1L0LD

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
240
structure length
240
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
total genus 51
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1l0lD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1l0lD01
4P4QB 3WU2V 3X39A 1CHIA 1WVEC 3H1KD 1CRGA 1QL4A 1YICA 2MHMA 3CP5A 3ZCFA 2BLFB 5TISV 3PH2B 1GU2A 1AOQA 1HCMA 1I8PA 3C2CA 1CIGA 1OAEA 1C52A 2B11B 3TF5A 3ZBMA 1R0QA 1PPJD 1SQQD 4IL6V 1H31B 3MK7B 1I6DA 1SQBD 2ZZS1 4GEDB 1KX7A 2Y0CA 4H0KA 1U74B 1E2RA 3L4MA 1YEBA 1A56A 1LMSA 1RAQA 4AANA 4WQEA 1K3HA 3HQ9A 1H31A 4J20A 2RN0A 1ZZHA 4N0KA 1S6VB 1KYOW 1W2LA 3SLEA 2HV4A 2BGVX 2V08A 1DW2A 2DVHA 3NBSA 2OZ1B 2PCCB 451CA 1KB0A 1FCDC 1CO6A 3RN1A 2GB8B 2IBZD 1CRCA 1KB9D 2N3BA 2LITA 1YIQA 3O1YA 2OZ1A 1C2NA 2GIWA 5KAIV 3KZIV 1KYOD 3HQ6A 5H2FV 1QL3A 4AALA 5CIDB 2L91A 1CYJA 2PCBB 3CXHW 1I8OA 2JQRA 1CTYA 5CIBB 2Y0EA 2YK3A 2MTAC 1CXCA 4AAOA 4FAVA 3ORVA 4FA5A 1EB7A 4NFGB 5AURA 5B5EV 5B66V 4LJIA 3JBTB 3ITKA 4EIEA 3CU4A 3OCDB 5E79V 3NBTA 2JTIB 3L71D 2C9XB 1CCRA 1KV9A 4WQ8A 4AX3A 1N9CA 1CRIA 1AOFA 1YCCA 1IRWA 1QYZA 2D0WA 1MZ4A 1CSWA 1FI3A 3O20A 4L3HA 3ZOOA 1I6EA 3OCDA 3H1LD 1SQPD 1YEAA 1CRYA 2LIRA 1CRJA 2N9JA 1QKSA 1N15A 1LC2A 3PTZA 1N50A 3WFEC 5EXQA 1I55A 2AXTV 2BPBB 1HJ5A 3PLNA 4A7PA 5IY51 1SQVD 1AYGA 1HZUA 4WQBA 2DGEA 1HROA 3RMZA 3L70D 2BCNB 4EICA 1HZVA 2JWAA 4O1WA 5B6QA 1CTZA 3L73D 4UB8V 3A0BV 4L3GA 4WQDA 5KLIB 2ZONG 1J3SA 5GTHV 2GC7D 3M97X 2CA3B 1DIIC 1SQXD 3PRJA 3ZOYA 4FANA 2BH4X 1CCHA 3VYMA 1LS9A 3HQ7A 3L74D 1KIBA 2ZXYA 5CIHB 1M60A 3DMIA 3HQ8A 1CRHA 3SWSA 1H33B 3NWVA 2C8SA 4AAMA 3O0RC 2QG4A 1H9XA 4RSZA 4DY9A 4XYDB 2KNCB 3L4OA 1F1CA 1L0LD 1CSVA 3OA8B 1NMIA 1N90A 3WFDC 1H33A 3H1HD 2FYUD 1IO3A 3CWBD 1VYDA 2V07A 1JDLA 5C9MA 3A9FA 4PJ0V 2AIUA 1H32B 3TDKA 1L9BC 2YQBA 1IZL0 1NMLA 3OA8A 1BE3D 1EZVD 1CYCA 2N9YB 1PP9D 1C6OA 3BCCD 3DR0A 4U3FD 1E29A 3PHLA 5CYTR 2FRCA 1DVHA 1FJ0A 3WUIA 1C6RA 3SJLA 3VNWA 3PXSA 1P84D 1B7VA 1I54A 1C6SA 1AKKA 4FA9A 1H32A 1E8EA 3CYTI 4PWAA 1QN2A 4FA1A 1CIEA 1FI9A 4QAOA 1YFCA 1HRCA 1NTKD 3L75D 2B4ZA 2C1DB 1ETPA 1HJ4A 2O3JA 1HH7A 2L4DA 2N9IA 2XTSB 2B12B 5KKZB 1CEDA 2QJKB 3WFCC 4WQ9A 4MU8A 1CC5A 2VHDA 5DJQC 2C1VA 1DIQC 3WFBC 1C7MA 2B0ZB 3DP5A 4EDFA 3FWLA 2CE0A 5TJHA 3ZOXA 2C1DA 1H9YA 3H1JD 1IRVA 4EIDA 1CIHA 4PW9B 1A8CA 2GC4D 1CYIA 2CA4B 4H0JA 4FA4A 1FHBA 1CIFA 3CX5D 1GKSA 2EXVA 351CA 5DJQB 4UB6V 1BCCD 5CICB 155CA 5KAFV 1RZ6A 2BH5X 1BL9A 2I8FA 1ZRTD 3GW6A 1NTZD 1RZ5A 5CIGB 2ZOOA 2QJPB 4K3IA 1DT1A 4XXLA 1WEJF 1FI7A 1NIRA 2YCCA 3ZOWA 4RJTA 1YNRA 2ORLA 3TGUD 1L9JC 5C0ZA 1CSUA 4V2KA 1M70A 1I5TA 1GDVA 1S5LV 1CHHA 3VMAA 2Q3EA 1K3GA 3A0HV 1NU1D 5KLVD 1DW1A 2C1UA 3RLMA 2FWLA 1LFMA 1W5CT 2N18C 2ZBOA 1LC1A 3PXTA 1CORA 1GIWA 1MG2D 3L72D 2D0SA 2FYNB 3GG2A 1F1FA 2A06D 1CXAA 1FOCA 3KHUA 1BGYD 1CNOA 4D6TD 3PXWA 4Y5RA 1HJ3A 1MG3D 4JCGA 4KMGA 2BCCD 2Y0DA 4YE1A 1A2SA 5DF5A 2AI5A 2N18B 4L1QA 4EIFA 2K9JB 3TYIA 1H1OA 2QJYB 3O5CA 1DW3A 1YTCA 1KX2A 1NTMD 3SXTA 4WQCA 4PD4D 5GTIV 1U75B 1CTJA 1COTA 5CIFB 4Q5PA 2CE1A 3RN0A 1C2RA 5CIEB 1C75A 2KS1A 1RAPA 4FB1A 2N3YA 2C2CA 1NNOA 1M6ZA 3VRDA 5DFSA 1IQCA 2PACA 3SVWA 2YIUB 1OCDA 1DW0A 1GJQA 3CX5W 2CXBA 1DVVA 4WQAA 2B10B 1CHJA 3ZIYA 3H1ID 2RMZA 1L0ND 4GYDA 1GQ1A 4WQ7A 3CXHD 3WC8A 4O1QA 1CSXA 3MK7C
chains in the Genus database with same CATH superfamily
2IYOA 2WPSA 1L0LE 3BRTB 1CHIA 4BWNA 3ZCFA 2FYUE 2FXOA 1S9KE 4N3YB 1CIGA 1C52A 1DX7A 1KQSO 1NU1K 4UB6E 3MK7B 2G8YA 4Y99B 1SQBD 1Y8AA 1OXZA 2ZZS1 2I1JA 1FJKA 3L4MA 1YEBA 3RGUA 3F5HA 2E75B 3HD7B 1K3HA 1QVFO 3L70J 3TYYA 1CZQA 2E5YA 1W2LA 4H44C 2V08A 3L73J 3BASA 2DVHA 2HPCB 2OZ1B 1MFZA 451CA 1N7SB 2ZT9D 1FCDC 3WMM0 2W83C 1D7MA 3HD7A 1NJIQ 4LGDE 2E42A 1KB9D 2AEFA 1WMKA 3GHGB 1K04A 3L72G 1PGOA 2HPCA 2OZ1A 1N7SA 1C2NA 2GIWA 1HJBA 4ZKUA 2KLVA 4AALA 2M5AB 5CIDB 2BCCG 5AVVB 4PV1C 1CYJA 4ASWA 4RO0A 2WZ7A 3GHGA 3Q2YA 1JUNA 1L0NK 1CTYA 2Y0EA 4KJMA 2K88A 4UB6H 5AVSB 2MTAC 1CXCA 3AE5C 1HVVA 2IPPA 3ORVA 2WSCJ 1G1IA 1U7MA 2ZYAA 1LT9C 1GK6A 5B5EV 4LJIA 2WT7B 3HE4B 1RE4A 4O9BA 3AEEC 3CWBJ 2M5AA 4EIEA 5E79V 3NBTA 3CCJP 1CCRA 1KV9A 1OVRA 1N9CA 4ASVA 1CRIA 2WQYC 4H13B 2JR8A 2D0WA 3Q5PA 2NPSD 3U1CA 1FZCC 1NGMB 2KYVA 3MGNA 2KLUA 2NRGA 2R5BA 3HE4A 3KXDA 2WT7A 5APTA 3ZDMA 4L3HA 3ZOOA 3F89A 3H1LD 2LIRA 1ZR4A 1N15A 1LC2A 1FZAA 3H1HE 1IK9A 4IFDK 5EXQA 1LTJC 2W6AA 1XTCC 2AXTV 2R5DA 3NFQA 1KORA 1JCCA 3L75J 1LTTC 2BPBB 1QL1A 5AVRB 3T97B 5AVYB 5AW8B 2W6JH 1MZ9A 2ZVNB 1HZUA 1AQTA 1T8ZA 1M57D 1SFCA 1NTME 3RMZA 3KPEA 3L70D 1N2DC 2WSEH 3V6IA 5KAIH 3KZIH 1PP9E 1FZGA 4QMAA 1HF9A 1Q81Q 5B6QA 3L73D 4N78E 5CMZA 1PPJG 2OGUA 1LNQA 3M97X 3L70G 4UB8E 1QGKB 3RL0C 1VQ4P 3ZOYA 5AVZB 1NKNA 4NPFX 3JCUE 2OTLP 1L4AB 1CRHA 2BASA 2CK3H 1VQMP 3NWVA 2C8SA 1USEA 4KT0J 2QG4A 2OYHB 1H9XA 1M7LA 4DJGA 4K3AA 1JY2P 4CPGA 2KNCB 4H44D 3L4OA 2IFMA 1FAVA 3I5CA 2J58A 3OA8B 1NU1J 1L4AA 3CWBD 2QM7A 2OYHA 1JDLA 2K1AA 2QEXP 5C9MA 2AIUA 2KNCA 2Q3IA 1KMIZ 3CWBG 2YQBA 1GK4A 4PJ0E 1IZL0 1RY3A 3SFDC 1NMLA 3OA8A 5CCGC 1SQPK 1EZVD 2FRCA 1N7LA 1DVHA 1FJ0A 4PV1D 2YKQA 3WUIA 4UB8H 5CHXA 3SJLA 1B7VA 1I54A 1AKKA 1YHQP 3CCRP 1E8EA 3B5NB 3CYTI 1SQVK 1KQGB 1CIEA 1NWQA 2XNDH 3AEFC 1KTMA 1YFCA 1N8RQ 3L75D 2B4ZA 1ETPA 4GOEA 2O3JA 1GU4A 3JCUH 3IN6A 1LWUC 2B12B 1CEDA 4WQ9A 2AEMA 2N9BA 1KB9E 3WFBC 1J1DC 5DJUB 2R3SA 3B5NA 1N73A 2BCCE 3AEAC 1KQLA 1J2JB 1EDLA 5K5GB 1A8CA 1WT6A 2GC4D 2MJZA 1CYIA 1L0NJ 2P10A 1GL2B 4WY4B 2H43A 1Q7YQ 4UB6V 3VMZA 1MFTA 3H1JJ 155CA 3RK3B 2BH5X 4AUWA 3CCQP 3H6PA 1PGJA 1NKZB 3M9HA 1DT1A 4PJ0H 1FE6A 1GL2A 1WEJF 4WY4A 1PZQA 3OW2O 4RJTA 3OJAB 2YKPA 3CD6P 2KZJA 1CSUA 1VQ7P 1SQXG 2WPQA 2N1TC 2JP3A 3Q3DA 1PGQA 1QEXA 5AVXB 1NU1D 1DW1A 3RLMA 2FWLA 2N18C 2ZBOA 3RL0B 2R44A 1LTIC 2FYNB 3GG2A 1J1EC 1JMBA 2Q6QA 1FS0E 1NU1G 1FOCA 2KXPB 2QRXA 3LW5H 1KB9H 1K9MQ 3A3YB 1USDA 4YE1A 2ZVOB 3P8CD 2Y9ZA 1PPJE 1M1JC 1H1OA 2QJYB 3L70E 1NTKK 1R8EA 1DW3A 1Q2NA 4PD4D 1Y9BA 1VF5D 2ZYGA 3L73E 2ZYDA 1COTA 2XDJA 5CCHA 5GTIE 1X9VA 1YI2P 1C75A 3M9BA 2B87B 3P7KA 4GODA 2O01J 1YTZT 3O8ZA 1M6ZA 3RK2C 5DFSA 1IQCA 4WWIA 3SVWA 1GJQA 5APXA 4JYCA 3ZIYA 1FBMA 2B87A 1L0ND 4WQ7A 1BDCA 2QIWA 4H0LB 2KB7P 3G3ZA 1JY3O 1NTZK 3MK7C 3CCUP 3P8MC 4Y99C 3WU2V 3X39A 1WVEC 4EIJA 3HTKB 5TISV 3CWBE 1GU2A 2E75C 3H1JG 3C2CA 4HYTB 2WSFJ 1OAEA 3HD7C 2B11B 1SQPJ 1SQQD 4IL6V 2G3AA 4HH2A 4DZOA 1URQB 5AVWB 4IL6X 3HTKA 2OTKE 1N7SC 4L74A 5KJ7A 3WUVA 2Y0CA 2QSIA 5GTIH 1SQVJ 1IFNA 1S72P 1LMSA 3SWKA 3GHGC 4GKGA 1VQ6P 3HQ9A 4J20A 1ZZHA 1URQA 2WVRA 1S5LX 1KYOW 3L75E 3NBSA 2E74B 1JOCA 2JO1A 1RE4C 1CO6A 3P32A 3RN1A 3FWNA 1ZMEC 5APQA 1SP4A 2LITA 1IFMA 1LTBC 2YO3A 1YIQA 2N1TD 1YJNP 1VDFA 4JBZA 2Z5HA 1PFIA 4D6TG 3HQ6A 2WSCH 1QL3A 2IX7C 1T3JA 1GMJA 1CSBA 1HTLC 2PCBB 1PV3A 5H2FE 5KTBA 1VQ8P 1AJYA 1X0TA 2Q9IA 4H13C 5CIBB 2YXRB 2YK3A 4MN4C 2J59M 4FAVA 2H89C 4FA5A 1EB7A 1SQXE 5AURA 1KQFB 3CU4A 2P67A 2QJKC 5B66E 2JTIB 3L71D 3TSIA 2VRSA 1NU1E 2QA4P 4XA4A 1BE3J 1T3UA 1CSWA 4KHXA 1HGVA 3BCCJ 4U3FJ 3RK2B 5CBNA 3O20A 1I6EA 3H1IG 2WPVB 2WWWA 3VN0A 1SQPD 2KOGA 1QKSA 1SVFA 5AW2B 3M0DA 3WFEC 1S2EA 5APWA 3MP7B 3OA7A 1NTKJ 1IK7A 1SQPG 1JNMA 3TK1A 3H1LJ 1SQVD 1AYGA 1JY3P 1HH0A 4WQBA 2XU6A 2HR3A 4O1WA 1CTZA 5H2FH 3A0BV 2I8DA 1L4AC 4WQDA 5KLIB 1X79B 1J3SA 3FXDA 2GC7D 1QX8A 1SQBG 2GA1A 2OYHC 1JY2O 2P7JA 1W2BO 3AEGC 4FANA 2BH4X 1JTHB 1CCHA 3HQ7A 1BCCJ 3L74D 5CIHB 5B66H 1M60A 3DMIA 2IZ0A 1NTZJ 4HB1A 4W7ZA 2M0BA 4IFMA 3O0RC 2I1KA 1HWTC 1QVGO 2CPBA 3H1JE 1JTHA 2ZT9B 1WRGA 4XYDB 4JYBA 2C0WA 2ZXEB 1F1CA 2LXBA 5KAIE 3KZIE 2ITAA 3G9RA 1IO3A 3QH9A 2KSJA 2OYIB 3B5NC 1N73C 3TDKA 1KC8Q 1BGYJ 1KV4A 1L9BC 3II6A 1BE3D 3CCEP 3BCCD 4U3FD 3PHLA 5CYTR 2OYIA 3SSUA 3VNWA 1P84D 1C6SA 1SLQA 3GF7A 5GTHH 4FA1A 1FI9A 1SQQK 1ZN5A 4U3FG 2IYPA 3EWKA 1NTKD 4GT1A 3CCLP 3GLMA 2L4DA 3RBXA 2JJLA 1SFCB 4ZKPA 5KKZB 1RF1B 2QJKB 1A02J 1GL2C 1CC5A 4WY4C 4D6TE 2VHDA 2NPSB 4LLHA 3M0AA 1Q82Q 4EDFA 1OFCX 3RK3C 2K9YA 5TJHA 3H1LG 3NMDA 1DD3A 1H9YA 1CIHA 1QLED 1PIXA 3AECC 1RF1A 4H0JA 1FHBA 3N7NA 2NPSA 3CX5D 351CA 1EZVI 1BCCD 5CICB 1A02F 1FDOA 5KAFV 4GDOA 1RZ6A 1BL9A 5APSA 3H1KJ 1ZRTD 2O01N 3GW6A 1NTZD 4I7ZB 2AEJA 5AW1B 1PGPA 2ZOOA 3L73G 1BCCG 2FYNC 2C0XA 1FI7A 3ZOWA 2JWDA 1YNRA 3H1IE 5C0ZA 2R3CA 1KFNA 1KILE 1S1CX 5CCHC 3L4FA 2Q3EA 1L4AD 1H88A 1W5CT 1LC1A 1NH4A 2OARA 1GIWA 1EDJA 2QJYC 1DEBA 1SQPE 2YMKA 4HKZH 2A06D 3CCMP 1QL2A 1W2EA 2H88C 1RF0A 3A2AA 1BGYD 1LT1A 1GTWA 1SQVE 2AI5A 4EIFA 2K9JB 3TYIA 1BGYG 2O01H 3U59A 3O5CA 2FY8A 1SQBE 2PRRA 4OVNF 4W80A 3SXTA 4WQCA 2UWJE 1E5WA 1U75B 1FOSF 3CCSP 2YNYA 1T6AA 2L5GB 3RN0A 2HODB 3R2PA 4H0LC 4FB1A 2N3YA 2C2CA 2K9JA 1K05A 1EZVG 1N73B 5BU5A 3B5ND 2YIUB 3V4QA 1NOHA 3CX5W 1IZNB 3D71A 1DVVA 5KJ7C 2HODA 3L35A 1GQ1A 2HG5D 3L75G 1DEEG 2FXPA 1S5LH 2YXQB 1L2PA 2WSFH 1NYHA 1CSXA 1URQC 1LTSC 4P4QB 3A7OA 1KD1Q 2LR2A 3V5BA 3H1KD 1KYOI 1OX3A 3CP5A 4PD4I 2BLFB 3PH2B 1GL2D 2BEQD 4WY4D 5AW4B 5KLVK 1LT9A 3H1KG 3TF5A 1R0QA 4YXDC 2Q1KA 4RKUJ 2E74C 1BE3E 3CMEP 1FZFA 3V2PA 4U3FE 1U74B 3SFEC 1SQQJ 3LIDA 1A56A 4AANA 4WQEA 2MKVA 2RN0A 4N0KA 1S6VB 1W5CE 5AVTB 2BGVX 1VQLP 1DW2A 3V2QA 1ZOYC 4L76A 3H1LE 3RL0D 1YJ9P 1YJWP 3VMYA 1JM0A 1KB0A 2Z5IA 3Q5RA 4LC1A 2IBZD 5CJ0A 1CRCA 2Y9YA 1BSNA 3WUTA 5CCHD 1GZLA 3O1YA 3E7KA 4WVZA 1GDTA 5KAIV 3KZIV 1KYOD 5CBOA 1LTGC 1BCCE 3EFFK 3AE6C 3M0DC 1I8OA 3MD0A 1DH3A 4IOIH 2FFDB 1ZLLA 2WTYA 4AAOA 3VTPC 2OQQA 4NFGB 2HLOA 1DIPA 3JSVC 1VF5B 3W67A 3H1HJ 1CI6B 3TNUB 2H7HA 5B5EE 2B89A 3BVHA 3AE4C 1GD2E 5CCGD 2D2CB 5M1BA 2C9XB 4WQ8A 5E79E 2XV5A 2FFDA 3VOPA 4JQ0D 1IRWA 1QYZA 2YMYA 3R4YA 2IZ1A 4H0LD 1VL2A 4DT0A 1PP9J 1CI6A 3TNUA 1JEKA 1FI3A 3L71J 2M3EA 2V7QJ 5AW3B 1L0NG 2FKWB 1YEAA 1CRYA 1MKMA 2SPZA 1BGYE 1IC2A 2WITA 1N50A 3USSA 5KLIC 3HUSB 1FZEA 1KZUB 5IY51 2AXTE 4BXLA 4EICA 3M06A 3GMAA 1HZVA 1EZVE 3A5TA 2IDBA 4N6JA 4AQRD 4UB8V 5APUA 1SQQG 2KI7B 3HUSA 4L3GA 2WSSH 3RL0g 2QE7H 2CA3B 3UIAA 2JEEA 2ZT9C 2POHA 1LS9A 1EC5A 1KN7A 1KIBA 2ZXYA 1XTGB 4WB4A 5B5EH 3I56P 3GF3A 5E79H 3S1KA 4ZNCA 3V2NA 3D70A 2ZXXA 2OYIC 2A45I 3AE9C 3L74J 4RSZA 2GM4A 3TGUJ 1NO4A 2B9BA 4C46A 3H1KE 4YTPC 1ZP0C 3IFMA 1CSVA 1JCDA 2W8ZA 5KLVJ 3AE2C 1N90A 1ZXGA 3H1HD 2V07A 3AE8C 1M8OB 3L72J 2AXTH 4W7YA 3VYIA 2Z4EA 4PJ0V 2J5UA 1H32B 1Q86Q 3W68A 3LW5J 5AW9B 3SWYA 1SFCC 5KKZC 2KK7A 2N9YB 1PP9D 3CLQA 1RF1C 2ZJSE 2BCCJ 2N1TA 1E29A 4N78D 2BEZF 2IFNA 3VP9A 1JY3N 2NPSC 2W6BA 1C6RA 4ZMDA 3VMXA 3PXSA 3CI9A 3E1RA 4FA9A 1H32A 4PWAA 1QN2A 5DJTB 3CPWO 3OAKA 4QAOA 3V4WA 3L71G 1RE3A 2C1DB 4OGQB 3BRVB 4XFJA 3RK2D 1FC2C 1GW4A 1HJ0A 1S4XA 1KILB 4DOJA 2C1VA 5BVZA 1DIQC 3H25A 1C7MA 2B0ZB 1IFDA 2JDIH 2CE0A 2E76B 3P8CE 4EYYQ 3ZOXA 4I7ZC 2C1DA 1MV8A 1SQXK 1KFMA 3D6YA 1KYOE 4OH8B 2A45G 4PD4E 1KILA 1U57A 1K73Q 1CIFA 3Q1MA 2W90A 1GKSA 2EXVA 5DJQB 1SQVG 2K37A 3FX0A 1RF0C 1VQNP 3IR9A 2E75D 4NPEA 1VQKP 2M8RA 1UIIA 3HD7D 1VPCA 1RZ5A 5GTHE 1P84I 5CIGB 3C8VA 2QJPB 4XXLA 2XKMA 1L0LK 2PAJA 4BRYB 1NIRA 2YCCA 1N7SD 2ORLA 3TGUD 2FYUK 4V2KA 4TT3H 1M70A 1L0NE 3Q5SA 1CHHA 1NAFA 3VMAA 4AYCA 1K3GA 3CL3D 5KLVD 3AEDC 2C1UA 3CXHI 3L74G 1U7JA 3FXEA 3PXTA 1CORA 3TGUG 4EI2A 3K5BA 1MG2D 1EDIA 4BRYA 3L72D 1BSHA 2GUSA 1F1FA 2Q7CA 1CXAA 3RBZA 5KLVG 3KHUA 1CNOA 4NPDA 2PFXA 2WMMA 4I1LA 4Y5RA 1HJ3A 3CX5I 4KMGA 4C7RA 2BCCD 1SQQE 1A2SA 1KYOH 1X22A 3U1AA 1YTCA 3B8EB 2YIUC 4PD4H 1KX2A 5GTIV 2C9LY 2P58A 4Q5PA 5AW6B 1OW6A 3O6QB 1BE3G 4H13D 1FZBA 2KSEA 3BCCG 3ABVC 1RQUA 3E1IA 2KP8A 2CXBA 3V2RA 1YIJP 4WQAA 1AA0A 1YQ3C 1CHJA 1IFPA 1SFCD 2RMZA 4GYDA 3CXHD 1NTKG 3O6QA 2JKVA 3BATA 3SWFA 2KUBA 2E5TA 3KQGA 1CRGA 1TU3F 1HBWA 1QL4A 3WU2E 1YICA 2MHMA 2XZRA 4EOTA 1EQ7A 3HE5B 1AOQA 3QWOC 1Z56A 1JY2N 1HCMA 1I8PA 2K3RA 1GW3A 5TISE 2KIKA 2PGDA 3ZBMA 1PPJD 1H31B 1VQ9P 5CJ4A 1ZV8A 3D0WA 1GU5A 1I6DA 4IL6E 1DD4A 1H8AA 3KDPB 4GEDB 1KX7A 3HE5A 4H0KA 4R4LA 3L71E 1E2RA 1NTZG 3T97A 3MUDA 1CW5A 1RAQA 1G2CB 3VP8A 1AV1A 3FGAD 4TLFA 1H31A 1S5LE 2HYNA 3SLEA 2HV4A 3A0HE 2RH0A 4R4MA 1FJPA 2PCCB 1NTMK 3NXSA 2GB8B 3AE7C 1G2CA 3G6EP 1SQXJ 2N3BA 2O1KA 2FFDC 2OTJP 3IAOA 2A06G 4H44B 3MHVA 1VF5C 1IFIA 5H2FV 1OZHA 3WU2H 5AVQB 2L91A 1OVVA 1YITP 2D2CC 2CPSA 1JB0J 3CXHW 1R5LA 4YXWH 3AE3C 2V4HA 2JQRA 5C39A 5TISH 1BDDA 1L0LJ 2B88A 1OWAA 3IF4A 1OW8A 1NAYA 5B66V 1YTZI 4IFFA 3JBTB 1NHLA 4IL6H 2FYUJ 3L74E 3ITKA 1G1JA 1Y47A 3OCDB 3TGUE 2V7QH 4PV1B 1RH5B 1VQ5P 4AX3A 4K35A 1FU1A 1AOFA 1YCCA 4HJGH 5KLVE 2IBZI 3HUSC 4L75A 2C9NY 1MZ4A 4I2LC 1T2KC 3PP5A 1LT9B 3A0HH 5AW7B 3L72E 3OCDA 1SQBK 2XNXA 1CRJA 2N9JA 3CC2P 2OYOA 3PTZA 2A45H 2H8PD 3M9QA 1I55A 1JO5A 1FZCB 1HJ5A 3PLNA 4A7PA 3C1LA 3RK3D 2KZIA 3S4RA 2DGEA 5L8RJ 1HROA 2BCNB 1YQ4C 2LKMA 2JWAA 3BCCE 1YYCA 1AQ5A 1FDMA 1LTJB 4WBAA 1FZCA 2ZONG 3CMAP 5GTHV 1P84E 3A0BE 1DIIC 2WSEJ 1SQXD 3PRJA 1VQOP 1NTKE 1RHZB 3VYMA 3C9IA 1OMIA 1HUCA 3AE1C 3CC7P 3CCVP 1LTJA 1OIPA 3HQ8A 1SS1A 3CXHE 2NZ2A 3SWSA 1H33B 1MUUA 4AAMA 1LGHB 4I6MC 1YBKA 4DCKA 3G4SP 1H89A 4DY9A 2IBZG 4U7JA 4C7NB 1L0LD 1RE3C 3CX5E 1NMIA 3LIEA 3WFDC 1H33A 2FYUD 1VYDA 1NVOA 4YPCA 1S9KD 2ZFCA 3HRNA 1PL5A 1L0LG 1M1KQ 1M56D 1ZRTE 3A9FA 1NTZE 1OVUA 4C7NA 2FYUG 4OGQC 4D6TJ 1IO4A 3M91A 1CYCA 1C6OA 2RKLA 3DR0A 1KILC 4XE5B 2AXCA 2ZAEB 2D2CD 1K8AQ 1JMMA 3WUUA 1IJDB 1P84H 3A0BH 3MIWA 2E76C 1NTMJ 2P2UA 2M3BA 3S9OA 2LXCB 1HRCA 1HJ4A 2DW3A 1HH7A 3B4SA 2N9IA 2XTSB 1LTAC 1HGZA 2A06E 3PH0A 2YO2A 3L37A 2QVAA 3WFCC 4MU8A 5APYA 5DJQC 3CXHH 4GIFA 2YKOA 1AVOA 2FYZA 5KJ7D 2O1JA 3DP5A 2E43A 3FWLA 1EXJA 4OWFA 3H1JD 5EFWB 1IRVA 4EIDA 4JPZB 5CCGA 2QJPC 4PW9B 3H1IJ 1T2KD 4M3LA 2CA4B 1LWUB 3L36A 4FA4A 1URQD 1AFOA 3CX5H 3PJSK 5AW5B 2W27A 1J1DB 1LP1B 4RESB 1ZW0A 3D6ZA 2I8FA 2FXMA 5KAFE 1AVYA 4K3IA 1LWUA 4Y28J 1UIXA 3AEBC 1VQPP 3JC22 2E74D 4GOFA 4Z1MH 1L9JC 1LP1A 3MZWB 1I5TA 1GDVA 3G71P 1S5LV 3A0HV 1SQBJ 1Q90D 1H0TB 1RQVA 1LFMA 1N86A 3N4XA 2D0SA 3B71A 3H32B 1M90Q 4D6TD 3PXWA 5APVA 1MG3D 2Q5UA 2N1TB 4JCGA 1H0TA 1IFJA 2PP6A 2Y0DA 5AVUB 1OW7A 1X8YA 1E79H 4L73A 5DF5A 3RK3E 2KS1B 5AW0B 2N18B 4L1QA 1R5SA 2GUVA 2HFED 3H1HG 3KYQA 1NTMD 3H32A 1J1EB 1FOSE 1CTJA 2FBWC 5CIFB 1LJ2A 3EFGA 2QM8A 2CE1A 1C2RA 5CIEB 2KS1A 1NTMG 1RAPA 1NNOA 2P1JA 1EDKA 3MTUE 1M1JB 3CC4P 1ZR2A 2WPRA 1PP9G 5KAFH 3VRDA 2PACA 1OCDA 1DW0A 1FDIA 3EQ2A 4OGQD 5BU8B 3I55P 2B10B 3NTNA 3H1ID 2IBZE 1KILD 1S3JA 1EXIA 4JF7A 1M1JA 2R32A 1KB9I 3MUDC 4B86A 3WC8A 4O1QA 2E76D
chains in the Genus database with same CATH topology
4P4QB 3WU2V 3X39A 1CHIA 1WVEC 3H1KD 1CRGA 1QL4A 1YICA 2MHMA 3CP5A 3ZCFA 2BLFB 5TISV 3PH2B 1GU2A 1AOQA 1HCMA 1I8PA 3C2CA 1CIGA 1OAEA 1C52A 2B11B 3TF5A 3ZBMA 1R0QA 1PPJD 1SQQD 4IL6V 1H31B 3MK7B 1I6DA 1SQBD 2ZZS1 4GEDB 1KX7A 2Y0CA 4H0KA 1U74B 1E2RA 3L4MA 1YEBA 1A56A 1LMSA 1RAQA 4AANA 4WQEA 1K3HA 3HQ9A 1H31A 4J20A 2RN0A 1ZZHA 4N0KA 1S6VB 1KYOW 1W2LA 3SLEA 2HV4A 2BGVX 2V08A 1DW2A 2DVHA 3NBSA 2OZ1B 2PCCB 451CA 1KB0A 1FCDC 1CO6A 3RN1A 2GB8B 2IBZD 1CRCA 1KB9D 2N3BA 2LITA 1YIQA 3O1YA 2OZ1A 1C2NA 2GIWA 5KAIV 3KZIV 1KYOD 3HQ6A 5H2FV 1QL3A 4AALA 5CIDB 2L91A 1CYJA 2PCBB 3CXHW 1I8OA 2JQRA 1CTYA 5CIBB 2Y0EA 2YK3A 2MTAC 1CXCA 4AAOA 4FAVA 3ORVA 4FA5A 1EB7A 4NFGB 5AURA 5B5EV 5B66V 4LJIA 3JBTB 3ITKA 4EIEA 3CU4A 3OCDB 5E79V 3NBTA 2JTIB 3L71D 2C9XB 1CCRA 1KV9A 4WQ8A 4AX3A 1N9CA 1CRIA 1AOFA 1YCCA 1IRWA 1QYZA 2D0WA 1MZ4A 1CSWA 1FI3A 3O20A 4L3HA 3ZOOA 1I6EA 3OCDA 3H1LD 1SQPD 1YEAA 1CRYA 2LIRA 1CRJA 2N9JA 1QKSA 1N15A 1LC2A 3PTZA 1N50A 3WFEC 5EXQA 1I55A 2AXTV 2BPBB 1HJ5A 3PLNA 4A7PA 5IY51 1SQVD 1AYGA 1HZUA 4WQBA 2DGEA 1HROA 3RMZA 3L70D 2BCNB 4EICA 1HZVA 2JWAA 4O1WA 5B6QA 1CTZA 3L73D 4UB8V 3A0BV 4L3GA 4WQDA 5KLIB 2ZONG 1J3SA 5GTHV 2GC7D 3M97X 2CA3B 1DIIC 1SQXD 3PRJA 3ZOYA 4FANA 2BH4X 1CCHA 3VYMA 1LS9A 3HQ7A 3L74D 1KIBA 2ZXYA 5CIHB 1M60A 3DMIA 3HQ8A 1CRHA 3SWSA 1H33B 3NWVA 2C8SA 4AAMA 3O0RC 2QG4A 1H9XA 4RSZA 4DY9A 4XYDB 2KNCB 3L4OA 1F1CA 1L0LD 1CSVA 3OA8B 1NMIA 1N90A 3WFDC 1H33A 3H1HD 2FYUD 1IO3A 3CWBD 1VYDA 2V07A 1JDLA 5C9MA 3A9FA 4PJ0V 2AIUA 1H32B 3TDKA 1L9BC 2YQBA 1IZL0 1NMLA 3OA8A 1BE3D 1EZVD 1CYCA 2N9YB 1PP9D 1C6OA 3BCCD 3DR0A 4U3FD 1E29A 3PHLA 5CYTR 2FRCA 1DVHA 1FJ0A 3WUIA 1C6RA 3SJLA 3VNWA 3PXSA 1P84D 1B7VA 1I54A 1C6SA 1AKKA 4FA9A 1H32A 1E8EA 3CYTI 4PWAA 1QN2A 4FA1A 1CIEA 1FI9A 4QAOA 1YFCA 1HRCA 1NTKD 3L75D 2B4ZA 2C1DB 1ETPA 1HJ4A 2O3JA 1HH7A 2L4DA 2N9IA 2XTSB 2B12B 5KKZB 1CEDA 2QJKB 3WFCC 4WQ9A 4MU8A 1CC5A 2VHDA 5DJQC 2C1VA 1DIQC 3WFBC 1C7MA 2B0ZB 3DP5A 4EDFA 3FWLA 2CE0A 5TJHA 3ZOXA 2C1DA 1H9YA 3H1JD 1IRVA 4EIDA 1CIHA 4PW9B 1A8CA 2GC4D 1CYIA 2CA4B 4H0JA 4FA4A 1FHBA 1CIFA 3CX5D 1GKSA 2EXVA 351CA 5DJQB 4UB6V 1BCCD 5CICB 155CA 5KAFV 1RZ6A 2BH5X 1BL9A 2I8FA 1ZRTD 3GW6A 1NTZD 1RZ5A 5CIGB 2ZOOA 2QJPB 4K3IA 1DT1A 4XXLA 1WEJF 1FI7A 1NIRA 2YCCA 3ZOWA 4RJTA 1YNRA 2ORLA 3TGUD 1L9JC 5C0ZA 1CSUA 4V2KA 1M70A 1I5TA 1GDVA 1S5LV 1CHHA 3VMAA 2Q3EA 1K3GA 3A0HV 1NU1D 5KLVD 1DW1A 2C1UA 3RLMA 2FWLA 1LFMA 1W5CT 2N18C 2ZBOA 1LC1A 3PXTA 1CORA 1GIWA 1MG2D 3L72D 2D0SA 2FYNB 3GG2A 1F1FA 2A06D 1CXAA 1FOCA 3KHUA 1BGYD 1CNOA 4D6TD 3PXWA 4Y5RA 1HJ3A 1MG3D 4JCGA 4KMGA 2BCCD 2Y0DA 4YE1A 1A2SA 5DF5A 2AI5A 2N18B 4L1QA 4EIFA 2K9JB 3TYIA 1H1OA 2QJYB 3O5CA 1DW3A 1YTCA 1KX2A 1NTMD 3SXTA 4WQCA 4PD4D 5GTIV 1U75B 1CTJA 1COTA 5CIFB 4Q5PA 2CE1A 3RN0A 1C2RA 5CIEB 1C75A 2KS1A 1RAPA 4FB1A 2N3YA 2C2CA 1NNOA 1M6ZA 3VRDA 5DFSA 1IQCA 2PACA 3SVWA 2YIUB 1OCDA 1DW0A 1GJQA 3CX5W 2CXBA 1DVVA 4WQAA 2B10B 1CHJA 3ZIYA 3H1ID 2RMZA 1L0ND 4GYDA 1GQ1A 4WQ7A 3CXHD 3WC8A 4O1QA 1CSXA 3MK7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4Q B;  3WU2 V;  3X39 A;  1CHI A;  1WVE C;  3H1K D;  1CRG A;  1QL4 A;  1YIC A;  2MHM A;  3CP5 A;  3ZCF A;  2BLF B;  5TIS V;  3PH2 B;  1GU2 A;  1AOQ A;  1HCM A;  1I8P A;  3C2C A;  1CIG A;  1OAE A;  1C52 A;  2B11 B;  3TF5 A;  3ZBM A;  1R0Q A;  1PPJ D;  1SQQ D;  4IL6 V;  1H31 B;  3MK7 B;  1I6D A;  1SQB D;  2ZZS 1;  4GED B;  1KX7 A;  2Y0C A;  4H0K A;  1U74 B;  1E2R A;  3L4M A;  1YEB A;  1A56 A;  1LMS A;  1RAQ A;  4AAN A;  4WQE A;  1K3H A;  3HQ9 A;  1H31 A;  4J20 A;  2RN0 A;  1ZZH A;  4N0K A;  1S6V B;  1KYO W;  1W2L A;  3SLE A;  2HV4 A;  2BGV X;  2V08 A;  1DW2 A;  2DVH A;  3NBS A;  2OZ1 B;  2PCC B;  451C A;  1KB0 A;  1FCD C;  1CO6 A;  3RN1 A;  2GB8 B;  2IBZ D;  1CRC A;  1KB9 D;  2N3B A;  2LIT A;  1YIQ A;  3O1Y A;  2OZ1 A;  1C2N A;  2GIW A;  5KAI V;  3KZI V;  1KYO D;  3HQ6 A;  5H2F V;  1QL3 A;  4AAL A;  5CID B;  2L91 A;  1CYJ A;  2PCB B;  3CXH W;  1I8O A;  2JQR A;  1CTY A;  5CIB B;  2Y0E A;  2YK3 A;  2MTA C;  1CXC A;  4AAO A;  4FAV A;  3ORV A;  4FA5 A;  1EB7 A;  4NFG B;  5AUR A;  5B5E V;  5B66 V;  4LJI A;  3JBT B;  3ITK A;  4EIE A;  3CU4 A;  3OCD B;  5E79 V;  3NBT A;  2JTI B;  3L71 D;  2C9X B;  1CCR A;  1KV9 A;  4WQ8 A;  4AX3 A;  1N9C A;  1CRI A;  1AOF A;  1YCC A;  1IRW A;  1QYZ A;  2D0W A;  1MZ4 A;  1CSW A;  1FI3 A;  3O20 A;  4L3H A;  3ZOO A;  1I6E A;  3OCD A;  3H1L D;  1SQP D;  1YEA A;  1CRY A;  2LIR A;  1CRJ A;  2N9J A;  1QKS A;  1N15 A;  1LC2 A;  3PTZ A;  1N50 A;  3WFE C;  5EXQ A;  1I55 A;  2AXT V;  2BPB B;  1HJ5 A;  3PLN A;  4A7P A;  5IY5 1;  1SQV D;  1AYG A;  1HZU A;  4WQB A;  2DGE A;  1HRO A;  3RMZ A;  3L70 D;  2BCN B;  4EIC A;  1HZV A;  2JWA A;  4O1W A;  5B6Q A;  1CTZ A;  3L73 D;  4UB8 V;  3A0B V;  4L3G A;  4WQD A;  5KLI B;  2ZON G;  1J3S A;  5GTH V;  2GC7 D;  3M97 X;  2CA3 B;  1DII C;  1SQX D;  3PRJ A;  3ZOY A;  4FAN A;  2BH4 X;  1CCH A;  3VYM A;  1LS9 A;  3HQ7 A;  3L74 D;  1KIB A;  2ZXY A;  5CIH B;  1M60 A;  3DMI A;  3HQ8 A;  1CRH A;  3SWS A;  1H33 B;  3NWV A;  2C8S A;  4AAM A;  3O0R C;  2QG4 A;  1H9X A;  4RSZ A;  4DY9 A;  4XYD B;  2KNC B;  3L4O A;  1F1C A;  1L0L D;  1CSV A;  3OA8 B;  1NMI A;  1N90 A;  3WFD C;  1H33 A;  3H1H D;  2FYU D;  1IO3 A;  3CWB D;  1VYD A;  2V07 A;  1JDL A;  5C9M A;  3A9F A;  4PJ0 V;  2AIU A;  1H32 B;  3TDK A;  1L9B C;  2YQB A;  1IZL 0;  1NML A;  3OA8 A;  1BE3 D;  1EZV D;  1CYC A;  2N9Y B;  1PP9 D;  1C6O A;  3BCC D;  3DR0 A;  4U3F D;  1E29 A;  3PHL A;  5CYT R;  2FRC A;  1DVH A;  1FJ0 A;  3WUI A;  1C6R A;  3SJL A;  3VNW A;  3PXS A;  1P84 D;  1B7V A;  1I54 A;  1C6S A;  1AKK A;  4FA9 A;  1H32 A;  1E8E A;  3CYT I;  4PWA A;  1QN2 A;  4FA1 A;  1CIE A;  1FI9 A;  4QAO A;  1YFC A;  1HRC A;  1NTK D;  3L75 D;  2B4Z A;  2C1D B;  1ETP A;  1HJ4 A;  2O3J A;  1HH7 A;  2L4D A;  2N9I A;  2XTS B;  2B12 B;  5KKZ B;  1CED A;  2QJK B;  3WFC C;  4WQ9 A;  4MU8 A;  1CC5 A;  2VHD A;  5DJQ C;  2C1V A;  1DIQ C;  3WFB C;  1C7M A;  2B0Z B;  3DP5 A;  4EDF A;  3FWL A;  2CE0 A;  5TJH A;  3ZOX A;  2C1D A;  1H9Y A;  3H1J D;  1IRV A;  4EID A;  1CIH A;  4PW9 B;  1A8C A;  2GC4 D;  1CYI A;  2CA4 B;  4H0J A;  4FA4 A;  1FHB A;  1CIF A;  3CX5 D;  1GKS A;  2EXV A;  351C A;  5DJQ B;  4UB6 V;  1BCC D;  5CIC B;  155C A;  5KAF V;  1RZ6 A;  2BH5 X;  1BL9 A;  2I8F A;  1ZRT D;  3GW6 A;  1NTZ D;  1RZ5 A;  5CIG B;  2ZOO A;  2QJP B;  4K3I A;  1DT1 A;  4XXL A;  1WEJ F;  1FI7 A;  1NIR A;  2YCC A;  3ZOW A;  4RJT A;  1YNR A;  2ORL A;  3TGU D;  1L9J C;  5C0Z A;  1CSU A;  4V2K A;  1M70 A;  1I5T A;  1GDV A;  1S5L V;  1CHH A;  3VMA A;  2Q3E A;  1K3G A;  3A0H V;  1NU1 D;  5KLV D;  1DW1 A;  2C1U A;  3RLM A;  2FWL A;  1LFM A;  1W5C T;  2N18 C;  2ZBO A;  1LC1 A;  3PXT A;  1COR A;  1GIW A;  1MG2 D;  3L72 D;  2D0S A;  2FYN B;  3GG2 A;  1F1F A;  2A06 D;  1CXA A;  1FOC A;  3KHU A;  1BGY D;  1CNO A;  4D6T D;  3PXW A;  4Y5R A;  1HJ3 A;  1MG3 D;  4JCG A;  4KMG A;  2BCC D;  2Y0D A;  4YE1 A;  1A2S A;  5DF5 A;  2AI5 A;  2N18 B;  4L1Q A;  4EIF A;  2K9J B;  3TYI A;  1H1O A;  2QJY B;  3O5C A;  1DW3 A;  1YTC A;  1KX2 A;  1NTM D;  3SXT A;  4WQC A;  4PD4 D;  5GTI V;  1U75 B;  1CTJ A;  1COT A;  5CIF B;  4Q5P A;  2CE1 A;  3RN0 A;  1C2R A;  5CIE B;  1C75 A;  2KS1 A;  1RAP A;  4FB1 A;  2N3Y A;  2C2C A;  1NNO A;  1M6Z A;  3VRD A;  5DFS A;  1IQC A;  2PAC A;  3SVW A;  2YIU B;  1OCD A;  1DW0 A;  1GJQ A;  3CX5 W;  2CXB A;  1DVV A;  4WQA A;  2B10 B;  1CHJ A;  3ZIY A;  3H1I D;  2RMZ A;  1L0N D;  4GYD A;  1GQ1 A;  4WQ7 A;  3CXH D;  3WC8 A;  4O1Q A;  1CSX A;  3MK7 C; 
#chains in the Genus database with same CATH topology
 2IYO A;  2WPS A;  1L0L E;  3BRT B;  1CHI A;  4BWN A;  3ZCF A;  2FYU E;  2FXO A;  1S9K E;  4N3Y B;  1CIG A;  1C52 A;  1DX7 A;  1KQS O;  1NU1 K;  4UB6 E;  3MK7 B;  2G8Y A;  4Y99 B;  1SQB D;  1Y8A A;  1OXZ A;  2ZZS 1;  2I1J A;  1FJK A;  3L4M A;  1YEB A;  3RGU A;  3F5H A;  2E75 B;  3HD7 B;  1K3H A;  1QVF O;  3L70 J;  3TYY A;  1CZQ A;  2E5Y A;  1W2L A;  4H44 C;  2V08 A;  3L73 J;  3BAS A;  2DVH A;  2HPC B;  2OZ1 B;  1MFZ A;  451C A;  1N7S B;  2ZT9 D;  1FCD C;  3WMM 0;  2W83 C;  1D7M A;  3HD7 A;  1NJI Q;  4LGD E;  2E42 A;  1KB9 D;  2AEF A;  1WMK A;  3GHG B;  1K04 A;  3L72 G;  1PGO A;  2HPC A;  2OZ1 A;  1N7S A;  1C2N A;  2GIW A;  1HJB A;  4ZKU A;  2KLV A;  4AAL A;  2M5A B;  5CID B;  2BCC G;  5AVV B;  4PV1 C;  1CYJ A;  4ASW A;  4RO0 A;  2WZ7 A;  3GHG A;  3Q2Y A;  1JUN A;  1L0N K;  1CTY A;  2Y0E A;  4KJM A;  2K88 A;  4UB6 H;  5AVS B;  2MTA C;  1CXC A;  3AE5 C;  1HVV A;  2IPP A;  3ORV A;  2WSC J;  1G1I A;  1U7M A;  2ZYA A;  1LT9 C;  1GK6 A;  5B5E V;  4LJI A;  2WT7 B;  3HE4 B;  1RE4 A;  4O9B A;  3AEE C;  3CWB J;  2M5A A;  4EIE A;  5E79 V;  3NBT A;  3CCJ P;  1CCR A;  1KV9 A;  1OVR A;  1N9C A;  4ASV A;  1CRI A;  2WQY C;  4H13 B;  2JR8 A;  2D0W A;  3Q5P A;  2NPS D;  3U1C A;  1FZC C;  1NGM B;  2KYV A;  3MGN A;  2KLU A;  2NRG A;  2R5B A;  3HE4 A;  3KXD A;  2WT7 A;  5APT A;  3ZDM A;  4L3H A;  3ZOO A;  3F89 A;  3H1L D;  2LIR A;  1ZR4 A;  1N15 A;  1LC2 A;  1FZA A;  3H1H E;  1IK9 A;  4IFD K;  5EXQ A;  1LTJ C;  2W6A A;  1XTC C;  2AXT V;  2R5D A;  3NFQ A;  1KOR A;  1JCC A;  3L75 J;  1LTT C;  2BPB B;  1QL1 A;  5AVR B;  3T97 B;  5AVY B;  5AW8 B;  2W6J H;  1MZ9 A;  2ZVN B;  1HZU A;  1AQT A;  1T8Z A;  1M57 D;  1SFC A;  1NTM E;  3RMZ A;  3KPE A;  3L70 D;  1N2D C;  2WSE H;  3V6I A;  5KAI H;  3KZI H;  1PP9 E;  1FZG A;  4QMA A;  1HF9 A;  1Q81 Q;  5B6Q A;  3L73 D;  4N78 E;  5CMZ A;  1PPJ G;  2OGU A;  1LNQ A;  3M97 X;  3L70 G;  4UB8 E;  1QGK B;  3RL0 C;  1VQ4 P;  3ZOY A;  5AVZ B;  1NKN A;  4NPF X;  3JCU E;  2OTL P;  1L4A B;  1CRH A;  2BAS A;  2CK3 H;  1VQM P;  3NWV A;  2C8S A;  1USE A;  4KT0 J;  2QG4 A;  2OYH B;  1H9X A;  1M7L A;  4DJG A;  4K3A A;  1JY2 P;  4CPG A;  2KNC B;  4H44 D;  3L4O A;  2IFM A;  1FAV A;  3I5C A;  2J58 A;  3OA8 B;  1NU1 J;  1L4A A;  3CWB D;  2QM7 A;  2OYH A;  1JDL A;  2K1A A;  2QEX P;  5C9M A;  2AIU A;  2KNC A;  2Q3I A;  1KMI Z;  3CWB G;  2YQB A;  1GK4 A;  4PJ0 E;  1IZL 0;  1RY3 A;  3SFD C;  1NML A;  3OA8 A;  5CCG C;  1SQP K;  1EZV D;  2FRC A;  1N7L A;  1DVH A;  1FJ0 A;  4PV1 D;  2YKQ A;  3WUI A;  4UB8 H;  5CHX A;  3SJL A;  1B7V A;  1I54 A;  1AKK A;  1YHQ P;  3CCR P;  1E8E A;  3B5N B;  3CYT I;  1SQV K;  1KQG B;  1CIE A;  1NWQ A;  2XND H;  3AEF C;  1KTM A;  1YFC A;  1N8R Q;  3L75 D;  2B4Z A;  1ETP A;  4GOE A;  2O3J A;  1GU4 A;  3JCU H;  3IN6 A;  1LWU C;  2B12 B;  1CED A;  4WQ9 A;  2AEM A;  2N9B A;  1KB9 E;  3WFB C;  1J1D C;  5DJU B;  2R3S A;  3B5N A;  1N73 A;  2BCC E;  3AEA C;  1KQL A;  1J2J B;  1EDL A;  5K5G B;  1A8C A;  1WT6 A;  2GC4 D;  2MJZ A;  1CYI A;  1L0N J;  2P10 A;  1GL2 B;  4WY4 B;  2H43 A;  1Q7Y Q;  4UB6 V;  3VMZ A;  1MFT A;  3H1J J;  155C A;  3RK3 B;  2BH5 X;  4AUW A;  3CCQ P;  3H6P A;  1PGJ A;  1NKZ B;  3M9H A;  1DT1 A;  4PJ0 H;  1FE6 A;  1GL2 A;  1WEJ F;  4WY4 A;  1PZQ A;  3OW2 O;  4RJT A;  3OJA B;  2YKP A;  3CD6 P;  2KZJ A;  1CSU A;  1VQ7 P;  1SQX G;  2WPQ A;  2N1T C;  2JP3 A;  3Q3D A;  1PGQ A;  1QEX A;  5AVX B;  1NU1 D;  1DW1 A;  3RLM A;  2FWL A;  2N18 C;  2ZBO A;  3RL0 B;  2R44 A;  1LTI C;  2FYN B;  3GG2 A;  1J1E C;  1JMB A;  2Q6Q A;  1FS0 E;  1NU1 G;  1FOC A;  2KXP B;  2QRX A;  3LW5 H;  1KB9 H;  1K9M Q;  3A3Y B;  1USD A;  4YE1 A;  2ZVO B;  3P8C D;  2Y9Z A;  1PPJ E;  1M1J C;  1H1O A;  2QJY B;  3L70 E;  1NTK K;  1R8E A;  1DW3 A;  1Q2N A;  4PD4 D;  1Y9B A;  1VF5 D;  2ZYG A;  3L73 E;  2ZYD A;  1COT A;  2XDJ A;  5CCH A;  5GTI E;  1X9V A;  1YI2 P;  1C75 A;  3M9B A;  2B87 B;  3P7K A;  4GOD A;  2O01 J;  1YTZ T;  3O8Z A;  1M6Z A;  3RK2 C;  5DFS A;  1IQC A;  4WWI A;  3SVW A;  1GJQ A;  5APX A;  4JYC A;  3ZIY A;  1FBM A;  2B87 A;  1L0N D;  4WQ7 A;  1BDC A;  2QIW A;  4H0L B;  2KB7 P;  3G3Z A;  1JY3 O;  1NTZ K;  3MK7 C;  3CCU P;  3P8M C;  4Y99 C;  3WU2 V;  3X39 A;  1WVE C;  4EIJ A;  3HTK B;  5TIS V;  3CWB E;  1GU2 A;  2E75 C;  3H1J G;  3C2C A;  4HYT B;  2WSF J;  1OAE A;  3HD7 C;  2B11 B;  1SQP J;  1SQQ D;  4IL6 V;  2G3A A;  4HH2 A;  4DZO A;  1URQ B;  5AVW B;  4IL6 X;  3HTK A;  2OTK E;  1N7S C;  4L74 A;  5KJ7 A;  3WUV A;  2Y0C A;  2QSI A;  5GTI H;  1SQV J;  1IFN A;  1S72 P;  1LMS A;  3SWK A;  3GHG C;  4GKG A;  1VQ6 P;  3HQ9 A;  4J20 A;  1ZZH A;  1URQ A;  2WVR A;  1S5L X;  1KYO W;  3L75 E;  3NBS A;  2E74 B;  1JOC A;  2JO1 A;  1RE4 C;  1CO6 A;  3P32 A;  3RN1 A;  3FWN A;  1ZME C;  5APQ A;  1SP4 A;  2LIT A;  1IFM A;  1LTB C;  2YO3 A;  1YIQ A;  2N1T D;  1YJN P;  1VDF A;  4JBZ A;  2Z5H A;  1PFI A;  4D6T G;  3HQ6 A;  2WSC H;  1QL3 A;  2IX7 C;  1T3J A;  1GMJ A;  1CSB A;  1HTL C;  2PCB B;  1PV3 A;  5H2F E;  5KTB A;  1VQ8 P;  1AJY A;  1X0T A;  2Q9I A;  4H13 C;  5CIB B;  2YXR B;  2YK3 A;  4MN4 C;  2J59 M;  4FAV A;  2H89 C;  4FA5 A;  1EB7 A;  1SQX E;  5AUR A;  1KQF B;  3CU4 A;  2P67 A;  2QJK C;  5B66 E;  2JTI B;  3L71 D;  3TSI A;  2VRS A;  1NU1 E;  2QA4 P;  4XA4 A;  1BE3 J;  1T3U A;  1CSW A;  4KHX A;  1HGV A;  3BCC J;  4U3F J;  3RK2 B;  5CBN A;  3O20 A;  1I6E A;  3H1I G;  2WPV B;  2WWW A;  3VN0 A;  1SQP D;  2KOG A;  1QKS A;  1SVF A;  5AW2 B;  3M0D A;  3WFE C;  1S2E A;  5APW A;  3MP7 B;  3OA7 A;  1NTK J;  1IK7 A;  1SQP G;  1JNM A;  3TK1 A;  3H1L J;  1SQV D;  1AYG A;  1JY3 P;  1HH0 A;  4WQB A;  2XU6 A;  2HR3 A;  4O1W A;  1CTZ A;  5H2F H;  3A0B V;  2I8D A;  1L4A C;  4WQD A;  5KLI B;  1X79 B;  1J3S A;  3FXD A;  2GC7 D;  1QX8 A;  1SQB G;  2GA1 A;  2OYH C;  1JY2 O;  2P7J A;  1W2B O;  3AEG C;  4FAN A;  2BH4 X;  1JTH B;  1CCH A;  3HQ7 A;  1BCC J;  3L74 D;  5CIH B;  5B66 H;  1M60 A;  3DMI A;  2IZ0 A;  1NTZ J;  4HB1 A;  4W7Z A;  2M0B A;  4IFM A;  3O0R C;  2I1K A;  1HWT C;  1QVG O;  2CPB A;  3H1J E;  1JTH A;  2ZT9 B;  1WRG A;  4XYD B;  4JYB A;  2C0W A;  2ZXE B;  1F1C A;  2LXB A;  5KAI E;  3KZI E;  2ITA A;  3G9R A;  1IO3 A;  3QH9 A;  2KSJ A;  2OYI B;  3B5N C;  1N73 C;  3TDK A;  1KC8 Q;  1BGY J;  1KV4 A;  1L9B C;  3II6 A;  1BE3 D;  3CCE P;  3BCC D;  4U3F D;  3PHL A;  5CYT R;  2OYI A;  3SSU A;  3VNW A;  1P84 D;  1C6S A;  1SLQ A;  3GF7 A;  5GTH H;  4FA1 A;  1FI9 A;  1SQQ K;  1ZN5 A;  4U3F G;  2IYP A;  3EWK A;  1NTK D;  4GT1 A;  3CCL P;  3GLM A;  2L4D A;  3RBX A;  2JJL A;  1SFC B;  4ZKP A;  5KKZ B;  1RF1 B;  2QJK B;  1A02 J;  1GL2 C;  1CC5 A;  4WY4 C;  4D6T E;  2VHD A;  2NPS B;  4LLH A;  3M0A A;  1Q82 Q;  4EDF A;  1OFC X;  3RK3 C;  2K9Y A;  5TJH A;  3H1L G;  3NMD A;  1DD3 A;  1H9Y A;  1CIH A;  1QLE D;  1PIX A;  3AEC C;  1RF1 A;  4H0J A;  1FHB A;  3N7N A;  2NPS A;  3CX5 D;  351C A;  1EZV I;  1BCC D;  5CIC B;  1A02 F;  1FDO A;  5KAF V;  4GDO A;  1RZ6 A;  1BL9 A;  5APS A;  3H1K J;  1ZRT D;  2O01 N;  3GW6 A;  1NTZ D;  4I7Z B;  2AEJ A;  5AW1 B;  1PGP A;  2ZOO A;  3L73 G;  1BCC G;  2FYN C;  2C0X A;  1FI7 A;  3ZOW A;  2JWD A;  1YNR A;  3H1I E;  5C0Z A;  2R3C A;  1KFN A;  1KIL E;  1S1C X;  5CCH C;  3L4F A;  2Q3E A;  1L4A D;  1H88 A;  1W5C T;  1LC1 A;  1NH4 A;  2OAR A;  1GIW A;  1EDJ A;  2QJY C;  1DEB A;  1SQP E;  2YMK A;  4HKZ H;  2A06 D;  3CCM P;  1QL2 A;  1W2E A;  2H88 C;  1RF0 A;  3A2A A;  1BGY D;  1LT1 A;  1GTW A;  1SQV E;  2AI5 A;  4EIF A;  2K9J B;  3TYI A;  1BGY G;  2O01 H;  3U59 A;  3O5C A;  2FY8 A;  1SQB E;  2PRR A;  4OVN F;  4W80 A;  3SXT A;  4WQC A;  2UWJ E;  1E5W A;  1U75 B;  1FOS F;  3CCS P;  2YNY A;  1T6A A;  2L5G B;  3RN0 A;  2HOD B;  3R2P A;  4H0L C;  4FB1 A;  2N3Y A;  2C2C A;  2K9J A;  1K05 A;  1EZV G;  1N73 B;  5BU5 A;  3B5N D;  2YIU B;  3V4Q A;  1NOH A;  3CX5 W;  1IZN B;  3D71 A;  1DVV A;  5KJ7 C;  2HOD A;  3L35 A;  1GQ1 A;  2HG5 D;  3L75 G;  1DEE G;  2FXP A;  1S5L H;  2YXQ B;  1L2P A;  2WSF H;  1NYH A;  1CSX A;  1URQ C;  1LTS C;  4P4Q B;  3A7O A;  1KD1 Q;  2LR2 A;  3V5B A;  3H1K D;  1KYO I;  1OX3 A;  3CP5 A;  4PD4 I;  2BLF B;  3PH2 B;  1GL2 D;  2BEQ D;  4WY4 D;  5AW4 B;  5KLV K;  1LT9 A;  3H1K G;  3TF5 A;  1R0Q A;  4YXD C;  2Q1K A;  4RKU J;  2E74 C;  1BE3 E;  3CME P;  1FZF A;  3V2P A;  4U3F E;  1U74 B;  3SFE C;  1SQQ J;  3LID A;  1A56 A;  4AAN A;  4WQE A;  2MKV A;  2RN0 A;  4N0K A;  1S6V B;  1W5C E;  5AVT B;  2BGV X;  1VQL P;  1DW2 A;  3V2Q A;  1ZOY C;  4L76 A;  3H1L E;  3RL0 D;  1YJ9 P;  1YJW P;  3VMY A;  1JM0 A;  1KB0 A;  2Z5I A;  3Q5R A;  4LC1 A;  2IBZ D;  5CJ0 A;  1CRC A;  2Y9Y A;  1BSN A;  3WUT A;  5CCH D;  1GZL A;  3O1Y A;  3E7K A;  4WVZ A;  1GDT A;  5KAI V;  3KZI V;  1KYO D;  5CBO A;  1LTG C;  1BCC E;  3EFF K;  3AE6 C;  3M0D C;  1I8O A;  3MD0 A;  1DH3 A;  4IOI H;  2FFD B;  1ZLL A;  2WTY A;  4AAO A;  3VTP C;  2OQQ A;  4NFG B;  2HLO A;  1DIP A;  3JSV C;  1VF5 B;  3W67 A;  3H1H J;  1CI6 B;  3TNU B;  2H7H A;  5B5E E;  2B89 A;  3BVH A;  3AE4 C;  1GD2 E;  5CCG D;  2D2C B;  5M1B A;  2C9X B;  4WQ8 A;  5E79 E;  2XV5 A;  2FFD A;  3VOP A;  4JQ0 D;  1IRW A;  1QYZ A;  2YMY A;  3R4Y A;  2IZ1 A;  4H0L D;  1VL2 A;  4DT0 A;  1PP9 J;  1CI6 A;  3TNU A;  1JEK A;  1FI3 A;  3L71 J;  2M3E A;  2V7Q J;  5AW3 B;  1L0N G;  2FKW B;  1YEA A;  1CRY A;  1MKM A;  2SPZ A;  1BGY E;  1IC2 A;  2WIT A;  1N50 A;  3USS A;  5KLI C;  3HUS B;  1FZE A;  1KZU B;  5IY5 1;  2AXT E;  4BXL A;  4EIC A;  3M06 A;  3GMA A;  1HZV A;  1EZV E;  3A5T A;  2IDB A;  4N6J A;  4AQR D;  4UB8 V;  5APU A;  1SQQ G;  2KI7 B;  3HUS A;  4L3G A;  2WSS H;  3RL0 g;  2QE7 H;  2CA3 B;  3UIA A;  2JEE A;  2ZT9 C;  2POH A;  1LS9 A;  1EC5 A;  1KN7 A;  1KIB A;  2ZXY A;  1XTG B;  4WB4 A;  5B5E H;  3I56 P;  3GF3 A;  5E79 H;  3S1K A;  4ZNC A;  3V2N A;  3D70 A;  2ZXX A;  2OYI C;  2A45 I;  3AE9 C;  3L74 J;  4RSZ A;  2GM4 A;  3TGU J;  1NO4 A;  2B9B A;  4C46 A;  3H1K E;  4YTP C;  1ZP0 C;  3IFM A;  1CSV A;  1JCD A;  2W8Z A;  5KLV J;  3AE2 C;  1N90 A;  1ZXG A;  3H1H D;  2V07 A;  3AE8 C;  1M8O B;  3L72 J;  2AXT H;  4W7Y A;  3VYI A;  2Z4E A;  4PJ0 V;  2J5U A;  1H32 B;  1Q86 Q;  3W68 A;  3LW5 J;  5AW9 B;  3SWY A;  1SFC C;  5KKZ C;  2KK7 A;  2N9Y B;  1PP9 D;  3CLQ A;  1RF1 C;  2ZJS E;  2BCC J;  2N1T A;  1E29 A;  4N78 D;  2BEZ F;  2IFN A;  3VP9 A;  1JY3 N;  2NPS C;  2W6B A;  1C6R A;  4ZMD A;  3VMX A;  3PXS A;  3CI9 A;  3E1R A;  4FA9 A;  1H32 A;  4PWA A;  1QN2 A;  5DJT B;  3CPW O;  3OAK A;  4QAO A;  3V4W A;  3L71 G;  1RE3 A;  2C1D B;  4OGQ B;  3BRV B;  4XFJ A;  3RK2 D;  1FC2 C;  1GW4 A;  1HJ0 A;  1S4X A;  1KIL B;  4DOJ A;  2C1V A;  5BVZ A;  1DIQ C;  3H25 A;  1C7M A;  2B0Z B;  1IFD A;  2JDI H;  2CE0 A;  2E76 B;  3P8C E;  4EYY Q;  3ZOX A;  4I7Z C;  2C1D A;  1MV8 A;  1SQX K;  1KFM A;  3D6Y A;  1KYO E;  4OH8 B;  2A45 G;  4PD4 E;  1KIL A;  1U57 A;  1K73 Q;  1CIF A;  3Q1M A;  2W90 A;  1GKS A;  2EXV A;  5DJQ B;  1SQV G;  2K37 A;  3FX0 A;  1RF0 C;  1VQN P;  3IR9 A;  2E75 D;  4NPE A;  1VQK P;  2M8R A;  1UII A;  3HD7 D;  1VPC A;  1RZ5 A;  5GTH E;  1P84 I;  5CIG B;  3C8V A;  2QJP B;  4XXL A;  2XKM A;  1L0L K;  2PAJ A;  4BRY B;  1NIR A;  2YCC A;  1N7S D;  2ORL A;  3TGU D;  2FYU K;  4V2K A;  4TT3 H;  1M70 A;  1L0N E;  3Q5S A;  1CHH A;  1NAF A;  3VMA A;  4AYC A;  1K3G A;  3CL3 D;  5KLV D;  3AED C;  2C1U A;  3CXH I;  3L74 G;  1U7J A;  3FXE A;  3PXT A;  1COR A;  3TGU G;  4EI2 A;  3K5B A;  1MG2 D;  1EDI A;  4BRY A;  3L72 D;  1BSH A;  2GUS A;  1F1F A;  2Q7C A;  1CXA A;  3RBZ A;  5KLV G;  3KHU A;  1CNO A;  4NPD A;  2PFX A;  2WMM A;  4I1L A;  4Y5R A;  1HJ3 A;  3CX5 I;  4KMG A;  4C7R A;  2BCC D;  1SQQ E;  1A2S A;  1KYO H;  1X22 A;  3U1A A;  1YTC A;  3B8E B;  2YIU C;  4PD4 H;  1KX2 A;  5GTI V;  2C9L Y;  2P58 A;  4Q5P A;  5AW6 B;  1OW6 A;  3O6Q B;  1BE3 G;  4H13 D;  1FZB A;  2KSE A;  3BCC G;  3ABV C;  1RQU A;  3E1I A;  2KP8 A;  2CXB A;  3V2R A;  1YIJ P;  4WQA A;  1AA0 A;  1YQ3 C;  1CHJ A;  1IFP A;  1SFC D;  2RMZ A;  4GYD A;  3CXH D;  1NTK G;  3O6Q A;  2JKV A;  3BAT A;  3SWF A;  2KUB A;  2E5T A;  3KQG A;  1CRG A;  1TU3 F;  1HBW A;  1QL4 A;  3WU2 E;  1YIC A;  2MHM A;  2XZR A;  4EOT A;  1EQ7 A;  3HE5 B;  1AOQ A;  3QWO C;  1Z56 A;  1JY2 N;  1HCM A;  1I8P A;  2K3R A;  1GW3 A;  5TIS E;  2KIK A;  2PGD A;  3ZBM A;  1PPJ D;  1H31 B;  1VQ9 P;  5CJ4 A;  1ZV8 A;  3D0W A;  1GU5 A;  1I6D A;  4IL6 E;  1DD4 A;  1H8A A;  3KDP B;  4GED B;  1KX7 A;  3HE5 A;  4H0K A;  4R4L A;  3L71 E;  1E2R A;  1NTZ G;  3T97 A;  3MUD A;  1CW5 A;  1RAQ A;  1G2C B;  3VP8 A;  1AV1 A;  3FGA D;  4TLF A;  1H31 A;  1S5L E;  2HYN A;  3SLE A;  2HV4 A;  3A0H E;  2RH0 A;  4R4M A;  1FJP A;  2PCC B;  1NTM K;  3NXS A;  2GB8 B;  3AE7 C;  1G2C A;  3G6E P;  1SQX J;  2N3B A;  2O1K A;  2FFD C;  2OTJ P;  3IAO A;  2A06 G;  4H44 B;  3MHV A;  1VF5 C;  1IFI A;  5H2F V;  1OZH A;  3WU2 H;  5AVQ B;  2L91 A;  1OVV A;  1YIT P;  2D2C C;  2CPS A;  1JB0 J;  3CXH W;  1R5L A;  4YXW H;  3AE3 C;  2V4H A;  2JQR A;  5C39 A;  5TIS H;  1BDD A;  1L0L J;  2B88 A;  1OWA A;  3IF4 A;  1OW8 A;  1NAY A;  5B66 V;  1YTZ I;  4IFF A;  3JBT B;  1NHL A;  4IL6 H;  2FYU J;  3L74 E;  3ITK A;  1G1J A;  1Y47 A;  3OCD B;  3TGU E;  2V7Q H;  4PV1 B;  1RH5 B;  1VQ5 P;  4AX3 A;  4K35 A;  1FU1 A;  1AOF A;  1YCC A;  4HJG H;  5KLV E;  2IBZ I;  3HUS C;  4L75 A;  2C9N Y;  1MZ4 A;  4I2L C;  1T2K C;  3PP5 A;  1LT9 B;  3A0H H;  5AW7 B;  3L72 E;  3OCD A;  1SQB K;  2XNX A;  1CRJ A;  2N9J A;  3CC2 P;  2OYO A;  3PTZ A;  2A45 H;  2H8P D;  3M9Q A;  1I55 A;  1JO5 A;  1FZC B;  1HJ5 A;  3PLN A;  4A7P A;  3C1L A;  3RK3 D;  2KZI A;  3S4R A;  2DGE A;  5L8R J;  1HRO A;  2BCN B;  1YQ4 C;  2LKM A;  2JWA A;  3BCC E;  1YYC A;  1AQ5 A;  1FDM A;  1LTJ B;  4WBA A;  1FZC A;  2ZON G;  3CMA P;  5GTH V;  1P84 E;  3A0B E;  1DII C;  2WSE J;  1SQX D;  3PRJ A;  1VQO P;  1NTK E;  1RHZ B;  3VYM A;  3C9I A;  1OMI A;  1HUC A;  3AE1 C;  3CC7 P;  3CCV P;  1LTJ A;  1OIP A;  3HQ8 A;  1SS1 A;  3CXH E;  2NZ2 A;  3SWS A;  1H33 B;  1MUU A;  4AAM A;  1LGH B;  4I6M C;  1YBK A;  4DCK A;  3G4S P;  1H89 A;  4DY9 A;  2IBZ G;  4U7J A;  4C7N B;  1L0L D;  1RE3 C;  3CX5 E;  1NMI A;  3LIE A;  3WFD C;  1H33 A;  2FYU D;  1VYD A;  1NVO A;  4YPC A;  1S9K D;  2ZFC A;  3HRN A;  1PL5 A;  1L0L G;  1M1K Q;  1M56 D;  1ZRT E;  3A9F A;  1NTZ E;  1OVU A;  4C7N A;  2FYU G;  4OGQ C;  4D6T J;  1IO4 A;  3M91 A;  1CYC A;  1C6O A;  2RKL A;  3DR0 A;  1KIL C;  4XE5 B;  2AXC A;  2ZAE B;  2D2C D;  1K8A Q;  1JMM A;  3WUU A;  1IJD B;  1P84 H;  3A0B H;  3MIW A;  2E76 C;  1NTM J;  2P2U A;  2M3B A;  3S9O A;  2LXC B;  1HRC A;  1HJ4 A;  2DW3 A;  1HH7 A;  3B4S A;  2N9I A;  2XTS B;  1LTA C;  1HGZ A;  2A06 E;  3PH0 A;  2YO2 A;  3L37 A;  2QVA A;  3WFC C;  4MU8 A;  5APY A;  5DJQ C;  3CXH H;  4GIF A;  2YKO A;  1AVO A;  2FYZ A;  5KJ7 D;  2O1J A;  3DP5 A;  2E43 A;  3FWL A;  1EXJ A;  4OWF A;  3H1J D;  5EFW B;  1IRV A;  4EID A;  4JPZ B;  5CCG A;  2QJP C;  4PW9 B;  3H1I J;  1T2K D;  4M3L A;  2CA4 B;  1LWU B;  3L36 A;  4FA4 A;  1URQ D;  1AFO A;  3CX5 H;  3PJS K;  5AW5 B;  2W27 A;  1J1D B;  1LP1 B;  4RES B;  1ZW0 A;  3D6Z A;  2I8F A;  2FXM A;  5KAF E;  1AVY A;  4K3I A;  1LWU A;  4Y28 J;  1UIX A;  3AEB C;  1VQP P;  3JC2 2;  2E74 D;  4GOF A;  4Z1M H;  1L9J C;  1LP1 A;  3MZW B;  1I5T A;  1GDV A;  3G71 P;  1S5L V;  3A0H V;  1SQB J;  1Q90 D;  1H0T B;  1RQV A;  1LFM A;  1N86 A;  3N4X A;  2D0S A;  3B71 A;  3H32 B;  1M90 Q;  4D6T D;  3PXW A;  5APV A;  1MG3 D;  2Q5U A;  2N1T B;  4JCG A;  1H0T A;  1IFJ A;  2PP6 A;  2Y0D A;  5AVU B;  1OW7 A;  1X8Y A;  1E79 H;  4L73 A;  5DF5 A;  3RK3 E;  2KS1 B;  5AW0 B;  2N18 B;  4L1Q A;  1R5S A;  2GUV A;  2HFE D;  3H1H G;  3KYQ A;  1NTM D;  3H32 A;  1J1E B;  1FOS E;  1CTJ A;  2FBW C;  5CIF B;  1LJ2 A;  3EFG A;  2QM8 A;  2CE1 A;  1C2R A;  5CIE B;  2KS1 A;  1NTM G;  1RAP A;  1NNO A;  2P1J A;  1EDK A;  3MTU E;  1M1J B;  3CC4 P;  1ZR2 A;  2WPR A;  1PP9 G;  5KAF H;  3VRD A;  2PAC A;  1OCD A;  1DW0 A;  1FDI A;  3EQ2 A;  4OGQ D;  5BU8 B;  3I55 P;  2B10 B;  3NTN A;  3H1I D;  2IBZ E;  1KIL D;  1S3J A;  1EXI A;  4JF7 A;  1M1J A;  2R32 A;  1KB9 I;  3MUD C;  4B86 A;  3WC8 A;  4O1Q A;  2E76 D; 
#chains in the Genus database with same CATH homology
 4P4Q B;  3WU2 V;  3X39 A;  1CHI A;  1WVE C;  3H1K D;  1CRG A;  1QL4 A;  1YIC A;  2MHM A;  3CP5 A;  3ZCF A;  2BLF B;  5TIS V;  3PH2 B;  1GU2 A;  1AOQ A;  1HCM A;  1I8P A;  3C2C A;  1CIG A;  1OAE A;  1C52 A;  2B11 B;  3TF5 A;  3ZBM A;  1R0Q A;  1PPJ D;  1SQQ D;  4IL6 V;  1H31 B;  3MK7 B;  1I6D A;  1SQB D;  2ZZS 1;  4GED B;  1KX7 A;  2Y0C A;  4H0K A;  1U74 B;  1E2R A;  3L4M A;  1YEB A;  1A56 A;  1LMS A;  1RAQ A;  4AAN A;  4WQE A;  1K3H A;  3HQ9 A;  1H31 A;  4J20 A;  2RN0 A;  1ZZH A;  4N0K A;  1S6V B;  1KYO W;  1W2L A;  3SLE A;  2HV4 A;  2BGV X;  2V08 A;  1DW2 A;  2DVH A;  3NBS A;  2OZ1 B;  2PCC B;  451C A;  1KB0 A;  1FCD C;  1CO6 A;  3RN1 A;  2GB8 B;  2IBZ D;  1CRC A;  1KB9 D;  2N3B A;  2LIT A;  1YIQ A;  3O1Y A;  2OZ1 A;  1C2N A;  2GIW A;  5KAI V;  3KZI V;  1KYO D;  3HQ6 A;  5H2F V;  1QL3 A;  4AAL A;  5CID B;  2L91 A;  1CYJ A;  2PCB B;  3CXH W;  1I8O A;  2JQR A;  1CTY A;  5CIB B;  2Y0E A;  2YK3 A;  2MTA C;  1CXC A;  4AAO A;  4FAV A;  3ORV A;  4FA5 A;  1EB7 A;  4NFG B;  5AUR A;  5B5E V;  5B66 V;  4LJI A;  3JBT B;  3ITK A;  4EIE A;  3CU4 A;  3OCD B;  5E79 V;  3NBT A;  2JTI B;  3L71 D;  2C9X B;  1CCR A;  1KV9 A;  4WQ8 A;  4AX3 A;  1N9C A;  1CRI A;  1AOF A;  1YCC A;  1IRW A;  1QYZ A;  2D0W A;  1MZ4 A;  1CSW A;  1FI3 A;  3O20 A;  4L3H A;  3ZOO A;  1I6E A;  3OCD A;  3H1L D;  1SQP D;  1YEA A;  1CRY A;  2LIR A;  1CRJ A;  2N9J A;  1QKS A;  1N15 A;  1LC2 A;  3PTZ A;  1N50 A;  3WFE C;  5EXQ A;  1I55 A;  2AXT V;  2BPB B;  1HJ5 A;  3PLN A;  4A7P A;  5IY5 1;  1SQV D;  1AYG A;  1HZU A;  4WQB A;  2DGE A;  1HRO A;  3RMZ A;  3L70 D;  2BCN B;  4EIC A;  1HZV A;  2JWA A;  4O1W A;  5B6Q A;  1CTZ A;  3L73 D;  4UB8 V;  3A0B V;  4L3G A;  4WQD A;  5KLI B;  2ZON G;  1J3S A;  5GTH V;  2GC7 D;  3M97 X;  2CA3 B;  1DII C;  1SQX D;  3PRJ A;  3ZOY A;  4FAN A;  2BH4 X;  1CCH A;  3VYM A;  1LS9 A;  3HQ7 A;  3L74 D;  1KIB A;  2ZXY A;  5CIH B;  1M60 A;  3DMI A;  3HQ8 A;  1CRH A;  3SWS A;  1H33 B;  3NWV A;  2C8S A;  4AAM A;  3O0R C;  2QG4 A;  1H9X A;  4RSZ A;  4DY9 A;  4XYD B;  2KNC B;  3L4O A;  1F1C A;  1L0L D;  1CSV A;  3OA8 B;  1NMI A;  1N90 A;  3WFD C;  1H33 A;  3H1H D;  2FYU D;  1IO3 A;  3CWB D;  1VYD A;  2V07 A;  1JDL A;  5C9M A;  3A9F A;  4PJ0 V;  2AIU A;  1H32 B;  3TDK A;  1L9B C;  2YQB A;  1IZL 0;  1NML A;  3OA8 A;  1BE3 D;  1EZV D;  1CYC A;  2N9Y B;  1PP9 D;  1C6O A;  3BCC D;  3DR0 A;  4U3F D;  1E29 A;  3PHL A;  5CYT R;  2FRC A;  1DVH A;  1FJ0 A;  3WUI A;  1C6R A;  3SJL A;  3VNW A;  3PXS A;  1P84 D;  1B7V A;  1I54 A;  1C6S A;  1AKK A;  4FA9 A;  1H32 A;  1E8E A;  3CYT I;  4PWA A;  1QN2 A;  4FA1 A;  1CIE A;  1FI9 A;  4QAO A;  1YFC A;  1HRC A;  1NTK D;  3L75 D;  2B4Z A;  2C1D B;  1ETP A;  1HJ4 A;  2O3J A;  1HH7 A;  2L4D A;  2N9I A;  2XTS B;  2B12 B;  5KKZ B;  1CED A;  2QJK B;  3WFC C;  4WQ9 A;  4MU8 A;  1CC5 A;  2VHD A;  5DJQ C;  2C1V A;  1DIQ C;  3WFB C;  1C7M A;  2B0Z B;  3DP5 A;  4EDF A;  3FWL A;  2CE0 A;  5TJH A;  3ZOX A;  2C1D A;  1H9Y A;  3H1J D;  1IRV A;  4EID A;  1CIH A;  4PW9 B;  1A8C A;  2GC4 D;  1CYI A;  2CA4 B;  4H0J A;  4FA4 A;  1FHB A;  1CIF A;  3CX5 D;  1GKS A;  2EXV A;  351C A;  5DJQ B;  4UB6 V;  1BCC D;  5CIC B;  155C A;  5KAF V;  1RZ6 A;  2BH5 X;  1BL9 A;  2I8F A;  1ZRT D;  3GW6 A;  1NTZ D;  1RZ5 A;  5CIG B;  2ZOO A;  2QJP B;  4K3I A;  1DT1 A;  4XXL A;  1WEJ F;  1FI7 A;  1NIR A;  2YCC A;  3ZOW A;  4RJT A;  1YNR A;  2ORL A;  3TGU D;  1L9J C;  5C0Z A;  1CSU A;  4V2K A;  1M70 A;  1I5T A;  1GDV A;  1S5L V;  1CHH A;  3VMA A;  2Q3E A;  1K3G A;  3A0H V;  1NU1 D;  5KLV D;  1DW1 A;  2C1U A;  3RLM A;  2FWL A;  1LFM A;  1W5C T;  2N18 C;  2ZBO A;  1LC1 A;  3PXT A;  1COR A;  1GIW A;  1MG2 D;  3L72 D;  2D0S A;  2FYN B;  3GG2 A;  1F1F A;  2A06 D;  1CXA A;  1FOC A;  3KHU A;  1BGY D;  1CNO A;  4D6T D;  3PXW A;  4Y5R A;  1HJ3 A;  1MG3 D;  4JCG A;  4KMG A;  2BCC D;  2Y0D A;  4YE1 A;  1A2S A;  5DF5 A;  2AI5 A;  2N18 B;  4L1Q A;  4EIF A;  2K9J B;  3TYI A;  1H1O A;  2QJY B;  3O5C A;  1DW3 A;  1YTC A;  1KX2 A;  1NTM D;  3SXT A;  4WQC A;  4PD4 D;  5GTI V;  1U75 B;  1CTJ A;  1COT A;  5CIF B;  4Q5P A;  2CE1 A;  3RN0 A;  1C2R A;  5CIE B;  1C75 A;  2KS1 A;  1RAP A;  4FB1 A;  2N3Y A;  2C2C A;  1NNO A;  1M6Z A;  3VRD A;  5DFS A;  1IQC A;  2PAC A;  3SVW A;  2YIU B;  1OCD A;  1DW0 A;  1GJQ A;  3CX5 W;  2CXB A;  1DVV A;  4WQA A;  2B10 B;  1CHJ A;  3ZIY A;  3H1I D;  2RMZ A;  1L0N D;  4GYD A;  1GQ1 A;  4WQ7 A;  3CXH D;  3WC8 A;  4O1Q A;  1CSX A;  3MK7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...