1NU1D

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 52
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1nu1D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1nu1D01
1DVVA 1C2RA 2LITA 4L3HA 4D6TD 3DMIA 2AI5A 3GG2A 2YQBA 1A2SA 3SVWA 4XXLA 1MG3D 1HH7A 2FRCA 3H1JD 4UB8V 1DIQC 1SQPD 2GB8B 5CIDB 1N9CA 2AXTV 351CA 1GKSA 1L9BC 3H1KD 3ZOYA 3A9FA 2DGEA 1E2RA 2I8FA 1LC2A 1OCDA 2V08A 2JQRA 1FJ0A 1E8EA 1NTMD 3WC8A 1QL4A 1LS9A 1EB7A 2CXBA 2YCCA 2D0SA 4WQBA 3L4OA 2Y0DA 4V2KA 3VMAA 1FOCA 1F1CA 2C9XB 3ITKA 2B0ZB 1WVEC 155CA 3MK7C 1L0ND 2FYNB 4EIEA 4WQ8A 1CCRA 1OAEA 3SWSA 3OCDB 1HJ5A 2FWLA 1CIEA 4WQ7A 2XTSB 3CYTI 3ORVA 2BCNB 3VNWA 1RAQA 3ZIYA 1I55A 1HCMA 5DJQC 2JTIB 5CIBB 1YNRA 3SLEA 1CRCA 1C6SA 1YIQA 2N18B 3ZBMA 3H1HD 3PLNA 2CA4B 4J20A 1CC5A 1CSXA 1AYGA 2GC4D 2KS1A 1CXCA 1S6VB 1L0LD 4GEDB 1GIWA 2L4DA 1AKKA 1A56A 2O3JA 2YIUB 3TYIA 1W2LA 2QJYB 2QJPB 1M6ZA 2ZZS1 1I8PA 3ZOOA 2N18C 3OA8A 1C6RA 1BE3D 1L9JC 1M60A 2BCCD 1H1OA 3VRDA 1C52A 1HRCA 1I5TA 2VHDA 3HQ8A 3SXTA 1H32A 5TJHA 2DVHA 4AAOA 1IO3A 3O20A 1RAPA 3WUIA 1IQCA 1YEAA 1YCCA 1CSWA 1YICA 4NFGB 4FANA 2QJKB 1E29A 1H31A 1H32B 3PHLA 5KAIV 1NNOA 3WFBC 3PXTA 1KYOW 3O1YA 1DIIC 5IY51 1HZUA 1F1FA 3NWVA 2B4ZA 1C6OA 1K3HA 4QAOA 2Y0CA 1QYZA 1CNOA 2K9JB 4KMGA 4WQ9A 1H9XA 2CE1A 5KLIB 1ZRTD 1DW0A 2B10B 3L73D 4N0KA 3C2CA 4PD4D 4WQDA 1KV9A 1N15A 4WQAA 5GTIV 5CIFB 2HV4A 2JWAA 1QKSA 3PXWA 1CTJA 3HQ7A 1LC1A 1HROA 1DW2A 3PXSA 2OZ1A 3FWLA 3CX5D 3MK7B 1BGYD 1GQ1A 1KIBA 4Q5PA 2MHMA 1KYOD 4JCGA 4WQEA 1MZ4A 2L91A 1H33A 3NBSA 2Q3EA 3PTZA 2ZOOA 2V07A 4AALA 4PW9B 1U75B 5CIEB 1RZ6A 1DW3A 2OZ1B 1NU1D 3BCCD 5DJQB 3ZOWA 4GYDA 1JDLA 4L1QA 4H0JA 1CHHA 5B66V 3TDKA 4EIFA 3CP5A 1H33B 1FHBA 4K3IA 1KX7A 4PWAA 2C1DA 5TISV 1DW1A 5EXQA 1GJQA 2KNCB 1CRIA 2B12B 2BGVX 2YK3A 4DY9A 3NBTA 3M97X 1CEDA 2N3YA 3CXHD 1NMLA 2C1DB 2AIUA 1EZVD 1CIGA 1NMIA 1CORA 1YFCA 3L74D 4A7PA 3X39A 5CYTR 2Y0EA 4U3FD 4L3GA 3KHUA 5DF5A 1QL3A 5KKZB 3O0RC 1M70A 1U74B 1CTYA 2MTAC 5KLVD 4LJIA 1LMSA 1VYDA 3DR0A 1N90A 3TGUD 2C2CA 2RMZA 1W5CT 3OA8B 3H1LD 1N50A 2IBZD 4AX3A 1CRGA 1WEJF 2C1VA 1GDVA 1IRWA 4WQCA 4FA1A 3CX5W 1C2NA 3L72D 5KAFV 4FAVA 4FA5A 3RLMA 3L4MA 3WU2V 1AOFA 1CRHA 2C8SA 1A8CA 2GC7D 1H31B 4PJ0V 3KZIV 5C9MA 1CRJA 5CIGB 5GTHV 1ETPA 1CIHA 1PPJD 1HJ3A 3DP5A 1YTCA 1PP9D 2LIRA 3PRJA 3ZOXA 4P4QB 1YEBA 5E79V 1IRVA 2N9YB 1CXAA 3WFDC 2CE0A 3HQ9A 1HJ4A 2ZXYA 3CWBD 3CXHW 1S5LV 1I54A 2RN0A 2A06D 4MU8A 3TF5A 4EDFA 4AAMA 2ZONG 1BL9A 1HZVA 3WFEC 1BCCD 4Y5RA 1CTZA 2PCBB 1P84D 1RZ5A 1FI9A 3GW6A 1FI3A 3L70D 3H1ID 1DT1A 1IZL0 2PACA 1CHIA 2D0WA 2BPBB 3O5CA 1CIFA 3OCDA 1NTKD 4XYDB 2FYUD 4UB6V 1SQQD 4H0KA 1CSVA 1LFMA 1NTZD 3RN0A 2GIWA 451CA 1CSUA 1CO6A 1I6EA 1COTA 1C7MA 3A0BV 3CU4A 2ORLA 1GU2A 1CCHA 1DVHA 3SJLA 3L71D 1CYCA 2BH5X 4RSZA 1FI7A 2C1UA 4AANA 1SQVD 5DFSA 3JBTB 1KX2A 3PH2B 4EICA 3WFCC 5AURA 1R0QA 3VYMA 4RJTA 1FCDC 1SQXD 2BH4X 2EXVA 5C0ZA 5H2FV 1AOQA 1CYJA 4FA9A 4FB1A 2N9IA 4O1WA 1CHJA 2ZBOA 4YE1A 3RN1A 2BLFB 2N3BA 1C75A 3A0HV 4IL6V 1CYIA 1ZZHA 1CRYA 1MG2D 4O1QA 1SQBD 3ZCFA 5B6QA 3HQ6A 5CIHB 1KB0A 5B5EV 3L75D 1H9YA 2N9JA 2B11B 3RMZA 1I8OA 2PCCB 4FA4A 1QN2A 1I6DA 1K3GA 5CICB 2CA3B 1J3SA 1NIRA 2QG4A 1B7VA 1KB9D 4EIDA
chains in the Genus database with same CATH superfamily
2W8ZA 2LITA 2HPCB 3GMAA 1T2KC 2YKPA 5B5EH 2FRCA 2E5TA 1EDIA 1SQPD 1GTWA 2R3SA 4GDOA 1ZW0A 2YO3A 3CC7P 1L4AA 1YJNP 3H1KD 3ZOYA 3VP9A 3WU2E 3H1HE 3C9IA 1OCDA 2JQRA 1PP9G 1U7JA 5CCHC 3SFEC 1LS9A 1SQXK 3CXHI 1FS0E 1N7LA 1DD4A 1EZVI 2Y0DA 3V2PA 1FOCA 1RH5B 1RF1C 2B0ZB 4WY4D 1BCCJ 2N1TB 1WVEC 2BCCE 5E79E 2I8DA 2POHA 155CA 1VF5B 1K73Q 1HH0A 1HUCA 3H1JG 1KC8Q 3SFDC 4JYBA 1SQBK 3QWOC 3P8MC 2XTSB 2BCNB 3VNWA 3ZIYA 1I55A 2JTIB 4J20A 1CXCA 1S6VB 1L0LD 2H43A 2IBZI 1KILE 1PFIA 4IL6X 3KPEA 3TYIA 2QJYB 1RY3A 3MD0A 2FXMA 1M6ZA 3MIWA 3L71J 3L35A 3W68A 3ZOOA 1IFIA 1FJKA 1NTZG 1BE3D 5KLVJ 5BVZA 4UB6E 5TJHA 1JUNA 4YXDC 3MP7B 5AW2B 1QLED 4FANA 1OXZA 1H31A 2B4ZA 1C6OA 1IFNA 3RGUA 1GMJA 3MUDA 4IFDK 4KMGA 1IK9A 1L0NK 1SQXG 3HTKB 5KLIB 2IPPA 4WQDA 4PD4D 2YO2A 2CK3H 3RBZA 1GL2D 2E42A 1CTJA 1HROA 2CPBA 1GK4A 3CXHE 1EZVE 3PJSK 3HRNA 5KLIC 4AQRD 4BRYA 3FWLA 3PP5A 3L74E 1GQ1A 1KIBA 3V2RA 1T6AA 1OMIA 1FDIA 3M0DA 1KYOD 1MZ4A 1L4AB 3H1JJ 2K3RA 4U3FE 2Y9ZA 3NBSA 2Q3EA 3PTZA 1JY2N 5APQA 1MFTA 3KXDA 3P8CE 3WUTA 1FDMA 1U75B 1GDTA 3S4RA 4GYDA 1JDLA 1CHHA 5DJUB 3I55P 4DCKA 4EIFA 1M1JB 3CP5A 1HBWA 5KJ7C 2E75D 1MZ9A 2QVAA 1KX7A 3E7KA 3SWFA 1M90Q 3M9BA 1EC5A 1HJBA 3F89A 2KNCB 2BGVX 2IFMA 3S9OA 1S9KD 1X9VA 1W2BO 1SP4A 2C1DB 1M1JC 1KB9H 5AW3B 4A7PA 5AVWB 1N86A 2PAJA 3SWKA 5DF5A 5KKZB 3O0RC 5CCGA 1L0NG 1X79B 1SVFA 3WMM0 1VYDA 3TGUD 2PP6A 1IC2A 2W27A 3AE7C 2C2CA 2RMZA 1P84H 3AEDC 1R8EA 3G3ZA 1N50A 3CWBE 5TISE 4LLHA 5KKZC 1VQOP 1EDLA 1CRGA 1WEJF 2GUVA 1IRWA 4FA1A 1SQXJ 1BGYE 2A06E 1LTSC 1KB9I 3L74G 4WB4A 2BCCJ 2ITAA 1HJ0A 4U3FG 3USSA 2GC7D 1H31B 1KTMA 1NKZB 3KZIV 1KZUB 2O01N 1PPJD 1HJ3A 2ZJSE 2XDJA 2LIRA 3A3YB 1K8AQ 1L2PA 4M3LA 2D2CD 3HUSC 2FYUK 1E79H 1CXAA 3WFDC 4K3AA 4KJMA 3HQ9A 2FYUE 2YMKA 5BU8B 2FKWB 1I54A 5GTHH 1Q86Q 1W2EA 3MTUE 1FZGA 2E76C 4MU8A 1G2CB 4AUWA 5APUA 4EDFA 1AQ5A 2ZONG 1RHZB 3I56P 5AW8B 3CCEP 2JKVA 1S4XA 4H0LD 4Y5RA 2PCBB 4H44C 5AVSB 1YQ4C 3GW6A 1HTLC 1CI6B 3D0WA 3L70D 3H1ID 2PACA 1VQKP 2NPSA 1ZV8A 2D0WA 3FXEA 3H1LE 1HVVA 2R5DA 4DZOA 3CWBG 2GM4A 4H0KA 1KQFB 1CSVA 5BU5A 1CSUA 1BGYG 4MN4C 1Y47A 3GHGA 2M3EA 3AE5C 3A0BV 3CU4A 1GU2A 3QH9A 2A45G 4RSZA 1FI7A 4PD4H 1SQVD 1N7SB 1OW7A 3AECC 3CCSP 1YBKA 3V4WA 1X22A 3L74J 1KB9E 3HE5A 2OGUA 1FOSE 3WFCC 1XTCC 4RJTA 1FCDC 1IFJA 2FYUG 1LT9A 4HYTB 4U3FJ 3W67A 2KI7B 1QL2A 1IO4A 2O01H 1N7SC 2ZYAA 1KYOH 4TT3H 1PL5A 1KFMA 1AOQA 4FB1A 1WMKA 2WPQA 1Q90D 4OGQD 4YE1A 3RN1A 4Y28J 3RK2D 1VQNP 3BATA 4GODA 4IL6V 1CYIA 1CRYA 4O1QA 2J59M 3FWNA 1VL2A 3H1KE 4PD4I 3HQ6A 1ZLLA 2ZVOB 4EIJA 3L75D 1H9YA 4W7YA 1FZCB 2HPCA 5CICB 1NTKK 1RF0C 5CCHA 3H1LG 3RK3B 3AEEC 4I7ZC 3WUVA 3P32A 1K05A 1DVVA 5AVRB 3A0HH 1C2RA 4D6TD 1JNMA 3GG2A 3L72G 2YQBA 3V4QA 1RF1A 3SVWA 4XXLA 1HH7A 3CCMP 4ZKPA 4UB8V 4K35A 2W90A 2GB8B 1G1JA 5AW9B 3RK3C 2LKMA 5CMZA 4YTPC 1L4AD 2LR2A 2AXTV 4Y99B 2KYVA 2E74D 2C0WA 5AVUB 3CWBJ 1U7MA 3P7KA 1L0LE 5GTHE 1BGYJ 2N1TA 1NTMD 3WC8A 1USDA 1QL4A 2PFXA 5CBNA 4IFFA 5KTBA 4WQBA 3L4OA 1JY3P 3VMAA 1T3JA 2KUBA 4Y99C 1Q81Q 1BE3E 2XZRA 2G3AA 1KN7A 1OAEA 4RESB 3CCUP 3O6QB 1CIEA 3RL0B 3CYTI 1S2EA 5DJQC 1OVRA 3H1KG 3SLEA 1CRCA 3ZBMA 2FYUJ 3PLNA 1CC5A 2V7QH 4KHXA 1GIWA 3TSIA 1AKKA 2YIUB 2XV5A 3RL0C 1W2LA 3B5NB 2ZXXA 3TK1A 1M8OB 1NTKG 4LGDE 2W83C 1I8PA 1U57A 4OH8B 3VRDA 4PD4E 5APWA 2P2UA 2YIUC 1N73B 1N8RQ 3B5NC 4AYCA 1IQCA 1LTTC 4GOEA 1YICA 3I5CA 3H1LJ 1VQ9P 2WPRA 1EXJA 2QM8A 1RE4C 1H32B 3PHLA 3D70A 3HTKA 1L0LG 3WFBC 1KYOE 2M0BA 3FGAD 1F1FA 3VOPA 1N73C 4PV1D 2OARA 4WQ9A 1EXIA 3Q5RA 1ZRTD 5AW0B 3C2CA 1FE6A 3AE1C 1S1CX 1KILB 1KV9A 1N15A 5GTIV 1IFPA 2JWAA 5KAIH 5KJ7A 1S9KE 1LC1A 1RF1B 2ZT9B 1ZMEC 3A0HE 3BRVB 3CX5D 1GU4A 1KILC 4N78D 3SSUA 2KXPB 1M1JA 3CCJP 1WT6A 2HLOA 1JTHB 1DW3A 2OZ1B 1NU1D 3IF4A 2KNCA 2ZT9C 1DD3A 4I6MC 5B66V 3TDKA 3H1KJ 2WQYC 1FHBA 4RO0A 4K3IA 3TGUE 2K1AA 3BRTB 4PWAA 2C1DA 3CCLP 1X8YA 2QIWA 1NJIQ 3G4SP 1GJQA 1EDKA 2B12B 2WWWA 2HG5D 4NPDA 2FYZA 3NBTA 3CMEP 1GW3A 1NAYA 1NTKJ 1NMLA 2AIUA 2P67A 1YFCA 1RQVA 1E5WA 1ZP0C 3NMDA 3LW5H 3X39A 4H0LC 5TISH 1J1DC 3Q1MA 3KHUA 5CCGD 1FU1A 1PPJE 1OIPA 2B87B 1JCDA 1CTYA 1DH3A 5KLVD 1GD2E 1J1EC 1JY2O 1L0LJ 1W5CT 4L76A 4N6JA 3HUSA 4OWFA 3S1KA 1JCCA 4WQCA 3H1HG 1A02F 3CX5W 3R4YA 1KD1Q 1BSHA 2J58A 3RLMA 3L4MA 3WU2V 2W6BA 4I1LA 1AOFA 2C8SA 1A8CA 2IYOA 4GKGA 3IR9A 3H32B 4WBAA 4EYYQ 2BCCG 3DP5A 1ZOYC 3L70E 2K9YA 3H1IE 1YTCA 1PP9D 2Q9IA 3CLQA 1T3UA 1YEBA 1NYHA 5E79V 3LIEA 1IRVA 1KQGB 3B71A 3KDPB 1G2CA 3V2NA 4PJ0H 1HGZA 1JMMA 2C9NY 3RK2C 2OQQA 2O1KA 4AAMA 3VYIA 1CI6A 2ZYDA 5KAIE 1BL9A 1HZVA 4L74A 2WPSA 1SQVE 1OW8A 5APYA 1PPJG 1FI9A 2M5AA 1FI3A 1S5LH 1IK7A 2NPSD 3G9RA 1IZL0 1CHIA 2WSFH 3ABVC 2O01J 3VP8A 1H89A 2BPBB 2DW3A 5AVVB 1OVVA 2IBZE 1CIFA 3OCDA 4XYDB 1S72P 4UB6V 2XU6A 1SQQD 2WSEH 1NTZD 4TLFA 1CO6A 1I6EA 4HH2A 1C7MA 2WMMA 1N7SA 2Z5HA 3HE4A 2PGDA 1CCHA 4ZNCA 2OYOA 5CJ0A 1CYCA 2O1JA 1SFCB 3L75E 3KYQA 5DFSA 2AEFA 3JBTB 2QE7H 2JR8A 3U1CA 4H13D 3M9QA 3L70G 3H1HJ 3H1IG 1NOHA 3PH2B 4EICA 1VQ6P 1VQ7P 3TNUA 2HODB 1J2JB 1USEA 3CX5H 1SFCC 1SQXD 4D6TE 2R5BA 1RF0A 1NHLA 3N4XA 1EZVG 5C0ZA 1CYJA 4Z1MH 1T2KD 4O1WA 3HD7B 4CPGA 3HUSB 2FFDC 2BLFB 2N3BA 1FZCA 2KSJA 1MG2D 3CI9A 1SQBD 1G1IA 1URQB 1SQVG 5B5EV 2Q1KA 2H88C 3RMZA 1NGMB 1I8OA 5AVZB 1I6DA 1NTME 2BEQD 2E76B 3HD7C 3CCVP 2XNDH 3C8VA 2CA3B 3N7NA 5CCHD 4EIDA 2IBZG 3CX5I 1URQC 1AJYA 1MUUA 2UWJE 3O8ZA 4L3HA 2WSSH 2QJKC 5AVTB 4H44B 1DIPA 2AI5A 1RQUA 1N2DC 4L75A 1MG3D 1DIQC 1MV8A 1IFMA 2KOGA 3NXSA 1YQ3C 1IJDB 5KAFE 351CA 3GF7A 1GKSA 1JY2P 1L9BC 3L75G 4JYCA 1LC2A 4PJ0E 5EFWB 1FJ0A 2N1TD 4XA4A 1VF5D 2CXBA 3O6QA 4N3YB 2M5AB 1F1CA 3EQ2A 3ITKA 1OWAA 2AEJA 2G8YA 2M3BA 1IFDA 3MK7C 1L0ND 2A06G 1NWQA 4WQ8A 1QEXA 5AVXB 3OCDB 1HJ5A 3GLMA 3L70J 1JY3N 1S5LE 3H1IJ 2P10A 2MKVA 4WY4B 1VQMP 2Q5UA 5CIBB 4DJGA 3B5NA 1MFZA 1EQ7A 1QVFO 1M1KQ 2CA4B 3HE4B 1Q7YQ 2GUSA 1NTMG 3M9HA 2IX7C 1RE4A 4GEDB 2R32A 2L4DA 4LC1A 3Q5PA 2NZ2A 2XNXA 4WY4C 2PRRA 2SPZA 1YTZI 2ZVNB 4ZKUA 3CMAP 2ZZS1 1N73A 3VMZA 2KS1B 5AVQB 1ZRTE 3OA8A 1C6RA 1SQVJ 1VQ4P 3TNUB 1SQPK 1H1OA 3BASA 3OAKA 1I5TA 3CCRP 3HQ8A 3SXTA 1JEKA 1H32A 1SQPE 5CBOA 2LXCB 4AAOA 1LJ2A 1H0TB 2HFED 1YEAA 4I7ZB 1YCCA 5APVA 5DJTB 2JWDA 2H7HA 1EDJA 4NFGB 4NPFX 1YJ9P 1BSNA 3CX5E 4GOFA 1LGHB 1NNOA 4N78E 4R4MA 4GT1A 3O1YA 2H8PD 4WWIA 5IY51 3NWVA 2QSIA 4QAOA 1LTJC 1KILA 3U59A 1NU1E 2Y0CA 3V6IA 1QYZA 1UIIA 2CPSA 1CNOA 2FXPA 2K9JB 1LWUB 2ZYGA 1H9XA 4KT0J 2CE1A 2OTLP 1DW0A 3L73D 3L75J 4N0KA 1Z56A 4WQAA 2HV4A 3VMXA 5KJ7D 3E1RA 2FY8A 1LP1A 3HQ7A 5AW7B 3OA7A 5H2FE 1LWUC 1DW2A 3PXSA 1L0LK 1JTHA 3LW5J 2OYIB 2OZ1A 1BGYD 4D6TJ 1GL2B 2K37A 2WSCH 1LTIC 4JCGA 2LXBA 2L91A 2ZOOA 2V4HA 3BCCD 5DJQB 2IZ1A 3AE9C 2P1JA 4HB1A 1Q2NA 2OYIC 5KLVE 2KSEA 1GL2C 1H33B 2YNYA 2IZ0A 1SQPG 1DW1A 1NTMJ 1KV4A 3AE8C 2QEXP 3M97X 1CEDA 1JOCA 2E75B 3M91A 1CIGA 1NMIA 1HGVA 2ZXEB 3G6EP 1CORA 2JEEA 2B87A 1SLQA 1NAFA 2Y0EA 1NU1G 4L3GA 2JO1A 4L73A 1M70A 2E75C 4R4LA 2MTAC 1PP9E 1LMSA 4JBZA 2P7JA 2Q7CA 3L4FA 3DR0A 1JO5A 3AEGC 2QA4P 1LTGC 3OA8B 3H1LD 2C0XA 3G71P 4AX3A 2B9BA 2W6AA 2C1VA 1GDVA 3H32A 1C2NA 3L72D 1W5CE 4HKZH 2GA1A 3CPWO 1AV1A 2MJZA 2Z4EA 1CRJA 5CIGB 5GTHV 1ETPA 2WSFJ 1YIJP 1BE3G 3M0AA 4IFMA 2KLUA 3Q3DA 1AQTA 3IAOA 2IYPA 3IFMA 1VDFA 4P4QB 1DX7A 2WSEJ 2N9YB 1AFOA 2ZXYA 2VRSA 1SQQE 1NTZE 4YPCA 3KZIH 3MGNA 2YKQA 3M06A 2D2CB 1AVYA 1LP1B 3TF5A 2OYHB 1M56D 4JF7A 1SQPJ 3WFEC 3VTPC 1BCCD 4C7NB 3WUUA 1CTZA 1P84D 1RZ5A 1CW5A 3A7OA 2D2CC 3OW2O 4O9BA 2BASA 1DT1A 1YTZT 2OYHC 4H0LB 3O5CA 1J1DB 4QMAA 1NTKD 1SQXE 1NU1J 2M8RA 1LFMA 2GIWA 1COTA 1SFCA 1LTBC 4ASVA 1N7SD 2YKOA 3RBXA 1J1EB 3L71D 1SQBE 1FZBA 1YHQP 3D6YA 1FZAA 2HODA 1RE3C 2FFDA 3A2AA 2N1TC 1M7LA 1VF5C 1LNQA 3PH0A 1QGKB 1NKNA 2WT7A 2HR3A 5AURA 2C9LY 1PGOA 3A0BH 1R0QA 3VN0A 4IOIH 3HD7A 2XKMA 2YXRB 2QRXA 2JDIH 1SQQG 3AEFC 3C1LA 2EXVA 1URQA 1VPCA 1Q82Q 2W6JH 2OTJP 2AEMA 4FA9A 1BE3J 3RL0g 2A45H 1CHJA 1PZQA 2QJYC 3A0HV 5K5GB 3ZCFA 1S5LX 1KB0A 3RK3D 5APSA 1BDDA 1WRGA 1PGJA 3T97A 2P58A 4OGQB 1AA0A 3A5TA 3RK2B 2PCCB 3AEAC 4FA4A 1K3GA 3TGUG 5KAFH 2OTKE 3FX0A 1XTGB 4JQ0D 1FZEA 4IL6H 3DMIA 1L0NE 4OGQC 1A2SA 4XE5B 2A45I 3H1JD 1KQLA 5L8RJ 1PP9J 5CIDB 1SQVK 1Y8AA 3B4SA 4DOJA 1N9CA 1SQBG 1TU3F 2BEZF 3A9FA 2DGEA 3D71A 2L5GB 1E2RA 2I8FA 1GZLA 2V08A 3KZIE 3Q2YA 1E8EA 2KZJA 1ZN5A 2R44A 5B5EE 2AXCA 1EB7A 2YXQB 2YCCA 1MKMA 4UB8H 3CCQP 2D0SA 2E74B 4V2KA 2E43A 2K88A 2C9XB 3RL0D 2N9BA 5AW6B 3V5BA 4WY4A 2AXTH 2FYNB 1GW4A 4EIEA 1CCRA 3SWSA 1OX3A 2FWLA 4WQ7A 1L4AC 1IZNB 1PIXA 1QX8A 3ORVA 5CHXA 2E74C 1RAQA 3K5BA 1HCMA 1ZR4A 2J5UA 1YNRA 3B5ND 1C6SA 1YIQA 2N18B 3H1HD 4W7ZA 5CJ4A 2FYNC 1SQQJ 1CSXA 1NTZJ 1AYGA 3EWKA 2GC4D 2KS1A 2Z5IA 2WTYA 1K04A 1ZXGA 3L36A 1A56A 2O3JA 2FFDB 2QJPB 1YYCA 1H0TA 1OZHA 4BWNA 1LTJA 1KFNA 2N18C 3L73E 3D6ZA 2WT7B 1L9JC 1M60A 2BCCD 1VQPP 1C52A 1HRCA 2VHDA 2DVHA 3TGUJ 1PGPA 1IO3A 3O20A 2QJPC 1RAPA 3WUIA 2Y9YA 2WSCJ 1CSWA 3A0BE 1T8ZA 3MZWB 4GIFA 2QJKB 1E29A 5C39A 1NTMK 2K9JA 1LWUA 5KAIV 1FBMA 2B89A 3PXTA 2FBWC 1KYOW 1JY3O 3V2QA 1DIIC 2KB7P 5H2FH 1HZUA 1FJPA 1KILD 1K3HA 4B86A 3BCCE 3T97B 2IFNA 4OVNF 5AW1B 3GF3A 3H25A 1SQBJ 1YI2P 2B10B 3AE4C 5AW4B 2ZT9D 4PV1B 2OYIA 5CIFB 1GU5A 1GL2A 2KLVA 1QKSA 1P84I 3PXWA 1R5SA 2ZAEB 1KQSO 2HYNA 1NO4A 1KORA 2V7QJ 3CL3D 2KP8A 1Y9BA 3OJAB 3MK7B 1NVOA 4IL6E 2RH0A 4ZMDA 4Q5PA 2WVRA 4PV1C 3MUDC 3EFGA 2MHMA 1CZQA 4WVZA 2E5YA 4WQEA 4EI2A 1H33A 3U1AA 5GTIH 2FXOA 4AALA 2V07A 4PW9B 4BRYB 5CIEB 1ZR2A 1RZ6A 3TYYA 3ZOWA 2WITA 4L1QA 4H0JA 4D6TG 3L73G 1OFCX 1M57D 3R2PA 5TISV 4XFJA 5EXQA 2IDBA 4U7JA 1FOSF 1CRIA 2YK3A 4DY9A 1JB0J 4I2LC 3SWYA 4DT0A 4UB8E 2N3YA 3CXHD 3M0DC 2KIKA 1AVOA 2R3CA 1DEBA 3L72E 1LTAC 1EZVD 1FDOA 4HJGH 3L74D 5B66H 3JC22 1NH4A 2AXTE 1L0NJ 1A02J 4W80A 3AE3C 5CYTR 1YITP 3JCUH 4U3FD 3BCCG 1H8AA 3P8CD 3EFFK 1QL3A 1U74B 1PV3A 4LJIA 1N90A 4RKUJ 2I1JA 1JMBA 1X0TA 1K9MQ 1LTJB 3FXDA 2IBZD 3Q5SA 5APXA 5KAFV 4FAVA 3CD6P 4FA5A 2RKLA 1NU1K 3UIAA 1CRHA 1FZFA 5AVYB 5CCGC 5APTA 4PJ0V 1BCCE 5C9MA 1QVGO 1P84E 1VQ8P 1CIHA 3CC2P 1JM0A 3F5HA 1UIXA 3VMYA 3PRJA 3ZOXA 4YXWH 1LT1A 2CE0A 3B8EB 1NTKE 4ASWA 3WU2H 2OYHA 1HJ4A 3CWBD 3CXHW 3AE6C 1KYOI 1S5LV 3AE2C 4EOTA 1OVUA 2RN0A 4C7NA 3IN6A 2A06D 1FZCC 3L73J 2I1KA 3ZDMA 3L71E 1VQLP 3H6PA 1FC2C 2Q6QA 5E79H 5KLVK 2B88A 4NPEA 1RE3A 3KQGA 2WPVB 4JPZB 2KK7A 1D7MA 1QL1A 1FAVA 2H89C 2Q3IA 3MHVA 3CC4P 5GTIE 2FYUD 3BCCJ 3RN0A 3L37A 451CA 2NPSB 1SFCD 2JP3A 2WZ7A 3BVHA 2JJLA 2ORLA 2QM7A 1DVHA 3SJLA 4BXLA 1R5LA 1BCCG 2BH5X 3JSVC 5AW5B 3RK3E 2C1UA 4AANA 3GHGB 2NPSC 4C46A 4UB6H 1KX2A 3AEBC 2NRGA 3NTNA 1GK6A 5B66E 3HD7D 3VYMA 3E1IA 3NFQA 3JCUE 3LIDA 1HF9A 4H13B 3GHGC 2KZIA 5M1BA 2BH4X 4C7RA 1URQD 1KMIZ 3HE5B 1H88A 5H2FV 3H1JE 1HWTC 1SS1A 2N9IA 2ZBOA 1LT9B 1VQ5P 3L71G 1YJWP 1C75A 1PGQA 2E76D 1ZZHA 2YMYA 5B6QA 4H13C 5CIHB 2N9JA 2B11B 5KLVG 3II6A 1QN2A 4H44D 3L72J 1S3JA 1DEEG 1LT9C 1J3SA 1CSBA 1NIRA 1OW6A 2QG4A 1B7VA 1KB9D 1BDCA 3CXHH 1SQQK 1NTZK 2ZFCA
chains in the Genus database with same CATH topology
1DVVA 1C2RA 2LITA 4L3HA 4D6TD 3DMIA 2AI5A 3GG2A 2YQBA 1A2SA 3SVWA 4XXLA 1MG3D 1HH7A 2FRCA 3H1JD 4UB8V 1DIQC 1SQPD 2GB8B 5CIDB 1N9CA 2AXTV 351CA 1GKSA 1L9BC 3H1KD 3ZOYA 3A9FA 2DGEA 1E2RA 2I8FA 1LC2A 1OCDA 2V08A 2JQRA 1FJ0A 1E8EA 1NTMD 3WC8A 1QL4A 1LS9A 1EB7A 2CXBA 2YCCA 2D0SA 4WQBA 3L4OA 2Y0DA 4V2KA 3VMAA 1FOCA 1F1CA 2C9XB 3ITKA 2B0ZB 1WVEC 155CA 3MK7C 1L0ND 2FYNB 4EIEA 4WQ8A 1CCRA 1OAEA 3SWSA 3OCDB 1HJ5A 2FWLA 1CIEA 4WQ7A 2XTSB 3CYTI 3ORVA 2BCNB 3VNWA 1RAQA 3ZIYA 1I55A 1HCMA 5DJQC 2JTIB 5CIBB 1YNRA 3SLEA 1CRCA 1C6SA 1YIQA 2N18B 3ZBMA 3H1HD 3PLNA 2CA4B 4J20A 1CC5A 1CSXA 1AYGA 2GC4D 2KS1A 1CXCA 1S6VB 1L0LD 4GEDB 1GIWA 2L4DA 1AKKA 1A56A 2O3JA 2YIUB 3TYIA 1W2LA 2QJYB 2QJPB 1M6ZA 2ZZS1 1I8PA 3ZOOA 2N18C 3OA8A 1C6RA 1BE3D 1L9JC 1M60A 2BCCD 1H1OA 3VRDA 1C52A 1HRCA 1I5TA 2VHDA 3HQ8A 3SXTA 1H32A 5TJHA 2DVHA 4AAOA 1IO3A 3O20A 1RAPA 3WUIA 1IQCA 1YEAA 1YCCA 1CSWA 1YICA 4NFGB 4FANA 2QJKB 1E29A 1H31A 1H32B 3PHLA 5KAIV 1NNOA 3WFBC 3PXTA 1KYOW 3O1YA 1DIIC 5IY51 1HZUA 1F1FA 3NWVA 2B4ZA 1C6OA 1K3HA 4QAOA 2Y0CA 1QYZA 1CNOA 2K9JB 4KMGA 4WQ9A 1H9XA 2CE1A 5KLIB 1ZRTD 1DW0A 2B10B 3L73D 4N0KA 3C2CA 4PD4D 4WQDA 1KV9A 1N15A 4WQAA 5GTIV 5CIFB 2HV4A 2JWAA 1QKSA 3PXWA 1CTJA 3HQ7A 1LC1A 1HROA 1DW2A 3PXSA 2OZ1A 3FWLA 3CX5D 3MK7B 1BGYD 1GQ1A 1KIBA 4Q5PA 2MHMA 1KYOD 4JCGA 4WQEA 1MZ4A 2L91A 1H33A 3NBSA 2Q3EA 3PTZA 2ZOOA 2V07A 4AALA 4PW9B 1U75B 5CIEB 1RZ6A 1DW3A 2OZ1B 1NU1D 3BCCD 5DJQB 3ZOWA 4GYDA 1JDLA 4L1QA 4H0JA 1CHHA 5B66V 3TDKA 4EIFA 3CP5A 1H33B 1FHBA 4K3IA 1KX7A 4PWAA 2C1DA 5TISV 1DW1A 5EXQA 1GJQA 2KNCB 1CRIA 2B12B 2BGVX 2YK3A 4DY9A 3NBTA 3M97X 1CEDA 2N3YA 3CXHD 1NMLA 2C1DB 2AIUA 1EZVD 1CIGA 1NMIA 1CORA 1YFCA 3L74D 4A7PA 3X39A 5CYTR 2Y0EA 4U3FD 4L3GA 3KHUA 5DF5A 1QL3A 5KKZB 3O0RC 1M70A 1U74B 1CTYA 2MTAC 5KLVD 4LJIA 1LMSA 1VYDA 3DR0A 1N90A 3TGUD 2C2CA 2RMZA 1W5CT 3OA8B 3H1LD 1N50A 2IBZD 4AX3A 1CRGA 1WEJF 2C1VA 1GDVA 1IRWA 4WQCA 4FA1A 3CX5W 1C2NA 3L72D 5KAFV 4FAVA 4FA5A 3RLMA 3L4MA 3WU2V 1AOFA 1CRHA 2C8SA 1A8CA 2GC7D 1H31B 4PJ0V 3KZIV 5C9MA 1CRJA 5CIGB 5GTHV 1ETPA 1CIHA 1PPJD 1HJ3A 3DP5A 1YTCA 1PP9D 2LIRA 3PRJA 3ZOXA 4P4QB 1YEBA 5E79V 1IRVA 2N9YB 1CXAA 3WFDC 2CE0A 3HQ9A 1HJ4A 2ZXYA 3CWBD 3CXHW 1S5LV 1I54A 2RN0A 2A06D 4MU8A 3TF5A 4EDFA 4AAMA 2ZONG 1BL9A 1HZVA 3WFEC 1BCCD 4Y5RA 1CTZA 2PCBB 1P84D 1RZ5A 1FI9A 3GW6A 1FI3A 3L70D 3H1ID 1DT1A 1IZL0 2PACA 1CHIA 2D0WA 2BPBB 3O5CA 1CIFA 3OCDA 1NTKD 4XYDB 2FYUD 4UB6V 1SQQD 4H0KA 1CSVA 1LFMA 1NTZD 3RN0A 2GIWA 451CA 1CSUA 1CO6A 1I6EA 1COTA 1C7MA 3A0BV 3CU4A 2ORLA 1GU2A 1CCHA 1DVHA 3SJLA 3L71D 1CYCA 2BH5X 4RSZA 1FI7A 2C1UA 4AANA 1SQVD 5DFSA 3JBTB 1KX2A 3PH2B 4EICA 3WFCC 5AURA 1R0QA 3VYMA 4RJTA 1FCDC 1SQXD 2BH4X 2EXVA 5C0ZA 5H2FV 1AOQA 1CYJA 4FA9A 4FB1A 2N9IA 4O1WA 1CHJA 2ZBOA 4YE1A 3RN1A 2BLFB 2N3BA 1C75A 3A0HV 4IL6V 1CYIA 1ZZHA 1CRYA 1MG2D 4O1QA 1SQBD 3ZCFA 5B6QA 3HQ6A 5CIHB 1KB0A 5B5EV 3L75D 1H9YA 2N9JA 2B11B 3RMZA 1I8OA 2PCCB 4FA4A 1QN2A 1I6DA 1K3GA 5CICB 2CA3B 1J3SA 1NIRA 2QG4A 1B7VA 1KB9D 4EIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVV A;  1C2R A;  2LIT A;  4L3H A;  4D6T D;  3DMI A;  2AI5 A;  3GG2 A;  2YQB A;  1A2S A;  3SVW A;  4XXL A;  1MG3 D;  1HH7 A;  2FRC A;  3H1J D;  4UB8 V;  1DIQ C;  1SQP D;  2GB8 B;  5CID B;  1N9C A;  2AXT V;  351C A;  1GKS A;  1L9B C;  3H1K D;  3ZOY A;  3A9F A;  2DGE A;  1E2R A;  2I8F A;  1LC2 A;  1OCD A;  2V08 A;  2JQR A;  1FJ0 A;  1E8E A;  1NTM D;  3WC8 A;  1QL4 A;  1LS9 A;  1EB7 A;  2CXB A;  2YCC A;  2D0S A;  4WQB A;  3L4O A;  2Y0D A;  4V2K A;  3VMA A;  1FOC A;  1F1C A;  2C9X B;  3ITK A;  2B0Z B;  1WVE C;  155C A;  3MK7 C;  1L0N D;  2FYN B;  4EIE A;  4WQ8 A;  1CCR A;  1OAE A;  3SWS A;  3OCD B;  1HJ5 A;  2FWL A;  1CIE A;  4WQ7 A;  2XTS B;  3CYT I;  3ORV A;  2BCN B;  3VNW A;  1RAQ A;  3ZIY A;  1I55 A;  1HCM A;  5DJQ C;  2JTI B;  5CIB B;  1YNR A;  3SLE A;  1CRC A;  1C6S A;  1YIQ A;  2N18 B;  3ZBM A;  3H1H D;  3PLN A;  2CA4 B;  4J20 A;  1CC5 A;  1CSX A;  1AYG A;  2GC4 D;  2KS1 A;  1CXC A;  1S6V B;  1L0L D;  4GED B;  1GIW A;  2L4D A;  1AKK A;  1A56 A;  2O3J A;  2YIU B;  3TYI A;  1W2L A;  2QJY B;  2QJP B;  1M6Z A;  2ZZS 1;  1I8P A;  3ZOO A;  2N18 C;  3OA8 A;  1C6R A;  1BE3 D;  1L9J C;  1M60 A;  2BCC D;  1H1O A;  3VRD A;  1C52 A;  1HRC A;  1I5T A;  2VHD A;  3HQ8 A;  3SXT A;  1H32 A;  5TJH A;  2DVH A;  4AAO A;  1IO3 A;  3O20 A;  1RAP A;  3WUI A;  1IQC A;  1YEA A;  1YCC A;  1CSW A;  1YIC A;  4NFG B;  4FAN A;  2QJK B;  1E29 A;  1H31 A;  1H32 B;  3PHL A;  5KAI V;  1NNO A;  3WFB C;  3PXT A;  1KYO W;  3O1Y A;  1DII C;  5IY5 1;  1HZU A;  1F1F A;  3NWV A;  2B4Z A;  1C6O A;  1K3H A;  4QAO A;  2Y0C A;  1QYZ A;  1CNO A;  2K9J B;  4KMG A;  4WQ9 A;  1H9X A;  2CE1 A;  5KLI B;  1ZRT D;  1DW0 A;  2B10 B;  3L73 D;  4N0K A;  3C2C A;  4PD4 D;  4WQD A;  1KV9 A;  1N15 A;  4WQA A;  5GTI V;  5CIF B;  2HV4 A;  2JWA A;  1QKS A;  3PXW A;  1CTJ A;  3HQ7 A;  1LC1 A;  1HRO A;  1DW2 A;  3PXS A;  2OZ1 A;  3FWL A;  3CX5 D;  3MK7 B;  1BGY D;  1GQ1 A;  1KIB A;  4Q5P A;  2MHM A;  1KYO D;  4JCG A;  4WQE A;  1MZ4 A;  2L91 A;  1H33 A;  3NBS A;  2Q3E A;  3PTZ A;  2ZOO A;  2V07 A;  4AAL A;  4PW9 B;  1U75 B;  5CIE B;  1RZ6 A;  1DW3 A;  2OZ1 B;  1NU1 D;  3BCC D;  5DJQ B;  3ZOW A;  4GYD A;  1JDL A;  4L1Q A;  4H0J A;  1CHH A;  5B66 V;  3TDK A;  4EIF A;  3CP5 A;  1H33 B;  1FHB A;  4K3I A;  1KX7 A;  4PWA A;  2C1D A;  5TIS V;  1DW1 A;  5EXQ A;  1GJQ A;  2KNC B;  1CRI A;  2B12 B;  2BGV X;  2YK3 A;  4DY9 A;  3NBT A;  3M97 X;  1CED A;  2N3Y A;  3CXH D;  1NML A;  2C1D B;  2AIU A;  1EZV D;  1CIG A;  1NMI A;  1COR A;  1YFC A;  3L74 D;  4A7P A;  3X39 A;  5CYT R;  2Y0E A;  4U3F D;  4L3G A;  3KHU A;  5DF5 A;  1QL3 A;  5KKZ B;  3O0R C;  1M70 A;  1U74 B;  1CTY A;  2MTA C;  5KLV D;  4LJI A;  1LMS A;  1VYD A;  3DR0 A;  1N90 A;  3TGU D;  2C2C A;  2RMZ A;  1W5C T;  3OA8 B;  3H1L D;  1N50 A;  2IBZ D;  4AX3 A;  1CRG A;  1WEJ F;  2C1V A;  1GDV A;  1IRW A;  4WQC A;  4FA1 A;  3CX5 W;  1C2N A;  3L72 D;  5KAF V;  4FAV A;  4FA5 A;  3RLM A;  3L4M A;  3WU2 V;  1AOF A;  1CRH A;  2C8S A;  1A8C A;  2GC7 D;  1H31 B;  4PJ0 V;  3KZI V;  5C9M A;  1CRJ A;  5CIG B;  5GTH V;  1ETP A;  1CIH A;  1PPJ D;  1HJ3 A;  3DP5 A;  1YTC A;  1PP9 D;  2LIR A;  3PRJ A;  3ZOX A;  4P4Q B;  1YEB A;  5E79 V;  1IRV A;  2N9Y B;  1CXA A;  3WFD C;  2CE0 A;  3HQ9 A;  1HJ4 A;  2ZXY A;  3CWB D;  3CXH W;  1S5L V;  1I54 A;  2RN0 A;  2A06 D;  4MU8 A;  3TF5 A;  4EDF A;  4AAM A;  2ZON G;  1BL9 A;  1HZV A;  3WFE C;  1BCC D;  4Y5R A;  1CTZ A;  2PCB B;  1P84 D;  1RZ5 A;  1FI9 A;  3GW6 A;  1FI3 A;  3L70 D;  3H1I D;  1DT1 A;  1IZL 0;  2PAC A;  1CHI A;  2D0W A;  2BPB B;  3O5C A;  1CIF A;  3OCD A;  1NTK D;  4XYD B;  2FYU D;  4UB6 V;  1SQQ D;  4H0K A;  1CSV A;  1LFM A;  1NTZ D;  3RN0 A;  2GIW A;  451C A;  1CSU A;  1CO6 A;  1I6E A;  1COT A;  1C7M A;  3A0B V;  3CU4 A;  2ORL A;  1GU2 A;  1CCH A;  1DVH A;  3SJL A;  3L71 D;  1CYC A;  2BH5 X;  4RSZ A;  1FI7 A;  2C1U A;  4AAN A;  1SQV D;  5DFS A;  3JBT B;  1KX2 A;  3PH2 B;  4EIC A;  3WFC C;  5AUR A;  1R0Q A;  3VYM A;  4RJT A;  1FCD C;  1SQX D;  2BH4 X;  2EXV A;  5C0Z A;  5H2F V;  1AOQ A;  1CYJ A;  4FA9 A;  4FB1 A;  2N9I A;  4O1W A;  1CHJ A;  2ZBO A;  4YE1 A;  3RN1 A;  2BLF B;  2N3B A;  1C75 A;  3A0H V;  4IL6 V;  1CYI A;  1ZZH A;  1CRY A;  1MG2 D;  4O1Q A;  1SQB D;  3ZCF A;  5B6Q A;  3HQ6 A;  5CIH B;  1KB0 A;  5B5E V;  3L75 D;  1H9Y A;  2N9J A;  2B11 B;  3RMZ A;  1I8O A;  2PCC B;  4FA4 A;  1QN2 A;  1I6D A;  1K3G A;  5CIC B;  2CA3 B;  1J3S A;  1NIR A;  2QG4 A;  1B7V A;  1KB9 D;  4EID A; 
#chains in the Genus database with same CATH topology
 2W8Z A;  2LIT A;  2HPC B;  3GMA A;  1T2K C;  2YKP A;  5B5E H;  2FRC A;  2E5T A;  1EDI A;  1SQP D;  1GTW A;  2R3S A;  4GDO A;  1ZW0 A;  2YO3 A;  3CC7 P;  1L4A A;  1YJN P;  3H1K D;  3ZOY A;  3VP9 A;  3WU2 E;  3H1H E;  3C9I A;  1OCD A;  2JQR A;  1PP9 G;  1U7J A;  5CCH C;  3SFE C;  1LS9 A;  1SQX K;  3CXH I;  1FS0 E;  1N7L A;  1DD4 A;  1EZV I;  2Y0D A;  3V2P A;  1FOC A;  1RH5 B;  1RF1 C;  2B0Z B;  4WY4 D;  1BCC J;  2N1T B;  1WVE C;  2BCC E;  5E79 E;  2I8D A;  2POH A;  155C A;  1VF5 B;  1K73 Q;  1HH0 A;  1HUC A;  3H1J G;  1KC8 Q;  3SFD C;  4JYB A;  1SQB K;  3QWO C;  3P8M C;  2XTS B;  2BCN B;  3VNW A;  3ZIY A;  1I55 A;  2JTI B;  4J20 A;  1CXC A;  1S6V B;  1L0L D;  2H43 A;  2IBZ I;  1KIL E;  1PFI A;  4IL6 X;  3KPE A;  3TYI A;  2QJY B;  1RY3 A;  3MD0 A;  2FXM A;  1M6Z A;  3MIW A;  3L71 J;  3L35 A;  3W68 A;  3ZOO A;  1IFI A;  1FJK A;  1NTZ G;  1BE3 D;  5KLV J;  5BVZ A;  4UB6 E;  5TJH A;  1JUN A;  4YXD C;  3MP7 B;  5AW2 B;  1QLE D;  4FAN A;  1OXZ A;  1H31 A;  2B4Z A;  1C6O A;  1IFN A;  3RGU A;  1GMJ A;  3MUD A;  4IFD K;  4KMG A;  1IK9 A;  1L0N K;  1SQX G;  3HTK B;  5KLI B;  2IPP A;  4WQD A;  4PD4 D;  2YO2 A;  2CK3 H;  3RBZ A;  1GL2 D;  2E42 A;  1CTJ A;  1HRO A;  2CPB A;  1GK4 A;  3CXH E;  1EZV E;  3PJS K;  3HRN A;  5KLI C;  4AQR D;  4BRY A;  3FWL A;  3PP5 A;  3L74 E;  1GQ1 A;  1KIB A;  3V2R A;  1T6A A;  1OMI A;  1FDI A;  3M0D A;  1KYO D;  1MZ4 A;  1L4A B;  3H1J J;  2K3R A;  4U3F E;  2Y9Z A;  3NBS A;  2Q3E A;  3PTZ A;  1JY2 N;  5APQ A;  1MFT A;  3KXD A;  3P8C E;  3WUT A;  1FDM A;  1U75 B;  1GDT A;  3S4R A;  4GYD A;  1JDL A;  1CHH A;  5DJU B;  3I55 P;  4DCK A;  4EIF A;  1M1J B;  3CP5 A;  1HBW A;  5KJ7 C;  2E75 D;  1MZ9 A;  2QVA A;  1KX7 A;  3E7K A;  3SWF A;  1M90 Q;  3M9B A;  1EC5 A;  1HJB A;  3F89 A;  2KNC B;  2BGV X;  2IFM A;  3S9O A;  1S9K D;  1X9V A;  1W2B O;  1SP4 A;  2C1D B;  1M1J C;  1KB9 H;  5AW3 B;  4A7P A;  5AVW B;  1N86 A;  2PAJ A;  3SWK A;  5DF5 A;  5KKZ B;  3O0R C;  5CCG A;  1L0N G;  1X79 B;  1SVF A;  3WMM 0;  1VYD A;  3TGU D;  2PP6 A;  1IC2 A;  2W27 A;  3AE7 C;  2C2C A;  2RMZ A;  1P84 H;  3AED C;  1R8E A;  3G3Z A;  1N50 A;  3CWB E;  5TIS E;  4LLH A;  5KKZ C;  1VQO P;  1EDL A;  1CRG A;  1WEJ F;  2GUV A;  1IRW A;  4FA1 A;  1SQX J;  1BGY E;  2A06 E;  1LTS C;  1KB9 I;  3L74 G;  4WB4 A;  2BCC J;  2ITA A;  1HJ0 A;  4U3F G;  3USS A;  2GC7 D;  1H31 B;  1KTM A;  1NKZ B;  3KZI V;  1KZU B;  2O01 N;  1PPJ D;  1HJ3 A;  2ZJS E;  2XDJ A;  2LIR A;  3A3Y B;  1K8A Q;  1L2P A;  4M3L A;  2D2C D;  3HUS C;  2FYU K;  1E79 H;  1CXA A;  3WFD C;  4K3A A;  4KJM A;  3HQ9 A;  2FYU E;  2YMK A;  5BU8 B;  2FKW B;  1I54 A;  5GTH H;  1Q86 Q;  1W2E A;  3MTU E;  1FZG A;  2E76 C;  4MU8 A;  1G2C B;  4AUW A;  5APU A;  4EDF A;  1AQ5 A;  2ZON G;  1RHZ B;  3I56 P;  5AW8 B;  3CCE P;  2JKV A;  1S4X A;  4H0L D;  4Y5R A;  2PCB B;  4H44 C;  5AVS B;  1YQ4 C;  3GW6 A;  1HTL C;  1CI6 B;  3D0W A;  3L70 D;  3H1I D;  2PAC A;  1VQK P;  2NPS A;  1ZV8 A;  2D0W A;  3FXE A;  3H1L E;  1HVV A;  2R5D A;  4DZO A;  3CWB G;  2GM4 A;  4H0K A;  1KQF B;  1CSV A;  5BU5 A;  1CSU A;  1BGY G;  4MN4 C;  1Y47 A;  3GHG A;  2M3E A;  3AE5 C;  3A0B V;  3CU4 A;  1GU2 A;  3QH9 A;  2A45 G;  4RSZ A;  1FI7 A;  4PD4 H;  1SQV D;  1N7S B;  1OW7 A;  3AEC C;  3CCS P;  1YBK A;  3V4W A;  1X22 A;  3L74 J;  1KB9 E;  3HE5 A;  2OGU A;  1FOS E;  3WFC C;  1XTC C;  4RJT A;  1FCD C;  1IFJ A;  2FYU G;  1LT9 A;  4HYT B;  4U3F J;  3W67 A;  2KI7 B;  1QL2 A;  1IO4 A;  2O01 H;  1N7S C;  2ZYA A;  1KYO H;  4TT3 H;  1PL5 A;  1KFM A;  1AOQ A;  4FB1 A;  1WMK A;  2WPQ A;  1Q90 D;  4OGQ D;  4YE1 A;  3RN1 A;  4Y28 J;  3RK2 D;  1VQN P;  3BAT A;  4GOD A;  4IL6 V;  1CYI A;  1CRY A;  4O1Q A;  2J59 M;  3FWN A;  1VL2 A;  3H1K E;  4PD4 I;  3HQ6 A;  1ZLL A;  2ZVO B;  4EIJ A;  3L75 D;  1H9Y A;  4W7Y A;  1FZC B;  2HPC A;  5CIC B;  1NTK K;  1RF0 C;  5CCH A;  3H1L G;  3RK3 B;  3AEE C;  4I7Z C;  3WUV A;  3P32 A;  1K05 A;  1DVV A;  5AVR B;  3A0H H;  1C2R A;  4D6T D;  1JNM A;  3GG2 A;  3L72 G;  2YQB A;  3V4Q A;  1RF1 A;  3SVW A;  4XXL A;  1HH7 A;  3CCM P;  4ZKP A;  4UB8 V;  4K35 A;  2W90 A;  2GB8 B;  1G1J A;  5AW9 B;  3RK3 C;  2LKM A;  5CMZ A;  4YTP C;  1L4A D;  2LR2 A;  2AXT V;  4Y99 B;  2KYV A;  2E74 D;  2C0W A;  5AVU B;  3CWB J;  1U7M A;  3P7K A;  1L0L E;  5GTH E;  1BGY J;  2N1T A;  1NTM D;  3WC8 A;  1USD A;  1QL4 A;  2PFX A;  5CBN A;  4IFF A;  5KTB A;  4WQB A;  3L4O A;  1JY3 P;  3VMA A;  1T3J A;  2KUB A;  4Y99 C;  1Q81 Q;  1BE3 E;  2XZR A;  2G3A A;  1KN7 A;  1OAE A;  4RES B;  3CCU P;  3O6Q B;  1CIE A;  3RL0 B;  3CYT I;  1S2E A;  5DJQ C;  1OVR A;  3H1K G;  3SLE A;  1CRC A;  3ZBM A;  2FYU J;  3PLN A;  1CC5 A;  2V7Q H;  4KHX A;  1GIW A;  3TSI A;  1AKK A;  2YIU B;  2XV5 A;  3RL0 C;  1W2L A;  3B5N B;  2ZXX A;  3TK1 A;  1M8O B;  1NTK G;  4LGD E;  2W83 C;  1I8P A;  1U57 A;  4OH8 B;  3VRD A;  4PD4 E;  5APW A;  2P2U A;  2YIU C;  1N73 B;  1N8R Q;  3B5N C;  4AYC A;  1IQC A;  1LTT C;  4GOE A;  1YIC A;  3I5C A;  3H1L J;  1VQ9 P;  2WPR A;  1EXJ A;  2QM8 A;  1RE4 C;  1H32 B;  3PHL A;  3D70 A;  3HTK A;  1L0L G;  3WFB C;  1KYO E;  2M0B A;  3FGA D;  1F1F A;  3VOP A;  1N73 C;  4PV1 D;  2OAR A;  4WQ9 A;  1EXI A;  3Q5R A;  1ZRT D;  5AW0 B;  3C2C A;  1FE6 A;  3AE1 C;  1S1C X;  1KIL B;  1KV9 A;  1N15 A;  5GTI V;  1IFP A;  2JWA A;  5KAI H;  5KJ7 A;  1S9K E;  1LC1 A;  1RF1 B;  2ZT9 B;  1ZME C;  3A0H E;  3BRV B;  3CX5 D;  1GU4 A;  1KIL C;  4N78 D;  3SSU A;  2KXP B;  1M1J A;  3CCJ P;  1WT6 A;  2HLO A;  1JTH B;  1DW3 A;  2OZ1 B;  1NU1 D;  3IF4 A;  2KNC A;  2ZT9 C;  1DD3 A;  4I6M C;  5B66 V;  3TDK A;  3H1K J;  2WQY C;  1FHB A;  4RO0 A;  4K3I A;  3TGU E;  2K1A A;  3BRT B;  4PWA A;  2C1D A;  3CCL P;  1X8Y A;  2QIW A;  1NJI Q;  3G4S P;  1GJQ A;  1EDK A;  2B12 B;  2WWW A;  2HG5 D;  4NPD A;  2FYZ A;  3NBT A;  3CME P;  1GW3 A;  1NAY A;  1NTK J;  1NML A;  2AIU A;  2P67 A;  1YFC A;  1RQV A;  1E5W A;  1ZP0 C;  3NMD A;  3LW5 H;  3X39 A;  4H0L C;  5TIS H;  1J1D C;  3Q1M A;  3KHU A;  5CCG D;  1FU1 A;  1PPJ E;  1OIP A;  2B87 B;  1JCD A;  1CTY A;  1DH3 A;  5KLV D;  1GD2 E;  1J1E C;  1JY2 O;  1L0L J;  1W5C T;  4L76 A;  4N6J A;  3HUS A;  4OWF A;  3S1K A;  1JCC A;  4WQC A;  3H1H G;  1A02 F;  3CX5 W;  3R4Y A;  1KD1 Q;  1BSH A;  2J58 A;  3RLM A;  3L4M A;  3WU2 V;  2W6B A;  4I1L A;  1AOF A;  2C8S A;  1A8C A;  2IYO A;  4GKG A;  3IR9 A;  3H32 B;  4WBA A;  4EYY Q;  2BCC G;  3DP5 A;  1ZOY C;  3L70 E;  2K9Y A;  3H1I E;  1YTC A;  1PP9 D;  2Q9I A;  3CLQ A;  1T3U A;  1YEB A;  1NYH A;  5E79 V;  3LIE A;  1IRV A;  1KQG B;  3B71 A;  3KDP B;  1G2C A;  3V2N A;  4PJ0 H;  1HGZ A;  1JMM A;  2C9N Y;  3RK2 C;  2OQQ A;  2O1K A;  4AAM A;  3VYI A;  1CI6 A;  2ZYD A;  5KAI E;  1BL9 A;  1HZV A;  4L74 A;  2WPS A;  1SQV E;  1OW8 A;  5APY A;  1PPJ G;  1FI9 A;  2M5A A;  1FI3 A;  1S5L H;  1IK7 A;  2NPS D;  3G9R A;  1IZL 0;  1CHI A;  2WSF H;  3ABV C;  2O01 J;  3VP8 A;  1H89 A;  2BPB B;  2DW3 A;  5AVV B;  1OVV A;  2IBZ E;  1CIF A;  3OCD A;  4XYD B;  1S72 P;  4UB6 V;  2XU6 A;  1SQQ D;  2WSE H;  1NTZ D;  4TLF A;  1CO6 A;  1I6E A;  4HH2 A;  1C7M A;  2WMM A;  1N7S A;  2Z5H A;  3HE4 A;  2PGD A;  1CCH A;  4ZNC A;  2OYO A;  5CJ0 A;  1CYC A;  2O1J A;  1SFC B;  3L75 E;  3KYQ A;  5DFS A;  2AEF A;  3JBT B;  2QE7 H;  2JR8 A;  3U1C A;  4H13 D;  3M9Q A;  3L70 G;  3H1H J;  3H1I G;  1NOH A;  3PH2 B;  4EIC A;  1VQ6 P;  1VQ7 P;  3TNU A;  2HOD B;  1J2J B;  1USE A;  3CX5 H;  1SFC C;  1SQX D;  4D6T E;  2R5B A;  1RF0 A;  1NHL A;  3N4X A;  1EZV G;  5C0Z A;  1CYJ A;  4Z1M H;  1T2K D;  4O1W A;  3HD7 B;  4CPG A;  3HUS B;  2FFD C;  2BLF B;  2N3B A;  1FZC A;  2KSJ A;  1MG2 D;  3CI9 A;  1SQB D;  1G1I A;  1URQ B;  1SQV G;  5B5E V;  2Q1K A;  2H88 C;  3RMZ A;  1NGM B;  1I8O A;  5AVZ B;  1I6D A;  1NTM E;  2BEQ D;  2E76 B;  3HD7 C;  3CCV P;  2XND H;  3C8V A;  2CA3 B;  3N7N A;  5CCH D;  4EID A;  2IBZ G;  3CX5 I;  1URQ C;  1AJY A;  1MUU A;  2UWJ E;  3O8Z A;  4L3H A;  2WSS H;  2QJK C;  5AVT B;  4H44 B;  1DIP A;  2AI5 A;  1RQU A;  1N2D C;  4L75 A;  1MG3 D;  1DIQ C;  1MV8 A;  1IFM A;  2KOG A;  3NXS A;  1YQ3 C;  1IJD B;  5KAF E;  351C A;  3GF7 A;  1GKS A;  1JY2 P;  1L9B C;  3L75 G;  4JYC A;  1LC2 A;  4PJ0 E;  5EFW B;  1FJ0 A;  2N1T D;  4XA4 A;  1VF5 D;  2CXB A;  3O6Q A;  4N3Y B;  2M5A B;  1F1C A;  3EQ2 A;  3ITK A;  1OWA A;  2AEJ A;  2G8Y A;  2M3B A;  1IFD A;  3MK7 C;  1L0N D;  2A06 G;  1NWQ A;  4WQ8 A;  1QEX A;  5AVX B;  3OCD B;  1HJ5 A;  3GLM A;  3L70 J;  1JY3 N;  1S5L E;  3H1I J;  2P10 A;  2MKV A;  4WY4 B;  1VQM P;  2Q5U A;  5CIB B;  4DJG A;  3B5N A;  1MFZ A;  1EQ7 A;  1QVF O;  1M1K Q;  2CA4 B;  3HE4 B;  1Q7Y Q;  2GUS A;  1NTM G;  3M9H A;  2IX7 C;  1RE4 A;  4GED B;  2R32 A;  2L4D A;  4LC1 A;  3Q5P A;  2NZ2 A;  2XNX A;  4WY4 C;  2PRR A;  2SPZ A;  1YTZ I;  2ZVN B;  4ZKU A;  3CMA P;  2ZZS 1;  1N73 A;  3VMZ A;  2KS1 B;  5AVQ B;  1ZRT E;  3OA8 A;  1C6R A;  1SQV J;  1VQ4 P;  3TNU B;  1SQP K;  1H1O A;  3BAS A;  3OAK A;  1I5T A;  3CCR P;  3HQ8 A;  3SXT A;  1JEK A;  1H32 A;  1SQP E;  5CBO A;  2LXC B;  4AAO A;  1LJ2 A;  1H0T B;  2HFE D;  1YEA A;  4I7Z B;  1YCC A;  5APV A;  5DJT B;  2JWD A;  2H7H A;  1EDJ A;  4NFG B;  4NPF X;  1YJ9 P;  1BSN A;  3CX5 E;  4GOF A;  1LGH B;  1NNO A;  4N78 E;  4R4M A;  4GT1 A;  3O1Y A;  2H8P D;  4WWI A;  5IY5 1;  3NWV A;  2QSI A;  4QAO A;  1LTJ C;  1KIL A;  3U59 A;  1NU1 E;  2Y0C A;  3V6I A;  1QYZ A;  1UII A;  2CPS A;  1CNO A;  2FXP A;  2K9J B;  1LWU B;  2ZYG A;  1H9X A;  4KT0 J;  2CE1 A;  2OTL P;  1DW0 A;  3L73 D;  3L75 J;  4N0K A;  1Z56 A;  4WQA A;  2HV4 A;  3VMX A;  5KJ7 D;  3E1R A;  2FY8 A;  1LP1 A;  3HQ7 A;  5AW7 B;  3OA7 A;  5H2F E;  1LWU C;  1DW2 A;  3PXS A;  1L0L K;  1JTH A;  3LW5 J;  2OYI B;  2OZ1 A;  1BGY D;  4D6T J;  1GL2 B;  2K37 A;  2WSC H;  1LTI C;  4JCG A;  2LXB A;  2L91 A;  2ZOO A;  2V4H A;  3BCC D;  5DJQ B;  2IZ1 A;  3AE9 C;  2P1J A;  4HB1 A;  1Q2N A;  2OYI C;  5KLV E;  2KSE A;  1GL2 C;  1H33 B;  2YNY A;  2IZ0 A;  1SQP G;  1DW1 A;  1NTM J;  1KV4 A;  3AE8 C;  2QEX P;  3M97 X;  1CED A;  1JOC A;  2E75 B;  3M91 A;  1CIG A;  1NMI A;  1HGV A;  2ZXE B;  3G6E P;  1COR A;  2JEE A;  2B87 A;  1SLQ A;  1NAF A;  2Y0E A;  1NU1 G;  4L3G A;  2JO1 A;  4L73 A;  1M70 A;  2E75 C;  4R4L A;  2MTA C;  1PP9 E;  1LMS A;  4JBZ A;  2P7J A;  2Q7C A;  3L4F A;  3DR0 A;  1JO5 A;  3AEG C;  2QA4 P;  1LTG C;  3OA8 B;  3H1L D;  2C0X A;  3G71 P;  4AX3 A;  2B9B A;  2W6A A;  2C1V A;  1GDV A;  3H32 A;  1C2N A;  3L72 D;  1W5C E;  4HKZ H;  2GA1 A;  3CPW O;  1AV1 A;  2MJZ A;  2Z4E A;  1CRJ A;  5CIG B;  5GTH V;  1ETP A;  2WSF J;  1YIJ P;  1BE3 G;  3M0A A;  4IFM A;  2KLU A;  3Q3D A;  1AQT A;  3IAO A;  2IYP A;  3IFM A;  1VDF A;  4P4Q B;  1DX7 A;  2WSE J;  2N9Y B;  1AFO A;  2ZXY A;  2VRS A;  1SQQ E;  1NTZ E;  4YPC A;  3KZI H;  3MGN A;  2YKQ A;  3M06 A;  2D2C B;  1AVY A;  1LP1 B;  3TF5 A;  2OYH B;  1M56 D;  4JF7 A;  1SQP J;  3WFE C;  3VTP C;  1BCC D;  4C7N B;  3WUU A;  1CTZ A;  1P84 D;  1RZ5 A;  1CW5 A;  3A7O A;  2D2C C;  3OW2 O;  4O9B A;  2BAS A;  1DT1 A;  1YTZ T;  2OYH C;  4H0L B;  3O5C A;  1J1D B;  4QMA A;  1NTK D;  1SQX E;  1NU1 J;  2M8R A;  1LFM A;  2GIW A;  1COT A;  1SFC A;  1LTB C;  4ASV A;  1N7S D;  2YKO A;  3RBX A;  1J1E B;  3L71 D;  1SQB E;  1FZB A;  1YHQ P;  3D6Y A;  1FZA A;  2HOD A;  1RE3 C;  2FFD A;  3A2A A;  2N1T C;  1M7L A;  1VF5 C;  1LNQ A;  3PH0 A;  1QGK B;  1NKN A;  2WT7 A;  2HR3 A;  5AUR A;  2C9L Y;  1PGO A;  3A0B H;  1R0Q A;  3VN0 A;  4IOI H;  3HD7 A;  2XKM A;  2YXR B;  2QRX A;  2JDI H;  1SQQ G;  3AEF C;  3C1L A;  2EXV A;  1URQ A;  1VPC A;  1Q82 Q;  2W6J H;  2OTJ P;  2AEM A;  4FA9 A;  1BE3 J;  3RL0 g;  2A45 H;  1CHJ A;  1PZQ A;  2QJY C;  3A0H V;  5K5G B;  3ZCF A;  1S5L X;  1KB0 A;  3RK3 D;  5APS A;  1BDD A;  1WRG A;  1PGJ A;  3T97 A;  2P58 A;  4OGQ B;  1AA0 A;  3A5T A;  3RK2 B;  2PCC B;  3AEA C;  4FA4 A;  1K3G A;  3TGU G;  5KAF H;  2OTK E;  3FX0 A;  1XTG B;  4JQ0 D;  1FZE A;  4IL6 H;  3DMI A;  1L0N E;  4OGQ C;  1A2S A;  4XE5 B;  2A45 I;  3H1J D;  1KQL A;  5L8R J;  1PP9 J;  5CID B;  1SQV K;  1Y8A A;  3B4S A;  4DOJ A;  1N9C A;  1SQB G;  1TU3 F;  2BEZ F;  3A9F A;  2DGE A;  3D71 A;  2L5G B;  1E2R A;  2I8F A;  1GZL A;  2V08 A;  3KZI E;  3Q2Y A;  1E8E A;  2KZJ A;  1ZN5 A;  2R44 A;  5B5E E;  2AXC A;  1EB7 A;  2YXQ B;  2YCC A;  1MKM A;  4UB8 H;  3CCQ P;  2D0S A;  2E74 B;  4V2K A;  2E43 A;  2K88 A;  2C9X B;  3RL0 D;  2N9B A;  5AW6 B;  3V5B A;  4WY4 A;  2AXT H;  2FYN B;  1GW4 A;  4EIE A;  1CCR A;  3SWS A;  1OX3 A;  2FWL A;  4WQ7 A;  1L4A C;  1IZN B;  1PIX A;  1QX8 A;  3ORV A;  5CHX A;  2E74 C;  1RAQ A;  3K5B A;  1HCM A;  1ZR4 A;  2J5U A;  1YNR A;  3B5N D;  1C6S A;  1YIQ A;  2N18 B;  3H1H D;  4W7Z A;  5CJ4 A;  2FYN C;  1SQQ J;  1CSX A;  1NTZ J;  1AYG A;  3EWK A;  2GC4 D;  2KS1 A;  2Z5I A;  2WTY A;  1K04 A;  1ZXG A;  3L36 A;  1A56 A;  2O3J A;  2FFD B;  2QJP B;  1YYC A;  1H0T A;  1OZH A;  4BWN A;  1LTJ A;  1KFN A;  2N18 C;  3L73 E;  3D6Z A;  2WT7 B;  1L9J C;  1M60 A;  2BCC D;  1VQP P;  1C52 A;  1HRC A;  2VHD A;  2DVH A;  3TGU J;  1PGP A;  1IO3 A;  3O20 A;  2QJP C;  1RAP A;  3WUI A;  2Y9Y A;  2WSC J;  1CSW A;  3A0B E;  1T8Z A;  3MZW B;  4GIF A;  2QJK B;  1E29 A;  5C39 A;  1NTM K;  2K9J A;  1LWU A;  5KAI V;  1FBM A;  2B89 A;  3PXT A;  2FBW C;  1KYO W;  1JY3 O;  3V2Q A;  1DII C;  2KB7 P;  5H2F H;  1HZU A;  1FJP A;  1KIL D;  1K3H A;  4B86 A;  3BCC E;  3T97 B;  2IFN A;  4OVN F;  5AW1 B;  3GF3 A;  3H25 A;  1SQB J;  1YI2 P;  2B10 B;  3AE4 C;  5AW4 B;  2ZT9 D;  4PV1 B;  2OYI A;  5CIF B;  1GU5 A;  1GL2 A;  2KLV A;  1QKS A;  1P84 I;  3PXW A;  1R5S A;  2ZAE B;  1KQS O;  2HYN A;  1NO4 A;  1KOR A;  2V7Q J;  3CL3 D;  2KP8 A;  1Y9B A;  3OJA B;  3MK7 B;  1NVO A;  4IL6 E;  2RH0 A;  4ZMD A;  4Q5P A;  2WVR A;  4PV1 C;  3MUD C;  3EFG A;  2MHM A;  1CZQ A;  4WVZ A;  2E5Y A;  4WQE A;  4EI2 A;  1H33 A;  3U1A A;  5GTI H;  2FXO A;  4AAL A;  2V07 A;  4PW9 B;  4BRY B;  5CIE B;  1ZR2 A;  1RZ6 A;  3TYY A;  3ZOW A;  2WIT A;  4L1Q A;  4H0J A;  4D6T G;  3L73 G;  1OFC X;  1M57 D;  3R2P A;  5TIS V;  4XFJ A;  5EXQ A;  2IDB A;  4U7J A;  1FOS F;  1CRI A;  2YK3 A;  4DY9 A;  1JB0 J;  4I2L C;  3SWY A;  4DT0 A;  4UB8 E;  2N3Y A;  3CXH D;  3M0D C;  2KIK A;  1AVO A;  2R3C A;  1DEB A;  3L72 E;  1LTA C;  1EZV D;  1FDO A;  4HJG H;  3L74 D;  5B66 H;  3JC2 2;  1NH4 A;  2AXT E;  1L0N J;  1A02 J;  4W80 A;  3AE3 C;  5CYT R;  1YIT P;  3JCU H;  4U3F D;  3BCC G;  1H8A A;  3P8C D;  3EFF K;  1QL3 A;  1U74 B;  1PV3 A;  4LJI A;  1N90 A;  4RKU J;  2I1J A;  1JMB A;  1X0T A;  1K9M Q;  1LTJ B;  3FXD A;  2IBZ D;  3Q5S A;  5APX A;  5KAF V;  4FAV A;  3CD6 P;  4FA5 A;  2RKL A;  1NU1 K;  3UIA A;  1CRH A;  1FZF A;  5AVY B;  5CCG C;  5APT A;  4PJ0 V;  1BCC E;  5C9M A;  1QVG O;  1P84 E;  1VQ8 P;  1CIH A;  3CC2 P;  1JM0 A;  3F5H A;  1UIX A;  3VMY A;  3PRJ A;  3ZOX A;  4YXW H;  1LT1 A;  2CE0 A;  3B8E B;  1NTK E;  4ASW A;  3WU2 H;  2OYH A;  1HJ4 A;  3CWB D;  3CXH W;  3AE6 C;  1KYO I;  1S5L V;  3AE2 C;  4EOT A;  1OVU A;  2RN0 A;  4C7N A;  3IN6 A;  2A06 D;  1FZC C;  3L73 J;  2I1K A;  3ZDM A;  3L71 E;  1VQL P;  3H6P A;  1FC2 C;  2Q6Q A;  5E79 H;  5KLV K;  2B88 A;  4NPE A;  1RE3 A;  3KQG A;  2WPV B;  4JPZ B;  2KK7 A;  1D7M A;  1QL1 A;  1FAV A;  2H89 C;  2Q3I A;  3MHV A;  3CC4 P;  5GTI E;  2FYU D;  3BCC J;  3RN0 A;  3L37 A;  451C A;  2NPS B;  1SFC D;  2JP3 A;  2WZ7 A;  3BVH A;  2JJL A;  2ORL A;  2QM7 A;  1DVH A;  3SJL A;  4BXL A;  1R5L A;  1BCC G;  2BH5 X;  3JSV C;  5AW5 B;  3RK3 E;  2C1U A;  4AAN A;  3GHG B;  2NPS C;  4C46 A;  4UB6 H;  1KX2 A;  3AEB C;  2NRG A;  3NTN A;  1GK6 A;  5B66 E;  3HD7 D;  3VYM A;  3E1I A;  3NFQ A;  3JCU E;  3LID A;  1HF9 A;  4H13 B;  3GHG C;  2KZI A;  5M1B A;  2BH4 X;  4C7R A;  1URQ D;  1KMI Z;  3HE5 B;  1H88 A;  5H2F V;  3H1J E;  1HWT C;  1SS1 A;  2N9I A;  2ZBO A;  1LT9 B;  1VQ5 P;  3L71 G;  1YJW P;  1C75 A;  1PGQ A;  2E76 D;  1ZZH A;  2YMY A;  5B6Q A;  4H13 C;  5CIH B;  2N9J A;  2B11 B;  5KLV G;  3II6 A;  1QN2 A;  4H44 D;  3L72 J;  1S3J A;  1DEE G;  1LT9 C;  1J3S A;  1CSB A;  1NIR A;  1OW6 A;  2QG4 A;  1B7V A;  1KB9 D;  1BDC A;  3CXH H;  1SQQ K;  1NTZ K;  2ZFC A; 
#chains in the Genus database with same CATH homology
 1DVV A;  1C2R A;  2LIT A;  4L3H A;  4D6T D;  3DMI A;  2AI5 A;  3GG2 A;  2YQB A;  1A2S A;  3SVW A;  4XXL A;  1MG3 D;  1HH7 A;  2FRC A;  3H1J D;  4UB8 V;  1DIQ C;  1SQP D;  2GB8 B;  5CID B;  1N9C A;  2AXT V;  351C A;  1GKS A;  1L9B C;  3H1K D;  3ZOY A;  3A9F A;  2DGE A;  1E2R A;  2I8F A;  1LC2 A;  1OCD A;  2V08 A;  2JQR A;  1FJ0 A;  1E8E A;  1NTM D;  3WC8 A;  1QL4 A;  1LS9 A;  1EB7 A;  2CXB A;  2YCC A;  2D0S A;  4WQB A;  3L4O A;  2Y0D A;  4V2K A;  3VMA A;  1FOC A;  1F1C A;  2C9X B;  3ITK A;  2B0Z B;  1WVE C;  155C A;  3MK7 C;  1L0N D;  2FYN B;  4EIE A;  4WQ8 A;  1CCR A;  1OAE A;  3SWS A;  3OCD B;  1HJ5 A;  2FWL A;  1CIE A;  4WQ7 A;  2XTS B;  3CYT I;  3ORV A;  2BCN B;  3VNW A;  1RAQ A;  3ZIY A;  1I55 A;  1HCM A;  5DJQ C;  2JTI B;  5CIB B;  1YNR A;  3SLE A;  1CRC A;  1C6S A;  1YIQ A;  2N18 B;  3ZBM A;  3H1H D;  3PLN A;  2CA4 B;  4J20 A;  1CC5 A;  1CSX A;  1AYG A;  2GC4 D;  2KS1 A;  1CXC A;  1S6V B;  1L0L D;  4GED B;  1GIW A;  2L4D A;  1AKK A;  1A56 A;  2O3J A;  2YIU B;  3TYI A;  1W2L A;  2QJY B;  2QJP B;  1M6Z A;  2ZZS 1;  1I8P A;  3ZOO A;  2N18 C;  3OA8 A;  1C6R A;  1BE3 D;  1L9J C;  1M60 A;  2BCC D;  1H1O A;  3VRD A;  1C52 A;  1HRC A;  1I5T A;  2VHD A;  3HQ8 A;  3SXT A;  1H32 A;  5TJH A;  2DVH A;  4AAO A;  1IO3 A;  3O20 A;  1RAP A;  3WUI A;  1IQC A;  1YEA A;  1YCC A;  1CSW A;  1YIC A;  4NFG B;  4FAN A;  2QJK B;  1E29 A;  1H31 A;  1H32 B;  3PHL A;  5KAI V;  1NNO A;  3WFB C;  3PXT A;  1KYO W;  3O1Y A;  1DII C;  5IY5 1;  1HZU A;  1F1F A;  3NWV A;  2B4Z A;  1C6O A;  1K3H A;  4QAO A;  2Y0C A;  1QYZ A;  1CNO A;  2K9J B;  4KMG A;  4WQ9 A;  1H9X A;  2CE1 A;  5KLI B;  1ZRT D;  1DW0 A;  2B10 B;  3L73 D;  4N0K A;  3C2C A;  4PD4 D;  4WQD A;  1KV9 A;  1N15 A;  4WQA A;  5GTI V;  5CIF B;  2HV4 A;  2JWA A;  1QKS A;  3PXW A;  1CTJ A;  3HQ7 A;  1LC1 A;  1HRO A;  1DW2 A;  3PXS A;  2OZ1 A;  3FWL A;  3CX5 D;  3MK7 B;  1BGY D;  1GQ1 A;  1KIB A;  4Q5P A;  2MHM A;  1KYO D;  4JCG A;  4WQE A;  1MZ4 A;  2L91 A;  1H33 A;  3NBS A;  2Q3E A;  3PTZ A;  2ZOO A;  2V07 A;  4AAL A;  4PW9 B;  1U75 B;  5CIE B;  1RZ6 A;  1DW3 A;  2OZ1 B;  1NU1 D;  3BCC D;  5DJQ B;  3ZOW A;  4GYD A;  1JDL A;  4L1Q A;  4H0J A;  1CHH A;  5B66 V;  3TDK A;  4EIF A;  3CP5 A;  1H33 B;  1FHB A;  4K3I A;  1KX7 A;  4PWA A;  2C1D A;  5TIS V;  1DW1 A;  5EXQ A;  1GJQ A;  2KNC B;  1CRI A;  2B12 B;  2BGV X;  2YK3 A;  4DY9 A;  3NBT A;  3M97 X;  1CED A;  2N3Y A;  3CXH D;  1NML A;  2C1D B;  2AIU A;  1EZV D;  1CIG A;  1NMI A;  1COR A;  1YFC A;  3L74 D;  4A7P A;  3X39 A;  5CYT R;  2Y0E A;  4U3F D;  4L3G A;  3KHU A;  5DF5 A;  1QL3 A;  5KKZ B;  3O0R C;  1M70 A;  1U74 B;  1CTY A;  2MTA C;  5KLV D;  4LJI A;  1LMS A;  1VYD A;  3DR0 A;  1N90 A;  3TGU D;  2C2C A;  2RMZ A;  1W5C T;  3OA8 B;  3H1L D;  1N50 A;  2IBZ D;  4AX3 A;  1CRG A;  1WEJ F;  2C1V A;  1GDV A;  1IRW A;  4WQC A;  4FA1 A;  3CX5 W;  1C2N A;  3L72 D;  5KAF V;  4FAV A;  4FA5 A;  3RLM A;  3L4M A;  3WU2 V;  1AOF A;  1CRH A;  2C8S A;  1A8C A;  2GC7 D;  1H31 B;  4PJ0 V;  3KZI V;  5C9M A;  1CRJ A;  5CIG B;  5GTH V;  1ETP A;  1CIH A;  1PPJ D;  1HJ3 A;  3DP5 A;  1YTC A;  1PP9 D;  2LIR A;  3PRJ A;  3ZOX A;  4P4Q B;  1YEB A;  5E79 V;  1IRV A;  2N9Y B;  1CXA A;  3WFD C;  2CE0 A;  3HQ9 A;  1HJ4 A;  2ZXY A;  3CWB D;  3CXH W;  1S5L V;  1I54 A;  2RN0 A;  2A06 D;  4MU8 A;  3TF5 A;  4EDF A;  4AAM A;  2ZON G;  1BL9 A;  1HZV A;  3WFE C;  1BCC D;  4Y5R A;  1CTZ A;  2PCB B;  1P84 D;  1RZ5 A;  1FI9 A;  3GW6 A;  1FI3 A;  3L70 D;  3H1I D;  1DT1 A;  1IZL 0;  2PAC A;  1CHI A;  2D0W A;  2BPB B;  3O5C A;  1CIF A;  3OCD A;  1NTK D;  4XYD B;  2FYU D;  4UB6 V;  1SQQ D;  4H0K A;  1CSV A;  1LFM A;  1NTZ D;  3RN0 A;  2GIW A;  451C A;  1CSU A;  1CO6 A;  1I6E A;  1COT A;  1C7M A;  3A0B V;  3CU4 A;  2ORL A;  1GU2 A;  1CCH A;  1DVH A;  3SJL A;  3L71 D;  1CYC A;  2BH5 X;  4RSZ A;  1FI7 A;  2C1U A;  4AAN A;  1SQV D;  5DFS A;  3JBT B;  1KX2 A;  3PH2 B;  4EIC A;  3WFC C;  5AUR A;  1R0Q A;  3VYM A;  4RJT A;  1FCD C;  1SQX D;  2BH4 X;  2EXV A;  5C0Z A;  5H2F V;  1AOQ A;  1CYJ A;  4FA9 A;  4FB1 A;  2N9I A;  4O1W A;  1CHJ A;  2ZBO A;  4YE1 A;  3RN1 A;  2BLF B;  2N3B A;  1C75 A;  3A0H V;  4IL6 V;  1CYI A;  1ZZH A;  1CRY A;  1MG2 D;  4O1Q A;  1SQB D;  3ZCF A;  5B6Q A;  3HQ6 A;  5CIH B;  1KB0 A;  5B5E V;  3L75 D;  1H9Y A;  2N9J A;  2B11 B;  3RMZ A;  1I8O A;  2PCC B;  4FA4 A;  1QN2 A;  1I6D A;  1K3G A;  5CIC B;  2CA3 B;  1J3S A;  1NIR A;  2QG4 A;  1B7V A;  1KB9 D;  4EID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...