1NU1D

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 52
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1nu1D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1nu1D01
4NFGB 3O0RC 2KNCB 2FYNB 4P4QB 2BH5X 2A06D 3CX5D 4FB1A 5DJQC 2Y0EA 3L73D 2L91A 3PRJA 1KX7A 1CYJA 1CCHA 3WFCC 1M6ZA 1C52A 1I6DA 1FCDC 4EIFA 1I8OA 4L3HA 1W5CT 1N50A 1GU2A 3A9FA 4WQ7A 3OCDA 2C1DB 5C9MA 2HV4A 1H9XA 3RN0A 155CA 3HQ7A 4PWAA 4UB6V 1CNOA 5IY51 4EIDA 3PTZA 3ZOOA 3WC8A 1BL9A 2XTSB 3C2CA 1ZRTD 1L9JC 1AKKA 2V08A 1GDVA 1EZVD 1CTJA 3SVWA 1IQCA 1HCMA 4QAOA 2QJPB 5TISV 3OCDB 2ZXYA 3H1LD 4D6TD 1CEDA 1E29A 1I8PA 5CIGB 3TGUD 1IRVA 2MTAC 1CC5A 2PACA 1DW2A 3SLEA 3HQ9A 2CA3B 3ZIYA 1LC1A 1H33B 5CICB 1ZZHA 1C7MA 5CIBB 3ZOXA 1NNOA 1C6OA 5CIFB 4FANA 1BCCD 1QL3A 1H31A 5KLIB 4FAVA 1CORA 1YIQA 4FA1A 3H1JD 3CP5A 3WFDC 3PXWA 1KB0A 3WU2V 3MK7B 1AYGA 4WQDA 1FI7A 3O5CA 2L4DA 1I55A 1HRCA 2N9IA 3JBTB 2MHMA 1A2SA 1GQ1A 1WVEC 1EB7A 5EXQA 5C0ZA 2GIWA 2C1VA 1N15A 3TF5A 1NIRA 1FI9A 1CRIA 1LFMA 1SQBD 1S6VB 1E8EA 1HROA 1MG3D 2CE1A 1B7VA 1LS9A 1J3SA 2CE0A 2LITA 5E79V 2O3JA 2FYUD 5AURA 1MG2D 1CSWA 3A0BV 4K3IA 1U75B 1YICA 2N3BA 3L4MA 5DF5A 3KHUA 1M60A 5KAIV 2PCCB 4WQ9A 2ORLA 1AOFA 5KLVD 2N9YB 2C1DA 3L4OA 4O1QA 3HQ8A 5B6QA 4A7PA 3NBSA 3VMAA 1U74B 4H0KA 1L0LD 2ZONG 1CRJA 3L72D 4WQBA 4YE1A 2BH4X 2LIRA 2ZZS1 3L75D 3SWSA 1H32B 3ZOWA 3WFEC 2AXTV 1C2NA 1LMSA 3MK7C 1KX2A 3GW6A 3CXHD 1KB9D 1CXAA 1CCRA 1CYIA 1H33A 1F1FA 3VNWA 3VRDA 5CYTR 1DW0A 2GC4D 4DY9A 2BCNB 1YFCA 2RMZA 2OZ1B 3CXHW 2CA4B 5B5EV 2GB8B 4RSZA 4FA4A 2N18B 4L3GA 4WQAA 1YCCA 1C2RA 2YK3A 1SQPD 1HJ5A 1C6RA 3VYMA 3H1KD 1CYCA 2BPBB 1KYOD 4J20A 2V07A 1QL4A 2Y0CA 4AAMA 1QYZA 2YCCA 1CIHA 2BGVX 3ZOYA 3NBTA 2CXBA 3A0HV 5KKZB 3L74D 1I54A 1KYOW 4MU8A 2JWAA 4WQEA 4AAOA 3WUIA 2FRCA 1KIBA 2C9XB 3FWLA 1CRGA 3X39A 1YEAA 4LJIA 1S5LV 1DT1A 2IBZD 2ZOOA 4WQ8A 1NTZD 1JDLA 5TJHA 1NMLA 1CRCA 5DFSA 1CIEA 4AANA 4AALA 3ZCFA 2JQRA 1RAQA 1SQVD 1PP9D 3ORVA 1CSUA 1F1CA 1L0ND 2BCCD 1H9YA 3CU4A 4WQCA 1GIWA 3OA8A 3SJLA 5H2FV 1H32A 2DVHA 1K3HA 1M70A 3CWBD 4Y5RA 2B10B 4H0JA 1QKSA 2KS1A 1IZL0 4RJTA 1GJQA 1HZUA 1P84D 2AIUA 451CA 4Q5PA 2Y0DA 1C75A 1HJ4A 1CHJA 4UB8V 5CIDB 1CTZA 2N18C 1A56A 4O1WA 1OAEA 2JTIB 1KV9A 2BLFB 3PH2B 3TYIA 1C6SA 4L1QA 3ZBMA 1WEJF 4JCGA 1RZ6A 2QJKB 4PJ0V 3OA8B 1HZVA 2C1UA 3PXSA 1FI3A 2RN0A 2OZ1A 5B66V 4V2KA 2K9JB 2AI5A 5GTHV 5CIHB 1COTA 1MZ4A 1CXCA 1IRWA 351CA 1DW3A 1CIGA 1GKSA 1DIIC 1CSXA 1VYDA 3GG2A 3NWVA 1BE3D 3CX5W 1YNRA 2QG4A 2C2CA 2DGEA 2D0SA 1CHHA 2B11B 5GTIV 2B12B 4EICA 4FA9A 1DIQC 1CIFA 1NU1D 4PD4D 2YQBA 3ITKA 3BCCD 2I8FA 1R0QA 1SQQD 4XXLA 1E2RA 3M97X 2B0ZB 2D0WA 3DP5A 3DR0A 4EDFA 2QJYB 1YTCA 1HH7A 1N90A 1OCDA 3KZIV 1RZ5A 3H1HD 3RLMA 1HJ3A 3L70D 1I5TA 2B4ZA 3H1ID 1CTYA 5DJQB 3L71D 1FOCA 1SQXD 1LC2A 1QN2A 1CSVA 3HQ6A 4N0KA 3RN1A 1AOQA 1CHIA 1K3GA 3WFBC 4PW9B 4GEDB 2ZBOA 2EXVA 1A8CA 3PXTA 3PHLA 3CYTI 1FJ0A 1CO6A 1PPJD 3DMIA 1I6EA 1W2LA 2PCBB 3RMZA 1CRYA 2N9JA 2FWLA 3PLNA 2C8SA 5KAFV 3TDKA 1L9BC 1RAPA 1BGYD 4GYDA 1NTMD 3O20A 1DW1A 4XYDB 3SXTA 1DVVA 2N3YA 4FA5A 1H31B 5CIEB 4AX3A 4EIEA 4IL6V 1IO3A 2YIUB 4KMGA 1ETPA 4U3FD 1FHBA 1NMIA 2GC7D 3O1YA 2Q3EA 1DVHA 2VHDA 1YEBA 1CRHA 1NTKD 1N9CA 1H1OA
chains in the Genus database with same CATH superfamily
3M0DA 4NFGB 1A02F 3OAKA 2FYNB 2B89A 2E76B 3CX5D 1DD4A 3BRTB 3L73D 2L91A 1DX7A 1NU1E 3KQGA 1T6AA 5H2FH 4PD4E 3PRJA 3BCCE 1J2JB 1M6ZA 1SQQE 2E74C 1GL2A 1I6DA 2G3AA 2YO3A 3CMEP 1I8OA 2O1JA 4UB8H 1CW5A 2OYHC 2Q1KA 3P7KA 1EZVE 1H9XA 3RN0A 3T97B 155CA 1BSHA 3LW5H 3B4SA 2K88A 3L70E 4UB6V 1LTJB 5IY51 4HYTB 4EIDA 3RL0B 1L9JC 1GL2B 2M0BA 1AKKA 3JCUE 1VQMP 3AEAC 2V08A 2I1KA 1CTJA 1QGKB 2WMMA 1IQCA 1L4AD 1OIPA 1USDA 2ZXYA 3H1LD 4D6TD 1H88A 1EDLA 4AUWA 1EXIA 1IRVA 2MTAC 4IL6E 1QX8A 2PACA 1DW2A 3HQ9A 3V2NA 1LC1A 1SQPG 1IK9A 1U7MA 4OWFA 1C6OA 2E5YA 5GTIH 1BCCD 3N4XA 2FYNC 2ZT9D 1CORA 1YIQA 2E76C 1M1JB 1NTME 2Q9IA 4XE5B 3WU2V 4L76A 1FI7A 1KYOI 2L4DA 4LC1A 4PV1D 1I55A 1SQXG 1NTKK 1GU4A 1GQ1A 3A3YB 3H32A 1EB7A 2WWWA 3KZIH 5AW9B 1RE3C 1NIRA 1CZQA 3B5ND 1M8OB 1SQBD 2AEMA 1HROA 1LTJC 1B7VA 4M3LA 1VQNP 4HJGH 1LTGC 1SFCB 1RH5B 1LTIC 2LITA 3RL0C 2B87A 5APQA 3UIAA 3L73E 2P67A 1GL2C 1BDDA 2N3BA 3KHUA 1VQ7P 3H32B 5KAIV 2ORLA 5KLVD 2C1DA 1NU1K 3SWKA 3HQ8A 1FZAA 3SFDC 2AEJA 1U74B 1TU3F 2E75D 5TISE 2ZZS1 3O6QB 3GF3A 3ZOWA 1BDCA 1M1JC 3N7NA 5KLVJ 3GHGA 1LMSA 2R3SA 2M3EA 4H44D 4WY4A 3VYIA 4GT1A 1NYHA 4IL6X 2KUBA 1CXAA 3H1LE 4D6TE 3VRDA 3H6PA 1OZHA 2JKVA 1RQVA 3P8CD 2XU6A 4O9BA 2WT7A 1BCCE 1M56D 1MFZA 3GHGB 2CA4B 5B5EV 1SFCC 2N18B 2PP6A 2A45H 1SQPD 1HJ5A 4JYCA 5BVZA 4PD4I 1FOSE 1N8RQ 1HGVA 2ZXXA 1QL4A 2XDJA 1QYZA 1X0TA 2BGVX 1PGJA 4L74A 3A0HV 1SQBE 4R4MA 1OW7A 1I54A 1KYOW 1SQVE 3M0AA 3WUIA 2C9XB 3CCLP 4WQ8A 4DZOA 1JDLA 1AA0A 2OTLP 1EXJA 2FXMA 3WUUA 1CIEA 3CXHH 1QL2A 2C0XA 1KILA 1PP9D 2N9BA 5CHXA 3RBXA 2PRRA 4EIJA 1H9YA 2GM4A 4WQCA 1JY3O 1LWUA 4L73A 2P1JA 5AVWB 3E1RA 2KYVA 4Q5PA 1N86A 1HTLC 3M91A 1HJ4A 5CIDB 4H13D 2N18C 1PP9J 1KV9A 1PV3A 2QJYC 3KXDA 1C6SA 4LGDE 1WEJF 2FYUJ 1RZ6A 2QJKB 2KIKA 5CCGD 4PJ0V 3MHVA 1URQA 1FI3A 2BEQD 2WTYA 2A45G 2P10A 2I8DA 2K9JB 2E43A 1JO5A 1WMKA 3CL3D 3P8CE 3S1KA 1CXCA 3CLQA 4C7NA 1Q81Q 1YYCA 2Q3IA 1GW4A 1GKSA 2PGDA 3A0BH 1VYDA 2ZVNB 4W80A 3L75J 1GD2E 1BE3D 1SQPE 1YNRA 2D0SA 2B12B 4EICA 2PFXA 5K5GB 2VRSA 3M06A 2ZT9B 2B0ZB 3NMDA 2R5DA 1ZW0A 3DP5A 3V4QA 1RE4A 3KDPB 3DR0A 4BWNA 1SQXE 1P84H 2AXTH 1YTCA 1BE3J 2CPSA 2P58A 2Z4EA 3V6IA 2CK3H 2KLUA 5H2FE 4GDOA 1LTBC 3H1HD 1SQVK 1EQ7A 1I5TA 3GMAA 3H1ID 1CTYA 2ZYGA 3L71D 3EWKA 2HODB 1OMIA 4UB8E 4ZKUA 3TGUG 1QN2A 2QJKC 3HQ6A 1VDFA 3W67A 3RN1A 1IFIA 4PW9B 3H1KJ 1VL2A 2OGUA 1T3UA 2ZBOA 2EXVA 1Y47A 2H7HA 3H1HJ 1A8CA 4N6JA 1S9KD 1FJ0A 2PCBB 5APUA 2KSJA 3L71J 3L74J 1CRYA 3G71P 3EQ2A 1OVRA 1RAPA 1BGYD 3HRNA 1RF1A 1YIJP 3O20A 1W2BO 1PGPA 2IBZG 4DJGA 1DVVA 3I55P 1H31B 4AX3A 3E1IA 4IL6V 1NKZB 1Z56A 2ZT9C 1HUCA 1VQ8P 5GTIE 1L0NG 2Q3EA 3E7KA 1MV8A 1KTMA 1SS1A 2FXPA 1NTKD 1BGYJ 4PV1C 3Q5PA 4WVZA 1AVOA 2OYIA 1RF1B 2OTJP 2KNCB 2YO2A 3KZIE 3G9RA 1AV1A 2ZYDA 3AEBC 1SQPK 1LNQA 1CYJA 2ITAA 1L0LG 3WFCC 3L72G 4EIFA 1NTKJ 2BASA 1IFDA 1JB0J 1LTAC 1N50A 1GU2A 1T2KD 3OCDA 3MZWB 3MUDC 5KJ7C 2YKQA 1SQXK 1CNOA 1Y8AA 2FFDB 2R32A 5APYA 5APSA 3H1IE 3ZOOA 1Q82Q 3WC8A 2XTSB 1AQTA 3C2CA 4HKZH 1R8EA 5GTHH 1JMBA 1EZVD 1PGQA 2OYHA 1YJWP 2D2CB 1S72P 2LR2A 5CMZA 1HCMA 2YMKA 5TISV 3OCDB 1NU1J 3CCRP 3TGUD 3BCCJ 1SQQJ 1S9KE 3CCSP 5AVSB 4YTPC 1UIXA 2POHA 3GF7A 1ZR4A 5CICB 1ZZHA 1C7MA 1LP1A 2GUSA 2IX7C 4FANA 1RF1C 1HJ0A 5KLIB 4Y28J 1LGHB 2PAJA 3L4FA 2NPSA 1HH0A 1OVUA 3L70J 1N7SB 3MK7B 3G6EP 4WQDA 2KB7P 2XNXA 3HD7B 1VQ6P 1JUNA 3O5CA 1W5CE 5KTBA 3G4SP 1HRCA 3RK2B 2N9IA 4IOIH 3VP9A 2MHMA 3TSIA 5EXQA 4WY4D 1N15A 3TF5A 2Q7CA 1CRIA 1OVVA 1LFMA 4RO0A 1S6VB 4C7RA 1IZNB 1K9MQ 4W7ZA 4Y99B 2QM7A 1FU1A 2FFDC 2NPSB 1FJPA 2O3JA 3TK1A 5AVQB 1U75B 1RE3A 1YICA 2WQYC 2PCCB 4WQ9A 1NTMJ 2D2CC 5AVZB 1AOFA 1YJNP 1GDTA 2N9YB 2XV5A 1G2CB 1EDIA 3T97A 2RH0A 3CC4P 2WPVB 5CBOA 3NBSA 1LTJA 3RGUA 1L0LD 1JY2N 4U3FG 3L72D 4GIFA 4YE1A 4AQRD 4R4LA 3VOPA 1ZMEC 1Y9BA 1IK7A 5CJ4A 2M3BA 1ZP0C 4DT0A 5KLIC 4NPDA 4GODA 3AEEC 2KS1B 2YKPA 1N7SC 3MK7C 5AW8B 3HD7C 1S1CX 1M90Q 1T8ZA 2H43A 3L73J 1KX2A 3GW6A 3RK2C 3VMYA 1K8AQ 1CYIA 3TGUE 1VQ4P 1KILD 4DY9A 1VQPP 2BCNB 2SPZA 3U1AA 3D6YA 2RMZA 1XTGB 1M1JA 2H89C 2OZ1B 4Y99C 3D71A 2NPSC 4RSZA 3FX0A 4L3GA 4WQAA 1C2RA 3IAOA 1C6RA 2W27A 5CCHC 1NJIQ 3Q5RA 2KP8A 3MD0A 2Y0CA 3A0BE 2IBZE 3RK3B 2YCCA 1CIHA 3KYQA 1G1IA 1IFJA 1GU5A 3ZOYA 3NBTA 1PFIA 1SFCA 2LKMA 3H1LJ 4D6TJ 2NZ2A 1URQD 4AYCA 1YHQP 3WUVA 1T3JA 2WSCH 3HTKB 1CRGA 3CI9A 4LJIA 1DT1A 1DEEG 2ZOOA 1BCCJ 2NRGA 1KQFB 3M9BA 4H0LD 3ZCFA 3H1JG 2YXRB 1P84E 2JQRA 1RAQA 2AXTE 1SQVD 1F1CA 1H89A 4CPGA 5CJ0A 2YXQB 1PPJG 3CU4A 1FJKA 2QEXP 3O6QA 1CI6B 3V2PA 5H2FV 1L0LE 3L72E 1M70A 3V2QA 3AE2C 4H0JA 1QKSA 4RJTA 3G3ZA 1HZUA 2WSEH 451CA 1SQBJ 2OQQA 4UB8V 3KPEA 4OVNF 1A56A 2QVAA 3HE5B 3RBZA 1Q7YQ 1OAEA 1SQVJ 1EDJA 4I1LA 1GK4A 1FZFA 3PH2B 3TYIA 1BSNA 3C1LA 1VF5D 1PZQA 2H8PD 3FXDA 2C1UA 2Q5UA 1YTZI 4V2KA 3RK3C 2WPRA 1FBMA 1KILE 5AVRB 4ASVA 2QM8A 1FDOA 5E79H 2A45I 4K3AA 1CIGA 2A06G 3R2PA 4YXDC 2W90A 1JY3P 2JEEA 1DIPA 1M57D 4EI2A 2QG4A 2DGEA 2B11B 4EYYQ 5GTIV 3ITKA 2I8FA 4XXLA 3M97X 2N1TA 1QVFO 4PJ0H 2B88A 4B86A 2HR3A 2KZIA 2QJYB 2O01H 4NPEA 1N90A 1OCDA 3KZIV 1RZ5A 1KQLA 1NAFA 2V7QJ 3ZDMA 1VQKP 5AVTB 2JDIH 5DJQB 1SQXD 1IFMA 1EZVI 2N1TB 4N0KA 1SQPJ 2IDBA 3TNUB 3D70A 1FZCB 4OGQD 1OW6A 1JEKA 3PXTA 1X8YA 3PP5A 1KB9H 1PPJD 1L0LK 5B66E 3D0WA 5GTHE 3L74G 2N9JA 1SQXJ 5AW0B 4U3FE 3TDKA 2FY8A 1L9BC 3EFGA 1N7LA 4GYDA 2K9JA 4PD4H 2J59M 3SXTA 1VQLP 3D6ZA 2V4HA 3VP8A 5AW7B 2KK7A 2IBZI 1L4AA 4LLHA 3LW5J 1N2DC 2VHDA 1S5LH 1YEBA 3GLMA 1H1OA 3O0RC 4DOJA 2Y9ZA 3BVHA 2A06D 1NVOA 4FB1A 5DJQC 2Y0EA 3JCUH 1M1KQ 5DJUB 2N1TC 2OARA 1P84I 1CCHA 2KOGA 1L4AB 2YNYA 1FCDC 1FZCC 4BRYA 5AW3B 5AW6B 2KLVA 1W5CT 4ZKPA 1GZLA 3A9FA 4WQ7A 1YTZT 4BXLA 1PGOA 1AFOA 5C9MA 1YBKA 3IF4A 2HODA 2R3CA 1FZGA 1KORA 5C39A 1FS0E 5APXA 1BL9A 2E76D 1YJ9P 3AE1C 4BRYB 3CD6P 2KSEA 4TLFA 4PV1B 3MUDA 5KJ7A 3BASA 1NWQA 3H1JE 1E29A 3CC2P 3B5NB 1SQQG 1CC5A 1PPJE 2CA3B 3ZIYA 1H33B 3IFMA 3ZOXA 4U7JA 5CIFB 3U1CA 3CX5H 1H31A 2LXBA 3CCQP 3RL0D 3CP5A 2QRXA 2I1JA 3PXWA 1IJDB 5BU8B 1KB0A 1GL2D 3H1IJ 1L4AC 1USEA 3WMM0 4GKGA 1R5SA 1WVEC 2GIWA 2C1VA 2HFED 2E75B 1FI9A 2KNCA 2M8RA 1E8EA 1VF5B 1NTZG 2IYPA 2CE1A 2CE0A 3B71A 2A06E 2Q6QA 4TT3H 1W2EA 1NAYA 2BCCG 3SWYA 5AURA 1MG2D 4H44B 1L2PA 1CSWA 3A0BV 2JO1A 4K3IA 1LTTC 2ZVOB 3L4MA 1SLQA 5DF5A 2QSIA 3CWBG 1NTMG 3L4OA 3QH9A 4O1QA 2HYNA 2C0WA 3B5NC 3AE6C 2FFDA 4H0KA 5KAFH 1NGMB 1CRJA 4RESB 3IR9A 4WQBA 1H8AA 2BH4X 2LIRA 1J1EB 1LTSC 3I5CA 4I7ZB 5AVXB 3CPWO 1VQOP 1SVFA 3F5HA 1H32B 3WFEC 1SFCD 2AXTV 1E5WA 5KKZC 4JBZA 2JWDA 4KT0J 2R5BA 4HH2A 3F89A 4XA4A 3CXHD 1KB9D 5AVUB 3VN0A 4YPCA 1S2EA 5APVA 1IC2A 3SFEC 2HPCB 4K35A 2E5TA 3MIWA 2E75C 1FZBA 1YFCA 1VF5C 1N7SA 2XZRA 1QVGO 1KC8Q 1GTWA 2C9LY 3HD7A 1KFNA 1LT9B 1YCCA 4KJMA 2Y9YA 1Q2NA 4H44C 5AW5B 4JF7A 1SP4A 3VYMA 1KQGB 1ZLLA 5E79E 1MUUA 3M9QA 1D7MA 1K04A 3HUSB 3V2RA 4AAMA 4UB6H 2IFMA 2CXBA 4IFFA 2QE7H 1JY2O 4D6TG 3TGUJ 1J1EC 4I7ZC 4WQEA 1JTHB 2MKVA 4H13B 1G1JA 3FWLA 5CCHA 3X39A 1MZ9A 4Z1MH 1S3JA 1YEAA 2IBZD 1G2CA 3EFFK 3RL0g 1NTZD 1BCCG 3HE4B 3L35A 2JR8A 2KZJA 5TJHA 1NMLA 5DFSA 2G8YA 4AANA 2FBWC 4AALA 1NH4A 3ORVA 1CSUA 1L0ND 2BCCD 4N3YB 4MN4C 4N78D 1GIWA 3VTPC 1NO4A 3SJLA 2V7QH 1HJBA 2DVHA 1K3HA 3CWBD 2GA1A 3MTUE 3S9OA 3OA7A 2KS1A 3CCEP 1IZL0 2O1KA 3AE3C 1P84D 2AIUA 2Y0DA 3WU2H 1SQBG 3SWFA 2GUVA 1JCCA 1LT9C 2WITA 2BLFB 1M7LA 1J1DB 5L8RJ 3MP7B 3CXHE 1KB9E 3PXSA 2RN0A 2WSSH 5DJTB 2OZ1A 3HUSC 5B66V 2IYOA 1U7JA 3Q1MA 2C9NY 5KLVG 5GTHV 5CIHB 1RQUA 1KD1Q 4IFMA 1L0LJ 1CSXA 2AXCA 1WRGA 2UWJE 3L72J 4H13C 3IN6A 3GG2A 5KAIH 2M5AB 3AE9C 2O01N 3K5BA 3I56P 5CCGC 1S5LE 2WSFJ 3USSA 2YQBA 1E2RA 2MJZA 2D0WA 1OFCX 3HTKA 2FYZA 3FXEA 3CCVP 1QL1A 1RF0C 3A7OA 1JCDA 1IFNA 2KI7B 1HJ3A 1PIXA 2K3RA 1NTZE 2B4ZA 2KXPB 1FOCA 1J1DC 1CI6A 2WVRA 1CSVA 1OX3A 2DW3A 1L0NE 1K73Q 2BCCE 4N78E 1K3GA 3WFBC 2LXCB 3ABVC 2P2UA 2H88C 5B5EH 3CWBE 3AECC 3HE5A 3PHLA 2WZ7A 2W6JH 2W6AA 3CYTI 4ZNCA 1HBWA 3CCJP 2FWLA 2C8SA 3AE5C 4L75A 3P8MC 3NXSA 1Q86Q 4DCKA 2QIWA 3M0DC 1WT6A 3II6A 4ASWA 4XYDB 4FA5A 3A0HH 1KFMA 5CIEB 1IO3A 2YKOA 2YIUB 1IFPA 4KMGA 3V4WA 4U3FD 2W8ZA 1FHBA 4I2LC 1PP9G 3QWOC 1OW8A 3CX5E 4JYBA 3AE7C 1KYOH 1DVHA 2ZXEB 1ZXGA 1CRHA 2FYUG 5KJ7D 1ZOYC 4P4QB 2BH5X 1SQQK 2QA4P 1S5LX 3Q3DA 3R4YA 4U3FJ 2JP3A 3BATA 1A02J 1FDIA 5AW2B 3C9IA 2K9YA 1KX7A 1C52A 2B87B 1NOHA 3L75G 1FAVA 1XTCC 4L3HA 3S4RA 1ZR2A 3JC22 1LT1A 2C1DB 2HV4A 3HQ7A 4PWAA 1AVYA 2IZ1A 1KV4A 3OW2O 3PTZA 3TNUA 4WBAA 1YQ4C 1LJ2A 1FZCA 1AQ5A 2IPPA 1ZRTD 1BE3G 1NTZK 5KAFE 1GDVA 1K05A 3CXHI 3SVWA 1KB9I 1QEXA 4QAOA 3M9HA 2YIUC 2QJPB 1L0NK 4ZMDA 1CEDA 5CIGB 1I8PA 4WY4B 1T2KC 4OH8B 4W7YA 3SLEA 1NTMK 2IFNA 5CIBB 1NNOA 4YXWH 3H1KG 1QL3A 4FAVA 4FA1A 3H1JD 3H1HG 3WFDC 1Q90D 2WT7B 1AYGA 4KHXA 3H1IG 5AW4B 1U57A 1HGZA 3L71G 2D2CD 1VQ9P 3A5TA 3JBTB 1IO4A 5M1BA 1A2SA 2E42A 5C0ZA 1CSBA 1NKNA 3PJSK 1JMMA 1MKMA 1PL5A 1KQSO 2XNDH 3U59A 3H1JJ 5KLVE 2ZYAA 1MG3D 2E74D 1LS9A 1J3SA 3L37A 3NFQA 5E79V 1NHLA 2FYUD 3LIDA 4UB6E 1N7SD 3HD7D 1M60A 1BGYG 2HLOA 2W6BA 3O8ZA 3GHGC 1KMIZ 2QJPC 3RK2D 5B6QA 4A7PA 1KZUB 4WY4C 1DEBA 2K1AA 3VMAA 1KILB 5AW1B 2WPQA 2ZONG 1N73A 3L75D 1LWUB 3SWSA 3LIEA 3AE8C 2ZAEB 2NPSD 3WUTA 1NTKG 1GMJA 2OYOA 4IL6H 1C2NA 3OJAB 3CCUP 1ZRTE 2Z5IA 4WB4A 4C46A 1DH3A 3B5NA 4I6MC 5CCHD 1X22A 5EFWB 3Q2YA 1CCRA 1JY3N 1N73B 3WU2E 3Q5SA 1QLED 1H33A 1F1FA 3VNWA 1MFTA 5CYTR 3CX5I 1DW0A 2GC4D 1URQB 2WSCJ 3FWNA 3CXHW 4EOTA 2GB8B 4FA4A 1NU1G 4C7NB 1X79B 1JOCA 3BCCG 1JM0A 3MGNA 2YK3A 4H0LB 3H1KD 3TYYA 1OWAA 1CYCA 1SQBK 2BPBB 1KYOD 4J20A 4GOFA 2V07A 1EZVG 1KILC 1HF9A 5KAIE 3L70G 5KKZB 2WSEJ 3L74D 1DD3A 4MU8A 2JWAA 1PP9E 1LWUC 1FC2C 4AAOA 5AVVB 2FRCA 1KIBA 1YITP 3P32A 5KLVK 2WSFH 1S5LV 2ZJSE 2FYUE 5TISH 1CRCA 3AEGC 3V5BA 3CMAP 1ZN5A 1GK6A 1N73C 3PH0A 4NPFX 3AEDC 3OA8A 1UIIA 3RK3D 3VMXA 3SSUA 1H32A 4Y5RA 1URQC 1S4XA 3L75E 2B10B 2R44A 1GJQA 1HWTC 1VPCA 1ZV8A 1C75A 1OXZA 1CHJA 1KN7A 1CTZA 2RKLA 4O1WA 5APTA 2JTIB 1JY2P 2W83C 5B5EE 4H0LC 4L1QA 5BU5A 3ZBMA 2HPCA 4JCGA 2BEZF 2AEFA 3OA8B 1HZVA 2O01J 1BE3E 2AI5A 4QMAA 1COTA 1MZ4A 3L36A 1IRWA 351CA 1LT9A 1DW3A 1FZEA 5CBNA 1DIIC 3L73G 4JQ0D 1YQ3C 1RE4C 2XKMA 3A0HE 1YI2P 3NWVA 5APWA 3CX5W 3NTNA 2C2CA 3HUSA 3H1KE 1CHHA 2OYIB 1GW3A 1KYOE 4FA9A 1X9VA 2WPSA 1DIQC 1CIFA 1NU1D 2YMYA 4PD4D 3H1HE 3BCCD 4GOEA 1R0QA 1SQQD 4OGQB 3AE4C 1JTHA 2IZ0A 3L71E 3L74E 4EDFA 5B66H 2CPBA 4HB1A 4XFJA 1HH7A 2B9BA 1FDMA 3HE4A 3RLMA 2OTKE 5CCGA 3L70D 2Z5HA 1AJYA 1HVVA 2K37A 4RKUJ 1EDKA 1R5LA 1H0TA 3H1LG 3B8EB 1RY3A 1LC2A 1E79H 2FYUK 3C8VA 4WWIA 1AOQA 2ZFCA 1CHIA 2E74B 4GEDB 1RF0A 3RK3E 2HG5D 1BGYE 2J5UA 3CCMP 2FXOA 4PJ0E 3JSVC 2OYHB 3FGAD 3H25A 1CO6A 1FOSF 3DMIA 1I6EA 1JNMA 1W2LA 1VQ5P 3RMZA 1H0TB 2FKWB 3PLNA 5KAFV 2JJLA 3A2AA 3W68A 1NTMD 1LP1B 2J58A 2OYIC 1DW1A 1NTKE 4JPZB 2N3YA 1NTZJ 3VMZA 2N1TD 4EIEA 5AVYB 4OGQC 1ETPA 1NMIA 1SQVG 2GC7D 1L0NJ 3BRVB 1FE6A 2BCCJ 3O1YA 2L5GB 3CC7P 2P7JA 3AEFC 2M5AA 1EC5A 4IFDK 1N9CA 1RHZB 3CWBJ
chains in the Genus database with same CATH topology
4NFGB 3O0RC 2KNCB 2FYNB 4P4QB 2BH5X 2A06D 3CX5D 4FB1A 5DJQC 2Y0EA 3L73D 2L91A 3PRJA 1KX7A 1CYJA 1CCHA 3WFCC 1M6ZA 1C52A 1I6DA 1FCDC 4EIFA 1I8OA 4L3HA 1W5CT 1N50A 1GU2A 3A9FA 4WQ7A 3OCDA 2C1DB 5C9MA 2HV4A 1H9XA 3RN0A 155CA 3HQ7A 4PWAA 4UB6V 1CNOA 5IY51 4EIDA 3PTZA 3ZOOA 3WC8A 1BL9A 2XTSB 3C2CA 1ZRTD 1L9JC 1AKKA 2V08A 1GDVA 1EZVD 1CTJA 3SVWA 1IQCA 1HCMA 4QAOA 2QJPB 5TISV 3OCDB 2ZXYA 3H1LD 4D6TD 1CEDA 1E29A 1I8PA 5CIGB 3TGUD 1IRVA 2MTAC 1CC5A 2PACA 1DW2A 3SLEA 3HQ9A 2CA3B 3ZIYA 1LC1A 1H33B 5CICB 1ZZHA 1C7MA 5CIBB 3ZOXA 1NNOA 1C6OA 5CIFB 4FANA 1BCCD 1QL3A 1H31A 5KLIB 4FAVA 1CORA 1YIQA 4FA1A 3H1JD 3CP5A 3WFDC 3PXWA 1KB0A 3WU2V 3MK7B 1AYGA 4WQDA 1FI7A 3O5CA 2L4DA 1I55A 1HRCA 2N9IA 3JBTB 2MHMA 1A2SA 1GQ1A 1WVEC 1EB7A 5EXQA 5C0ZA 2GIWA 2C1VA 1N15A 3TF5A 1NIRA 1FI9A 1CRIA 1LFMA 1SQBD 1S6VB 1E8EA 1HROA 1MG3D 2CE1A 1B7VA 1LS9A 1J3SA 2CE0A 2LITA 5E79V 2O3JA 2FYUD 5AURA 1MG2D 1CSWA 3A0BV 4K3IA 1U75B 1YICA 2N3BA 3L4MA 5DF5A 3KHUA 1M60A 5KAIV 2PCCB 4WQ9A 2ORLA 1AOFA 5KLVD 2N9YB 2C1DA 3L4OA 4O1QA 3HQ8A 5B6QA 4A7PA 3NBSA 3VMAA 1U74B 4H0KA 1L0LD 2ZONG 1CRJA 3L72D 4WQBA 4YE1A 2BH4X 2LIRA 2ZZS1 3L75D 3SWSA 1H32B 3ZOWA 3WFEC 2AXTV 1C2NA 1LMSA 3MK7C 1KX2A 3GW6A 3CXHD 1KB9D 1CXAA 1CCRA 1CYIA 1H33A 1F1FA 3VNWA 3VRDA 5CYTR 1DW0A 2GC4D 4DY9A 2BCNB 1YFCA 2RMZA 2OZ1B 3CXHW 2CA4B 5B5EV 2GB8B 4RSZA 4FA4A 2N18B 4L3GA 4WQAA 1YCCA 1C2RA 2YK3A 1SQPD 1HJ5A 1C6RA 3VYMA 3H1KD 1CYCA 2BPBB 1KYOD 4J20A 2V07A 1QL4A 2Y0CA 4AAMA 1QYZA 2YCCA 1CIHA 2BGVX 3ZOYA 3NBTA 2CXBA 3A0HV 5KKZB 3L74D 1I54A 1KYOW 4MU8A 2JWAA 4WQEA 4AAOA 3WUIA 2FRCA 1KIBA 2C9XB 3FWLA 1CRGA 3X39A 1YEAA 4LJIA 1S5LV 1DT1A 2IBZD 2ZOOA 4WQ8A 1NTZD 1JDLA 5TJHA 1NMLA 1CRCA 5DFSA 1CIEA 4AANA 4AALA 3ZCFA 2JQRA 1RAQA 1SQVD 1PP9D 3ORVA 1CSUA 1F1CA 1L0ND 2BCCD 1H9YA 3CU4A 4WQCA 1GIWA 3OA8A 3SJLA 5H2FV 1H32A 2DVHA 1K3HA 1M70A 3CWBD 4Y5RA 2B10B 4H0JA 1QKSA 2KS1A 1IZL0 4RJTA 1GJQA 1HZUA 1P84D 2AIUA 451CA 4Q5PA 2Y0DA 1C75A 1HJ4A 1CHJA 4UB8V 5CIDB 1CTZA 2N18C 1A56A 4O1WA 1OAEA 2JTIB 1KV9A 2BLFB 3PH2B 3TYIA 1C6SA 4L1QA 3ZBMA 1WEJF 4JCGA 1RZ6A 2QJKB 4PJ0V 3OA8B 1HZVA 2C1UA 3PXSA 1FI3A 2RN0A 2OZ1A 5B66V 4V2KA 2K9JB 2AI5A 5GTHV 5CIHB 1COTA 1MZ4A 1CXCA 1IRWA 351CA 1DW3A 1CIGA 1GKSA 1DIIC 1CSXA 1VYDA 3GG2A 3NWVA 1BE3D 3CX5W 1YNRA 2QG4A 2C2CA 2DGEA 2D0SA 1CHHA 2B11B 5GTIV 2B12B 4EICA 4FA9A 1DIQC 1CIFA 1NU1D 4PD4D 2YQBA 3ITKA 3BCCD 2I8FA 1R0QA 1SQQD 4XXLA 1E2RA 3M97X 2B0ZB 2D0WA 3DP5A 3DR0A 4EDFA 2QJYB 1YTCA 1HH7A 1N90A 1OCDA 3KZIV 1RZ5A 3H1HD 3RLMA 1HJ3A 3L70D 1I5TA 2B4ZA 3H1ID 1CTYA 5DJQB 3L71D 1FOCA 1SQXD 1LC2A 1QN2A 1CSVA 3HQ6A 4N0KA 3RN1A 1AOQA 1CHIA 1K3GA 3WFBC 4PW9B 4GEDB 2ZBOA 2EXVA 1A8CA 3PXTA 3PHLA 3CYTI 1FJ0A 1CO6A 1PPJD 3DMIA 1I6EA 1W2LA 2PCBB 3RMZA 1CRYA 2N9JA 2FWLA 3PLNA 2C8SA 5KAFV 3TDKA 1L9BC 1RAPA 1BGYD 4GYDA 1NTMD 3O20A 1DW1A 4XYDB 3SXTA 1DVVA 2N3YA 4FA5A 1H31B 5CIEB 4AX3A 4EIEA 4IL6V 1IO3A 2YIUB 4KMGA 1ETPA 4U3FD 1FHBA 1NMIA 2GC7D 3O1YA 2Q3EA 1DVHA 2VHDA 1YEBA 1CRHA 1NTKD 1N9CA 1H1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NFG B;  3O0R C;  2KNC B;  2FYN B;  4P4Q B;  2BH5 X;  2A06 D;  3CX5 D;  4FB1 A;  5DJQ C;  2Y0E A;  3L73 D;  2L91 A;  3PRJ A;  1KX7 A;  1CYJ A;  1CCH A;  3WFC C;  1M6Z A;  1C52 A;  1I6D A;  1FCD C;  4EIF A;  1I8O A;  4L3H A;  1W5C T;  1N50 A;  1GU2 A;  3A9F A;  4WQ7 A;  3OCD A;  2C1D B;  5C9M A;  2HV4 A;  1H9X A;  3RN0 A;  155C A;  3HQ7 A;  4PWA A;  4UB6 V;  1CNO A;  5IY5 1;  4EID A;  3PTZ A;  3ZOO A;  3WC8 A;  1BL9 A;  2XTS B;  3C2C A;  1ZRT D;  1L9J C;  1AKK A;  2V08 A;  1GDV A;  1EZV D;  1CTJ A;  3SVW A;  1IQC A;  1HCM A;  4QAO A;  2QJP B;  5TIS V;  3OCD B;  2ZXY A;  3H1L D;  4D6T D;  1CED A;  1E29 A;  1I8P A;  5CIG B;  3TGU D;  1IRV A;  2MTA C;  1CC5 A;  2PAC A;  1DW2 A;  3SLE A;  3HQ9 A;  2CA3 B;  3ZIY A;  1LC1 A;  1H33 B;  5CIC B;  1ZZH A;  1C7M A;  5CIB B;  3ZOX A;  1NNO A;  1C6O A;  5CIF B;  4FAN A;  1BCC D;  1QL3 A;  1H31 A;  5KLI B;  4FAV A;  1COR A;  1YIQ A;  4FA1 A;  3H1J D;  3CP5 A;  3WFD C;  3PXW A;  1KB0 A;  3WU2 V;  3MK7 B;  1AYG A;  4WQD A;  1FI7 A;  3O5C A;  2L4D A;  1I55 A;  1HRC A;  2N9I A;  3JBT B;  2MHM A;  1A2S A;  1GQ1 A;  1WVE C;  1EB7 A;  5EXQ A;  5C0Z A;  2GIW A;  2C1V A;  1N15 A;  3TF5 A;  1NIR A;  1FI9 A;  1CRI A;  1LFM A;  1SQB D;  1S6V B;  1E8E A;  1HRO A;  1MG3 D;  2CE1 A;  1B7V A;  1LS9 A;  1J3S A;  2CE0 A;  2LIT A;  5E79 V;  2O3J A;  2FYU D;  5AUR A;  1MG2 D;  1CSW A;  3A0B V;  4K3I A;  1U75 B;  1YIC A;  2N3B A;  3L4M A;  5DF5 A;  3KHU A;  1M60 A;  5KAI V;  2PCC B;  4WQ9 A;  2ORL A;  1AOF A;  5KLV D;  2N9Y B;  2C1D A;  3L4O A;  4O1Q A;  3HQ8 A;  5B6Q A;  4A7P A;  3NBS A;  3VMA A;  1U74 B;  4H0K A;  1L0L D;  2ZON G;  1CRJ A;  3L72 D;  4WQB A;  4YE1 A;  2BH4 X;  2LIR A;  2ZZS 1;  3L75 D;  3SWS A;  1H32 B;  3ZOW A;  3WFE C;  2AXT V;  1C2N A;  1LMS A;  3MK7 C;  1KX2 A;  3GW6 A;  3CXH D;  1KB9 D;  1CXA A;  1CCR A;  1CYI A;  1H33 A;  1F1F A;  3VNW A;  3VRD A;  5CYT R;  1DW0 A;  2GC4 D;  4DY9 A;  2BCN B;  1YFC A;  2RMZ A;  2OZ1 B;  3CXH W;  2CA4 B;  5B5E V;  2GB8 B;  4RSZ A;  4FA4 A;  2N18 B;  4L3G A;  4WQA A;  1YCC A;  1C2R A;  2YK3 A;  1SQP D;  1HJ5 A;  1C6R A;  3VYM A;  3H1K D;  1CYC A;  2BPB B;  1KYO D;  4J20 A;  2V07 A;  1QL4 A;  2Y0C A;  4AAM A;  1QYZ A;  2YCC A;  1CIH A;  2BGV X;  3ZOY A;  3NBT A;  2CXB A;  3A0H V;  5KKZ B;  3L74 D;  1I54 A;  1KYO W;  4MU8 A;  2JWA A;  4WQE A;  4AAO A;  3WUI A;  2FRC A;  1KIB A;  2C9X B;  3FWL A;  1CRG A;  3X39 A;  1YEA A;  4LJI A;  1S5L V;  1DT1 A;  2IBZ D;  2ZOO A;  4WQ8 A;  1NTZ D;  1JDL A;  5TJH A;  1NML A;  1CRC A;  5DFS A;  1CIE A;  4AAN A;  4AAL A;  3ZCF A;  2JQR A;  1RAQ A;  1SQV D;  1PP9 D;  3ORV A;  1CSU A;  1F1C A;  1L0N D;  2BCC D;  1H9Y A;  3CU4 A;  4WQC A;  1GIW A;  3OA8 A;  3SJL A;  5H2F V;  1H32 A;  2DVH A;  1K3H A;  1M70 A;  3CWB D;  4Y5R A;  2B10 B;  4H0J A;  1QKS A;  2KS1 A;  1IZL 0;  4RJT A;  1GJQ A;  1HZU A;  1P84 D;  2AIU A;  451C A;  4Q5P A;  2Y0D A;  1C75 A;  1HJ4 A;  1CHJ A;  4UB8 V;  5CID B;  1CTZ A;  2N18 C;  1A56 A;  4O1W A;  1OAE A;  2JTI B;  1KV9 A;  2BLF B;  3PH2 B;  3TYI A;  1C6S A;  4L1Q A;  3ZBM A;  1WEJ F;  4JCG A;  1RZ6 A;  2QJK B;  4PJ0 V;  3OA8 B;  1HZV A;  2C1U A;  3PXS A;  1FI3 A;  2RN0 A;  2OZ1 A;  5B66 V;  4V2K A;  2K9J B;  2AI5 A;  5GTH V;  5CIH B;  1COT A;  1MZ4 A;  1CXC A;  1IRW A;  351C A;  1DW3 A;  1CIG A;  1GKS A;  1DII C;  1CSX A;  1VYD A;  3GG2 A;  3NWV A;  1BE3 D;  3CX5 W;  1YNR A;  2QG4 A;  2C2C A;  2DGE A;  2D0S A;  1CHH A;  2B11 B;  5GTI V;  2B12 B;  4EIC A;  4FA9 A;  1DIQ C;  1CIF A;  1NU1 D;  4PD4 D;  2YQB A;  3ITK A;  3BCC D;  2I8F A;  1R0Q A;  1SQQ D;  4XXL A;  1E2R A;  3M97 X;  2B0Z B;  2D0W A;  3DP5 A;  3DR0 A;  4EDF A;  2QJY B;  1YTC A;  1HH7 A;  1N90 A;  1OCD A;  3KZI V;  1RZ5 A;  3H1H D;  3RLM A;  1HJ3 A;  3L70 D;  1I5T A;  2B4Z A;  3H1I D;  1CTY A;  5DJQ B;  3L71 D;  1FOC A;  1SQX D;  1LC2 A;  1QN2 A;  1CSV A;  3HQ6 A;  4N0K A;  3RN1 A;  1AOQ A;  1CHI A;  1K3G A;  3WFB C;  4PW9 B;  4GED B;  2ZBO A;  2EXV A;  1A8C A;  3PXT A;  3PHL A;  3CYT I;  1FJ0 A;  1CO6 A;  1PPJ D;  3DMI A;  1I6E A;  1W2L A;  2PCB B;  3RMZ A;  1CRY A;  2N9J A;  2FWL A;  3PLN A;  2C8S A;  5KAF V;  3TDK A;  1L9B C;  1RAP A;  1BGY D;  4GYD A;  1NTM D;  3O20 A;  1DW1 A;  4XYD B;  3SXT A;  1DVV A;  2N3Y A;  4FA5 A;  1H31 B;  5CIE B;  4AX3 A;  4EIE A;  4IL6 V;  1IO3 A;  2YIU B;  4KMG A;  1ETP A;  4U3F D;  1FHB A;  1NMI A;  2GC7 D;  3O1Y A;  2Q3E A;  1DVH A;  2VHD A;  1YEB A;  1CRH A;  1NTK D;  1N9C A;  1H1O A; 
#chains in the Genus database with same CATH topology
 3M0D A;  4NFG B;  1A02 F;  3OAK A;  2FYN B;  2B89 A;  2E76 B;  3CX5 D;  1DD4 A;  3BRT B;  3L73 D;  2L91 A;  1DX7 A;  1NU1 E;  3KQG A;  1T6A A;  5H2F H;  4PD4 E;  3PRJ A;  3BCC E;  1J2J B;  1M6Z A;  1SQQ E;  2E74 C;  1GL2 A;  1I6D A;  2G3A A;  2YO3 A;  3CME P;  1I8O A;  2O1J A;  4UB8 H;  1CW5 A;  2OYH C;  2Q1K A;  3P7K A;  1EZV E;  1H9X A;  3RN0 A;  3T97 B;  155C A;  1BSH A;  3LW5 H;  3B4S A;  2K88 A;  3L70 E;  4UB6 V;  1LTJ B;  5IY5 1;  4HYT B;  4EID A;  3RL0 B;  1L9J C;  1GL2 B;  2M0B A;  1AKK A;  3JCU E;  1VQM P;  3AEA C;  2V08 A;  2I1K A;  1CTJ A;  1QGK B;  2WMM A;  1IQC A;  1L4A D;  1OIP A;  1USD A;  2ZXY A;  3H1L D;  4D6T D;  1H88 A;  1EDL A;  4AUW A;  1EXI A;  1IRV A;  2MTA C;  4IL6 E;  1QX8 A;  2PAC A;  1DW2 A;  3HQ9 A;  3V2N A;  1LC1 A;  1SQP G;  1IK9 A;  1U7M A;  4OWF A;  1C6O A;  2E5Y A;  5GTI H;  1BCC D;  3N4X A;  2FYN C;  2ZT9 D;  1COR A;  1YIQ A;  2E76 C;  1M1J B;  1NTM E;  2Q9I A;  4XE5 B;  3WU2 V;  4L76 A;  1FI7 A;  1KYO I;  2L4D A;  4LC1 A;  4PV1 D;  1I55 A;  1SQX G;  1NTK K;  1GU4 A;  1GQ1 A;  3A3Y B;  3H32 A;  1EB7 A;  2WWW A;  3KZI H;  5AW9 B;  1RE3 C;  1NIR A;  1CZQ A;  3B5N D;  1M8O B;  1SQB D;  2AEM A;  1HRO A;  1LTJ C;  1B7V A;  4M3L A;  1VQN P;  4HJG H;  1LTG C;  1SFC B;  1RH5 B;  1LTI C;  2LIT A;  3RL0 C;  2B87 A;  5APQ A;  3UIA A;  3L73 E;  2P67 A;  1GL2 C;  1BDD A;  2N3B A;  3KHU A;  1VQ7 P;  3H32 B;  5KAI V;  2ORL A;  5KLV D;  2C1D A;  1NU1 K;  3SWK A;  3HQ8 A;  1FZA A;  3SFD C;  2AEJ A;  1U74 B;  1TU3 F;  2E75 D;  5TIS E;  2ZZS 1;  3O6Q B;  3GF3 A;  3ZOW A;  1BDC A;  1M1J C;  3N7N A;  5KLV J;  3GHG A;  1LMS A;  2R3S A;  2M3E A;  4H44 D;  4WY4 A;  3VYI A;  4GT1 A;  1NYH A;  4IL6 X;  2KUB A;  1CXA A;  3H1L E;  4D6T E;  3VRD A;  3H6P A;  1OZH A;  2JKV A;  1RQV A;  3P8C D;  2XU6 A;  4O9B A;  2WT7 A;  1BCC E;  1M56 D;  1MFZ A;  3GHG B;  2CA4 B;  5B5E V;  1SFC C;  2N18 B;  2PP6 A;  2A45 H;  1SQP D;  1HJ5 A;  4JYC A;  5BVZ A;  4PD4 I;  1FOS E;  1N8R Q;  1HGV A;  2ZXX A;  1QL4 A;  2XDJ A;  1QYZ A;  1X0T A;  2BGV X;  1PGJ A;  4L74 A;  3A0H V;  1SQB E;  4R4M A;  1OW7 A;  1I54 A;  1KYO W;  1SQV E;  3M0A A;  3WUI A;  2C9X B;  3CCL P;  4WQ8 A;  4DZO A;  1JDL A;  1AA0 A;  2OTL P;  1EXJ A;  2FXM A;  3WUU A;  1CIE A;  3CXH H;  1QL2 A;  2C0X A;  1KIL A;  1PP9 D;  2N9B A;  5CHX A;  3RBX A;  2PRR A;  4EIJ A;  1H9Y A;  2GM4 A;  4WQC A;  1JY3 O;  1LWU A;  4L73 A;  2P1J A;  5AVW B;  3E1R A;  2KYV A;  4Q5P A;  1N86 A;  1HTL C;  3M91 A;  1HJ4 A;  5CID B;  4H13 D;  2N18 C;  1PP9 J;  1KV9 A;  1PV3 A;  2QJY C;  3KXD A;  1C6S A;  4LGD E;  1WEJ F;  2FYU J;  1RZ6 A;  2QJK B;  2KIK A;  5CCG D;  4PJ0 V;  3MHV A;  1URQ A;  1FI3 A;  2BEQ D;  2WTY A;  2A45 G;  2P10 A;  2I8D A;  2K9J B;  2E43 A;  1JO5 A;  1WMK A;  3CL3 D;  3P8C E;  3S1K A;  1CXC A;  3CLQ A;  4C7N A;  1Q81 Q;  1YYC A;  2Q3I A;  1GW4 A;  1GKS A;  2PGD A;  3A0B H;  1VYD A;  2ZVN B;  4W80 A;  3L75 J;  1GD2 E;  1BE3 D;  1SQP E;  1YNR A;  2D0S A;  2B12 B;  4EIC A;  2PFX A;  5K5G B;  2VRS A;  3M06 A;  2ZT9 B;  2B0Z B;  3NMD A;  2R5D A;  1ZW0 A;  3DP5 A;  3V4Q A;  1RE4 A;  3KDP B;  3DR0 A;  4BWN A;  1SQX E;  1P84 H;  2AXT H;  1YTC A;  1BE3 J;  2CPS A;  2P58 A;  2Z4E A;  3V6I A;  2CK3 H;  2KLU A;  5H2F E;  4GDO A;  1LTB C;  3H1H D;  1SQV K;  1EQ7 A;  1I5T A;  3GMA A;  3H1I D;  1CTY A;  2ZYG A;  3L71 D;  3EWK A;  2HOD B;  1OMI A;  4UB8 E;  4ZKU A;  3TGU G;  1QN2 A;  2QJK C;  3HQ6 A;  1VDF A;  3W67 A;  3RN1 A;  1IFI A;  4PW9 B;  3H1K J;  1VL2 A;  2OGU A;  1T3U A;  2ZBO A;  2EXV A;  1Y47 A;  2H7H A;  3H1H J;  1A8C A;  4N6J A;  1S9K D;  1FJ0 A;  2PCB B;  5APU A;  2KSJ A;  3L71 J;  3L74 J;  1CRY A;  3G71 P;  3EQ2 A;  1OVR A;  1RAP A;  1BGY D;  3HRN A;  1RF1 A;  1YIJ P;  3O20 A;  1W2B O;  1PGP A;  2IBZ G;  4DJG A;  1DVV A;  3I55 P;  1H31 B;  4AX3 A;  3E1I A;  4IL6 V;  1NKZ B;  1Z56 A;  2ZT9 C;  1HUC A;  1VQ8 P;  5GTI E;  1L0N G;  2Q3E A;  3E7K A;  1MV8 A;  1KTM A;  1SS1 A;  2FXP A;  1NTK D;  1BGY J;  4PV1 C;  3Q5P A;  4WVZ A;  1AVO A;  2OYI A;  1RF1 B;  2OTJ P;  2KNC B;  2YO2 A;  3KZI E;  3G9R A;  1AV1 A;  2ZYD A;  3AEB C;  1SQP K;  1LNQ A;  1CYJ A;  2ITA A;  1L0L G;  3WFC C;  3L72 G;  4EIF A;  1NTK J;  2BAS A;  1IFD A;  1JB0 J;  1LTA C;  1N50 A;  1GU2 A;  1T2K D;  3OCD A;  3MZW B;  3MUD C;  5KJ7 C;  2YKQ A;  1SQX K;  1CNO A;  1Y8A A;  2FFD B;  2R32 A;  5APY A;  5APS A;  3H1I E;  3ZOO A;  1Q82 Q;  3WC8 A;  2XTS B;  1AQT A;  3C2C A;  4HKZ H;  1R8E A;  5GTH H;  1JMB A;  1EZV D;  1PGQ A;  2OYH A;  1YJW P;  2D2C B;  1S72 P;  2LR2 A;  5CMZ A;  1HCM A;  2YMK A;  5TIS V;  3OCD B;  1NU1 J;  3CCR P;  3TGU D;  3BCC J;  1SQQ J;  1S9K E;  3CCS P;  5AVS B;  4YTP C;  1UIX A;  2POH A;  3GF7 A;  1ZR4 A;  5CIC B;  1ZZH A;  1C7M A;  1LP1 A;  2GUS A;  2IX7 C;  4FAN A;  1RF1 C;  1HJ0 A;  5KLI B;  4Y28 J;  1LGH B;  2PAJ A;  3L4F A;  2NPS A;  1HH0 A;  1OVU A;  3L70 J;  1N7S B;  3MK7 B;  3G6E P;  4WQD A;  2KB7 P;  2XNX A;  3HD7 B;  1VQ6 P;  1JUN A;  3O5C A;  1W5C E;  5KTB A;  3G4S P;  1HRC A;  3RK2 B;  2N9I A;  4IOI H;  3VP9 A;  2MHM A;  3TSI A;  5EXQ A;  4WY4 D;  1N15 A;  3TF5 A;  2Q7C A;  1CRI A;  1OVV A;  1LFM A;  4RO0 A;  1S6V B;  4C7R A;  1IZN B;  1K9M Q;  4W7Z A;  4Y99 B;  2QM7 A;  1FU1 A;  2FFD C;  2NPS B;  1FJP A;  2O3J A;  3TK1 A;  5AVQ B;  1U75 B;  1RE3 A;  1YIC A;  2WQY C;  2PCC B;  4WQ9 A;  1NTM J;  2D2C C;  5AVZ B;  1AOF A;  1YJN P;  1GDT A;  2N9Y B;  2XV5 A;  1G2C B;  1EDI A;  3T97 A;  2RH0 A;  3CC4 P;  2WPV B;  5CBO A;  3NBS A;  1LTJ A;  3RGU A;  1L0L D;  1JY2 N;  4U3F G;  3L72 D;  4GIF A;  4YE1 A;  4AQR D;  4R4L A;  3VOP A;  1ZME C;  1Y9B A;  1IK7 A;  5CJ4 A;  2M3B A;  1ZP0 C;  4DT0 A;  5KLI C;  4NPD A;  4GOD A;  3AEE C;  2KS1 B;  2YKP A;  1N7S C;  3MK7 C;  5AW8 B;  3HD7 C;  1S1C X;  1M90 Q;  1T8Z A;  2H43 A;  3L73 J;  1KX2 A;  3GW6 A;  3RK2 C;  3VMY A;  1K8A Q;  1CYI A;  3TGU E;  1VQ4 P;  1KIL D;  4DY9 A;  1VQP P;  2BCN B;  2SPZ A;  3U1A A;  3D6Y A;  2RMZ A;  1XTG B;  1M1J A;  2H89 C;  2OZ1 B;  4Y99 C;  3D71 A;  2NPS C;  4RSZ A;  3FX0 A;  4L3G A;  4WQA A;  1C2R A;  3IAO A;  1C6R A;  2W27 A;  5CCH C;  1NJI Q;  3Q5R A;  2KP8 A;  3MD0 A;  2Y0C A;  3A0B E;  2IBZ E;  3RK3 B;  2YCC A;  1CIH A;  3KYQ A;  1G1I A;  1IFJ A;  1GU5 A;  3ZOY A;  3NBT A;  1PFI A;  1SFC A;  2LKM A;  3H1L J;  4D6T J;  2NZ2 A;  1URQ D;  4AYC A;  1YHQ P;  3WUV A;  1T3J A;  2WSC H;  3HTK B;  1CRG A;  3CI9 A;  4LJI A;  1DT1 A;  1DEE G;  2ZOO A;  1BCC J;  2NRG A;  1KQF B;  3M9B A;  4H0L D;  3ZCF A;  3H1J G;  2YXR B;  1P84 E;  2JQR A;  1RAQ A;  2AXT E;  1SQV D;  1F1C A;  1H89 A;  4CPG A;  5CJ0 A;  2YXQ B;  1PPJ G;  3CU4 A;  1FJK A;  2QEX P;  3O6Q A;  1CI6 B;  3V2P A;  5H2F V;  1L0L E;  3L72 E;  1M70 A;  3V2Q A;  3AE2 C;  4H0J A;  1QKS A;  4RJT A;  3G3Z A;  1HZU A;  2WSE H;  451C A;  1SQB J;  2OQQ A;  4UB8 V;  3KPE A;  4OVN F;  1A56 A;  2QVA A;  3HE5 B;  3RBZ A;  1Q7Y Q;  1OAE A;  1SQV J;  1EDJ A;  4I1L A;  1GK4 A;  1FZF A;  3PH2 B;  3TYI A;  1BSN A;  3C1L A;  1VF5 D;  1PZQ A;  2H8P D;  3FXD A;  2C1U A;  2Q5U A;  1YTZ I;  4V2K A;  3RK3 C;  2WPR A;  1FBM A;  1KIL E;  5AVR B;  4ASV A;  2QM8 A;  1FDO A;  5E79 H;  2A45 I;  4K3A A;  1CIG A;  2A06 G;  3R2P A;  4YXD C;  2W90 A;  1JY3 P;  2JEE A;  1DIP A;  1M57 D;  4EI2 A;  2QG4 A;  2DGE A;  2B11 B;  4EYY Q;  5GTI V;  3ITK A;  2I8F A;  4XXL A;  3M97 X;  2N1T A;  1QVF O;  4PJ0 H;  2B88 A;  4B86 A;  2HR3 A;  2KZI A;  2QJY B;  2O01 H;  4NPE A;  1N90 A;  1OCD A;  3KZI V;  1RZ5 A;  1KQL A;  1NAF A;  2V7Q J;  3ZDM A;  1VQK P;  5AVT B;  2JDI H;  5DJQ B;  1SQX D;  1IFM A;  1EZV I;  2N1T B;  4N0K A;  1SQP J;  2IDB A;  3TNU B;  3D70 A;  1FZC B;  4OGQ D;  1OW6 A;  1JEK A;  3PXT A;  1X8Y A;  3PP5 A;  1KB9 H;  1PPJ D;  1L0L K;  5B66 E;  3D0W A;  5GTH E;  3L74 G;  2N9J A;  1SQX J;  5AW0 B;  4U3F E;  3TDK A;  2FY8 A;  1L9B C;  3EFG A;  1N7L A;  4GYD A;  2K9J A;  4PD4 H;  2J59 M;  3SXT A;  1VQL P;  3D6Z A;  2V4H A;  3VP8 A;  5AW7 B;  2KK7 A;  2IBZ I;  1L4A A;  4LLH A;  3LW5 J;  1N2D C;  2VHD A;  1S5L H;  1YEB A;  3GLM A;  1H1O A;  3O0R C;  4DOJ A;  2Y9Z A;  3BVH A;  2A06 D;  1NVO A;  4FB1 A;  5DJQ C;  2Y0E A;  3JCU H;  1M1K Q;  5DJU B;  2N1T C;  2OAR A;  1P84 I;  1CCH A;  2KOG A;  1L4A B;  2YNY A;  1FCD C;  1FZC C;  4BRY A;  5AW3 B;  5AW6 B;  2KLV A;  1W5C T;  4ZKP A;  1GZL A;  3A9F A;  4WQ7 A;  1YTZ T;  4BXL A;  1PGO A;  1AFO A;  5C9M A;  1YBK A;  3IF4 A;  2HOD A;  2R3C A;  1FZG A;  1KOR A;  5C39 A;  1FS0 E;  5APX A;  1BL9 A;  2E76 D;  1YJ9 P;  3AE1 C;  4BRY B;  3CD6 P;  2KSE A;  4TLF A;  4PV1 B;  3MUD A;  5KJ7 A;  3BAS A;  1NWQ A;  3H1J E;  1E29 A;  3CC2 P;  3B5N B;  1SQQ G;  1CC5 A;  1PPJ E;  2CA3 B;  3ZIY A;  1H33 B;  3IFM A;  3ZOX A;  4U7J A;  5CIF B;  3U1C A;  3CX5 H;  1H31 A;  2LXB A;  3CCQ P;  3RL0 D;  3CP5 A;  2QRX A;  2I1J A;  3PXW A;  1IJD B;  5BU8 B;  1KB0 A;  1GL2 D;  3H1I J;  1L4A C;  1USE A;  3WMM 0;  4GKG A;  1R5S A;  1WVE C;  2GIW A;  2C1V A;  2HFE D;  2E75 B;  1FI9 A;  2KNC A;  2M8R A;  1E8E A;  1VF5 B;  1NTZ G;  2IYP A;  2CE1 A;  2CE0 A;  3B71 A;  2A06 E;  2Q6Q A;  4TT3 H;  1W2E A;  1NAY A;  2BCC G;  3SWY A;  5AUR A;  1MG2 D;  4H44 B;  1L2P A;  1CSW A;  3A0B V;  2JO1 A;  4K3I A;  1LTT C;  2ZVO B;  3L4M A;  1SLQ A;  5DF5 A;  2QSI A;  3CWB G;  1NTM G;  3L4O A;  3QH9 A;  4O1Q A;  2HYN A;  2C0W A;  3B5N C;  3AE6 C;  2FFD A;  4H0K A;  5KAF H;  1NGM B;  1CRJ A;  4RES B;  3IR9 A;  4WQB A;  1H8A A;  2BH4 X;  2LIR A;  1J1E B;  1LTS C;  3I5C A;  4I7Z B;  5AVX B;  3CPW O;  1VQO P;  1SVF A;  3F5H A;  1H32 B;  3WFE C;  1SFC D;  2AXT V;  1E5W A;  5KKZ C;  4JBZ A;  2JWD A;  4KT0 J;  2R5B A;  4HH2 A;  3F89 A;  4XA4 A;  3CXH D;  1KB9 D;  5AVU B;  3VN0 A;  4YPC A;  1S2E A;  5APV A;  1IC2 A;  3SFE C;  2HPC B;  4K35 A;  2E5T A;  3MIW A;  2E75 C;  1FZB A;  1YFC A;  1VF5 C;  1N7S A;  2XZR A;  1QVG O;  1KC8 Q;  1GTW A;  2C9L Y;  3HD7 A;  1KFN A;  1LT9 B;  1YCC A;  4KJM A;  2Y9Y A;  1Q2N A;  4H44 C;  5AW5 B;  4JF7 A;  1SP4 A;  3VYM A;  1KQG B;  1ZLL A;  5E79 E;  1MUU A;  3M9Q A;  1D7M A;  1K04 A;  3HUS B;  3V2R A;  4AAM A;  4UB6 H;  2IFM A;  2CXB A;  4IFF A;  2QE7 H;  1JY2 O;  4D6T G;  3TGU J;  1J1E C;  4I7Z C;  4WQE A;  1JTH B;  2MKV A;  4H13 B;  1G1J A;  3FWL A;  5CCH A;  3X39 A;  1MZ9 A;  4Z1M H;  1S3J A;  1YEA A;  2IBZ D;  1G2C A;  3EFF K;  3RL0 g;  1NTZ D;  1BCC G;  3HE4 B;  3L35 A;  2JR8 A;  2KZJ A;  5TJH A;  1NML A;  5DFS A;  2G8Y A;  4AAN A;  2FBW C;  4AAL A;  1NH4 A;  3ORV A;  1CSU A;  1L0N D;  2BCC D;  4N3Y B;  4MN4 C;  4N78 D;  1GIW A;  3VTP C;  1NO4 A;  3SJL A;  2V7Q H;  1HJB A;  2DVH A;  1K3H A;  3CWB D;  2GA1 A;  3MTU E;  3S9O A;  3OA7 A;  2KS1 A;  3CCE P;  1IZL 0;  2O1K A;  3AE3 C;  1P84 D;  2AIU A;  2Y0D A;  3WU2 H;  1SQB G;  3SWF A;  2GUV A;  1JCC A;  1LT9 C;  2WIT A;  2BLF B;  1M7L A;  1J1D B;  5L8R J;  3MP7 B;  3CXH E;  1KB9 E;  3PXS A;  2RN0 A;  2WSS H;  5DJT B;  2OZ1 A;  3HUS C;  5B66 V;  2IYO A;  1U7J A;  3Q1M A;  2C9N Y;  5KLV G;  5GTH V;  5CIH B;  1RQU A;  1KD1 Q;  4IFM A;  1L0L J;  1CSX A;  2AXC A;  1WRG A;  2UWJ E;  3L72 J;  4H13 C;  3IN6 A;  3GG2 A;  5KAI H;  2M5A B;  3AE9 C;  2O01 N;  3K5B A;  3I56 P;  5CCG C;  1S5L E;  2WSF J;  3USS A;  2YQB A;  1E2R A;  2MJZ A;  2D0W A;  1OFC X;  3HTK A;  2FYZ A;  3FXE A;  3CCV P;  1QL1 A;  1RF0 C;  3A7O A;  1JCD A;  1IFN A;  2KI7 B;  1HJ3 A;  1PIX A;  2K3R A;  1NTZ E;  2B4Z A;  2KXP B;  1FOC A;  1J1D C;  1CI6 A;  2WVR A;  1CSV A;  1OX3 A;  2DW3 A;  1L0N E;  1K73 Q;  2BCC E;  4N78 E;  1K3G A;  3WFB C;  2LXC B;  3ABV C;  2P2U A;  2H88 C;  5B5E H;  3CWB E;  3AEC C;  3HE5 A;  3PHL A;  2WZ7 A;  2W6J H;  2W6A A;  3CYT I;  4ZNC A;  1HBW A;  3CCJ P;  2FWL A;  2C8S A;  3AE5 C;  4L75 A;  3P8M C;  3NXS A;  1Q86 Q;  4DCK A;  2QIW A;  3M0D C;  1WT6 A;  3II6 A;  4ASW A;  4XYD B;  4FA5 A;  3A0H H;  1KFM A;  5CIE B;  1IO3 A;  2YKO A;  2YIU B;  1IFP A;  4KMG A;  3V4W A;  4U3F D;  2W8Z A;  1FHB A;  4I2L C;  1PP9 G;  3QWO C;  1OW8 A;  3CX5 E;  4JYB A;  3AE7 C;  1KYO H;  1DVH A;  2ZXE B;  1ZXG A;  1CRH A;  2FYU G;  5KJ7 D;  1ZOY C;  4P4Q B;  2BH5 X;  1SQQ K;  2QA4 P;  1S5L X;  3Q3D A;  3R4Y A;  4U3F J;  2JP3 A;  3BAT A;  1A02 J;  1FDI A;  5AW2 B;  3C9I A;  2K9Y A;  1KX7 A;  1C52 A;  2B87 B;  1NOH A;  3L75 G;  1FAV A;  1XTC C;  4L3H A;  3S4R A;  1ZR2 A;  3JC2 2;  1LT1 A;  2C1D B;  2HV4 A;  3HQ7 A;  4PWA A;  1AVY A;  2IZ1 A;  1KV4 A;  3OW2 O;  3PTZ A;  3TNU A;  4WBA A;  1YQ4 C;  1LJ2 A;  1FZC A;  1AQ5 A;  2IPP A;  1ZRT D;  1BE3 G;  1NTZ K;  5KAF E;  1GDV A;  1K05 A;  3CXH I;  3SVW A;  1KB9 I;  1QEX A;  4QAO A;  3M9H A;  2YIU C;  2QJP B;  1L0N K;  4ZMD A;  1CED A;  5CIG B;  1I8P A;  4WY4 B;  1T2K C;  4OH8 B;  4W7Y A;  3SLE A;  1NTM K;  2IFN A;  5CIB B;  1NNO A;  4YXW H;  3H1K G;  1QL3 A;  4FAV A;  4FA1 A;  3H1J D;  3H1H G;  3WFD C;  1Q90 D;  2WT7 B;  1AYG A;  4KHX A;  3H1I G;  5AW4 B;  1U57 A;  1HGZ A;  3L71 G;  2D2C D;  1VQ9 P;  3A5T A;  3JBT B;  1IO4 A;  5M1B A;  1A2S A;  2E42 A;  5C0Z A;  1CSB A;  1NKN A;  3PJS K;  1JMM A;  1MKM A;  1PL5 A;  1KQS O;  2XND H;  3U59 A;  3H1J J;  5KLV E;  2ZYA A;  1MG3 D;  2E74 D;  1LS9 A;  1J3S A;  3L37 A;  3NFQ A;  5E79 V;  1NHL A;  2FYU D;  3LID A;  4UB6 E;  1N7S D;  3HD7 D;  1M60 A;  1BGY G;  2HLO A;  2W6B A;  3O8Z A;  3GHG C;  1KMI Z;  2QJP C;  3RK2 D;  5B6Q A;  4A7P A;  1KZU B;  4WY4 C;  1DEB A;  2K1A A;  3VMA A;  1KIL B;  5AW1 B;  2WPQ A;  2ZON G;  1N73 A;  3L75 D;  1LWU B;  3SWS A;  3LIE A;  3AE8 C;  2ZAE B;  2NPS D;  3WUT A;  1NTK G;  1GMJ A;  2OYO A;  4IL6 H;  1C2N A;  3OJA B;  3CCU P;  1ZRT E;  2Z5I A;  4WB4 A;  4C46 A;  1DH3 A;  3B5N A;  4I6M C;  5CCH D;  1X22 A;  5EFW B;  3Q2Y A;  1CCR A;  1JY3 N;  1N73 B;  3WU2 E;  3Q5S A;  1QLE D;  1H33 A;  1F1F A;  3VNW A;  1MFT A;  5CYT R;  3CX5 I;  1DW0 A;  2GC4 D;  1URQ B;  2WSC J;  3FWN A;  3CXH W;  4EOT A;  2GB8 B;  4FA4 A;  1NU1 G;  4C7N B;  1X79 B;  1JOC A;  3BCC G;  1JM0 A;  3MGN A;  2YK3 A;  4H0L B;  3H1K D;  3TYY A;  1OWA A;  1CYC A;  1SQB K;  2BPB B;  1KYO D;  4J20 A;  4GOF A;  2V07 A;  1EZV G;  1KIL C;  1HF9 A;  5KAI E;  3L70 G;  5KKZ B;  2WSE J;  3L74 D;  1DD3 A;  4MU8 A;  2JWA A;  1PP9 E;  1LWU C;  1FC2 C;  4AAO A;  5AVV B;  2FRC A;  1KIB A;  1YIT P;  3P32 A;  5KLV K;  2WSF H;  1S5L V;  2ZJS E;  2FYU E;  5TIS H;  1CRC A;  3AEG C;  3V5B A;  3CMA P;  1ZN5 A;  1GK6 A;  1N73 C;  3PH0 A;  4NPF X;  3AED C;  3OA8 A;  1UII A;  3RK3 D;  3VMX A;  3SSU A;  1H32 A;  4Y5R A;  1URQ C;  1S4X A;  3L75 E;  2B10 B;  2R44 A;  1GJQ A;  1HWT C;  1VPC A;  1ZV8 A;  1C75 A;  1OXZ A;  1CHJ A;  1KN7 A;  1CTZ A;  2RKL A;  4O1W A;  5APT A;  2JTI B;  1JY2 P;  2W83 C;  5B5E E;  4H0L C;  4L1Q A;  5BU5 A;  3ZBM A;  2HPC A;  4JCG A;  2BEZ F;  2AEF A;  3OA8 B;  1HZV A;  2O01 J;  1BE3 E;  2AI5 A;  4QMA A;  1COT A;  1MZ4 A;  3L36 A;  1IRW A;  351C A;  1LT9 A;  1DW3 A;  1FZE A;  5CBN A;  1DII C;  3L73 G;  4JQ0 D;  1YQ3 C;  1RE4 C;  2XKM A;  3A0H E;  1YI2 P;  3NWV A;  5APW A;  3CX5 W;  3NTN A;  2C2C A;  3HUS A;  3H1K E;  1CHH A;  2OYI B;  1GW3 A;  1KYO E;  4FA9 A;  1X9V A;  2WPS A;  1DIQ C;  1CIF A;  1NU1 D;  2YMY A;  4PD4 D;  3H1H E;  3BCC D;  4GOE A;  1R0Q A;  1SQQ D;  4OGQ B;  3AE4 C;  1JTH A;  2IZ0 A;  3L71 E;  3L74 E;  4EDF A;  5B66 H;  2CPB A;  4HB1 A;  4XFJ A;  1HH7 A;  2B9B A;  1FDM A;  3HE4 A;  3RLM A;  2OTK E;  5CCG A;  3L70 D;  2Z5H A;  1AJY A;  1HVV A;  2K37 A;  4RKU J;  1EDK A;  1R5L A;  1H0T A;  3H1L G;  3B8E B;  1RY3 A;  1LC2 A;  1E79 H;  2FYU K;  3C8V A;  4WWI A;  1AOQ A;  2ZFC A;  1CHI A;  2E74 B;  4GED B;  1RF0 A;  3RK3 E;  2HG5 D;  1BGY E;  2J5U A;  3CCM P;  2FXO A;  4PJ0 E;  3JSV C;  2OYH B;  3FGA D;  3H25 A;  1CO6 A;  1FOS F;  3DMI A;  1I6E A;  1JNM A;  1W2L A;  1VQ5 P;  3RMZ A;  1H0T B;  2FKW B;  3PLN A;  5KAF V;  2JJL A;  3A2A A;  3W68 A;  1NTM D;  1LP1 B;  2J58 A;  2OYI C;  1DW1 A;  1NTK E;  4JPZ B;  2N3Y A;  1NTZ J;  3VMZ A;  2N1T D;  4EIE A;  5AVY B;  4OGQ C;  1ETP A;  1NMI A;  1SQV G;  2GC7 D;  1L0N J;  3BRV B;  1FE6 A;  2BCC J;  3O1Y A;  2L5G B;  3CC7 P;  2P7J A;  3AEF C;  2M5A A;  1EC5 A;  4IFD K;  1N9C A;  1RHZ B;  3CWB J; 
#chains in the Genus database with same CATH homology
 4NFG B;  3O0R C;  2KNC B;  2FYN B;  4P4Q B;  2BH5 X;  2A06 D;  3CX5 D;  4FB1 A;  5DJQ C;  2Y0E A;  3L73 D;  2L91 A;  3PRJ A;  1KX7 A;  1CYJ A;  1CCH A;  3WFC C;  1M6Z A;  1C52 A;  1I6D A;  1FCD C;  4EIF A;  1I8O A;  4L3H A;  1W5C T;  1N50 A;  1GU2 A;  3A9F A;  4WQ7 A;  3OCD A;  2C1D B;  5C9M A;  2HV4 A;  1H9X A;  3RN0 A;  155C A;  3HQ7 A;  4PWA A;  4UB6 V;  1CNO A;  5IY5 1;  4EID A;  3PTZ A;  3ZOO A;  3WC8 A;  1BL9 A;  2XTS B;  3C2C A;  1ZRT D;  1L9J C;  1AKK A;  2V08 A;  1GDV A;  1EZV D;  1CTJ A;  3SVW A;  1IQC A;  1HCM A;  4QAO A;  2QJP B;  5TIS V;  3OCD B;  2ZXY A;  3H1L D;  4D6T D;  1CED A;  1E29 A;  1I8P A;  5CIG B;  3TGU D;  1IRV A;  2MTA C;  1CC5 A;  2PAC A;  1DW2 A;  3SLE A;  3HQ9 A;  2CA3 B;  3ZIY A;  1LC1 A;  1H33 B;  5CIC B;  1ZZH A;  1C7M A;  5CIB B;  3ZOX A;  1NNO A;  1C6O A;  5CIF B;  4FAN A;  1BCC D;  1QL3 A;  1H31 A;  5KLI B;  4FAV A;  1COR A;  1YIQ A;  4FA1 A;  3H1J D;  3CP5 A;  3WFD C;  3PXW A;  1KB0 A;  3WU2 V;  3MK7 B;  1AYG A;  4WQD A;  1FI7 A;  3O5C A;  2L4D A;  1I55 A;  1HRC A;  2N9I A;  3JBT B;  2MHM A;  1A2S A;  1GQ1 A;  1WVE C;  1EB7 A;  5EXQ A;  5C0Z A;  2GIW A;  2C1V A;  1N15 A;  3TF5 A;  1NIR A;  1FI9 A;  1CRI A;  1LFM A;  1SQB D;  1S6V B;  1E8E A;  1HRO A;  1MG3 D;  2CE1 A;  1B7V A;  1LS9 A;  1J3S A;  2CE0 A;  2LIT A;  5E79 V;  2O3J A;  2FYU D;  5AUR A;  1MG2 D;  1CSW A;  3A0B V;  4K3I A;  1U75 B;  1YIC A;  2N3B A;  3L4M A;  5DF5 A;  3KHU A;  1M60 A;  5KAI V;  2PCC B;  4WQ9 A;  2ORL A;  1AOF A;  5KLV D;  2N9Y B;  2C1D A;  3L4O A;  4O1Q A;  3HQ8 A;  5B6Q A;  4A7P A;  3NBS A;  3VMA A;  1U74 B;  4H0K A;  1L0L D;  2ZON G;  1CRJ A;  3L72 D;  4WQB A;  4YE1 A;  2BH4 X;  2LIR A;  2ZZS 1;  3L75 D;  3SWS A;  1H32 B;  3ZOW A;  3WFE C;  2AXT V;  1C2N A;  1LMS A;  3MK7 C;  1KX2 A;  3GW6 A;  3CXH D;  1KB9 D;  1CXA A;  1CCR A;  1CYI A;  1H33 A;  1F1F A;  3VNW A;  3VRD A;  5CYT R;  1DW0 A;  2GC4 D;  4DY9 A;  2BCN B;  1YFC A;  2RMZ A;  2OZ1 B;  3CXH W;  2CA4 B;  5B5E V;  2GB8 B;  4RSZ A;  4FA4 A;  2N18 B;  4L3G A;  4WQA A;  1YCC A;  1C2R A;  2YK3 A;  1SQP D;  1HJ5 A;  1C6R A;  3VYM A;  3H1K D;  1CYC A;  2BPB B;  1KYO D;  4J20 A;  2V07 A;  1QL4 A;  2Y0C A;  4AAM A;  1QYZ A;  2YCC A;  1CIH A;  2BGV X;  3ZOY A;  3NBT A;  2CXB A;  3A0H V;  5KKZ B;  3L74 D;  1I54 A;  1KYO W;  4MU8 A;  2JWA A;  4WQE A;  4AAO A;  3WUI A;  2FRC A;  1KIB A;  2C9X B;  3FWL A;  1CRG A;  3X39 A;  1YEA A;  4LJI A;  1S5L V;  1DT1 A;  2IBZ D;  2ZOO A;  4WQ8 A;  1NTZ D;  1JDL A;  5TJH A;  1NML A;  1CRC A;  5DFS A;  1CIE A;  4AAN A;  4AAL A;  3ZCF A;  2JQR A;  1RAQ A;  1SQV D;  1PP9 D;  3ORV A;  1CSU A;  1F1C A;  1L0N D;  2BCC D;  1H9Y A;  3CU4 A;  4WQC A;  1GIW A;  3OA8 A;  3SJL A;  5H2F V;  1H32 A;  2DVH A;  1K3H A;  1M70 A;  3CWB D;  4Y5R A;  2B10 B;  4H0J A;  1QKS A;  2KS1 A;  1IZL 0;  4RJT A;  1GJQ A;  1HZU A;  1P84 D;  2AIU A;  451C A;  4Q5P A;  2Y0D A;  1C75 A;  1HJ4 A;  1CHJ A;  4UB8 V;  5CID B;  1CTZ A;  2N18 C;  1A56 A;  4O1W A;  1OAE A;  2JTI B;  1KV9 A;  2BLF B;  3PH2 B;  3TYI A;  1C6S A;  4L1Q A;  3ZBM A;  1WEJ F;  4JCG A;  1RZ6 A;  2QJK B;  4PJ0 V;  3OA8 B;  1HZV A;  2C1U A;  3PXS A;  1FI3 A;  2RN0 A;  2OZ1 A;  5B66 V;  4V2K A;  2K9J B;  2AI5 A;  5GTH V;  5CIH B;  1COT A;  1MZ4 A;  1CXC A;  1IRW A;  351C A;  1DW3 A;  1CIG A;  1GKS A;  1DII C;  1CSX A;  1VYD A;  3GG2 A;  3NWV A;  1BE3 D;  3CX5 W;  1YNR A;  2QG4 A;  2C2C A;  2DGE A;  2D0S A;  1CHH A;  2B11 B;  5GTI V;  2B12 B;  4EIC A;  4FA9 A;  1DIQ C;  1CIF A;  1NU1 D;  4PD4 D;  2YQB A;  3ITK A;  3BCC D;  2I8F A;  1R0Q A;  1SQQ D;  4XXL A;  1E2R A;  3M97 X;  2B0Z B;  2D0W A;  3DP5 A;  3DR0 A;  4EDF A;  2QJY B;  1YTC A;  1HH7 A;  1N90 A;  1OCD A;  3KZI V;  1RZ5 A;  3H1H D;  3RLM A;  1HJ3 A;  3L70 D;  1I5T A;  2B4Z A;  3H1I D;  1CTY A;  5DJQ B;  3L71 D;  1FOC A;  1SQX D;  1LC2 A;  1QN2 A;  1CSV A;  3HQ6 A;  4N0K A;  3RN1 A;  1AOQ A;  1CHI A;  1K3G A;  3WFB C;  4PW9 B;  4GED B;  2ZBO A;  2EXV A;  1A8C A;  3PXT A;  3PHL A;  3CYT I;  1FJ0 A;  1CO6 A;  1PPJ D;  3DMI A;  1I6E A;  1W2L A;  2PCB B;  3RMZ A;  1CRY A;  2N9J A;  2FWL A;  3PLN A;  2C8S A;  5KAF V;  3TDK A;  1L9B C;  1RAP A;  1BGY D;  4GYD A;  1NTM D;  3O20 A;  1DW1 A;  4XYD B;  3SXT A;  1DVV A;  2N3Y A;  4FA5 A;  1H31 B;  5CIE B;  4AX3 A;  4EIE A;  4IL6 V;  1IO3 A;  2YIU B;  4KMG A;  1ETP A;  4U3F D;  1FHB A;  1NMI A;  2GC7 D;  3O1Y A;  2Q3E A;  1DVH A;  2VHD A;  1YEB A;  1CRH A;  1NTK D;  1N9C A;  1H1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...