3A0BV

Crystal structure of br-substituted photosystem ii complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
137
structure length
137
Chain Sequence
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 29
structure length 137
sequence length 137
chains with identical sequence v
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF14495 Cytochrom_C550 Cytochrome c-550 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3a0bV00
2V08A 3H1JD 1HZVA 4H0JA 2ZXYA 2CA4B 3L72D 1N90A 5C0ZA 1H9XA 1YEAA 1MZ4A 2N9JA 5GTHV 1A8CA 1H31A 2V07A 1CRCA 1BE3D 4AALA 4AAMA 3O20A 1CXAA 1I6EA 2B10B 1L9BC 2L4DA 4UB8V 4L1QA 3RLMA 3CP5A 4GEDB 2AXTV 1QN2A 3OCDB 3SWSA 1KX2A 2FRCA 1QKSA 3KZIV 4FA5A 4AANA 3CWBD 2MHMA 2ZBOA 1FJ0A 1NMIA 4JCGA 2A06D 4EIEA 1CRGA 2YQBA 4KMGA 1CHHA 1SQBD 1E2RA 1DVVA 2AIUA 1GU2A 1DT1A 3HQ8A 1YTCA 3NBSA 5DJQC 1CSUA 1C7MA 3M97X 3ZOWA 5CIFB 3DMIA 2C1VA 3CU4A 1DW0A 2IBZD 3DP5A 4PJ0V 3A0BV 3TYIA 1C2NA 1N50A 3OA8A 2CXBA 3O0RC 1QL3A 3ORVA 1F1CA 1I5TA 2GC7D 3PXTA 4D6TD 5CIDB 1CIGA 3PH2B 2N3BA 2PCBB 3CYTI 5KLVD 2DVHA 1CORA 1FCDC 3VRDA 1RZ6A 3H1KD 1NTKD 5B5EV 2C1UA 3PXWA 1C52A 3SXTA 1DIQC 2ZZS1 4EICA 1NTZD 1NU1D 4AX3A 2C9XB 3ZOOA 5DF5A 2B12B 1DIIC 1SQVD 1CC5A 1C75A 2PACA 1M60A 2GB8B 4PWAA 1AYGA 1AKKA 1IRVA 1B7VA 5CIEB 1I54A 1I6DA 3OA8B 3VNWA 3TGUD 4FANA 2MTAC 4WQ8A 3L70D 3OCDA 1LFMA 1KIBA 1P84D 2FYNB 1A2SA 3C2CA 4DY9A 1CCRA 1F1FA 3HQ7A 3RMZA 4EIDA 2YK3A 3A0HV 4WQ7A 1EZVD 1EB7A 4H0KA 1CYJA 5IY51 4MU8A 1L9JC 4AAOA 1CTZA 1ZRTD 1L0ND 1C6RA 3MK7B 1YIQA 4P4QB 3DR0A 1L0LD 1NIRA 1YFCA 1RAQA 1HCMA 1CIFA 1CRYA 4J20A 1SQQD 5TISV 3WUIA 3O5CA 1HRCA 4YE1A 1FI3A 5EXQA 2YCCA 1SQPD 3H1HD 4L3HA 4IL6V 2VHDA 4NFGB 2ZOOA 1WEJF 1KYOW 3H1ID 2GIWA 2PCCB 1GDVA 1HH7A 1N9CA 1U75B 3WU2V 2I8FA 2LITA 1DW3A 1OCDA 1CYCA 1BL9A 2OZ1B 1H32B 4O1WA 1FI9A 4WQ9A 4EIFA 1CNOA 1S6VB 4O1QA 1CSXA 3ZOXA 4PW9B 4FAVA 1AOFA 2FWLA 1M70A 2EXVA 1C6OA 2BGVX 1BCCD 3SVWA 1DW2A 1FOCA 4N0KA 1CIHA 1KYOD 4WQCA 5C9MA 3A9FA 155CA 2CE0A 1CSWA 1YCCA 1GQ1A 4RSZA 1OAEA 1KB9D 1CRIA 1H9YA 1M6ZA 5B66V 1FHBA 1MG2D 1E8EA 1CSVA 1NMLA 4WQDA 1BGYD 1C2RA 5E79V 1ZZHA 1CHJA 4FA1A 2BPBB 3CX5W 3RN0A 1HJ4A 1SQXD 2YIUB 4UB6V 5GTIV 2BH4X 1S5LV 1CYIA 3MK7C 1CIEA 4PD4D 1E29A 2XTSB 2AI5A 4Y5RA 3ZCFA 3WFEC 3ZOYA 5KLIB 1AOQA 5DFSA 1I55A 3L4OA 3L4MA 2GC4D 2QJYB 1LC1A 1IO3A 1CEDA 1HZUA 4WQBA 2B0ZB 5CIHB 2B4ZA 1KB0A 1W5CT 2CE1A 5CIGB 4FB1A 1HJ3A 2OZ1A 2N3YA 4XXLA 3VYMA 1H32A 5CICB 3ZIYA 3X39A 3NWVA 1CRHA 2QJKB 1NNOA 4V2KA 1CO6A 3NBTA 3BCCD 3CX5D 1C6SA 1PPJD 2BLFB 1FI7A 1I8PA 4U3FD 2ORLA 2JTIB 1LMSA 2N18C 3ZBMA 4XYDB 3L74D 3JBTB 1MG3D 1H33A 1HJ5A 2C1DB 5CYTR 4FA9A 1CHIA 1CCHA 1WVEC 1KV9A 1I8OA 1IQCA 5CIBB 1RZ5A 5AURA 3WC8A 1NTMD 1YICA 2N18B 3WFCC 3HQ6A 2JQRA 1CTYA 1LS9A 4K3IA 1PP9D 3L75D 2FYUD 1H31B 1CRJA 2C8SA 1K3HA 4GYDA 351CA 1RAPA 4QAOA 3WFDC 3WFBC 5DJQB 3SLEA 1JDLA 4L3GA 3CXHW 1IRWA 1COTA 1H33B 5KAIV 1IZL0 1QL4A 5B6QA 1DW1A 2CA3B 1A56A 2DGEA 4LJIA 1YNRA 1R0QA 2D0SA 2LIRA 4WQAA 1KX7A 1N15A 1DVHA 4Q5PA 1GIWA 2C2CA 2N9IA 2D0WA 1W2LA 1QYZA 2QJPB 1K3GA 1YEBA 2ZONG 2BH5X 5KAFV 3RN1A 4WQEA 1J3SA 1GKSA 1U74B 5KKZB 3HQ9A 2BCNB 2BCCD 2HV4A 1VYDA 1CTJA 3L73D 2B11B 1GJQA 1H1OA 3H1LD 2C1DA 1ETPA 1HROA 4FA4A 5H2FV 3CXHD 3O1YA 1CXCA 3PXSA 3SJLA 1LC2A 3L71D 451CA
chains in the Genus database with same CATH superfamily
2V08A 3H1JD 1HZVA 4H0JA 2ZXYA 2CA4B 3L72D 1N90A 5C0ZA 1H9XA 1YEAA 1MZ4A 2N9JA 5GTHV 1A8CA 1H31A 2V07A 1CRCA 1BE3D 4AALA 4AAMA 3O20A 1CXAA 1I6EA 2B10B 1L9BC 2L4DA 4UB8V 4L1QA 3RLMA 3CP5A 4GEDB 2AXTV 1QN2A 3OCDB 3SWSA 1KX2A 2FRCA 1QKSA 3KZIV 4FA5A 4AANA 3CWBD 2MHMA 2ZBOA 1FJ0A 1NMIA 4JCGA 2A06D 4EIEA 1CRGA 2YQBA 4KMGA 1CHHA 1SQBD 1E2RA 1DVVA 2AIUA 1GU2A 1DT1A 3HQ8A 1YTCA 3NBSA 5DJQC 1CSUA 1C7MA 3M97X 3ZOWA 5CIFB 3DMIA 2C1VA 3CU4A 1DW0A 2IBZD 3DP5A 4PJ0V 3A0BV 3TYIA 1C2NA 1N50A 3OA8A 2CXBA 3O0RC 1QL3A 3ORVA 1F1CA 1I5TA 2GC7D 3PXTA 4D6TD 5CIDB 1CIGA 3PH2B 2N3BA 2PCBB 3CYTI 5KLVD 2DVHA 1CORA 1FCDC 3VRDA 1RZ6A 3H1KD 1NTKD 5B5EV 2C1UA 3PXWA 1C52A 3SXTA 1DIQC 2ZZS1 4EICA 1NTZD 1NU1D 4AX3A 2C9XB 3ZOOA 5DF5A 2B12B 1DIIC 1SQVD 1CC5A 1C75A 2PACA 1M60A 2GB8B 4PWAA 1AYGA 1AKKA 1IRVA 1B7VA 5CIEB 1I54A 1I6DA 3OA8B 3VNWA 3TGUD 4FANA 2MTAC 4WQ8A 3L70D 3OCDA 1LFMA 1KIBA 1P84D 2FYNB 1A2SA 3C2CA 4DY9A 1CCRA 1F1FA 3HQ7A 3RMZA 4EIDA 2YK3A 3A0HV 4WQ7A 1EZVD 1EB7A 4H0KA 1CYJA 5IY51 4MU8A 1L9JC 4AAOA 1CTZA 1ZRTD 1L0ND 1C6RA 3MK7B 1YIQA 4P4QB 3DR0A 1L0LD 1NIRA 1YFCA 1RAQA 1HCMA 1CIFA 1CRYA 4J20A 1SQQD 5TISV 3WUIA 3O5CA 1HRCA 4YE1A 1FI3A 5EXQA 2YCCA 1SQPD 3H1HD 4L3HA 4IL6V 2VHDA 4NFGB 2ZOOA 1WEJF 1KYOW 3H1ID 2GIWA 2PCCB 1GDVA 1HH7A 1N9CA 1U75B 3WU2V 2I8FA 2LITA 1DW3A 1OCDA 1CYCA 1BL9A 2OZ1B 1H32B 4O1WA 1FI9A 4WQ9A 4EIFA 1CNOA 1S6VB 4O1QA 1CSXA 3ZOXA 4PW9B 4FAVA 1AOFA 2FWLA 1M70A 2EXVA 1C6OA 2BGVX 1BCCD 3SVWA 1DW2A 1FOCA 4N0KA 1CIHA 1KYOD 4WQCA 5C9MA 3A9FA 155CA 2CE0A 1CSWA 1YCCA 1GQ1A 4RSZA 1OAEA 1KB9D 1CRIA 1H9YA 1M6ZA 5B66V 1FHBA 1MG2D 1E8EA 1CSVA 1NMLA 4WQDA 1BGYD 1C2RA 5E79V 1ZZHA 1CHJA 4FA1A 2BPBB 3CX5W 3RN0A 1HJ4A 1SQXD 2YIUB 4UB6V 5GTIV 2BH4X 1S5LV 1CYIA 3MK7C 1CIEA 4PD4D 1E29A 2XTSB 2AI5A 4Y5RA 3ZCFA 3WFEC 3ZOYA 5KLIB 1AOQA 5DFSA 1I55A 3L4OA 3L4MA 2GC4D 2QJYB 1LC1A 1IO3A 1CEDA 1HZUA 4WQBA 2B0ZB 5CIHB 2B4ZA 1KB0A 1W5CT 2CE1A 5CIGB 4FB1A 1HJ3A 2OZ1A 2N3YA 4XXLA 3VYMA 1H32A 5CICB 3ZIYA 3X39A 3NWVA 1CRHA 2QJKB 1NNOA 4V2KA 1CO6A 3NBTA 3BCCD 3CX5D 1C6SA 1PPJD 2BLFB 1FI7A 1I8PA 4U3FD 2ORLA 2JTIB 1LMSA 2N18C 3ZBMA 4XYDB 3L74D 3JBTB 1MG3D 1H33A 1HJ5A 2C1DB 5CYTR 4FA9A 1CHIA 1CCHA 1WVEC 1KV9A 1I8OA 1IQCA 5CIBB 1RZ5A 5AURA 3WC8A 1NTMD 1YICA 2N18B 3WFCC 3HQ6A 2JQRA 1CTYA 1LS9A 4K3IA 1PP9D 3L75D 2FYUD 1H31B 1CRJA 2C8SA 1K3HA 4GYDA 351CA 1RAPA 4QAOA 3WFDC 3WFBC 5DJQB 3SLEA 1JDLA 4L3GA 3CXHW 1IRWA 1COTA 1H33B 5KAIV 1IZL0 1QL4A 5B6QA 1DW1A 2CA3B 1A56A 2DGEA 4LJIA 1YNRA 1R0QA 2D0SA 2LIRA 4WQAA 3D0WA 1N15A 1KX7A 1DVHA 4Q5PA 1GIWA 2C2CA 2N9IA 2D0WA 1W2LA 1QYZA 2QJPB 1K3GA 1YEBA 2ZONG 2BH5X 5KAFV 3RN1A 4WQEA 1J3SA 1GKSA 1U74B 5KKZB 3HQ9A 2BCNB 2BCCD 2HV4A 1VYDA 1CTJA 3L73D 2B11B 1GJQA 1H1OA 3H1LD 2C1DA 1ETPA 1HROA 4FA4A 5H2FV 3CXHD 3O1YA 1CXCA 3PXSA 3SJLA 1LC2A 3L71D 451CA
chains in the Genus database with same CATH topology
2V08A 3H1JD 1HZVA 4H0JA 2ZXYA 2CA4B 3L72D 1N90A 5C0ZA 1H9XA 1YEAA 1MZ4A 2N9JA 5GTHV 1A8CA 1H31A 2V07A 1CRCA 1BE3D 4AALA 4AAMA 3O20A 1CXAA 1I6EA 2B10B 1L9BC 2L4DA 4UB8V 4L1QA 3RLMA 3CP5A 4GEDB 2AXTV 1QN2A 3OCDB 3SWSA 1KX2A 2FRCA 1QKSA 3KZIV 4FA5A 4AANA 3CWBD 2MHMA 2ZBOA 1FJ0A 1NMIA 4JCGA 2A06D 4EIEA 1CRGA 2YQBA 4KMGA 1CHHA 1SQBD 1E2RA 1DVVA 2AIUA 1GU2A 1DT1A 3HQ8A 1YTCA 3NBSA 5DJQC 1CSUA 1C7MA 3M97X 3ZOWA 5CIFB 3DMIA 2C1VA 3CU4A 1DW0A 2IBZD 3DP5A 4PJ0V 3A0BV 3TYIA 1C2NA 1N50A 3OA8A 2CXBA 3O0RC 1QL3A 3ORVA 1F1CA 1I5TA 2GC7D 3PXTA 4D6TD 5CIDB 1CIGA 3PH2B 2N3BA 2PCBB 3CYTI 5KLVD 2DVHA 1CORA 1FCDC 3VRDA 1RZ6A 3H1KD 1NTKD 5B5EV 2C1UA 3PXWA 1C52A 3SXTA 1DIQC 2ZZS1 4EICA 1NTZD 1NU1D 4AX3A 2C9XB 3ZOOA 5DF5A 2B12B 1DIIC 1SQVD 1CC5A 1C75A 2PACA 1M60A 2GB8B 4PWAA 1AYGA 1AKKA 1IRVA 1B7VA 5CIEB 1I54A 1I6DA 3OA8B 3VNWA 3TGUD 4FANA 2MTAC 4WQ8A 3L70D 3OCDA 1LFMA 1KIBA 1P84D 2FYNB 1A2SA 3C2CA 4DY9A 1CCRA 1F1FA 3HQ7A 3RMZA 4EIDA 2YK3A 3A0HV 4WQ7A 1EZVD 1EB7A 4H0KA 1CYJA 5IY51 4MU8A 1L9JC 4AAOA 1CTZA 1ZRTD 1L0ND 1C6RA 3MK7B 1YIQA 4P4QB 3DR0A 1L0LD 1NIRA 1YFCA 1RAQA 1HCMA 1CIFA 1CRYA 4J20A 1SQQD 5TISV 3WUIA 3O5CA 1HRCA 4YE1A 1FI3A 5EXQA 2YCCA 1SQPD 3H1HD 4L3HA 4IL6V 2VHDA 4NFGB 2ZOOA 1WEJF 1KYOW 3H1ID 2GIWA 2PCCB 1GDVA 1HH7A 1N9CA 1U75B 3WU2V 2I8FA 2LITA 1DW3A 1OCDA 1CYCA 1BL9A 2OZ1B 1H32B 4O1WA 1FI9A 4WQ9A 4EIFA 1CNOA 1S6VB 4O1QA 1CSXA 3ZOXA 4PW9B 4FAVA 1AOFA 2FWLA 1M70A 2EXVA 1C6OA 2BGVX 1BCCD 3SVWA 1DW2A 1FOCA 4N0KA 1CIHA 1KYOD 4WQCA 5C9MA 3A9FA 155CA 2CE0A 1CSWA 1YCCA 1GQ1A 4RSZA 1OAEA 1KB9D 1CRIA 1H9YA 1M6ZA 5B66V 1FHBA 1MG2D 1E8EA 1CSVA 1NMLA 4WQDA 1BGYD 1C2RA 5E79V 1ZZHA 1CHJA 4FA1A 2BPBB 3CX5W 3RN0A 1HJ4A 1SQXD 2YIUB 4UB6V 5GTIV 2BH4X 1S5LV 1CYIA 3MK7C 1CIEA 4PD4D 1E29A 2XTSB 2AI5A 4Y5RA 3ZCFA 3WFEC 3ZOYA 5KLIB 1AOQA 5DFSA 1I55A 3L4OA 3L4MA 2GC4D 2QJYB 1LC1A 1IO3A 1CEDA 1HZUA 4WQBA 2B0ZB 5CIHB 2B4ZA 1KB0A 1W5CT 2CE1A 5CIGB 4FB1A 1HJ3A 2OZ1A 2N3YA 4XXLA 3VYMA 1H32A 5CICB 3ZIYA 3X39A 3NWVA 1CRHA 2QJKB 1NNOA 4V2KA 1CO6A 3NBTA 3BCCD 3CX5D 1C6SA 1PPJD 2BLFB 1FI7A 1I8PA 4U3FD 2ORLA 2JTIB 1LMSA 2N18C 3ZBMA 4XYDB 3L74D 3JBTB 1MG3D 1H33A 1HJ5A 2C1DB 5CYTR 4FA9A 1CHIA 1CCHA 1WVEC 1KV9A 1I8OA 1IQCA 5CIBB 1RZ5A 5AURA 3WC8A 1NTMD 1YICA 2N18B 3WFCC 3HQ6A 2JQRA 1CTYA 1LS9A 4K3IA 1PP9D 3L75D 2FYUD 1H31B 1CRJA 2C8SA 1K3HA 4GYDA 351CA 1RAPA 4QAOA 3WFDC 3WFBC 5DJQB 3SLEA 1JDLA 4L3GA 3CXHW 1IRWA 1COTA 1H33B 5KAIV 1IZL0 1QL4A 5B6QA 1DW1A 2CA3B 1A56A 2DGEA 4LJIA 1YNRA 1R0QA 2D0SA 2LIRA 4WQAA 1KX7A 1N15A 1DVHA 4Q5PA 1GIWA 2C2CA 2N9IA 2D0WA 1W2LA 1QYZA 2QJPB 1K3GA 1YEBA 2ZONG 2BH5X 5KAFV 3RN1A 4WQEA 1J3SA 1GKSA 1U74B 5KKZB 3HQ9A 2BCNB 2BCCD 2HV4A 1VYDA 1CTJA 3L73D 2B11B 1GJQA 1H1OA 3H1LD 2C1DA 1ETPA 1HROA 4FA4A 5H2FV 3CXHD 3O1YA 1CXCA 3PXSA 3SJLA 1LC2A 3L71D 451CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V08 A;  3H1J D;  1HZV A;  4H0J A;  2ZXY A;  2CA4 B;  3L72 D;  1N90 A;  5C0Z A;  1H9X A;  1YEA A;  1MZ4 A;  2N9J A;  5GTH V;  1A8C A;  1H31 A;  2V07 A;  1CRC A;  1BE3 D;  4AAL A;  4AAM A;  3O20 A;  1CXA A;  1I6E A;  2B10 B;  1L9B C;  2L4D A;  4UB8 V;  4L1Q A;  3RLM A;  3CP5 A;  4GED B;  2AXT V;  1QN2 A;  3OCD B;  3SWS A;  1KX2 A;  2FRC A;  1QKS A;  3KZI V;  4FA5 A;  4AAN A;  3CWB D;  2MHM A;  2ZBO A;  1FJ0 A;  1NMI A;  4JCG A;  2A06 D;  4EIE A;  1CRG A;  2YQB A;  4KMG A;  1CHH A;  1SQB D;  1E2R A;  1DVV A;  2AIU A;  1GU2 A;  1DT1 A;  3HQ8 A;  1YTC A;  3NBS A;  5DJQ C;  1CSU A;  1C7M A;  3M97 X;  3ZOW A;  5CIF B;  3DMI A;  2C1V A;  3CU4 A;  1DW0 A;  2IBZ D;  3DP5 A;  4PJ0 V;  3A0B V;  3TYI A;  1C2N A;  1N50 A;  3OA8 A;  2CXB A;  3O0R C;  1QL3 A;  3ORV A;  1F1C A;  1I5T A;  2GC7 D;  3PXT A;  4D6T D;  5CID B;  1CIG A;  3PH2 B;  2N3B A;  2PCB B;  3CYT I;  5KLV D;  2DVH A;  1COR A;  1FCD C;  3VRD A;  1RZ6 A;  3H1K D;  1NTK D;  5B5E V;  2C1U A;  3PXW A;  1C52 A;  3SXT A;  1DIQ C;  2ZZS 1;  4EIC A;  1NTZ D;  1NU1 D;  4AX3 A;  2C9X B;  3ZOO A;  5DF5 A;  2B12 B;  1DII C;  1SQV D;  1CC5 A;  1C75 A;  2PAC A;  1M60 A;  2GB8 B;  4PWA A;  1AYG A;  1AKK A;  1IRV A;  1B7V A;  5CIE B;  1I54 A;  1I6D A;  3OA8 B;  3VNW A;  3TGU D;  4FAN A;  2MTA C;  4WQ8 A;  3L70 D;  3OCD A;  1LFM A;  1KIB A;  1P84 D;  2FYN B;  1A2S A;  3C2C A;  4DY9 A;  1CCR A;  1F1F A;  3HQ7 A;  3RMZ A;  4EID A;  2YK3 A;  3A0H V;  4WQ7 A;  1EZV D;  1EB7 A;  4H0K A;  1CYJ A;  5IY5 1;  4MU8 A;  1L9J C;  4AAO A;  1CTZ A;  1ZRT D;  1L0N D;  1C6R A;  3MK7 B;  1YIQ A;  4P4Q B;  3DR0 A;  1L0L D;  1NIR A;  1YFC A;  1RAQ A;  1HCM A;  1CIF A;  1CRY A;  4J20 A;  1SQQ D;  5TIS V;  3WUI A;  3O5C A;  1HRC A;  4YE1 A;  1FI3 A;  5EXQ A;  2YCC A;  1SQP D;  3H1H D;  4L3H A;  4IL6 V;  2VHD A;  4NFG B;  2ZOO A;  1WEJ F;  1KYO W;  3H1I D;  2GIW A;  2PCC B;  1GDV A;  1HH7 A;  1N9C A;  1U75 B;  3WU2 V;  2I8F A;  2LIT A;  1DW3 A;  1OCD A;  1CYC A;  1BL9 A;  2OZ1 B;  1H32 B;  4O1W A;  1FI9 A;  4WQ9 A;  4EIF A;  1CNO A;  1S6V B;  4O1Q A;  1CSX A;  3ZOX A;  4PW9 B;  4FAV A;  1AOF A;  2FWL A;  1M70 A;  2EXV A;  1C6O A;  2BGV X;  1BCC D;  3SVW A;  1DW2 A;  1FOC A;  4N0K A;  1CIH A;  1KYO D;  4WQC A;  5C9M A;  3A9F A;  155C A;  2CE0 A;  1CSW A;  1YCC A;  1GQ1 A;  4RSZ A;  1OAE A;  1KB9 D;  1CRI A;  1H9Y A;  1M6Z A;  5B66 V;  1FHB A;  1MG2 D;  1E8E A;  1CSV A;  1NML A;  4WQD A;  1BGY D;  1C2R A;  5E79 V;  1ZZH A;  1CHJ A;  4FA1 A;  2BPB B;  3CX5 W;  3RN0 A;  1HJ4 A;  1SQX D;  2YIU B;  4UB6 V;  5GTI V;  2BH4 X;  1S5L V;  1CYI A;  3MK7 C;  1CIE A;  4PD4 D;  1E29 A;  2XTS B;  2AI5 A;  4Y5R A;  3ZCF A;  3WFE C;  3ZOY A;  5KLI B;  1AOQ A;  5DFS A;  1I55 A;  3L4O A;  3L4M A;  2GC4 D;  2QJY B;  1LC1 A;  1IO3 A;  1CED A;  1HZU A;  4WQB A;  2B0Z B;  5CIH B;  2B4Z A;  1KB0 A;  1W5C T;  2CE1 A;  5CIG B;  4FB1 A;  1HJ3 A;  2OZ1 A;  2N3Y A;  4XXL A;  3VYM A;  1H32 A;  5CIC B;  3ZIY A;  3X39 A;  3NWV A;  1CRH A;  2QJK B;  1NNO A;  4V2K A;  1CO6 A;  3NBT A;  3BCC D;  3CX5 D;  1C6S A;  1PPJ D;  2BLF B;  1FI7 A;  1I8P A;  4U3F D;  2ORL A;  2JTI B;  1LMS A;  2N18 C;  3ZBM A;  4XYD B;  3L74 D;  3JBT B;  1MG3 D;  1H33 A;  1HJ5 A;  2C1D B;  5CYT R;  4FA9 A;  1CHI A;  1CCH A;  1WVE C;  1KV9 A;  1I8O A;  1IQC A;  5CIB B;  1RZ5 A;  5AUR A;  3WC8 A;  1NTM D;  1YIC A;  2N18 B;  3WFC C;  3HQ6 A;  2JQR A;  1CTY A;  1LS9 A;  4K3I A;  1PP9 D;  3L75 D;  2FYU D;  1H31 B;  1CRJ A;  2C8S A;  1K3H A;  4GYD A;  351C A;  1RAP A;  4QAO A;  3WFD C;  3WFB C;  5DJQ B;  3SLE A;  1JDL A;  4L3G A;  3CXH W;  1IRW A;  1COT A;  1H33 B;  5KAI V;  1IZL 0;  1QL4 A;  5B6Q A;  1DW1 A;  2CA3 B;  1A56 A;  2DGE A;  4LJI A;  1YNR A;  1R0Q A;  2D0S A;  2LIR A;  4WQA A;  1KX7 A;  1N15 A;  1DVH A;  4Q5P A;  1GIW A;  2C2C A;  2N9I A;  2D0W A;  1W2L A;  1QYZ A;  2QJP B;  1K3G A;  1YEB A;  2ZON G;  2BH5 X;  5KAF V;  3RN1 A;  4WQE A;  1J3S A;  1GKS A;  1U74 B;  5KKZ B;  3HQ9 A;  2BCN B;  2BCC D;  2HV4 A;  1VYD A;  1CTJ A;  3L73 D;  2B11 B;  1GJQ A;  1H1O A;  3H1L D;  2C1D A;  1ETP A;  1HRO A;  4FA4 A;  5H2F V;  3CXH D;  3O1Y A;  1CXC A;  3PXS A;  3SJL A;  1LC2 A;  3L71 D;  451C A; 
#chains in the Genus database with same CATH topology
 2V08 A;  3H1J D;  1HZV A;  4H0J A;  2ZXY A;  2CA4 B;  3L72 D;  1N90 A;  5C0Z A;  1H9X A;  1YEA A;  1MZ4 A;  2N9J A;  5GTH V;  1A8C A;  1H31 A;  2V07 A;  1CRC A;  1BE3 D;  4AAL A;  4AAM A;  3O20 A;  1CXA A;  1I6E A;  2B10 B;  1L9B C;  2L4D A;  4UB8 V;  4L1Q A;  3RLM A;  3CP5 A;  4GED B;  2AXT V;  1QN2 A;  3OCD B;  3SWS A;  1KX2 A;  2FRC A;  1QKS A;  3KZI V;  4FA5 A;  4AAN A;  3CWB D;  2MHM A;  2ZBO A;  1FJ0 A;  1NMI A;  4JCG A;  2A06 D;  4EIE A;  1CRG A;  2YQB A;  4KMG A;  1CHH A;  1SQB D;  1E2R A;  1DVV A;  2AIU A;  1GU2 A;  1DT1 A;  3HQ8 A;  1YTC A;  3NBS A;  5DJQ C;  1CSU A;  1C7M A;  3M97 X;  3ZOW A;  5CIF B;  3DMI A;  2C1V A;  3CU4 A;  1DW0 A;  2IBZ D;  3DP5 A;  4PJ0 V;  3A0B V;  3TYI A;  1C2N A;  1N50 A;  3OA8 A;  2CXB A;  3O0R C;  1QL3 A;  3ORV A;  1F1C A;  1I5T A;  2GC7 D;  3PXT A;  4D6T D;  5CID B;  1CIG A;  3PH2 B;  2N3B A;  2PCB B;  3CYT I;  5KLV D;  2DVH A;  1COR A;  1FCD C;  3VRD A;  1RZ6 A;  3H1K D;  1NTK D;  5B5E V;  2C1U A;  3PXW A;  1C52 A;  3SXT A;  1DIQ C;  2ZZS 1;  4EIC A;  1NTZ D;  1NU1 D;  4AX3 A;  2C9X B;  3ZOO A;  5DF5 A;  2B12 B;  1DII C;  1SQV D;  1CC5 A;  1C75 A;  2PAC A;  1M60 A;  2GB8 B;  4PWA A;  1AYG A;  1AKK A;  1IRV A;  1B7V A;  5CIE B;  1I54 A;  1I6D A;  3OA8 B;  3VNW A;  3TGU D;  4FAN A;  2MTA C;  4WQ8 A;  3L70 D;  3OCD A;  1LFM A;  1KIB A;  1P84 D;  2FYN B;  1A2S A;  3C2C A;  4DY9 A;  1CCR A;  1F1F A;  3HQ7 A;  3RMZ A;  4EID A;  2YK3 A;  3A0H V;  4WQ7 A;  1EZV D;  1EB7 A;  4H0K A;  1CYJ A;  5IY5 1;  4MU8 A;  1L9J C;  4AAO A;  1CTZ A;  1ZRT D;  1L0N D;  1C6R A;  3MK7 B;  1YIQ A;  4P4Q B;  3DR0 A;  1L0L D;  1NIR A;  1YFC A;  1RAQ A;  1HCM A;  1CIF A;  1CRY A;  4J20 A;  1SQQ D;  5TIS V;  3WUI A;  3O5C A;  1HRC A;  4YE1 A;  1FI3 A;  5EXQ A;  2YCC A;  1SQP D;  3H1H D;  4L3H A;  4IL6 V;  2VHD A;  4NFG B;  2ZOO A;  1WEJ F;  1KYO W;  3H1I D;  2GIW A;  2PCC B;  1GDV A;  1HH7 A;  1N9C A;  1U75 B;  3WU2 V;  2I8F A;  2LIT A;  1DW3 A;  1OCD A;  1CYC A;  1BL9 A;  2OZ1 B;  1H32 B;  4O1W A;  1FI9 A;  4WQ9 A;  4EIF A;  1CNO A;  1S6V B;  4O1Q A;  1CSX A;  3ZOX A;  4PW9 B;  4FAV A;  1AOF A;  2FWL A;  1M70 A;  2EXV A;  1C6O A;  2BGV X;  1BCC D;  3SVW A;  1DW2 A;  1FOC A;  4N0K A;  1CIH A;  1KYO D;  4WQC A;  5C9M A;  3A9F A;  155C A;  2CE0 A;  1CSW A;  1YCC A;  1GQ1 A;  4RSZ A;  1OAE A;  1KB9 D;  1CRI A;  1H9Y A;  1M6Z A;  5B66 V;  1FHB A;  1MG2 D;  1E8E A;  1CSV A;  1NML A;  4WQD A;  1BGY D;  1C2R A;  5E79 V;  1ZZH A;  1CHJ A;  4FA1 A;  2BPB B;  3CX5 W;  3RN0 A;  1HJ4 A;  1SQX D;  2YIU B;  4UB6 V;  5GTI V;  2BH4 X;  1S5L V;  1CYI A;  3MK7 C;  1CIE A;  4PD4 D;  1E29 A;  2XTS B;  2AI5 A;  4Y5R A;  3ZCF A;  3WFE C;  3ZOY A;  5KLI B;  1AOQ A;  5DFS A;  1I55 A;  3L4O A;  3L4M A;  2GC4 D;  2QJY B;  1LC1 A;  1IO3 A;  1CED A;  1HZU A;  4WQB A;  2B0Z B;  5CIH B;  2B4Z A;  1KB0 A;  1W5C T;  2CE1 A;  5CIG B;  4FB1 A;  1HJ3 A;  2OZ1 A;  2N3Y A;  4XXL A;  3VYM A;  1H32 A;  5CIC B;  3ZIY A;  3X39 A;  3NWV A;  1CRH A;  2QJK B;  1NNO A;  4V2K A;  1CO6 A;  3NBT A;  3BCC D;  3CX5 D;  1C6S A;  1PPJ D;  2BLF B;  1FI7 A;  1I8P A;  4U3F D;  2ORL A;  2JTI B;  1LMS A;  2N18 C;  3ZBM A;  4XYD B;  3L74 D;  3JBT B;  1MG3 D;  1H33 A;  1HJ5 A;  2C1D B;  5CYT R;  4FA9 A;  1CHI A;  1CCH A;  1WVE C;  1KV9 A;  1I8O A;  1IQC A;  5CIB B;  1RZ5 A;  5AUR A;  3WC8 A;  1NTM D;  1YIC A;  2N18 B;  3WFC C;  3HQ6 A;  2JQR A;  1CTY A;  1LS9 A;  4K3I A;  1PP9 D;  3L75 D;  2FYU D;  1H31 B;  1CRJ A;  2C8S A;  1K3H A;  4GYD A;  351C A;  1RAP A;  4QAO A;  3WFD C;  3WFB C;  5DJQ B;  3SLE A;  1JDL A;  4L3G A;  3CXH W;  1IRW A;  1COT A;  1H33 B;  5KAI V;  1IZL 0;  1QL4 A;  5B6Q A;  1DW1 A;  2CA3 B;  1A56 A;  2DGE A;  4LJI A;  1YNR A;  1R0Q A;  2D0S A;  2LIR A;  4WQA A;  3D0W A;  1N15 A;  1KX7 A;  1DVH A;  4Q5P A;  1GIW A;  2C2C A;  2N9I A;  2D0W A;  1W2L A;  1QYZ A;  2QJP B;  1K3G A;  1YEB A;  2ZON G;  2BH5 X;  5KAF V;  3RN1 A;  4WQE A;  1J3S A;  1GKS A;  1U74 B;  5KKZ B;  3HQ9 A;  2BCN B;  2BCC D;  2HV4 A;  1VYD A;  1CTJ A;  3L73 D;  2B11 B;  1GJQ A;  1H1O A;  3H1L D;  2C1D A;  1ETP A;  1HRO A;  4FA4 A;  5H2F V;  3CXH D;  3O1Y A;  1CXC A;  3PXS A;  3SJL A;  1LC2 A;  3L71 D;  451C A; 
#chains in the Genus database with same CATH homology
 2V08 A;  3H1J D;  1HZV A;  4H0J A;  2ZXY A;  2CA4 B;  3L72 D;  1N90 A;  5C0Z A;  1H9X A;  1YEA A;  1MZ4 A;  2N9J A;  5GTH V;  1A8C A;  1H31 A;  2V07 A;  1CRC A;  1BE3 D;  4AAL A;  4AAM A;  3O20 A;  1CXA A;  1I6E A;  2B10 B;  1L9B C;  2L4D A;  4UB8 V;  4L1Q A;  3RLM A;  3CP5 A;  4GED B;  2AXT V;  1QN2 A;  3OCD B;  3SWS A;  1KX2 A;  2FRC A;  1QKS A;  3KZI V;  4FA5 A;  4AAN A;  3CWB D;  2MHM A;  2ZBO A;  1FJ0 A;  1NMI A;  4JCG A;  2A06 D;  4EIE A;  1CRG A;  2YQB A;  4KMG A;  1CHH A;  1SQB D;  1E2R A;  1DVV A;  2AIU A;  1GU2 A;  1DT1 A;  3HQ8 A;  1YTC A;  3NBS A;  5DJQ C;  1CSU A;  1C7M A;  3M97 X;  3ZOW A;  5CIF B;  3DMI A;  2C1V A;  3CU4 A;  1DW0 A;  2IBZ D;  3DP5 A;  4PJ0 V;  3A0B V;  3TYI A;  1C2N A;  1N50 A;  3OA8 A;  2CXB A;  3O0R C;  1QL3 A;  3ORV A;  1F1C A;  1I5T A;  2GC7 D;  3PXT A;  4D6T D;  5CID B;  1CIG A;  3PH2 B;  2N3B A;  2PCB B;  3CYT I;  5KLV D;  2DVH A;  1COR A;  1FCD C;  3VRD A;  1RZ6 A;  3H1K D;  1NTK D;  5B5E V;  2C1U A;  3PXW A;  1C52 A;  3SXT A;  1DIQ C;  2ZZS 1;  4EIC A;  1NTZ D;  1NU1 D;  4AX3 A;  2C9X B;  3ZOO A;  5DF5 A;  2B12 B;  1DII C;  1SQV D;  1CC5 A;  1C75 A;  2PAC A;  1M60 A;  2GB8 B;  4PWA A;  1AYG A;  1AKK A;  1IRV A;  1B7V A;  5CIE B;  1I54 A;  1I6D A;  3OA8 B;  3VNW A;  3TGU D;  4FAN A;  2MTA C;  4WQ8 A;  3L70 D;  3OCD A;  1LFM A;  1KIB A;  1P84 D;  2FYN B;  1A2S A;  3C2C A;  4DY9 A;  1CCR A;  1F1F A;  3HQ7 A;  3RMZ A;  4EID A;  2YK3 A;  3A0H V;  4WQ7 A;  1EZV D;  1EB7 A;  4H0K A;  1CYJ A;  5IY5 1;  4MU8 A;  1L9J C;  4AAO A;  1CTZ A;  1ZRT D;  1L0N D;  1C6R A;  3MK7 B;  1YIQ A;  4P4Q B;  3DR0 A;  1L0L D;  1NIR A;  1YFC A;  1RAQ A;  1HCM A;  1CIF A;  1CRY A;  4J20 A;  1SQQ D;  5TIS V;  3WUI A;  3O5C A;  1HRC A;  4YE1 A;  1FI3 A;  5EXQ A;  2YCC A;  1SQP D;  3H1H D;  4L3H A;  4IL6 V;  2VHD A;  4NFG B;  2ZOO A;  1WEJ F;  1KYO W;  3H1I D;  2GIW A;  2PCC B;  1GDV A;  1HH7 A;  1N9C A;  1U75 B;  3WU2 V;  2I8F A;  2LIT A;  1DW3 A;  1OCD A;  1CYC A;  1BL9 A;  2OZ1 B;  1H32 B;  4O1W A;  1FI9 A;  4WQ9 A;  4EIF A;  1CNO A;  1S6V B;  4O1Q A;  1CSX A;  3ZOX A;  4PW9 B;  4FAV A;  1AOF A;  2FWL A;  1M70 A;  2EXV A;  1C6O A;  2BGV X;  1BCC D;  3SVW A;  1DW2 A;  1FOC A;  4N0K A;  1CIH A;  1KYO D;  4WQC A;  5C9M A;  3A9F A;  155C A;  2CE0 A;  1CSW A;  1YCC A;  1GQ1 A;  4RSZ A;  1OAE A;  1KB9 D;  1CRI A;  1H9Y A;  1M6Z A;  5B66 V;  1FHB A;  1MG2 D;  1E8E A;  1CSV A;  1NML A;  4WQD A;  1BGY D;  1C2R A;  5E79 V;  1ZZH A;  1CHJ A;  4FA1 A;  2BPB B;  3CX5 W;  3RN0 A;  1HJ4 A;  1SQX D;  2YIU B;  4UB6 V;  5GTI V;  2BH4 X;  1S5L V;  1CYI A;  3MK7 C;  1CIE A;  4PD4 D;  1E29 A;  2XTS B;  2AI5 A;  4Y5R A;  3ZCF A;  3WFE C;  3ZOY A;  5KLI B;  1AOQ A;  5DFS A;  1I55 A;  3L4O A;  3L4M A;  2GC4 D;  2QJY B;  1LC1 A;  1IO3 A;  1CED A;  1HZU A;  4WQB A;  2B0Z B;  5CIH B;  2B4Z A;  1KB0 A;  1W5C T;  2CE1 A;  5CIG B;  4FB1 A;  1HJ3 A;  2OZ1 A;  2N3Y A;  4XXL A;  3VYM A;  1H32 A;  5CIC B;  3ZIY A;  3X39 A;  3NWV A;  1CRH A;  2QJK B;  1NNO A;  4V2K A;  1CO6 A;  3NBT A;  3BCC D;  3CX5 D;  1C6S A;  1PPJ D;  2BLF B;  1FI7 A;  1I8P A;  4U3F D;  2ORL A;  2JTI B;  1LMS A;  2N18 C;  3ZBM A;  4XYD B;  3L74 D;  3JBT B;  1MG3 D;  1H33 A;  1HJ5 A;  2C1D B;  5CYT R;  4FA9 A;  1CHI A;  1CCH A;  1WVE C;  1KV9 A;  1I8O A;  1IQC A;  5CIB B;  1RZ5 A;  5AUR A;  3WC8 A;  1NTM D;  1YIC A;  2N18 B;  3WFC C;  3HQ6 A;  2JQR A;  1CTY A;  1LS9 A;  4K3I A;  1PP9 D;  3L75 D;  2FYU D;  1H31 B;  1CRJ A;  2C8S A;  1K3H A;  4GYD A;  351C A;  1RAP A;  4QAO A;  3WFD C;  3WFB C;  5DJQ B;  3SLE A;  1JDL A;  4L3G A;  3CXH W;  1IRW A;  1COT A;  1H33 B;  5KAI V;  1IZL 0;  1QL4 A;  5B6Q A;  1DW1 A;  2CA3 B;  1A56 A;  2DGE A;  4LJI A;  1YNR A;  1R0Q A;  2D0S A;  2LIR A;  4WQA A;  1KX7 A;  1N15 A;  1DVH A;  4Q5P A;  1GIW A;  2C2C A;  2N9I A;  2D0W A;  1W2L A;  1QYZ A;  2QJP B;  1K3G A;  1YEB A;  2ZON G;  2BH5 X;  5KAF V;  3RN1 A;  4WQE A;  1J3S A;  1GKS A;  1U74 B;  5KKZ B;  3HQ9 A;  2BCN B;  2BCC D;  2HV4 A;  1VYD A;  1CTJ A;  3L73 D;  2B11 B;  1GJQ A;  1H1O A;  3H1L D;  2C1D A;  1ETP A;  1HRO A;  4FA4 A;  5H2F V;  3CXH D;  3O1Y A;  1CXC A;  3PXS A;  3SJL A;  1LC2 A;  3L71 D;  451C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...