1NU1D

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 52
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1nu1D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1nu1D01
2YK3A 1CCHA 1L0LD 2AIUA 4EIDA 1LMSA 1KYOW 1CHHA 2FRCA 1U75B 2GB8B 4L1QA 4XXLA 1FOCA 2CA3B 1CHIA 1IQCA 2HV4A 3ZOYA 2K9JB 3ZOXA 1HJ5A 1MZ4A 2O3JA 351CA 4GYDA 1YICA 1HZVA 4YE1A 1CTYA 3L4OA 1AYGA 1COTA 1KIBA 4WQ9A 3FWLA 3PRJA 1CTJA 5KKZB 1I5TA 1IO3A 3PXSA 3JBTB 1M6ZA 1CIHA 5B6QA 4L3HA 1CNOA 1CIFA 2DGEA 2Y0DA 1F1FA 1J3SA 1C6SA 1IRWA 2PACA 1GU2A 3DMIA 3A0BV 1GKSA 1N50A 3PLNA 1I8OA 1I8PA 3CX5D 1N9CA 1I6EA 2B10B 3HQ7A 3PXWA 3OA8B 2Y0EA 5TJHA 2QJYB 1YTCA 3GW6A 1K3GA 1GJQA 1AOFA 4AAMA 2C8SA 2BGVX 1FI3A 5H2FV 5DJQB 3VMAA 1CRYA 1LC1A 2N9IA 5B5EV 2C1DA 4RSZA 3TF5A 4H0KA 2FWLA 1F1CA 1CSVA 3KHUA 1H32A 3H1KD 1GDVA 3ORVA 2YIUB 1NMIA 3SVWA 3L71D 1DIQC 1E29A 1S5LV 4XYDB 1AKKA 1H33B 1BCCD 1CYCA 3M97X 1FI7A 1HJ4A 2EXVA 3SWSA 2Q3EA 2OZ1B 1YFCA 2JTIB 1YCCA 4Y5RA 1NTZD 4PWAA 4WQDA 5E79V 1CRCA 5GTIV 1CRJA 1WVEC 1ZZHA 1QYZA 1KX7A 2GC7D 1GQ1A 3KZIV 1RAQA 1H33A 2C9XB 2BLFB 2V07A 1I6DA 5DF5A 4AX3A 3CWBD 1FCDC 4DY9A 2N18B 4K3IA 1YNRA 1DIIC 3CX5W 2KS1A 3H1JD 1KB0A 2ORLA 1CIGA 3A9FA 4D6TD 4WQ8A 4UB6V 1R0QA 2LIRA 3VNWA 1JDLA 5CIHB 4PD4D 1SQBD 3ZBMA 5B66V 3ZOWA 2PCCB 2XTSB 4EIFA 2VHDA 5KLVD 4EICA 1A56A 1H9YA 4JCGA 1L0ND 2DVHA 1NIRA 3DR0A 2JWAA 1DVVA 1SQVD 4FA9A 5CIGB 2ZXYA 4WQ7A 3TGUD 3VYMA 3CU4A 1LS9A 4FA4A 2MHMA 2B12B 2JQRA 4NFGB 5DFSA 1CRGA 1N90A 4V2KA 4WQBA 1ETPA 1KYOD 1CYJA 3NBSA 1CIEA 1A8CA 1C52A 5C0ZA 3L70D 2BCCD 1L9BC 2QG4A 1CORA 1CC5A 3CXHW 1RZ5A 1YEAA 1CRHA 2CA4B 4FA1A 3PTZA 2LITA 1FHBA 3A0HV 1BL9A 2QJPB 3HQ8A 2QJKB 3C2CA 3CXHD 4QAOA 3WFBC 3RN0A 3MK7B 1QL4A 2YQBA 1H9XA 4WQCA 3X39A 4MU8A 1L9JC 1C2NA 4PJ0V 4EDFA 1CRIA 2B0ZB 1CHJA 5AURA 1EZVD 1NTMD 2V08A 2D0WA 1NMLA 4Q5PA 3ZCFA 5KLIB 1IRVA 3CP5A 1SQQD 3PHLA 1MG2D 1DVHA 2PCBB 4AALA 3RLMA 1HJ3A 1P84D 1SQXD 1LC2A 4P4QB 1MG3D 3L75D 2B11B 1CCRA 3GG2A 3TYIA 2AXTV 4FAVA 1VYDA 3H1ID 1C2RA 3RMZA 1A2SA 1CXAA 1E8EA 1QL3A 1OCDA 3TDKA 3ZOOA 5CIDB 3RN1A 1B7VA 3O0RC 3PXTA 1PPJD 2C1DB 4O1WA 1CXCA 5DJQC 3WC8A 2BH4X 1K3HA 3WFDC 4A7PA 3ITKA 2Y0CA 4PW9B 2ZZS1 3SLEA 4WQEA 1U74B 1C75A 3O20A 451CA 2BH5X 4L3GA 1W5CT 1GIWA 3HQ6A 2OZ1A 1NNOA 2AI5A 1CEDA 1HROA 3WU2V 4AANA 1HZUA 155CA 3SXTA 3O1YA 5IY51 1KX2A 3PH2B 2ZOOA 1BE3D 1HRCA 4U3FD 3OCDB 5KAFV 3WUIA 2I8FA 3NBTA 2GIWA 2CXBA 3DP5A 2ZONG 2B4ZA 1RAPA 1QKSA 3WFCC 1I54A 1H31A 1FI9A 4O1QA 2BCNB 2IBZD 2N18C 2FYNB 3MK7C 1YEBA 3L4MA 3OCDA 2MTAC 1NTKD 4UB8V 1KV9A 4J20A 5C9MA 2RMZA 3H1LD 3BCCD 2D0SA 3WFEC 1DW3A 4RJTA 1M60A 1DW2A 1DW1A 2L4DA 3H1HD 1NU1D 2BPBB 1E2RA 5TISV 1CO6A 1ZRTD 1BGYD 3NWVA 4LJIA 1CSUA 2N3BA 2N3YA 4FA5A 1CSXA 3L72D 4KMGA 1PP9D 3OA8A 3L74D 2FYUD 1LFMA 4H0JA 5CIBB 4WQAA 2A06D 3VRDA 1C6OA 2N9JA 4IL6V 2C2CA 1RZ6A 1EB7A 3O5CA 1QN2A 2C1VA 2ZBOA 1WEJF 1DT1A 1IZL0 1HH7A 1KB9D 4FB1A 2CE1A 5EXQA 1S6VB 5KAIV 5CICB 1N15A 3CYTI 1OAEA 3ZIYA 5CIFB 3HQ9A 1FJ0A 1HCMA 4AAOA 1M70A 2RN0A 2N9YB 1DW0A 2CE0A 4FANA 1H31B 3L73D 4N0KA 1H1OA 1CSWA 5CIEB 1SQPD 2L91A 1AOQA 1YIQA 1H32B 1I55A 4GEDB 1CYIA 2GC4D 1C7MA 2C1UA 5CYTR 3SJLA 2YCCA 5GTHV 2KNCB 1CTZA 1C6RA 4EIEA 1W2LA
chains in the Genus database with same CATH superfamily
1L0LD 4EIDA 3H1LJ 1IK9A 3AE1C 4ZKUA 4L1QA 2HV4A 3ZOYA 1X79B 2K9JB 4WY4B 1HWTC 3C8VA 2O3JA 4IFFA 5DJUB 1FDMA 2YXRB 1CTYA 4K35A 4IL6E 2OTKE 4GIFA 3FWLA 3TGUE 1KZUB 5KKZB 2HODB 2DW3A 5AVSB 1I5TA 3PXSA 4D6TE 1HH0A 4I1LA 5KAIE 4GKGA 1J3SA 2IYPA 1XTCC 4PD4E 3VP9A 2R3SA 3CC4P 4Y99C 1L0LJ 2Z5HA 1PPJG 3A0BV 1GKSA 3GMAA 2M3BA 4L73A 3PLNA 1I8PA 3CX5D 3AEDC 1LTAC 1MFTA 2B10B 2KZJA 1YTCA 4H13C 1M1KQ 4I7ZC 1FI3A 1SQXJ 1DEEG 3TF5A 1S5LE 3VOPA 1H32A 1GDVA 1HVVA 2YIUB 3SVWA 1W5CE 3L70E 2HG5D 1S5LV 4XYDB 1BSNA 1PGJA 2A06E 1BCCD 3M97X 3NXSA 3Q1MA 5K5GB 1LTBC 1QL2A 1LP1B 1SQBG 1YYCA 5E79V 2OYHC 5AVVB 1PGQA 1NH4A 3PH0A 1NTKG 1GQ1A 3KZIV 2QM8A 2FYUJ 2Q3IA 2C9XB 2E76D 1FZAA 3BCCG 3VN0A 4AX3A 3H1LG 4OWFA 4K3IA 1SP4A 2ITAA 5BU8B 5KAIH 1GW4A 4LC1A 1RH5B 1JCDA 2K9JA 4M3LA 2KB7P 1ZMEC 2GM4A 1JDLA 2AEJA 3AE8C 1VQ7P 3CMEP 3ZBMA 3ZOWA 2KLVA 1FZGA 1BE3E 3FXEA 5CJ0A 4EIFA 2KS1B 2A45I 1J1DB 1LTJB 1RE4C 1NIRA 1BSHA 3EFGA 1DIPA 1JUNA 2FXOA 1FZCA 2ZXYA 3VYMA 2W90A 1LS9A 4FA4A 1VQ6P 1QLED 1N7SD 1N90A 4WQBA 4H13B 2O01J 3M0AA 1ETPA 1KYOD 3RGUA 1JEKA 3NBSA 3H1JG 1T2KC 1C52A 2WSEH 2BCCD 2QG4A 3HD7D 2JO1A 4H0LC 1SQPG 1XTGB 3SSUA 1S9KD 1DX7A 1RZ5A 4U3FE 1YEAA 2E74D 1SQPJ 3PTZA 3A0HV 2W27A 1KN7A 5CCGA 5APVA 2D2CD 2VRSA 5APSA 3WFBC 1BCCJ 1NTKJ 2H8PD 2ZJSE 4WQCA 5GTIH 5AVWB 1S3JA 3B5ND 2HLOA 4YPCA 3HUSC 1CRIA 1CHJA 2V08A 3KPEA 1NMLA 5KLIB 3RK3D 1GD2E 1H89A 5L8RJ 2JR8A 3D71A 3TK1A 2PCBB 2QIWA 1GL2A 4AALA 1QGKB 3II6A 1SQXD 1P84D 1NKNA 2WZ7A 3B5NB 3S4RA 3GG2A 5CMZA 1KILD 4FAVA 1X22A 3F5HA 1OXZA 1YBKA 1KYOI 4EYYQ 3RMZA 2OQQA 1A2SA 1IK7A 3G6EP 3P8MC 1E8EA 2NPSB 1NWQA 3RN1A 4R4LA 1FZCC 3O0RC 4O1WA 1PPJD 2C1DB 2BH4X 1G1IA 2M5AA 3ITKA 3SLEA 2O01N 3BATA 4D6TJ 1IFNA 1RF0A 1U74B 1LNQA 3CXHI 3HQ6A 2N9BA 3T97B 2AI5A 1CEDA 1EXIA 3WU2V 3H1KG 5APYA 3IF4A 3USSA 1HJ0A 3SXTA 1QVFO 4TLFA 1KX2A 3PH2B 2XU6A 4N3YB 1JTHA 4R4MA 2ZOOA 3V4QA 3CPWO 1EXJA 1X8YA 1SQPK 1BCCG 4H0LB 1H88A 3U1CA 1M57D 1NHLA 4KHXA 1H31A 1FI9A 4O1QA 2N18C 3L70J 1JM0A 1YEBA 3L4MA 2PFXA 2XZRA 1T2KD 2MTAC 1NTKD 5KLIC 4UB8H 5C9MA 4GDOA 2V4HA 3WFEC 2HYNA 1LP1A 2FFDA 2YMKA 3SFEC 2Q9IA 1DW2A 2KIKA 3H1HE 1DW1A 2D2CC 1NVOA 1CO6A 1ZRTD 1N7SB 3NWVA 2OYIB 1R5LA 1VQOP 4FA5A 1CSXA 1KB9E 3H1IE 1G2CA 3JSVC 3L74D 3L71E 1SFCB 1PZQA 1K05A 5KLVG 3FXDA 1N73C 2C2CA 2K3RA 3S1KA 3CX5I 1QN2A 2ZBOA 1HH7A 4PD4I 1KB9D 2NRGA 3HE4B 1S72P 3D6YA 2HFED 1M7LA 1N15A 3S9OA 3D6ZA 5CIFB 1NU1G 3L72E 5KJ7C 3SWYA 3RK2B 5CCHD 1BGYG 3V6IA 3ZDMA 5CIEB 1SQPD 2R32A 2POHA 1H32B 2ZT9C 2BEZF 2WMMA 2C0XA 1FE6A 1KILC 2A06G 4GOFA 5GTHV 3CCUP 2QA4P 1CTZA 3MUDC 1C6RA 4EIEA 3AE4C 1VQKP 4EI2A 1CCHA 2FFDC 4Y28J 1KYOW 2FRCA 2HPCA 2GB8B 5CBNA 3CCRP 1CHIA 1KQFB 1FJPA 1HJ5A 1YITP 2J58A 1QVGO 1HZVA 1G2CB 2O1KA 3M06A 2L5GB 1AYGA 2MKVA 1KIBA 4WQ9A 1OW8A 3PRJA 2G8YA 1IO4A 3CX5H 3L36A 3RL0D 1VF5C 2WSSH 2YNYA 1IO3A 1SFCA 3LIEA 1M6ZA 1CIHA 5B6QA 1CIFA 2Y0DA 1J1EB 5KAFH 2FFDB 1C6SA 1IRWA 5AW5B 2PACA 1GU2A 1VQ8P 2N1TC 2YO3A 1KQLA 1AA0A 3L4FA 4L75A 2IZ0A 3HD7A 1FAVA 3HQ7A 3PXWA 4PJ0H 1Q81Q 2Y0EA 4OH8B 3CCLP 4YXDC 1KC8Q 2BGVX 1NOHA 2KUBA 1YJWP 1CRYA 2C1DA 3IR9A 4RSZA 5B5EH 3OJAB 2FWLA 3KHUA 3H1KD 1PGOA 1USDA 3A2AA 3O6QA 5EFWB 4LGDE 1E29A 3MTUE 1H33B 2E74C 1T3JA 4U3FG 2EXVA 2Q3EA 2OZ1B 1YFCA 3V2NA 4Y5RA 4PWAA 4WQDA 5AW9B 1LTIC 4Z1MH 1JY3P 1NTKK 4IL6H 4ZKPA 1CRCA 2NPSC 3AECC 1ZZHA 2I8DA 2IBZI 3TNUA 2GC7D 2IFMA 1JY2N 2WSEJ 4UB8E 1N7SC 1JCCA 1EZVE 4H44D 5DF5A 3AEFC 3CWBD 1YNRA 1H8AA 5CCGC 1DIIC 1SQVE 3M9HA 3CD6P 2K1AA 2ORLA 1IFIA 4D6TD 1VQPP 3N4XA 2LIRA 1FS0E 2G3AA 3VNWA 1U7MA 2PP6A 4PD4D 1YTZI 3GHGB 3HD7C 1L4AD 5B66V 4DZOA 3A0BH 2WSFJ 1KYOH 2XTSB 1NAFA 5AW1B 1PIXA 2Y9ZA 4JCGA 1HGVA 1L0ND 3VP8A 3CXHE 2H88C 3RK3E 1DVVA 1VQ5P 2JWDA 5CIGB 2Z5IA 2NZ2A 3B4SA 2WT7A 3TGUD 1N2DC 2SPZA 1KQGB 3NFQA 3O8ZA 4NFGB 5DFSA 1CRGA 4V2KA 2QVAA 1CYJA 1VF5B 3KDPB 2LXBA 2YO2A 1CIEA 5C0ZA 3L70D 1R8EA 1SQBE 1L0NE 1L9BC 1ZR2A 1MFZA 1SQXG 3Q5RA 1CRHA 2CA4B 2V7QH 2QJPB 3BCCJ 1VF5D 3LIDA 1BGYE 3RN0A 3M0DA 3GF3A 1SQQE 1H9XA 1SQQK 3AEBC 3H1IJ 1NU1K 2OYOA 1P84E 5CJ4A 1LTTC 2E75C 2I1JA 1C2NA 2M3EA 1OIPA 1RF1C 1KQSO 3B5NC 2WVRA 1NTMD 4YXWH 3A5TA 4Q5PA 3ZCFA 1FZBA 1SVFA 4DJGA 2QRXA 3CP5A 1SQBK 1SQQD 1KD1Q 3PHLA 1W2BO 1MG2D 1OX3A 1T6AA 3IAOA 2WPSA 1IFJA 1HJ3A 4U7JA 4EIJA 4P4QB 3P8CE 1KV4A 4JQ0D 4DOJA 1PV3A 2B11B 3BASA 1CCRA 1DEBA 1HGZA 1KILE 3RBXA 1VYDA 1AQ5A 1NTMK 2WPQA 4NPEA 3HUSB 1CXAA 3RK3B 1JB0J 1CW5A 1DD3A 2QEXP 3PXTA 1SFCD 1CXCA 2C0WA 3RL0g 1TU3F 4I2LC 2QJKC 3CC7P 1LWUA 3G3ZA 3VMXA 2ZZS1 3BRVB 4WQEA 2H43A 1C75A 3O20A 2Q5UA 451CA 1W5CT 3JCUH 1VQMP 2W83C 4PV1D 1VQ4P 2BCCE 1FJKA 5IY51 1NAYA 1MKMA 2R44A 3AE5C 4XA4A 4JPZB 1RQUA 3HD7B 1BE3D 3LW5H 2FYUE 1JY2P 1N73A 2CPSA 3WUVA 1FZEA 2E76B 4DT0A 2B89A 3DP5A 3H1JJ 3I56P 1QKSA 2B88A 4WY4A 2WSCJ 5BVZA 2BCNB 5KJ7A 1ZRTE 3NMDA 1JNMA 4XFJA 3F89A 4BWNA 2J59M 1Q86Q 1RQVA 4OVNF 3AEEC 4J20A 3H1LD 2AEMA 3AEGC 3EFFK 1UIXA 2D0SA 4HJGH 1EDLA 1Y8AA 4I7ZB 1G1JA 1M60A 3R4YA 2KOGA 1LWUB 3L37A 1T3UA 2PAJA 3MUDA 1L4AC 1BGYD 3RL0B 1VDFA 4CPGA 1KB9H 3MZWB 1EDKA 4KMGA 3D0WA 1PP9D 3OA8A 3FWNA 3L73J 1LFMA 1EC5A 2RH0A 3VRDA 4JBZA 2Q6QA 3T97A 3V2PA 3KZIH 1ZN5A 2LXCB 2C1VA 1M56D 5C39A 1IZL0 4FB1A 2H7HA 2CE1A 1PP9E 2QJYC 4BXLA 5AW4B 1DD4A 3CXHH 5KAIV 5CICB 1OAEA 3ZIYA 3MIWA 4O9BA 3HQ9A 2N1TA 1HCMA 2IZ1A 5B66E 3G4SP 2RN0A 3SWFA 1NJIQ 3AE9C 1P84I 3TYYA 4FANA 2ZXXA 2ZYAA 4UB6H 1H31B 3L73D 1JY3O 1H1OA 3A0BE 1N7LA 1KB9I 4ASVA 5M1BA 3RK2D 1AV1A 3L72G 2KYVA 1I55A 1NU1E 1GDTA 4GEDB 1S2EA 1SQXK 3L74G 4ZMDA 1HTLC 2KNCB 4N78E 1GL2B 2WSFH 2YK3A 1JOCA 5AW3B 1A02J 5KLVE 1FOCA 5GTIE 1L4AA 3ZOXA 1YQ3C 1NTZE 2ZT9B 4AUWA 4YE1A 1T8ZA 4H13D 3V2QA 1COTA 2CPBA 1M1JC 2ZAEB 5BU5A 4WBAA 3HRNA 5E79E 4HB1A 4L3HA 2DGEA 1F1FA 1KORA 3CCSP 1EZVI 1GTWA 1AVYA 2LR2A 3V4WA 3H1IG 1LT9B 3DMIA 1H0TA 2I1KA 2P1JA 1LTSC 1NYHA 2W6AA 1QX8A 1N9CA 1NKZB 5TJHA 2QJYB 4HKZH 3GW6A 2K88A 2N1TB 4AAMA 5H2FE 1ZR4A 2C8SA 2PRRA 3AE2C 5DJQB 2P7JA 1GU4A 2IPPA 3VMAA 1LC1A 2N9IA 1OVUA 2IDBA 1J1EC 1WRGA 3CLQA 3ORVA 3H6PA 1N86A 1NMIA 5TISH 3CCMP 3L71D 3L74E 1Y47A 4KJMA 1DIQC 1K8AQ 2JJLA 1E5WA 4JF7A 1S5LH 5APXA 1YQ4C 1PL5A 1CYCA 1FI7A 5AW0B 5GTHE 2M0BA 2YXQB 1YCCA 1ZP0C 1NTZD 1Y9BA 1URQC 3G9RA 1IZNB 5CCGD 2FKWB 1K04A 1WVEC 1QYZA 1L0NG 1KX7A 1OFCX 1YJNP 4RO0A 1RAQA 1H33A 1GK4A 1M1JA 1FBMA 4PD4H 3EWKA 4WY4D 1LT9A 3A7OA 2V07A 1I6DA 1KMIZ 1AFOA 3KXDA 4I6MC 1FCDC 1VQLP 4K3AA 1J2JB 1SQPE 2E76C 5AVUB 3A3YB 2KS1A 1PGPA 3H1JE 1NO4A 1CIGA 2B9BA 4WQ8A 1JMBA 3IFMA 1GL2D 4NPFX 3SWKA 1ZV8A 1ZXGA 5TISE 3L72J 1E79H 2BCCJ 1KILA 1RE4A 3LW5J 3E1IA 4PV1C 1YHQP 1PPJE 2VHDA 1KFMA 2P58A 1Q82Q 2JDIH 2DVHA 1Z56A 3H25A 3Q5PA 1S1CX 2JWAA 2FY8A 2OTJP 4FA9A 5AVYB 1M8OB 2QSIA 3GHGA 3TGUJ 4WQ7A 3CU4A 3O6QB 4KT0J 2B12B 2JQRA 1EZVG 1NTMG 2JP3A 3WU2H 1A8CA 2E74B 2WQYC 4PV1B 3CXHW 1LWUC 3L73G 2HPCB 2YMYA 2BASA 3B8EB 1HJBA 1FHBA 3VYIA 1BL9A 1JY2O 4W7ZA 3CXHD 2OGUA 3WUUA 4H0LD 1OVVA 2HODA 1NGMB 4MU8A 2E43A 1YIJP 1L9JC 1L0LG 2K37A 2R3CA 4EDFA 1OWAA 2B0ZB 1N73B 5H2FH 3V2RA 2E42A 3CI9A 2D0WA 1VQNP 4C7NA 4Y99B 3L70G 1DVHA 2RKLA 3JCUE 3P32A 1LC2A 1MG3D 1BE3G 3CC2P 2AXTV 1GL2C 1JMMA 1BDCA 1URQD 5B66H 1C2RA 3H1LE 1QL3A 1USEA 1OCDA 1M1JB 5E79H 5APWA 1IJDB 3GHGC 3H32A 4L76A 5DJQC 1HBWA 2XKMA 3QH9A 1RF0C 5GTHH 4A7PA 2Y0CA 3L74J 3CWBE 1KILB 4PW9B 1FDOA 4DCKA 2KXPB 1N7SA 4L3GA 4GT1A 1HROA 1Q2NA 2KZIA 3P8CD 1SQQG 1NTKE 4AANA 1HZUA 3K5BA 3O1YA 5AVRB 3L71J 1DH3A 4OGQC 2OARA 1LJ2A 4U3FD 3RK2C 5KAFV 2YKPA 4XE5B 3NBTA 3B71A 3UIAA 4IOIH 3CCQP 2ZONG 1KTMA 2ZFCA 2XNDH 3WFCC 3HE5A 2WPVB 3R2PA 3U1AA 2FYUG 1I54A 2GA1A 3FX0A 2HR3A 3M9QA 2FYNB 3MK7C 5KJ7D 2WSCH 4UB8V 4AQRD 1L2PA 4B86A 5APUA 2Y9YA 1NTME 3W67A 3BCCD 3KZIE 3PP5A 3L73E 1DW3A 4U3FJ 2XDJA 4RJTA 3QWOC 1AQTA 2L4DA 3H1HD 1ZLLA 2Z4EA 3E1RA 3W68A 2C9LY 4D6TG 3TNUB 1BGYJ 4LJIA 1CSUA 2N3BA 3L72D 3A0HE 4JYCA 3M0DC 3GLMA 1IFDA 1OW6A 1RHZB 4WQAA 3KYQA 3V5BA 1C6OA 5AVXB 2OYHA 3WUTA 4IL6V 1RZ6A 1EB7A 3CMAP 3E7KA 4LLHA 5B5EE 2O1JA 1N8RQ 4GODA 3HTKA 4H44C 1WMKA 2WWWA 2ZXEB 5AW7B 1L0NK 2N1TD 2N9YB 1DW0A 2CE0A 2B87B 3MP7B 4N0KA 3EQ2A 3MD0A 4L74A 1CSWA 2MJZA 1EDJA 1QEXA 1IC2A 2GC4D 1C7MA 2C1UA 2FYUK 5CYTR 3RL0C 3HTKB 2FYZA 2ZT9D 2FYNC 2A45G 4WWIA 1IFMA 4IL6X 1FOSF 4QMAA 1AVOA 5AW8B 1W2LA 2AIUA 1LMSA 3C9IA 1CHHA 3H32B 2UWJE 3OA7A 1U75B 4RESB 3H1KE 4XXLA 4TT3H 2CA3B 1IQCA 5CBOA 1LT1A 1MZ4A 2JEEA 351CA 3I55P 4GYDA 2A45H 3BVHA 1YICA 4OGQB 3L4OA 1PFIA 1HUCA 5AVQB 2GUVA 1CTJA 3L75G 1SQVK 3JBTB 2E5TA 3CCEP 1CNOA 1NTZK 1Q7YQ 1FDIA 3H1KJ 1VL2A 4N78D 5KLVK 4OGQD 1L0NJ 5CHXA 3G71P 3VTPC 2PGDA 5APTA 1NU1J 1N50A 1I8OA 1X9VA 3GF7A 1I6EA 2ZYGA 3CCVP 3OA8B 2W6JH 1K3GA 1RE3C 1GJQA 1AOFA 1FOSE 2AXTE 1CI6B 5H2FV 5KTBA 5B5EV 5CCHA 4H0KA 1F1CA 1CSVA 1U7JA 3WU2E 1U57A 2W8ZA 1UIIA 1FZCB 1GMJA 2QJPC 1WT6A 2NPSD 2O01H 3KQGA 3I5CA 1AKKA 2WITA 1LTJA 4JYBA 2AXTH 1HJ4A 3SWSA 3CCJP 3A0HH 3D70A 2JTIB 1IFPA 1QL1A 5APQA 1GZLA 5DJTB 2C9NY 1ZW0A 2IBZG 1RF1B 5GTIV 1CRJA 2KSJA 1K9MQ 1KFNA 1LTGC 4NPDA 2XV5A 5KAFE 2BLFB 1FC2C 1OVRA 1OMIA 4IFMA 4IFDK 1GW3A 4DY9A 2YKOA 3BRTB 2N18B 3CX5W 1FZFA 2P10A 1M90Q 1HF9A 3H1HG 3L71G 3H1JD 4BRYB 1GK6A 3CX5E 1KB0A 3A9FA 3PJSK 2YIUC 4UB6V 1R0QA 1SQQJ 3HE4A 5CIHB 1PP9G 1SQBD 2IX7C 1NTZG 4UB6E 2PCCB 1S9KE 1S4XA 2QE7H 2E5YA 2J5UA 5KLVD 4EICA 1A56A 1H9YA 3U59A 1CI6A 3WMM0 3DR0A 5CCHC 2XNXA 2V7QJ 1SQVD 2AXCA 2FBWC 1BCCE 1CZQA 3MGNA 5AVZB 2MHMA 2P2UA 1LTJC 2KI7B 2ZVNB 1BE3J 3C1LA 4EOTA 1SLQA 1SS1A 1YJ9P 1CORA 2M5AB 1CC5A 1MV8A 4FA1A 2LITA 2K9YA 3HQ8A 1SQXE 2QJKB 3C2CA 1KYOE 4QAOA 4BRYA 3MK7B 1QL4A 2YQBA 4C7NB 2GUSA 3X39A 1X0TA 2KP8A 3B5NA 3VMZA 4PJ0V 2KSEA 1RY3A 1JY3N 5AURA 1L0LK 1EZVD 1RF1A 1LGHB 4WB4A 1IRVA 2FXMA 2BCCG 2E75D 3RBZA 3CWBJ 3RLMA 1PP9J 3L75D 3TYIA 3Q3DA 3H1ID 1OZHA 5KLVJ 1URQA 3ABVC 3M91A 3TDKA 3ZOOA 5CIDB 1EDIA 1B7VA 1YTZT 3WC8A 1SQVJ 4RKUJ 4GOEA 1K3HA 3WFDC 1SQBJ 1GU5A 4WVZA 1P84H 2WTYA 3SFDC 3NTNA 1J1DC 3N7NA 1LT9C 1JTHB 2H89C 2BH5X 2P67A 1MZ9A 1GIWA 2OZ1A 2E75B 1NNOA 2OYIA 2WPRA 3L75E 1H0TB 3Q5SA 155CA 1D7MA 2W6BA 1S5LX 3VMYA 1JO5A 4ZNCA 3AE6C 3HUSA 2IBZE 4HYTB 2QM7A 1Q90D 1HRCA 2M8RA 1SFCC 3OCDB 3WUIA 2AEFA 2I8FA 5AW2B 3Q2YA 2GIWA 2CXBA 2KK7A 2Q7CA 2B4ZA 1RAPA 3P7KA 3M9BA 2WT7B 1L4AB 2OTLP 2KLUA 3RK3C 4N6JA 1ZOYC 2R5BA 2IBZD 3AE3C 2R5DA 1EQ7A 2IYOA 4YTPC 4WY4C 3OCDA 2ZVOB 1KV9A 2BEQD 2RMZA 1MUUA 3CWBG 1BDDA 2Q1KA 4C7RA 1W2EA 1YI2P 1NU1D 2BPBB 1E2RA 5AVTB 5TISV 2OYHB 1FU1A 2N3YA 2FXPA 4AYCA 1VQ9P 3AE7C 2D2CB 2FYUD 3CL3D 4PJ0E 4W80A 4H0JA 5CIBB 4HH2A 2A06D 2OYIC 2N9JA 1VPCA 3AEAC 1URQB 3O5CA 3BCCE 2NPSA 2B87A 3IN6A 2JKVA 3JC22 1WEJF 1DT1A 1SQVG 3MHVA 2IFNA 1CSBA 4ASWA 3TGUG 1L0LE 5EXQA 3OAKA 1S6VB 2ZYDA 3FGAD 3CYTI 1FJ0A 4AAOA 1AJYA 1M70A 2KNCA 2LKMA 1K73Q 3HE5B 1NTMJ 5AW6B 1NTZJ 4H44B 2L91A 1AOQA 3L35A 1YIQA 3TSIA 1CYIA 1RE3A 2CK3H 3OW2O 2YKQA 1OW7A 3SJLA 5KKZC 1A02F 1R5SA 2YCCA 3L75J 4MN4C 3H1HJ 4W7YA 4C46A
chains in the Genus database with same CATH topology
2YK3A 1CCHA 1L0LD 2AIUA 4EIDA 1LMSA 1KYOW 1CHHA 2FRCA 1U75B 2GB8B 4L1QA 4XXLA 1FOCA 2CA3B 1CHIA 1IQCA 2HV4A 3ZOYA 2K9JB 3ZOXA 1HJ5A 1MZ4A 2O3JA 351CA 4GYDA 1YICA 1HZVA 4YE1A 1CTYA 3L4OA 1AYGA 1COTA 1KIBA 4WQ9A 3FWLA 3PRJA 1CTJA 5KKZB 1I5TA 1IO3A 3PXSA 3JBTB 1M6ZA 1CIHA 5B6QA 4L3HA 1CNOA 1CIFA 2DGEA 2Y0DA 1F1FA 1J3SA 1C6SA 1IRWA 2PACA 1GU2A 3DMIA 3A0BV 1GKSA 1N50A 3PLNA 1I8OA 1I8PA 3CX5D 1N9CA 1I6EA 2B10B 3HQ7A 3PXWA 3OA8B 2Y0EA 5TJHA 2QJYB 1YTCA 3GW6A 1K3GA 1GJQA 1AOFA 4AAMA 2C8SA 2BGVX 1FI3A 5H2FV 5DJQB 3VMAA 1CRYA 1LC1A 2N9IA 5B5EV 2C1DA 4RSZA 3TF5A 4H0KA 2FWLA 1F1CA 1CSVA 3KHUA 1H32A 3H1KD 1GDVA 3ORVA 2YIUB 1NMIA 3SVWA 3L71D 1DIQC 1E29A 1S5LV 4XYDB 1AKKA 1H33B 1BCCD 1CYCA 3M97X 1FI7A 1HJ4A 2EXVA 3SWSA 2Q3EA 2OZ1B 1YFCA 2JTIB 1YCCA 4Y5RA 1NTZD 4PWAA 4WQDA 5E79V 1CRCA 5GTIV 1CRJA 1WVEC 1ZZHA 1QYZA 1KX7A 2GC7D 1GQ1A 3KZIV 1RAQA 1H33A 2C9XB 2BLFB 2V07A 1I6DA 5DF5A 4AX3A 3CWBD 1FCDC 4DY9A 2N18B 4K3IA 1YNRA 1DIIC 3CX5W 2KS1A 3H1JD 1KB0A 2ORLA 1CIGA 3A9FA 4D6TD 4WQ8A 4UB6V 1R0QA 2LIRA 3VNWA 1JDLA 5CIHB 4PD4D 1SQBD 3ZBMA 5B66V 3ZOWA 2PCCB 2XTSB 4EIFA 2VHDA 5KLVD 4EICA 1A56A 1H9YA 4JCGA 1L0ND 2DVHA 1NIRA 3DR0A 2JWAA 1DVVA 1SQVD 4FA9A 5CIGB 2ZXYA 4WQ7A 3TGUD 3VYMA 3CU4A 1LS9A 4FA4A 2MHMA 2B12B 2JQRA 4NFGB 5DFSA 1CRGA 1N90A 4V2KA 4WQBA 1ETPA 1KYOD 1CYJA 3NBSA 1CIEA 1A8CA 1C52A 5C0ZA 3L70D 2BCCD 1L9BC 2QG4A 1CORA 1CC5A 3CXHW 1RZ5A 1YEAA 1CRHA 2CA4B 4FA1A 3PTZA 2LITA 1FHBA 3A0HV 1BL9A 2QJPB 3HQ8A 2QJKB 3C2CA 3CXHD 4QAOA 3WFBC 3RN0A 3MK7B 1QL4A 2YQBA 1H9XA 4WQCA 3X39A 4MU8A 1L9JC 1C2NA 4PJ0V 4EDFA 1CRIA 2B0ZB 1CHJA 5AURA 1EZVD 1NTMD 2V08A 2D0WA 1NMLA 4Q5PA 3ZCFA 5KLIB 1IRVA 3CP5A 1SQQD 3PHLA 1MG2D 1DVHA 2PCBB 4AALA 3RLMA 1HJ3A 1P84D 1SQXD 1LC2A 4P4QB 1MG3D 3L75D 2B11B 1CCRA 3GG2A 3TYIA 2AXTV 4FAVA 1VYDA 3H1ID 1C2RA 3RMZA 1A2SA 1CXAA 1E8EA 1QL3A 1OCDA 3TDKA 3ZOOA 5CIDB 3RN1A 1B7VA 3O0RC 3PXTA 1PPJD 2C1DB 4O1WA 1CXCA 5DJQC 3WC8A 2BH4X 1K3HA 3WFDC 4A7PA 3ITKA 2Y0CA 4PW9B 2ZZS1 3SLEA 4WQEA 1U74B 1C75A 3O20A 451CA 2BH5X 4L3GA 1W5CT 1GIWA 3HQ6A 2OZ1A 1NNOA 2AI5A 1CEDA 1HROA 3WU2V 4AANA 1HZUA 155CA 3SXTA 3O1YA 5IY51 1KX2A 3PH2B 2ZOOA 1BE3D 1HRCA 4U3FD 3OCDB 5KAFV 3WUIA 2I8FA 3NBTA 2GIWA 2CXBA 3DP5A 2ZONG 2B4ZA 1RAPA 1QKSA 3WFCC 1I54A 1H31A 1FI9A 4O1QA 2BCNB 2IBZD 2N18C 2FYNB 3MK7C 1YEBA 3L4MA 3OCDA 2MTAC 1NTKD 4UB8V 1KV9A 4J20A 5C9MA 2RMZA 3H1LD 3BCCD 2D0SA 3WFEC 1DW3A 4RJTA 1M60A 1DW2A 1DW1A 2L4DA 3H1HD 1NU1D 2BPBB 1E2RA 5TISV 1CO6A 1ZRTD 1BGYD 3NWVA 4LJIA 1CSUA 2N3BA 2N3YA 4FA5A 1CSXA 3L72D 4KMGA 1PP9D 3OA8A 3L74D 2FYUD 1LFMA 4H0JA 5CIBB 4WQAA 2A06D 3VRDA 1C6OA 2N9JA 4IL6V 2C2CA 1RZ6A 1EB7A 3O5CA 1QN2A 2C1VA 2ZBOA 1WEJF 1DT1A 1IZL0 1HH7A 1KB9D 4FB1A 2CE1A 5EXQA 1S6VB 5KAIV 5CICB 1N15A 3CYTI 1OAEA 3ZIYA 5CIFB 3HQ9A 1FJ0A 1HCMA 4AAOA 1M70A 2RN0A 2N9YB 1DW0A 2CE0A 4FANA 1H31B 3L73D 4N0KA 1H1OA 1CSWA 5CIEB 1SQPD 2L91A 1AOQA 1YIQA 1H32B 1I55A 4GEDB 1CYIA 2GC4D 1C7MA 2C1UA 5CYTR 3SJLA 2YCCA 5GTHV 2KNCB 1CTZA 1C6RA 4EIEA 1W2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YK3 A;  1CCH A;  1L0L D;  2AIU A;  4EID A;  1LMS A;  1KYO W;  1CHH A;  2FRC A;  1U75 B;  2GB8 B;  4L1Q A;  4XXL A;  1FOC A;  2CA3 B;  1CHI A;  1IQC A;  2HV4 A;  3ZOY A;  2K9J B;  3ZOX A;  1HJ5 A;  1MZ4 A;  2O3J A;  351C A;  4GYD A;  1YIC A;  1HZV A;  4YE1 A;  1CTY A;  3L4O A;  1AYG A;  1COT A;  1KIB A;  4WQ9 A;  3FWL A;  3PRJ A;  1CTJ A;  5KKZ B;  1I5T A;  1IO3 A;  3PXS A;  3JBT B;  1M6Z A;  1CIH A;  5B6Q A;  4L3H A;  1CNO A;  1CIF A;  2DGE A;  2Y0D A;  1F1F A;  1J3S A;  1C6S A;  1IRW A;  2PAC A;  1GU2 A;  3DMI A;  3A0B V;  1GKS A;  1N50 A;  3PLN A;  1I8O A;  1I8P A;  3CX5 D;  1N9C A;  1I6E A;  2B10 B;  3HQ7 A;  3PXW A;  3OA8 B;  2Y0E A;  5TJH A;  2QJY B;  1YTC A;  3GW6 A;  1K3G A;  1GJQ A;  1AOF A;  4AAM A;  2C8S A;  2BGV X;  1FI3 A;  5H2F V;  5DJQ B;  3VMA A;  1CRY A;  1LC1 A;  2N9I A;  5B5E V;  2C1D A;  4RSZ A;  3TF5 A;  4H0K A;  2FWL A;  1F1C A;  1CSV A;  3KHU A;  1H32 A;  3H1K D;  1GDV A;  3ORV A;  2YIU B;  1NMI A;  3SVW A;  3L71 D;  1DIQ C;  1E29 A;  1S5L V;  4XYD B;  1AKK A;  1H33 B;  1BCC D;  1CYC A;  3M97 X;  1FI7 A;  1HJ4 A;  2EXV A;  3SWS A;  2Q3E A;  2OZ1 B;  1YFC A;  2JTI B;  1YCC A;  4Y5R A;  1NTZ D;  4PWA A;  4WQD A;  5E79 V;  1CRC A;  5GTI V;  1CRJ A;  1WVE C;  1ZZH A;  1QYZ A;  1KX7 A;  2GC7 D;  1GQ1 A;  3KZI V;  1RAQ A;  1H33 A;  2C9X B;  2BLF B;  2V07 A;  1I6D A;  5DF5 A;  4AX3 A;  3CWB D;  1FCD C;  4DY9 A;  2N18 B;  4K3I A;  1YNR A;  1DII C;  3CX5 W;  2KS1 A;  3H1J D;  1KB0 A;  2ORL A;  1CIG A;  3A9F A;  4D6T D;  4WQ8 A;  4UB6 V;  1R0Q A;  2LIR A;  3VNW A;  1JDL A;  5CIH B;  4PD4 D;  1SQB D;  3ZBM A;  5B66 V;  3ZOW A;  2PCC B;  2XTS B;  4EIF A;  2VHD A;  5KLV D;  4EIC A;  1A56 A;  1H9Y A;  4JCG A;  1L0N D;  2DVH A;  1NIR A;  3DR0 A;  2JWA A;  1DVV A;  1SQV D;  4FA9 A;  5CIG B;  2ZXY A;  4WQ7 A;  3TGU D;  3VYM A;  3CU4 A;  1LS9 A;  4FA4 A;  2MHM A;  2B12 B;  2JQR A;  4NFG B;  5DFS A;  1CRG A;  1N90 A;  4V2K A;  4WQB A;  1ETP A;  1KYO D;  1CYJ A;  3NBS A;  1CIE A;  1A8C A;  1C52 A;  5C0Z A;  3L70 D;  2BCC D;  1L9B C;  2QG4 A;  1COR A;  1CC5 A;  3CXH W;  1RZ5 A;  1YEA A;  1CRH A;  2CA4 B;  4FA1 A;  3PTZ A;  2LIT A;  1FHB A;  3A0H V;  1BL9 A;  2QJP B;  3HQ8 A;  2QJK B;  3C2C A;  3CXH D;  4QAO A;  3WFB C;  3RN0 A;  3MK7 B;  1QL4 A;  2YQB A;  1H9X A;  4WQC A;  3X39 A;  4MU8 A;  1L9J C;  1C2N A;  4PJ0 V;  4EDF A;  1CRI A;  2B0Z B;  1CHJ A;  5AUR A;  1EZV D;  1NTM D;  2V08 A;  2D0W A;  1NML A;  4Q5P A;  3ZCF A;  5KLI B;  1IRV A;  3CP5 A;  1SQQ D;  3PHL A;  1MG2 D;  1DVH A;  2PCB B;  4AAL A;  3RLM A;  1HJ3 A;  1P84 D;  1SQX D;  1LC2 A;  4P4Q B;  1MG3 D;  3L75 D;  2B11 B;  1CCR A;  3GG2 A;  3TYI A;  2AXT V;  4FAV A;  1VYD A;  3H1I D;  1C2R A;  3RMZ A;  1A2S A;  1CXA A;  1E8E A;  1QL3 A;  1OCD A;  3TDK A;  3ZOO A;  5CID B;  3RN1 A;  1B7V A;  3O0R C;  3PXT A;  1PPJ D;  2C1D B;  4O1W A;  1CXC A;  5DJQ C;  3WC8 A;  2BH4 X;  1K3H A;  3WFD C;  4A7P A;  3ITK A;  2Y0C A;  4PW9 B;  2ZZS 1;  3SLE A;  4WQE A;  1U74 B;  1C75 A;  3O20 A;  451C A;  2BH5 X;  4L3G A;  1W5C T;  1GIW A;  3HQ6 A;  2OZ1 A;  1NNO A;  2AI5 A;  1CED A;  1HRO A;  3WU2 V;  4AAN A;  1HZU A;  155C A;  3SXT A;  3O1Y A;  5IY5 1;  1KX2 A;  3PH2 B;  2ZOO A;  1BE3 D;  1HRC A;  4U3F D;  3OCD B;  5KAF V;  3WUI A;  2I8F A;  3NBT A;  2GIW A;  2CXB A;  3DP5 A;  2ZON G;  2B4Z A;  1RAP A;  1QKS A;  3WFC C;  1I54 A;  1H31 A;  1FI9 A;  4O1Q A;  2BCN B;  2IBZ D;  2N18 C;  2FYN B;  3MK7 C;  1YEB A;  3L4M A;  3OCD A;  2MTA C;  1NTK D;  4UB8 V;  1KV9 A;  4J20 A;  5C9M A;  2RMZ A;  3H1L D;  3BCC D;  2D0S A;  3WFE C;  1DW3 A;  4RJT A;  1M60 A;  1DW2 A;  1DW1 A;  2L4D A;  3H1H D;  1NU1 D;  2BPB B;  1E2R A;  5TIS V;  1CO6 A;  1ZRT D;  1BGY D;  3NWV A;  4LJI A;  1CSU A;  2N3B A;  2N3Y A;  4FA5 A;  1CSX A;  3L72 D;  4KMG A;  1PP9 D;  3OA8 A;  3L74 D;  2FYU D;  1LFM A;  4H0J A;  5CIB B;  4WQA A;  2A06 D;  3VRD A;  1C6O A;  2N9J A;  4IL6 V;  2C2C A;  1RZ6 A;  1EB7 A;  3O5C A;  1QN2 A;  2C1V A;  2ZBO A;  1WEJ F;  1DT1 A;  1IZL 0;  1HH7 A;  1KB9 D;  4FB1 A;  2CE1 A;  5EXQ A;  1S6V B;  5KAI V;  5CIC B;  1N15 A;  3CYT I;  1OAE A;  3ZIY A;  5CIF B;  3HQ9 A;  1FJ0 A;  1HCM A;  4AAO A;  1M70 A;  2RN0 A;  2N9Y B;  1DW0 A;  2CE0 A;  4FAN A;  1H31 B;  3L73 D;  4N0K A;  1H1O A;  1CSW A;  5CIE B;  1SQP D;  2L91 A;  1AOQ A;  1YIQ A;  1H32 B;  1I55 A;  4GED B;  1CYI A;  2GC4 D;  1C7M A;  2C1U A;  5CYT R;  3SJL A;  2YCC A;  5GTH V;  2KNC B;  1CTZ A;  1C6R A;  4EIE A;  1W2L A; 
#chains in the Genus database with same CATH topology
 1L0L D;  4EID A;  3H1L J;  1IK9 A;  3AE1 C;  4ZKU A;  4L1Q A;  2HV4 A;  3ZOY A;  1X79 B;  2K9J B;  4WY4 B;  1HWT C;  3C8V A;  2O3J A;  4IFF A;  5DJU B;  1FDM A;  2YXR B;  1CTY A;  4K35 A;  4IL6 E;  2OTK E;  4GIF A;  3FWL A;  3TGU E;  1KZU B;  5KKZ B;  2HOD B;  2DW3 A;  5AVS B;  1I5T A;  3PXS A;  4D6T E;  1HH0 A;  4I1L A;  5KAI E;  4GKG A;  1J3S A;  2IYP A;  1XTC C;  4PD4 E;  3VP9 A;  2R3S A;  3CC4 P;  4Y99 C;  1L0L J;  2Z5H A;  1PPJ G;  3A0B V;  1GKS A;  3GMA A;  2M3B A;  4L73 A;  3PLN A;  1I8P A;  3CX5 D;  3AED C;  1LTA C;  1MFT A;  2B10 B;  2KZJ A;  1YTC A;  4H13 C;  1M1K Q;  4I7Z C;  1FI3 A;  1SQX J;  1DEE G;  3TF5 A;  1S5L E;  3VOP A;  1H32 A;  1GDV A;  1HVV A;  2YIU B;  3SVW A;  1W5C E;  3L70 E;  2HG5 D;  1S5L V;  4XYD B;  1BSN A;  1PGJ A;  2A06 E;  1BCC D;  3M97 X;  3NXS A;  3Q1M A;  5K5G B;  1LTB C;  1QL2 A;  1LP1 B;  1SQB G;  1YYC A;  5E79 V;  2OYH C;  5AVV B;  1PGQ A;  1NH4 A;  3PH0 A;  1NTK G;  1GQ1 A;  3KZI V;  2QM8 A;  2FYU J;  2Q3I A;  2C9X B;  2E76 D;  1FZA A;  3BCC G;  3VN0 A;  4AX3 A;  3H1L G;  4OWF A;  4K3I A;  1SP4 A;  2ITA A;  5BU8 B;  5KAI H;  1GW4 A;  4LC1 A;  1RH5 B;  1JCD A;  2K9J A;  4M3L A;  2KB7 P;  1ZME C;  2GM4 A;  1JDL A;  2AEJ A;  3AE8 C;  1VQ7 P;  3CME P;  3ZBM A;  3ZOW A;  2KLV A;  1FZG A;  1BE3 E;  3FXE A;  5CJ0 A;  4EIF A;  2KS1 B;  2A45 I;  1J1D B;  1LTJ B;  1RE4 C;  1NIR A;  1BSH A;  3EFG A;  1DIP A;  1JUN A;  2FXO A;  1FZC A;  2ZXY A;  3VYM A;  2W90 A;  1LS9 A;  4FA4 A;  1VQ6 P;  1QLE D;  1N7S D;  1N90 A;  4WQB A;  4H13 B;  2O01 J;  3M0A A;  1ETP A;  1KYO D;  3RGU A;  1JEK A;  3NBS A;  3H1J G;  1T2K C;  1C52 A;  2WSE H;  2BCC D;  2QG4 A;  3HD7 D;  2JO1 A;  4H0L C;  1SQP G;  1XTG B;  3SSU A;  1S9K D;  1DX7 A;  1RZ5 A;  4U3F E;  1YEA A;  2E74 D;  1SQP J;  3PTZ A;  3A0H V;  2W27 A;  1KN7 A;  5CCG A;  5APV A;  2D2C D;  2VRS A;  5APS A;  3WFB C;  1BCC J;  1NTK J;  2H8P D;  2ZJS E;  4WQC A;  5GTI H;  5AVW B;  1S3J A;  3B5N D;  2HLO A;  4YPC A;  3HUS C;  1CRI A;  1CHJ A;  2V08 A;  3KPE A;  1NML A;  5KLI B;  3RK3 D;  1GD2 E;  1H89 A;  5L8R J;  2JR8 A;  3D71 A;  3TK1 A;  2PCB B;  2QIW A;  1GL2 A;  4AAL A;  1QGK B;  3II6 A;  1SQX D;  1P84 D;  1NKN A;  2WZ7 A;  3B5N B;  3S4R A;  3GG2 A;  5CMZ A;  1KIL D;  4FAV A;  1X22 A;  3F5H A;  1OXZ A;  1YBK A;  1KYO I;  4EYY Q;  3RMZ A;  2OQQ A;  1A2S A;  1IK7 A;  3G6E P;  3P8M C;  1E8E A;  2NPS B;  1NWQ A;  3RN1 A;  4R4L A;  1FZC C;  3O0R C;  4O1W A;  1PPJ D;  2C1D B;  2BH4 X;  1G1I A;  2M5A A;  3ITK A;  3SLE A;  2O01 N;  3BAT A;  4D6T J;  1IFN A;  1RF0 A;  1U74 B;  1LNQ A;  3CXH I;  3HQ6 A;  2N9B A;  3T97 B;  2AI5 A;  1CED A;  1EXI A;  3WU2 V;  3H1K G;  5APY A;  3IF4 A;  3USS A;  1HJ0 A;  3SXT A;  1QVF O;  4TLF A;  1KX2 A;  3PH2 B;  2XU6 A;  4N3Y B;  1JTH A;  4R4M A;  2ZOO A;  3V4Q A;  3CPW O;  1EXJ A;  1X8Y A;  1SQP K;  1BCC G;  4H0L B;  1H88 A;  3U1C A;  1M57 D;  1NHL A;  4KHX A;  1H31 A;  1FI9 A;  4O1Q A;  2N18 C;  3L70 J;  1JM0 A;  1YEB A;  3L4M A;  2PFX A;  2XZR A;  1T2K D;  2MTA C;  1NTK D;  5KLI C;  4UB8 H;  5C9M A;  4GDO A;  2V4H A;  3WFE C;  2HYN A;  1LP1 A;  2FFD A;  2YMK A;  3SFE C;  2Q9I A;  1DW2 A;  2KIK A;  3H1H E;  1DW1 A;  2D2C C;  1NVO A;  1CO6 A;  1ZRT D;  1N7S B;  3NWV A;  2OYI B;  1R5L A;  1VQO P;  4FA5 A;  1CSX A;  1KB9 E;  3H1I E;  1G2C A;  3JSV C;  3L74 D;  3L71 E;  1SFC B;  1PZQ A;  1K05 A;  5KLV G;  3FXD A;  1N73 C;  2C2C A;  2K3R A;  3S1K A;  3CX5 I;  1QN2 A;  2ZBO A;  1HH7 A;  4PD4 I;  1KB9 D;  2NRG A;  3HE4 B;  1S72 P;  3D6Y A;  2HFE D;  1M7L A;  1N15 A;  3S9O A;  3D6Z A;  5CIF B;  1NU1 G;  3L72 E;  5KJ7 C;  3SWY A;  3RK2 B;  5CCH D;  1BGY G;  3V6I A;  3ZDM A;  5CIE B;  1SQP D;  2R32 A;  2POH A;  1H32 B;  2ZT9 C;  2BEZ F;  2WMM A;  2C0X A;  1FE6 A;  1KIL C;  2A06 G;  4GOF A;  5GTH V;  3CCU P;  2QA4 P;  1CTZ A;  3MUD C;  1C6R A;  4EIE A;  3AE4 C;  1VQK P;  4EI2 A;  1CCH A;  2FFD C;  4Y28 J;  1KYO W;  2FRC A;  2HPC A;  2GB8 B;  5CBN A;  3CCR P;  1CHI A;  1KQF B;  1FJP A;  1HJ5 A;  1YIT P;  2J58 A;  1QVG O;  1HZV A;  1G2C B;  2O1K A;  3M06 A;  2L5G B;  1AYG A;  2MKV A;  1KIB A;  4WQ9 A;  1OW8 A;  3PRJ A;  2G8Y A;  1IO4 A;  3CX5 H;  3L36 A;  3RL0 D;  1VF5 C;  2WSS H;  2YNY A;  1IO3 A;  1SFC A;  3LIE A;  1M6Z A;  1CIH A;  5B6Q A;  1CIF A;  2Y0D A;  1J1E B;  5KAF H;  2FFD B;  1C6S A;  1IRW A;  5AW5 B;  2PAC A;  1GU2 A;  1VQ8 P;  2N1T C;  2YO3 A;  1KQL A;  1AA0 A;  3L4F A;  4L75 A;  2IZ0 A;  3HD7 A;  1FAV A;  3HQ7 A;  3PXW A;  4PJ0 H;  1Q81 Q;  2Y0E A;  4OH8 B;  3CCL P;  4YXD C;  1KC8 Q;  2BGV X;  1NOH A;  2KUB A;  1YJW P;  1CRY A;  2C1D A;  3IR9 A;  4RSZ A;  5B5E H;  3OJA B;  2FWL A;  3KHU A;  3H1K D;  1PGO A;  1USD A;  3A2A A;  3O6Q A;  5EFW B;  4LGD E;  1E29 A;  3MTU E;  1H33 B;  2E74 C;  1T3J A;  4U3F G;  2EXV A;  2Q3E A;  2OZ1 B;  1YFC A;  3V2N A;  4Y5R A;  4PWA A;  4WQD A;  5AW9 B;  1LTI C;  4Z1M H;  1JY3 P;  1NTK K;  4IL6 H;  4ZKP A;  1CRC A;  2NPS C;  3AEC C;  1ZZH A;  2I8D A;  2IBZ I;  3TNU A;  2GC7 D;  2IFM A;  1JY2 N;  2WSE J;  4UB8 E;  1N7S C;  1JCC A;  1EZV E;  4H44 D;  5DF5 A;  3AEF C;  3CWB D;  1YNR A;  1H8A A;  5CCG C;  1DII C;  1SQV E;  3M9H A;  3CD6 P;  2K1A A;  2ORL A;  1IFI A;  4D6T D;  1VQP P;  3N4X A;  2LIR A;  1FS0 E;  2G3A A;  3VNW A;  1U7M A;  2PP6 A;  4PD4 D;  1YTZ I;  3GHG B;  3HD7 C;  1L4A D;  5B66 V;  4DZO A;  3A0B H;  2WSF J;  1KYO H;  2XTS B;  1NAF A;  5AW1 B;  1PIX A;  2Y9Z A;  4JCG A;  1HGV A;  1L0N D;  3VP8 A;  3CXH E;  2H88 C;  3RK3 E;  1DVV A;  1VQ5 P;  2JWD A;  5CIG B;  2Z5I A;  2NZ2 A;  3B4S A;  2WT7 A;  3TGU D;  1N2D C;  2SPZ A;  1KQG B;  3NFQ A;  3O8Z A;  4NFG B;  5DFS A;  1CRG A;  4V2K A;  2QVA A;  1CYJ A;  1VF5 B;  3KDP B;  2LXB A;  2YO2 A;  1CIE A;  5C0Z A;  3L70 D;  1R8E A;  1SQB E;  1L0N E;  1L9B C;  1ZR2 A;  1MFZ A;  1SQX G;  3Q5R A;  1CRH A;  2CA4 B;  2V7Q H;  2QJP B;  3BCC J;  1VF5 D;  3LID A;  1BGY E;  3RN0 A;  3M0D A;  3GF3 A;  1SQQ E;  1H9X A;  1SQQ K;  3AEB C;  3H1I J;  1NU1 K;  2OYO A;  1P84 E;  5CJ4 A;  1LTT C;  2E75 C;  2I1J A;  1C2N A;  2M3E A;  1OIP A;  1RF1 C;  1KQS O;  3B5N C;  2WVR A;  1NTM D;  4YXW H;  3A5T A;  4Q5P A;  3ZCF A;  1FZB A;  1SVF A;  4DJG A;  2QRX A;  3CP5 A;  1SQB K;  1SQQ D;  1KD1 Q;  3PHL A;  1W2B O;  1MG2 D;  1OX3 A;  1T6A A;  3IAO A;  2WPS A;  1IFJ A;  1HJ3 A;  4U7J A;  4EIJ A;  4P4Q B;  3P8C E;  1KV4 A;  4JQ0 D;  4DOJ A;  1PV3 A;  2B11 B;  3BAS A;  1CCR A;  1DEB A;  1HGZ A;  1KIL E;  3RBX A;  1VYD A;  1AQ5 A;  1NTM K;  2WPQ A;  4NPE A;  3HUS B;  1CXA A;  3RK3 B;  1JB0 J;  1CW5 A;  1DD3 A;  2QEX P;  3PXT A;  1SFC D;  1CXC A;  2C0W A;  3RL0 g;  1TU3 F;  4I2L C;  2QJK C;  3CC7 P;  1LWU A;  3G3Z A;  3VMX A;  2ZZS 1;  3BRV B;  4WQE A;  2H43 A;  1C75 A;  3O20 A;  2Q5U A;  451C A;  1W5C T;  3JCU H;  1VQM P;  2W83 C;  4PV1 D;  1VQ4 P;  2BCC E;  1FJK A;  5IY5 1;  1NAY A;  1MKM A;  2R44 A;  3AE5 C;  4XA4 A;  4JPZ B;  1RQU A;  3HD7 B;  1BE3 D;  3LW5 H;  2FYU E;  1JY2 P;  1N73 A;  2CPS A;  3WUV A;  1FZE A;  2E76 B;  4DT0 A;  2B89 A;  3DP5 A;  3H1J J;  3I56 P;  1QKS A;  2B88 A;  4WY4 A;  2WSC J;  5BVZ A;  2BCN B;  5KJ7 A;  1ZRT E;  3NMD A;  1JNM A;  4XFJ A;  3F89 A;  4BWN A;  2J59 M;  1Q86 Q;  1RQV A;  4OVN F;  3AEE C;  4J20 A;  3H1L D;  2AEM A;  3AEG C;  3EFF K;  1UIX A;  2D0S A;  4HJG H;  1EDL A;  1Y8A A;  4I7Z B;  1G1J A;  1M60 A;  3R4Y A;  2KOG A;  1LWU B;  3L37 A;  1T3U A;  2PAJ A;  3MUD A;  1L4A C;  1BGY D;  3RL0 B;  1VDF A;  4CPG A;  1KB9 H;  3MZW B;  1EDK A;  4KMG A;  3D0W A;  1PP9 D;  3OA8 A;  3FWN A;  3L73 J;  1LFM A;  1EC5 A;  2RH0 A;  3VRD A;  4JBZ A;  2Q6Q A;  3T97 A;  3V2P A;  3KZI H;  1ZN5 A;  2LXC B;  2C1V A;  1M56 D;  5C39 A;  1IZL 0;  4FB1 A;  2H7H A;  2CE1 A;  1PP9 E;  2QJY C;  4BXL A;  5AW4 B;  1DD4 A;  3CXH H;  5KAI V;  5CIC B;  1OAE A;  3ZIY A;  3MIW A;  4O9B A;  3HQ9 A;  2N1T A;  1HCM A;  2IZ1 A;  5B66 E;  3G4S P;  2RN0 A;  3SWF A;  1NJI Q;  3AE9 C;  1P84 I;  3TYY A;  4FAN A;  2ZXX A;  2ZYA A;  4UB6 H;  1H31 B;  3L73 D;  1JY3 O;  1H1O A;  3A0B E;  1N7L A;  1KB9 I;  4ASV A;  5M1B A;  3RK2 D;  1AV1 A;  3L72 G;  2KYV A;  1I55 A;  1NU1 E;  1GDT A;  4GED B;  1S2E A;  1SQX K;  3L74 G;  4ZMD A;  1HTL C;  2KNC B;  4N78 E;  1GL2 B;  2WSF H;  2YK3 A;  1JOC A;  5AW3 B;  1A02 J;  5KLV E;  1FOC A;  5GTI E;  1L4A A;  3ZOX A;  1YQ3 C;  1NTZ E;  2ZT9 B;  4AUW A;  4YE1 A;  1T8Z A;  4H13 D;  3V2Q A;  1COT A;  2CPB A;  1M1J C;  2ZAE B;  5BU5 A;  4WBA A;  3HRN A;  5E79 E;  4HB1 A;  4L3H A;  2DGE A;  1F1F A;  1KOR A;  3CCS P;  1EZV I;  1GTW A;  1AVY A;  2LR2 A;  3V4W A;  3H1I G;  1LT9 B;  3DMI A;  1H0T A;  2I1K A;  2P1J A;  1LTS C;  1NYH A;  2W6A A;  1QX8 A;  1N9C A;  1NKZ B;  5TJH A;  2QJY B;  4HKZ H;  3GW6 A;  2K88 A;  2N1T B;  4AAM A;  5H2F E;  1ZR4 A;  2C8S A;  2PRR A;  3AE2 C;  5DJQ B;  2P7J A;  1GU4 A;  2IPP A;  3VMA A;  1LC1 A;  2N9I A;  1OVU A;  2IDB A;  1J1E C;  1WRG A;  3CLQ A;  3ORV A;  3H6P A;  1N86 A;  1NMI A;  5TIS H;  3CCM P;  3L71 D;  3L74 E;  1Y47 A;  4KJM A;  1DIQ C;  1K8A Q;  2JJL A;  1E5W A;  4JF7 A;  1S5L H;  5APX A;  1YQ4 C;  1PL5 A;  1CYC A;  1FI7 A;  5AW0 B;  5GTH E;  2M0B A;  2YXQ B;  1YCC A;  1ZP0 C;  1NTZ D;  1Y9B A;  1URQ C;  3G9R A;  1IZN B;  5CCG D;  2FKW B;  1K04 A;  1WVE C;  1QYZ A;  1L0N G;  1KX7 A;  1OFC X;  1YJN P;  4RO0 A;  1RAQ A;  1H33 A;  1GK4 A;  1M1J A;  1FBM A;  4PD4 H;  3EWK A;  4WY4 D;  1LT9 A;  3A7O A;  2V07 A;  1I6D A;  1KMI Z;  1AFO A;  3KXD A;  4I6M C;  1FCD C;  1VQL P;  4K3A A;  1J2J B;  1SQP E;  2E76 C;  5AVU B;  3A3Y B;  2KS1 A;  1PGP A;  3H1J E;  1NO4 A;  1CIG A;  2B9B A;  4WQ8 A;  1JMB A;  3IFM A;  1GL2 D;  4NPF X;  3SWK A;  1ZV8 A;  1ZXG A;  5TIS E;  3L72 J;  1E79 H;  2BCC J;  1KIL A;  1RE4 A;  3LW5 J;  3E1I A;  4PV1 C;  1YHQ P;  1PPJ E;  2VHD A;  1KFM A;  2P58 A;  1Q82 Q;  2JDI H;  2DVH A;  1Z56 A;  3H25 A;  3Q5P A;  1S1C X;  2JWA A;  2FY8 A;  2OTJ P;  4FA9 A;  5AVY B;  1M8O B;  2QSI A;  3GHG A;  3TGU J;  4WQ7 A;  3CU4 A;  3O6Q B;  4KT0 J;  2B12 B;  2JQR A;  1EZV G;  1NTM G;  2JP3 A;  3WU2 H;  1A8C A;  2E74 B;  2WQY C;  4PV1 B;  3CXH W;  1LWU C;  3L73 G;  2HPC B;  2YMY A;  2BAS A;  3B8E B;  1HJB A;  1FHB A;  3VYI A;  1BL9 A;  1JY2 O;  4W7Z A;  3CXH D;  2OGU A;  3WUU A;  4H0L D;  1OVV A;  2HOD A;  1NGM B;  4MU8 A;  2E43 A;  1YIJ P;  1L9J C;  1L0L G;  2K37 A;  2R3C A;  4EDF A;  1OWA A;  2B0Z B;  1N73 B;  5H2F H;  3V2R A;  2E42 A;  3CI9 A;  2D0W A;  1VQN P;  4C7N A;  4Y99 B;  3L70 G;  1DVH A;  2RKL A;  3JCU E;  3P32 A;  1LC2 A;  1MG3 D;  1BE3 G;  3CC2 P;  2AXT V;  1GL2 C;  1JMM A;  1BDC A;  1URQ D;  5B66 H;  1C2R A;  3H1L E;  1QL3 A;  1USE A;  1OCD A;  1M1J B;  5E79 H;  5APW A;  1IJD B;  3GHG C;  3H32 A;  4L76 A;  5DJQ C;  1HBW A;  2XKM A;  3QH9 A;  1RF0 C;  5GTH H;  4A7P A;  2Y0C A;  3L74 J;  3CWB E;  1KIL B;  4PW9 B;  1FDO A;  4DCK A;  2KXP B;  1N7S A;  4L3G A;  4GT1 A;  1HRO A;  1Q2N A;  2KZI A;  3P8C D;  1SQQ G;  1NTK E;  4AAN A;  1HZU A;  3K5B A;  3O1Y A;  5AVR B;  3L71 J;  1DH3 A;  4OGQ C;  2OAR A;  1LJ2 A;  4U3F D;  3RK2 C;  5KAF V;  2YKP A;  4XE5 B;  3NBT A;  3B71 A;  3UIA A;  4IOI H;  3CCQ P;  2ZON G;  1KTM A;  2ZFC A;  2XND H;  3WFC C;  3HE5 A;  2WPV B;  3R2P A;  3U1A A;  2FYU G;  1I54 A;  2GA1 A;  3FX0 A;  2HR3 A;  3M9Q A;  2FYN B;  3MK7 C;  5KJ7 D;  2WSC H;  4UB8 V;  4AQR D;  1L2P A;  4B86 A;  5APU A;  2Y9Y A;  1NTM E;  3W67 A;  3BCC D;  3KZI E;  3PP5 A;  3L73 E;  1DW3 A;  4U3F J;  2XDJ A;  4RJT A;  3QWO C;  1AQT A;  2L4D A;  3H1H D;  1ZLL A;  2Z4E A;  3E1R A;  3W68 A;  2C9L Y;  4D6T G;  3TNU B;  1BGY J;  4LJI A;  1CSU A;  2N3B A;  3L72 D;  3A0H E;  4JYC A;  3M0D C;  3GLM A;  1IFD A;  1OW6 A;  1RHZ B;  4WQA A;  3KYQ A;  3V5B A;  1C6O A;  5AVX B;  2OYH A;  3WUT A;  4IL6 V;  1RZ6 A;  1EB7 A;  3CMA P;  3E7K A;  4LLH A;  5B5E E;  2O1J A;  1N8R Q;  4GOD A;  3HTK A;  4H44 C;  1WMK A;  2WWW A;  2ZXE B;  5AW7 B;  1L0N K;  2N1T D;  2N9Y B;  1DW0 A;  2CE0 A;  2B87 B;  3MP7 B;  4N0K A;  3EQ2 A;  3MD0 A;  4L74 A;  1CSW A;  2MJZ A;  1EDJ A;  1QEX A;  1IC2 A;  2GC4 D;  1C7M A;  2C1U A;  2FYU K;  5CYT R;  3RL0 C;  3HTK B;  2FYZ A;  2ZT9 D;  2FYN C;  2A45 G;  4WWI A;  1IFM A;  4IL6 X;  1FOS F;  4QMA A;  1AVO A;  5AW8 B;  1W2L A;  2AIU A;  1LMS A;  3C9I A;  1CHH A;  3H32 B;  2UWJ E;  3OA7 A;  1U75 B;  4RES B;  3H1K E;  4XXL A;  4TT3 H;  2CA3 B;  1IQC A;  5CBO A;  1LT1 A;  1MZ4 A;  2JEE A;  351C A;  3I55 P;  4GYD A;  2A45 H;  3BVH A;  1YIC A;  4OGQ B;  3L4O A;  1PFI A;  1HUC A;  5AVQ B;  2GUV A;  1CTJ A;  3L75 G;  1SQV K;  3JBT B;  2E5T A;  3CCE P;  1CNO A;  1NTZ K;  1Q7Y Q;  1FDI A;  3H1K J;  1VL2 A;  4N78 D;  5KLV K;  4OGQ D;  1L0N J;  5CHX A;  3G71 P;  3VTP C;  2PGD A;  5APT A;  1NU1 J;  1N50 A;  1I8O A;  1X9V A;  3GF7 A;  1I6E A;  2ZYG A;  3CCV P;  3OA8 B;  2W6J H;  1K3G A;  1RE3 C;  1GJQ A;  1AOF A;  1FOS E;  2AXT E;  1CI6 B;  5H2F V;  5KTB A;  5B5E V;  5CCH A;  4H0K A;  1F1C A;  1CSV A;  1U7J A;  3WU2 E;  1U57 A;  2W8Z A;  1UII A;  1FZC B;  1GMJ A;  2QJP C;  1WT6 A;  2NPS D;  2O01 H;  3KQG A;  3I5C A;  1AKK A;  2WIT A;  1LTJ A;  4JYB A;  2AXT H;  1HJ4 A;  3SWS A;  3CCJ P;  3A0H H;  3D70 A;  2JTI B;  1IFP A;  1QL1 A;  5APQ A;  1GZL A;  5DJT B;  2C9N Y;  1ZW0 A;  2IBZ G;  1RF1 B;  5GTI V;  1CRJ A;  2KSJ A;  1K9M Q;  1KFN A;  1LTG C;  4NPD A;  2XV5 A;  5KAF E;  2BLF B;  1FC2 C;  1OVR A;  1OMI A;  4IFM A;  4IFD K;  1GW3 A;  4DY9 A;  2YKO A;  3BRT B;  2N18 B;  3CX5 W;  1FZF A;  2P10 A;  1M90 Q;  1HF9 A;  3H1H G;  3L71 G;  3H1J D;  4BRY B;  1GK6 A;  3CX5 E;  1KB0 A;  3A9F A;  3PJS K;  2YIU C;  4UB6 V;  1R0Q A;  1SQQ J;  3HE4 A;  5CIH B;  1PP9 G;  1SQB D;  2IX7 C;  1NTZ G;  4UB6 E;  2PCC B;  1S9K E;  1S4X A;  2QE7 H;  2E5Y A;  2J5U A;  5KLV D;  4EIC A;  1A56 A;  1H9Y A;  3U59 A;  1CI6 A;  3WMM 0;  3DR0 A;  5CCH C;  2XNX A;  2V7Q J;  1SQV D;  2AXC A;  2FBW C;  1BCC E;  1CZQ A;  3MGN A;  5AVZ B;  2MHM A;  2P2U A;  1LTJ C;  2KI7 B;  2ZVN B;  1BE3 J;  3C1L A;  4EOT A;  1SLQ A;  1SS1 A;  1YJ9 P;  1COR A;  2M5A B;  1CC5 A;  1MV8 A;  4FA1 A;  2LIT A;  2K9Y A;  3HQ8 A;  1SQX E;  2QJK B;  3C2C A;  1KYO E;  4QAO A;  4BRY A;  3MK7 B;  1QL4 A;  2YQB A;  4C7N B;  2GUS A;  3X39 A;  1X0T A;  2KP8 A;  3B5N A;  3VMZ A;  4PJ0 V;  2KSE A;  1RY3 A;  1JY3 N;  5AUR A;  1L0L K;  1EZV D;  1RF1 A;  1LGH B;  4WB4 A;  1IRV A;  2FXM A;  2BCC G;  2E75 D;  3RBZ A;  3CWB J;  3RLM A;  1PP9 J;  3L75 D;  3TYI A;  3Q3D A;  3H1I D;  1OZH A;  5KLV J;  1URQ A;  3ABV C;  3M91 A;  3TDK A;  3ZOO A;  5CID B;  1EDI A;  1B7V A;  1YTZ T;  3WC8 A;  1SQV J;  4RKU J;  4GOE A;  1K3H A;  3WFD C;  1SQB J;  1GU5 A;  4WVZ A;  1P84 H;  2WTY A;  3SFD C;  3NTN A;  1J1D C;  3N7N A;  1LT9 C;  1JTH B;  2H89 C;  2BH5 X;  2P67 A;  1MZ9 A;  1GIW A;  2OZ1 A;  2E75 B;  1NNO A;  2OYI A;  2WPR A;  3L75 E;  1H0T B;  3Q5S A;  155C A;  1D7M A;  2W6B A;  1S5L X;  3VMY A;  1JO5 A;  4ZNC A;  3AE6 C;  3HUS A;  2IBZ E;  4HYT B;  2QM7 A;  1Q90 D;  1HRC A;  2M8R A;  1SFC C;  3OCD B;  3WUI A;  2AEF A;  2I8F A;  5AW2 B;  3Q2Y A;  2GIW A;  2CXB A;  2KK7 A;  2Q7C A;  2B4Z A;  1RAP A;  3P7K A;  3M9B A;  2WT7 B;  1L4A B;  2OTL P;  2KLU A;  3RK3 C;  4N6J A;  1ZOY C;  2R5B A;  2IBZ D;  3AE3 C;  2R5D A;  1EQ7 A;  2IYO A;  4YTP C;  4WY4 C;  3OCD A;  2ZVO B;  1KV9 A;  2BEQ D;  2RMZ A;  1MUU A;  3CWB G;  1BDD A;  2Q1K A;  4C7R A;  1W2E A;  1YI2 P;  1NU1 D;  2BPB B;  1E2R A;  5AVT B;  5TIS V;  2OYH B;  1FU1 A;  2N3Y A;  2FXP A;  4AYC A;  1VQ9 P;  3AE7 C;  2D2C B;  2FYU D;  3CL3 D;  4PJ0 E;  4W80 A;  4H0J A;  5CIB B;  4HH2 A;  2A06 D;  2OYI C;  2N9J A;  1VPC A;  3AEA C;  1URQ B;  3O5C A;  3BCC E;  2NPS A;  2B87 A;  3IN6 A;  2JKV A;  3JC2 2;  1WEJ F;  1DT1 A;  1SQV G;  3MHV A;  2IFN A;  1CSB A;  4ASW A;  3TGU G;  1L0L E;  5EXQ A;  3OAK A;  1S6V B;  2ZYD A;  3FGA D;  3CYT I;  1FJ0 A;  4AAO A;  1AJY A;  1M70 A;  2KNC A;  2LKM A;  1K73 Q;  3HE5 B;  1NTM J;  5AW6 B;  1NTZ J;  4H44 B;  2L91 A;  1AOQ A;  3L35 A;  1YIQ A;  3TSI A;  1CYI A;  1RE3 A;  2CK3 H;  3OW2 O;  2YKQ A;  1OW7 A;  3SJL A;  5KKZ C;  1A02 F;  1R5S A;  2YCC A;  3L75 J;  4MN4 C;  3H1H J;  4W7Y A;  4C46 A; 
#chains in the Genus database with same CATH homology
 2YK3 A;  1CCH A;  1L0L D;  2AIU A;  4EID A;  1LMS A;  1KYO W;  1CHH A;  2FRC A;  1U75 B;  2GB8 B;  4L1Q A;  4XXL A;  1FOC A;  2CA3 B;  1CHI A;  1IQC A;  2HV4 A;  3ZOY A;  2K9J B;  3ZOX A;  1HJ5 A;  1MZ4 A;  2O3J A;  351C A;  4GYD A;  1YIC A;  1HZV A;  4YE1 A;  1CTY A;  3L4O A;  1AYG A;  1COT A;  1KIB A;  4WQ9 A;  3FWL A;  3PRJ A;  1CTJ A;  5KKZ B;  1I5T A;  1IO3 A;  3PXS A;  3JBT B;  1M6Z A;  1CIH A;  5B6Q A;  4L3H A;  1CNO A;  1CIF A;  2DGE A;  2Y0D A;  1F1F A;  1J3S A;  1C6S A;  1IRW A;  2PAC A;  1GU2 A;  3DMI A;  3A0B V;  1GKS A;  1N50 A;  3PLN A;  1I8O A;  1I8P A;  3CX5 D;  1N9C A;  1I6E A;  2B10 B;  3HQ7 A;  3PXW A;  3OA8 B;  2Y0E A;  5TJH A;  2QJY B;  1YTC A;  3GW6 A;  1K3G A;  1GJQ A;  1AOF A;  4AAM A;  2C8S A;  2BGV X;  1FI3 A;  5H2F V;  5DJQ B;  3VMA A;  1CRY A;  1LC1 A;  2N9I A;  5B5E V;  2C1D A;  4RSZ A;  3TF5 A;  4H0K A;  2FWL A;  1F1C A;  1CSV A;  3KHU A;  1H32 A;  3H1K D;  1GDV A;  3ORV A;  2YIU B;  1NMI A;  3SVW A;  3L71 D;  1DIQ C;  1E29 A;  1S5L V;  4XYD B;  1AKK A;  1H33 B;  1BCC D;  1CYC A;  3M97 X;  1FI7 A;  1HJ4 A;  2EXV A;  3SWS A;  2Q3E A;  2OZ1 B;  1YFC A;  2JTI B;  1YCC A;  4Y5R A;  1NTZ D;  4PWA A;  4WQD A;  5E79 V;  1CRC A;  5GTI V;  1CRJ A;  1WVE C;  1ZZH A;  1QYZ A;  1KX7 A;  2GC7 D;  1GQ1 A;  3KZI V;  1RAQ A;  1H33 A;  2C9X B;  2BLF B;  2V07 A;  1I6D A;  5DF5 A;  4AX3 A;  3CWB D;  1FCD C;  4DY9 A;  2N18 B;  4K3I A;  1YNR A;  1DII C;  3CX5 W;  2KS1 A;  3H1J D;  1KB0 A;  2ORL A;  1CIG A;  3A9F A;  4D6T D;  4WQ8 A;  4UB6 V;  1R0Q A;  2LIR A;  3VNW A;  1JDL A;  5CIH B;  4PD4 D;  1SQB D;  3ZBM A;  5B66 V;  3ZOW A;  2PCC B;  2XTS B;  4EIF A;  2VHD A;  5KLV D;  4EIC A;  1A56 A;  1H9Y A;  4JCG A;  1L0N D;  2DVH A;  1NIR A;  3DR0 A;  2JWA A;  1DVV A;  1SQV D;  4FA9 A;  5CIG B;  2ZXY A;  4WQ7 A;  3TGU D;  3VYM A;  3CU4 A;  1LS9 A;  4FA4 A;  2MHM A;  2B12 B;  2JQR A;  4NFG B;  5DFS A;  1CRG A;  1N90 A;  4V2K A;  4WQB A;  1ETP A;  1KYO D;  1CYJ A;  3NBS A;  1CIE A;  1A8C A;  1C52 A;  5C0Z A;  3L70 D;  2BCC D;  1L9B C;  2QG4 A;  1COR A;  1CC5 A;  3CXH W;  1RZ5 A;  1YEA A;  1CRH A;  2CA4 B;  4FA1 A;  3PTZ A;  2LIT A;  1FHB A;  3A0H V;  1BL9 A;  2QJP B;  3HQ8 A;  2QJK B;  3C2C A;  3CXH D;  4QAO A;  3WFB C;  3RN0 A;  3MK7 B;  1QL4 A;  2YQB A;  1H9X A;  4WQC A;  3X39 A;  4MU8 A;  1L9J C;  1C2N A;  4PJ0 V;  4EDF A;  1CRI A;  2B0Z B;  1CHJ A;  5AUR A;  1EZV D;  1NTM D;  2V08 A;  2D0W A;  1NML A;  4Q5P A;  3ZCF A;  5KLI B;  1IRV A;  3CP5 A;  1SQQ D;  3PHL A;  1MG2 D;  1DVH A;  2PCB B;  4AAL A;  3RLM A;  1HJ3 A;  1P84 D;  1SQX D;  1LC2 A;  4P4Q B;  1MG3 D;  3L75 D;  2B11 B;  1CCR A;  3GG2 A;  3TYI A;  2AXT V;  4FAV A;  1VYD A;  3H1I D;  1C2R A;  3RMZ A;  1A2S A;  1CXA A;  1E8E A;  1QL3 A;  1OCD A;  3TDK A;  3ZOO A;  5CID B;  3RN1 A;  1B7V A;  3O0R C;  3PXT A;  1PPJ D;  2C1D B;  4O1W A;  1CXC A;  5DJQ C;  3WC8 A;  2BH4 X;  1K3H A;  3WFD C;  4A7P A;  3ITK A;  2Y0C A;  4PW9 B;  2ZZS 1;  3SLE A;  4WQE A;  1U74 B;  1C75 A;  3O20 A;  451C A;  2BH5 X;  4L3G A;  1W5C T;  1GIW A;  3HQ6 A;  2OZ1 A;  1NNO A;  2AI5 A;  1CED A;  1HRO A;  3WU2 V;  4AAN A;  1HZU A;  155C A;  3SXT A;  3O1Y A;  5IY5 1;  1KX2 A;  3PH2 B;  2ZOO A;  1BE3 D;  1HRC A;  4U3F D;  3OCD B;  5KAF V;  3WUI A;  2I8F A;  3NBT A;  2GIW A;  2CXB A;  3DP5 A;  2ZON G;  2B4Z A;  1RAP A;  1QKS A;  3WFC C;  1I54 A;  1H31 A;  1FI9 A;  4O1Q A;  2BCN B;  2IBZ D;  2N18 C;  2FYN B;  3MK7 C;  1YEB A;  3L4M A;  3OCD A;  2MTA C;  1NTK D;  4UB8 V;  1KV9 A;  4J20 A;  5C9M A;  2RMZ A;  3H1L D;  3BCC D;  2D0S A;  3WFE C;  1DW3 A;  4RJT A;  1M60 A;  1DW2 A;  1DW1 A;  2L4D A;  3H1H D;  1NU1 D;  2BPB B;  1E2R A;  5TIS V;  1CO6 A;  1ZRT D;  1BGY D;  3NWV A;  4LJI A;  1CSU A;  2N3B A;  2N3Y A;  4FA5 A;  1CSX A;  3L72 D;  4KMG A;  1PP9 D;  3OA8 A;  3L74 D;  2FYU D;  1LFM A;  4H0J A;  5CIB B;  4WQA A;  2A06 D;  3VRD A;  1C6O A;  2N9J A;  4IL6 V;  2C2C A;  1RZ6 A;  1EB7 A;  3O5C A;  1QN2 A;  2C1V A;  2ZBO A;  1WEJ F;  1DT1 A;  1IZL 0;  1HH7 A;  1KB9 D;  4FB1 A;  2CE1 A;  5EXQ A;  1S6V B;  5KAI V;  5CIC B;  1N15 A;  3CYT I;  1OAE A;  3ZIY A;  5CIF B;  3HQ9 A;  1FJ0 A;  1HCM A;  4AAO A;  1M70 A;  2RN0 A;  2N9Y B;  1DW0 A;  2CE0 A;  4FAN A;  1H31 B;  3L73 D;  4N0K A;  1H1O A;  1CSW A;  5CIE B;  1SQP D;  2L91 A;  1AOQ A;  1YIQ A;  1H32 B;  1I55 A;  4GED B;  1CYI A;  2GC4 D;  1C7M A;  2C1U A;  5CYT R;  3SJL A;  2YCC A;  5GTH V;  2KNC B;  1CTZ A;  1C6R A;  4EIE A;  1W2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...