8 V;  3A0B V;  1M6Z A;  1EB7 A;  1GQ1 A;  1A56 A;  1CSW A;  1KB9 D;  2MHM A;  5B6Q A;  4AAM A;  4NFG B;  1YEB A;  1C6R A;  3H1H D;  1MZ4 A;  1HJ5 A;  5TIS V;  3ZIY A;  2BLF B;  3CU4 A;  1JDL A;  1RZ5 A;  1HZU A;  4MU8 A;  4P4Q B;  3DMI A;  1CHH A;  1M60 A;  2CE1 A;  1P84 D;  1CRI A;  4Q5P A;  4D6T D;  3RN0 A;  1CRC A;  4PD4 D;  2L4D A;  3O1Y A;  1RAQ A;  3PXS A;  3L72 D;  5C9M A;  3WFD C;  3L73 D;  3SXT A;  2QJY B;  3ZOW A;  1L0N D;  3O5C A;  2FWL A;  2N18 C;  1CIE A;  1CYC A;  4UB6 V;  1C2R A;  4V2K A;  3BCC D;  2C1V A;  1QYZ A;  1RZ6 A;  1MG3 D;  1QN2 A;  1SQP D;  1QKS A;  1CHJ A;  1SQX D;  1C6S A;  1N9C A;  4DY9 A;  2B12 B;  3M97 X;  1H33 A;  4EIE A;  1CRY A;  2OZ1 A;  2GIW A;  4YE1 A;  5KAF V;  1F1C A;  1H32 A;  2BCN B;  2N3B A;  1AOF A;  1CCR A;  2B4Z A;  1AYG A;  3CX5 W;  1GU2 A;  3DR0 A;  3OA8 A;  4PW9 B;  2C1D B;  1KV9 A;  4FA1 A;  2AI5 A;  3CX5 D;  1DII C;  3SVW A;  1LFM A;  4U3F D;  3MK7 B;  4L3H A;  3L75 D;  1YIQ A;  4RSZ A;  3VYM A;  2AIU A;  1DW1 A;  2BH5 X;  4WQD A;  1H33 B;  1K3G A;  1COR A;  2PCC B;  3NBS A;  4PJ0 V;  1FI3 A;  1DW3 A;  3L74 D;  5CIE B;  5EXQ A;  1HH7 A;  4GED B;  5IY5 1;  5GTH V;  1CIG A;  3L4O A;  4N0K A;  1CC5 A;  1I6E A;  1HCM A;  3RMZ A;  1FI7 A;  1H9X A;  3CXH W;  1YTC A;  3OA8 B;  1IZL 0;  1N50 A;  3KZI V;  2FYU D;  1NML A;  1CIF A;  3O20 A;  1B7V A;  2JTI B;  2DVH A;  3SJL A;  3CXH D;  2GB8 B;  3A0H V;  5KKZ B;  2ZXY A;  2GC7 D;  1C75 A;  1CTY A;  1DIQ C;  2ORL A;  1HZV A;  1CHI A;  1SQB D;  5CIG B;  1QL4 A;  4H0K A;  4J20 A;  1DVV A;  1CRJ A;  1CCH A;  1NTK D;  2CA4 B;  5CIC B;  4K3I A;  1LS9 A;  3H1L D;  2I8F A;  1HRO A;  2YK3 A;  1CTZ A;  1NTZ D;  4EIF A;  4L3G A;  1FHB A;  1L9J C;  1CXC A;  5CIH B;  4FA5 A;  2B11 B;  2D0W A;  2JQR A;  4PWA A;  4H0J A;  5B66 V;  1NU1 D;  3HQ6 A;  5DJQ B;  1CIH A;  1KYO W;  2PAC A;  3L71 D;  1IRW A;  1U75 B;  2C1D A;  451C A;  3PXW A;  3WC8 A;  1WEJ F;  1CSV A;  4FA4 A;  5AUR A;  3WFB C;  3NWV A;  1H31 B;  2PCB B;  1WVE C;  4WQ7 A;  1QL3 A;  5DFS A;  1BE3 D;  1CSX A;  2YCC A;  1VYD A;  3DP5 A;  155C A;  3WU2 V;  1C7M A;  1OCD A;  3SLE A;  1CSU A;  2N9J A;  1SQV D;  2YQB A;  1E8E A;  1RAP A;  2HV4 A;  4WQB A;  2CXB A;  4FB1 A;  2BH4 X;  3C2C A;  1I8P A;  4XXL A;  4KMG A;  2AXT V;  3OCD B;  1DW2 A;  2V07 A;  1LMS A;  3CP5 A;  1YNR A;  1I54 A;  4L1Q A;  3RN1 A;  1GJQ A;  2YIU B;  1W5C T;  4GYD A;  3PXT A;  3VNW A;  1CED A;  1I55 A;  1KB0 A;  1IQC A;  4WQE A;  1E2R A;  2ZBO A;  1U74 B;  1FJ0 A;  3X39 A;  3PH2 B;  2ZZS 1;  1H9Y A;  3NBT A;  1AKK A;  4FA9 A;  3CYT I;  1HRC A;  1CXA A;  4WQ9 A;  2BGV X;  3ZBM A;  1IRV A;  1M70 A;  1GDV A;  3H1K D;  2C1U A;  4JCG A;  2BCC D;  3L4M A;  4O1Q A;  2QJK B;  2FYN B;  1ZZH A;  1BGY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...