1NU1D

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 52
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1nu1D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1nu1D01
1CSWA 3CXHW 1H32A 1ZRTD 1H31A 2PCBB 2CE0A 4WQEA 1BL9A 1CYJA 1KX7A 1CIFA 1CO6A 1SQVD 1VYDA 4P4QB 1W5CT 1C6RA 2RMZA 2B4ZA 4V2KA 1C6OA 4PW9B 2Y0DA 2L4DA 2VHDA 1NTZD 3H1JD 2BPBB 5GTIV 2OZ1B 2YK3A 1H9YA 1CTZA 3L70D 1GU2A 1GDVA 1AYGA 5KLIB 4EIEA 5C0ZA 3A9FA 5CYTR 2N3YA 351CA 1CHJA 2PACA 2CA3B 4H0JA 1HJ4A 1HZUA 2XTSB 5CIDB 3SVWA 1E8EA 4J20A 3L72D 2ZONG 5TJHA 4IL6V 3ZOXA 4WQCA 3BCCD 4QAOA 2AI5A 4LJIA 2A06D 3VYMA 1NNOA 4L1QA 2QJYB 2V08A 1CRCA 4FA1A 3H1LD 3CYTI 4K3IA 1CEDA 2PCCB 4L3HA 155CA 3GW6A 1B7VA 4N0KA 3VNWA 2CXBA 1I5TA 1CNOA 2O3JA 1DT1A 1L0ND 4FA9A 1DW2A 1FHBA 3PHLA 4AAMA 1N15A 1KYOD 1CSUA 1M60A 3OA8B 3A0BV 1YFCA 5TISV 1NMIA 4GEDB 1PP9D 1RAQA 4A7PA 2N9YB 1I55A 1KX2A 1MZ4A 2BCNB 5C9MA 3L71D 3CWBD 1FCDC 1KB0A 4RSZA 2ZBOA 4KMGA 1R0QA 2FYUD 1CIEA 3L74D 4FA4A 1H31B 1DW3A 2JTIB 5CIBB 3WU2V 5B6QA 1YICA 5KAFV 3A0HV 3CU4A 1C52A 1CIHA 2HV4A 4Y5RA 5CIHB 1H33B 1COTA 2YIUB 1KYOW 1HROA 3PXTA 3PTZA 3WFEC 4NFGB 2Y0CA 3SXTA 1E29A 5IY51 1CSVA 2YCCA 1N9CA 4FB1A 3CX5W 1HJ3A 4H0KA 1LMSA 1J3SA 1RZ5A 4EIDA 1CRIA 1E2RA 1FI3A 2RN0A 3TGUD 1OCDA 2YQBA 1IRVA 1K3HA 2Y0EA 2FRCA 2OZ1A 3L75D 4XXLA 4EDFA 1IO3A 4YE1A 2B12B 2I8FA 1DW1A 2QJKB 2KS1A 1LFMA 2BH5X 2N9IA 1SQXD 2B10B 5AURA 1IZL0 2ZXYA 2KNCB 3L73D 1I54A 2DGEA 1CYIA 1GKSA 5CIGB 1DIIC 1HCMA 1QL3A 4EIFA 1M70A 3OCDB 2C1UA 1DIQC 2AXTV 3MK7C 1I6EA 1OAEA 3MK7B 1C7MA 5B5EV 2QJPB 1A8CA 1YNRA 4WQ7A 4L3GA 4MU8A 1GQ1A 5H2FV 3PLNA 4UB6V 1I8PA 4AANA 3FWLA 1CSXA 3O0RC 3PXWA 1YTCA 1W2LA 5EXQA 2V07A 2B11B 2BH4X 1IQCA 1CXAA 4WQ8A 3ZIYA 2QG4A 5DFSA 3ZBMA 1M6ZA 3X39A 1SQBD 2LIRA 2JQRA 1CYCA 3SLEA 3TDKA 1CTYA 1RZ6A 5KLVD 3TF5A 3HQ8A 1CXCA 2LITA 3RN0A 4UB8V 3DP5A 1L0LD 4DY9A 1KV9A 1K3GA 1S5LV 2D0SA 3ZOOA 4FANA 1SQQD 1H33A 1MG2D 1NTKD 2Q3EA 1CIGA 1CHHA 3PRJA 3RN1A 1NMLA 1SQPD 1QN2A 4EICA 1QKSA 1F1CA 1CRGA 3C2CA 3M97X 1GJQA 1P84D 1LS9A 1EZVD 4PWAA 2BCCD 1YCCA 2C1VA 2BLFB 5CICB 1FJ0A 2GIWA 4U3FD 4AX3A 1EB7A 3VMAA 3HQ6A 1H9XA 1FOCA 1CC5A 451CA 1C75A 1N90A 1KB9D 5GTHV 1LC2A 2MHMA 1QYZA 5DJQB 3JBTB 5B66V 4O1WA 3PXSA 4AALA 2EXVA 1NIRA 1U74B 3WC8A 1MG3D 2K9JB 1DW0A 2IBZD 1FI9A 2C1DA 2CA4B 3O5CA 3DMIA 4FAVA 1L9JC 3VRDA 4D6TD 1BCCD 1C2RA 1KIBA 3NBSA 5DF5A 5DJQC 3GG2A 2BGVX 2C9XB 1RAPA 2DVHA 1N50A 3CX5D 3WUIA 3PH2B 1CHIA 3NBTA 1C2NA 4O1QA 1I8OA 1A56A 3WFCC 1U75B 4XYDB 1BGYD 3ZCFA 2C8SA 3NWVA 1AOFA 3TYIA 3O1YA 2ZZS1 4RJTA 2N9JA 3HQ9A 1C6SA 2ORLA 2C1DB 2GB8B 1CRHA 1HJ5A 2N18B 4PD4D 1ETPA 3WFBC 5KKZB 1H1OA 4Q5PA 4WQDA 1ZZHA 1LC1A 3O20A 3CXHD 5CIFB 2N18C 2MTAC 1H32B 1YEBA 4JCGA 4PJ0V 1S6VB 1CORA 3L4MA 1GIWA 1WEJF 1HRCA 2AIUA 4WQ9A 2D0WA 3H1HD 5CIEB 2L91A 2B0ZB 2JWAA 1CRYA 1JDLA 2GC7D 4WQBA 4AAOA 1CCHA 1CTJA 4WQAA 3H1KD 3WFDC 3CP5A 2FYNB 3ORVA 3OA8A 3RMZA 1NTMD 1A2SA 1AOQA 1DVVA 5E79V 3SWSA 1F1FA 2CE1A 1WVEC 1BE3D 2GC4D 1IRWA 3RLMA 1DVHA 3ITKA 3HQ7A 1YEAA 1QL4A 2N3BA 3ZOYA 2FWLA 1HH7A 1CRJA 3KZIV 1FI7A 1YIQA 3KHUA 1PPJD 3H1ID 3ZOWA 1I6DA 1CCRA 3L4OA 2C2CA 2ZOOA 1L9BC 1NU1D 4FA5A 4GYDA 3DR0A 1HZVA 1AKKA 3OCDA 5KAIV 3SJLA
chains in the Genus database with same CATH superfamily
1CSWA 3M9HA 2KOGA 3CXHW 1USDA 1H32A 3P7KA 2FY8A 1ZRTD 2QA4P 1YTZT 2CE0A 4AYCA 2HODA 1CYJA 5AW9B 3USSA 1CIFA 2FFDC 1VL2A 2CK3H 2JDIH 3W67A 1XTCC 3RL0g 1P84E 2D2CB 3CC7P 2KLUA 1NTZD 3H1JD 5GTIV 1H9YA 1PGPA 1CTZA 3L70D 1GU2A 2ZYGA 4H13D 5C0ZA 4H44D 3A9FA 1YIJP 4H0JA 1P84I 5E79H 2XTSB 4UB8E 5AW2B 2WSEH 1X22A 3L72D 5TJHA 3ZOXA 5KLVE 3BCCD 3BATA 2KIKA 3VYMA 2XDJA 4L1QA 3BCCE 2V08A 4DCKA 3CYTI 4HKZH 4BWNA 4K3IA 3H32B 1SQQK 4RO0A 2OYIA 155CA 3II6A 1KILA 1R5SA 2WMMA 4BRYA 4XA4A 1LGHB 1K9MQ 2AEMA 5KLVG 1RE3A 3OA8B 1MZ9A 1D7MA 2J58A 3AEFC 1IFPA 2OTKE 2AXTE 2C9NY 3H1KE 3H1HG 1NMIA 2YMKA 4GEDB 3HD7B 1PP9D 2MJZA 2N9YB 1I55A 3UIAA 5C9MA 1SQQG 3V2PA 2NPSA 1Q90D 3CWBD 5KAIE 1FCDC 4KMGA 2FYUD 5C39A 2I1KA 4FA4A 2JTIB 1PP9G 1LT9A 3WU2V 4I2LC 5B6QA 5KAFV 3CWBG 5M1BA 3BRVB 1AQ5A 4PD4H 1SQPK 3CI9A 3QWOC 3H1HE 3PXTA 2PFXA 2AEJA 4PV1D 3PTZA 3VMYA 1T2KD 4RKUJ 1E29A 1M1JA 4IFMA 3RK3D 1ZR2A 2WQYC 3KPEA 4W80A 4LC1A 2FYNC 3CD6P 1R8EA 2CPBA 2QM8A 4EDFA 1IO3A 3L74J 4YE1A 2B12B 4L76A 4U3FE 2HPCA 4R4LA 3L36A 2KS1A 2M0BA 1LFMA 2BH5X 1SQXD 5APVA 2ZVOB 3BCCJ 1NTKG 2B10B 1NTME 4H0LB 2ZXYA 1LJ2A 3L73D 1GKSA 1N7SB 1SQVK 4IL6E 3AE4C 1SQXG 1HCMA 3LIEA 2R44A 1NGMB 1QVGO 3SSUA 1M70A 2BEQD 3M0DA 1JY3N 5APYA 1C7MA 5GTHE 3FXEA 1K04A 3CCQP 1KORA 1GDTA 1DD3A 3PLNA 5H2FV 4OVNF 5CCGA 3AE2C 1L4AB 1LTTC 4AANA 1CSXA 3PXWA 4U7JA 1X0TA 3F5HA 4L73A 5AVTB 5EXQA 4N78D 5AVZB 3CCSP 2KLVA 1HJ0A 1IQCA 1BSHA 1KQFB 1RF0C 5APUA 1CYCA 3M9QA 1BSNA 1EDIA 2L5GB 4GDOA 1CXCA 2LITA 2IFNA 4IFFA 2QEXP 3HE4B 1L0LD 3GF7A 5AVVB 1K3GA 4JYBA 4JQ0D 1S5LH 1YJ9P 1H33A 1J1EB 3L70E 2FFDB 1CHHA 1GK4A 4LGDE 1NMLA 2FXMA 1S5LX 1HF9A 1GU4A 3D6ZA 1GJQA 1P84D 3OJAB 1YQ4C 1LS9A 1G2CA 1EZVD 4PWAA 5L8RJ 1YCCA 1SQXE 2K1AA 2UWJE 3NXSA 4AX3A 1BGYG 3HE4A 1EB7A 2FXOA 3IFMA 3RK3C 5GTIH 3HQ6A 2XKMA 1EZVG 451CA 5GTHV 1OW6A 1J1EC 2KYVA 5E79E 2OQQA 3AEAC 4TLFA 1FOSF 1NTMK 1KD1Q 1JMMA 1S72P 1U57A 4XE5B 5APQA 1DW0A 2C1DA 3DMIA 4FAVA 3VRDA 3A7OA 2QJYC 1RHZB 1SQVE 5DJQC 2BGVX 1M7LA 2D2CD 1KILD 1C2NA 4WVZA 3V6IA 1I8OA 1GU5A 1UIIA 1OW8A 1U75B 1RF1C 3TGUJ 2YXRB 1M8OB 1URQD 3OA7A 1PPJG 3L4FA 3TYIA 1L0LK 2KI7B 4QMAA 4I6MC 4OGQD 1N73B 2KNCA 1KV4A 4PD4D 4Q5PA 4WQDA 3CX5E 2GA1A 1FJPA 1S9KE 3HTKB 1OVVA 2OYHA 5CIFB 5CCGC 4JCGA 1N7SC 1NTKJ 4D6TG 4PJ0V 1AV1A 2R3CA 3L4MA 1S3JA 2W90A 1KILE 1HRCA 2AIUA 2WSFH 1NTZJ 2Q1KA 1FS0E 3CX5I 3V4QA 5CIEB 1KYOH 2WPSA 5H2FH 2GC7D 1GW4A 4AAOA 4H44B 2NZ2A 1CCHA 1Q82Q 1CTJA 2IYOA 3M9BA 1GL2D 2FYNB 3ORVA 2Q9IA 1QEXA 2G3AA 2HFED 2OYIC 2QRXA 1WVEC 2C0XA 3V2NA 3WUVA 1T2KC 1LWUB 2OYOA 3ZOYA 3KHUA 3H1ID 3KDPB 1I6DA 5CHXA 1L9BC 5B66E 1NTKE 2BCCE 2Q6QA 4U3FG 1AJYA 3DR0A 1HZVA 4N6JA 4L75A 3OCDA 3RK3B 3L72J 1H31A 3LW5J 1Q81Q 1Y47A 1CO6A 2OTJP 2E43A 1W5CT 1C6RA 4WY4D 4EIJA 4V2KA 2HLOA 1C6OA 1PV3A 4XFJA 3MUDC 4OGQC 1FDIA 3I55P 2YK3A 1BCCG 2YMYA 1VQLP 5KLIB 4EIEA 3M0AA 2KP8A 2N3YA 2LR2A 351CA 1JY2N 3KQGA 1CHJA 4WWIA 3MD0A 4N3YB 3O6QB 1E8EA 4J20A 1QGKB 3HD7A 1E5WA 1IFNA 1JOCA 2QJYB 3B5NA 1CRCA 2JR8A 1WMKA 4FA1A 3H1LD 3E7KA 2A45I 3CCUP 3VNWA 1NU1G 2CXBA 1I5TA 3TGUE 2O3JA 1DT1A 2WZ7A 4JBZA 4FA9A 1NTZG 2YIUC 1LWUA 3Q5SA 5AW1B 1FU1A 4UB6E 1RY3A 1G1IA 3L70G 3O6QA 5KJ7C 1M60A 1VQOP 5TISV 1RAQA 2ITAA 4A7PA 1JO5A 1BE3E 2BCNB 1MV8A 2QVAA 4TT3H 4OH8B 1R0QA 3C1LA 4NPFX 1CIEA 3L74D 3H1JG 1DW3A 1PGQA 2DW3A 5CIBB 1L0NK 1GMJA 3MTUE 3A0HV 3CU4A 1ZXGA 1K05A 1H33B 2YO3A 4ZKPA 3S1KA 1L4AD 1KYOW 5AW0B 2M5AB 4U3FJ 3RK2D 1YHQP 1RF0A 2O01N 4NFGB 1YQ3C 5BU5A 3L72G 3CX5W 2N1TA 1HH0A 3CCMP 1NU1E 2RN0A 3AE9C 2YKQA 3CPWO 1K3HA 2Y0EA 4GOEA 2FRCA 1VQ5P 1L0LJ 2I8FA 3B5NB 2RKLA 2N9IA 1OXZA 1VQ7P 1L4AC 2WVRA 4M3LA 4AQRD 1CI6A 1LT1A 1DIIC 4YPCA 4R4MA 4D6TE 2P67A 4EIFA 3OCDB 1WT6A 3Q5RA 1IO4A 1OVRA 2WITA 1GW3A 2O01H 2P10A 1A8CA 4WQ7A 4H0LC 3RBZA 4PV1B 5CJ0A 5CBOA 3PH0A 1PGJA 3E1RA 2V07A 2SPZA 2W83C 1ZMEC 1FZEA 1VDFA 2JP3A 3CL3D 3T97B 3MP7B 1SQBD 1IFMA 1KQGB 2JQRA 1CTYA 1YBKA 3OW2O 2LXCB 1LP1A 3RN0A 4UB8V 4KT0J 3H1JJ 3MHVA 2ZFCA 2KSJA 5KJ7A 1S5LV 1PFIA 4FANA 2A45H 1USEA 2FYZA 1MG2D 1NTKD 2Z4EA 3PRJA 1SQQE 2M3EA 3VP8A 3NTNA 3L73G 1SQPD 3VMXA 2W6JH 1X8YA 2M3BA 1QKSA 1F1CA 1P84H 2N1TB 5AVWB 3M97X 3GHGA 1NHLA 4IL6H 2C1VA 5AVQB 5CICB 1FJ0A 1SQPG 2ZT9D 4LLHA 5B5EE 4EYYQ 3VMAA 1K73Q 1CC5A 4PJ0H 1MKMA 2IX7C 3M91A 1DEBA 4KJMA 1N90A 1DH3A 3A0HE 2MHMA 3LIDA 3B5NC 1J1DB 4O9BA 2FBWC 2K9JB 1NOHA 3N4XA 1JY3O 1L9JC 3HRNA 2FXPA 4JPZB 1KFNA 3WMM0 1C2RA 1KIBA 2AXTH 5APXA 1NKZB 1PIXA 3GG2A 5EFWB 3PH2B 1CHIA 1TU3F 3H32A 3WFCC 3L73E 1BGYD 3ZCFA 3H1IJ 5KAFH 3VP9A 1DD4A 1OW7A 1EC5A 5KJ7D 3BCCG 3O1YA 3HQ9A 2Y9ZA 3NMDA 2GB8B 1CRHA 1JCCA 1ETPA 3WFBC 1H0TA 2JO1A 1H1OA 1CW5A 1JY2O 4H13C 1HBWA 1AVOA 2Z5HA 2WSCJ 2N18C 2MTAC 1LP1B 5AW8B 3CMAP 2WSSH 2IZ1A 2D2CC 1LT9B 1AA0A 3H1HD 2JJLA 2P7JA 1L4AA 2AEFA 2P58A 3L71E 2HODB 1ZV8A 2L91A 3IAOA 1T3JA 3S9OA 3R2PA 1KZUB 3SWKA 3H1KD 3L73J 2FYUG 5CBNA 5H2FE 1OX3A 1A2SA 2XNDH 3U59A 1F1FA 2CE1A 2GC4D 3RLMA 4C7NB 1FJKA 5APSA 3HQ7A 1HJBA 3S4RA 1R5LA 1QL4A 2N3BA 1QX8A 3E1IA 4YTPC 3IN6A 3CCVP 2FWLA 1JY2P 1CRJA 1GD2E 1YIQA 1IK7A 1PPJD 3JCUH 2BCCG 5KLIC 1A02F 4B86A 1AKKA 3AE3C 2R5BA 5KAIV 3PP5A 1N86A 1Y9BA 1W2BO 1NU1K 1S4XA 4OGQB 3G3ZA 5AW4B 1HGVA 2I1JA 2A06E 1BL9A 2I8DA 1KFMA 1KX7A 2WT7B 4P4QB 2FFDA 1IJDB 1N73A 2AXCA 3L71G 1ZOYC 4UB8H 2ZYDA 2YNYA 3M0DC 2L4DA 2VHDA 3V5BA 2BPBB 2FYUE 3HTKA 2H89C 2WPQA 3CCRP 2WSEJ 1AYGA 1OMIA 5CYTR 5AVUB 2KXPB 2PACA 2CA3B 1HJ4A 1HZUA 4L74A 3BASA 1PP9J 3AE5C 3GF3A 2ZONG 3U1CA 4QAOA 4LJIA 3EWKA 2XZRA 3LW5H 2A06D 1ZR4A 1NNOA 2YKOA 1L0NG 2OYIB 1ZN5A 1FC2C 3V2RA 3HUSC 3TGUG 4N0KA 1CNOA 1NO4A 4C7NA 1L0ND 2XU6A 4AAMA 1OWAA 2VRSA 1N15A 5KLVJ 1KYOD 2IBZI 4DT0A 5TISH 3A0BV 3H1HJ 1LTGC 3T97A 1SQQJ 1FZCA 1KX2A 3EQ2A 1KB0A 4RSZA 2ZBOA 2MKVA 3SFDC 4NPDA 1X9VA 3L75G 3RL0D 2HR3A 1H31B 4H13B 4WY4B 1N2DC 4PD4E 3QH9A 2H7HA 1YICA 2YO2A 1CIHA 2BCCJ 1COTA 2YIUB 3WFEC 2Y0CA 1BDCA 4ASWA 5IY51 2YCCA 4FB1A 4PD4I 1AFOA 4N78E 4OWFA 1M1JB 4H0KA 1FE6A 1J3SA 1RZ5A 2E75D 1QLED 1CRIA 3CCLP 1FI3A 1KQSO 1KB9E 1ZLLA 3L35A 1OCDA 1DEEG 2YQBA 2E74C 3L74G 3CC4P 3AEGC 4GT1A 2QJKB 4I7ZC 1YJNP 3AEDC 4Y28J 2GUVA 3GHGC 3F89A 1S9KD 3A0BH 4ASVA 1KB9I 1IZL0 1SQBJ 2KNCB 2K9JA 1I54A 2DGEA 2KZJA 2J5UA 1SQXJ 2HYNA 3A0BE 2O01J 3W68A 2QSIA 1RE4A 2KZIA 4Z1MH 1M56D 3A5TA 1RQVA 2C1UA 2ZYAA 1DIQC 2AXTV 2Q3IA 1OAEA 3MK7B 3MUDA 5B5EV 1FBMA 1SQPE 3ZDMA 1YNRA 1SP4A 4L3GA 4GKGA 4PJ0E 4UB6V 1DIPA 1XTGB 2W6BA 1VQPP 3FWLA 2WT7A 1URQA 3B4SA 2XNXA 1YTCA 1A02J 1W2LA 3RK3E 4JF7A 1KQLA 1PZQA 3Q3DA 2B11B 2BH4X 1CXAA 4WQ8A 3ZIYA 2E5TA 1NH4A 2QG4A 3Q1MA 2HPCB 3EFGA 1VQ9P 3ZBMA 1M6ZA 2ZVNB 1JNMA 2O1KA 3SLEA 1VPCA 2PGDA 5KLVD 3TF5A 1IC2A 1KILC 3HQ8A 1GZLA 1T8ZA 1Q7YQ 3H1IE 5AVYB 2BEZF 3RL0B 1JEKA 3AE1C 2C9LY 3DP5A 3L75J 4DY9A 3H1LJ 1RE3C 1KV9A 5CCGD 1NWQA 1SQQD 3SWYA 4EOTA 4H0LD 1N7SD 1T3UA 4AUWA 2Q3EA 2NPSC 3HE5B 1VF5D 2IBZG 3GLMA 1QN2A 4EICA 1CRGA 1NAFA 3PJSK 1VF5C 3BVHA 4PV1C 5GTIE 2BLFB 1G2CB 2GIWA 4GODA 1SQBE 4U3FD 2ZXEB 5APWA 3CCJP 3H6PA 2WPVB 1H9XA 2J59M 1JB0J 2K9YA 3VN0A 2OYHC 2Y9YA 2FKWB 1C75A 1LC2A 5DJQB 1OZHA 1LNQA 5AW7B 1SQVJ 2V7QJ 3PXSA 4AALA 1NIRA 1U74B 1SQPJ 3WC8A 2C0WA 1MG3D 2GM4A 3C9IA 2E76B 2CA4B 3O5CA 1SQBG 1NAYA 5CCHD 1BCCD 3CMEP 2W8ZA 2HG5D 2IFMA 1DX7A 1U7JA 1EXIA 1N50A 1RF1A 4O1QA 3HE5A 5AVSB 1A56A 1H88A 3FGAD 3Q5PA 1NTKK 3A0HH 2C8SA 3WU2H 5AVRB 2OARA 1YJWP 1MFZA 4ZNCA 3D0WA 3O8ZA 2N9JA 1C6SA 1NTMG 3MIWA 1OFCX 2ORLA 1VQ4P 1YTZI 1HJ5A 5APTA 5KKZB 1GL2A 3L74E 1UIXA 1SS1A 1FZBA 1LC1A 1PL5A 2WWWA 3TK1A 1ZW0A 2ZXXA 1RH5B 2H43A 5KKZC 3V4WA 3AE7C 1W2EA 1YEBA 3CX5H 1LTJC 3TNUB 3JCUE 1S6VB 3IR9A 1CI6B 5DJTB 4IFDK 5BVZA 3NFQA 2B9BA 3MZWB 3GHGB 3WUTA 1S2EA 3A3YB 2WPRA 3R4YA 2YXQB 1IFIA 2QJKC 3CWBJ 3CXHE 2JWAA 1JDLA 4WQBA 1Q86Q 1PP9E 4WQAA 3P8CE 1S1CX 1GTWA 1LTSC 1N8RQ 1RF1B 2O1JA 1AQTA 1KB9H 1X79B 2R32A 2IYPA 5E79V 2K3RA 1LTIC 1BE3D 1FZCB 2E76C 1URQB 1DVHA 3CXHI 3ITKA 5CCHA 4RESB 4WY4A 1HH7A 4GIFA 1FDMA 1FI7A 2FYUJ 3H1LE 1BE3G 1VQ8P 3CC2P 1CCRA 3L4OA 3U1AA 2IZ0A 3BRTB 1HWTC 1W5CE 1VQ6P 1MUUA 4D6TJ 5AVXB 1SFCA 2N1TC 1SQVG 3VOPA 1CZQA 1BGYE 4WY4C 3AECC 4Y99B 3ABVC 2BASA 2PCBB 3H1KG 4KHXA 4WQEA 1VF5B 1HVVA 2Q5UA 1QL2A 1SQVD 1VYDA 2E76D 2N1TD 3HD7D 1JUNA 4JYCA 1BDDA 2RMZA 2B4ZA 3L72E 1NKNA 1JTHA 3WUUA 1EDJA 4PW9B 2Y0DA 2OZ1B 1BCCJ 1GDVA 1JCDA 3AEEC 3TNUA 2WTYA 4W7ZA 1HUCA 1NTMJ 5CIDB 3SVWA 1GL2B 1SQXK 1IZNB 2GUSA 4IL6V 1CSBA 4WQCA 4I1LA 4HJGH 2AI5A 1H89A 3AE8C 1L0NE 1LWUC 3CCEP 1E79H 1WRGA 3SFEC 1ZRTE 1CEDA 2PCCB 2E75C 4L3HA 3GW6A 3VMZA 1B7VA 2K88A 3M06A 2E5YA 1N7SA 2R3SA 1DW2A 1FHBA 3PHLA 1EDKA 1VQNP 1CSUA 1SFCD 1QVFO 4H44C 3CLQA 1YFCA 3N7NA 2OGUA 3SWFA 2W27A 2JWDA 4ZMDA 1MZ4A 1KN7A 3L71D 3RGUA 2E74D 4DJGA 2K37A 2A45G 3VYIA 1H8AA 3HD7C 3WU2E 3RK2B 2N9BA 2A06G 3B8EB 4UB6H 4Y99C 1FDOA 1BGYJ 1LTBC 3P8MC 4BRYB 3P8CD 3IF4A 4HB1A 2LXBA 1C52A 3C8VA 1YITP 2HV4A 4IL6X 4Y5RA 1N73C 1M57D 5CIHB 1BE3J 5B5EH 1KC8Q 3CWBE 1NTZK 2POHA 3L71J 1HROA 2E74B 1FOSE 2W6AA 2JEEA 3SXTA 1CSVA 5AW3B 1N9CA 3H1KJ 1HJ3A 1KILB 1SVFA 1IK9A 1LMSA 1FZCC 3B71A 1BCCE 2WSCH 2ZJSE 4EIDA 2QJPC 1E2RA 3TGUD 1JY3P 3OAKA 4DZOA 2PRRA 2IPPA 3RL0C 1IRVA 1VQMP 4WB4A 1OVUA 1LT9C 2OZ1A 3L75D 4XXLA 1L0LG 1DW1A 2E75B 3GMAA 3K5BA 4BXLA 5CMZA 3TSIA 1PGOA 2B87B 2PP6A 1NJIQ 3G6EP 1NYHA 5AURA 1RQUA 3JSVC 2IDBA 1CYIA 3D71A 5CIGB 1JM0A 1LTJB 3B5ND 2Z5IA 3Q2YA 1N7LA 1QL3A 5CJ4A 3L37A 1EZVE 2P2UA 2PAJA 1EXJA 3D70A 3G9RA 3MK7C 1I6EA 4IOIH 2QJPB 2ZAEB 2KS1B 2LKMA 2ZT9B 4MU8A 1IFJA 1GQ1A 1S5LE 3D6YA 2QM7A 1ZP0C 1I8PA 3O0RC 2KK7A 1EZVI 1J2JB 2CPSA 1EDLA 2R5DA 4YXWH 2G8YA 2WSFJ 5DFSA 1G1JA 3X39A 2LIRA 3TDKA 1RZ6A 1L0NJ 4I7ZB 3EFFK 1YI2P 1T6AA 1PPJE 4WBAA 1J1DC 3RK2C 2V4HA 1FAVA 1FZGA 3G71P 2D0SA 3ZOOA 4DOJA 2NRGA 1CIGA 1URQC 3RN1A 2ZT9C 1SQBK 2OYHB 3H1JE 1K8AQ 3C2CA 2JKVA 2OTLP 5AW6B 3RBXA 2B89A 2BCCD 1Y8AA 1OIPA 2NPSD 1RE4C 2RH0A 1LTAC 1Z56A 5KTBA 1FOCA 3HUSA 1KB9D 5GTHH 1QYZA 5CCHC 3JBTB 2M5AA 2B87A 3JC22 5B66V 4O1WA 4GOFA 3I56P 4ZKUA 2EXVA 1HTLC 2V7QH 4CPGA 2IBZD 1FI9A 1LTJA 2E42A 3I5CA 4D6TD 5TISE 3NBSA 5DF5A 1Q2NA 2QIWA 2C9XB 1RAPA 3KYQA 2DVHA 4MN4C 3CX5D 3WUIA 3NBTA 3AE6C 1KTMA 3HUSB 1HGZA 4XYDB 3AEBC 1MFTA 3NWVA 1GK6A 1SFCC 3H1IG 1M90Q 1AOFA 3H25A 2ZZS1 4W7YA 2P1JA 4RJTA 3KXDA 3FXDA 1H0TB 2C1DB 4NPEA 1YYCA 5KLVK 2N18B 4YXDC 4HYTB 2KSEA 1SLQA 1VQKP 3TYYA 1ZZHA 4K3AA 3O20A 3FWNA 3CXHD 5BU8B 3FX0A 2KUBA 1H32B 1KYOI 1QL1A 3L75E 5DJUB 1CORA 1GIWA 1WEJF 1JMBA 1FZFA 4WQ9A 5KAFE 2D0WA 4C7RA 3KZIH 2B88A 2B0ZB 1AVYA 1CRYA 1JTHB 3KZIE 2QE7H 3WFDC 2M8RA 3P32A 3MGNA 5KAIH 1SFCB 3CP5A 1IFDA 1KYOE 3OA8A 3RMZA 3CXHH 5B66H 1NTMD 2H88C 3V2QA 1AOQA 1DVVA 2Q7CA 3SWSA 1NU1J 1IRWA 1NVOA 2NPSB 4C46A 2YKPA 1KMIZ 1M1JC 3A2AA 1YEAA 3L70J 1FZAA 2XV5A 1EQ7A 1NTZE 4EI2A 3H1LG 1GL2C 1L0LE 2H8PD 3KZIV 2IBZE 2FYUK 3VTPC 3ZOWA 2C2CA 4K35A 2ZOOA 1M1KQ 4HH2A 5AW5B 1NU1D 4FA5A 4GYDA 1U7MA 3G4SP 2KB7P 5K5GB 1L2PA 3SJLA
chains in the Genus database with same CATH topology
1CSWA 3CXHW 1H32A 1ZRTD 1H31A 2PCBB 2CE0A 4WQEA 1BL9A 1CYJA 1KX7A 1CIFA 1CO6A 1SQVD 1VYDA 4P4QB 1W5CT 1C6RA 2RMZA 2B4ZA 4V2KA 1C6OA 4PW9B 2Y0DA 2L4DA 2VHDA 1NTZD 3H1JD 2BPBB 5GTIV 2OZ1B 2YK3A 1H9YA 1CTZA 3L70D 1GU2A 1GDVA 1AYGA 5KLIB 4EIEA 5C0ZA 3A9FA 5CYTR 2N3YA 351CA 1CHJA 2PACA 2CA3B 4H0JA 1HJ4A 1HZUA 2XTSB 5CIDB 3SVWA 1E8EA 4J20A 3L72D 2ZONG 5TJHA 4IL6V 3ZOXA 4WQCA 3BCCD 4QAOA 2AI5A 4LJIA 2A06D 3VYMA 1NNOA 4L1QA 2QJYB 2V08A 1CRCA 4FA1A 3H1LD 3CYTI 4K3IA 1CEDA 2PCCB 4L3HA 155CA 3GW6A 1B7VA 4N0KA 3VNWA 2CXBA 1I5TA 1CNOA 2O3JA 1DT1A 1L0ND 4FA9A 1DW2A 1FHBA 3PHLA 4AAMA 1N15A 1KYOD 1CSUA 1M60A 3OA8B 3A0BV 1YFCA 5TISV 1NMIA 4GEDB 1PP9D 1RAQA 4A7PA 2N9YB 1I55A 1KX2A 1MZ4A 2BCNB 5C9MA 3L71D 3CWBD 1FCDC 1KB0A 4RSZA 2ZBOA 4KMGA 1R0QA 2FYUD 1CIEA 3L74D 4FA4A 1H31B 1DW3A 2JTIB 5CIBB 3WU2V 5B6QA 1YICA 5KAFV 3A0HV 3CU4A 1C52A 1CIHA 2HV4A 4Y5RA 5CIHB 1H33B 1COTA 2YIUB 1KYOW 1HROA 3PXTA 3PTZA 3WFEC 4NFGB 2Y0CA 3SXTA 1E29A 5IY51 1CSVA 2YCCA 1N9CA 4FB1A 3CX5W 1HJ3A 4H0KA 1LMSA 1J3SA 1RZ5A 4EIDA 1CRIA 1E2RA 1FI3A 2RN0A 3TGUD 1OCDA 2YQBA 1IRVA 1K3HA 2Y0EA 2FRCA 2OZ1A 3L75D 4XXLA 4EDFA 1IO3A 4YE1A 2B12B 2I8FA 1DW1A 2QJKB 2KS1A 1LFMA 2BH5X 2N9IA 1SQXD 2B10B 5AURA 1IZL0 2ZXYA 2KNCB 3L73D 1I54A 2DGEA 1CYIA 1GKSA 5CIGB 1DIIC 1HCMA 1QL3A 4EIFA 1M70A 3OCDB 2C1UA 1DIQC 2AXTV 3MK7C 1I6EA 1OAEA 3MK7B 1C7MA 5B5EV 2QJPB 1A8CA 1YNRA 4WQ7A 4L3GA 4MU8A 1GQ1A 5H2FV 3PLNA 4UB6V 1I8PA 4AANA 3FWLA 1CSXA 3O0RC 3PXWA 1YTCA 1W2LA 5EXQA 2V07A 2B11B 2BH4X 1IQCA 1CXAA 4WQ8A 3ZIYA 2QG4A 5DFSA 3ZBMA 1M6ZA 3X39A 1SQBD 2LIRA 2JQRA 1CYCA 3SLEA 3TDKA 1CTYA 1RZ6A 5KLVD 3TF5A 3HQ8A 1CXCA 2LITA 3RN0A 4UB8V 3DP5A 1L0LD 4DY9A 1KV9A 1K3GA 1S5LV 2D0SA 3ZOOA 4FANA 1SQQD 1H33A 1MG2D 1NTKD 2Q3EA 1CIGA 1CHHA 3PRJA 3RN1A 1NMLA 1SQPD 1QN2A 4EICA 1QKSA 1F1CA 1CRGA 3C2CA 3M97X 1GJQA 1P84D 1LS9A 1EZVD 4PWAA 2BCCD 1YCCA 2C1VA 2BLFB 5CICB 1FJ0A 2GIWA 4U3FD 4AX3A 1EB7A 3VMAA 3HQ6A 1H9XA 1FOCA 1CC5A 451CA 1C75A 1N90A 1KB9D 5GTHV 1LC2A 2MHMA 1QYZA 5DJQB 3JBTB 5B66V 4O1WA 3PXSA 4AALA 2EXVA 1NIRA 1U74B 3WC8A 1MG3D 2K9JB 1DW0A 2IBZD 1FI9A 2C1DA 2CA4B 3O5CA 3DMIA 4FAVA 1L9JC 3VRDA 4D6TD 1BCCD 1C2RA 1KIBA 3NBSA 5DF5A 5DJQC 3GG2A 2BGVX 2C9XB 1RAPA 2DVHA 1N50A 3CX5D 3WUIA 3PH2B 1CHIA 3NBTA 1C2NA 4O1QA 1I8OA 1A56A 3WFCC 1U75B 4XYDB 1BGYD 3ZCFA 2C8SA 3NWVA 1AOFA 3TYIA 3O1YA 2ZZS1 4RJTA 2N9JA 3HQ9A 1C6SA 2ORLA 2C1DB 2GB8B 1CRHA 1HJ5A 2N18B 4PD4D 1ETPA 3WFBC 5KKZB 1H1OA 4Q5PA 4WQDA 1ZZHA 1LC1A 3O20A 3CXHD 5CIFB 2N18C 2MTAC 1H32B 1YEBA 4JCGA 4PJ0V 1S6VB 1CORA 3L4MA 1GIWA 1WEJF 1HRCA 2AIUA 4WQ9A 2D0WA 3H1HD 5CIEB 2L91A 2B0ZB 2JWAA 1CRYA 1JDLA 2GC7D 4WQBA 4AAOA 1CCHA 1CTJA 4WQAA 3H1KD 3WFDC 3CP5A 2FYNB 3ORVA 3OA8A 3RMZA 1NTMD 1A2SA 1AOQA 1DVVA 5E79V 3SWSA 1F1FA 2CE1A 1WVEC 1BE3D 2GC4D 1IRWA 3RLMA 1DVHA 3ITKA 3HQ7A 1YEAA 1QL4A 2N3BA 3ZOYA 2FWLA 1HH7A 1CRJA 3KZIV 1FI7A 1YIQA 3KHUA 1PPJD 3H1ID 3ZOWA 1I6DA 1CCRA 3L4OA 2C2CA 2ZOOA 1L9BC 1NU1D 4FA5A 4GYDA 3DR0A 1HZVA 1AKKA 3OCDA 5KAIV 3SJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSW A;  3CXH W;  1H32 A;  1ZRT D;  1H31 A;  2PCB B;  2CE0 A;  4WQE A;  1BL9 A;  1CYJ A;  1KX7 A;  1CIF A;  1CO6 A;  1SQV D;  1VYD A;  4P4Q B;  1W5C T;  1C6R A;  2RMZ A;  2B4Z A;  4V2K A;  1C6O A;  4PW9 B;  2Y0D A;  2L4D A;  2VHD A;  1NTZ D;  3H1J D;  2BPB B;  5GTI V;  2OZ1 B;  2YK3 A;  1H9Y A;  1CTZ A;  3L70 D;  1GU2 A;  1GDV A;  1AYG A;  5KLI B;  4EIE A;  5C0Z A;  3A9F A;  5CYT R;  2N3Y A;  351C A;  1CHJ A;  2PAC A;  2CA3 B;  4H0J A;  1HJ4 A;  1HZU A;  2XTS B;  5CID B;  3SVW A;  1E8E A;  4J20 A;  3L72 D;  2ZON G;  5TJH A;  4IL6 V;  3ZOX A;  4WQC A;  3BCC D;  4QAO A;  2AI5 A;  4LJI A;  2A06 D;  3VYM A;  1NNO A;  4L1Q A;  2QJY B;  2V08 A;  1CRC A;  4FA1 A;  3H1L D;  3CYT I;  4K3I A;  1CED A;  2PCC B;  4L3H A;  155C A;  3GW6 A;  1B7V A;  4N0K A;  3VNW A;  2CXB A;  1I5T A;  1CNO A;  2O3J A;  1DT1 A;  1L0N D;  4FA9 A;  1DW2 A;  1FHB A;  3PHL A;  4AAM A;  1N15 A;  1KYO D;  1CSU A;  1M60 A;  3OA8 B;  3A0B V;  1YFC A;  5TIS V;  1NMI A;  4GED B;  1PP9 D;  1RAQ A;  4A7P A;  2N9Y B;  1I55 A;  1KX2 A;  1MZ4 A;  2BCN B;  5C9M A;  3L71 D;  3CWB D;  1FCD C;  1KB0 A;  4RSZ A;  2ZBO A;  4KMG A;  1R0Q A;  2FYU D;  1CIE A;  3L74 D;  4FA4 A;  1H31 B;  1DW3 A;  2JTI B;  5CIB B;  3WU2 V;  5B6Q A;  1YIC A;  5KAF V;  3A0H V;  3CU4 A;  1C52 A;  1CIH A;  2HV4 A;  4Y5R A;  5CIH B;  1H33 B;  1COT A;  2YIU B;  1KYO W;  1HRO A;  3PXT A;  3PTZ A;  3WFE C;  4NFG B;  2Y0C A;  3SXT A;  1E29 A;  5IY5 1;  1CSV A;  2YCC A;  1N9C A;  4FB1 A;  3CX5 W;  1HJ3 A;  4H0K A;  1LMS A;  1J3S A;  1RZ5 A;  4EID A;  1CRI A;  1E2R A;  1FI3 A;  2RN0 A;  3TGU D;  1OCD A;  2YQB A;  1IRV A;  1K3H A;  2Y0E A;  2FRC A;  2OZ1 A;  3L75 D;  4XXL A;  4EDF A;  1IO3 A;  4YE1 A;  2B12 B;  2I8F A;  1DW1 A;  2QJK B;  2KS1 A;  1LFM A;  2BH5 X;  2N9I A;  1SQX D;  2B10 B;  5AUR A;  1IZL 0;  2ZXY A;  2KNC B;  3L73 D;  1I54 A;  2DGE A;  1CYI A;  1GKS A;  5CIG B;  1DII C;  1HCM A;  1QL3 A;  4EIF A;  1M70 A;  3OCD B;  2C1U A;  1DIQ C;  2AXT V;  3MK7 C;  1I6E A;  1OAE A;  3MK7 B;  1C7M A;  5B5E V;  2QJP B;  1A8C A;  1YNR A;  4WQ7 A;  4L3G A;  4MU8 A;  1GQ1 A;  5H2F V;  3PLN A;  4UB6 V;  1I8P A;  4AAN A;  3FWL A;  1CSX A;  3O0R C;  3PXW A;  1YTC A;  1W2L A;  5EXQ A;  2V07 A;  2B11 B;  2BH4 X;  1IQC A;  1CXA A;  4WQ8 A;  3ZIY A;  2QG4 A;  5DFS A;  3ZBM A;  1M6Z A;  3X39 A;  1SQB D;  2LIR A;  2JQR A;  1CYC A;  3SLE A;  3TDK A;  1CTY A;  1RZ6 A;  5KLV D;  3TF5 A;  3HQ8 A;  1CXC A;  2LIT A;  3RN0 A;  4UB8 V;  3DP5 A;  1L0L D;  4DY9 A;  1KV9 A;  1K3G A;  1S5L V;  2D0S A;  3ZOO A;  4FAN A;  1SQQ D;  1H33 A;  1MG2 D;  1NTK D;  2Q3E A;  1CIG A;  1CHH A;  3PRJ A;  3RN1 A;  1NML A;  1SQP D;  1QN2 A;  4EIC A;  1QKS A;  1F1C A;  1CRG A;  3C2C A;  3M97 X;  1GJQ A;  1P84 D;  1LS9 A;  1EZV D;  4PWA A;  2BCC D;  1YCC A;  2C1V A;  2BLF B;  5CIC B;  1FJ0 A;  2GIW A;  4U3F D;  4AX3 A;  1EB7 A;  3VMA A;  3HQ6 A;  1H9X A;  1FOC A;  1CC5 A;  451C A;  1C75 A;  1N90 A;  1KB9 D;  5GTH V;  1LC2 A;  2MHM A;  1QYZ A;  5DJQ B;  3JBT B;  5B66 V;  4O1W A;  3PXS A;  4AAL A;  2EXV A;  1NIR A;  1U74 B;  3WC8 A;  1MG3 D;  2K9J B;  1DW0 A;  2IBZ D;  1FI9 A;  2C1D A;  2CA4 B;  3O5C A;  3DMI A;  4FAV A;  1L9J C;  3VRD A;  4D6T D;  1BCC D;  1C2R A;  1KIB A;  3NBS A;  5DF5 A;  5DJQ C;  3GG2 A;  2BGV X;  2C9X B;  1RAP A;  2DVH A;  1N50 A;  3CX5 D;  3WUI A;  3PH2 B;  1CHI A;  3NBT A;  1C2N A;  4O1Q A;  1I8O A;  1A56 A;  3WFC C;  1U75 B;  4XYD B;  1BGY D;  3ZCF A;  2C8S A;  3NWV A;  1AOF A;  3TYI A;  3O1Y A;  2ZZS 1;  4RJT A;  2N9J A;  3HQ9 A;  1C6S A;  2ORL A;  2C1D B;  2GB8 B;  1CRH A;  1HJ5 A;  2N18 B;  4PD4 D;  1ETP A;  3WFB C;  5KKZ B;  1H1O A;  4Q5P A;  4WQD A;  1ZZH A;  1LC1 A;  3O20 A;  3CXH D;  5CIF B;  2N18 C;  2MTA C;  1H32 B;  1YEB A;  4JCG A;  4PJ0 V;  1S6V B;  1COR A;  3L4M A;  1GIW A;  1WEJ F;  1HRC A;  2AIU A;  4WQ9 A;  2D0W A;  3H1H D;  5CIE B;  2L91 A;  2B0Z B;  2JWA A;  1CRY A;  1JDL A;  2GC7 D;  4WQB A;  4AAO A;  1CCH A;  1CTJ A;  4WQA A;  3H1K D;  3WFD C;  3CP5 A;  2FYN B;  3ORV A;  3OA8 A;  3RMZ A;  1NTM D;  1A2S A;  1AOQ A;  1DVV A;  5E79 V;  3SWS A;  1F1F A;  2CE1 A;  1WVE C;  1BE3 D;  2GC4 D;  1IRW A;  3RLM A;  1DVH A;  3ITK A;  3HQ7 A;  1YEA A;  1QL4 A;  2N3B A;  3ZOY A;  2FWL A;  1HH7 A;  1CRJ A;  3KZI V;  1FI7 A;  1YIQ A;  3KHU A;  1PPJ D;  3H1I D;  3ZOW A;  1I6D A;  1CCR A;  3L4O A;  2C2C A;  2ZOO A;  1L9B C;  1NU1 D;  4FA5 A;  4GYD A;  3DR0 A;  1HZV A;  1AKK A;  3OCD A;  5KAI V;  3SJL A; 
#chains in the Genus database with same CATH topology
 1CSW A;  3M9H A;  2KOG A;  3CXH W;  1USD A;  1H32 A;  3P7K A;  2FY8 A;  1ZRT D;  2QA4 P;  1YTZ T;  2CE0 A;  4AYC A;  2HOD A;  1CYJ A;  5AW9 B;  3USS A;  1CIF A;  2FFD C;  1VL2 A;  2CK3 H;  2JDI H;  3W67 A;  1XTC C;  3RL0 g;  1P84 E;  2D2C B;  3CC7 P;  2KLU A;  1NTZ D;  3H1J D;  5GTI V;  1H9Y A;  1PGP A;  1CTZ A;  3L70 D;  1GU2 A;  2ZYG A;  4H13 D;  5C0Z A;  4H44 D;  3A9F A;  1YIJ P;  4H0J A;  1P84 I;  5E79 H;  2XTS B;  4UB8 E;  5AW2 B;  2WSE H;  1X22 A;  3L72 D;  5TJH A;  3ZOX A;  5KLV E;  3BCC D;  3BAT A;  2KIK A;  3VYM A;  2XDJ A;  4L1Q A;  3BCC E;  2V08 A;  4DCK A;  3CYT I;  4HKZ H;  4BWN A;  4K3I A;  3H32 B;  1SQQ K;  4RO0 A;  2OYI A;  155C A;  3II6 A;  1KIL A;  1R5S A;  2WMM A;  4BRY A;  4XA4 A;  1LGH B;  1K9M Q;  2AEM A;  5KLV G;  1RE3 A;  3OA8 B;  1MZ9 A;  1D7M A;  2J58 A;  3AEF C;  1IFP A;  2OTK E;  2AXT E;  2C9N Y;  3H1K E;  3H1H G;  1NMI A;  2YMK A;  4GED B;  3HD7 B;  1PP9 D;  2MJZ A;  2N9Y B;  1I55 A;  3UIA A;  5C9M A;  1SQQ G;  3V2P A;  2NPS A;  1Q90 D;  3CWB D;  5KAI E;  1FCD C;  4KMG A;  2FYU D;  5C39 A;  2I1K A;  4FA4 A;  2JTI B;  1PP9 G;  1LT9 A;  3WU2 V;  4I2L C;  5B6Q A;  5KAF V;  3CWB G;  5M1B A;  3BRV B;  1AQ5 A;  4PD4 H;  1SQP K;  3CI9 A;  3QWO C;  3H1H E;  3PXT A;  2PFX A;  2AEJ A;  4PV1 D;  3PTZ A;  3VMY A;  1T2K D;  4RKU J;  1E29 A;  1M1J A;  4IFM A;  3RK3 D;  1ZR2 A;  2WQY C;  3KPE A;  4W80 A;  4LC1 A;  2FYN C;  3CD6 P;  1R8E A;  2CPB A;  2QM8 A;  4EDF A;  1IO3 A;  3L74 J;  4YE1 A;  2B12 B;  4L76 A;  4U3F E;  2HPC A;  4R4L A;  3L36 A;  2KS1 A;  2M0B A;  1LFM A;  2BH5 X;  1SQX D;  5APV A;  2ZVO B;  3BCC J;  1NTK G;  2B10 B;  1NTM E;  4H0L B;  2ZXY A;  1LJ2 A;  3L73 D;  1GKS A;  1N7S B;  1SQV K;  4IL6 E;  3AE4 C;  1SQX G;  1HCM A;  3LIE A;  2R44 A;  1NGM B;  1QVG O;  3SSU A;  1M70 A;  2BEQ D;  3M0D A;  1JY3 N;  5APY A;  1C7M A;  5GTH E;  3FXE A;  1K04 A;  3CCQ P;  1KOR A;  1GDT A;  1DD3 A;  3PLN A;  5H2F V;  4OVN F;  5CCG A;  3AE2 C;  1L4A B;  1LTT C;  4AAN A;  1CSX A;  3PXW A;  4U7J A;  1X0T A;  3F5H A;  4L73 A;  5AVT B;  5EXQ A;  4N78 D;  5AVZ B;  3CCS P;  2KLV A;  1HJ0 A;  1IQC A;  1BSH A;  1KQF B;  1RF0 C;  5APU A;  1CYC A;  3M9Q A;  1BSN A;  1EDI A;  2L5G B;  4GDO A;  1CXC A;  2LIT A;  2IFN A;  4IFF A;  2QEX P;  3HE4 B;  1L0L D;  3GF7 A;  5AVV B;  1K3G A;  4JYB A;  4JQ0 D;  1S5L H;  1YJ9 P;  1H33 A;  1J1E B;  3L70 E;  2FFD B;  1CHH A;  1GK4 A;  4LGD E;  1NML A;  2FXM A;  1S5L X;  1HF9 A;  1GU4 A;  3D6Z A;  1GJQ A;  1P84 D;  3OJA B;  1YQ4 C;  1LS9 A;  1G2C A;  1EZV D;  4PWA A;  5L8R J;  1YCC A;  1SQX E;  2K1A A;  2UWJ E;  3NXS A;  4AX3 A;  1BGY G;  3HE4 A;  1EB7 A;  2FXO A;  3IFM A;  3RK3 C;  5GTI H;  3HQ6 A;  2XKM A;  1EZV G;  451C A;  5GTH V;  1OW6 A;  1J1E C;  2KYV A;  5E79 E;  2OQQ A;  3AEA C;  4TLF A;  1FOS F;  1NTM K;  1KD1 Q;  1JMM A;  1S72 P;  1U57 A;  4XE5 B;  5APQ A;  1DW0 A;  2C1D A;  3DMI A;  4FAV A;  3VRD A;  3A7O A;  2QJY C;  1RHZ B;  1SQV E;  5DJQ C;  2BGV X;  1M7L A;  2D2C D;  1KIL D;  1C2N A;  4WVZ A;  3V6I A;  1I8O A;  1GU5 A;  1UII A;  1OW8 A;  1U75 B;  1RF1 C;  3TGU J;  2YXR B;  1M8O B;  1URQ D;  3OA7 A;  1PPJ G;  3L4F A;  3TYI A;  1L0L K;  2KI7 B;  4QMA A;  4I6M C;  4OGQ D;  1N73 B;  2KNC A;  1KV4 A;  4PD4 D;  4Q5P A;  4WQD A;  3CX5 E;  2GA1 A;  1FJP A;  1S9K E;  3HTK B;  1OVV A;  2OYH A;  5CIF B;  5CCG C;  4JCG A;  1N7S C;  1NTK J;  4D6T G;  4PJ0 V;  1AV1 A;  2R3C A;  3L4M A;  1S3J A;  2W90 A;  1KIL E;  1HRC A;  2AIU A;  2WSF H;  1NTZ J;  2Q1K A;  1FS0 E;  3CX5 I;  3V4Q A;  5CIE B;  1KYO H;  2WPS A;  5H2F H;  2GC7 D;  1GW4 A;  4AAO A;  4H44 B;  2NZ2 A;  1CCH A;  1Q82 Q;  1CTJ A;  2IYO A;  3M9B A;  1GL2 D;  2FYN B;  3ORV A;  2Q9I A;  1QEX A;  2G3A A;  2HFE D;  2OYI C;  2QRX A;  1WVE C;  2C0X A;  3V2N A;  3WUV A;  1T2K C;  1LWU B;  2OYO A;  3ZOY A;  3KHU A;  3H1I D;  3KDP B;  1I6D A;  5CHX A;  1L9B C;  5B66 E;  1NTK E;  2BCC E;  2Q6Q A;  4U3F G;  1AJY A;  3DR0 A;  1HZV A;  4N6J A;  4L75 A;  3OCD A;  3RK3 B;  3L72 J;  1H31 A;  3LW5 J;  1Q81 Q;  1Y47 A;  1CO6 A;  2OTJ P;  2E43 A;  1W5C T;  1C6R A;  4WY4 D;  4EIJ A;  4V2K A;  2HLO A;  1C6O A;  1PV3 A;  4XFJ A;  3MUD C;  4OGQ C;  1FDI A;  3I55 P;  2YK3 A;  1BCC G;  2YMY A;  1VQL P;  5KLI B;  4EIE A;  3M0A A;  2KP8 A;  2N3Y A;  2LR2 A;  351C A;  1JY2 N;  3KQG A;  1CHJ A;  4WWI A;  3MD0 A;  4N3Y B;  3O6Q B;  1E8E A;  4J20 A;  1QGK B;  3HD7 A;  1E5W A;  1IFN A;  1JOC A;  2QJY B;  3B5N A;  1CRC A;  2JR8 A;  1WMK A;  4FA1 A;  3H1L D;  3E7K A;  2A45 I;  3CCU P;  3VNW A;  1NU1 G;  2CXB A;  1I5T A;  3TGU E;  2O3J A;  1DT1 A;  2WZ7 A;  4JBZ A;  4FA9 A;  1NTZ G;  2YIU C;  1LWU A;  3Q5S A;  5AW1 B;  1FU1 A;  4UB6 E;  1RY3 A;  1G1I A;  3L70 G;  3O6Q A;  5KJ7 C;  1M60 A;  1VQO P;  5TIS V;  1RAQ A;  2ITA A;  4A7P A;  1JO5 A;  1BE3 E;  2BCN B;  1MV8 A;  2QVA A;  4TT3 H;  4OH8 B;  1R0Q A;  3C1L A;  4NPF X;  1CIE A;  3L74 D;  3H1J G;  1DW3 A;  1PGQ A;  2DW3 A;  5CIB B;  1L0N K;  1GMJ A;  3MTU E;  3A0H V;  3CU4 A;  1ZXG A;  1K05 A;  1H33 B;  2YO3 A;  4ZKP A;  3S1K A;  1L4A D;  1KYO W;  5AW0 B;  2M5A B;  4U3F J;  3RK2 D;  1YHQ P;  1RF0 A;  2O01 N;  4NFG B;  1YQ3 C;  5BU5 A;  3L72 G;  3CX5 W;  2N1T A;  1HH0 A;  3CCM P;  1NU1 E;  2RN0 A;  3AE9 C;  2YKQ A;  3CPW O;  1K3H A;  2Y0E A;  4GOE A;  2FRC A;  1VQ5 P;  1L0L J;  2I8F A;  3B5N B;  2RKL A;  2N9I A;  1OXZ A;  1VQ7 P;  1L4A C;  2WVR A;  4M3L A;  4AQR D;  1CI6 A;  1LT1 A;  1DII C;  4YPC A;  4R4M A;  4D6T E;  2P67 A;  4EIF A;  3OCD B;  1WT6 A;  3Q5R A;  1IO4 A;  1OVR A;  2WIT A;  1GW3 A;  2O01 H;  2P10 A;  1A8C A;  4WQ7 A;  4H0L C;  3RBZ A;  4PV1 B;  5CJ0 A;  5CBO A;  3PH0 A;  1PGJ A;  3E1R A;  2V07 A;  2SPZ A;  2W83 C;  1ZME C;  1FZE A;  1VDF A;  2JP3 A;  3CL3 D;  3T97 B;  3MP7 B;  1SQB D;  1IFM A;  1KQG B;  2JQR A;  1CTY A;  1YBK A;  3OW2 O;  2LXC B;  1LP1 A;  3RN0 A;  4UB8 V;  4KT0 J;  3H1J J;  3MHV A;  2ZFC A;  2KSJ A;  5KJ7 A;  1S5L V;  1PFI A;  4FAN A;  2A45 H;  1USE A;  2FYZ A;  1MG2 D;  1NTK D;  2Z4E A;  3PRJ A;  1SQQ E;  2M3E A;  3VP8 A;  3NTN A;  3L73 G;  1SQP D;  3VMX A;  2W6J H;  1X8Y A;  2M3B A;  1QKS A;  1F1C A;  1P84 H;  2N1T B;  5AVW B;  3M97 X;  3GHG A;  1NHL A;  4IL6 H;  2C1V A;  5AVQ B;  5CIC B;  1FJ0 A;  1SQP G;  2ZT9 D;  4LLH A;  5B5E E;  4EYY Q;  3VMA A;  1K73 Q;  1CC5 A;  4PJ0 H;  1MKM A;  2IX7 C;  3M91 A;  1DEB A;  4KJM A;  1N90 A;  1DH3 A;  3A0H E;  2MHM A;  3LID A;  3B5N C;  1J1D B;  4O9B A;  2FBW C;  2K9J B;  1NOH A;  3N4X A;  1JY3 O;  1L9J C;  3HRN A;  2FXP A;  4JPZ B;  1KFN A;  3WMM 0;  1C2R A;  1KIB A;  2AXT H;  5APX A;  1NKZ B;  1PIX A;  3GG2 A;  5EFW B;  3PH2 B;  1CHI A;  1TU3 F;  3H32 A;  3WFC C;  3L73 E;  1BGY D;  3ZCF A;  3H1I J;  5KAF H;  3VP9 A;  1DD4 A;  1OW7 A;  1EC5 A;  5KJ7 D;  3BCC G;  3O1Y A;  3HQ9 A;  2Y9Z A;  3NMD A;  2GB8 B;  1CRH A;  1JCC A;  1ETP A;  3WFB C;  1H0T A;  2JO1 A;  1H1O A;  1CW5 A;  1JY2 O;  4H13 C;  1HBW A;  1AVO A;  2Z5H A;  2WSC J;  2N18 C;  2MTA C;  1LP1 B;  5AW8 B;  3CMA P;  2WSS H;  2IZ1 A;  2D2C C;  1LT9 B;  1AA0 A;  3H1H D;  2JJL A;  2P7J A;  1L4A A;  2AEF A;  2P58 A;  3L71 E;  2HOD B;  1ZV8 A;  2L91 A;  3IAO A;  1T3J A;  3S9O A;  3R2P A;  1KZU B;  3SWK A;  3H1K D;  3L73 J;  2FYU G;  5CBN A;  5H2F E;  1OX3 A;  1A2S A;  2XND H;  3U59 A;  1F1F A;  2CE1 A;  2GC4 D;  3RLM A;  4C7N B;  1FJK A;  5APS A;  3HQ7 A;  1HJB A;  3S4R A;  1R5L A;  1QL4 A;  2N3B A;  1QX8 A;  3E1I A;  4YTP C;  3IN6 A;  3CCV P;  2FWL A;  1JY2 P;  1CRJ A;  1GD2 E;  1YIQ A;  1IK7 A;  1PPJ D;  3JCU H;  2BCC G;  5KLI C;  1A02 F;  4B86 A;  1AKK A;  3AE3 C;  2R5B A;  5KAI V;  3PP5 A;  1N86 A;  1Y9B A;  1W2B O;  1NU1 K;  1S4X A;  4OGQ B;  3G3Z A;  5AW4 B;  1HGV A;  2I1J A;  2A06 E;  1BL9 A;  2I8D A;  1KFM A;  1KX7 A;  2WT7 B;  4P4Q B;  2FFD A;  1IJD B;  1N73 A;  2AXC A;  3L71 G;  1ZOY C;  4UB8 H;  2ZYD A;  2YNY A;  3M0D C;  2L4D A;  2VHD A;  3V5B A;  2BPB B;  2FYU E;  3HTK A;  2H89 C;  2WPQ A;  3CCR P;  2WSE J;  1AYG A;  1OMI A;  5CYT R;  5AVU B;  2KXP B;  2PAC A;  2CA3 B;  1HJ4 A;  1HZU A;  4L74 A;  3BAS A;  1PP9 J;  3AE5 C;  3GF3 A;  2ZON G;  3U1C A;  4QAO A;  4LJI A;  3EWK A;  2XZR A;  3LW5 H;  2A06 D;  1ZR4 A;  1NNO A;  2YKO A;  1L0N G;  2OYI B;  1ZN5 A;  1FC2 C;  3V2R A;  3HUS C;  3TGU G;  4N0K A;  1CNO A;  1NO4 A;  4C7N A;  1L0N D;  2XU6 A;  4AAM A;  1OWA A;  2VRS A;  1N15 A;  5KLV J;  1KYO D;  2IBZ I;  4DT0 A;  5TIS H;  3A0B V;  3H1H J;  1LTG C;  3T97 A;  1SQQ J;  1FZC A;  1KX2 A;  3EQ2 A;  1KB0 A;  4RSZ A;  2ZBO A;  2MKV A;  3SFD C;  4NPD A;  1X9V A;  3L75 G;  3RL0 D;  2HR3 A;  1H31 B;  4H13 B;  4WY4 B;  1N2D C;  4PD4 E;  3QH9 A;  2H7H A;  1YIC A;  2YO2 A;  1CIH A;  2BCC J;  1COT A;  2YIU B;  3WFE C;  2Y0C A;  1BDC A;  4ASW A;  5IY5 1;  2YCC A;  4FB1 A;  4PD4 I;  1AFO A;  4N78 E;  4OWF A;  1M1J B;  4H0K A;  1FE6 A;  1J3S A;  1RZ5 A;  2E75 D;  1QLE D;  1CRI A;  3CCL P;  1FI3 A;  1KQS O;  1KB9 E;  1ZLL A;  3L35 A;  1OCD A;  1DEE G;  2YQB A;  2E74 C;  3L74 G;  3CC4 P;  3AEG C;  4GT1 A;  2QJK B;  4I7Z C;  1YJN P;  3AED C;  4Y28 J;  2GUV A;  3GHG C;  3F89 A;  1S9K D;  3A0B H;  4ASV A;  1KB9 I;  1IZL 0;  1SQB J;  2KNC B;  2K9J A;  1I54 A;  2DGE A;  2KZJ A;  2J5U A;  1SQX J;  2HYN A;  3A0B E;  2O01 J;  3W68 A;  2QSI A;  1RE4 A;  2KZI A;  4Z1M H;  1M56 D;  3A5T A;  1RQV A;  2C1U A;  2ZYA A;  1DIQ C;  2AXT V;  2Q3I A;  1OAE A;  3MK7 B;  3MUD A;  5B5E V;  1FBM A;  1SQP E;  3ZDM A;  1YNR A;  1SP4 A;  4L3G A;  4GKG A;  4PJ0 E;  4UB6 V;  1DIP A;  1XTG B;  2W6B A;  1VQP P;  3FWL A;  2WT7 A;  1URQ A;  3B4S A;  2XNX A;  1YTC A;  1A02 J;  1W2L A;  3RK3 E;  4JF7 A;  1KQL A;  1PZQ A;  3Q3D A;  2B11 B;  2BH4 X;  1CXA A;  4WQ8 A;  3ZIY A;  2E5T A;  1NH4 A;  2QG4 A;  3Q1M A;  2HPC B;  3EFG A;  1VQ9 P;  3ZBM A;  1M6Z A;  2ZVN B;  1JNM A;  2O1K A;  3SLE A;  1VPC A;  2PGD A;  5KLV D;  3TF5 A;  1IC2 A;  1KIL C;  3HQ8 A;  1GZL A;  1T8Z A;  1Q7Y Q;  3H1I E;  5AVY B;  2BEZ F;  3RL0 B;  1JEK A;  3AE1 C;  2C9L Y;  3DP5 A;  3L75 J;  4DY9 A;  3H1L J;  1RE3 C;  1KV9 A;  5CCG D;  1NWQ A;  1SQQ D;  3SWY A;  4EOT A;  4H0L D;  1N7S D;  1T3U A;  4AUW A;  2Q3E A;  2NPS C;  3HE5 B;  1VF5 D;  2IBZ G;  3GLM A;  1QN2 A;  4EIC A;  1CRG A;  1NAF A;  3PJS K;  1VF5 C;  3BVH A;  4PV1 C;  5GTI E;  2BLF B;  1G2C B;  2GIW A;  4GOD A;  1SQB E;  4U3F D;  2ZXE B;  5APW A;  3CCJ P;  3H6P A;  2WPV B;  1H9X A;  2J59 M;  1JB0 J;  2K9Y A;  3VN0 A;  2OYH C;  2Y9Y A;  2FKW B;  1C75 A;  1LC2 A;  5DJQ B;  1OZH A;  1LNQ A;  5AW7 B;  1SQV J;  2V7Q J;  3PXS A;  4AAL A;  1NIR A;  1U74 B;  1SQP J;  3WC8 A;  2C0W A;  1MG3 D;  2GM4 A;  3C9I A;  2E76 B;  2CA4 B;  3O5C A;  1SQB G;  1NAY A;  5CCH D;  1BCC D;  3CME P;  2W8Z A;  2HG5 D;  2IFM A;  1DX7 A;  1U7J A;  1EXI A;  1N50 A;  1RF1 A;  4O1Q A;  3HE5 A;  5AVS B;  1A56 A;  1H88 A;  3FGA D;  3Q5P A;  1NTK K;  3A0H H;  2C8S A;  3WU2 H;  5AVR B;  2OAR A;  1YJW P;  1MFZ A;  4ZNC A;  3D0W A;  3O8Z A;  2N9J A;  1C6S A;  1NTM G;  3MIW A;  1OFC X;  2ORL A;  1VQ4 P;  1YTZ I;  1HJ5 A;  5APT A;  5KKZ B;  1GL2 A;  3L74 E;  1UIX A;  1SS1 A;  1FZB A;  1LC1 A;  1PL5 A;  2WWW A;  3TK1 A;  1ZW0 A;  2ZXX A;  1RH5 B;  2H43 A;  5KKZ C;  3V4W A;  3AE7 C;  1W2E A;  1YEB A;  3CX5 H;  1LTJ C;  3TNU B;  3JCU E;  1S6V B;  3IR9 A;  1CI6 B;  5DJT B;  4IFD K;  5BVZ A;  3NFQ A;  2B9B A;  3MZW B;  3GHG B;  3WUT A;  1S2E A;  3A3Y B;  2WPR A;  3R4Y A;  2YXQ B;  1IFI A;  2QJK C;  3CWB J;  3CXH E;  2JWA A;  1JDL A;  4WQB A;  1Q86 Q;  1PP9 E;  4WQA A;  3P8C E;  1S1C X;  1GTW A;  1LTS C;  1N8R Q;  1RF1 B;  2O1J A;  1AQT A;  1KB9 H;  1X79 B;  2R32 A;  2IYP A;  5E79 V;  2K3R A;  1LTI C;  1BE3 D;  1FZC B;  2E76 C;  1URQ B;  1DVH A;  3CXH I;  3ITK A;  5CCH A;  4RES B;  4WY4 A;  1HH7 A;  4GIF A;  1FDM A;  1FI7 A;  2FYU J;  3H1L E;  1BE3 G;  1VQ8 P;  3CC2 P;  1CCR A;  3L4O A;  3U1A A;  2IZ0 A;  3BRT B;  1HWT C;  1W5C E;  1VQ6 P;  1MUU A;  4D6T J;  5AVX B;  1SFC A;  2N1T C;  1SQV G;  3VOP A;  1CZQ A;  1BGY E;  4WY4 C;  3AEC C;  4Y99 B;  3ABV C;  2BAS A;  2PCB B;  3H1K G;  4KHX A;  4WQE A;  1VF5 B;  1HVV A;  2Q5U A;  1QL2 A;  1SQV D;  1VYD A;  2E76 D;  2N1T D;  3HD7 D;  1JUN A;  4JYC A;  1BDD A;  2RMZ A;  2B4Z A;  3L72 E;  1NKN A;  1JTH A;  3WUU A;  1EDJ A;  4PW9 B;  2Y0D A;  2OZ1 B;  1BCC J;  1GDV A;  1JCD A;  3AEE C;  3TNU A;  2WTY A;  4W7Z A;  1HUC A;  1NTM J;  5CID B;  3SVW A;  1GL2 B;  1SQX K;  1IZN B;  2GUS A;  4IL6 V;  1CSB A;  4WQC A;  4I1L A;  4HJG H;  2AI5 A;  1H89 A;  3AE8 C;  1L0N E;  1LWU C;  3CCE P;  1E79 H;  1WRG A;  3SFE C;  1ZRT E;  1CED A;  2PCC B;  2E75 C;  4L3H A;  3GW6 A;  3VMZ A;  1B7V A;  2K88 A;  3M06 A;  2E5Y A;  1N7S A;  2R3S A;  1DW2 A;  1FHB A;  3PHL A;  1EDK A;  1VQN P;  1CSU A;  1SFC D;  1QVF O;  4H44 C;  3CLQ A;  1YFC A;  3N7N A;  2OGU A;  3SWF A;  2W27 A;  2JWD A;  4ZMD A;  1MZ4 A;  1KN7 A;  3L71 D;  3RGU A;  2E74 D;  4DJG A;  2K37 A;  2A45 G;  3VYI A;  1H8A A;  3HD7 C;  3WU2 E;  3RK2 B;  2N9B A;  2A06 G;  3B8E B;  4UB6 H;  4Y99 C;  1FDO A;  1BGY J;  1LTB C;  3P8M C;  4BRY B;  3P8C D;  3IF4 A;  4HB1 A;  2LXB A;  1C52 A;  3C8V A;  1YIT P;  2HV4 A;  4IL6 X;  4Y5R A;  1N73 C;  1M57 D;  5CIH B;  1BE3 J;  5B5E H;  1KC8 Q;  3CWB E;  1NTZ K;  2POH A;  3L71 J;  1HRO A;  2E74 B;  1FOS E;  2W6A A;  2JEE A;  3SXT A;  1CSV A;  5AW3 B;  1N9C A;  3H1K J;  1HJ3 A;  1KIL B;  1SVF A;  1IK9 A;  1LMS A;  1FZC C;  3B71 A;  1BCC E;  2WSC H;  2ZJS E;  4EID A;  2QJP C;  1E2R A;  3TGU D;  1JY3 P;  3OAK A;  4DZO A;  2PRR A;  2IPP A;  3RL0 C;  1IRV A;  1VQM P;  4WB4 A;  1OVU A;  1LT9 C;  2OZ1 A;  3L75 D;  4XXL A;  1L0L G;  1DW1 A;  2E75 B;  3GMA A;  3K5B A;  4BXL A;  5CMZ A;  3TSI A;  1PGO A;  2B87 B;  2PP6 A;  1NJI Q;  3G6E P;  1NYH A;  5AUR A;  1RQU A;  3JSV C;  2IDB A;  1CYI A;  3D71 A;  5CIG B;  1JM0 A;  1LTJ B;  3B5N D;  2Z5I A;  3Q2Y A;  1N7L A;  1QL3 A;  5CJ4 A;  3L37 A;  1EZV E;  2P2U A;  2PAJ A;  1EXJ A;  3D70 A;  3G9R A;  3MK7 C;  1I6E A;  4IOI H;  2QJP B;  2ZAE B;  2KS1 B;  2LKM A;  2ZT9 B;  4MU8 A;  1IFJ A;  1GQ1 A;  1S5L E;  3D6Y A;  2QM7 A;  1ZP0 C;  1I8P A;  3O0R C;  2KK7 A;  1EZV I;  1J2J B;  2CPS A;  1EDL A;  2R5D A;  4YXW H;  2G8Y A;  2WSF J;  5DFS A;  1G1J A;  3X39 A;  2LIR A;  3TDK A;  1RZ6 A;  1L0N J;  4I7Z B;  3EFF K;  1YI2 P;  1T6A A;  1PPJ E;  4WBA A;  1J1D C;  3RK2 C;  2V4H A;  1FAV A;  1FZG A;  3G71 P;  2D0S A;  3ZOO A;  4DOJ A;  2NRG A;  1CIG A;  1URQ C;  3RN1 A;  2ZT9 C;  1SQB K;  2OYH B;  3H1J E;  1K8A Q;  3C2C A;  2JKV A;  2OTL P;  5AW6 B;  3RBX A;  2B89 A;  2BCC D;  1Y8A A;  1OIP A;  2NPS D;  1RE4 C;  2RH0 A;  1LTA C;  1Z56 A;  5KTB A;  1FOC A;  3HUS A;  1KB9 D;  5GTH H;  1QYZ A;  5CCH C;  3JBT B;  2M5A A;  2B87 A;  3JC2 2;  5B66 V;  4O1W A;  4GOF A;  3I56 P;  4ZKU A;  2EXV A;  1HTL C;  2V7Q H;  4CPG A;  2IBZ D;  1FI9 A;  1LTJ A;  2E42 A;  3I5C A;  4D6T D;  5TIS E;  3NBS A;  5DF5 A;  1Q2N A;  2QIW A;  2C9X B;  1RAP A;  3KYQ A;  2DVH A;  4MN4 C;  3CX5 D;  3WUI A;  3NBT A;  3AE6 C;  1KTM A;  3HUS B;  1HGZ A;  4XYD B;  3AEB C;  1MFT A;  3NWV A;  1GK6 A;  1SFC C;  3H1I G;  1M90 Q;  1AOF A;  3H25 A;  2ZZS 1;  4W7Y A;  2P1J A;  4RJT A;  3KXD A;  3FXD A;  1H0T B;  2C1D B;  4NPE A;  1YYC A;  5KLV K;  2N18 B;  4YXD C;  4HYT B;  2KSE A;  1SLQ A;  1VQK P;  3TYY A;  1ZZH A;  4K3A A;  3O20 A;  3FWN A;  3CXH D;  5BU8 B;  3FX0 A;  2KUB A;  1H32 B;  1KYO I;  1QL1 A;  3L75 E;  5DJU B;  1COR A;  1GIW A;  1WEJ F;  1JMB A;  1FZF A;  4WQ9 A;  5KAF E;  2D0W A;  4C7R A;  3KZI H;  2B88 A;  2B0Z B;  1AVY A;  1CRY A;  1JTH B;  3KZI E;  2QE7 H;  3WFD C;  2M8R A;  3P32 A;  3MGN A;  5KAI H;  1SFC B;  3CP5 A;  1IFD A;  1KYO E;  3OA8 A;  3RMZ A;  3CXH H;  5B66 H;  1NTM D;  2H88 C;  3V2Q A;  1AOQ A;  1DVV A;  2Q7C A;  3SWS A;  1NU1 J;  1IRW A;  1NVO A;  2NPS B;  4C46 A;  2YKP A;  1KMI Z;  1M1J C;  3A2A A;  1YEA A;  3L70 J;  1FZA A;  2XV5 A;  1EQ7 A;  1NTZ E;  4EI2 A;  3H1L G;  1GL2 C;  1L0L E;  2H8P D;  3KZI V;  2IBZ E;  2FYU K;  3VTP C;  3ZOW A;  2C2C A;  4K35 A;  2ZOO A;  1M1K Q;  4HH2 A;  5AW5 B;  1NU1 D;  4FA5 A;  4GYD A;  1U7M A;  3G4S P;  2KB7 P;  5K5G B;  1L2P A;  3SJL A; 
#chains in the Genus database with same CATH homology
 1CSW A;  3CXH W;  1H32 A;  1ZRT D;  1H31 A;  2PCB B;  2CE0 A;  4WQE A;  1BL9 A;  1CYJ A;  1KX7 A;  1CIF A;  1CO6 A;  1SQV D;  1VYD A;  4P4Q B;  1W5C T;  1C6R A;  2RMZ A;  2B4Z A;  4V2K A;  1C6O A;  4PW9 B;  2Y0D A;  2L4D A;  2VHD A;  1NTZ D;  3H1J D;  2BPB B;  5GTI V;  2OZ1 B;  2YK3 A;  1H9Y A;  1CTZ A;  3L70 D;  1GU2 A;  1GDV A;  1AYG A;  5KLI B;  4EIE A;  5C0Z A;  3A9F A;  5CYT R;  2N3Y A;  351C A;  1CHJ A;  2PAC A;  2CA3 B;  4H0J A;  1HJ4 A;  1HZU A;  2XTS B;  5CID B;  3SVW A;  1E8E A;  4J20 A;  3L72 D;  2ZON G;  5TJH A;  4IL6 V;  3ZOX A;  4WQC A;  3BCC D;  4QAO A;  2AI5 A;  4LJI A;  2A06 D;  3VYM A;  1NNO A;  4L1Q A;  2QJY B;  2V08 A;  1CRC A;  4FA1 A;  3H1L D;  3CYT I;  4K3I A;  1CED A;  2PCC B;  4L3H A;  155C A;  3GW6 A;  1B7V A;  4N0K A;  3VNW A;  2CXB A;  1I5T A;  1CNO A;  2O3J A;  1DT1 A;  1L0N D;  4FA9 A;  1DW2 A;  1FHB A;  3PHL A;  4AAM A;  1N15 A;  1KYO D;  1CSU A;  1M60 A;  3OA8 B;  3A0B V;  1YFC A;  5TIS V;  1NMI A;  4GED B;  1PP9 D;  1RAQ A;  4A7P A;  2N9Y B;  1I55 A;  1KX2 A;  1MZ4 A;  2BCN B;  5C9M A;  3L71 D;  3CWB D;  1FCD C;  1KB0 A;  4RSZ A;  2ZBO A;  4KMG A;  1R0Q A;  2FYU D;  1CIE A;  3L74 D;  4FA4 A;  1H31 B;  1DW3 A;  2JTI B;  5CIB B;  3WU2 V;  5B6Q A;  1YIC A;  5KAF V;  3A0H V;  3CU4 A;  1C52 A;  1CIH A;  2HV4 A;  4Y5R A;  5CIH B;  1H33 B;  1COT A;  2YIU B;  1KYO W;  1HRO A;  3PXT A;  3PTZ A;  3WFE C;  4NFG B;  2Y0C A;  3SXT A;  1E29 A;  5IY5 1;  1CSV A;  2YCC A;  1N9C A;  4FB1 A;  3CX5 W;  1HJ3 A;  4H0K A;  1LMS A;  1J3S A;  1RZ5 A;  4EID A;  1CRI A;  1E2R A;  1FI3 A;  2RN0 A;  3TGU D;  1OCD A;  2YQB A;  1IRV A;  1K3H A;  2Y0E A;  2FRC A;  2OZ1 A;  3L75 D;  4XXL A;  4EDF A;  1IO3 A;  4YE1 A;  2B12 B;  2I8F A;  1DW1 A;  2QJK B;  2KS1 A;  1LFM A;  2BH5 X;  2N9I A;  1SQX D;  2B10 B;  5AUR A;  1IZL 0;  2ZXY A;  2KNC B;  3L73 D;  1I54 A;  2DGE A;  1CYI A;  1GKS A;  5CIG B;  1DII C;  1HCM A;  1QL3 A;  4EIF A;  1M70 A;  3OCD B;  2C1U A;  1DIQ C;  2AXT V;  3MK7 C;  1I6E A;  1OAE A;  3MK7 B;  1C7M A;  5B5E V;  2QJP B;  1A8C A;  1YNR A;  4WQ7 A;  4L3G A;  4MU8 A;  1GQ1 A;  5H2F V;  3PLN A;  4UB6 V;  1I8P A;  4AAN A;  3FWL A;  1CSX A;  3O0R C;  3PXW A;  1YTC A;  1W2L A;  5EXQ A;  2V07 A;  2B11 B;  2BH4 X;  1IQC A;  1CXA A;  4WQ8 A;  3ZIY A;  2QG4 A;  5DFS A;  3ZBM A;  1M6Z A;  3X39 A;  1SQB D;  2LIR A;  2JQR A;  1CYC A;  3SLE A;  3TDK A;  1CTY A;  1RZ6 A;  5KLV D;  3TF5 A;  3HQ8 A;  1CXC A;  2LIT A;  3RN0 A;  4UB8 V;  3DP5 A;  1L0L D;  4DY9 A;  1KV9 A;  1K3G A;  1S5L V;  2D0S A;  3ZOO A;  4FAN A;  1SQQ D;  1H33 A;  1MG2 D;  1NTK D;  2Q3E A;  1CIG A;  1CHH A;  3PRJ A;  3RN1 A;  1NML A;  1SQP D;  1QN2 A;  4EIC A;  1QKS A;  1F1C A;  1CRG A;  3C2C A;  3M97 X;  1GJQ A;  1P84 D;  1LS9 A;  1EZV D;  4PWA A;  2BCC D;  1YCC A;  2C1V A;  2BLF B;  5CIC B;  1FJ0 A;  2GIW A;  4U3F D;  4AX3 A;  1EB7 A;  3VMA A;  3HQ6 A;  1H9X A;  1FOC A;  1CC5 A;  451C A;  1C75 A;  1N90 A;  1KB9 D;  5GTH V;  1LC2 A;  2MHM A;  1QYZ A;  5DJQ B;  3JBT B;  5B66 V;  4O1W A;  3PXS A;  4AAL A;  2EXV A;  1NIR A;  1U74 B;  3WC8 A;  1MG3 D;  2K9J B;  1DW0 A;  2IBZ D;  1FI9 A;  2C1D A;  2CA4 B;  3O5C A;  3DMI A;  4FAV A;  1L9J C;  3VRD A;  4D6T D;  1BCC D;  1C2R A;  1KIB A;  3NBS A;  5DF5 A;  5DJQ C;  3GG2 A;  2BGV X;  2C9X B;  1RAP A;  2DVH A;  1N50 A;  3CX5 D;  3WUI A;  3PH2 B;  1CHI A;  3NBT A;  1C2N A;  4O1Q A;  1I8O A;  1A56 A;  3WFC C;  1U75 B;  4XYD B;  1BGY D;  3ZCF A;  2C8S A;  3NWV A;  1AOF A;  3TYI A;  3O1Y A;  2ZZS 1;  4RJT A;  2N9J A;  3HQ9 A;  1C6S A;  2ORL A;  2C1D B;  2GB8 B;  1CRH A;  1HJ5 A;  2N18 B;  4PD4 D;  1ETP A;  3WFB C;  5KKZ B;  1H1O A;  4Q5P A;  4WQD A;  1ZZH A;  1LC1 A;  3O20 A;  3CXH D;  5CIF B;  2N18 C;  2MTA C;  1H32 B;  1YEB A;  4JCG A;  4PJ0 V;  1S6V B;  1COR A;  3L4M A;  1GIW A;  1WEJ F;  1HRC A;  2AIU A;  4WQ9 A;  2D0W A;  3H1H D;  5CIE B;  2L91 A;  2B0Z B;  2JWA A;  1CRY A;  1JDL A;  2GC7 D;  4WQB A;  4AAO A;  1CCH A;  1CTJ A;  4WQA A;  3H1K D;  3WFD C;  3CP5 A;  2FYN B;  3ORV A;  3OA8 A;  3RMZ A;  1NTM D;  1A2S A;  1AOQ A;  1DVV A;  5E79 V;  3SWS A;  1F1F A;  2CE1 A;  1WVE C;  1BE3 D;  2GC4 D;  1IRW A;  3RLM A;  1DVH A;  3ITK A;  3HQ7 A;  1YEA A;  1QL4 A;  2N3B A;  3ZOY A;  2FWL A;  1HH7 A;  1CRJ A;  3KZI V;  1FI7 A;  1YIQ A;  3KHU A;  1PPJ D;  3H1I D;  3ZOW A;  1I6D A;  1CCR A;  3L4O A;  2C2C A;  2ZOO A;  1L9B C;  1NU1 D;  4FA5 A;  4GYD A;  3DR0 A;  1HZV A;  1AKK A;  3OCD A;  5KAI V;  3SJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...