1NU1D

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 52
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1nu1D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1nu1D01
1CTYA 5CIDB 2EXVA 2AIUA 2C1UA 1CHJA 3HQ8A 1HROA 1H33A 3ZOYA 3CYTI 1YCCA 4RJTA 1GIWA 5GTHV 1QYZA 1LC2A 3KHUA 2QJYB 1N50A 1NMLA 1E8EA 3PXSA 4XXLA 4GEDB 3MK7C 3WFCC 3WFEC 4A7PA 3L72D 1AKKA 3C2CA 3RN0A 1H31A 2YIUB 1IRVA 2L4DA 3ZCFA 1L9JC 1EB7A 1KIBA 3A0BV 2JWAA 4EICA 1CRYA 2BH5X 2YK3A 4Y5RA 1HZVA 4DY9A 3L70D 1CC5A 1GJQA 1H1OA 1CCHA 3TGUD 1KX7A 5CIBB 3RMZA 4KMGA 1C75A 4FA1A 5CIGB 1DIQC 4FA5A 2D0WA 4D6TD 1YFCA 1NMIA 4EIEA 2N9JA 4H0JA 5C9MA 1H31B 4GYDA 2JQRA 1R0QA 1MG3D 1MZ4A 1F1FA 155CA 1SQBD 2PCBB 5B5EV 1I6DA 1K3HA 2A06D 2I8FA 1QL4A 3PH2B 2C2CA 5CIEB 451CA 5GTIV 2B0ZB 1ZRTD 2BGVX 3SXTA 1KX2A 3PHLA 1I6EA 4FB1A 3WFDC 2CE1A 1I5TA 1FCDC 3L4OA 3OCDB 2N18C 1BGYD 1CIHA 5B6QA 1L0ND 2C1VA 1DT1A 2C1DB 4L3GA 1CNOA 2V07A 3PLNA 3NBTA 1SQQD 3H1JD 3VNWA 2QJPB 5KLIB 1N9CA 1CHIA 1EZVD 1C7MA 4P4QB 1YIQA 3ZBMA 3CWBD 1RZ5A 5C0ZA 3O5CA 2KNCB 4U3FD 5KAFV 3ITKA 3HQ9A 4IL6V 4WQ8A 1BCCD 1C2RA 3WC8A 1NTMD 5EXQA 4AAOA 1P84D 1CEDA 1HZUA 3O20A 3ZOOA 1I8OA 2RN0A 4QAOA 4MU8A 4FA4A 5CIFB 1AYGA 2YCCA 3MK7B 3WFBC 1RAQA 3L73D 2BLFB 4WQAA 1KYOW 4LJIA 4AANA 4UB6V 1C52A 4L3HA 1YEBA 3L75D 2BH4X 1NIRA 4WQCA 1OAEA 2RMZA 1W2LA 2CA4B 2C8SA 5DFSA 2BPBB 1LFMA 3CX5W 1WEJF 3DR0A 3SLEA 2IBZD 4PW9B 3FWLA 3CP5A 1CRHA 1GQ1A 3PXWA 1M6ZA 2GC4D 4WQEA 4FANA 2D0SA 3H1KD 2CE0A 1HH7A 1IO3A 1CHHA 3PXTA 1CRCA 2Y0DA 2B10B 3TDKA 4Q5PA 1FOCA 5DJQC 3SWSA 1KB0A 3NWVA 3HQ7A 2FYNB 1S6VB 2O3JA 1FI3A 3SVWA 1I54A 1OCDA 2N18B 4EDFA 2C9XB 4RSZA 1DIIC 4AALA 4NFGB 3OCDA 3OA8A 3WUIA 3GW6A 2FWLA 4FA9A 1NNOA 1YEAA 2C1DA 5TJHA 2FYUD 3WU2V 1U74B 2MTAC 1S5LV 5TISV 1CIEA 351CA 5B66V 1KB9D 1W5CT 1FHBA 1DW3A 1WVEC 5CICB 1DVHA 1QN2A 3X39A 3OA8B 3GG2A 2N9YB 1HRCA 1LS9A 1CXAA 3VMAA 2ZONG 1CYJA 3VRDA 1A56A 4PD4D 1SQPD 1JDLA 2VHDA 3A0HV 1L0LD 3L71D 1SQVD 4O1QA 1IRWA 1BL9A 3RLMA 3TYIA 5KAIV 1HJ4A 1CSWA 1I55A 2ZZS1 1CRIA 1M70A 1FJ0A 2QJKB 4PWAA 3H1ID 5H2FV 1RZ6A 1AOQA 1U75B 2Y0CA 1IQCA 1CRGA 1NTZD 1A2SA 1DW1A 5DF5A 1CIFA 1KYOD 1CRJA 1CTZA 5KLVD 1CYIA 5DJQB 3VYMA 1H32B 1YNRA 1HJ5A 4V2KA 3ZOWA 1ETPA 1LMSA 1QKSA 3CX5D 3L4MA 1SQXD 1MG2D 1RAPA 3JBTB 1L9BC 3DP5A 1NTKD 3ZOXA 2OZ1A 1N90A 1K3GA 1BE3D 3BCCD 3H1HD 2MHMA 3SJLA 3A9FA 4XYDB 3CU4A 3PRJA 1CCRA 1E2RA 2N9IA 2BCCD 3L74D 2DGEA 4PJ0V 4WQ9A 3O0RC 3TF5A 1H33B 2Y0EA 3CXHW 2OZ1B 2LITA 2HV4A 4AAMA 1GKSA 2B4ZA 2PACA 1I8PA 1C2NA 3CXHD 4L1QA 5E79V 1F1CA 2N3BA 4FAVA 2JTIB 1CO6A 1H9XA 3ORVA 1GU2A 1M60A 2CA3B 1CSVA 2YQBA 4J20A 2QG4A 3M97X 5AURA 1COTA 1E29A 2GB8B 2KS1A 2FRCA 1ZZHA 2ZOOA 1YICA 1DW2A 3PTZA 2K9JB 1FI7A 1DW0A 3HQ6A 5KKZB 2B11B 1HJ3A 1DVVA 4O1WA 5IY51 2L91A 4AX3A 3DMIA 3ZIYA 4N0KA 1NU1D 1CORA 2GIWA 1CTJA 1IZL0 2ORLA 1CIGA 2PCCB 1LC1A 2ZXYA 1GDVA 1CXCA 2XTSB 2CXBA 4WQDA 4K3IA 2LIRA 2GC7D 1A8CA 2AXTV 3KZIV 1CYCA 1CSXA 4H0KA 4WQBA 2ZBOA 1H32A 5CYTR 3RN1A 1C6SA 2B12B 2DVHA 4EIFA 1B7VA 1QL3A 1H9YA 1FI9A 1CSUA 1PP9D 3H1LD 5CIHB 1YTCA 1C6OA 1J3SA 1C6RA 2V08A 2N3YA 3NBSA 1VYDA 2BCNB 3O1YA 1HCMA 4JCGA 1KV9A 1PPJD 4EIDA 2Q3EA 2AI5A 1AOFA 1N15A 4YE1A 4UB8V 4WQ7A
chains in the Genus database with same CATH superfamily
3CWBJ 2JDIH 4U3FJ 5KLIC 3V2NA 5H2FE 3HQ8A 1NTME 1SLQA 3NMDA 2ZT9B 3AE7C 3G4SP 3A5TA 3H32A 4Y99C 1E8EA 2V4HA 3GHGB 1MFZA 4GEDB 2B89A 3L72D 2J58A 1N7SC 2KSEA 2E76B 2XV5A 2YIUB 3ZCFA 2L4DA 1IFNA 2KB7P 1S9KE 3A0BV 5E79H 2M0BA 2YK3A 2WPRA 1H1OA 1CCHA 3TGUD 3RMZA 4KMGA 1G1IA 4BRYB 1U7MA 1C75A 2YO3A 4FA1A 2R3CA 3E1RA 1DIQC 2D0WA 1NMIA 4H0JA 5C9MA 3RK3D 1H31B 3B8EB 4LC1A 1BE3J 2NPSD 2QEXP 3O6QA 1R0QA 1NTKK 5B5EV 1I6DA 3CMEP 1VQ8P 5EFWB 1W2BO 3L74J 1SQQG 2C2CA 2E74C 5KJ7C 451CA 5GTIV 1IK9A 1EZVG 1PGOA 3N7NA 4W7YA 1P84I 2FYNC 2C0XA 1RH5B 1I6EA 1FCDC 4GOFA 1X8YA 3U1CA 4H0LD 4TLFA 2FYUE 1L4AD 1NTMG 1ZW0A 2C1DB 1YJNP 4WY4C 5AW6B 1SQQD 3S1KA 3P8MC 5CCGA 2BEQD 2WPQA 5KLIB 1EZVD 1IFIA 4P4QB 3H6PA 1YIQA 2IPPA 4EOTA 1RZ5A 1LGHB 1HWTC 2E5TA 3HQ9A 4IL6V 1M1JB 1Y8AA 3D6YA 2RKLA 3G71P 2OGUA 1NTMD 4Y99B 1P84D 4I6MC 1HZUA 1OVUA 4MU8A 4FA4A 3KZIE 1L0LE 1AYGA 2YCCA 1SQVE 3H25A 4I1LA 3L71J 1KYOW 4AANA 4L3HA 3CCUP 3CX5H 4KHXA 4WQCA 4KJMA 2CA4B 3MP7B 3H1IJ 1S9KD 3CX5W 4PW9B 2QJKC 1OXZA 3T97A 5K5GB 1CRHA 1GQ1A 3KXDA 1M6ZA 4FANA 2D0SA 1PFIA 5KLVJ 3A0BH 1HH7A 1CHHA 3SWKA 3TDKA 1FOSF 1FOCA 2E74B 2JR8A 1JEKA 2FYUG 2FYNB 1SQXE 1S6VB 3GF3A 1Q7YQ 1OCDA 2HPCB 1QVFO 4EDFA 1FZCA 2H43A 1FU1A 4WY4B 1N8RQ 4DJGA 3GW6A 2D2CD 1EXIA 5CCHD 1YEAA 4OGQD 1UIXA 3M9HA 1OX3A 2QM7A 2FYUD 3M9BA 2PGDA 2Q5UA 3RK2D 1T3JA 5APVA 2FY8A 1CIEA 2YKOA 2JO1A 1L0LG 3P8CE 4TT3H 3R4YA 1WVEC 1QN2A 3EFFK 3X39A 3AEEC 4QMAA 1AFOA 2ZONG 3CD6P 2YKPA 3A0HV 1L0LD 5AW7B 1SQVD 1BL9A 4IL6H 1SFCA 5KAIV 1A02J 3K5BA 1NU1J 1E79H 2NRGA 4XE5B 1A02F 1KQGB 2QJKB 1RF0A 3RL0B 5H2FV 2A45G 2LKMA 5APQA 2IYOA 1RZ6A 1AOQA 1BGYE 2K3RA 5CJ4A 5C39A 1SQXG 1RF1A 2B87A 3D70A 1VQLP 1KQLA 1LTBC 5BU5A 1SQQJ 4R4LA 1JTHB 3M91A 1QEXA 1FZBA 1ETPA 3WMM0 1AA0A 1PP9J 1HGZA 2LXBA 1SQPK 4Y28J 1YBKA 4DZOA 1SQXD 4C7NA 3JBTB 3B5ND 2JKVA 1G2CA 1PPJE 1VDFA 2FFDA 2MHMA 3SJLA 4U7JA 1KB9I 1EDKA 2M8RA 4ASWA 3BASA 5CCGC 1GD2E 1YHQP 2N9IA 3HE5A 2Z4EA 2O01J 1URQB 3O0RC 1HJ0A 4AQRD 3TF5A 2OYHA 4R4MA 4I7ZC 3U59A 1S5LX 2WT7B 3P8CD 1HTLC 3CCLP 4PD4I 1KFMA 2N3BA 4FAVA 2JTIB 2W8ZA 1VQ7P 1CSVA 3IAOA 4YTPC 1XTCC 3M97X 5AURA 2E75C 2GB8B 4IFDK 2FRCA 2HFED 1DW0A 3SWYA 3HUSA 1HJ3A 1DVVA 3L70E 1X79B 1IFPA 3ZIYA 1J1EC 4WVZA 2GIWA 2WSSH 2N9BA 1CI6A 2KS1B 2Q3IA 2AEJA 1HGVA 2B88A 1NWQA 1KYOI 4W7ZA 2CXBA 3WU2E 3I56P 1DD3A 3W68A 2B9BA 3O6QB 5KAIH 3KZIV 4H0KA 1SQBJ 3QH9A 3AE6C 3RGUA 2IX7C 1G1JA 2KZIA 1C6SA 1PPJG 2B12B 3CX5I 1J1DC 4EIFA 2WPVB 1P84H 1PL5A 1CSUA 3L37A 2FYUK 3I5CA 4K3AA 1YTCA 4O9BA 3MUDA 1C6RA 1NKNA 4GODA 1FZCC 2BCNB 1L0NJ 3H1JE 2O01H 1HCMA 1PPJD 4EIDA 2AXTE 1JO5A 3A7OA 4AYCA 1EDLA 2QJPC 1BCCE 4I7ZB 3CXHI 1L0LK 1CHJA 1SQVK 3ZOYA 3HTKA 1VQ5P 1GIWA 5GTHV 2QRXA 2OYIA 1LC2A 3KHUA 1GK6A 3L73E 1NVOA 1NMLA 1XTGB 1QLED 2C9NY 1IZNB 1S72P 4UB8E 3L75E 2CK3H 3WFEC 3GLMA 4H44C 3C2CA 2FKWB 3RN0A 3HD7D 2K9JA 5AVTB 2ZXXA 2FBWC 1SFCC 1J1EB 1YI2P 1EB7A 2AEMA 4EI2A 3FGAD 4PV1C 3L70D 1GJQA 2N1TB 1N86A 5CIBB 1RF0C 3T97B 3Q5SA 5TISH 5B66H 4EIEA 2N9JA 1USEA 1YYCA 2AXCA 4GYDA 2ITAA 2JQRA 1MG3D 1F1FA 2L5GB 4M3LA 3AEDC 2PCBB 1J1DB 1K3HA 1PGQA 1NAFA 1K04A 1OMIA 5APUA 2ZVOB 3AE4C 3H1JG 1NHLA 2BGVX 1FZCB 1WMKA 3WFDC 2CE1A 1I5TA 3FX0A 3KZIH 2N18C 5M1BA 1BCCG 1CIHA 2C1VA 5AVQB 5DJUB 4ZKUA 2FFDC 2V07A 3PLNA 4IL6X 2ZXEB 1VQ6P 3H1JD 2WVRA 3AEGC 2QJPB 1CHIA 3RL0D 1KD1Q 1KILA 3O5CA 3L73G 2GUSA 1YTZT 5KAFV 2K9YA 4H13C 1LWUA 4WQ8A 1BCCD 2OYHC 3L75G 3WC8A 1JY3N 2GUVA 1SQPE 2RN0A 3NFQA 1JOCA 3USSA 3WFBC 1RAQA 1BDDA 4H44B 3L73D 4LJIA 1SFCB 1U7JA 2A45H 5DJTB 3L72G 2W27A 3L75D 3HUSC 1NIRA 4PV1B 5GTHH 1YQ4C 1W2LA 2BPBB 1LFMA 3CL3D 1K73Q 2UWJE 3TGUG 3GMAA 4DT0A 1NTZJ 3PXWA 1URQD 2HR3A 1R5SA 2B87B 3SFDC 3CC4P 4UB6E 3PXTA 1FAVA 3CMAP 4HB1A 1GTWA 2KYVA 1GL2D 3LW5J 5AW4B 3HQ7A 3AE2C 1CSBA 1FI3A 4C7NB 2P1JA 2W6JH 1I54A 2N18B 3ZDMA 1NTKJ 2NPSA 2KOGA 3CCEP 3BCCJ 3H1HJ 4NFGB 2FFDB 1EZVI 1KB9H 1MUUA 4N3YB 1K8AQ 2H8PD 2BCCJ 3WU2V 1U74B 2HLOA 1SQPG 2OTLP 4H13B 5AW2B 2OYHB 3OJAB 3KQGA 2SPZA 1W5CT 4PD4H 2WQYC 1DEBA 3OA8B 1OW7A 1L4AA 1Z56A 1RQVA 3VMXA 1CXAA 4L73A 3JC22 2OYIC 2K1AA 1M8OB 2WZ7A 1SQPD 2VHDA 1DX7A 2K37A 3AE5C 3EQ2A 5KAFH 5BVZA 1SP4A 3HUSB 2YXRB 2ZFCA 1IRWA 1FZFA 3RLMA 1FE6A 2KP8A 3D0WA 5APWA 1CSWA 1Q90D 1X9VA 1I55A 3JSVC 1FJ0A 1CI6B 3PJSK 1NH4A 1KYOH 2OQQA 1MKMA 3Q3DA 1RE3A 3JCUE 1LTGC 1N7SB 3NXSA 3AE8C 3C8VA 1CRGA 3CC2P 2YKQA 1FJPA 1RHZB 1DW1A 3LW5H 3V4QA 2Q9IA 3VYMA 4YPCA 3H1JJ 1NJIQ 1JY2N 3H1LE 1J2JB 4V2KA 1AQTA 2PRRA 1FZAA 4N6JA 1MZ9A 5AW8B 3L4MA 4LGDE 1BCCJ 1L9BC 3CCVP 3ZOXA 2OZ1A 1N90A 5CMZA 1K3GA 1K9MQ 3A9FA 4XYDB 3PRJA 1GDTA 3Q1MA 2Q6QA 1CCRA 1QL1A 2N1TD 2O1KA 1KC8Q 3CXHH 1S2EA 1H0TB 4PJ0V 2IDBA 1KILC 2Y0EA 1T2KC 3CXHW 4AUWA 1R5LA 2IZ1A 2HYNA 3M0DC 1LWUC 5APTA 3CCJP 3F89A 1H8AA 2OYIB 4CPGA 5B5EH 5CCHA 2KUBA 1VF5C 3E1IA 2YO2A 1Q86Q 1M60A 3WU2H 2ZYAA 1WRGA 2QJYC 5GTIH 1COTA 3L72J 1YICA 1YJ9P 3PTZA 2K9JB 1FI7A 2C9LY 1SQVG 3HQ6A 3IFMA 3VN0A 1GU5A 4O1WA 3KDPB 2L91A 4N0KA 2JJLA 1CORA 3TGUJ 2ORLA 4D6TE 2WSCJ 5E79E 1CZQA 2PCCB 2MKVA 4HYTB 2ZXYA 1VQPP 1NYHA 1W5CE 3NTNA 5CJ0A 3V6IA 2WWWA 1CXCA 3H1LG 1JMMA 2XTSB 1YQ3C 4WQDA 1S5LE 1M1KQ 2XZRA 1A8CA 1CYCA 1NOHA 2A45I 2G3AA 4DCKA 1N7LA 3B4SA 3EWKA 1H32A 3RN1A 2E42A 1ZRTE 4HH2A 1JY3O 1B7VA 1ZN5A 1H9YA 1K05A 1FI9A 3U1AA 3H1LD 1VQNP 2HODA 1C6OA 1ZP0C 1J3SA 2Q1KA 1U57A 3RK3C 2NPSC 1VYDA 3O1YA 1FDIA 1KV9A 1N15A 1LNQA 1PZQA 3CWBE 2ZT9D 4WWIA 1NAYA 4GT1A 4U3FE 1CTYA 3GHGA 3Q2YA 2EXVA 2C0WA 3FWNA 2KK7A 1LWUB 3B5NA 3CCSP 5AVWB 4MN4C 1AVYA 4NPDA 4ZMDA 1VF5B 1NTMJ 2FXMA 3N4XA 1YCCA 2E76D 4H0LC 4RJTA 1L4AC 1JNMA 4WB4A 1QYZA 2QJYB 4EYYQ 1FZEA 4IFFA 1YJWP 3Q5RA 4XXLA 2AEFA 4PJ0H 3M0AA 3OW2O 4BRYA 3MK7C 3G3ZA 3WFCC 4A7PA 1MV8A 1AKKA 1FC2C 3MTUE 4K35A 2WSCH 1H31A 1KIBA 1QVGO 4EICA 1M56D 2BH5X 2I8DA 3KYQA 4Y5RA 3CCRP 4DY9A 3H32B 2IBZE 3PH0A 1KX7A 4L75A 5CIGB 4FA5A 4D6TD 3H1KE 1RE3C 1VPCA 1EDIA 1RE4A 3C1LA 1DD4A 1MZ4A 155CA 1BGYG 1SVFA 1RY3A 3L74E 1QL4A 3PH2B 1HF9A 3A0BE 1PV3A 1JCCA 4NPEA 2B0ZB 3A0HH 1ZRTD 3QWOC 3RK3B 3CWBG 2NPSB 1KQSO 1KX2A 1KTMA 2E5YA 4U3FG 3LIDA 3L4OA 2KLUA 3R2PA 1M1JA 1BGYD 1VQOP 3LIEA 2BEZF 1HVVA 3L35A 3AEBC 3MIWA 1DT1A 4L3GA 1DEEG 1CNOA 3NBTA 2FYUJ 1FS0E 3VNWA 5H2FH 1OFCX 1C7MA 4IOIH 3CCMP 1ZR2A 3CWBD 5C0ZA 2HG5D 2KZJA 1BDCA 5APYA 4U3FD 1N7SD 5KTBA 1T6AA 4H0LB 1L4AB 2H88C 2WITA 2D2CC 3CCQP 3O20A 3ZOOA 1I8OA 1SQBK 5CCHC 4OGQC 5AVSB 3L71E 3MK7B 5BU8B 3RK2C 1L0LJ 1S4XA 2IBZG 2BLFB 1JY2O 1SQVJ 3P7KA 2PP6A 1EDJA 3WUTA 1YEBA 3H1KG 1DH3A 1OAEA 4RESB 3H1IE 1LT9A 4IL6E 1GW3A 2C8SA 2E75B 3DR0A 4ZKPA 3L70G 1LT1A 2E74D 5KJ7D 2IBZD 2YXQB 3FWLA 4BWNA 3CP5A 3HD7A 2GC4D 1ZMEC 5KLVE 1ZLLA 2HPCA 4WQEA 1FOSE 3H1KD 4BXLA 2CE0A 1IO3A 4DOJA 1AVOA 2FXPA 2B10B 4WY4D 4Q5PA 1RQUA 3SWSA 1KB0A 2Y9YA 3OA7A 2G8YA 2J59M 3V4WA 1IJDB 3SVWA 3CPWO 1SQXJ 5AW9B 3S9OA 2XNXA 4AALA 3G9RA 3OCDA 1RF1C 2FWLA 3VOPA 1YITP 3L4FA 1KQFB 2OARA 1NNOA 3RL0g 2QIWA 1PGJA 1R8EA 5TJHA 2MTAC 1S5LV 1EC5A 2WSFJ 1LTIC 3L36A 4Z1MH 2JWDA 3UIAA 2KNCA 4IFMA 3B5NC 2H89C 1FHBA 1DW3A 5AVUB 2D2CB 1DVHA 3MGNA 1JCDA 3GG2A 2K88A 4GIFA 3V2PA 3VMAA 3RK2B 2XDJA 1Q81Q 3VRDA 1A56A 3H1IG 5AW0B 3L71D 2KLVA 1E5WA 1LP1A 3F5HA 3SSUA 1USDA 1NU1E 3VYIA 4L74A 5KKZC 5AVRB 2IYPA 5KLVG 2ZZS1 2GM4A 5AW1B 1CRIA 5CBNA 3WUVA 4PWAA 3H1ID 1T8ZA 4JF7A 2IFMA 1T2KD 3CC7P 1BGYJ 1A2SA 1RE4C 1JUNA 2R5BA 2R5DA 1CTZA 5KLVD 1CYIA 3HE4A 1H32B 3E7KA 3AECC 3KPEA 5KAIE 1PP9E 3ZOWA 2M3BA 5AVVB 2DW3A 1QKSA 2HODB 1URQA 2QA4P 1MG2D 3RBXA 1P84E 4NPFX 1RF1B 2WSFH 1JMBA 1Y9BA 2QE7H 1M1JC 2WT7A 3AE1C 3ABVC 3G6EP 2ZYGA 2JEEA 3CU4A 1GL2A 4XFJA 1IFMA 2DGEA 3B5NB 1WT6A 2KXPB 4WBAA 1ZV8A 2R3SA 1G2CB 1NTZK 3MUDC 4YXWH 3BATA 2HV4A 1GKSA 1C2NA 2Z5HA 4L1QA 2R44A 2POHA 1HBWA 2XNDH 1CO6A 1NU1G 2CA3B 2YQBA 4J20A 1S5LH 2BASA 3HE5B 2PAJA 2KS1A 3CLQA 2WSEJ 3H1KJ 1GK4A 5KKZB 2FYZA 4AX3A 3DMIA 2PFXA 1KFNA 2V7QJ 1NU1D 3L70J 1LT9C 2M5AA 1CTJA 1IZL0 4OH8B 3VP9A 4HKZH 1LC1A 4GDOA 3CI9A 1PP9G 1AV1A 2I1KA 4JPZB 1FZGA 3VMZA 5TISE 1SQBE 3HD7C 2LIRA 3WUUA 2GC7D 2A06E 5AVZB 1YIJP 2AXTV 3AE3C 1S3JA 5B66E 1UIIA 4WQBA 2P67A 2ZBOA 3D71A 2DVHA 1VL2A 2OYOA 5CCGD 3AEAC 1GU4A 1PP9D 3PP5A 1FDMA 1X0TA 2MJZA 2V08A 1LTJA 2YMKA 1L0NE 3TSIA 2RH0A 2E43A 1FBMA 3D6ZA 4JCGA 1Q82Q 2O01N 1KV4A 2Q3EA 3HRNA 2AI5A 3B71A 1AOFA 2QM8A 4UB8V 4WQ7A 2E75D 5CIDB 3EFGA 2AIUA 1QX8A 3W67A 4C7RA 2C1UA 2OTJP 1HROA 1H33A 1N73A 3CYTI 2P10A 3VP8A 2LR2A 2WSEH 1VQKP 4B86A 1N50A 3OAKA 2N1TA 1JM0A 3PXSA 4JYBA 1LTSC 3L73J 3RL0C 2V7QH 3L75J 3TNUA 3HTKB 2JP3A 1M90Q 1IRVA 2KI7B 1L9JC 1KN7A 1LT9B 2JWAA 1CRYA 1ZR4A 1SQBG 1HZVA 2FXOA 2GA1A 2WMMA 4EIJA 2A06G 3V5BA 5KLVK 1CC5A 1YTZI 2KSJA 3M9QA 1KMIZ 5GTHE 2P2UA 1SS1A 3V2RA 1YFCA 3HD7B 4ZNCA 1JY3P 2O1JA 2ZVNB 5CBOA 1DIPA 2I1JA 3C9IA 2ZAEB 1SQBD 4OVNF 2A06D 1L0NG 3IR9A 2I8FA 3TK1A 2XKMA 2IZ0A 1W2EA 5CIEB 3M06A 1BSHA 3SXTA 2R32A 3PHLA 1URQC 4FB1A 2QVAA 4N78E 3OCDB 2AXTH 3Q5PA 4I2LC 5B6QA 1L0ND 1M57D 4KT0J 2Q7CA 2W6AA 1GL2C 2W6BA 1N9CA 1KB9E 5APSA 3ZBMA 5AVXB 4RO0A 2KNCB 4H44D 3BVHA 3ITKA 1QGKB 3A2AA 1SFCD 1C2RA 1IFDA 4L76A 2W83C 2CPSA 1EXJA 5EXQA 4AAOA 1CEDA 3V2QA 3II6A 4PD4E 4PV1D 4UB8H 4QAOA 5CIFB 1NU1K 3MHVA 1OWAA 1SQPJ 1KILB 1LP1B 4WQAA 3FXEA 4UB6V 1C52A 1M7LA 1OVRA 1NGMB 2BH4X 5KAFE 2RMZA 5DFSA 4OWFA 2YMYA 1WEJF 2Y9ZA 3SLEA 1SQQK 2Z5IA 1NTZE 1KYOE 4D6TG 3HE4B 2Y0DA 1CRCA 3I55P 1L2PA 1NTMK 5DJQC 3CX5E 3NWVA 2O3JA 1NTKE 1BE3E 4H13D 3BCCE 3H1HE 2C9XB 4RSZA 1LTJC 1DIIC 1TU3F 3OA8A 3WUIA 2H7HA 4N78D 4FA9A 1IC2A 5CHXA 1FJKA 1GL2B 2BCCE 1OZHA 2C1DA 1IO4A 1HJBA 5TISV 1CW5A 351CA 5B66V 1KB9D 1PIXA 1GMJA 5L8RJ 3CXHE 1H89A 5CICB 1VQ9P 1JY2P 1IK7A 1HRCA 2N9YB 2NZ2A 1N73C 1LS9A 3FXDA 1CYJA 2KIKA 4YXDC 3P32A 2N1TC 4PD4D 5B5EE 1JDLA 1N7SA 4O1QA 3IN6A 1X22A 5GTIE 1NTZG 3BRTB 3TYIA 3TYYA 1HJ4A 3SFEC 1LJ2A 2IBZI 4GOEA 1M70A 2M5AB 1N2DC 1NO4A 1KORA 1S1CX 4UB6H 1U75B 2Y0CA 1IQCA 1NTZD 2YNYA 4HJGH 1AJYA 1NTKG 5DF5A 1CIFA 1KYOD 1CRJA 1ZOYC 1H88A 5DJQB 1BE3G 3BCCG 3H1HG 1PGPA 1BSNA 4LLHA 1L0NK 3GF7A 1MFTA 1YNRA 2LXCB 1HJ5A 2QSIA 5KJ7A 1KILE 1LMSA 3H1LJ 1H0TA 2BCCG 3L74G 3CX5D 1VQ4P 1QL2A 1LTJB 1RAPA 3DP5A 1NTKD 4JBZA 5AW5B 1IFJA 2P7JA 1JB0J 1EQ7A 1BE3D 3BCCD 3H1HD 2VRSA 4WY4A 4ASVA 1OW8A 2W90A 1E2RA 2WTYA 2BCCD 4JQ0D 3BRVB 3L74D 4WQ9A 3VMYA 1H33B 2OTKE 3VTPC 1ZXGA 1N73B 2OZ1B 2LITA 1LTAC 4AAMA 2B4ZA 2PACA 1I8PA 3MD0A 3CXHD 5E79V 1F1CA 1GZLA 1H9XA 3ORVA 2ZT9C 1GU2A 2QG4A 3L72E 2WPSA 2M3EA 4C46A 1E29A 5AVYB 1ZZHA 1D7MA 2ZOOA 1Q2NA 3GHGC 1DW2A 3L71G 3TNUB 1T3UA 4PJ0E 1SQXK 2B11B 5IY51 2XU6A 2E76C 3TGUE 1VQMP 4OGQB 2YIUC 3AEFC 3JCUH 1HH0A 1FDOA 2J5UA 1CIGA 4D6TJ 3RK3E 4RKUJ 1GW4A 1GDVA 3AE9C 1KZUB 3SWFA 4K3IA 1CSXA 1OIPA 4W80A 4XA4A 3O8ZA 2IFNA 2P58A 5CYTR 5AW3B 1JTHA 1OW6A 1QL3A 1LTTC 1AQ5A 5APXA 5CIHB 1Y47A 1KILD 3M0DA 3IF4A 2ZYDA 2N3YA 3A3YB 1OVVA 3A0HE 4JYCA 3S4RA 3NBSA 4GKGA 1SQQE 3MZWB 1VF5D 2CPBA 1HUCA 1EZVE 4YE1A 2ZJSE 3RBZA 1NKZB
chains in the Genus database with same CATH topology
1CTYA 5CIDB 2EXVA 2AIUA 2C1UA 1CHJA 3HQ8A 1HROA 1H33A 3ZOYA 3CYTI 1YCCA 4RJTA 1GIWA 5GTHV 1QYZA 1LC2A 3KHUA 2QJYB 1N50A 1NMLA 1E8EA 3PXSA 4XXLA 4GEDB 3MK7C 3WFCC 3WFEC 4A7PA 3L72D 1AKKA 3C2CA 3RN0A 1H31A 2YIUB 1IRVA 2L4DA 3ZCFA 1L9JC 1EB7A 1KIBA 3A0BV 2JWAA 4EICA 1CRYA 2BH5X 2YK3A 4Y5RA 1HZVA 4DY9A 3L70D 1CC5A 1GJQA 1H1OA 1CCHA 3TGUD 1KX7A 5CIBB 3RMZA 4KMGA 1C75A 4FA1A 5CIGB 1DIQC 4FA5A 2D0WA 4D6TD 1YFCA 1NMIA 4EIEA 2N9JA 4H0JA 5C9MA 1H31B 4GYDA 2JQRA 1R0QA 1MG3D 1MZ4A 1F1FA 155CA 1SQBD 2PCBB 5B5EV 1I6DA 1K3HA 2A06D 2I8FA 1QL4A 3PH2B 2C2CA 5CIEB 451CA 5GTIV 2B0ZB 1ZRTD 2BGVX 3SXTA 1KX2A 3PHLA 1I6EA 4FB1A 3WFDC 2CE1A 1I5TA 1FCDC 3L4OA 3OCDB 2N18C 1BGYD 1CIHA 5B6QA 1L0ND 2C1VA 1DT1A 2C1DB 4L3GA 1CNOA 2V07A 3PLNA 3NBTA 1SQQD 3H1JD 3VNWA 2QJPB 5KLIB 1N9CA 1CHIA 1EZVD 1C7MA 4P4QB 1YIQA 3ZBMA 3CWBD 1RZ5A 5C0ZA 3O5CA 2KNCB 4U3FD 5KAFV 3ITKA 3HQ9A 4IL6V 4WQ8A 1BCCD 1C2RA 3WC8A 1NTMD 5EXQA 4AAOA 1P84D 1CEDA 1HZUA 3O20A 3ZOOA 1I8OA 2RN0A 4QAOA 4MU8A 4FA4A 5CIFB 1AYGA 2YCCA 3MK7B 3WFBC 1RAQA 3L73D 2BLFB 4WQAA 1KYOW 4LJIA 4AANA 4UB6V 1C52A 4L3HA 1YEBA 3L75D 2BH4X 1NIRA 4WQCA 1OAEA 2RMZA 1W2LA 2CA4B 2C8SA 5DFSA 2BPBB 1LFMA 3CX5W 1WEJF 3DR0A 3SLEA 2IBZD 4PW9B 3FWLA 3CP5A 1CRHA 1GQ1A 3PXWA 1M6ZA 2GC4D 4WQEA 4FANA 2D0SA 3H1KD 2CE0A 1HH7A 1IO3A 1CHHA 3PXTA 1CRCA 2Y0DA 2B10B 3TDKA 4Q5PA 1FOCA 5DJQC 3SWSA 1KB0A 3NWVA 3HQ7A 2FYNB 1S6VB 2O3JA 1FI3A 3SVWA 1I54A 1OCDA 2N18B 4EDFA 2C9XB 4RSZA 1DIIC 4AALA 4NFGB 3OCDA 3OA8A 3WUIA 3GW6A 2FWLA 4FA9A 1NNOA 1YEAA 2C1DA 5TJHA 2FYUD 3WU2V 1U74B 2MTAC 1S5LV 5TISV 1CIEA 351CA 5B66V 1KB9D 1W5CT 1FHBA 1DW3A 1WVEC 5CICB 1DVHA 1QN2A 3X39A 3OA8B 3GG2A 2N9YB 1HRCA 1LS9A 1CXAA 3VMAA 2ZONG 1CYJA 3VRDA 1A56A 4PD4D 1SQPD 1JDLA 2VHDA 3A0HV 1L0LD 3L71D 1SQVD 4O1QA 1IRWA 1BL9A 3RLMA 3TYIA 5KAIV 1HJ4A 1CSWA 1I55A 2ZZS1 1CRIA 1M70A 1FJ0A 2QJKB 4PWAA 3H1ID 5H2FV 1RZ6A 1AOQA 1U75B 2Y0CA 1IQCA 1CRGA 1NTZD 1A2SA 1DW1A 5DF5A 1CIFA 1KYOD 1CRJA 1CTZA 5KLVD 1CYIA 5DJQB 3VYMA 1H32B 1YNRA 1HJ5A 4V2KA 3ZOWA 1ETPA 1LMSA 1QKSA 3CX5D 3L4MA 1SQXD 1MG2D 1RAPA 3JBTB 1L9BC 3DP5A 1NTKD 3ZOXA 2OZ1A 1N90A 1K3GA 1BE3D 3BCCD 3H1HD 2MHMA 3SJLA 3A9FA 4XYDB 3CU4A 3PRJA 1CCRA 1E2RA 2N9IA 2BCCD 3L74D 2DGEA 4PJ0V 4WQ9A 3O0RC 3TF5A 1H33B 2Y0EA 3CXHW 2OZ1B 2LITA 2HV4A 4AAMA 1GKSA 2B4ZA 2PACA 1I8PA 1C2NA 3CXHD 4L1QA 5E79V 1F1CA 2N3BA 4FAVA 2JTIB 1CO6A 1H9XA 3ORVA 1GU2A 1M60A 2CA3B 1CSVA 2YQBA 4J20A 2QG4A 3M97X 5AURA 1COTA 1E29A 2GB8B 2KS1A 2FRCA 1ZZHA 2ZOOA 1YICA 1DW2A 3PTZA 2K9JB 1FI7A 1DW0A 3HQ6A 5KKZB 2B11B 1HJ3A 1DVVA 4O1WA 5IY51 2L91A 4AX3A 3DMIA 3ZIYA 4N0KA 1NU1D 1CORA 2GIWA 1CTJA 1IZL0 2ORLA 1CIGA 2PCCB 1LC1A 2ZXYA 1GDVA 1CXCA 2XTSB 2CXBA 4WQDA 4K3IA 2LIRA 2GC7D 1A8CA 2AXTV 3KZIV 1CYCA 1CSXA 4H0KA 4WQBA 2ZBOA 1H32A 5CYTR 3RN1A 1C6SA 2B12B 2DVHA 4EIFA 1B7VA 1QL3A 1H9YA 1FI9A 1CSUA 1PP9D 3H1LD 5CIHB 1YTCA 1C6OA 1J3SA 1C6RA 2V08A 2N3YA 3NBSA 1VYDA 2BCNB 3O1YA 1HCMA 4JCGA 1KV9A 1PPJD 4EIDA 2Q3EA 2AI5A 1AOFA 1N15A 4YE1A 4UB8V 4WQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTY A;  5CID B;  2EXV A;  2AIU A;  2C1U A;  1CHJ A;  3HQ8 A;  1HRO A;  1H33 A;  3ZOY A;  3CYT I;  1YCC A;  4RJT A;  1GIW A;  5GTH V;  1QYZ A;  1LC2 A;  3KHU A;  2QJY B;  1N50 A;  1NML A;  1E8E A;  3PXS A;  4XXL A;  4GED B;  3MK7 C;  3WFC C;  3WFE C;  4A7P A;  3L72 D;  1AKK A;  3C2C A;  3RN0 A;  1H31 A;  2YIU B;  1IRV A;  2L4D A;  3ZCF A;  1L9J C;  1EB7 A;  1KIB A;  3A0B V;  2JWA A;  4EIC A;  1CRY A;  2BH5 X;  2YK3 A;  4Y5R A;  1HZV A;  4DY9 A;  3L70 D;  1CC5 A;  1GJQ A;  1H1O A;  1CCH A;  3TGU D;  1KX7 A;  5CIB B;  3RMZ A;  4KMG A;  1C75 A;  4FA1 A;  5CIG B;  1DIQ C;  4FA5 A;  2D0W A;  4D6T D;  1YFC A;  1NMI A;  4EIE A;  2N9J A;  4H0J A;  5C9M A;  1H31 B;  4GYD A;  2JQR A;  1R0Q A;  1MG3 D;  1MZ4 A;  1F1F A;  155C A;  1SQB D;  2PCB B;  5B5E V;  1I6D A;  1K3H A;  2A06 D;  2I8F A;  1QL4 A;  3PH2 B;  2C2C A;  5CIE B;  451C A;  5GTI V;  2B0Z B;  1ZRT D;  2BGV X;  3SXT A;  1KX2 A;  3PHL A;  1I6E A;  4FB1 A;  3WFD C;  2CE1 A;  1I5T A;  1FCD C;  3L4O A;  3OCD B;  2N18 C;  1BGY D;  1CIH A;  5B6Q A;  1L0N D;  2C1V A;  1DT1 A;  2C1D B;  4L3G A;  1CNO A;  2V07 A;  3PLN A;  3NBT A;  1SQQ D;  3H1J D;  3VNW A;  2QJP B;  5KLI B;  1N9C A;  1CHI A;  1EZV D;  1C7M A;  4P4Q B;  1YIQ A;  3ZBM A;  3CWB D;  1RZ5 A;  5C0Z A;  3O5C A;  2KNC B;  4U3F D;  5KAF V;  3ITK A;  3HQ9 A;  4IL6 V;  4WQ8 A;  1BCC D;  1C2R A;  3WC8 A;  1NTM D;  5EXQ A;  4AAO A;  1P84 D;  1CED A;  1HZU A;  3O20 A;  3ZOO A;  1I8O A;  2RN0 A;  4QAO A;  4MU8 A;  4FA4 A;  5CIF B;  1AYG A;  2YCC A;  3MK7 B;  3WFB C;  1RAQ A;  3L73 D;  2BLF B;  4WQA A;  1KYO W;  4LJI A;  4AAN A;  4UB6 V;  1C52 A;  4L3H A;  1YEB A;  3L75 D;  2BH4 X;  1NIR A;  4WQC A;  1OAE A;  2RMZ A;  1W2L A;  2CA4 B;  2C8S A;  5DFS A;  2BPB B;  1LFM A;  3CX5 W;  1WEJ F;  3DR0 A;  3SLE A;  2IBZ D;  4PW9 B;  3FWL A;  3CP5 A;  1CRH A;  1GQ1 A;  3PXW A;  1M6Z A;  2GC4 D;  4WQE A;  4FAN A;  2D0S A;  3H1K D;  2CE0 A;  1HH7 A;  1IO3 A;  1CHH A;  3PXT A;  1CRC A;  2Y0D A;  2B10 B;  3TDK A;  4Q5P A;  1FOC A;  5DJQ C;  3SWS A;  1KB0 A;  3NWV A;  3HQ7 A;  2FYN B;  1S6V B;  2O3J A;  1FI3 A;  3SVW A;  1I54 A;  1OCD A;  2N18 B;  4EDF A;  2C9X B;  4RSZ A;  1DII C;  4AAL A;  4NFG B;  3OCD A;  3OA8 A;  3WUI A;  3GW6 A;  2FWL A;  4FA9 A;  1NNO A;  1YEA A;  2C1D A;  5TJH A;  2FYU D;  3WU2 V;  1U74 B;  2MTA C;  1S5L V;  5TIS V;  1CIE A;  351C A;  5B66 V;  1KB9 D;  1W5C T;  1FHB A;  1DW3 A;  1WVE C;  5CIC B;  1DVH A;  1QN2 A;  3X39 A;  3OA8 B;  3GG2 A;  2N9Y B;  1HRC A;  1LS9 A;  1CXA A;  3VMA A;  2ZON G;  1CYJ A;  3VRD A;  1A56 A;  4PD4 D;  1SQP D;  1JDL A;  2VHD A;  3A0H V;  1L0L D;  3L71 D;  1SQV D;  4O1Q A;  1IRW A;  1BL9 A;  3RLM A;  3TYI A;  5KAI V;  1HJ4 A;  1CSW A;  1I55 A;  2ZZS 1;  1CRI A;  1M70 A;  1FJ0 A;  2QJK B;  4PWA A;  3H1I D;  5H2F V;  1RZ6 A;  1AOQ A;  1U75 B;  2Y0C A;  1IQC A;  1CRG A;  1NTZ D;  1A2S A;  1DW1 A;  5DF5 A;  1CIF A;  1KYO D;  1CRJ A;  1CTZ A;  5KLV D;  1CYI A;  5DJQ B;  3VYM A;  1H32 B;  1YNR A;  1HJ5 A;  4V2K A;  3ZOW A;  1ETP A;  1LMS A;  1QKS A;  3CX5 D;  3L4M A;  1SQX D;  1MG2 D;  1RAP A;  3JBT B;  1L9B C;  3DP5 A;  1NTK D;  3ZOX A;  2OZ1 A;  1N90 A;  1K3G A;  1BE3 D;  3BCC D;  3H1H D;  2MHM A;  3SJL A;  3A9F A;  4XYD B;  3CU4 A;  3PRJ A;  1CCR A;  1E2R A;  2N9I A;  2BCC D;  3L74 D;  2DGE A;  4PJ0 V;  4WQ9 A;  3O0R C;  3TF5 A;  1H33 B;  2Y0E A;  3CXH W;  2OZ1 B;  2LIT A;  2HV4 A;  4AAM A;  1GKS A;  2B4Z A;  2PAC A;  1I8P A;  1C2N A;  3CXH D;  4L1Q A;  5E79 V;  1F1C A;  2N3B A;  4FAV A;  2JTI B;  1CO6 A;  1H9X A;  3ORV A;  1GU2 A;  1M60 A;  2CA3 B;  1CSV A;  2YQB A;  4J20 A;  2QG4 A;  3M97 X;  5AUR A;  1COT A;  1E29 A;  2GB8 B;  2KS1 A;  2FRC A;  1ZZH A;  2ZOO A;  1YIC A;  1DW2 A;  3PTZ A;  2K9J B;  1FI7 A;  1DW0 A;  3HQ6 A;  5KKZ B;  2B11 B;  1HJ3 A;  1DVV A;  4O1W A;  5IY5 1;  2L91 A;  4AX3 A;  3DMI A;  3ZIY A;  4N0K A;  1NU1 D;  1COR A;  2GIW A;  1CTJ A;  1IZL 0;  2ORL A;  1CIG A;  2PCC B;  1LC1 A;  2ZXY A;  1GDV A;  1CXC A;  2XTS B;  2CXB A;  4WQD A;  4K3I A;  2LIR A;  2GC7 D;  1A8C A;  2AXT V;  3KZI V;  1CYC A;  1CSX A;  4H0K A;  4WQB A;  2ZBO A;  1H32 A;  5CYT R;  3RN1 A;  1C6S A;  2B12 B;  2DVH A;  4EIF A;  1B7V A;  1QL3 A;  1H9Y A;  1FI9 A;  1CSU A;  1PP9 D;  3H1L D;  5CIH B;  1YTC A;  1C6O A;  1J3S A;  1C6R A;  2V08 A;  2N3Y A;  3NBS A;  1VYD A;  2BCN B;  3O1Y A;  1HCM A;  4JCG A;  1KV9 A;  1PPJ D;  4EID A;  2Q3E A;  2AI5 A;  1AOF A;  1N15 A;  4YE1 A;  4UB8 V;  4WQ7 A; 
#chains in the Genus database with same CATH topology
 3CWB J;  2JDI H;  4U3F J;  5KLI C;  3V2N A;  5H2F E;  3HQ8 A;  1NTM E;  1SLQ A;  3NMD A;  2ZT9 B;  3AE7 C;  3G4S P;  3A5T A;  3H32 A;  4Y99 C;  1E8E A;  2V4H A;  3GHG B;  1MFZ A;  4GED B;  2B89 A;  3L72 D;  2J58 A;  1N7S C;  2KSE A;  2E76 B;  2XV5 A;  2YIU B;  3ZCF A;  2L4D A;  1IFN A;  2KB7 P;  1S9K E;  3A0B V;  5E79 H;  2M0B A;  2YK3 A;  2WPR A;  1H1O A;  1CCH A;  3TGU D;  3RMZ A;  4KMG A;  1G1I A;  4BRY B;  1U7M A;  1C75 A;  2YO3 A;  4FA1 A;  2R3C A;  3E1R A;  1DIQ C;  2D0W A;  1NMI A;  4H0J A;  5C9M A;  3RK3 D;  1H31 B;  3B8E B;  4LC1 A;  1BE3 J;  2NPS D;  2QEX P;  3O6Q A;  1R0Q A;  1NTK K;  5B5E V;  1I6D A;  3CME P;  1VQ8 P;  5EFW B;  1W2B O;  3L74 J;  1SQQ G;  2C2C A;  2E74 C;  5KJ7 C;  451C A;  5GTI V;  1IK9 A;  1EZV G;  1PGO A;  3N7N A;  4W7Y A;  1P84 I;  2FYN C;  2C0X A;  1RH5 B;  1I6E A;  1FCD C;  4GOF A;  1X8Y A;  3U1C A;  4H0L D;  4TLF A;  2FYU E;  1L4A D;  1NTM G;  1ZW0 A;  2C1D B;  1YJN P;  4WY4 C;  5AW6 B;  1SQQ D;  3S1K A;  3P8M C;  5CCG A;  2BEQ D;  2WPQ A;  5KLI B;  1EZV D;  1IFI A;  4P4Q B;  3H6P A;  1YIQ A;  2IPP A;  4EOT A;  1RZ5 A;  1LGH B;  1HWT C;  2E5T A;  3HQ9 A;  4IL6 V;  1M1J B;  1Y8A A;  3D6Y A;  2RKL A;  3G71 P;  2OGU A;  1NTM D;  4Y99 B;  1P84 D;  4I6M C;  1HZU A;  1OVU A;  4MU8 A;  4FA4 A;  3KZI E;  1L0L E;  1AYG A;  2YCC A;  1SQV E;  3H25 A;  4I1L A;  3L71 J;  1KYO W;  4AAN A;  4L3H A;  3CCU P;  3CX5 H;  4KHX A;  4WQC A;  4KJM A;  2CA4 B;  3MP7 B;  3H1I J;  1S9K D;  3CX5 W;  4PW9 B;  2QJK C;  1OXZ A;  3T97 A;  5K5G B;  1CRH A;  1GQ1 A;  3KXD A;  1M6Z A;  4FAN A;  2D0S A;  1PFI A;  5KLV J;  3A0B H;  1HH7 A;  1CHH A;  3SWK A;  3TDK A;  1FOS F;  1FOC A;  2E74 B;  2JR8 A;  1JEK A;  2FYU G;  2FYN B;  1SQX E;  1S6V B;  3GF3 A;  1Q7Y Q;  1OCD A;  2HPC B;  1QVF O;  4EDF A;  1FZC A;  2H43 A;  1FU1 A;  4WY4 B;  1N8R Q;  4DJG A;  3GW6 A;  2D2C D;  1EXI A;  5CCH D;  1YEA A;  4OGQ D;  1UIX A;  3M9H A;  1OX3 A;  2QM7 A;  2FYU D;  3M9B A;  2PGD A;  2Q5U A;  3RK2 D;  1T3J A;  5APV A;  2FY8 A;  1CIE A;  2YKO A;  2JO1 A;  1L0L G;  3P8C E;  4TT3 H;  3R4Y A;  1WVE C;  1QN2 A;  3EFF K;  3X39 A;  3AEE C;  4QMA A;  1AFO A;  2ZON G;  3CD6 P;  2YKP A;  3A0H V;  1L0L D;  5AW7 B;  1SQV D;  1BL9 A;  4IL6 H;  1SFC A;  5KAI V;  1A02 J;  3K5B A;  1NU1 J;  1E79 H;  2NRG A;  4XE5 B;  1A02 F;  1KQG B;  2QJK B;  1RF0 A;  3RL0 B;  5H2F V;  2A45 G;  2LKM A;  5APQ A;  2IYO A;  1RZ6 A;  1AOQ A;  1BGY E;  2K3R A;  5CJ4 A;  5C39 A;  1SQX G;  1RF1 A;  2B87 A;  3D70 A;  1VQL P;  1KQL A;  1LTB C;  5BU5 A;  1SQQ J;  4R4L A;  1JTH B;  3M91 A;  1QEX A;  1FZB A;  1ETP A;  3WMM 0;  1AA0 A;  1PP9 J;  1HGZ A;  2LXB A;  1SQP K;  4Y28 J;  1YBK A;  4DZO A;  1SQX D;  4C7N A;  3JBT B;  3B5N D;  2JKV A;  1G2C A;  1PPJ E;  1VDF A;  2FFD A;  2MHM A;  3SJL A;  4U7J A;  1KB9 I;  1EDK A;  2M8R A;  4ASW A;  3BAS A;  5CCG C;  1GD2 E;  1YHQ P;  2N9I A;  3HE5 A;  2Z4E A;  2O01 J;  1URQ B;  3O0R C;  1HJ0 A;  4AQR D;  3TF5 A;  2OYH A;  4R4M A;  4I7Z C;  3U59 A;  1S5L X;  2WT7 B;  3P8C D;  1HTL C;  3CCL P;  4PD4 I;  1KFM A;  2N3B A;  4FAV A;  2JTI B;  2W8Z A;  1VQ7 P;  1CSV A;  3IAO A;  4YTP C;  1XTC C;  3M97 X;  5AUR A;  2E75 C;  2GB8 B;  4IFD K;  2FRC A;  2HFE D;  1DW0 A;  3SWY A;  3HUS A;  1HJ3 A;  1DVV A;  3L70 E;  1X79 B;  1IFP A;  3ZIY A;  1J1E C;  4WVZ A;  2GIW A;  2WSS H;  2N9B A;  1CI6 A;  2KS1 B;  2Q3I A;  2AEJ A;  1HGV A;  2B88 A;  1NWQ A;  1KYO I;  4W7Z A;  2CXB A;  3WU2 E;  3I56 P;  1DD3 A;  3W68 A;  2B9B A;  3O6Q B;  5KAI H;  3KZI V;  4H0K A;  1SQB J;  3QH9 A;  3AE6 C;  3RGU A;  2IX7 C;  1G1J A;  2KZI A;  1C6S A;  1PPJ G;  2B12 B;  3CX5 I;  1J1D C;  4EIF A;  2WPV B;  1P84 H;  1PL5 A;  1CSU A;  3L37 A;  2FYU K;  3I5C A;  4K3A A;  1YTC A;  4O9B A;  3MUD A;  1C6R A;  1NKN A;  4GOD A;  1FZC C;  2BCN B;  1L0N J;  3H1J E;  2O01 H;  1HCM A;  1PPJ D;  4EID A;  2AXT E;  1JO5 A;  3A7O A;  4AYC A;  1EDL A;  2QJP C;  1BCC E;  4I7Z B;  3CXH I;  1L0L K;  1CHJ A;  1SQV K;  3ZOY A;  3HTK A;  1VQ5 P;  1GIW A;  5GTH V;  2QRX A;  2OYI A;  1LC2 A;  3KHU A;  1GK6 A;  3L73 E;  1NVO A;  1NML A;  1XTG B;  1QLE D;  2C9N Y;  1IZN B;  1S72 P;  4UB8 E;  3L75 E;  2CK3 H;  3WFE C;  3GLM A;  4H44 C;  3C2C A;  2FKW B;  3RN0 A;  3HD7 D;  2K9J A;  5AVT B;  2ZXX A;  2FBW C;  1SFC C;  1J1E B;  1YI2 P;  1EB7 A;  2AEM A;  4EI2 A;  3FGA D;  4PV1 C;  3L70 D;  1GJQ A;  2N1T B;  1N86 A;  5CIB B;  1RF0 C;  3T97 B;  3Q5S A;  5TIS H;  5B66 H;  4EIE A;  2N9J A;  1USE A;  1YYC A;  2AXC A;  4GYD A;  2ITA A;  2JQR A;  1MG3 D;  1F1F A;  2L5G B;  4M3L A;  3AED C;  2PCB B;  1J1D B;  1K3H A;  1PGQ A;  1NAF A;  1K04 A;  1OMI A;  5APU A;  2ZVO B;  3AE4 C;  3H1J G;  1NHL A;  2BGV X;  1FZC B;  1WMK A;  3WFD C;  2CE1 A;  1I5T A;  3FX0 A;  3KZI H;  2N18 C;  5M1B A;  1BCC G;  1CIH A;  2C1V A;  5AVQ B;  5DJU B;  4ZKU A;  2FFD C;  2V07 A;  3PLN A;  4IL6 X;  2ZXE B;  1VQ6 P;  3H1J D;  2WVR A;  3AEG C;  2QJP B;  1CHI A;  3RL0 D;  1KD1 Q;  1KIL A;  3O5C A;  3L73 G;  2GUS A;  1YTZ T;  5KAF V;  2K9Y A;  4H13 C;  1LWU A;  4WQ8 A;  1BCC D;  2OYH C;  3L75 G;  3WC8 A;  1JY3 N;  2GUV A;  1SQP E;  2RN0 A;  3NFQ A;  1JOC A;  3USS A;  3WFB C;  1RAQ A;  1BDD A;  4H44 B;  3L73 D;  4LJI A;  1SFC B;  1U7J A;  2A45 H;  5DJT B;  3L72 G;  2W27 A;  3L75 D;  3HUS C;  1NIR A;  4PV1 B;  5GTH H;  1YQ4 C;  1W2L A;  2BPB B;  1LFM A;  3CL3 D;  1K73 Q;  2UWJ E;  3TGU G;  3GMA A;  4DT0 A;  1NTZ J;  3PXW A;  1URQ D;  2HR3 A;  1R5S A;  2B87 B;  3SFD C;  3CC4 P;  4UB6 E;  3PXT A;  1FAV A;  3CMA P;  4HB1 A;  1GTW A;  2KYV A;  1GL2 D;  3LW5 J;  5AW4 B;  3HQ7 A;  3AE2 C;  1CSB A;  1FI3 A;  4C7N B;  2P1J A;  2W6J H;  1I54 A;  2N18 B;  3ZDM A;  1NTK J;  2NPS A;  2KOG A;  3CCE P;  3BCC J;  3H1H J;  4NFG B;  2FFD B;  1EZV I;  1KB9 H;  1MUU A;  4N3Y B;  1K8A Q;  2H8P D;  2BCC J;  3WU2 V;  1U74 B;  2HLO A;  1SQP G;  2OTL P;  4H13 B;  5AW2 B;  2OYH B;  3OJA B;  3KQG A;  2SPZ A;  1W5C T;  4PD4 H;  2WQY C;  1DEB A;  3OA8 B;  1OW7 A;  1L4A A;  1Z56 A;  1RQV A;  3VMX A;  1CXA A;  4L73 A;  3JC2 2;  2OYI C;  2K1A A;  1M8O B;  2WZ7 A;  1SQP D;  2VHD A;  1DX7 A;  2K37 A;  3AE5 C;  3EQ2 A;  5KAF H;  5BVZ A;  1SP4 A;  3HUS B;  2YXR B;  2ZFC A;  1IRW A;  1FZF A;  3RLM A;  1FE6 A;  2KP8 A;  3D0W A;  5APW A;  1CSW A;  1Q90 D;  1X9V A;  1I55 A;  3JSV C;  1FJ0 A;  1CI6 B;  3PJS K;  1NH4 A;  1KYO H;  2OQQ A;  1MKM A;  3Q3D A;  1RE3 A;  3JCU E;  1LTG C;  1N7S B;  3NXS A;  3AE8 C;  3C8V A;  1CRG A;  3CC2 P;  2YKQ A;  1FJP A;  1RHZ B;  1DW1 A;  3LW5 H;  3V4Q A;  2Q9I A;  3VYM A;  4YPC A;  3H1J J;  1NJI Q;  1JY2 N;  3H1L E;  1J2J B;  4V2K A;  1AQT A;  2PRR A;  1FZA A;  4N6J A;  1MZ9 A;  5AW8 B;  3L4M A;  4LGD E;  1BCC J;  1L9B C;  3CCV P;  3ZOX A;  2OZ1 A;  1N90 A;  5CMZ A;  1K3G A;  1K9M Q;  3A9F A;  4XYD B;  3PRJ A;  1GDT A;  3Q1M A;  2Q6Q A;  1CCR A;  1QL1 A;  2N1T D;  2O1K A;  1KC8 Q;  3CXH H;  1S2E A;  1H0T B;  4PJ0 V;  2IDB A;  1KIL C;  2Y0E A;  1T2K C;  3CXH W;  4AUW A;  1R5L A;  2IZ1 A;  2HYN A;  3M0D C;  1LWU C;  5APT A;  3CCJ P;  3F89 A;  1H8A A;  2OYI B;  4CPG A;  5B5E H;  5CCH A;  2KUB A;  1VF5 C;  3E1I A;  2YO2 A;  1Q86 Q;  1M60 A;  3WU2 H;  2ZYA A;  1WRG A;  2QJY C;  5GTI H;  1COT A;  3L72 J;  1YIC A;  1YJ9 P;  3PTZ A;  2K9J B;  1FI7 A;  2C9L Y;  1SQV G;  3HQ6 A;  3IFM A;  3VN0 A;  1GU5 A;  4O1W A;  3KDP B;  2L91 A;  4N0K A;  2JJL A;  1COR A;  3TGU J;  2ORL A;  4D6T E;  2WSC J;  5E79 E;  1CZQ A;  2PCC B;  2MKV A;  4HYT B;  2ZXY A;  1VQP P;  1NYH A;  1W5C E;  3NTN A;  5CJ0 A;  3V6I A;  2WWW A;  1CXC A;  3H1L G;  1JMM A;  2XTS B;  1YQ3 C;  4WQD A;  1S5L E;  1M1K Q;  2XZR A;  1A8C A;  1CYC A;  1NOH A;  2A45 I;  2G3A A;  4DCK A;  1N7L A;  3B4S A;  3EWK A;  1H32 A;  3RN1 A;  2E42 A;  1ZRT E;  4HH2 A;  1JY3 O;  1B7V A;  1ZN5 A;  1H9Y A;  1K05 A;  1FI9 A;  3U1A A;  3H1L D;  1VQN P;  2HOD A;  1C6O A;  1ZP0 C;  1J3S A;  2Q1K A;  1U57 A;  3RK3 C;  2NPS C;  1VYD A;  3O1Y A;  1FDI A;  1KV9 A;  1N15 A;  1LNQ A;  1PZQ A;  3CWB E;  2ZT9 D;  4WWI A;  1NAY A;  4GT1 A;  4U3F E;  1CTY A;  3GHG A;  3Q2Y A;  2EXV A;  2C0W A;  3FWN A;  2KK7 A;  1LWU B;  3B5N A;  3CCS P;  5AVW B;  4MN4 C;  1AVY A;  4NPD A;  4ZMD A;  1VF5 B;  1NTM J;  2FXM A;  3N4X A;  1YCC A;  2E76 D;  4H0L C;  4RJT A;  1L4A C;  1JNM A;  4WB4 A;  1QYZ A;  2QJY B;  4EYY Q;  1FZE A;  4IFF A;  1YJW P;  3Q5R A;  4XXL A;  2AEF A;  4PJ0 H;  3M0A A;  3OW2 O;  4BRY A;  3MK7 C;  3G3Z A;  3WFC C;  4A7P A;  1MV8 A;  1AKK A;  1FC2 C;  3MTU E;  4K35 A;  2WSC H;  1H31 A;  1KIB A;  1QVG O;  4EIC A;  1M56 D;  2BH5 X;  2I8D A;  3KYQ A;  4Y5R A;  3CCR P;  4DY9 A;  3H32 B;  2IBZ E;  3PH0 A;  1KX7 A;  4L75 A;  5CIG B;  4FA5 A;  4D6T D;  3H1K E;  1RE3 C;  1VPC A;  1EDI A;  1RE4 A;  3C1L A;  1DD4 A;  1MZ4 A;  155C A;  1BGY G;  1SVF A;  1RY3 A;  3L74 E;  1QL4 A;  3PH2 B;  1HF9 A;  3A0B E;  1PV3 A;  1JCC A;  4NPE A;  2B0Z B;  3A0H H;  1ZRT D;  3QWO C;  3RK3 B;  3CWB G;  2NPS B;  1KQS O;  1KX2 A;  1KTM A;  2E5Y A;  4U3F G;  3LID A;  3L4O A;  2KLU A;  3R2P A;  1M1J A;  1BGY D;  1VQO P;  3LIE A;  2BEZ F;  1HVV A;  3L35 A;  3AEB C;  3MIW A;  1DT1 A;  4L3G A;  1DEE G;  1CNO A;  3NBT A;  2FYU J;  1FS0 E;  3VNW A;  5H2F H;  1OFC X;  1C7M A;  4IOI H;  3CCM P;  1ZR2 A;  3CWB D;  5C0Z A;  2HG5 D;  2KZJ A;  1BDC A;  5APY A;  4U3F D;  1N7S D;  5KTB A;  1T6A A;  4H0L B;  1L4A B;  2H88 C;  2WIT A;  2D2C C;  3CCQ P;  3O20 A;  3ZOO A;  1I8O A;  1SQB K;  5CCH C;  4OGQ C;  5AVS B;  3L71 E;  3MK7 B;  5BU8 B;  3RK2 C;  1L0L J;  1S4X A;  2IBZ G;  2BLF B;  1JY2 O;  1SQV J;  3P7K A;  2PP6 A;  1EDJ A;  3WUT A;  1YEB A;  3H1K G;  1DH3 A;  1OAE A;  4RES B;  3H1I E;  1LT9 A;  4IL6 E;  1GW3 A;  2C8S A;  2E75 B;  3DR0 A;  4ZKP A;  3L70 G;  1LT1 A;  2E74 D;  5KJ7 D;  2IBZ D;  2YXQ B;  3FWL A;  4BWN A;  3CP5 A;  3HD7 A;  2GC4 D;  1ZME C;  5KLV E;  1ZLL A;  2HPC A;  4WQE A;  1FOS E;  3H1K D;  4BXL A;  2CE0 A;  1IO3 A;  4DOJ A;  1AVO A;  2FXP A;  2B10 B;  4WY4 D;  4Q5P A;  1RQU A;  3SWS A;  1KB0 A;  2Y9Y A;  3OA7 A;  2G8Y A;  2J59 M;  3V4W A;  1IJD B;  3SVW A;  3CPW O;  1SQX J;  5AW9 B;  3S9O A;  2XNX A;  4AAL A;  3G9R A;  3OCD A;  1RF1 C;  2FWL A;  3VOP A;  1YIT P;  3L4F A;  1KQF B;  2OAR A;  1NNO A;  3RL0 g;  2QIW A;  1PGJ A;  1R8E A;  5TJH A;  2MTA C;  1S5L V;  1EC5 A;  2WSF J;  1LTI C;  3L36 A;  4Z1M H;  2JWD A;  3UIA A;  2KNC A;  4IFM A;  3B5N C;  2H89 C;  1FHB A;  1DW3 A;  5AVU B;  2D2C B;  1DVH A;  3MGN A;  1JCD A;  3GG2 A;  2K88 A;  4GIF A;  3V2P A;  3VMA A;  3RK2 B;  2XDJ A;  1Q81 Q;  3VRD A;  1A56 A;  3H1I G;  5AW0 B;  3L71 D;  2KLV A;  1E5W A;  1LP1 A;  3F5H A;  3SSU A;  1USD A;  1NU1 E;  3VYI A;  4L74 A;  5KKZ C;  5AVR B;  2IYP A;  5KLV G;  2ZZS 1;  2GM4 A;  5AW1 B;  1CRI A;  5CBN A;  3WUV A;  4PWA A;  3H1I D;  1T8Z A;  4JF7 A;  2IFM A;  1T2K D;  3CC7 P;  1BGY J;  1A2S A;  1RE4 C;  1JUN A;  2R5B A;  2R5D A;  1CTZ A;  5KLV D;  1CYI A;  3HE4 A;  1H32 B;  3E7K A;  3AEC C;  3KPE A;  5KAI E;  1PP9 E;  3ZOW A;  2M3B A;  5AVV B;  2DW3 A;  1QKS A;  2HOD B;  1URQ A;  2QA4 P;  1MG2 D;  3RBX A;  1P84 E;  4NPF X;  1RF1 B;  2WSF H;  1JMB A;  1Y9B A;  2QE7 H;  1M1J C;  2WT7 A;  3AE1 C;  3ABV C;  3G6E P;  2ZYG A;  2JEE A;  3CU4 A;  1GL2 A;  4XFJ A;  1IFM A;  2DGE A;  3B5N B;  1WT6 A;  2KXP B;  4WBA A;  1ZV8 A;  2R3S A;  1G2C B;  1NTZ K;  3MUD C;  4YXW H;  3BAT A;  2HV4 A;  1GKS A;  1C2N A;  2Z5H A;  4L1Q A;  2R44 A;  2POH A;  1HBW A;  2XND H;  1CO6 A;  1NU1 G;  2CA3 B;  2YQB A;  4J20 A;  1S5L H;  2BAS A;  3HE5 B;  2PAJ A;  2KS1 A;  3CLQ A;  2WSE J;  3H1K J;  1GK4 A;  5KKZ B;  2FYZ A;  4AX3 A;  3DMI A;  2PFX A;  1KFN A;  2V7Q J;  1NU1 D;  3L70 J;  1LT9 C;  2M5A A;  1CTJ A;  1IZL 0;  4OH8 B;  3VP9 A;  4HKZ H;  1LC1 A;  4GDO A;  3CI9 A;  1PP9 G;  1AV1 A;  2I1K A;  4JPZ B;  1FZG A;  3VMZ A;  5TIS E;  1SQB E;  3HD7 C;  2LIR A;  3WUU A;  2GC7 D;  2A06 E;  5AVZ B;  1YIJ P;  2AXT V;  3AE3 C;  1S3J A;  5B66 E;  1UII A;  4WQB A;  2P67 A;  2ZBO A;  3D71 A;  2DVH A;  1VL2 A;  2OYO A;  5CCG D;  3AEA C;  1GU4 A;  1PP9 D;  3PP5 A;  1FDM A;  1X0T A;  2MJZ A;  2V08 A;  1LTJ A;  2YMK A;  1L0N E;  3TSI A;  2RH0 A;  2E43 A;  1FBM A;  3D6Z A;  4JCG A;  1Q82 Q;  2O01 N;  1KV4 A;  2Q3E A;  3HRN A;  2AI5 A;  3B71 A;  1AOF A;  2QM8 A;  4UB8 V;  4WQ7 A;  2E75 D;  5CID B;  3EFG A;  2AIU A;  1QX8 A;  3W67 A;  4C7R A;  2C1U A;  2OTJ P;  1HRO A;  1H33 A;  1N73 A;  3CYT I;  2P10 A;  3VP8 A;  2LR2 A;  2WSE H;  1VQK P;  4B86 A;  1N50 A;  3OAK A;  2N1T A;  1JM0 A;  3PXS A;  4JYB A;  1LTS C;  3L73 J;  3RL0 C;  2V7Q H;  3L75 J;  3TNU A;  3HTK B;  2JP3 A;  1M90 Q;  1IRV A;  2KI7 B;  1L9J C;  1KN7 A;  1LT9 B;  2JWA A;  1CRY A;  1ZR4 A;  1SQB G;  1HZV A;  2FXO A;  2GA1 A;  2WMM A;  4EIJ A;  2A06 G;  3V5B A;  5KLV K;  1CC5 A;  1YTZ I;  2KSJ A;  3M9Q A;  1KMI Z;  5GTH E;  2P2U A;  1SS1 A;  3V2R A;  1YFC A;  3HD7 B;  4ZNC A;  1JY3 P;  2O1J A;  2ZVN B;  5CBO A;  1DIP A;  2I1J A;  3C9I A;  2ZAE B;  1SQB D;  4OVN F;  2A06 D;  1L0N G;  3IR9 A;  2I8F A;  3TK1 A;  2XKM A;  2IZ0 A;  1W2E A;  5CIE B;  3M06 A;  1BSH A;  3SXT A;  2R32 A;  3PHL A;  1URQ C;  4FB1 A;  2QVA A;  4N78 E;  3OCD B;  2AXT H;  3Q5P A;  4I2L C;  5B6Q A;  1L0N D;  1M57 D;  4KT0 J;  2Q7C A;  2W6A A;  1GL2 C;  2W6B A;  1N9C A;  1KB9 E;  5APS A;  3ZBM A;  5AVX B;  4RO0 A;  2KNC B;  4H44 D;  3BVH A;  3ITK A;  1QGK B;  3A2A A;  1SFC D;  1C2R A;  1IFD A;  4L76 A;  2W83 C;  2CPS A;  1EXJ A;  5EXQ A;  4AAO A;  1CED A;  3V2Q A;  3II6 A;  4PD4 E;  4PV1 D;  4UB8 H;  4QAO A;  5CIF B;  1NU1 K;  3MHV A;  1OWA A;  1SQP J;  1KIL B;  1LP1 B;  4WQA A;  3FXE A;  4UB6 V;  1C52 A;  1M7L A;  1OVR A;  1NGM B;  2BH4 X;  5KAF E;  2RMZ A;  5DFS A;  4OWF A;  2YMY A;  1WEJ F;  2Y9Z A;  3SLE A;  1SQQ K;  2Z5I A;  1NTZ E;  1KYO E;  4D6T G;  3HE4 B;  2Y0D A;  1CRC A;  3I55 P;  1L2P A;  1NTM K;  5DJQ C;  3CX5 E;  3NWV A;  2O3J A;  1NTK E;  1BE3 E;  4H13 D;  3BCC E;  3H1H E;  2C9X B;  4RSZ A;  1LTJ C;  1DII C;  1TU3 F;  3OA8 A;  3WUI A;  2H7H A;  4N78 D;  4FA9 A;  1IC2 A;  5CHX A;  1FJK A;  1GL2 B;  2BCC E;  1OZH A;  2C1D A;  1IO4 A;  1HJB A;  5TIS V;  1CW5 A;  351C A;  5B66 V;  1KB9 D;  1PIX A;  1GMJ A;  5L8R J;  3CXH E;  1H89 A;  5CIC B;  1VQ9 P;  1JY2 P;  1IK7 A;  1HRC A;  2N9Y B;  2NZ2 A;  1N73 C;  1LS9 A;  3FXD A;  1CYJ A;  2KIK A;  4YXD C;  3P32 A;  2N1T C;  4PD4 D;  5B5E E;  1JDL A;  1N7S A;  4O1Q A;  3IN6 A;  1X22 A;  5GTI E;  1NTZ G;  3BRT B;  3TYI A;  3TYY A;  1HJ4 A;  3SFE C;  1LJ2 A;  2IBZ I;  4GOE A;  1M70 A;  2M5A B;  1N2D C;  1NO4 A;  1KOR A;  1S1C X;  4UB6 H;  1U75 B;  2Y0C A;  1IQC A;  1NTZ D;  2YNY A;  4HJG H;  1AJY A;  1NTK G;  5DF5 A;  1CIF A;  1KYO D;  1CRJ A;  1ZOY C;  1H88 A;  5DJQ B;  1BE3 G;  3BCC G;  3H1H G;  1PGP A;  1BSN A;  4LLH A;  1L0N K;  3GF7 A;  1MFT A;  1YNR A;  2LXC B;  1HJ5 A;  2QSI A;  5KJ7 A;  1KIL E;  1LMS A;  3H1L J;  1H0T A;  2BCC G;  3L74 G;  3CX5 D;  1VQ4 P;  1QL2 A;  1LTJ B;  1RAP A;  3DP5 A;  1NTK D;  4JBZ A;  5AW5 B;  1IFJ A;  2P7J A;  1JB0 J;  1EQ7 A;  1BE3 D;  3BCC D;  3H1H D;  2VRS A;  4WY4 A;  4ASV A;  1OW8 A;  2W90 A;  1E2R A;  2WTY A;  2BCC D;  4JQ0 D;  3BRV B;  3L74 D;  4WQ9 A;  3VMY A;  1H33 B;  2OTK E;  3VTP C;  1ZXG A;  1N73 B;  2OZ1 B;  2LIT A;  1LTA C;  4AAM A;  2B4Z A;  2PAC A;  1I8P A;  3MD0 A;  3CXH D;  5E79 V;  1F1C A;  1GZL A;  1H9X A;  3ORV A;  2ZT9 C;  1GU2 A;  2QG4 A;  3L72 E;  2WPS A;  2M3E A;  4C46 A;  1E29 A;  5AVY B;  1ZZH A;  1D7M A;  2ZOO A;  1Q2N A;  3GHG C;  1DW2 A;  3L71 G;  3TNU B;  1T3U A;  4PJ0 E;  1SQX K;  2B11 B;  5IY5 1;  2XU6 A;  2E76 C;  3TGU E;  1VQM P;  4OGQ B;  2YIU C;  3AEF C;  3JCU H;  1HH0 A;  1FDO A;  2J5U A;  1CIG A;  4D6T J;  3RK3 E;  4RKU J;  1GW4 A;  1GDV A;  3AE9 C;  1KZU B;  3SWF A;  4K3I A;  1CSX A;  1OIP A;  4W80 A;  4XA4 A;  3O8Z A;  2IFN A;  2P58 A;  5CYT R;  5AW3 B;  1JTH A;  1OW6 A;  1QL3 A;  1LTT C;  1AQ5 A;  5APX A;  5CIH B;  1Y47 A;  1KIL D;  3M0D A;  3IF4 A;  2ZYD A;  2N3Y A;  3A3Y B;  1OVV A;  3A0H E;  4JYC A;  3S4R A;  3NBS A;  4GKG A;  1SQQ E;  3MZW B;  1VF5 D;  2CPB A;  1HUC A;  1EZV E;  4YE1 A;  2ZJS E;  3RBZ A;  1NKZ B; 
#chains in the Genus database with same CATH homology
 1CTY A;  5CID B;  2EXV A;  2AIU A;  2C1U A;  1CHJ A;  3HQ8 A;  1HRO A;  1H33 A;  3ZOY A;  3CYT I;  1YCC A;  4RJT A;  1GIW A;  5GTH V;  1QYZ A;  1LC2 A;  3KHU A;  2QJY B;  1N50 A;  1NML A;  1E8E A;  3PXS A;  4XXL A;  4GED B;  3MK7 C;  3WFC C;  3WFE C;  4A7P A;  3L72 D;  1AKK A;  3C2C A;  3RN0 A;  1H31 A;  2YIU B;  1IRV A;  2L4D A;  3ZCF A;  1L9J C;  1EB7 A;  1KIB A;  3A0B V;  2JWA A;  4EIC A;  1CRY A;  2BH5 X;  2YK3 A;  4Y5R A;  1HZV A;  4DY9 A;  3L70 D;  1CC5 A;  1GJQ A;  1H1O A;  1CCH A;  3TGU D;  1KX7 A;  5CIB B;  3RMZ A;  4KMG A;  1C75 A;  4FA1 A;  5CIG B;  1DIQ C;  4FA5 A;  2D0W A;  4D6T D;  1YFC A;  1NMI A;  4EIE A;  2N9J A;  4H0J A;  5C9M A;  1H31 B;  4GYD A;  2JQR A;  1R0Q A;  1MG3 D;  1MZ4 A;  1F1F A;  155C A;  1SQB D;  2PCB B;  5B5E V;  1I6D A;  1K3H A;  2A06 D;  2I8F A;  1QL4 A;  3PH2 B;  2C2C A;  5CIE B;  451C A;  5GTI V;  2B0Z B;  1ZRT D;  2BGV X;  3SXT A;  1KX2 A;  3PHL A;  1I6E A;  4FB1 A;  3WFD C;  2CE1 A;  1I5T A;  1FCD C;  3L4O A;  3OCD B;  2N18 C;  1BGY D;  1CIH A;  5B6Q A;  1L0N D;  2C1V A;  1DT1 A;  2C1D B;  4L3G A;  1CNO A;  2V07 A;  3PLN A;  3NBT A;  1SQQ D;  3H1J D;  3VNW A;  2QJP B;  5KLI B;  1N9C A;  1CHI A;  1EZV D;  1C7M A;  4P4Q B;  1YIQ A;  3ZBM A;  3CWB D;  1RZ5 A;  5C0Z A;  3O5C A;  2KNC B;  4U3F D;  5KAF V;  3ITK A;  3HQ9 A;  4IL6 V;  4WQ8 A;  1BCC D;  1C2R A;  3WC8 A;  1NTM D;  5EXQ A;  4AAO A;  1P84 D;  1CED A;  1HZU A;  3O20 A;  3ZOO A;  1I8O A;  2RN0 A;  4QAO A;  4MU8 A;  4FA4 A;  5CIF B;  1AYG A;  2YCC A;  3MK7 B;  3WFB C;  1RAQ A;  3L73 D;  2BLF B;  4WQA A;  1KYO W;  4LJI A;  4AAN A;  4UB6 V;  1C52 A;  4L3H A;  1YEB A;  3L75 D;  2BH4 X;  1NIR A;  4WQC A;  1OAE A;  2RMZ A;  1W2L A;  2CA4 B;  2C8S A;  5DFS A;  2BPB B;  1LFM A;  3CX5 W;  1WEJ F;  3DR0 A;  3SLE A;  2IBZ D;  4PW9 B;  3FWL A;  3CP5 A;  1CRH A;  1GQ1 A;  3PXW A;  1M6Z A;  2GC4 D;  4WQE A;  4FAN A;  2D0S A;  3H1K D;  2CE0 A;  1HH7 A;  1IO3 A;  1CHH A;  3PXT A;  1CRC A;  2Y0D A;  2B10 B;  3TDK A;  4Q5P A;  1FOC A;  5DJQ C;  3SWS A;  1KB0 A;  3NWV A;  3HQ7 A;  2FYN B;  1S6V B;  2O3J A;  1FI3 A;  3SVW A;  1I54 A;  1OCD A;  2N18 B;  4EDF A;  2C9X B;  4RSZ A;  1DII C;  4AAL A;  4NFG B;  3OCD A;  3OA8 A;  3WUI A;  3GW6 A;  2FWL A;  4FA9 A;  1NNO A;  1YEA A;  2C1D A;  5TJH A;  2FYU D;  3WU2 V;  1U74 B;  2MTA C;  1S5L V;  5TIS V;  1CIE A;  351C A;  5B66 V;  1KB9 D;  1W5C T;  1FHB A;  1DW3 A;  1WVE C;  5CIC B;  1DVH A;  1QN2 A;  3X39 A;  3OA8 B;  3GG2 A;  2N9Y B;  1HRC A;  1LS9 A;  1CXA A;  3VMA A;  2ZON G;  1CYJ A;  3VRD A;  1A56 A;  4PD4 D;  1SQP D;  1JDL A;  2VHD A;  3A0H V;  1L0L D;  3L71 D;  1SQV D;  4O1Q A;  1IRW A;  1BL9 A;  3RLM A;  3TYI A;  5KAI V;  1HJ4 A;  1CSW A;  1I55 A;  2ZZS 1;  1CRI A;  1M70 A;  1FJ0 A;  2QJK B;  4PWA A;  3H1I D;  5H2F V;  1RZ6 A;  1AOQ A;  1U75 B;  2Y0C A;  1IQC A;  1CRG A;  1NTZ D;  1A2S A;  1DW1 A;  5DF5 A;  1CIF A;  1KYO D;  1CRJ A;  1CTZ A;  5KLV D;  1CYI A;  5DJQ B;  3VYM A;  1H32 B;  1YNR A;  1HJ5 A;  4V2K A;  3ZOW A;  1ETP A;  1LMS A;  1QKS A;  3CX5 D;  3L4M A;  1SQX D;  1MG2 D;  1RAP A;  3JBT B;  1L9B C;  3DP5 A;  1NTK D;  3ZOX A;  2OZ1 A;  1N90 A;  1K3G A;  1BE3 D;  3BCC D;  3H1H D;  2MHM A;  3SJL A;  3A9F A;  4XYD B;  3CU4 A;  3PRJ A;  1CCR A;  1E2R A;  2N9I A;  2BCC D;  3L74 D;  2DGE A;  4PJ0 V;  4WQ9 A;  3O0R C;  3TF5 A;  1H33 B;  2Y0E A;  3CXH W;  2OZ1 B;  2LIT A;  2HV4 A;  4AAM A;  1GKS A;  2B4Z A;  2PAC A;  1I8P A;  1C2N A;  3CXH D;  4L1Q A;  5E79 V;  1F1C A;  2N3B A;  4FAV A;  2JTI B;  1CO6 A;  1H9X A;  3ORV A;  1GU2 A;  1M60 A;  2CA3 B;  1CSV A;  2YQB A;  4J20 A;  2QG4 A;  3M97 X;  5AUR A;  1COT A;  1E29 A;  2GB8 B;  2KS1 A;  2FRC A;  1ZZH A;  2ZOO A;  1YIC A;  1DW2 A;  3PTZ A;  2K9J B;  1FI7 A;  1DW0 A;  3HQ6 A;  5KKZ B;  2B11 B;  1HJ3 A;  1DVV A;  4O1W A;  5IY5 1;  2L91 A;  4AX3 A;  3DMI A;  3ZIY A;  4N0K A;  1NU1 D;  1COR A;  2GIW A;  1CTJ A;  1IZL 0;  2ORL A;  1CIG A;  2PCC B;  1LC1 A;  2ZXY A;  1GDV A;  1CXC A;  2XTS B;  2CXB A;  4WQD A;  4K3I A;  2LIR A;  2GC7 D;  1A8C A;  2AXT V;  3KZI V;  1CYC A;  1CSX A;  4H0K A;  4WQB A;  2ZBO A;  1H32 A;  5CYT R;  3RN1 A;  1C6S A;  2B12 B;  2DVH A;  4EIF A;  1B7V A;  1QL3 A;  1H9Y A;  1FI9 A;  1CSU A;  1PP9 D;  3H1L D;  5CIH B;  1YTC A;  1C6O A;  1J3S A;  1C6R A;  2V08 A;  2N3Y A;  3NBS A;  1VYD A;  2BCN B;  3O1Y A;  1HCM A;  4JCG A;  1KV9 A;  1PPJ D;  4EID A;  2Q3E A;  2AI5 A;  1AOF A;  1N15 A;  4YE1 A;  4UB8 V;  4WQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...