1L0LD

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
240
structure length
240
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1l0lD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1l0lD01
1GJQA 1AYGA 2C1DA 4XXLA 3A0BV 1LC1A 1M70A 1QKSA 2C1DB 1IZL0 1CEDA 1I55A 2JQRA 1CRHA 2Q3EA 4RSZA 2B10B 3OA8A 3O5CA 1NIRA 1CXCA 4AALA 3OA8B 2BCCD 1CYJA 1IRVA 1DIQC 5C9MA 3CYTI 3ORVA 1LMSA 3WFDC 1CC5A 2JTIB 1HZUA 1RZ6A 2RMZA 1QYZA 3SVWA 4GEDB 1CO6A 1H32A 3PHLA 1YNRA 5CIEB 4PJ0V 1GIWA 1E2RA 5CIHB 3WFEC 2GC4D 2C1VA 1RZ5A 1CSXA 3CU4A 1I8OA 1RAQA 2MHMA 4XYDB 1ZRTD 1KYOD 1JDLA 4FB1A 3JBTB 2AXTV 3DP5A 1QL4A 2LITA 3RMZA 1CYCA 2BH4X 4WQ9A 1CHIA 1A56A 4J20A 2GC7D 1W2LA 1N90A 1YEAA 1L9JC 1DW0A 4EIEA 1L0LD 1J3SA 1CRGA 1AOQA 1S6VB 1U74B 2CA3B 2FYUD 3RN0A 1AKKA 1CIEA 3O20A 4AAOA 3OCDB 5DJQB 5TJHA 4FAVA 2Y0DA 1VYDA 3HQ9A 4L1QA 1KX2A 5B6QA 3SWSA 1HCMA 2KNCB 2GB8B 1YTCA 351CA 1HROA 1CCHA 4PWAA 4D6TD 4FANA 3CX5D 5KLVD 3L73D 1H9XA 3HQ7A 1SQVD 1BE3D 4U3FD 4WQAA 1E29A 1DIIC 3L4OA 1CHJA 5CYTR 3ZOXA 3M97X 1C6SA 1FOCA 2CXBA 4UB6V 1OCDA 2CE0A 1S5LV 2CE1A 1CTYA 4JCGA 4N0KA 1BGYD 2B12B 4AAMA 2C8SA 1MZ4A 3DR0A 1NNOA 2N3BA 2V07A 1W5CT 5CIGB 2FRCA 1DW1A 1F1FA 3PXWA 1N15A 1AOFA 1FHBA 4AX3A 2GIWA 3KZIV 1KB9D 3L72D 1I54A 4WQDA 5CIBB 5TISV 5H2FV 3PLNA 1LS9A 1KX7A 2ZXYA 3WU2V 3NBSA 2BH5X 2ZBOA 2EXVA 3SJLA 3L4MA 1WVEC 3L70D 5EXQA 1KIBA 1N50A 1F1CA 1C6OA 3X39A 3FWLA 2O3JA 2FWLA 1HJ3A 1E8EA 1GDVA 3WC8A 1COTA 1CYIA 1YEBA 1PP9D 4UB8V 3RLMA 1KV9A 3CWBD 1IRWA 4WQEA 1EB7A 2N18B 2L91A 3H1LD 1HJ4A 5CIDB 4AANA 4FA1A 2ZOOA 4K3IA 2B11B 3SXTA 1QN2A 1GKSA 3PRJA 2C1UA 2ORLA 5KLIB 2N9YB 3L74D 1L0ND 2FYNB 2D0SA 1SQXD 3A0HV 3HQ8A 1DVVA 2I8FA 2YQBA 5KAFV 1FCDC 1CNOA 1P84D 2N9JA 3ZOWA 3OCDA 2B0ZB 2IBZD 2N18C 2AI5A 2RN0A 5DF5A 2D0WA 5CIFB 1B7VA 2K9JB 4IL6V 1CXAA 1C75A 1CIGA 5KAIV 2BGVX 5IY51 1RAPA 1BCCD 1H33B 3PH2B 2QJPB 5B5EV 1SQBD 1DVHA 2DVHA 3WUIA 3PXSA 1M60A 4O1QA 4EICA 1CORA 3ZOYA 2BPBB 1LFMA 4L3HA 4WQCA 2C9XB 3O1YA 4YE1A 5CICB 1A2SA 3L71D 451CA 3ITKA 1I8PA 2N9IA 1C52A 4QAOA 5GTIV 3KHUA 3TDKA 1H9YA 3RN1A 2XTSB 4A7PA 4O1WA 5AURA 2QJYB 3PTZA 4WQ8A 1H1OA 3TGUD 3ZBMA 3WFBC 2OZ1B 3SLEA 1NTZD 1CSUA 3CP5A 3VYMA 2PCCB 1C2NA 3H1HD 2PCBB 1HH7A 1CSWA 1I6DA 4FA5A 5KKZB 1QL3A 4L3GA 3NWVA 1CCRA 4V2KA 3A9FA 3VMAA 1CTJA 2BLFB 3H1ID 1GQ1A 3CXHW 1NTKD 1NU1D 1ZZHA 1K3GA 4MU8A 1WEJF 1SQQD 1N9CA 2HV4A 1K3HA 1CSVA 1KB0A 1FI3A 1L9BC 1M6ZA 5DFSA 5E79V 3C2CA 2LIRA 155CA 1A8CA 4KMGA 1I5TA 2L4DA 3MK7B 4EDFA 1H32B 3DMIA 1CRJA 2N3YA 1NTMD 3H1JD 1YIQA 3ZIYA 1DW2A 4WQ7A 4NFGB 2QG4A 4Q5PA 1FI9A 3O0RC 5B66V 2CA4B 3HQ6A 5GTHV 3ZCFA 3TF5A 2AIUA 1C2RA 4PD4D 1CHHA 4PW9B 1OAEA 2YCCA 1H33A 4DY9A 1SQPD 2ZONG 1YCCA 4Y5RA 4H0JA 1BL9A 1KYOW 4EIFA 1IO3A 2ZZS1 1HRCA 4WQBA 1CRCA 1C7MA 3BCCD 2KS1A 3MK7C 2VHDA 1CRYA 1ETPA 1U75B 1PPJD 1CIFA 1NMLA 2Y0EA 4GYDA 2PACA 3L75D 2C2CA 2DGEA 2JWAA 3H1KD 1LC2A 2QJKB 1EZVD 3ZOOA 2YK3A 4LJIA 3VNWA 1MG2D 1YICA 1NMIA 1FJ0A 1HJ5A 3GW6A 2V08A 4FA9A 1CRIA 5C0ZA 1DW3A 4EIDA 1CTZA 4P4QB 1MG3D 1IQCA 2OZ1A 2Y0CA 1DT1A 3VRDA 2A06D 4FA4A 1HZVA 2B4ZA 3GG2A 3PXTA 1C6RA 1FI7A 1H31A 2BCNB 3CX5W 1CIHA 3TYIA 1I6EA 1R0QA 2YIUB 1GU2A 3NBTA 5DJQC 3CXHD 1YFCA 4RJTA 1H31B 2MTAC 4H0KA 3WFCC
chains in the Genus database with same CATH superfamily
2XZRA 1AYGA 2KXPB 2C1DA 3Q5PA 1M70A 1RE4C 1PP9E 1IZL0 2P58A 3S9OA 2Q3EA 2B10B 1SQQE 3MUDA 2WT7B 2YXQB 2QIWA 2AEMA 4AALA 2HODA 3RL0C 1BGYJ 3OA8B 1T2KC 3FGAD 4C7NA 5AVQB 3BATA 1IFPA 2JTIB 5AW7B 1HZUA 1UIIA 1HGVA 4GEDB 1ZMEC 1CO6A 1L4AC 2KIKA 4PJ0V 5AW9B 1SQXG 3LW5J 1GIWA 1EDJA 2WPQA 2M3BA 1L0LG 2IZ1A 1SFCA 1CSXA 1N73B 3CU4A 1LNQA 1LP1A 1JB0J 1GL2A 1L0NK 1ZRTD 1KYOD 1OVUA 2LITA 3PJSK 1A56A 1PP9J 1SQQJ 1GU5A 2O01H 1KFMA 2W8ZA 3L75E 2ZYGA 1EXJA 5AW8B 1U74B 4AQRD 2Y9YA 2CA3B 3FWNA 2WSSH 3RBZA 3H32A 3IR9A 5DJQB 2KNCA 5TJHA 2D2CB 3M9HA 1M90Q 2G8YA 4Y99B 3P8MC 1HCMA 1YTCA 4PWAA 3RK2B 1ZN5A 4FANA 3MP7B 5KLVD 1SQVD 3KZIH 3ZOXA 1FOCA 3C8VA 2CXBA 1OCDA 2H89C 3KZIE 1ZOYC 2N1TB 1QEXA 2C8SA 2IFNA 2W6AA 3OW2O 1NNOA 1DD3A 1DD4A 4MN4C 2QJPC 1OW7A 1DW1A 3L75J 2WT7A 1NWQA 2BCCE 2O01J 2I8DA 2JJLA 1PZQA 2OYIB 2XNXA 3EFGA 3L72D 4EYYQ 4NPDA 4WQDA 3HRNA 3PLNA 2ZXYA 5KJ7D 2Z5HA 5CJ4A 2C9LY 5CCHC 1Q82Q 1NU1K 1FZBA 2DW3A 1SQQK 2E43A 1NKZB 2FWLA 3L74G 1L0NG 1CZQA 1GDVA 3N7NA 1CYIA 1YEBA 3WUUA 3V4WA 4NPEA 1IRWA 4WQEA 3R2PA 1L2PA 1JY2O 2L91A 3O8ZA 3RGUA 5AW1B 1LTTC 4EIJA 1IK7A 1LWUA 4FA1A 4IL6H 3Q1MA 4K3IA 2W27A 2B11B 3B5ND 1BCCG 2J58A 1QN2A 1KV4A 4IL6E 2BCCJ 3VMYA 2WTYA 3MGNA 3HQ8A 2FYUE 1VQ6P 4PV1C 1WT6A 1X0TA 1N86A 4LLHA 1LTJC 3P7KA 3CCVP 3CX5H 2N18C 1KILC 1IFJA 3GHGC 1HUCA 3CX5E 2BGVX 1M1JC 3PH2B 1SQBD 1DVHA 3SWKA 3WUIA 3R4YA 3VP8A 2A06G 4YTPC 3V4QA 2R44A 3C1LA 2BPBB 4WQCA 2OARA 5CICB 3Q3DA 3L71D 3ITKA 3HE4B 2YMYA 3RK3E 5GTIV 3M06A 3SWYA 2Q1KA 3TDKA 1N7SD 1JY2N 1N8RQ 2I1JA 4YXDC 2J59M 2QJYB 4H13C 2FYUJ 2OYIA 2LKMA 1NU1G 3TGUD 2B87B 3E1RA 3G3ZA 3WFBC 4RO0A 3MD0A 1SQQG 2WQYC 2XKMA 3UIAA 4DJGA 3U59A 1VPCA 3H1HD 4AYCA 3NWVA 3H1ID 4EI2A 3SSUA 1IFIA 1NTKD 3WUTA 1PGJA 1ZZHA 1YTZI 1FZCA 1SLQA 1YBKA 4H44B 1N9CA 4I6MC 3B5NB 5GTHH 3CC4P 1K3HA 1KB0A 1EDLA 4WY4C 4JYCA 2LIRA 5GTHE 1K73Q 1DIPA 155CA 1A8CA 1SQXE 1Y8AA 3V6IA 2L4DA 4EDFA 1CW5A 1L0LE 3DMIA 3USSA 1M8OB 2WMMA 1NTMD 1S5LX 3H1JD 1H88A 2POHA 2R3SA 1ZP0C 3ZIYA 1AVOA 4DOJA 3L75G 4Q5PA 2R3CA 1SP4A 5AW2B 1J1EC 3HQ6A 3ZCFA 3A2AA 3HE5B 4W7ZA 4PW9B 2YCCA 3VYIA 4DY9A 1SQPD 1YCCA 2FYUK 5GTIH 1KYOW 3D6ZA 1IO3A 5DJUB 2KYVA 3BCCD 4W80A 2XU6A 5GTIE 4IFMA 2B88A 2Z5IA 4IFDK 3Q5SA 1H89A 1W2BO 1PPJD 3HE4A 2LR2A 1PIXA 2CPBA 1DX7A 2DGEA 1N7SB 1YHQP 2QJKB 3VNWA 1SQXJ 2ZT9D 3HUSA 1FJ0A 3CLQA 1L0LJ 1KFNA 2V08A 1T3UA 2B87A 1CRIA 5KJ7A 1NTZE 3OAKA 3L72G 5BVZA 3VRDA 3GLMA 2BCCG 3PXTA 5AW0B 1VQMP 2ITAA 2WSFH 5APVA 1I6EA 3AECC 5DJQC 3CXHD 3WUVA 2D2CC 2MTAC 4H0KA 2WVRA 4XXLA 3A0BV 3D70A 1T6AA 1LC1A 2QM7A 3CCRP 1KQGB 2C1DB 1CRHA 1EC5A 4Y28J 1YQ3C 4O9BA 1NHLA 3B5NA 3KYQA 1CYJA 3QH9A 5C9MA 2QM8A 1GK6A 2AXTH 4LC1A 2HODB 2N1TC 2YIUC 3SVWA 1CSBA 1T8ZA 4C7NB 3ZDMA 2AXTE 3PHLA 1L0NE 5CIEB 3NXSA 4L74A 1NTZJ 5CIHB 2FKWB 1OW8A 5CCGC 1ZR4A 5AVWB 2QRXA 2MHMA 2FYUG 5L8RJ 2OYHA 1RQUA 1SFCB 2QA4P 1SQXK 3GMAA 1MV8A 3RMZA 2BH4X 1BCCE 1E5WA 3S1KA 4D6TG 3PP5A 3G6EP 1N90A 1DW0A 4EIEA 1VF5B 4U3FG 3H1KE 1N7SA 1EZVE 1FOSF 4TT3H 1AKKA 4UB6H 1WMKA 5K5GB 3OCDB 1URQD 4FAVA 4HYTB 1L0NJ 2NPSD 4UB6E 1VYDA 1HWTC 1RF0C 4L1QA 1LJ2A 2R5DA 2KNCB 1CCHA 351CA 2E75B 2A06E 2WITA 3L73D 1H9XA 3HQ7A 1BE3D 4WQAA 3A0BE 2E74C 1CHJA 3M97X 4RESB 1C6SA 4C46A 4EOTA 2K3RA 4OVNF 3WU2H 3M9BA 1BCCJ 1BGYD 1NTZK 2N3BA 3WU2E 2V07A 1AA0A 1W5CT 3V2RA 3L36A 1NTKG 2JO1A 2V7QJ 1HF9A 1NU1E 4ZKUA 5C39A 3H1KJ 4XE5B 3KZIV 1K05A 4UB8H 2O01N 1KB9D 5CIBB 1LS9A 3NBSA 3AE4C 4UB8E 2K1AA 2ZYAA 1MFZA 1W5CE 1J1DB 1FZEA 1MUUA 3L70D 1N50A 5AVZB 3CX5I 1SS1A 1NTMG 1YJ9P 1KYOH 1EXIA 1HJ3A 1VDFA 3CCJP 1UIXA 1LTJA 3G4SP 2KP8A 1PP9D 1NAYA 3AE5C 1ZRTE 2IZ0A 1KYOE 2Q6QA 1KV9A 1BSHA 1X79B 2HR3A 1M1JA 3H1LD 1S9KD 2ZOOA 2KLUA 3VOPA 3SXTA 3V2NA 1VQPP 2Q9IA 2E5YA 2QVAA 4I1LA 3PRJA 2ORLA 1LWUB 1NU1J 3RBXA 4RKUJ 2FYNB 4N78E 1DVVA 4GOFA 5AW6B 2I8FA 1QVFO 2YQBA 1X8YA 2M8RA 1FCDC 1YJWP 3MIWA 1CNOA 4H44C 1P84D 2N9JA 3ZOWA 3OCDA 2QEXP 2KUBA 1W2EA 2IBZD 2FFDC 2CK3H 2WPSA 2RN0A 1YIJP 2D0WA 1B7VA 4IL6V 1CXAA 1RF1A 3D0WA 5KAIV 2B9BA 1FZGA 1AVYA 1MFTA 1H33B 1NO4A 2GM4A 5KLIC 2ZVOB 3MTUE 3ZOYA 1X9VA 1K9MQ 1LFMA 2OTKE 1NTZG 4B86A 2C9XB 2E74D 4HKZH 3KDPB 1I8PA 4JBZA 2N9IA 4N3YB 3A5TA 1JMBA 2WZ7A 1LT9A 1U7MA 4O1WA 3I56P 3PTZA 3L72E 1T3JA 1K04A 3A3YB 1M1KQ 3D6YA 2Z4EA 1KZUB 2K88A 3VYMA 2PCCB 3AEDC 2XNDH 3RL0D 2PCBB 1T2KD 5KKZB 1KQFB 4L3GA 3RK3C 1JY3O 1G1JA 3VMAA 1IC2A 2BLFB 2KOGA 4I7ZB 2PRRA 2BEZF 1L4AD 3CXHW 1FDMA 1N2DC 3HD7C 1OX3A 4MU8A 3SWFA 2A45H 4OGQC 2K9YA 1DH3A 1RE3A 5KTBA 1FZCB 1KQSO 4U7JA 2IFMA 4L73A 1N7LA 4JPZB 2E76C 4IOIH 3L72J 5KAIH 1I5TA 1FDOA 4WVZA 1QX8A 5KAIE 3TSIA 3CCQP 1URQA 1VQ7P 3CC2P 2NPSA 4WQ7A 4NFGB 2QG4A 3MUDC 3H1KG 1Q81Q 3AE1C 5GTHV 4GOEA 3TF5A 1EZVG 1NVOA 1YJNP 4PD4D 1ZR2A 1SQBE 2XDJA 1H33A 4TLFA 1JMMA 4D6TE 1FOSE 5APXA 1QLED 4H0JA 3L73G 4EIFA 2P2UA 2RH0A 3EFFK 4WQBA 1CRCA 1C7MA 1BE3G 4U3FE 3MK7C 2ZXXA 1JY3N 3KXDA 1EDIA 2PFXA 2W6BA 1CIFA 3G71P 1JCDA 5KLVK 1S1CX 5AVUB 1SQVK 3VMZA 1VQLP 4LJIA 1GL2C 4L76A 2H8PD 3IAOA 3GW6A 3TGUE 3FXDA 4FA9A 2ZXEB 1GZLA 4EIDA 3HUSB 3L37A 1VF5C 1YI2P 3B8EB 1DT1A 3MHVA 3RL0B 3H1HE 4FA4A 2B4ZA 1H31A 1HGZA 3FX0A 1H0TB 4DCKA 1CIHA 3TYIA 1SQBJ 1VQKP 4GODA 1R0QA 3NMDA 5CHXA 3H1IE 4D6TJ 1HBWA 1GJQA 1L4AB 5CCHD 1NTKE 3AEFC 4U3FJ 2W90A 1AV1A 1I55A 2JQRA 2M0BA 2IYOA 4H0LC 3CMEP 3HD7D 3O5CA 1NIRA 3M0AA 1EZVI 3CYTI 1LMSA 4HB1A 1ZXGA 3WFDC 2RKLA 3TGUJ 2W83C 3M0DA 1NTME 2P1JA 2BEQD 1YNRA 1AQ5A 3B4SA 2E76D 3WFEC 3P8CD 1OXZA 3H1HJ 1LGHB 4XYDB 1JDLA 1RF0A 4PV1D 3LIDA 1OVVA 2AXTV 3DP5A 4K35A 3H1IJ 1QL4A 2V4HA 1AFOA 1CYCA 4L75A 2OYHB 1NTKJ 1YITP 2NRGA 5CJ0A 1KILD 2L5GB 3PH0A 2H43A 1PL5A 2WSCH 2OQQA 3VN0A 5KLVG 2KI7B 4J20A 1MKMA 3RL0g 1W2LA 1L9JC 2E42A 1SQVG 2C0XA 1L0LD 1S6VB 1SQBK 3IN6A 1KQLA 1GK4A 2B89A 1N73C 3RN0A 3O20A 1EDKA 1NTMJ 2JP3A 1BSNA 1RE4A 3HQ9A 1U57A 5B6QA 3VTPC 3D71A 1LWUC 2GB8B 3MZWB 1JY3P 3CXHH 3AE6C 4H13D 1E29A 1KYOI 1H0TA 1DIIC 3L4OA 1HVVA 3CXHE 5TISH 5H2FH 3K5BA 4UB6V 2CE0A 2CE1A 3CCUP 1G2CA 4JCGA 1L4AA 2B12B 3EWKA 5TISE 1MZ4A 3AE2C 4JYBA 4BRYA 4K3AA 4Y99C 4GDOA 2Q7CA 3RK2C 3Q2YA 4KJMA 1N15A 1AOFA 1JNMA 1U7JA 4AX3A 2GIWA 4H0LD 3JSVC 4YPCA 1I54A 2SPZA 3WU2V 1NTKK 2BH5X 3SJLA 3L4MA 1WVEC 1LT1A 1RQVA 5EXQA 2A45G 1F1CA 3N4XA 3FWLA 3CI9A 4AUWA 3W67A 2O3JA 4WY4D 1R5LA 1COTA 4PV1B 2YNYA 3L35A 4UB8V 1FBMA 3CWBD 2OYIC 5KAFH 1LTJB 2IDBA 5AVSB 2N18B 1NTMK 1Q90D 3NTNA 3GHGB 2C9NY 1LTAC 5APSA 4ASVA 1M1JB 2WSFJ 3H6PA 1RH5B 1SQBG 2KZIA 5AVRB 1NKNA 5B5EH 3L74D 1L0ND 1SQPK 1NAFA 5B5EE 4JF7A 1NGMB 4KHXA 1YTZT 3L71G 2ZT9B 2G3AA 2AI5A 5DF5A 5CIFB 5APYA 1C75A 3H25A 4ZKPA 1XTCC 3AE7C 1RAPA 1QL2A 3L73E 1BCCD 3U1AA 1BE3E 2DVHA 3PXSA 1RF1B 3A7OA 3TGUG 2IX7C 4HJGH 2KS1B 3TNUB 3LIEA 1NOHA 4L3HA 5CCHA 2AEFA 4YE1A 1Q7YQ 3B71A 3H1HG 451CA 2P67A 2YMKA 1C52A 4QAOA 2A45I 2IPPA 3E7KA 3KHUA 1KB9H 3HD7A 3F89A 4OWFA 1H9YA 3H1IG 4A7PA 2D2CD 2GUSA 3EQ2A 1WRGA 4WQ8A 4YXWH 1LT9B 3ZBMA 4ASWA 1AQTA 1QL1A 3L70E 1PGOA 3CP5A 1G1IA 1C2NA 3V5BA 3T97B 4FA5A 1A02J 4WY4B 3L73J 4N6JA 1QL3A 2HYNA 2LXCB 5APUA 1BE3J 2N1TD 3A9FA 1CTJA 2FXPA 2O1JA 5BU8B 3H1JG 3BRVB 3HUSC 1GQ1A 1Q2NA 2QJYC 1NU1D 4HH2A 5KJ7C 3H1LE 1GW3A 1KILA 3NFQA 4LGDE 5CCGD 1SQQD 1S9KE 3GHGA 1J1EB 1OVRA 5B66H 5CMZA 2HV4A 1CSVA 2ZVNB 4DZOA 1SQPG 3CL3D 1L9BC 5E79V 5B66E 3C2CA 4KMGA 1P84H 2YO3A 3BCCG 2P7JA 1H32B 1YIQA 1P84E 2MKVA 3CPWO 1FC2C 1DW2A 1PPJG 2IBZE 1D7MA 3L70J 3O0RC 1URQB 2CA4B 2NPSB 3B5NC 4BXLA 3VMXA 1JUNA 4Y5RA 1IZNB 5KLVE 3IFMA 1BL9A 3E1IA 2ZZS1 1HRCA 3TNUA 2KS1A 1SQVE 1NJIQ 2VHDA 1USDA 3H1LJ 1ETPA 2PAJA 4N78D 1OW6A 2ZYDA 1NMLA 1IJDB 2PACA 3L75D 3O6QB 1SVFA 1AJYA 1IFMA 1LC2A 1LTGC 3ZOOA 3GF3A 5AVYB 2YK3A 2OYHC 1VQ4P 1E79H 1MG2D 1YICA 1NMIA 1HJ5A 3G9RA 2BASA 2LXBA 2FY8A 4WWIA 1DW3A 1CTZA 1IO4A 1MZ9A 2WWWA 1VQOP 1ZV8A 1HZVA 3GG2A 1C6RA 2BCNB 2ZJSE 3T97A 4WY4A 4ZNCA 1VL2A 2YIUB 3NBTA 1N7SC 4NPFX 1YFCA 1H31B 2OTLP 2QJKC 5KLVJ 2WSEH 1VQ8P 4W7YA 1SQVJ 5E79H 1QKSA 1OZHA 4PJ0H 1JOCA 1CEDA 4RSZA 3OA8A 3CWBG 5E79E 4IL6X 4PJ0E 4WBAA 3TK1A 1HJ0A 1CXCA 2KB7P 1TU3F 2GA1A 2BCCD 1R8EA 1IRVA 1DIQC 1HH0A 3ORVA 2J5UA 1CC5A 4OH8B 2N9BA 2O1KA 1RZ6A 1PV3A 1KORA 1QYZA 2RMZA 4IFFA 1H32A 1QGKB 1USEA 2W6JH 1DEEG 1M7LA 1OWAA 3JC22 3P32A 5APQA 1E2RA 1Y47A 2PGDA 1N73A 4PD4H 1S3JA 3BVHA 3FXEA 2GC4D 2C1VA 3WFCC 3V2PA 1RZ5A 1I8OA 1RAQA 4PD4E 2OGUA 3CXHI 4FB1A 3JBTB 2AXCA 3HTKB 3M9QA 3VP9A 4H44D 4WQ9A 2E5TA 1CHIA 3M91A 3SFDC 2WPVB 2FBWC 2XV5A 1JTHB 2WSEJ 3WMM0 1Z56A 2YKPA 2GC7D 1YEAA 1OIPA 4Z1MH 1J3SA 2JR8A 2E74B 1CRGA 1AOQA 2Q5UA 3IF4A 3O6QA 3L71E 3SFEC 1IFDA 2QSIA 3I55P 2FYUD 1A02F 2IYPA 1CIEA 1BGYG 1SFCC 4AAOA 4M3LA 1VQ5P 2Y0DA 2YKQA 1FDIA 1Q86Q 1KX2A 1HROA 4D6TD 5APWA 3CX5D 2K37A 4U3FD 5CYTR 2N1TA 1VQNP 1S5LV 2ZT9C 1CTYA 4N0KA 3L70G 5AVVB 1M57D 4AAMA 1DEBA 2MJZA 3DR0A 1Y9BA 3CCEP 1NH4A 1G2CB 2M5AB 2NZ2A 5CIGB 5CCGA 1IFNA 3RK3D 2FRCA 4BRYB 1RF1C 1S4XA 2JDIH 1PP9G 1F1FA 2E75C 3PXWA 2KLVA 1GW4A 1GDTA 1FHBA 3L71J 5CBOA 3V2QA 5TISV 5H2FV 1JM0A 1KX7A 1CI6B 2GUVA 2JEEA 3H1LG 4OGQD 2ZBOA 3AEGC 2EXVA 2YKOA 1KIBA 3AEAC 1C6OA 3X39A 3P8CE 3H1JE 1E8EA 1FZFA 3I5CA 3WC8A 1YQ4C 1R5SA 1LT9C 3RLMA 1KN7A 3U1CA 3HTKA 5AVXB 1JCCA 1EB7A 2FFDB 2H88C 2IBZG 5AVTB 3ABVC 1KILE 4JQ0D 1FU1A 1HJ4A 2I1KA 1SQPE 2ZAEB 3AE8C 4KT0J 5CIDB 4AANA 1JTHA 1J1DC 1ZW0A 3F5HA 1S72P 3KPEA 1KD1Q 2CPSA 3BCCE 1GKSA 1FS0E 2C1UA 2KZJA 2PP6A 1KC8Q 5KLIB 2N9YB 2D0SA 1KB9I 1NYHA 1SQXD 3A0HV 2OYOA 3GF7A 1PPJE 2UWJE 2JKVA 5AW5B 5KAFV 3CD6P 2FXMA 2B0ZB 3Q5RA 2AEJA 1BDDA 1OMIA 2K9JB 2QE7H 1FZAA 1SFCD 2VRSA 1S5LH 1CIGA 1RE3C 1FJKA 2HLOA 5IY51 3H1JJ 1K8AQ 3CCLP 2KK7A 3AE3C 3OJAB 1GL2D 2QJPB 5B5EV 1S5LE 2YO2A 1M60A 4O1QA 4EICA 1J2JB 1GMJA 4R4MA 3TYYA 1CORA 2FYNC 1FE6A 2R32A 4DT0A 1VF5D 1RY3A 3O1YA 1URQC 1A2SA 1SQPJ 2HFED 2NPSC 2P10A 3CCSP 3RK3B 3CC7P 2M5AA 1KTMA 3BCCJ 4GKGA 5H2FE 3RN1A 2XTSB 1BDCA 5AURA 2HPCB 3CMAP 3HD7B 3W68A 1H1OA 1JO5A 2E75D 2WSCJ 5AW4B 1GTWA 1P84I 4OGQB 1CI6A 2OZ1B 3SLEA 1H8AA 3BRTB 2IBZI 1VQ9P 1NTZD 4BWNA 1CSUA 1HH7A 1X22A 1JY2P 1CSWA 1I6DA 2E76B 1CCRA 3AE9C 4V2KA 1LTIC 5AW3B 4GIFA 1JEKA 3S4RA 2Q3IA 2JWDA 3CWBE 3QWOC 3BASA 4C7RA 2Y9ZA 4CPGA 1K3GA 1LTBC 3A0HH 1WEJF 2FFDA 4R4LA 1M56D 2R5BA 3A0HE 3KQGA 1KILB 1OFCX 3CCMP 1FI3A 5KAFE 5KKZC 5BU5A 1M6ZA 5DFSA 3L74E 4XFJA 1FJPA 2KSEA 3MK7B 5APTA 1CRJA 2N3YA 5EFWB 4I7ZC 4ZMDA 5M1BA 1FI9A 3HE5A 2M3EA 5B66V 2K9JA 1LP1B 3II6A 1L0LK 4QMAA 1GL2B 3AEBC 1FZCC 2AIUA 1C2RA 1CHHA 1OAEA 2ZFCA 3JCUH 2C0WA 3AEEC 2ZONG 2V7QH 1PGPA 3CWBJ 4WB4A 3JCUE 4H13B 3M0DC 2KSJA 1CRYA 1YYCA 1S2EA 5DJTB 1U75B 1LTSC 1GU4A 2Y0EA 4GYDA 4XA4A 2C2CA 2OTJP 1BGYE 2JWAA 1QVGO 3H1KD 1EQ7A 1EZVD 3L74J 1ZLLA 3C9IA 1IK9A 3H32B 5CBNA 2WPRA 1HTLC 4GT1A 3L4FA 1KMIZ 2FYZA 2HPCA 1PFIA 3LW5H 3A0BH 1XTGB 1FAVA 5C0ZA 2H7HA 4H0LB 4P4QB 1MG3D 1PGQA 1KB9E 1IQCA 2OZ1A 2Y0CA 2FXOA 1GD2E 2HG5D 2A06D 3RK2D 1HJBA 4I2LC 3OA7A 1RHZB 1FI7A 2YXRB 4PD4I 3CX5W 1GU2A 4RJTA 3SWSA
chains in the Genus database with same CATH topology
1GJQA 1AYGA 2C1DA 4XXLA 3A0BV 1LC1A 1M70A 1QKSA 2C1DB 1IZL0 1CEDA 1I55A 2JQRA 1CRHA 2Q3EA 4RSZA 2B10B 3OA8A 3O5CA 1NIRA 1CXCA 4AALA 3OA8B 2BCCD 1CYJA 1IRVA 1DIQC 5C9MA 3CYTI 3ORVA 1LMSA 3WFDC 1CC5A 2JTIB 1HZUA 1RZ6A 2RMZA 1QYZA 3SVWA 4GEDB 1CO6A 1H32A 3PHLA 1YNRA 5CIEB 4PJ0V 1GIWA 1E2RA 5CIHB 3WFEC 2GC4D 2C1VA 1RZ5A 1CSXA 3CU4A 1I8OA 1RAQA 2MHMA 4XYDB 1ZRTD 1KYOD 1JDLA 4FB1A 3JBTB 2AXTV 3DP5A 1QL4A 2LITA 3RMZA 1CYCA 2BH4X 4WQ9A 1CHIA 1A56A 4J20A 2GC7D 1W2LA 1N90A 1YEAA 1L9JC 1DW0A 4EIEA 1L0LD 1J3SA 1CRGA 1AOQA 1S6VB 1U74B 2CA3B 2FYUD 3RN0A 1AKKA 1CIEA 3O20A 4AAOA 3OCDB 5DJQB 5TJHA 4FAVA 2Y0DA 1VYDA 3HQ9A 4L1QA 1KX2A 5B6QA 3SWSA 1HCMA 2KNCB 2GB8B 1YTCA 351CA 1HROA 1CCHA 4PWAA 4D6TD 4FANA 3CX5D 5KLVD 3L73D 1H9XA 3HQ7A 1SQVD 1BE3D 4U3FD 4WQAA 1E29A 1DIIC 3L4OA 1CHJA 5CYTR 3ZOXA 3M97X 1C6SA 1FOCA 2CXBA 4UB6V 1OCDA 2CE0A 1S5LV 2CE1A 1CTYA 4JCGA 4N0KA 1BGYD 2B12B 4AAMA 2C8SA 1MZ4A 3DR0A 1NNOA 2N3BA 2V07A 1W5CT 5CIGB 2FRCA 1DW1A 1F1FA 3PXWA 1N15A 1AOFA 1FHBA 4AX3A 2GIWA 3KZIV 1KB9D 3L72D 1I54A 4WQDA 5CIBB 5TISV 5H2FV 3PLNA 1LS9A 1KX7A 2ZXYA 3WU2V 3NBSA 2BH5X 2ZBOA 2EXVA 3SJLA 3L4MA 1WVEC 3L70D 5EXQA 1KIBA 1N50A 1F1CA 1C6OA 3X39A 3FWLA 2O3JA 2FWLA 1HJ3A 1E8EA 1GDVA 3WC8A 1COTA 1CYIA 1YEBA 1PP9D 4UB8V 3RLMA 1KV9A 3CWBD 1IRWA 4WQEA 1EB7A 2N18B 2L91A 3H1LD 1HJ4A 5CIDB 4AANA 4FA1A 2ZOOA 4K3IA 2B11B 3SXTA 1QN2A 1GKSA 3PRJA 2C1UA 2ORLA 5KLIB 2N9YB 3L74D 1L0ND 2FYNB 2D0SA 1SQXD 3A0HV 3HQ8A 1DVVA 2I8FA 2YQBA 5KAFV 1FCDC 1CNOA 1P84D 2N9JA 3ZOWA 3OCDA 2B0ZB 2IBZD 2N18C 2AI5A 2RN0A 5DF5A 2D0WA 5CIFB 1B7VA 2K9JB 4IL6V 1CXAA 1C75A 1CIGA 5KAIV 2BGVX 5IY51 1RAPA 1BCCD 1H33B 3PH2B 2QJPB 5B5EV 1SQBD 1DVHA 2DVHA 3WUIA 3PXSA 1M60A 4O1QA 4EICA 1CORA 3ZOYA 2BPBB 1LFMA 4L3HA 4WQCA 2C9XB 3O1YA 4YE1A 5CICB 1A2SA 3L71D 451CA 3ITKA 1I8PA 2N9IA 1C52A 4QAOA 5GTIV 3KHUA 3TDKA 1H9YA 3RN1A 2XTSB 4A7PA 4O1WA 5AURA 2QJYB 3PTZA 4WQ8A 1H1OA 3TGUD 3ZBMA 3WFBC 2OZ1B 3SLEA 1NTZD 1CSUA 3CP5A 3VYMA 2PCCB 1C2NA 3H1HD 2PCBB 1HH7A 1CSWA 1I6DA 4FA5A 5KKZB 1QL3A 4L3GA 3NWVA 1CCRA 4V2KA 3A9FA 3VMAA 1CTJA 2BLFB 3H1ID 1GQ1A 3CXHW 1NTKD 1NU1D 1ZZHA 1K3GA 4MU8A 1WEJF 1SQQD 1N9CA 2HV4A 1K3HA 1CSVA 1KB0A 1FI3A 1L9BC 1M6ZA 5DFSA 5E79V 3C2CA 2LIRA 155CA 1A8CA 4KMGA 1I5TA 2L4DA 3MK7B 4EDFA 1H32B 3DMIA 1CRJA 2N3YA 1NTMD 3H1JD 1YIQA 3ZIYA 1DW2A 4WQ7A 4NFGB 2QG4A 4Q5PA 1FI9A 3O0RC 5B66V 2CA4B 3HQ6A 5GTHV 3ZCFA 3TF5A 2AIUA 1C2RA 4PD4D 1CHHA 4PW9B 1OAEA 2YCCA 1H33A 4DY9A 1SQPD 2ZONG 1YCCA 4Y5RA 4H0JA 1BL9A 1KYOW 4EIFA 1IO3A 2ZZS1 1HRCA 4WQBA 1CRCA 1C7MA 3BCCD 2KS1A 3MK7C 2VHDA 1CRYA 1ETPA 1U75B 1PPJD 1CIFA 1NMLA 2Y0EA 4GYDA 2PACA 3L75D 2C2CA 2DGEA 2JWAA 3H1KD 1LC2A 2QJKB 1EZVD 3ZOOA 2YK3A 4LJIA 3VNWA 1MG2D 1YICA 1NMIA 1FJ0A 1HJ5A 3GW6A 2V08A 4FA9A 1CRIA 5C0ZA 1DW3A 4EIDA 1CTZA 4P4QB 1MG3D 1IQCA 2OZ1A 2Y0CA 1DT1A 3VRDA 2A06D 4FA4A 1HZVA 2B4ZA 3GG2A 3PXTA 1C6RA 1FI7A 1H31A 2BCNB 3CX5W 1CIHA 3TYIA 1I6EA 1R0QA 2YIUB 1GU2A 3NBTA 5DJQC 3CXHD 1YFCA 4RJTA 1H31B 2MTAC 4H0KA 3WFCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJQ A;  1AYG A;  2C1D A;  4XXL A;  3A0B V;  1LC1 A;  1M70 A;  1QKS A;  2C1D B;  1IZL 0;  1CED A;  1I55 A;  2JQR A;  1CRH A;  2Q3E A;  4RSZ A;  2B10 B;  3OA8 A;  3O5C A;  1NIR A;  1CXC A;  4AAL A;  3OA8 B;  2BCC D;  1CYJ A;  1IRV A;  1DIQ C;  5C9M A;  3CYT I;  3ORV A;  1LMS A;  3WFD C;  1CC5 A;  2JTI B;  1HZU A;  1RZ6 A;  2RMZ A;  1QYZ A;  3SVW A;  4GED B;  1CO6 A;  1H32 A;  3PHL A;  1YNR A;  5CIE B;  4PJ0 V;  1GIW A;  1E2R A;  5CIH B;  3WFE C;  2GC4 D;  2C1V A;  1RZ5 A;  1CSX A;  3CU4 A;  1I8O A;  1RAQ A;  2MHM A;  4XYD B;  1ZRT D;  1KYO D;  1JDL A;  4FB1 A;  3JBT B;  2AXT V;  3DP5 A;  1QL4 A;  2LIT A;  3RMZ A;  1CYC A;  2BH4 X;  4WQ9 A;  1CHI A;  1A56 A;  4J20 A;  2GC7 D;  1W2L A;  1N90 A;  1YEA A;  1L9J C;  1DW0 A;  4EIE A;  1L0L D;  1J3S A;  1CRG A;  1AOQ A;  1S6V B;  1U74 B;  2CA3 B;  2FYU D;  3RN0 A;  1AKK A;  1CIE A;  3O20 A;  4AAO A;  3OCD B;  5DJQ B;  5TJH A;  4FAV A;  2Y0D A;  1VYD A;  3HQ9 A;  4L1Q A;  1KX2 A;  5B6Q A;  3SWS A;  1HCM A;  2KNC B;  2GB8 B;  1YTC A;  351C A;  1HRO A;  1CCH A;  4PWA A;  4D6T D;  4FAN A;  3CX5 D;  5KLV D;  3L73 D;  1H9X A;  3HQ7 A;  1SQV D;  1BE3 D;  4U3F D;  4WQA A;  1E29 A;  1DII C;  3L4O A;  1CHJ A;  5CYT R;  3ZOX A;  3M97 X;  1C6S A;  1FOC A;  2CXB A;  4UB6 V;  1OCD A;  2CE0 A;  1S5L V;  2CE1 A;  1CTY A;  4JCG A;  4N0K A;  1BGY D;  2B12 B;  4AAM A;  2C8S A;  1MZ4 A;  3DR0 A;  1NNO A;  2N3B A;  2V07 A;  1W5C T;  5CIG B;  2FRC A;  1DW1 A;  1F1F A;  3PXW A;  1N15 A;  1AOF A;  1FHB A;  4AX3 A;  2GIW A;  3KZI V;  1KB9 D;  3L72 D;  1I54 A;  4WQD A;  5CIB B;  5TIS V;  5H2F V;  3PLN A;  1LS9 A;  1KX7 A;  2ZXY A;  3WU2 V;  3NBS A;  2BH5 X;  2ZBO A;  2EXV A;  3SJL A;  3L4M A;  1WVE C;  3L70 D;  5EXQ A;  1KIB A;  1N50 A;  1F1C A;  1C6O A;  3X39 A;  3FWL A;  2O3J A;  2FWL A;  1HJ3 A;  1E8E A;  1GDV A;  3WC8 A;  1COT A;  1CYI A;  1YEB A;  1PP9 D;  4UB8 V;  3RLM A;  1KV9 A;  3CWB D;  1IRW A;  4WQE A;  1EB7 A;  2N18 B;  2L91 A;  3H1L D;  1HJ4 A;  5CID B;  4AAN A;  4FA1 A;  2ZOO A;  4K3I A;  2B11 B;  3SXT A;  1QN2 A;  1GKS A;  3PRJ A;  2C1U A;  2ORL A;  5KLI B;  2N9Y B;  3L74 D;  1L0N D;  2FYN B;  2D0S A;  1SQX D;  3A0H V;  3HQ8 A;  1DVV A;  2I8F A;  2YQB A;  5KAF V;  1FCD C;  1CNO A;  1P84 D;  2N9J A;  3ZOW A;  3OCD A;  2B0Z B;  2IBZ D;  2N18 C;  2AI5 A;  2RN0 A;  5DF5 A;  2D0W A;  5CIF B;  1B7V A;  2K9J B;  4IL6 V;  1CXA A;  1C75 A;  1CIG A;  5KAI V;  2BGV X;  5IY5 1;  1RAP A;  1BCC D;  1H33 B;  3PH2 B;  2QJP B;  5B5E V;  1SQB D;  1DVH A;  2DVH A;  3WUI A;  3PXS A;  1M60 A;  4O1Q A;  4EIC A;  1COR A;  3ZOY A;  2BPB B;  1LFM A;  4L3H A;  4WQC A;  2C9X B;  3O1Y A;  4YE1 A;  5CIC B;  1A2S A;  3L71 D;  451C A;  3ITK A;  1I8P A;  2N9I A;  1C52 A;  4QAO A;  5GTI V;  3KHU A;  3TDK A;  1H9Y A;  3RN1 A;  2XTS B;  4A7P A;  4O1W A;  5AUR A;  2QJY B;  3PTZ A;  4WQ8 A;  1H1O A;  3TGU D;  3ZBM A;  3WFB C;  2OZ1 B;  3SLE A;  1NTZ D;  1CSU A;  3CP5 A;  3VYM A;  2PCC B;  1C2N A;  3H1H D;  2PCB B;  1HH7 A;  1CSW A;  1I6D A;  4FA5 A;  5KKZ B;  1QL3 A;  4L3G A;  3NWV A;  1CCR A;  4V2K A;  3A9F A;  3VMA A;  1CTJ A;  2BLF B;  3H1I D;  1GQ1 A;  3CXH W;  1NTK D;  1NU1 D;  1ZZH A;  1K3G A;  4MU8 A;  1WEJ F;  1SQQ D;  1N9C A;  2HV4 A;  1K3H A;  1CSV A;  1KB0 A;  1FI3 A;  1L9B C;  1M6Z A;  5DFS A;  5E79 V;  3C2C A;  2LIR A;  155C A;  1A8C A;  4KMG A;  1I5T A;  2L4D A;  3MK7 B;  4EDF A;  1H32 B;  3DMI A;  1CRJ A;  2N3Y A;  1NTM D;  3H1J D;  1YIQ A;  3ZIY A;  1DW2 A;  4WQ7 A;  4NFG B;  2QG4 A;  4Q5P A;  1FI9 A;  3O0R C;  5B66 V;  2CA4 B;  3HQ6 A;  5GTH V;  3ZCF A;  3TF5 A;  2AIU A;  1C2R A;  4PD4 D;  1CHH A;  4PW9 B;  1OAE A;  2YCC A;  1H33 A;  4DY9 A;  1SQP D;  2ZON G;  1YCC A;  4Y5R A;  4H0J A;  1BL9 A;  1KYO W;  4EIF A;  1IO3 A;  2ZZS 1;  1HRC A;  4WQB A;  1CRC A;  1C7M A;  3BCC D;  2KS1 A;  3MK7 C;  2VHD A;  1CRY A;  1ETP A;  1U75 B;  1PPJ D;  1CIF A;  1NML A;  2Y0E A;  4GYD A;  2PAC A;  3L75 D;  2C2C A;  2DGE A;  2JWA A;  3H1K D;  1LC2 A;  2QJK B;  1EZV D;  3ZOO A;  2YK3 A;  4LJI A;  3VNW A;  1MG2 D;  1YIC A;  1NMI A;  1FJ0 A;  1HJ5 A;  3GW6 A;  2V08 A;  4FA9 A;  1CRI A;  5C0Z A;  1DW3 A;  4EID A;  1CTZ A;  4P4Q B;  1MG3 D;  1IQC A;  2OZ1 A;  2Y0C A;  1DT1 A;  3VRD A;  2A06 D;  4FA4 A;  1HZV A;  2B4Z A;  3GG2 A;  3PXT A;  1C6R A;  1FI7 A;  1H31 A;  2BCN B;  3CX5 W;  1CIH A;  3TYI A;  1I6E A;  1R0Q A;  2YIU B;  1GU2 A;  3NBT A;  5DJQ C;  3CXH D;  1YFC A;  4RJT A;  1H31 B;  2MTA C;  4H0K A;  3WFC C; 
#chains in the Genus database with same CATH topology
 2XZR A;  1AYG A;  2KXP B;  2C1D A;  3Q5P A;  1M70 A;  1RE4 C;  1PP9 E;  1IZL 0;  2P58 A;  3S9O A;  2Q3E A;  2B10 B;  1SQQ E;  3MUD A;  2WT7 B;  2YXQ B;  2QIW A;  2AEM A;  4AAL A;  2HOD A;  3RL0 C;  1BGY J;  3OA8 B;  1T2K C;  3FGA D;  4C7N A;  5AVQ B;  3BAT A;  1IFP A;  2JTI B;  5AW7 B;  1HZU A;  1UII A;  1HGV A;  4GED B;  1ZME C;  1CO6 A;  1L4A C;  2KIK A;  4PJ0 V;  5AW9 B;  1SQX G;  3LW5 J;  1GIW A;  1EDJ A;  2WPQ A;  2M3B A;  1L0L G;  2IZ1 A;  1SFC A;  1CSX A;  1N73 B;  3CU4 A;  1LNQ A;  1LP1 A;  1JB0 J;  1GL2 A;  1L0N K;  1ZRT D;  1KYO D;  1OVU A;  2LIT A;  3PJS K;  1A56 A;  1PP9 J;  1SQQ J;  1GU5 A;  2O01 H;  1KFM A;  2W8Z A;  3L75 E;  2ZYG A;  1EXJ A;  5AW8 B;  1U74 B;  4AQR D;  2Y9Y A;  2CA3 B;  3FWN A;  2WSS H;  3RBZ A;  3H32 A;  3IR9 A;  5DJQ B;  2KNC A;  5TJH A;  2D2C B;  3M9H A;  1M90 Q;  2G8Y A;  4Y99 B;  3P8M C;  1HCM A;  1YTC A;  4PWA A;  3RK2 B;  1ZN5 A;  4FAN A;  3MP7 B;  5KLV D;  1SQV D;  3KZI H;  3ZOX A;  1FOC A;  3C8V A;  2CXB A;  1OCD A;  2H89 C;  3KZI E;  1ZOY C;  2N1T B;  1QEX A;  2C8S A;  2IFN A;  2W6A A;  3OW2 O;  1NNO A;  1DD3 A;  1DD4 A;  4MN4 C;  2QJP C;  1OW7 A;  1DW1 A;  3L75 J;  2WT7 A;  1NWQ A;  2BCC E;  2O01 J;  2I8D A;  2JJL A;  1PZQ A;  2OYI B;  2XNX A;  3EFG A;  3L72 D;  4EYY Q;  4NPD A;  4WQD A;  3HRN A;  3PLN A;  2ZXY A;  5KJ7 D;  2Z5H A;  5CJ4 A;  2C9L Y;  5CCH C;  1Q82 Q;  1NU1 K;  1FZB A;  2DW3 A;  1SQQ K;  2E43 A;  1NKZ B;  2FWL A;  3L74 G;  1L0N G;  1CZQ A;  1GDV A;  3N7N A;  1CYI A;  1YEB A;  3WUU A;  3V4W A;  4NPE A;  1IRW A;  4WQE A;  3R2P A;  1L2P A;  1JY2 O;  2L91 A;  3O8Z A;  3RGU A;  5AW1 B;  1LTT C;  4EIJ A;  1IK7 A;  1LWU A;  4FA1 A;  4IL6 H;  3Q1M A;  4K3I A;  2W27 A;  2B11 B;  3B5N D;  1BCC G;  2J58 A;  1QN2 A;  1KV4 A;  4IL6 E;  2BCC J;  3VMY A;  2WTY A;  3MGN A;  3HQ8 A;  2FYU E;  1VQ6 P;  4PV1 C;  1WT6 A;  1X0T A;  1N86 A;  4LLH A;  1LTJ C;  3P7K A;  3CCV P;  3CX5 H;  2N18 C;  1KIL C;  1IFJ A;  3GHG C;  1HUC A;  3CX5 E;  2BGV X;  1M1J C;  3PH2 B;  1SQB D;  1DVH A;  3SWK A;  3WUI A;  3R4Y A;  3VP8 A;  2A06 G;  4YTP C;  3V4Q A;  2R44 A;  3C1L A;  2BPB B;  4WQC A;  2OAR A;  5CIC B;  3Q3D A;  3L71 D;  3ITK A;  3HE4 B;  2YMY A;  3RK3 E;  5GTI V;  3M06 A;  3SWY A;  2Q1K A;  3TDK A;  1N7S D;  1JY2 N;  1N8R Q;  2I1J A;  4YXD C;  2J59 M;  2QJY B;  4H13 C;  2FYU J;  2OYI A;  2LKM A;  1NU1 G;  3TGU D;  2B87 B;  3E1R A;  3G3Z A;  3WFB C;  4RO0 A;  3MD0 A;  1SQQ G;  2WQY C;  2XKM A;  3UIA A;  4DJG A;  3U59 A;  1VPC A;  3H1H D;  4AYC A;  3NWV A;  3H1I D;  4EI2 A;  3SSU A;  1IFI A;  1NTK D;  3WUT A;  1PGJ A;  1ZZH A;  1YTZ I;  1FZC A;  1SLQ A;  1YBK A;  4H44 B;  1N9C A;  4I6M C;  3B5N B;  5GTH H;  3CC4 P;  1K3H A;  1KB0 A;  1EDL A;  4WY4 C;  4JYC A;  2LIR A;  5GTH E;  1K73 Q;  1DIP A;  155C A;  1A8C A;  1SQX E;  1Y8A A;  3V6I A;  2L4D A;  4EDF A;  1CW5 A;  1L0L E;  3DMI A;  3USS A;  1M8O B;  2WMM A;  1NTM D;  1S5L X;  3H1J D;  1H88 A;  2POH A;  2R3S A;  1ZP0 C;  3ZIY A;  1AVO A;  4DOJ A;  3L75 G;  4Q5P A;  2R3C A;  1SP4 A;  5AW2 B;  1J1E C;  3HQ6 A;  3ZCF A;  3A2A A;  3HE5 B;  4W7Z A;  4PW9 B;  2YCC A;  3VYI A;  4DY9 A;  1SQP D;  1YCC A;  2FYU K;  5GTI H;  1KYO W;  3D6Z A;  1IO3 A;  5DJU B;  2KYV A;  3BCC D;  4W80 A;  2XU6 A;  5GTI E;  4IFM A;  2B88 A;  2Z5I A;  4IFD K;  3Q5S A;  1H89 A;  1W2B O;  1PPJ D;  3HE4 A;  2LR2 A;  1PIX A;  2CPB A;  1DX7 A;  2DGE A;  1N7S B;  1YHQ P;  2QJK B;  3VNW A;  1SQX J;  2ZT9 D;  3HUS A;  1FJ0 A;  3CLQ A;  1L0L J;  1KFN A;  2V08 A;  1T3U A;  2B87 A;  1CRI A;  5KJ7 A;  1NTZ E;  3OAK A;  3L72 G;  5BVZ A;  3VRD A;  3GLM A;  2BCC G;  3PXT A;  5AW0 B;  1VQM P;  2ITA A;  2WSF H;  5APV A;  1I6E A;  3AEC C;  5DJQ C;  3CXH D;  3WUV A;  2D2C C;  2MTA C;  4H0K A;  2WVR A;  4XXL A;  3A0B V;  3D70 A;  1T6A A;  1LC1 A;  2QM7 A;  3CCR P;  1KQG B;  2C1D B;  1CRH A;  1EC5 A;  4Y28 J;  1YQ3 C;  4O9B A;  1NHL A;  3B5N A;  3KYQ A;  1CYJ A;  3QH9 A;  5C9M A;  2QM8 A;  1GK6 A;  2AXT H;  4LC1 A;  2HOD B;  2N1T C;  2YIU C;  3SVW A;  1CSB A;  1T8Z A;  4C7N B;  3ZDM A;  2AXT E;  3PHL A;  1L0N E;  5CIE B;  3NXS A;  4L74 A;  1NTZ J;  5CIH B;  2FKW B;  1OW8 A;  5CCG C;  1ZR4 A;  5AVW B;  2QRX A;  2MHM A;  2FYU G;  5L8R J;  2OYH A;  1RQU A;  1SFC B;  2QA4 P;  1SQX K;  3GMA A;  1MV8 A;  3RMZ A;  2BH4 X;  1BCC E;  1E5W A;  3S1K A;  4D6T G;  3PP5 A;  3G6E P;  1N90 A;  1DW0 A;  4EIE A;  1VF5 B;  4U3F G;  3H1K E;  1N7S A;  1EZV E;  1FOS F;  4TT3 H;  1AKK A;  4UB6 H;  1WMK A;  5K5G B;  3OCD B;  1URQ D;  4FAV A;  4HYT B;  1L0N J;  2NPS D;  4UB6 E;  1VYD A;  1HWT C;  1RF0 C;  4L1Q A;  1LJ2 A;  2R5D A;  2KNC B;  1CCH A;  351C A;  2E75 B;  2A06 E;  2WIT A;  3L73 D;  1H9X A;  3HQ7 A;  1BE3 D;  4WQA A;  3A0B E;  2E74 C;  1CHJ A;  3M97 X;  4RES B;  1C6S A;  4C46 A;  4EOT A;  2K3R A;  4OVN F;  3WU2 H;  3M9B A;  1BCC J;  1BGY D;  1NTZ K;  2N3B A;  3WU2 E;  2V07 A;  1AA0 A;  1W5C T;  3V2R A;  3L36 A;  1NTK G;  2JO1 A;  2V7Q J;  1HF9 A;  1NU1 E;  4ZKU A;  5C39 A;  3H1K J;  4XE5 B;  3KZI V;  1K05 A;  4UB8 H;  2O01 N;  1KB9 D;  5CIB B;  1LS9 A;  3NBS A;  3AE4 C;  4UB8 E;  2K1A A;  2ZYA A;  1MFZ A;  1W5C E;  1J1D B;  1FZE A;  1MUU A;  3L70 D;  1N50 A;  5AVZ B;  3CX5 I;  1SS1 A;  1NTM G;  1YJ9 P;  1KYO H;  1EXI A;  1HJ3 A;  1VDF A;  3CCJ P;  1UIX A;  1LTJ A;  3G4S P;  2KP8 A;  1PP9 D;  1NAY A;  3AE5 C;  1ZRT E;  2IZ0 A;  1KYO E;  2Q6Q A;  1KV9 A;  1BSH A;  1X79 B;  2HR3 A;  1M1J A;  3H1L D;  1S9K D;  2ZOO A;  2KLU A;  3VOP A;  3SXT A;  3V2N A;  1VQP P;  2Q9I A;  2E5Y A;  2QVA A;  4I1L A;  3PRJ A;  2ORL A;  1LWU B;  1NU1 J;  3RBX A;  4RKU J;  2FYN B;  4N78 E;  1DVV A;  4GOF A;  5AW6 B;  2I8F A;  1QVF O;  2YQB A;  1X8Y A;  2M8R A;  1FCD C;  1YJW P;  3MIW A;  1CNO A;  4H44 C;  1P84 D;  2N9J A;  3ZOW A;  3OCD A;  2QEX P;  2KUB A;  1W2E A;  2IBZ D;  2FFD C;  2CK3 H;  2WPS A;  2RN0 A;  1YIJ P;  2D0W A;  1B7V A;  4IL6 V;  1CXA A;  1RF1 A;  3D0W A;  5KAI V;  2B9B A;  1FZG A;  1AVY A;  1MFT A;  1H33 B;  1NO4 A;  2GM4 A;  5KLI C;  2ZVO B;  3MTU E;  3ZOY A;  1X9V A;  1K9M Q;  1LFM A;  2OTK E;  1NTZ G;  4B86 A;  2C9X B;  2E74 D;  4HKZ H;  3KDP B;  1I8P A;  4JBZ A;  2N9I A;  4N3Y B;  3A5T A;  1JMB A;  2WZ7 A;  1LT9 A;  1U7M A;  4O1W A;  3I56 P;  3PTZ A;  3L72 E;  1T3J A;  1K04 A;  3A3Y B;  1M1K Q;  3D6Y A;  2Z4E A;  1KZU B;  2K88 A;  3VYM A;  2PCC B;  3AED C;  2XND H;  3RL0 D;  2PCB B;  1T2K D;  5KKZ B;  1KQF B;  4L3G A;  3RK3 C;  1JY3 O;  1G1J A;  3VMA A;  1IC2 A;  2BLF B;  2KOG A;  4I7Z B;  2PRR A;  2BEZ F;  1L4A D;  3CXH W;  1FDM A;  1N2D C;  3HD7 C;  1OX3 A;  4MU8 A;  3SWF A;  2A45 H;  4OGQ C;  2K9Y A;  1DH3 A;  1RE3 A;  5KTB A;  1FZC B;  1KQS O;  4U7J A;  2IFM A;  4L73 A;  1N7L A;  4JPZ B;  2E76 C;  4IOI H;  3L72 J;  5KAI H;  1I5T A;  1FDO A;  4WVZ A;  1QX8 A;  5KAI E;  3TSI A;  3CCQ P;  1URQ A;  1VQ7 P;  3CC2 P;  2NPS A;  4WQ7 A;  4NFG B;  2QG4 A;  3MUD C;  3H1K G;  1Q81 Q;  3AE1 C;  5GTH V;  4GOE A;  3TF5 A;  1EZV G;  1NVO A;  1YJN P;  4PD4 D;  1ZR2 A;  1SQB E;  2XDJ A;  1H33 A;  4TLF A;  1JMM A;  4D6T E;  1FOS E;  5APX A;  1QLE D;  4H0J A;  3L73 G;  4EIF A;  2P2U A;  2RH0 A;  3EFF K;  4WQB A;  1CRC A;  1C7M A;  1BE3 G;  4U3F E;  3MK7 C;  2ZXX A;  1JY3 N;  3KXD A;  1EDI A;  2PFX A;  2W6B A;  1CIF A;  3G71 P;  1JCD A;  5KLV K;  1S1C X;  5AVU B;  1SQV K;  3VMZ A;  1VQL P;  4LJI A;  1GL2 C;  4L76 A;  2H8P D;  3IAO A;  3GW6 A;  3TGU E;  3FXD A;  4FA9 A;  2ZXE B;  1GZL A;  4EID A;  3HUS B;  3L37 A;  1VF5 C;  1YI2 P;  3B8E B;  1DT1 A;  3MHV A;  3RL0 B;  3H1H E;  4FA4 A;  2B4Z A;  1H31 A;  1HGZ A;  3FX0 A;  1H0T B;  4DCK A;  1CIH A;  3TYI A;  1SQB J;  1VQK P;  4GOD A;  1R0Q A;  3NMD A;  5CHX A;  3H1I E;  4D6T J;  1HBW A;  1GJQ A;  1L4A B;  5CCH D;  1NTK E;  3AEF C;  4U3F J;  2W90 A;  1AV1 A;  1I55 A;  2JQR A;  2M0B A;  2IYO A;  4H0L C;  3CME P;  3HD7 D;  3O5C A;  1NIR A;  3M0A A;  1EZV I;  3CYT I;  1LMS A;  4HB1 A;  1ZXG A;  3WFD C;  2RKL A;  3TGU J;  2W83 C;  3M0D A;  1NTM E;  2P1J A;  2BEQ D;  1YNR A;  1AQ5 A;  3B4S A;  2E76 D;  3WFE C;  3P8C D;  1OXZ A;  3H1H J;  1LGH B;  4XYD B;  1JDL A;  1RF0 A;  4PV1 D;  3LID A;  1OVV A;  2AXT V;  3DP5 A;  4K35 A;  3H1I J;  1QL4 A;  2V4H A;  1AFO A;  1CYC A;  4L75 A;  2OYH B;  1NTK J;  1YIT P;  2NRG A;  5CJ0 A;  1KIL D;  2L5G B;  3PH0 A;  2H43 A;  1PL5 A;  2WSC H;  2OQQ A;  3VN0 A;  5KLV G;  2KI7 B;  4J20 A;  1MKM A;  3RL0 g;  1W2L A;  1L9J C;  2E42 A;  1SQV G;  2C0X A;  1L0L D;  1S6V B;  1SQB K;  3IN6 A;  1KQL A;  1GK4 A;  2B89 A;  1N73 C;  3RN0 A;  3O20 A;  1EDK A;  1NTM J;  2JP3 A;  1BSN A;  1RE4 A;  3HQ9 A;  1U57 A;  5B6Q A;  3VTP C;  3D71 A;  1LWU C;  2GB8 B;  3MZW B;  1JY3 P;  3CXH H;  3AE6 C;  4H13 D;  1E29 A;  1KYO I;  1H0T A;  1DII C;  3L4O A;  1HVV A;  3CXH E;  5TIS H;  5H2F H;  3K5B A;  4UB6 V;  2CE0 A;  2CE1 A;  3CCU P;  1G2C A;  4JCG A;  1L4A A;  2B12 B;  3EWK A;  5TIS E;  1MZ4 A;  3AE2 C;  4JYB A;  4BRY A;  4K3A A;  4Y99 C;  4GDO A;  2Q7C A;  3RK2 C;  3Q2Y A;  4KJM A;  1N15 A;  1AOF A;  1JNM A;  1U7J A;  4AX3 A;  2GIW A;  4H0L D;  3JSV C;  4YPC A;  1I54 A;  2SPZ A;  3WU2 V;  1NTK K;  2BH5 X;  3SJL A;  3L4M A;  1WVE C;  1LT1 A;  1RQV A;  5EXQ A;  2A45 G;  1F1C A;  3N4X A;  3FWL A;  3CI9 A;  4AUW A;  3W67 A;  2O3J A;  4WY4 D;  1R5L A;  1COT A;  4PV1 B;  2YNY A;  3L35 A;  4UB8 V;  1FBM A;  3CWB D;  2OYI C;  5KAF H;  1LTJ B;  2IDB A;  5AVS B;  2N18 B;  1NTM K;  1Q90 D;  3NTN A;  3GHG B;  2C9N Y;  1LTA C;  5APS A;  4ASV A;  1M1J B;  2WSF J;  3H6P A;  1RH5 B;  1SQB G;  2KZI A;  5AVR B;  1NKN A;  5B5E H;  3L74 D;  1L0N D;  1SQP K;  1NAF A;  5B5E E;  4JF7 A;  1NGM B;  4KHX A;  1YTZ T;  3L71 G;  2ZT9 B;  2G3A A;  2AI5 A;  5DF5 A;  5CIF B;  5APY A;  1C75 A;  3H25 A;  4ZKP A;  1XTC C;  3AE7 C;  1RAP A;  1QL2 A;  3L73 E;  1BCC D;  3U1A A;  1BE3 E;  2DVH A;  3PXS A;  1RF1 B;  3A7O A;  3TGU G;  2IX7 C;  4HJG H;  2KS1 B;  3TNU B;  3LIE A;  1NOH A;  4L3H A;  5CCH A;  2AEF A;  4YE1 A;  1Q7Y Q;  3B71 A;  3H1H G;  451C A;  2P67 A;  2YMK A;  1C52 A;  4QAO A;  2A45 I;  2IPP A;  3E7K A;  3KHU A;  1KB9 H;  3HD7 A;  3F89 A;  4OWF A;  1H9Y A;  3H1I G;  4A7P A;  2D2C D;  2GUS A;  3EQ2 A;  1WRG A;  4WQ8 A;  4YXW H;  1LT9 B;  3ZBM A;  4ASW A;  1AQT A;  1QL1 A;  3L70 E;  1PGO A;  3CP5 A;  1G1I A;  1C2N A;  3V5B A;  3T97 B;  4FA5 A;  1A02 J;  4WY4 B;  3L73 J;  4N6J A;  1QL3 A;  2HYN A;  2LXC B;  5APU A;  1BE3 J;  2N1T D;  3A9F A;  1CTJ A;  2FXP A;  2O1J A;  5BU8 B;  3H1J G;  3BRV B;  3HUS C;  1GQ1 A;  1Q2N A;  2QJY C;  1NU1 D;  4HH2 A;  5KJ7 C;  3H1L E;  1GW3 A;  1KIL A;  3NFQ A;  4LGD E;  5CCG D;  1SQQ D;  1S9K E;  3GHG A;  1J1E B;  1OVR A;  5B66 H;  5CMZ A;  2HV4 A;  1CSV A;  2ZVN B;  4DZO A;  1SQP G;  3CL3 D;  1L9B C;  5E79 V;  5B66 E;  3C2C A;  4KMG A;  1P84 H;  2YO3 A;  3BCC G;  2P7J A;  1H32 B;  1YIQ A;  1P84 E;  2MKV A;  3CPW O;  1FC2 C;  1DW2 A;  1PPJ G;  2IBZ E;  1D7M A;  3L70 J;  3O0R C;  1URQ B;  2CA4 B;  2NPS B;  3B5N C;  4BXL A;  3VMX A;  1JUN A;  4Y5R A;  1IZN B;  5KLV E;  3IFM A;  1BL9 A;  3E1I A;  2ZZS 1;  1HRC A;  3TNU A;  2KS1 A;  1SQV E;  1NJI Q;  2VHD A;  1USD A;  3H1L J;  1ETP A;  2PAJ A;  4N78 D;  1OW6 A;  2ZYD A;  1NML A;  1IJD B;  2PAC A;  3L75 D;  3O6Q B;  1SVF A;  1AJY A;  1IFM A;  1LC2 A;  1LTG C;  3ZOO A;  3GF3 A;  5AVY B;  2YK3 A;  2OYH C;  1VQ4 P;  1E79 H;  1MG2 D;  1YIC A;  1NMI A;  1HJ5 A;  3G9R A;  2BAS A;  2LXB A;  2FY8 A;  4WWI A;  1DW3 A;  1CTZ A;  1IO4 A;  1MZ9 A;  2WWW A;  1VQO P;  1ZV8 A;  1HZV A;  3GG2 A;  1C6R A;  2BCN B;  2ZJS E;  3T97 A;  4WY4 A;  4ZNC A;  1VL2 A;  2YIU B;  3NBT A;  1N7S C;  4NPF X;  1YFC A;  1H31 B;  2OTL P;  2QJK C;  5KLV J;  2WSE H;  1VQ8 P;  4W7Y A;  1SQV J;  5E79 H;  1QKS A;  1OZH A;  4PJ0 H;  1JOC A;  1CED A;  4RSZ A;  3OA8 A;  3CWB G;  5E79 E;  4IL6 X;  4PJ0 E;  4WBA A;  3TK1 A;  1HJ0 A;  1CXC A;  2KB7 P;  1TU3 F;  2GA1 A;  2BCC D;  1R8E A;  1IRV A;  1DIQ C;  1HH0 A;  3ORV A;  2J5U A;  1CC5 A;  4OH8 B;  2N9B A;  2O1K A;  1RZ6 A;  1PV3 A;  1KOR A;  1QYZ A;  2RMZ A;  4IFF A;  1H32 A;  1QGK B;  1USE A;  2W6J H;  1DEE G;  1M7L A;  1OWA A;  3JC2 2;  3P32 A;  5APQ A;  1E2R A;  1Y47 A;  2PGD A;  1N73 A;  4PD4 H;  1S3J A;  3BVH A;  3FXE A;  2GC4 D;  2C1V A;  3WFC C;  3V2P A;  1RZ5 A;  1I8O A;  1RAQ A;  4PD4 E;  2OGU A;  3CXH I;  4FB1 A;  3JBT B;  2AXC A;  3HTK B;  3M9Q A;  3VP9 A;  4H44 D;  4WQ9 A;  2E5T A;  1CHI A;  3M91 A;  3SFD C;  2WPV B;  2FBW C;  2XV5 A;  1JTH B;  2WSE J;  3WMM 0;  1Z56 A;  2YKP A;  2GC7 D;  1YEA A;  1OIP A;  4Z1M H;  1J3S A;  2JR8 A;  2E74 B;  1CRG A;  1AOQ A;  2Q5U A;  3IF4 A;  3O6Q A;  3L71 E;  3SFE C;  1IFD A;  2QSI A;  3I55 P;  2FYU D;  1A02 F;  2IYP A;  1CIE A;  1BGY G;  1SFC C;  4AAO A;  4M3L A;  1VQ5 P;  2Y0D A;  2YKQ A;  1FDI A;  1Q86 Q;  1KX2 A;  1HRO A;  4D6T D;  5APW A;  3CX5 D;  2K37 A;  4U3F D;  5CYT R;  2N1T A;  1VQN P;  1S5L V;  2ZT9 C;  1CTY A;  4N0K A;  3L70 G;  5AVV B;  1M57 D;  4AAM A;  1DEB A;  2MJZ A;  3DR0 A;  1Y9B A;  3CCE P;  1NH4 A;  1G2C B;  2M5A B;  2NZ2 A;  5CIG B;  5CCG A;  1IFN A;  3RK3 D;  2FRC A;  4BRY B;  1RF1 C;  1S4X A;  2JDI H;  1PP9 G;  1F1F A;  2E75 C;  3PXW A;  2KLV A;  1GW4 A;  1GDT A;  1FHB A;  3L71 J;  5CBO A;  3V2Q A;  5TIS V;  5H2F V;  1JM0 A;  1KX7 A;  1CI6 B;  2GUV A;  2JEE A;  3H1L G;  4OGQ D;  2ZBO A;  3AEG C;  2EXV A;  2YKO A;  1KIB A;  3AEA C;  1C6O A;  3X39 A;  3P8C E;  3H1J E;  1E8E A;  1FZF A;  3I5C A;  3WC8 A;  1YQ4 C;  1R5S A;  1LT9 C;  3RLM A;  1KN7 A;  3U1C A;  3HTK A;  5AVX B;  1JCC A;  1EB7 A;  2FFD B;  2H88 C;  2IBZ G;  5AVT B;  3ABV C;  1KIL E;  4JQ0 D;  1FU1 A;  1HJ4 A;  2I1K A;  1SQP E;  2ZAE B;  3AE8 C;  4KT0 J;  5CID B;  4AAN A;  1JTH A;  1J1D C;  1ZW0 A;  3F5H A;  1S72 P;  3KPE A;  1KD1 Q;  2CPS A;  3BCC E;  1GKS A;  1FS0 E;  2C1U A;  2KZJ A;  2PP6 A;  1KC8 Q;  5KLI B;  2N9Y B;  2D0S A;  1KB9 I;  1NYH A;  1SQX D;  3A0H V;  2OYO A;  3GF7 A;  1PPJ E;  2UWJ E;  2JKV A;  5AW5 B;  5KAF V;  3CD6 P;  2FXM A;  2B0Z B;  3Q5R A;  2AEJ A;  1BDD A;  1OMI A;  2K9J B;  2QE7 H;  1FZA A;  1SFC D;  2VRS A;  1S5L H;  1CIG A;  1RE3 C;  1FJK A;  2HLO A;  5IY5 1;  3H1J J;  1K8A Q;  3CCL P;  2KK7 A;  3AE3 C;  3OJA B;  1GL2 D;  2QJP B;  5B5E V;  1S5L E;  2YO2 A;  1M60 A;  4O1Q A;  4EIC A;  1J2J B;  1GMJ A;  4R4M A;  3TYY A;  1COR A;  2FYN C;  1FE6 A;  2R32 A;  4DT0 A;  1VF5 D;  1RY3 A;  3O1Y A;  1URQ C;  1A2S A;  1SQP J;  2HFE D;  2NPS C;  2P10 A;  3CCS P;  3RK3 B;  3CC7 P;  2M5A A;  1KTM A;  3BCC J;  4GKG A;  5H2F E;  3RN1 A;  2XTS B;  1BDC A;  5AUR A;  2HPC B;  3CMA P;  3HD7 B;  3W68 A;  1H1O A;  1JO5 A;  2E75 D;  2WSC J;  5AW4 B;  1GTW A;  1P84 I;  4OGQ B;  1CI6 A;  2OZ1 B;  3SLE A;  1H8A A;  3BRT B;  2IBZ I;  1VQ9 P;  1NTZ D;  4BWN A;  1CSU A;  1HH7 A;  1X22 A;  1JY2 P;  1CSW A;  1I6D A;  2E76 B;  1CCR A;  3AE9 C;  4V2K A;  1LTI C;  5AW3 B;  4GIF A;  1JEK A;  3S4R A;  2Q3I A;  2JWD A;  3CWB E;  3QWO C;  3BAS A;  4C7R A;  2Y9Z A;  4CPG A;  1K3G A;  1LTB C;  3A0H H;  1WEJ F;  2FFD A;  4R4L A;  1M56 D;  2R5B A;  3A0H E;  3KQG A;  1KIL B;  1OFC X;  3CCM P;  1FI3 A;  5KAF E;  5KKZ C;  5BU5 A;  1M6Z A;  5DFS A;  3L74 E;  4XFJ A;  1FJP A;  2KSE A;  3MK7 B;  5APT A;  1CRJ A;  2N3Y A;  5EFW B;  4I7Z C;  4ZMD A;  5M1B A;  1FI9 A;  3HE5 A;  2M3E A;  5B66 V;  2K9J A;  1LP1 B;  3II6 A;  1L0L K;  4QMA A;  1GL2 B;  3AEB C;  1FZC C;  2AIU A;  1C2R A;  1CHH A;  1OAE A;  2ZFC A;  3JCU H;  2C0W A;  3AEE C;  2ZON G;  2V7Q H;  1PGP A;  3CWB J;  4WB4 A;  3JCU E;  4H13 B;  3M0D C;  2KSJ A;  1CRY A;  1YYC A;  1S2E A;  5DJT B;  1U75 B;  1LTS C;  1GU4 A;  2Y0E A;  4GYD A;  4XA4 A;  2C2C A;  2OTJ P;  1BGY E;  2JWA A;  1QVG O;  3H1K D;  1EQ7 A;  1EZV D;  3L74 J;  1ZLL A;  3C9I A;  1IK9 A;  3H32 B;  5CBN A;  2WPR A;  1HTL C;  4GT1 A;  3L4F A;  1KMI Z;  2FYZ A;  2HPC A;  1PFI A;  3LW5 H;  3A0B H;  1XTG B;  1FAV A;  5C0Z A;  2H7H A;  4H0L B;  4P4Q B;  1MG3 D;  1PGQ A;  1KB9 E;  1IQC A;  2OZ1 A;  2Y0C A;  2FXO A;  1GD2 E;  2HG5 D;  2A06 D;  3RK2 D;  1HJB A;  4I2L C;  3OA7 A;  1RHZ B;  1FI7 A;  2YXR B;  4PD4 I;  3CX5 W;  1GU2 A;  4RJT A;  3SWS A; 
#chains in the Genus database with same CATH homology
 1GJQ A;  1AYG A;  2C1D A;  4XXL A;  3A0B V;  1LC1 A;  1M70 A;  1QKS A;  2C1D B;  1IZL 0;  1CED A;  1I55 A;  2JQR A;  1CRH A;  2Q3E A;  4RSZ A;  2B10 B;  3OA8 A;  3O5C A;  1NIR A;  1CXC A;  4AAL A;  3OA8 B;  2BCC D;  1CYJ A;  1IRV A;  1DIQ C;  5C9M A;  3CYT I;  3ORV A;  1LMS A;  3WFD C;  1CC5 A;  2JTI B;  1HZU A;  1RZ6 A;  2RMZ A;  1QYZ A;  3SVW A;  4GED B;  1CO6 A;  1H32 A;  3PHL A;  1YNR A;  5CIE B;  4PJ0 V;  1GIW A;  1E2R A;  5CIH B;  3WFE C;  2GC4 D;  2C1V A;  1RZ5 A;  1CSX A;  3CU4 A;  1I8O A;  1RAQ A;  2MHM A;  4XYD B;  1ZRT D;  1KYO D;  1JDL A;  4FB1 A;  3JBT B;  2AXT V;  3DP5 A;  1QL4 A;  2LIT A;  3RMZ A;  1CYC A;  2BH4 X;  4WQ9 A;  1CHI A;  1A56 A;  4J20 A;  2GC7 D;  1W2L A;  1N90 A;  1YEA A;  1L9J C;  1DW0 A;  4EIE A;  1L0L D;  1J3S A;  1CRG A;  1AOQ A;  1S6V B;  1U74 B;  2CA3 B;  2FYU D;  3RN0 A;  1AKK A;  1CIE A;  3O20 A;  4AAO A;  3OCD B;  5DJQ B;  5TJH A;  4FAV A;  2Y0D A;  1VYD A;  3HQ9 A;  4L1Q A;  1KX2 A;  5B6Q A;  3SWS A;  1HCM A;  2KNC B;  2GB8 B;  1YTC A;  351C A;  1HRO A;  1CCH A;  4PWA A;  4D6T D;  4FAN A;  3CX5 D;  5KLV D;  3L73 D;  1H9X A;  3HQ7 A;  1SQV D;  1BE3 D;  4U3F D;  4WQA A;  1E29 A;  1DII C;  3L4O A;  1CHJ A;  5CYT R;  3ZOX A;  3M97 X;  1C6S A;  1FOC A;  2CXB A;  4UB6 V;  1OCD A;  2CE0 A;  1S5L V;  2CE1 A;  1CTY A;  4JCG A;  4N0K A;  1BGY D;  2B12 B;  4AAM A;  2C8S A;  1MZ4 A;  3DR0 A;  1NNO A;  2N3B A;  2V07 A;  1W5C T;  5CIG B;  2FRC A;  1DW1 A;  1F1F A;  3PXW A;  1N15 A;  1AOF A;  1FHB A;  4AX3 A;  2GIW A;  3KZI V;  1KB9 D;  3L72 D;  1I54 A;  4WQD A;  5CIB B;  5TIS V;  5H2F V;  3PLN A;  1LS9 A;  1KX7 A;  2ZXY A;  3WU2 V;  3NBS A;  2BH5 X;  2ZBO A;  2EXV A;  3SJL A;  3L4M A;  1WVE C;  3L70 D;  5EXQ A;  1KIB A;  1N50 A;  1F1C A;  1C6O A;  3X39 A;  3FWL A;  2O3J A;  2FWL A;  1HJ3 A;  1E8E A;  1GDV A;  3WC8 A;  1COT A;  1CYI A;  1YEB A;  1PP9 D;  4UB8 V;  3RLM A;  1KV9 A;  3CWB D;  1IRW A;  4WQE A;  1EB7 A;  2N18 B;  2L91 A;  3H1L D;  1HJ4 A;  5CID B;  4AAN A;  4FA1 A;  2ZOO A;  4K3I A;  2B11 B;  3SXT A;  1QN2 A;  1GKS A;  3PRJ A;  2C1U A;  2ORL A;  5KLI B;  2N9Y B;  3L74 D;  1L0N D;  2FYN B;  2D0S A;  1SQX D;  3A0H V;  3HQ8 A;  1DVV A;  2I8F A;  2YQB A;  5KAF V;  1FCD C;  1CNO A;  1P84 D;  2N9J A;  3ZOW A;  3OCD A;  2B0Z B;  2IBZ D;  2N18 C;  2AI5 A;  2RN0 A;  5DF5 A;  2D0W A;  5CIF B;  1B7V A;  2K9J B;  4IL6 V;  1CXA A;  1C75 A;  1CIG A;  5KAI V;  2BGV X;  5IY5 1;  1RAP A;  1BCC D;  1H33 B;  3PH2 B;  2QJP B;  5B5E V;  1SQB D;  1DVH A;  2DVH A;  3WUI A;  3PXS A;  1M60 A;  4O1Q A;  4EIC A;  1COR A;  3ZOY A;  2BPB B;  1LFM A;  4L3H A;  4WQC A;  2C9X B;  3O1Y A;  4YE1 A;  5CIC B;  1A2S A;  3L71 D;  451C A;  3ITK A;  1I8P A;  2N9I A;  1C52 A;  4QAO A;  5GTI V;  3KHU A;  3TDK A;  1H9Y A;  3RN1 A;  2XTS B;  4A7P A;  4O1W A;  5AUR A;  2QJY B;  3PTZ A;  4WQ8 A;  1H1O A;  3TGU D;  3ZBM A;  3WFB C;  2OZ1 B;  3SLE A;  1NTZ D;  1CSU A;  3CP5 A;  3VYM A;  2PCC B;  1C2N A;  3H1H D;  2PCB B;  1HH7 A;  1CSW A;  1I6D A;  4FA5 A;  5KKZ B;  1QL3 A;  4L3G A;  3NWV A;  1CCR A;  4V2K A;  3A9F A;  3VMA A;  1CTJ A;  2BLF B;  3H1I D;  1GQ1 A;  3CXH W;  1NTK D;  1NU1 D;  1ZZH A;  1K3G A;  4MU8 A;  1WEJ F;  1SQQ D;  1N9C A;  2HV4 A;  1K3H A;  1CSV A;  1KB0 A;  1FI3 A;  1L9B C;  1M6Z A;  5DFS A;  5E79 V;  3C2C A;  2LIR A;  155C A;  1A8C A;  4KMG A;  1I5T A;  2L4D A;  3MK7 B;  4EDF A;  1H32 B;  3DMI A;  1CRJ A;  2N3Y A;  1NTM D;  3H1J D;  1YIQ A;  3ZIY A;  1DW2 A;  4WQ7 A;  4NFG B;  2QG4 A;  4Q5P A;  1FI9 A;  3O0R C;  5B66 V;  2CA4 B;  3HQ6 A;  5GTH V;  3ZCF A;  3TF5 A;  2AIU A;  1C2R A;  4PD4 D;  1CHH A;  4PW9 B;  1OAE A;  2YCC A;  1H33 A;  4DY9 A;  1SQP D;  2ZON G;  1YCC A;  4Y5R A;  4H0J A;  1BL9 A;  1KYO W;  4EIF A;  1IO3 A;  2ZZS 1;  1HRC A;  4WQB A;  1CRC A;  1C7M A;  3BCC D;  2KS1 A;  3MK7 C;  2VHD A;  1CRY A;  1ETP A;  1U75 B;  1PPJ D;  1CIF A;  1NML A;  2Y0E A;  4GYD A;  2PAC A;  3L75 D;  2C2C A;  2DGE A;  2JWA A;  3H1K D;  1LC2 A;  2QJK B;  1EZV D;  3ZOO A;  2YK3 A;  4LJI A;  3VNW A;  1MG2 D;  1YIC A;  1NMI A;  1FJ0 A;  1HJ5 A;  3GW6 A;  2V08 A;  4FA9 A;  1CRI A;  5C0Z A;  1DW3 A;  4EID A;  1CTZ A;  4P4Q B;  1MG3 D;  1IQC A;  2OZ1 A;  2Y0C A;  1DT1 A;  3VRD A;  2A06 D;  4FA4 A;  1HZV A;  2B4Z A;  3GG2 A;  3PXT A;  1C6R A;  1FI7 A;  1H31 A;  2BCN B;  3CX5 W;  1CIH A;  3TYI A;  1I6E A;  1R0Q A;  2YIU B;  1GU2 A;  3NBT A;  5DJQ C;  3CXH D;  1YFC A;  4RJT A;  1H31 B;  2MTA C;  4H0K A;  3WFC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...