1L0LD

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
240
structure length
240
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1l0lD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1l0lD01
3TDKA 5E79V 4Y5RA 1CIFA 1C6OA 1GKSA 3CXHD 3L70D 2BCNB 2QG4A 1AOFA 2CA4B 2ZBOA 2BH4X 1AKKA 3CX5W 3KHUA 1MZ4A 5C9MA 1CCHA 3JBTB 1QYZA 2ZONG 3HQ8A 3KZIV 1KB9D 1RAQA 4EIFA 5IY51 2N9JA 3DP5A 2IBZD 3CU4A 1FI9A 4WQEA 1CRJA 1DW2A 2YIUB 1K3GA 1ZZHA 3PXSA 1BGYD 2D0WA 5KAIV 2ZOOA 3A9FA 3BCCD 1IRVA 1NU1D 2GB8B 3ZBMA 2PCBB 3ZCFA 2N9IA 3X39A 1C7MA 3C2CA 1H9XA 1VYDA 4AALA 1YTCA 2OZ1B 4XXLA 2DVHA 2L91A 1H33A 3NBSA 1H31B 2B4ZA 4L1QA 3VYMA 1CIGA 4UB6V 4PJ0V 3O1YA 1CRIA 1HJ5A 1LS9A 4U3FD 1HZVA 1I55A 1CHIA 1YCCA 1CIEA 5CIFB 2Y0EA 3MK7C 3OCDB 2CE0A 3HQ9A 1MG3D 2JQRA 4WQ9A 1CSUA 1DVVA 1N50A 3H1KD 3PH2B 2KS1A 2K9JB 1CSWA 3M97X 5H2FV 1CYIA 2BH5X 2QJYB 2V08A 5KLVD 5GTIV 1FHBA 3DMIA 1H32A 2CA3B 5KKZB 1CYCA 1GIWA 3L75D 2HV4A 1EB7A 1YEAA 1KX2A 1CHJA 4EIEA 5CIBB 2DGEA 351CA 1GJQA 4EICA 3OA8B 1I54A 1N90A 2QJKB 1DT1A 2A06D 4J20A 1S5LV 2C1VA 1DIIC 2C1DA 1L0ND 4WQAA 2YCCA 4L3GA 3WUIA 2EXVA 1L9BC 1DVHA 4H0JA 1GU2A 2D0SA 3WFEC 1HROA 1I6DA 2KNCB 1QKSA 3L72D 1E29A 2CXBA 3ORVA 2B11B 1P84D 2RMZA 2YK3A 3MK7B 2Y0CA 1GQ1A 1F1CA 3CP5A 2PACA 1KB0A 4DY9A 5CICB 1CTJA 2YQBA 1QL4A 1LMSA 2N3YA 1H9YA 3DR0A 5EXQA 5TJHA 2O3JA 4RJTA 2N3BA 4EIDA 4KMGA 1RZ5A 2MHMA 1NMLA 1H33B 1PPJD 3CXHW 2N18C 1KIBA 1FOCA 3NWVA 1DIQC 2AXTV 155CA 1YEBA 2MTAC 1COTA 2C1UA 1IRWA 2VHDA 5DF5A 3WFCC 4LJIA 3PXTA 1YIQA 3ITKA 1L9JC 4WQ7A 1EZVD 2AIUA 5DJQC 1IO3A 1WVEC 1CSVA 3H1ID 2Q3EA 1C6RA 4RSZA 1CIHA 1CO6A 1CTZA 5TISV 1A56A 5CIGB 1KV9A 3GW6A 2B10B 2B12B 1DW0A 3L4MA 1I5TA 1ETPA 4D6TD 1CRCA 4GYDA 1YICA 4UB8V 2N9YB 3WFBC 3H1HD 5CIEB 1H1OA 1L0LD 1QN2A 1HZUA 2OZ1A 2AI5A 1E8EA 3L74D 3VRDA 1CNOA 4FA9A 1H31A 1K3HA 2C1DB 4EDFA 1LC2A 5B66V 1QL3A 1NTMD 1YFCA 4IL6V 1BE3D 1E2RA 3WU2V 2N18B 4WQBA 2RN0A 4N0KA 3OCDA 1U75B 4FA1A 1KYOD 2LIRA 3PLNA 1AOQA 1C6SA 1BL9A 1AYGA 1N15A 1RZ6A 1DW1A 1GDVA 3RMZA 3VMAA 5C0ZA 1FI7A 1RAPA 1C52A 2Y0DA 1SQXD 1PP9D 4AAOA 1MG2D 4FB1A 3FWLA 5CIDB 1W2LA 1HJ3A 5DJQB 3H1LD 1B7VA 3O5CA 3PTZA 1NNOA 1NTZD 1CRGA 3A0BV 1KYOW 3HQ7A 3OA8A 5CYTR 1HRCA 2GC7D 2CE1A 3A0HV 1I8OA 2FYNB 3ZOYA 3O20A 1HCMA 3ZOWA 2ZXYA 1NIRA 2I8FA 1CRHA 1JDLA 3WC8A 3RN1A 4WQDA 2FWLA 1OCDA 4NFGB 1HJ4A 4Q5PA 3RLMA 1ZRTD 4FAVA 2C8SA 1SQBD 2XTSB 5GTHV 3ZOOA 3HQ6A 5AURA 1KX7A 2JWAA 1CXCA 4AX3A 1BCCD 3VNWA 3SLEA 1OAEA 1R0QA 1NMIA 4AAMA 4O1WA 3WFDC 1F1FA 2FRCA 3L71D 2PCCB 4O1QA 3SVWA 2FYUD 1CXAA 1NTKD 2C2CA 4PWAA 2BGVX 2JTIB 4MU8A 4YE1A 1IZL0 3CWBD 1C2NA 1I8PA 2GIWA 3PRJA 1H32B 4FA5A 1SQVD 451CA 4GEDB 1M6ZA 1N9CA 1M60A 4H0KA 3SWSA 5B5EV 2BLFB 1YNRA 1WEJF 2ZZS1 4PD4D 2C9XB 1CORA 1A8CA 5KLIB 1I6EA 3ZOXA 1U74B 3H1JD 1J3SA 3SXTA 4JCGA 1FI3A 5B6QA 4FA4A 2BPBB 2LITA 1C2RA 1S6VB 2ORLA 3ZIYA 1W5CT 3O0RC 2GC4D 3PHLA 4V2KA 3SJLA 3L4OA 3TGUD 1CC5A 2V07A 5DFSA 1CCRA 1LFMA 5KAFV 1CEDA 3TF5A 4L3HA 4A7PA 3CYTI 2QJPB 1A2SA 1M70A 4FANA 1IQCA 1CYJA 1CRYA 1FJ0A 3NBTA 1CSXA 4AANA 1CTYA 1LC1A 3CX5D 4WQ8A 4P4QB 2BCCD 1SQQD 3PXWA 4WQCA 5CIHB 4K3IA 2B0ZB 1FCDC 1C75A 1HH7A 3TYIA 1CHHA 4XYDB 1DW3A 4QAOA 1SQPD 2L4DA 3RN0A 4PW9B 3L73D 3GG2A
chains in the Genus database with same CATH superfamily
3T97A 1FOSE 3TDKA 2QEXP 1C6OA 1OW8A 1OMIA 3L70D 2OTJP 1SQPG 1NAFA 2ZBOA 3CX5W 1EDIA 5E79H 1IFDA 3KYQA 3Q3DA 3KZIV 4EIFA 1SQQJ 2P1JA 2NZ2A 2OARA 1FI9A 3CU4A 2LXBA 1JY2N 1A02F 2WSEH 1CRJA 1M7LA 1KQFB 4EYYQ 1ZZHA 1BGYD 1LT9A 1K73Q 3BCCD 1OVVA 2KXPB 1H89A 1LTSC 3X39A 3P8CD 4AALA 4W80A 2DVHA 1H33A 1U7JA 3KXDA 4GT1A 1QGKB 5CCHA 4UB6V 3C1LA 4PJ0V 2JEEA 1EXJA 5AVXB 1HJ5A 1HZVA 1IK7A 1I55A 2SPZA 1N7SD 3MK7C 1EZVG 3OCDB 3AEGC 2ZYAA 3HQ9A 3OJAB 1CSUA 1DVVA 1BGYJ 4H13B 1T3UA 3H1IG 4Y99C 2K9JB 2ZAEB 1SFCD 3M97X 5CCHD 1CYIA 2BH5X 2QJYB 2L5GB 1MKMA 3RBXA 5GTIV 1RF0A 1KB9I 5APSA 1FHBA 3RK3C 1X22A 1H32A 2CA3B 5KKZB 1JO5A 3L75D 2HV4A 1EB7A 1YEAA 4JQ0D 4EIEA 4EICA 4U3FE 1J1DC 3CXHH 3L74G 3CCVP 1S2EA 1S72P 2A06D 3D6ZA 1S5LV 1FE6A 1M1JB 1W2BO 4WY4B 2WITA 2P58A 3WU2H 2K37A 4L3GA 3WUIA 4HJGH 5KLVE 2E5TA 4BRYB 3L75J 3GF7A 2ZVOB 1L0NG 3ORVA 3EFGA 2OYHB 2AEJA 2RMZA 2R3CA 5EFWB 1GQ1A 3CP5A 3H32A 4L75A 4I7ZC 2AEFA 1RQUA 1S9KD 1DD4A 1LWUB 4DY9A 1K8AQ 2YQBA 1QL4A 4WVZA 1JY3O 2JR8A 4LLHA 1W2EA 1RZ5A 1PGOA 1EDJA 1OX3A 2WVRA 3CXHW 2KP8A 3L72E 1DIQC 1USEA 1LTGC 4GOFA 3HD7A 2R5DA 1COTA 2VHDA 4ASWA 3PXTA 2M5AA 2K1AA 3VTPC 1L9JC 3HUSC 3B5NA 1IO3A 1EQ7A 3S1KA 2H88C 4RSZA 1CO6A 1H0TB 3HD7D 4JBZA 3CMEP 1M90Q 2B10B 1PPJE 1URQC 2IPPA 1DW0A 5CJ4A 2FFDC 3RBZA 2RKLA 1I5TA 1ETPA 5APUA 1FZGA 3GHGA 2OYOA 4I6MC 2J5UA 1EXIA 4UB8V 4DOJA 3E7KA 3WFBC 3SSUA 1L0LD 3A5TA 1HZUA 2OZ1A 1SQVK 4FA9A 4AYCA 1AV1A 2C1DB 1WRGA 3KPEA 4EDFA 2QA4P 3HE5B 3CWBJ 1IFMA 4KHXA 1G2CB 3P7KA 4IL6V 1BE3D 1E2RA 2N18B 1DD3A 1OZHA 4N0KA 5E79E 1JY2P 4GDOA 4IOIH 3PLNA 1AOQA 3RL0D 4D6TE 5APVA 3S9OA 2N9BA 1RAPA 2B87A 2O01N 3H1HE 1EZVI 1L0LJ 4AAOA 1KQLA 3FWLA 4RKUJ 4JF7A 1B7VA 3O5CA 2KZJA 3E1RA 1YTZT 1CRGA 1PP9G 3RGUA 1BE3J 5CYTR 5KAIE 4H44C 1I8OA 3ZOYA 3B4SA 3O20A 3ZOWA 1NIRA 1YI2P 2OYIC 1JDLA 1FJKA 1X8YA 4PD4I 2HODA 2W83C 2KB7P 1JMBA 1ZRTD 4FAVA 1SQQK 3OAKA 3M06A 5GTHV 4K3AA 1QX8A 1KX7A 1CW5A 3MP7B 3TK1A 3MHVA 2FYZA 1VDFA 2O1JA 1VF5B 3QWOC 5APQA 4OGQB 4YTPC 1FAVA 4BWNA 2NPSB 1VQOP 2FRCA 3G3ZA 5H2FE 3KZIH 4BXLA 1CXAA 1Y8AA 1JM0A 2A45H 2C2CA 2BGVX 4YE1A 2OTKE 1SQBE 1I8PA 2M3EA 3VMZA 3PRJA 3L36A 4FA5A 1YJ9P 2K88A 451CA 1HUCA 4GEDB 1OXZA 4GOEA 4H0KA 1KYOH 5M1BA 2Q5UA 3AE7C 1NKNA 1QL1A 1S3JA 2C9XB 3D70A 5KLIB 2CK3H 2B88A 4ASVA 2RH0A 1R5SA 4PJ0H 3V2PA 1HH0A 4U3FG 5B6QA 3M91A 3CC4P 1KV4A 4C7RA 4IL6X 4O9BA 1C2RA 4Z1MH 3ZIYA 1SQVE 1T2KC 3SJLA 1M1KQ 1CC5A 2V07A 5DFSA 1CCRA 4WWIA 3TF5A 1GL2B 2WSEJ 4A7PA 1G1JA 4PD4E 5KLVG 1IQCA 3EQ2A 2DW3A 1GMJA 3HUSB 5KAFH 3Q5RA 3C9IA 3H1KE 1LC1A 4WQ8A 2Q6QA 1NH4A 1JTHA 1IFIA 1PL5A 4WQCA 4K3IA 1C75A 2AXTE 1S5LH 4XYDB 4HB1A 1SQPD 3BASA 3TGUE 3RN0A 4H13C 5AVQB 2P10A 4Y5RA 1CIFA 3CXHD 1NOHA 5CJ0A 4R4MA 2BH4X 1SQXK 3L72G 1JY3P 2QJYC 2WTYA 5C9MA 2HPCA 3JBTB 1FU1A 1MV8A 2WPSA 3MD0A 3HQ8A 1RAQA 5KKZC 1SQQE 3II6A 2XKMA 4WQEA 1KORA 1URQA 1SQPJ 2FFDA 4TLFA 3N7NA 2D0WA 2G3AA 3I5CA 1NU1D 3U1AA 2GB8B 1M1JC 2PCBB 1RE4A 4WY4C 2N9IA 1PPJG 3M9QA 3VN0A 3CCQP 2E75B 2D2CB 2L91A 4H0LC 3NBSA 1H31B 2B4ZA 3G6EP 1KILA 1CRIA 1LS9A 2OYHC 5CIFB 2CE0A 1MG3D 2JQRA 1A02J 1N50A 3H1KD 1BGYE 3H25A 1GW3A 1LWUC 1NU1J 5L8RJ 3FX0A 5AVZB 1HJ0A 1NTKK 1LTJB 2FXOA 3CX5H 3QH9A 3SWYA 1KILD 2V08A 3FWNA 4YXWH 2E76B 2M3BA 4D6TG 3DMIA 1CSBA 1CYCA 1GIWA 2OQQA 2PP6A 1KX2A 1FDIA 5CIBB 2DGEA 3HE4B 351CA 1X79B 3OA8B 3H1HG 1JY2O 3IR9A 3USSA 1N90A 1DT1A 2R3SA 3NXSA 3BVHA 1IFJA 1CI6B 1L0LK 1YIJP 1L4AA 2OYIA 1PGQA 2KOGA 2PFXA 1DH3A 1L0ND 2R5BA 1L9BC 1DVHA 1N86A 3K5BA 3WFEC 4H44D 2H7HA 3L75E 1E29A 2CXBA 2B11B 1Y9BA 1L4AD 2WT7A 1HGZA 3IN6A 2PACA 2A06E 1R5LA 2ZT9D 4WB4A 1Z56A 1NTZG 1LTBC 1KYOE 1LT9B 2KYVA 1CTJA 2Q7CA 1N7SB 1L0NJ 1XTCC 2N3BA 4EIDA 2MHMA 3HTKB 1FZCA 1H33B 1N2DC 2N18C 4LGDE 1SFCB 1KIBA 3NWVA 3JCUE 1YEBA 2YXQB 1SQBG 1JNMA 3FXEA 2KI7B 2C1UA 3CCJP 5DF5A 3I55P 1S9KE 2JO1A 1L2PA 1UIXA 4WQ7A 3G71P 1DEBA 4EIJA 2Q3EA 5KTBA 1VL2A 1CTZA 2GA1A 3D0WA 4I1LA 5KAFE 3GW6A 4RO0A 3L4MA 3F89A 1VQ7P 5TISH 3Q5SA 1KD1Q 1CRCA 4GYDA 2MKVA 5AW8B 5BVZA 1AFOA 5CIEB 2YO3A 1BSHA 2YMYA 1GDTA 2AI5A 3VRDA 1CNOA 2BEQD 2R32A 2KSJA 1QL3A 1NYHA 1NTMD 1P84H 1VF5C 4WQBA 4OGQC 3OCDA 4PV1C 1KYOD 4NPFX 3NMDA 2NPSC 5B66H 1BL9A 1FZFA 1N15A 4JPZB 1RZ6A 2YMKA 2K9JA 2Y0DA 1SQXD 4H0LB 3CD6P 3TGUG 1VQ5P 1PP9D 3IF4A 5K5GB 1L0LE 1HJ3A 5DJQB 1SVFA 1VQPP 4XA4A 2WQYC 3PTZA 2UWJE 1NTMJ 2WSCH 3V6IA 3AE8C 3O8ZA 1FS0E 1BE3E 3H1LG 3M0DC 2GC7D 1M57D 5KLIC 4DT0A 2P7JA 3KQGA 3A0BH 1SQQG 2I8FA 3HD7B 3RN1A 1M1JA 3SWKA 1OCDA 1SQXJ 3AECC 4WY4A 3RLMA 3A0HH 1PP9J 1YTZI 2P2UA 3L73G 1EDLA 3ZOOA 3G9RA 2ZJSE 1SQPK 3L70G 4BRYA 2JWAA 3UIAA 3AEBC 1IFNA 1BCCD 2OYHA 2B89A 1R0QA 1GL2C 3M9BA 3WFDC 1HVVA 2N1TB 1SS1A 1F1FA 4AQRD 1N8RQ 3L71D 2KS1B 2PCCB 1LWUA 1NTKD 3AE5C 5AW5B 2JTIB 4MU8A 1GD2E 1ZRTE 2FY8A 1H8AA 2Q9IA 3CWBD 3RL0B 3HRNA 2E74B 1BGYG 2FYUG 1Q82Q 1Q86Q 3WUUA 5APWA 3BCCG 4TT3H 3B8EB 1QVGO 3U59A 1N9CA 4EI2A 3SWSA 5CCGA 1BCCJ 1RE3C 4ZKPA 3B5ND 3CCUP 4ZKUA 4IFFA 1NU1K 1CORA 1I6EA 3ZOXA 3LW5J 3A2AA 1U74B 3H1JD 1J3SA 3L71J 5B5EH 1NTKJ 3Q5PA 3CXHI 1IJDB 4NPEA 4DZOA 2JP3A 3CLQA 2B87B 5CCGD 2LITA 2ORLA 2KUBA 1H88A 1HF9A 2P67A 1PGJA 2C9NY 1W5CT 2W27A 1H0TA 1FOSF 5AW7B 2HLOA 3PHLA 2HYNA 3IAOA 1HBWA 5KJ7C 1N73B 2QJPB 1CYJA 5AW1B 3H1JJ 1CRYA 2KLVA 1LGHB 2E75C 1CTYA 2D2CC 3VMYA 3CX5D 1XTGB 4C7NB 3TSIA 4N6JA 4R4LA 2BCCD 2A06G 2KLUA 3HE5A 5CBOA 3CC2P 1Q2NA 3TYIA 1FCDC 1G2CA 1CHHA 1DW3A 4HYTB 4PW9B 3GG2A 1U7MA 5AVSB 5E79V 1JUNA 1JOCA 1LJ2A 1GKSA 2QG4A 1R8EA 1AOFA 1WMKA 1L0NK 2CA4B 1LTJC 2WPQA 1AKKA 1MZ4A 3O6QB 5AVWB 3CMAP 2E76C 2KNCA 5TISE 2ZONG 3VMXA 1KB9D 2Z5IA 2BCCJ 4C46A 5IY51 3H6PA 2IBZD 1HJBA 2WPRA 1OVUA 3KDPB 4L73A 4PV1B 3AE3C 1SQPE 1OW6A 3V4WA 5KAIV 2KSEA 3A9FA 2XDJA 2NRGA 2PGDA 3CCRP 1BDDA 1MFZA 1FZBA 3CXHE 3D71A 3ZBMA 3ZCFA 1C7MA 1VYDA 1YTCA 5B66E 4L74A 4QMAA 3TYYA 3WU2E 1LT1A 3OA7A 4I2LC 1CHIA 1CIEA 2HG5D 4OH8B 2NPSA 4UB6H 4KJMA 3RK3D 3PH2B 2PAJA 1LT9C 4GKGA 1CSWA 1NU1E 2Q3IA 1YITP 5H2FV 1IO4A 1N7SC 4Y28J 3CCEP 3P8MC 1LP1A 3FGAD 4M3LA 1ZXGA 3OW2O 3A0BE 2XU6A 2Z4EA 1DEEG 1RF1B 2VRSA 1Y47A 3GF3A 1SFCC 1CHJA 3A0HE 2M0BA 5CCHC 1GJQA 1I54A 3M0DA 5GTIH 1HGVA 2QJKB 2O01J 1RY3A 2I1JA 3RK2B 2LXCB 2LR2A 1GZLA 1ZV8A 2ZFCA 3B71A 1BE3G 4DJGA 3SFDC 1KILE 1NTMK 2EXVA 4GODA 1ZW0A 4H0JA 2D0SA 1KC8Q 1I6DA 2QIWA 2HPCB 1YQ3C 3LW5H 2JDIH 3C8VA 1P84D 1FDMA 3VYIA 1GL2A 5APYA 2YKQA 1RH5B 3CCLP 3L4FA 3CCSP 1KB0A 5CMZA 2YKOA 3HUSA 4U7JA 2H89C 2N3YA 1L0NE 2GM4A 3DR0A 5EXQA 4RJTA 2O3JA 3U1CA 4N3YB 1GL2D 1NHLA 2A45I 1NMLA 5B5EE 2Z5HA 2CPSA 2YXRB 1FOCA 1NTZJ 3W67A 1KILB 2AXTV 1NKZB 155CA 4XE5B 1HWTC 3P32A 4B86A 1AJYA 2ZVNB 1ZR4A 4HH2A 1VQ6P 1IRWA 3WFCC 1KYOI 3ITKA 1YIQA 1QLED 3SFEC 1YHQP 1EZVD 1URQD 1KFNA 2V7QJ 1PV3A 5DJQC 5APXA 5CBNA 1WVEC 1CSVA 3H1ID 3TNUB 3VP8A 3WMM0 5BU8B 5C39A 2WSCJ 1BDCA 5KJ7A 4L76A 3AE9C 1FC2C 1T8ZA 3HD7C 1YICA 3BATA 1LNQA 3R2PA 1KN7A 1Q90D 1H1OA 3L74D 2WMMA 1QL2A 1H31A 1NWQA 1K3HA 3H1IJ 4UB8H 2ZT9B 1KMIZ 3AE6C 1YJNP 1YFCA 1E5WA 4HKZH 4YPCA 2N1TC 2C9LY 3T97B 3FXDA 2E75D 4LC1A 2C0XA 1DW1A 1GDVA 3RMZA 3VMAA 5C0ZA 1FI7A 1KB9H 4IL6H 2C0WA 3A7OA 3KZIE 2ZYDA 5CIDB 1W2LA 3L74J 3RL0C 2E74C 3H1LD 1NNOA 4DCKA 1ZOYC 1FJPA 1NTME 1T6AA 1USDA 3HE4A 4XFJA 3OA8A 1HRCA 1ZMEC 1FZCB 1OIPA 3G4SP 2FYNB 2OTLP 2Q1KA 1CI6A 1ZN5A 3AE4C 1CRHA 2E76D 4WQDA 1HJ4A 4Q5PA 1SQXE 1PP9E 2XTSB 4UB6E 4PJ0E 2BASA 3H1LJ 1GW4A 1JCDA 2O01H 1CXCA 1QEXA 2FXPA 2MJZA 1OAEA 2AXCA 2IFNA 4AAMA 1N73C 5GTHH 1JMMA 1IFPA 2QJPC 2YKPA 2R44A 4N78D 3L73J 2FYUD 4PWAA 3L70J 5GTIE 2H43A 1N7SA 1SP4A 1OWAA 3R4YA 1H32B 3HTKA 5KAIH 1QVFO 3CX5I 3MZWB 1NU1G 1BSNA 1SFCA 1AVYA 2KK7A 4JYCA 1BCCE 2BLFB 1VPCA 1WEJF 2ZZS1 1S5LE 1SQVG 3M9HA 2XNDH 2WSFJ 1M56D 3L71E 2FYUJ 1T2KD 3N4XA 1NTKE 3BCCJ 4FA4A 2XZRA 2BPBB 1KQGB 3CWBE 3H1KG 4EOTA 3WUVA 2W8ZA 3O0RC 2IDBA 2WWWA 3L4OA 5KAFV 5H2FH 4L3HA 2IBZI 3A3YB 1UIIA 2V7QH 1A2SA 3H32B 3GMAA 1M70A 4FANA 1GU4A 1X9VA 3H1JE 3NBTA 1FJ0A 4AANA 4ZMDA 1DX7A 1G1IA 4P4QB 2QRXA 4OVNF 3V2NA 4H13D 3MUDC 1VQKP 4OWFA 1N7LA 1MZ9A 1SLQA 4GIFA 5AVTB 2BCNB 1JCCA 4NPDA 5AVRB 4ZNCA 2M5AB 3KHUA 5AW9B 1CCHA 2K9YA 3B5NB 2AEMA 1QYZA 3CX5E 1RF1C 2JKVA 2N9JA 1NTZK 2BCCE 3DP5A 1OVRA 5DJTB 4WY4D 1DW2A 4PD4H 2YIUB 4WBAA 2CPBA 3S4RA 1K3GA 1J1EB 2QJKC 3JC22 4H0LD 1Q7YQ 1KFMA 4UB8E 3PXSA 3GHGB 3RK2C 2ZOOA 1K9MQ 1IRVA 3C2CA 2HFED 1H9XA 4IFMA 2OZ1B 4XXLA 1SQBK 1VQNP 1DIPA 2I8DA 4L1QA 3VYMA 2AXTH 1CIGA 1KB9E 4IL6E 3O1YA 2LKMA 2V4HA 1KQSO 2IBZE 4U3FD 1YCCA 2Y0EA 3GLMA 1RQVA 1U57A 2N1TA 4WQ9A 5AW0B 2IFMA 1P84I 1OW7A 2KS1A 1W5CE 2FKWB 2I1KA 2KIKA 1JY3N 1RE4C 2ITAA 3CI9A 2WSSH 2Y9ZA 5KLVD 1NO4A 2N1TD 1YJWP 4U3FJ 1KILC 3CC7P 3SWFA 4AUWA 2A45G 1NJIQ 3L75G 1HTLC 1MUUA 1S5LX 3AEDC 5AVVB 4J20A 2B9BA 1AVOA 2C1VA 3RK3E 3AE2C 1NTMG 2E74D 2HODB 1DIIC 4MN4C 5AVUB 2C1DA 4KT0J 5GTHE 4WQAA 1NGMB 1WT6A 2YCCA 3AEAC 3NFQA 5KLVJ 3AEFC 1GU2A 2WZ7A 1HROA 2QSIA 2KNCB 1QKSA 3L72D 2WSFH 4CPGA 1ZR2A 1SQXG 1AQTA 2YK3A 3MK7B 1PIXA 2Y0CA 1N73A 1F1CA 3MIWA 1VQ4P 4Y99B 5CICB 3CCMP 1EDKA 1L4AC 1KTMA 2M8RA 1LMSA 1JB0J 1H9YA 4C7NA 3JSVC 3V2QA 5TJHA 4KMGA 2ZT9C 3CL3D 2QVAA 3RK3B 1S4XA 1MFTA 1PPJD 1YBKA 3L72J 1VQLP 1FZEA 2W6BA 2ZXEB 2XV5A 1NTZE 1P84E 1PZQA 2G8YA 1ZLLA 1J1DB 4W7YA 3F5HA 2MTAC 1RHZB 2QM8A 4LJIA 3PP5A 2H8PD 2QM7A 5CHXA 5AW6B 2AIUA 1BCCG 2IZ1A 3AEEC 3O6QA 3D6YA 5DJUB 1TU3F 1D7MA 1C6RA 1CIHA 5TISV 1A56A 5CIGB 1LP1B 1KV9A 3L71G 1PGPA 2B12B 1NTKG 1FZCC 5AVYB 2FYNC 3V2RA 2YNYA 4D6TD 4IFDK 3CWBG 2FYUK 2ZYGA 4I7ZB 5AW3B 5AW2B 2N9YB 3I56P 1VF5D 3H1HD 4OGQD 1QN2A 1EZVE 1E8EA 2ZXXA 4PV1D 1JTHB 2J59M 2KZIA 2NPSD 1KZUB 1LC2A 5B66V 3H1IE 3MGNA 3MUDA 3JCUH 2E43A 1L0LG 3H1JG 1YQ4C 1NVOA 3WU2V 2RN0A 1U75B 1FBMA 4FA1A 4D6TJ 2LIRA 2E5YA 1C6SA 2W6AA 1AYGA 3V4QA 3BRTB 3L37A 3BRVB 4YXDC 1C52A 3H1HJ 1JEKA 1MG2D 4FB1A 1AQ5A 1VQ8P 2HR3A 2QE7H 1RF0C 3L74E 2BEZF 1T3JA 1NTZD 1RF1A 1S1CX 1FDOA 3A0BV 1KYOW 3HQ7A 3CPWO 1URQB 3W68A 2CE1A 2FFDB 1M8OB 3A0HV 1HCMA 2ZXYA 2E42A 2JWDA 2BCCG 3Q1MA 3MTUE 3WC8A 1GK4A 2FWLA 4NFGB 2C8SA 2J58A 1SQBD 3EFFK 2IZ0A 3H1LE 2IYPA 3HQ6A 5AURA 3L35A 1K05A 1RE3A 3RL0g 3WUTA 3RK2D 1GU5A 4AX3A 3VNWA 3SLEA 1EC5A 1NMIA 3EWKA 4O1WA 2Y9YA 3L73E 4O1QA 3SVWA 3PH0A 4RESB 2IBZG 3AE1C 3L70E 1SQBJ 1IZL0 2W6JH 1GTWA 1Q81Q 1C2NA 2GIWA 1SQVD 4W7ZA 3LIEA 1M6ZA 1M60A 1ZP0C 5B5EV 3IFMA 2JJLA 1E79H 1YNRA 2O1KA 4H44B 2IX7C 4PD4D 1A8CA 2FBWC 1LTTC 1NAYA 1L4AB 4N78E 2OYIB 5AW4B 3SXTA 3M0AA 2GUSA 3VP9A 2FYUE 4JCGA 1FI3A 3B5NC 3BCCE 3NTNA 2PRRA 5KJ7D 1IZNB 1S6VB 2K3RA 3P8CE 3VOPA 3PJSK 1SQVJ 2GC4D 3TNUA 2IYOA 4V2KA 1AA0A 3TGUD 2YIUC 3ZDMA 4K35A 1J1EC 2GUVA 1LFMA 1CEDA 2WT7B 2D2CD 1GK6A 5CCGC 3CYTI 3GHGC 1J2JB 1LTIC 2XNXA 1LTJA 1X0TA 1LTAC 3Q2YA 3V5BA 4JYBA 1CZQA 2YO2A 1IC2A 2WPVB 1CSXA 1VQ9P 3ABVC 3H1KJ 5BU5A 5KLVK 1YYCA 1K04A 3LIDA 2FXMA 1FZAA 1SQQD 3PXWA 2OGUA 2W90A 1IK9A 5CIHB 2B0ZB 5APTA 1HH7A 1VQMP 3TGUJ 1PFIA 4QAOA 2POHA 1OFCX 3E1IA 2L4DA 3L73D
chains in the Genus database with same CATH topology
3TDKA 5E79V 4Y5RA 1CIFA 1C6OA 1GKSA 3CXHD 3L70D 2BCNB 2QG4A 1AOFA 2CA4B 2ZBOA 2BH4X 1AKKA 3CX5W 3KHUA 1MZ4A 5C9MA 1CCHA 3JBTB 1QYZA 2ZONG 3HQ8A 3KZIV 1KB9D 1RAQA 4EIFA 5IY51 2N9JA 3DP5A 2IBZD 3CU4A 1FI9A 4WQEA 1CRJA 1DW2A 2YIUB 1K3GA 1ZZHA 3PXSA 1BGYD 2D0WA 5KAIV 2ZOOA 3A9FA 3BCCD 1IRVA 1NU1D 2GB8B 3ZBMA 2PCBB 3ZCFA 2N9IA 3X39A 1C7MA 3C2CA 1H9XA 1VYDA 4AALA 1YTCA 2OZ1B 4XXLA 2DVHA 2L91A 1H33A 3NBSA 1H31B 2B4ZA 4L1QA 3VYMA 1CIGA 4UB6V 4PJ0V 3O1YA 1CRIA 1HJ5A 1LS9A 4U3FD 1HZVA 1I55A 1CHIA 1YCCA 1CIEA 5CIFB 2Y0EA 3MK7C 3OCDB 2CE0A 3HQ9A 1MG3D 2JQRA 4WQ9A 1CSUA 1DVVA 1N50A 3H1KD 3PH2B 2KS1A 2K9JB 1CSWA 3M97X 5H2FV 1CYIA 2BH5X 2QJYB 2V08A 5KLVD 5GTIV 1FHBA 3DMIA 1H32A 2CA3B 5KKZB 1CYCA 1GIWA 3L75D 2HV4A 1EB7A 1YEAA 1KX2A 1CHJA 4EIEA 5CIBB 2DGEA 351CA 1GJQA 4EICA 3OA8B 1I54A 1N90A 2QJKB 1DT1A 2A06D 4J20A 1S5LV 2C1VA 1DIIC 2C1DA 1L0ND 4WQAA 2YCCA 4L3GA 3WUIA 2EXVA 1L9BC 1DVHA 4H0JA 1GU2A 2D0SA 3WFEC 1HROA 1I6DA 2KNCB 1QKSA 3L72D 1E29A 2CXBA 3ORVA 2B11B 1P84D 2RMZA 2YK3A 3MK7B 2Y0CA 1GQ1A 1F1CA 3CP5A 2PACA 1KB0A 4DY9A 5CICB 1CTJA 2YQBA 1QL4A 1LMSA 2N3YA 1H9YA 3DR0A 5EXQA 5TJHA 2O3JA 4RJTA 2N3BA 4EIDA 4KMGA 1RZ5A 2MHMA 1NMLA 1H33B 1PPJD 3CXHW 2N18C 1KIBA 1FOCA 3NWVA 1DIQC 2AXTV 155CA 1YEBA 2MTAC 1COTA 2C1UA 1IRWA 2VHDA 5DF5A 3WFCC 4LJIA 3PXTA 1YIQA 3ITKA 1L9JC 4WQ7A 1EZVD 2AIUA 5DJQC 1IO3A 1WVEC 1CSVA 3H1ID 2Q3EA 1C6RA 4RSZA 1CIHA 1CO6A 1CTZA 5TISV 1A56A 5CIGB 1KV9A 3GW6A 2B10B 2B12B 1DW0A 3L4MA 1I5TA 1ETPA 4D6TD 1CRCA 4GYDA 1YICA 4UB8V 2N9YB 3WFBC 3H1HD 5CIEB 1H1OA 1L0LD 1QN2A 1HZUA 2OZ1A 2AI5A 1E8EA 3L74D 3VRDA 1CNOA 4FA9A 1H31A 1K3HA 2C1DB 4EDFA 1LC2A 5B66V 1QL3A 1NTMD 1YFCA 4IL6V 1BE3D 1E2RA 3WU2V 2N18B 4WQBA 2RN0A 4N0KA 3OCDA 1U75B 4FA1A 1KYOD 2LIRA 3PLNA 1AOQA 1C6SA 1BL9A 1AYGA 1N15A 1RZ6A 1DW1A 1GDVA 3RMZA 3VMAA 5C0ZA 1FI7A 1RAPA 1C52A 2Y0DA 1SQXD 1PP9D 4AAOA 1MG2D 4FB1A 3FWLA 5CIDB 1W2LA 1HJ3A 5DJQB 3H1LD 1B7VA 3O5CA 3PTZA 1NNOA 1NTZD 1CRGA 3A0BV 1KYOW 3HQ7A 3OA8A 5CYTR 1HRCA 2GC7D 2CE1A 3A0HV 1I8OA 2FYNB 3ZOYA 3O20A 1HCMA 3ZOWA 2ZXYA 1NIRA 2I8FA 1CRHA 1JDLA 3WC8A 3RN1A 4WQDA 2FWLA 1OCDA 4NFGB 1HJ4A 4Q5PA 3RLMA 1ZRTD 4FAVA 2C8SA 1SQBD 2XTSB 5GTHV 3ZOOA 3HQ6A 5AURA 1KX7A 2JWAA 1CXCA 4AX3A 1BCCD 3VNWA 3SLEA 1OAEA 1R0QA 1NMIA 4AAMA 4O1WA 3WFDC 1F1FA 2FRCA 3L71D 2PCCB 4O1QA 3SVWA 2FYUD 1CXAA 1NTKD 2C2CA 4PWAA 2BGVX 2JTIB 4MU8A 4YE1A 1IZL0 3CWBD 1C2NA 1I8PA 2GIWA 3PRJA 1H32B 4FA5A 1SQVD 451CA 4GEDB 1M6ZA 1N9CA 1M60A 4H0KA 3SWSA 5B5EV 2BLFB 1YNRA 1WEJF 2ZZS1 4PD4D 2C9XB 1CORA 1A8CA 5KLIB 1I6EA 3ZOXA 1U74B 3H1JD 1J3SA 3SXTA 4JCGA 1FI3A 5B6QA 4FA4A 2BPBB 2LITA 1C2RA 1S6VB 2ORLA 3ZIYA 1W5CT 3O0RC 2GC4D 3PHLA 4V2KA 3SJLA 3L4OA 3TGUD 1CC5A 2V07A 5DFSA 1CCRA 1LFMA 5KAFV 1CEDA 3TF5A 4L3HA 4A7PA 3CYTI 2QJPB 1A2SA 1M70A 4FANA 1IQCA 1CYJA 1CRYA 1FJ0A 3NBTA 1CSXA 4AANA 1CTYA 1LC1A 3CX5D 4WQ8A 4P4QB 2BCCD 1SQQD 3PXWA 4WQCA 5CIHB 4K3IA 2B0ZB 1FCDC 1C75A 1HH7A 3TYIA 1CHHA 4XYDB 1DW3A 4QAOA 1SQPD 2L4DA 3RN0A 4PW9B 3L73D 3GG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDK A;  5E79 V;  4Y5R A;  1CIF A;  1C6O A;  1GKS A;  3CXH D;  3L70 D;  2BCN B;  2QG4 A;  1AOF A;  2CA4 B;  2ZBO A;  2BH4 X;  1AKK A;  3CX5 W;  3KHU A;  1MZ4 A;  5C9M A;  1CCH A;  3JBT B;  1QYZ A;  2ZON G;  3HQ8 A;  3KZI V;  1KB9 D;  1RAQ A;  4EIF A;  5IY5 1;  2N9J A;  3DP5 A;  2IBZ D;  3CU4 A;  1FI9 A;  4WQE A;  1CRJ A;  1DW2 A;  2YIU B;  1K3G A;  1ZZH A;  3PXS A;  1BGY D;  2D0W A;  5KAI V;  2ZOO A;  3A9F A;  3BCC D;  1IRV A;  1NU1 D;  2GB8 B;  3ZBM A;  2PCB B;  3ZCF A;  2N9I A;  3X39 A;  1C7M A;  3C2C A;  1H9X A;  1VYD A;  4AAL A;  1YTC A;  2OZ1 B;  4XXL A;  2DVH A;  2L91 A;  1H33 A;  3NBS A;  1H31 B;  2B4Z A;  4L1Q A;  3VYM A;  1CIG A;  4UB6 V;  4PJ0 V;  3O1Y A;  1CRI A;  1HJ5 A;  1LS9 A;  4U3F D;  1HZV A;  1I55 A;  1CHI A;  1YCC A;  1CIE A;  5CIF B;  2Y0E A;  3MK7 C;  3OCD B;  2CE0 A;  3HQ9 A;  1MG3 D;  2JQR A;  4WQ9 A;  1CSU A;  1DVV A;  1N50 A;  3H1K D;  3PH2 B;  2KS1 A;  2K9J B;  1CSW A;  3M97 X;  5H2F V;  1CYI A;  2BH5 X;  2QJY B;  2V08 A;  5KLV D;  5GTI V;  1FHB A;  3DMI A;  1H32 A;  2CA3 B;  5KKZ B;  1CYC A;  1GIW A;  3L75 D;  2HV4 A;  1EB7 A;  1YEA A;  1KX2 A;  1CHJ A;  4EIE A;  5CIB B;  2DGE A;  351C A;  1GJQ A;  4EIC A;  3OA8 B;  1I54 A;  1N90 A;  2QJK B;  1DT1 A;  2A06 D;  4J20 A;  1S5L V;  2C1V A;  1DII C;  2C1D A;  1L0N D;  4WQA A;  2YCC A;  4L3G A;  3WUI A;  2EXV A;  1L9B C;  1DVH A;  4H0J A;  1GU2 A;  2D0S A;  3WFE C;  1HRO A;  1I6D A;  2KNC B;  1QKS A;  3L72 D;  1E29 A;  2CXB A;  3ORV A;  2B11 B;  1P84 D;  2RMZ A;  2YK3 A;  3MK7 B;  2Y0C A;  1GQ1 A;  1F1C A;  3CP5 A;  2PAC A;  1KB0 A;  4DY9 A;  5CIC B;  1CTJ A;  2YQB A;  1QL4 A;  1LMS A;  2N3Y A;  1H9Y A;  3DR0 A;  5EXQ A;  5TJH A;  2O3J A;  4RJT A;  2N3B A;  4EID A;  4KMG A;  1RZ5 A;  2MHM A;  1NML A;  1H33 B;  1PPJ D;  3CXH W;  2N18 C;  1KIB A;  1FOC A;  3NWV A;  1DIQ C;  2AXT V;  155C A;  1YEB A;  2MTA C;  1COT A;  2C1U A;  1IRW A;  2VHD A;  5DF5 A;  3WFC C;  4LJI A;  3PXT A;  1YIQ A;  3ITK A;  1L9J C;  4WQ7 A;  1EZV D;  2AIU A;  5DJQ C;  1IO3 A;  1WVE C;  1CSV A;  3H1I D;  2Q3E A;  1C6R A;  4RSZ A;  1CIH A;  1CO6 A;  1CTZ A;  5TIS V;  1A56 A;  5CIG B;  1KV9 A;  3GW6 A;  2B10 B;  2B12 B;  1DW0 A;  3L4M A;  1I5T A;  1ETP A;  4D6T D;  1CRC A;  4GYD A;  1YIC A;  4UB8 V;  2N9Y B;  3WFB C;  3H1H D;  5CIE B;  1H1O A;  1L0L D;  1QN2 A;  1HZU A;  2OZ1 A;  2AI5 A;  1E8E A;  3L74 D;  3VRD A;  1CNO A;  4FA9 A;  1H31 A;  1K3H A;  2C1D B;  4EDF A;  1LC2 A;  5B66 V;  1QL3 A;  1NTM D;  1YFC A;  4IL6 V;  1BE3 D;  1E2R A;  3WU2 V;  2N18 B;  4WQB A;  2RN0 A;  4N0K A;  3OCD A;  1U75 B;  4FA1 A;  1KYO D;  2LIR A;  3PLN A;  1AOQ A;  1C6S A;  1BL9 A;  1AYG A;  1N15 A;  1RZ6 A;  1DW1 A;  1GDV A;  3RMZ A;  3VMA A;  5C0Z A;  1FI7 A;  1RAP A;  1C52 A;  2Y0D A;  1SQX D;  1PP9 D;  4AAO A;  1MG2 D;  4FB1 A;  3FWL A;  5CID B;  1W2L A;  1HJ3 A;  5DJQ B;  3H1L D;  1B7V A;  3O5C A;  3PTZ A;  1NNO A;  1NTZ D;  1CRG A;  3A0B V;  1KYO W;  3HQ7 A;  3OA8 A;  5CYT R;  1HRC A;  2GC7 D;  2CE1 A;  3A0H V;  1I8O A;  2FYN B;  3ZOY A;  3O20 A;  1HCM A;  3ZOW A;  2ZXY A;  1NIR A;  2I8F A;  1CRH A;  1JDL A;  3WC8 A;  3RN1 A;  4WQD A;  2FWL A;  1OCD A;  4NFG B;  1HJ4 A;  4Q5P A;  3RLM A;  1ZRT D;  4FAV A;  2C8S A;  1SQB D;  2XTS B;  5GTH V;  3ZOO A;  3HQ6 A;  5AUR A;  1KX7 A;  2JWA A;  1CXC A;  4AX3 A;  1BCC D;  3VNW A;  3SLE A;  1OAE A;  1R0Q A;  1NMI A;  4AAM A;  4O1W A;  3WFD C;  1F1F A;  2FRC A;  3L71 D;  2PCC B;  4O1Q A;  3SVW A;  2FYU D;  1CXA A;  1NTK D;  2C2C A;  4PWA A;  2BGV X;  2JTI B;  4MU8 A;  4YE1 A;  1IZL 0;  3CWB D;  1C2N A;  1I8P A;  2GIW A;  3PRJ A;  1H32 B;  4FA5 A;  1SQV D;  451C A;  4GED B;  1M6Z A;  1N9C A;  1M60 A;  4H0K A;  3SWS A;  5B5E V;  2BLF B;  1YNR A;  1WEJ F;  2ZZS 1;  4PD4 D;  2C9X B;  1COR A;  1A8C A;  5KLI B;  1I6E A;  3ZOX A;  1U74 B;  3H1J D;  1J3S A;  3SXT A;  4JCG A;  1FI3 A;  5B6Q A;  4FA4 A;  2BPB B;  2LIT A;  1C2R A;  1S6V B;  2ORL A;  3ZIY A;  1W5C T;  3O0R C;  2GC4 D;  3PHL A;  4V2K A;  3SJL A;  3L4O A;  3TGU D;  1CC5 A;  2V07 A;  5DFS A;  1CCR A;  1LFM A;  5KAF V;  1CED A;  3TF5 A;  4L3H A;  4A7P A;  3CYT I;  2QJP B;  1A2S A;  1M70 A;  4FAN A;  1IQC A;  1CYJ A;  1CRY A;  1FJ0 A;  3NBT A;  1CSX A;  4AAN A;  1CTY A;  1LC1 A;  3CX5 D;  4WQ8 A;  4P4Q B;  2BCC D;  1SQQ D;  3PXW A;  4WQC A;  5CIH B;  4K3I A;  2B0Z B;  1FCD C;  1C75 A;  1HH7 A;  3TYI A;  1CHH A;  4XYD B;  1DW3 A;  4QAO A;  1SQP D;  2L4D A;  3RN0 A;  4PW9 B;  3L73 D;  3GG2 A; 
#chains in the Genus database with same CATH topology
 3T97 A;  1FOS E;  3TDK A;  2QEX P;  1C6O A;  1OW8 A;  1OMI A;  3L70 D;  2OTJ P;  1SQP G;  1NAF A;  2ZBO A;  3CX5 W;  1EDI A;  5E79 H;  1IFD A;  3KYQ A;  3Q3D A;  3KZI V;  4EIF A;  1SQQ J;  2P1J A;  2NZ2 A;  2OAR A;  1FI9 A;  3CU4 A;  2LXB A;  1JY2 N;  1A02 F;  2WSE H;  1CRJ A;  1M7L A;  1KQF B;  4EYY Q;  1ZZH A;  1BGY D;  1LT9 A;  1K73 Q;  3BCC D;  1OVV A;  2KXP B;  1H89 A;  1LTS C;  3X39 A;  3P8C D;  4AAL A;  4W80 A;  2DVH A;  1H33 A;  1U7J A;  3KXD A;  4GT1 A;  1QGK B;  5CCH A;  4UB6 V;  3C1L A;  4PJ0 V;  2JEE A;  1EXJ A;  5AVX B;  1HJ5 A;  1HZV A;  1IK7 A;  1I55 A;  2SPZ A;  1N7S D;  3MK7 C;  1EZV G;  3OCD B;  3AEG C;  2ZYA A;  3HQ9 A;  3OJA B;  1CSU A;  1DVV A;  1BGY J;  4H13 B;  1T3U A;  3H1I G;  4Y99 C;  2K9J B;  2ZAE B;  1SFC D;  3M97 X;  5CCH D;  1CYI A;  2BH5 X;  2QJY B;  2L5G B;  1MKM A;  3RBX A;  5GTI V;  1RF0 A;  1KB9 I;  5APS A;  1FHB A;  3RK3 C;  1X22 A;  1H32 A;  2CA3 B;  5KKZ B;  1JO5 A;  3L75 D;  2HV4 A;  1EB7 A;  1YEA A;  4JQ0 D;  4EIE A;  4EIC A;  4U3F E;  1J1D C;  3CXH H;  3L74 G;  3CCV P;  1S2E A;  1S72 P;  2A06 D;  3D6Z A;  1S5L V;  1FE6 A;  1M1J B;  1W2B O;  4WY4 B;  2WIT A;  2P58 A;  3WU2 H;  2K37 A;  4L3G A;  3WUI A;  4HJG H;  5KLV E;  2E5T A;  4BRY B;  3L75 J;  3GF7 A;  2ZVO B;  1L0N G;  3ORV A;  3EFG A;  2OYH B;  2AEJ A;  2RMZ A;  2R3C A;  5EFW B;  1GQ1 A;  3CP5 A;  3H32 A;  4L75 A;  4I7Z C;  2AEF A;  1RQU A;  1S9K D;  1DD4 A;  1LWU B;  4DY9 A;  1K8A Q;  2YQB A;  1QL4 A;  4WVZ A;  1JY3 O;  2JR8 A;  4LLH A;  1W2E A;  1RZ5 A;  1PGO A;  1EDJ A;  1OX3 A;  2WVR A;  3CXH W;  2KP8 A;  3L72 E;  1DIQ C;  1USE A;  1LTG C;  4GOF A;  3HD7 A;  2R5D A;  1COT A;  2VHD A;  4ASW A;  3PXT A;  2M5A A;  2K1A A;  3VTP C;  1L9J C;  3HUS C;  3B5N A;  1IO3 A;  1EQ7 A;  3S1K A;  2H88 C;  4RSZ A;  1CO6 A;  1H0T B;  3HD7 D;  4JBZ A;  3CME P;  1M90 Q;  2B10 B;  1PPJ E;  1URQ C;  2IPP A;  1DW0 A;  5CJ4 A;  2FFD C;  3RBZ A;  2RKL A;  1I5T A;  1ETP A;  5APU A;  1FZG A;  3GHG A;  2OYO A;  4I6M C;  2J5U A;  1EXI A;  4UB8 V;  4DOJ A;  3E7K A;  3WFB C;  3SSU A;  1L0L D;  3A5T A;  1HZU A;  2OZ1 A;  1SQV K;  4FA9 A;  4AYC A;  1AV1 A;  2C1D B;  1WRG A;  3KPE A;  4EDF A;  2QA4 P;  3HE5 B;  3CWB J;  1IFM A;  4KHX A;  1G2C B;  3P7K A;  4IL6 V;  1BE3 D;  1E2R A;  2N18 B;  1DD3 A;  1OZH A;  4N0K A;  5E79 E;  1JY2 P;  4GDO A;  4IOI H;  3PLN A;  1AOQ A;  3RL0 D;  4D6T E;  5APV A;  3S9O A;  2N9B A;  1RAP A;  2B87 A;  2O01 N;  3H1H E;  1EZV I;  1L0L J;  4AAO A;  1KQL A;  3FWL A;  4RKU J;  4JF7 A;  1B7V A;  3O5C A;  2KZJ A;  3E1R A;  1YTZ T;  1CRG A;  1PP9 G;  3RGU A;  1BE3 J;  5CYT R;  5KAI E;  4H44 C;  1I8O A;  3ZOY A;  3B4S A;  3O20 A;  3ZOW A;  1NIR A;  1YI2 P;  2OYI C;  1JDL A;  1FJK A;  1X8Y A;  4PD4 I;  2HOD A;  2W83 C;  2KB7 P;  1JMB A;  1ZRT D;  4FAV A;  1SQQ K;  3OAK A;  3M06 A;  5GTH V;  4K3A A;  1QX8 A;  1KX7 A;  1CW5 A;  3MP7 B;  3TK1 A;  3MHV A;  2FYZ A;  1VDF A;  2O1J A;  1VF5 B;  3QWO C;  5APQ A;  4OGQ B;  4YTP C;  1FAV A;  4BWN A;  2NPS B;  1VQO P;  2FRC A;  3G3Z A;  5H2F E;  3KZI H;  4BXL A;  1CXA A;  1Y8A A;  1JM0 A;  2A45 H;  2C2C A;  2BGV X;  4YE1 A;  2OTK E;  1SQB E;  1I8P A;  2M3E A;  3VMZ A;  3PRJ A;  3L36 A;  4FA5 A;  1YJ9 P;  2K88 A;  451C A;  1HUC A;  4GED B;  1OXZ A;  4GOE A;  4H0K A;  1KYO H;  5M1B A;  2Q5U A;  3AE7 C;  1NKN A;  1QL1 A;  1S3J A;  2C9X B;  3D70 A;  5KLI B;  2CK3 H;  2B88 A;  4ASV A;  2RH0 A;  1R5S A;  4PJ0 H;  3V2P A;  1HH0 A;  4U3F G;  5B6Q A;  3M91 A;  3CC4 P;  1KV4 A;  4C7R A;  4IL6 X;  4O9B A;  1C2R A;  4Z1M H;  3ZIY A;  1SQV E;  1T2K C;  3SJL A;  1M1K Q;  1CC5 A;  2V07 A;  5DFS A;  1CCR A;  4WWI A;  3TF5 A;  1GL2 B;  2WSE J;  4A7P A;  1G1J A;  4PD4 E;  5KLV G;  1IQC A;  3EQ2 A;  2DW3 A;  1GMJ A;  3HUS B;  5KAF H;  3Q5R A;  3C9I A;  3H1K E;  1LC1 A;  4WQ8 A;  2Q6Q A;  1NH4 A;  1JTH A;  1IFI A;  1PL5 A;  4WQC A;  4K3I A;  1C75 A;  2AXT E;  1S5L H;  4XYD B;  4HB1 A;  1SQP D;  3BAS A;  3TGU E;  3RN0 A;  4H13 C;  5AVQ B;  2P10 A;  4Y5R A;  1CIF A;  3CXH D;  1NOH A;  5CJ0 A;  4R4M A;  2BH4 X;  1SQX K;  3L72 G;  1JY3 P;  2QJY C;  2WTY A;  5C9M A;  2HPC A;  3JBT B;  1FU1 A;  1MV8 A;  2WPS A;  3MD0 A;  3HQ8 A;  1RAQ A;  5KKZ C;  1SQQ E;  3II6 A;  2XKM A;  4WQE A;  1KOR A;  1URQ A;  1SQP J;  2FFD A;  4TLF A;  3N7N A;  2D0W A;  2G3A A;  3I5C A;  1NU1 D;  3U1A A;  2GB8 B;  1M1J C;  2PCB B;  1RE4 A;  4WY4 C;  2N9I A;  1PPJ G;  3M9Q A;  3VN0 A;  3CCQ P;  2E75 B;  2D2C B;  2L91 A;  4H0L C;  3NBS A;  1H31 B;  2B4Z A;  3G6E P;  1KIL A;  1CRI A;  1LS9 A;  2OYH C;  5CIF B;  2CE0 A;  1MG3 D;  2JQR A;  1A02 J;  1N50 A;  3H1K D;  1BGY E;  3H25 A;  1GW3 A;  1LWU C;  1NU1 J;  5L8R J;  3FX0 A;  5AVZ B;  1HJ0 A;  1NTK K;  1LTJ B;  2FXO A;  3CX5 H;  3QH9 A;  3SWY A;  1KIL D;  2V08 A;  3FWN A;  4YXW H;  2E76 B;  2M3B A;  4D6T G;  3DMI A;  1CSB A;  1CYC A;  1GIW A;  2OQQ A;  2PP6 A;  1KX2 A;  1FDI A;  5CIB B;  2DGE A;  3HE4 B;  351C A;  1X79 B;  3OA8 B;  3H1H G;  1JY2 O;  3IR9 A;  3USS A;  1N90 A;  1DT1 A;  2R3S A;  3NXS A;  3BVH A;  1IFJ A;  1CI6 B;  1L0L K;  1YIJ P;  1L4A A;  2OYI A;  1PGQ A;  2KOG A;  2PFX A;  1DH3 A;  1L0N D;  2R5B A;  1L9B C;  1DVH A;  1N86 A;  3K5B A;  3WFE C;  4H44 D;  2H7H A;  3L75 E;  1E29 A;  2CXB A;  2B11 B;  1Y9B A;  1L4A D;  2WT7 A;  1HGZ A;  3IN6 A;  2PAC A;  2A06 E;  1R5L A;  2ZT9 D;  4WB4 A;  1Z56 A;  1NTZ G;  1LTB C;  1KYO E;  1LT9 B;  2KYV A;  1CTJ A;  2Q7C A;  1N7S B;  1L0N J;  1XTC C;  2N3B A;  4EID A;  2MHM A;  3HTK B;  1FZC A;  1H33 B;  1N2D C;  2N18 C;  4LGD E;  1SFC B;  1KIB A;  3NWV A;  3JCU E;  1YEB A;  2YXQ B;  1SQB G;  1JNM A;  3FXE A;  2KI7 B;  2C1U A;  3CCJ P;  5DF5 A;  3I55 P;  1S9K E;  2JO1 A;  1L2P A;  1UIX A;  4WQ7 A;  3G71 P;  1DEB A;  4EIJ A;  2Q3E A;  5KTB A;  1VL2 A;  1CTZ A;  2GA1 A;  3D0W A;  4I1L A;  5KAF E;  3GW6 A;  4RO0 A;  3L4M A;  3F89 A;  1VQ7 P;  5TIS H;  3Q5S A;  1KD1 Q;  1CRC A;  4GYD A;  2MKV A;  5AW8 B;  5BVZ A;  1AFO A;  5CIE B;  2YO3 A;  1BSH A;  2YMY A;  1GDT A;  2AI5 A;  3VRD A;  1CNO A;  2BEQ D;  2R32 A;  2KSJ A;  1QL3 A;  1NYH A;  1NTM D;  1P84 H;  1VF5 C;  4WQB A;  4OGQ C;  3OCD A;  4PV1 C;  1KYO D;  4NPF X;  3NMD A;  2NPS C;  5B66 H;  1BL9 A;  1FZF A;  1N15 A;  4JPZ B;  1RZ6 A;  2YMK A;  2K9J A;  2Y0D A;  1SQX D;  4H0L B;  3CD6 P;  3TGU G;  1VQ5 P;  1PP9 D;  3IF4 A;  5K5G B;  1L0L E;  1HJ3 A;  5DJQ B;  1SVF A;  1VQP P;  4XA4 A;  2WQY C;  3PTZ A;  2UWJ E;  1NTM J;  2WSC H;  3V6I A;  3AE8 C;  3O8Z A;  1FS0 E;  1BE3 E;  3H1L G;  3M0D C;  2GC7 D;  1M57 D;  5KLI C;  4DT0 A;  2P7J A;  3KQG A;  3A0B H;  1SQQ G;  2I8F A;  3HD7 B;  3RN1 A;  1M1J A;  3SWK A;  1OCD A;  1SQX J;  3AEC C;  4WY4 A;  3RLM A;  3A0H H;  1PP9 J;  1YTZ I;  2P2U A;  3L73 G;  1EDL A;  3ZOO A;  3G9R A;  2ZJS E;  1SQP K;  3L70 G;  4BRY A;  2JWA A;  3UIA A;  3AEB C;  1IFN A;  1BCC D;  2OYH A;  2B89 A;  1R0Q A;  1GL2 C;  3M9B A;  3WFD C;  1HVV A;  2N1T B;  1SS1 A;  1F1F A;  4AQR D;  1N8R Q;  3L71 D;  2KS1 B;  2PCC B;  1LWU A;  1NTK D;  3AE5 C;  5AW5 B;  2JTI B;  4MU8 A;  1GD2 E;  1ZRT E;  2FY8 A;  1H8A A;  2Q9I A;  3CWB D;  3RL0 B;  3HRN A;  2E74 B;  1BGY G;  2FYU G;  1Q82 Q;  1Q86 Q;  3WUU A;  5APW A;  3BCC G;  4TT3 H;  3B8E B;  1QVG O;  3U59 A;  1N9C A;  4EI2 A;  3SWS A;  5CCG A;  1BCC J;  1RE3 C;  4ZKP A;  3B5N D;  3CCU P;  4ZKU A;  4IFF A;  1NU1 K;  1COR A;  1I6E A;  3ZOX A;  3LW5 J;  3A2A A;  1U74 B;  3H1J D;  1J3S A;  3L71 J;  5B5E H;  1NTK J;  3Q5P A;  3CXH I;  1IJD B;  4NPE A;  4DZO A;  2JP3 A;  3CLQ A;  2B87 B;  5CCG D;  2LIT A;  2ORL A;  2KUB A;  1H88 A;  1HF9 A;  2P67 A;  1PGJ A;  2C9N Y;  1W5C T;  2W27 A;  1H0T A;  1FOS F;  5AW7 B;  2HLO A;  3PHL A;  2HYN A;  3IAO A;  1HBW A;  5KJ7 C;  1N73 B;  2QJP B;  1CYJ A;  5AW1 B;  3H1J J;  1CRY A;  2KLV A;  1LGH B;  2E75 C;  1CTY A;  2D2C C;  3VMY A;  3CX5 D;  1XTG B;  4C7N B;  3TSI A;  4N6J A;  4R4L A;  2BCC D;  2A06 G;  2KLU A;  3HE5 A;  5CBO A;  3CC2 P;  1Q2N A;  3TYI A;  1FCD C;  1G2C A;  1CHH A;  1DW3 A;  4HYT B;  4PW9 B;  3GG2 A;  1U7M A;  5AVS B;  5E79 V;  1JUN A;  1JOC A;  1LJ2 A;  1GKS A;  2QG4 A;  1R8E A;  1AOF A;  1WMK A;  1L0N K;  2CA4 B;  1LTJ C;  2WPQ A;  1AKK A;  1MZ4 A;  3O6Q B;  5AVW B;  3CMA P;  2E76 C;  2KNC A;  5TIS E;  2ZON G;  3VMX A;  1KB9 D;  2Z5I A;  2BCC J;  4C46 A;  5IY5 1;  3H6P A;  2IBZ D;  1HJB A;  2WPR A;  1OVU A;  3KDP B;  4L73 A;  4PV1 B;  3AE3 C;  1SQP E;  1OW6 A;  3V4W A;  5KAI V;  2KSE A;  3A9F A;  2XDJ A;  2NRG A;  2PGD A;  3CCR P;  1BDD A;  1MFZ A;  1FZB A;  3CXH E;  3D71 A;  3ZBM A;  3ZCF A;  1C7M A;  1VYD A;  1YTC A;  5B66 E;  4L74 A;  4QMA A;  3TYY A;  3WU2 E;  1LT1 A;  3OA7 A;  4I2L C;  1CHI A;  1CIE A;  2HG5 D;  4OH8 B;  2NPS A;  4UB6 H;  4KJM A;  3RK3 D;  3PH2 B;  2PAJ A;  1LT9 C;  4GKG A;  1CSW A;  1NU1 E;  2Q3I A;  1YIT P;  5H2F V;  1IO4 A;  1N7S C;  4Y28 J;  3CCE P;  3P8M C;  1LP1 A;  3FGA D;  4M3L A;  1ZXG A;  3OW2 O;  3A0B E;  2XU6 A;  2Z4E A;  1DEE G;  1RF1 B;  2VRS A;  1Y47 A;  3GF3 A;  1SFC C;  1CHJ A;  3A0H E;  2M0B A;  5CCH C;  1GJQ A;  1I54 A;  3M0D A;  5GTI H;  1HGV A;  2QJK B;  2O01 J;  1RY3 A;  2I1J A;  3RK2 B;  2LXC B;  2LR2 A;  1GZL A;  1ZV8 A;  2ZFC A;  3B71 A;  1BE3 G;  4DJG A;  3SFD C;  1KIL E;  1NTM K;  2EXV A;  4GOD A;  1ZW0 A;  4H0J A;  2D0S A;  1KC8 Q;  1I6D A;  2QIW A;  2HPC B;  1YQ3 C;  3LW5 H;  2JDI H;  3C8V A;  1P84 D;  1FDM A;  3VYI A;  1GL2 A;  5APY A;  2YKQ A;  1RH5 B;  3CCL P;  3L4F A;  3CCS P;  1KB0 A;  5CMZ A;  2YKO A;  3HUS A;  4U7J A;  2H89 C;  2N3Y A;  1L0N E;  2GM4 A;  3DR0 A;  5EXQ A;  4RJT A;  2O3J A;  3U1C A;  4N3Y B;  1GL2 D;  1NHL A;  2A45 I;  1NML A;  5B5E E;  2Z5H A;  2CPS A;  2YXR B;  1FOC A;  1NTZ J;  3W67 A;  1KIL B;  2AXT V;  1NKZ B;  155C A;  4XE5 B;  1HWT C;  3P32 A;  4B86 A;  1AJY A;  2ZVN B;  1ZR4 A;  4HH2 A;  1VQ6 P;  1IRW A;  3WFC C;  1KYO I;  3ITK A;  1YIQ A;  1QLE D;  3SFE C;  1YHQ P;  1EZV D;  1URQ D;  1KFN A;  2V7Q J;  1PV3 A;  5DJQ C;  5APX A;  5CBN A;  1WVE C;  1CSV A;  3H1I D;  3TNU B;  3VP8 A;  3WMM 0;  5BU8 B;  5C39 A;  2WSC J;  1BDC A;  5KJ7 A;  4L76 A;  3AE9 C;  1FC2 C;  1T8Z A;  3HD7 C;  1YIC A;  3BAT A;  1LNQ A;  3R2P A;  1KN7 A;  1Q90 D;  1H1O A;  3L74 D;  2WMM A;  1QL2 A;  1H31 A;  1NWQ A;  1K3H A;  3H1I J;  4UB8 H;  2ZT9 B;  1KMI Z;  3AE6 C;  1YJN P;  1YFC A;  1E5W A;  4HKZ H;  4YPC A;  2N1T C;  2C9L Y;  3T97 B;  3FXD A;  2E75 D;  4LC1 A;  2C0X A;  1DW1 A;  1GDV A;  3RMZ A;  3VMA A;  5C0Z A;  1FI7 A;  1KB9 H;  4IL6 H;  2C0W A;  3A7O A;  3KZI E;  2ZYD A;  5CID B;  1W2L A;  3L74 J;  3RL0 C;  2E74 C;  3H1L D;  1NNO A;  4DCK A;  1ZOY C;  1FJP A;  1NTM E;  1T6A A;  1USD A;  3HE4 A;  4XFJ A;  3OA8 A;  1HRC A;  1ZME C;  1FZC B;  1OIP A;  3G4S P;  2FYN B;  2OTL P;  2Q1K A;  1CI6 A;  1ZN5 A;  3AE4 C;  1CRH A;  2E76 D;  4WQD A;  1HJ4 A;  4Q5P A;  1SQX E;  1PP9 E;  2XTS B;  4UB6 E;  4PJ0 E;  2BAS A;  3H1L J;  1GW4 A;  1JCD A;  2O01 H;  1CXC A;  1QEX A;  2FXP A;  2MJZ A;  1OAE A;  2AXC A;  2IFN A;  4AAM A;  1N73 C;  5GTH H;  1JMM A;  1IFP A;  2QJP C;  2YKP A;  2R44 A;  4N78 D;  3L73 J;  2FYU D;  4PWA A;  3L70 J;  5GTI E;  2H43 A;  1N7S A;  1SP4 A;  1OWA A;  3R4Y A;  1H32 B;  3HTK A;  5KAI H;  1QVF O;  3CX5 I;  3MZW B;  1NU1 G;  1BSN A;  1SFC A;  1AVY A;  2KK7 A;  4JYC A;  1BCC E;  2BLF B;  1VPC A;  1WEJ F;  2ZZS 1;  1S5L E;  1SQV G;  3M9H A;  2XND H;  2WSF J;  1M56 D;  3L71 E;  2FYU J;  1T2K D;  3N4X A;  1NTK E;  3BCC J;  4FA4 A;  2XZR A;  2BPB B;  1KQG B;  3CWB E;  3H1K G;  4EOT A;  3WUV A;  2W8Z A;  3O0R C;  2IDB A;  2WWW A;  3L4O A;  5KAF V;  5H2F H;  4L3H A;  2IBZ I;  3A3Y B;  1UII A;  2V7Q H;  1A2S A;  3H32 B;  3GMA A;  1M70 A;  4FAN A;  1GU4 A;  1X9V A;  3H1J E;  3NBT A;  1FJ0 A;  4AAN A;  4ZMD A;  1DX7 A;  1G1I A;  4P4Q B;  2QRX A;  4OVN F;  3V2N A;  4H13 D;  3MUD C;  1VQK P;  4OWF A;  1N7L A;  1MZ9 A;  1SLQ A;  4GIF A;  5AVT B;  2BCN B;  1JCC A;  4NPD A;  5AVR B;  4ZNC A;  2M5A B;  3KHU A;  5AW9 B;  1CCH A;  2K9Y A;  3B5N B;  2AEM A;  1QYZ A;  3CX5 E;  1RF1 C;  2JKV A;  2N9J A;  1NTZ K;  2BCC E;  3DP5 A;  1OVR A;  5DJT B;  4WY4 D;  1DW2 A;  4PD4 H;  2YIU B;  4WBA A;  2CPB A;  3S4R A;  1K3G A;  1J1E B;  2QJK C;  3JC2 2;  4H0L D;  1Q7Y Q;  1KFM A;  4UB8 E;  3PXS A;  3GHG B;  3RK2 C;  2ZOO A;  1K9M Q;  1IRV A;  3C2C A;  2HFE D;  1H9X A;  4IFM A;  2OZ1 B;  4XXL A;  1SQB K;  1VQN P;  1DIP A;  2I8D A;  4L1Q A;  3VYM A;  2AXT H;  1CIG A;  1KB9 E;  4IL6 E;  3O1Y A;  2LKM A;  2V4H A;  1KQS O;  2IBZ E;  4U3F D;  1YCC A;  2Y0E A;  3GLM A;  1RQV A;  1U57 A;  2N1T A;  4WQ9 A;  5AW0 B;  2IFM A;  1P84 I;  1OW7 A;  2KS1 A;  1W5C E;  2FKW B;  2I1K A;  2KIK A;  1JY3 N;  1RE4 C;  2ITA A;  3CI9 A;  2WSS H;  2Y9Z A;  5KLV D;  1NO4 A;  2N1T D;  1YJW P;  4U3F J;  1KIL C;  3CC7 P;  3SWF A;  4AUW A;  2A45 G;  1NJI Q;  3L75 G;  1HTL C;  1MUU A;  1S5L X;  3AED C;  5AVV B;  4J20 A;  2B9B A;  1AVO A;  2C1V A;  3RK3 E;  3AE2 C;  1NTM G;  2E74 D;  2HOD B;  1DII C;  4MN4 C;  5AVU B;  2C1D A;  4KT0 J;  5GTH E;  4WQA A;  1NGM B;  1WT6 A;  2YCC A;  3AEA C;  3NFQ A;  5KLV J;  3AEF C;  1GU2 A;  2WZ7 A;  1HRO A;  2QSI A;  2KNC B;  1QKS A;  3L72 D;  2WSF H;  4CPG A;  1ZR2 A;  1SQX G;  1AQT A;  2YK3 A;  3MK7 B;  1PIX A;  2Y0C A;  1N73 A;  1F1C A;  3MIW A;  1VQ4 P;  4Y99 B;  5CIC B;  3CCM P;  1EDK A;  1L4A C;  1KTM A;  2M8R A;  1LMS A;  1JB0 J;  1H9Y A;  4C7N A;  3JSV C;  3V2Q A;  5TJH A;  4KMG A;  2ZT9 C;  3CL3 D;  2QVA A;  3RK3 B;  1S4X A;  1MFT A;  1PPJ D;  1YBK A;  3L72 J;  1VQL P;  1FZE A;  2W6B A;  2ZXE B;  2XV5 A;  1NTZ E;  1P84 E;  1PZQ A;  2G8Y A;  1ZLL A;  1J1D B;  4W7Y A;  3F5H A;  2MTA C;  1RHZ B;  2QM8 A;  4LJI A;  3PP5 A;  2H8P D;  2QM7 A;  5CHX A;  5AW6 B;  2AIU A;  1BCC G;  2IZ1 A;  3AEE C;  3O6Q A;  3D6Y A;  5DJU B;  1TU3 F;  1D7M A;  1C6R A;  1CIH A;  5TIS V;  1A56 A;  5CIG B;  1LP1 B;  1KV9 A;  3L71 G;  1PGP A;  2B12 B;  1NTK G;  1FZC C;  5AVY B;  2FYN C;  3V2R A;  2YNY A;  4D6T D;  4IFD K;  3CWB G;  2FYU K;  2ZYG A;  4I7Z B;  5AW3 B;  5AW2 B;  2N9Y B;  3I56 P;  1VF5 D;  3H1H D;  4OGQ D;  1QN2 A;  1EZV E;  1E8E A;  2ZXX A;  4PV1 D;  1JTH B;  2J59 M;  2KZI A;  2NPS D;  1KZU B;  1LC2 A;  5B66 V;  3H1I E;  3MGN A;  3MUD A;  3JCU H;  2E43 A;  1L0L G;  3H1J G;  1YQ4 C;  1NVO A;  3WU2 V;  2RN0 A;  1U75 B;  1FBM A;  4FA1 A;  4D6T J;  2LIR A;  2E5Y A;  1C6S A;  2W6A A;  1AYG A;  3V4Q A;  3BRT B;  3L37 A;  3BRV B;  4YXD C;  1C52 A;  3H1H J;  1JEK A;  1MG2 D;  4FB1 A;  1AQ5 A;  1VQ8 P;  2HR3 A;  2QE7 H;  1RF0 C;  3L74 E;  2BEZ F;  1T3J A;  1NTZ D;  1RF1 A;  1S1C X;  1FDO A;  3A0B V;  1KYO W;  3HQ7 A;  3CPW O;  1URQ B;  3W68 A;  2CE1 A;  2FFD B;  1M8O B;  3A0H V;  1HCM A;  2ZXY A;  2E42 A;  2JWD A;  2BCC G;  3Q1M A;  3MTU E;  3WC8 A;  1GK4 A;  2FWL A;  4NFG B;  2C8S A;  2J58 A;  1SQB D;  3EFF K;  2IZ0 A;  3H1L E;  2IYP A;  3HQ6 A;  5AUR A;  3L35 A;  1K05 A;  1RE3 A;  3RL0 g;  3WUT A;  3RK2 D;  1GU5 A;  4AX3 A;  3VNW A;  3SLE A;  1EC5 A;  1NMI A;  3EWK A;  4O1W A;  2Y9Y A;  3L73 E;  4O1Q A;  3SVW A;  3PH0 A;  4RES B;  2IBZ G;  3AE1 C;  3L70 E;  1SQB J;  1IZL 0;  2W6J H;  1GTW A;  1Q81 Q;  1C2N A;  2GIW A;  1SQV D;  4W7Z A;  3LIE A;  1M6Z A;  1M60 A;  1ZP0 C;  5B5E V;  3IFM A;  2JJL A;  1E79 H;  1YNR A;  2O1K A;  4H44 B;  2IX7 C;  4PD4 D;  1A8C A;  2FBW C;  1LTT C;  1NAY A;  1L4A B;  4N78 E;  2OYI B;  5AW4 B;  3SXT A;  3M0A A;  2GUS A;  3VP9 A;  2FYU E;  4JCG A;  1FI3 A;  3B5N C;  3BCC E;  3NTN A;  2PRR A;  5KJ7 D;  1IZN B;  1S6V B;  2K3R A;  3P8C E;  3VOP A;  3PJS K;  1SQV J;  2GC4 D;  3TNU A;  2IYO A;  4V2K A;  1AA0 A;  3TGU D;  2YIU C;  3ZDM A;  4K35 A;  1J1E C;  2GUV A;  1LFM A;  1CED A;  2WT7 B;  2D2C D;  1GK6 A;  5CCG C;  3CYT I;  3GHG C;  1J2J B;  1LTI C;  2XNX A;  1LTJ A;  1X0T A;  1LTA C;  3Q2Y A;  3V5B A;  4JYB A;  1CZQ A;  2YO2 A;  1IC2 A;  2WPV B;  1CSX A;  1VQ9 P;  3ABV C;  3H1K J;  5BU5 A;  5KLV K;  1YYC A;  1K04 A;  3LID A;  2FXM A;  1FZA A;  1SQQ D;  3PXW A;  2OGU A;  2W90 A;  1IK9 A;  5CIH B;  2B0Z B;  5APT A;  1HH7 A;  1VQM P;  3TGU J;  1PFI A;  4QAO A;  2POH A;  1OFC X;  3E1I A;  2L4D A;  3L73 D; 
#chains in the Genus database with same CATH homology
 3TDK A;  5E79 V;  4Y5R A;  1CIF A;  1C6O A;  1GKS A;  3CXH D;  3L70 D;  2BCN B;  2QG4 A;  1AOF A;  2CA4 B;  2ZBO A;  2BH4 X;  1AKK A;  3CX5 W;  3KHU A;  1MZ4 A;  5C9M A;  1CCH A;  3JBT B;  1QYZ A;  2ZON G;  3HQ8 A;  3KZI V;  1KB9 D;  1RAQ A;  4EIF A;  5IY5 1;  2N9J A;  3DP5 A;  2IBZ D;  3CU4 A;  1FI9 A;  4WQE A;  1CRJ A;  1DW2 A;  2YIU B;  1K3G A;  1ZZH A;  3PXS A;  1BGY D;  2D0W A;  5KAI V;  2ZOO A;  3A9F A;  3BCC D;  1IRV A;  1NU1 D;  2GB8 B;  3ZBM A;  2PCB B;  3ZCF A;  2N9I A;  3X39 A;  1C7M A;  3C2C A;  1H9X A;  1VYD A;  4AAL A;  1YTC A;  2OZ1 B;  4XXL A;  2DVH A;  2L91 A;  1H33 A;  3NBS A;  1H31 B;  2B4Z A;  4L1Q A;  3VYM A;  1CIG A;  4UB6 V;  4PJ0 V;  3O1Y A;  1CRI A;  1HJ5 A;  1LS9 A;  4U3F D;  1HZV A;  1I55 A;  1CHI A;  1YCC A;  1CIE A;  5CIF B;  2Y0E A;  3MK7 C;  3OCD B;  2CE0 A;  3HQ9 A;  1MG3 D;  2JQR A;  4WQ9 A;  1CSU A;  1DVV A;  1N50 A;  3H1K D;  3PH2 B;  2KS1 A;  2K9J B;  1CSW A;  3M97 X;  5H2F V;  1CYI A;  2BH5 X;  2QJY B;  2V08 A;  5KLV D;  5GTI V;  1FHB A;  3DMI A;  1H32 A;  2CA3 B;  5KKZ B;  1CYC A;  1GIW A;  3L75 D;  2HV4 A;  1EB7 A;  1YEA A;  1KX2 A;  1CHJ A;  4EIE A;  5CIB B;  2DGE A;  351C A;  1GJQ A;  4EIC A;  3OA8 B;  1I54 A;  1N90 A;  2QJK B;  1DT1 A;  2A06 D;  4J20 A;  1S5L V;  2C1V A;  1DII C;  2C1D A;  1L0N D;  4WQA A;  2YCC A;  4L3G A;  3WUI A;  2EXV A;  1L9B C;  1DVH A;  4H0J A;  1GU2 A;  2D0S A;  3WFE C;  1HRO A;  1I6D A;  2KNC B;  1QKS A;  3L72 D;  1E29 A;  2CXB A;  3ORV A;  2B11 B;  1P84 D;  2RMZ A;  2YK3 A;  3MK7 B;  2Y0C A;  1GQ1 A;  1F1C A;  3CP5 A;  2PAC A;  1KB0 A;  4DY9 A;  5CIC B;  1CTJ A;  2YQB A;  1QL4 A;  1LMS A;  2N3Y A;  1H9Y A;  3DR0 A;  5EXQ A;  5TJH A;  2O3J A;  4RJT A;  2N3B A;  4EID A;  4KMG A;  1RZ5 A;  2MHM A;  1NML A;  1H33 B;  1PPJ D;  3CXH W;  2N18 C;  1KIB A;  1FOC A;  3NWV A;  1DIQ C;  2AXT V;  155C A;  1YEB A;  2MTA C;  1COT A;  2C1U A;  1IRW A;  2VHD A;  5DF5 A;  3WFC C;  4LJI A;  3PXT A;  1YIQ A;  3ITK A;  1L9J C;  4WQ7 A;  1EZV D;  2AIU A;  5DJQ C;  1IO3 A;  1WVE C;  1CSV A;  3H1I D;  2Q3E A;  1C6R A;  4RSZ A;  1CIH A;  1CO6 A;  1CTZ A;  5TIS V;  1A56 A;  5CIG B;  1KV9 A;  3GW6 A;  2B10 B;  2B12 B;  1DW0 A;  3L4M A;  1I5T A;  1ETP A;  4D6T D;  1CRC A;  4GYD A;  1YIC A;  4UB8 V;  2N9Y B;  3WFB C;  3H1H D;  5CIE B;  1H1O A;  1L0L D;  1QN2 A;  1HZU A;  2OZ1 A;  2AI5 A;  1E8E A;  3L74 D;  3VRD A;  1CNO A;  4FA9 A;  1H31 A;  1K3H A;  2C1D B;  4EDF A;  1LC2 A;  5B66 V;  1QL3 A;  1NTM D;  1YFC A;  4IL6 V;  1BE3 D;  1E2R A;  3WU2 V;  2N18 B;  4WQB A;  2RN0 A;  4N0K A;  3OCD A;  1U75 B;  4FA1 A;  1KYO D;  2LIR A;  3PLN A;  1AOQ A;  1C6S A;  1BL9 A;  1AYG A;  1N15 A;  1RZ6 A;  1DW1 A;  1GDV A;  3RMZ A;  3VMA A;  5C0Z A;  1FI7 A;  1RAP A;  1C52 A;  2Y0D A;  1SQX D;  1PP9 D;  4AAO A;  1MG2 D;  4FB1 A;  3FWL A;  5CID B;  1W2L A;  1HJ3 A;  5DJQ B;  3H1L D;  1B7V A;  3O5C A;  3PTZ A;  1NNO A;  1NTZ D;  1CRG A;  3A0B V;  1KYO W;  3HQ7 A;  3OA8 A;  5CYT R;  1HRC A;  2GC7 D;  2CE1 A;  3A0H V;  1I8O A;  2FYN B;  3ZOY A;  3O20 A;  1HCM A;  3ZOW A;  2ZXY A;  1NIR A;  2I8F A;  1CRH A;  1JDL A;  3WC8 A;  3RN1 A;  4WQD A;  2FWL A;  1OCD A;  4NFG B;  1HJ4 A;  4Q5P A;  3RLM A;  1ZRT D;  4FAV A;  2C8S A;  1SQB D;  2XTS B;  5GTH V;  3ZOO A;  3HQ6 A;  5AUR A;  1KX7 A;  2JWA A;  1CXC A;  4AX3 A;  1BCC D;  3VNW A;  3SLE A;  1OAE A;  1R0Q A;  1NMI A;  4AAM A;  4O1W A;  3WFD C;  1F1F A;  2FRC A;  3L71 D;  2PCC B;  4O1Q A;  3SVW A;  2FYU D;  1CXA A;  1NTK D;  2C2C A;  4PWA A;  2BGV X;  2JTI B;  4MU8 A;  4YE1 A;  1IZL 0;  3CWB D;  1C2N A;  1I8P A;  2GIW A;  3PRJ A;  1H32 B;  4FA5 A;  1SQV D;  451C A;  4GED B;  1M6Z A;  1N9C A;  1M60 A;  4H0K A;  3SWS A;  5B5E V;  2BLF B;  1YNR A;  1WEJ F;  2ZZS 1;  4PD4 D;  2C9X B;  1COR A;  1A8C A;  5KLI B;  1I6E A;  3ZOX A;  1U74 B;  3H1J D;  1J3S A;  3SXT A;  4JCG A;  1FI3 A;  5B6Q A;  4FA4 A;  2BPB B;  2LIT A;  1C2R A;  1S6V B;  2ORL A;  3ZIY A;  1W5C T;  3O0R C;  2GC4 D;  3PHL A;  4V2K A;  3SJL A;  3L4O A;  3TGU D;  1CC5 A;  2V07 A;  5DFS A;  1CCR A;  1LFM A;  5KAF V;  1CED A;  3TF5 A;  4L3H A;  4A7P A;  3CYT I;  2QJP B;  1A2S A;  1M70 A;  4FAN A;  1IQC A;  1CYJ A;  1CRY A;  1FJ0 A;  3NBT A;  1CSX A;  4AAN A;  1CTY A;  1LC1 A;  3CX5 D;  4WQ8 A;  4P4Q B;  2BCC D;  1SQQ D;  3PXW A;  4WQC A;  5CIH B;  4K3I A;  2B0Z B;  1FCD C;  1C75 A;  1HH7 A;  3TYI A;  1CHH A;  4XYD B;  1DW3 A;  4QAO A;  1SQP D;  2L4D A;  3RN0 A;  4PW9 B;  3L73 D;  3GG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...