1PPJD

Bovine cytochrome bc1 complex with stigmatellin and antimycin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 73
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ppjD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ppjD01
4WQ8A 1NNOA 2LITA 2N18B 1DW3A 1S5LV 3DP5A 1K3HA 1YIQA 2V07A 4FA1A 1FI3A 3NBTA 1NIRA 2QG4A 2BCNB 5CYTR 1C52A 1NMIA 1NTZD 2CA3B 4H0JA 1NU1D 3WFDC 3ORVA 3CWBD 1CYIA 3SWSA 2GIWA 1RZ6A 4RSZA 1U74B 1CRIA 3GG2A 2IBZD 1FHBA 3RLMA 1QYZA 1C2NA 3PH2B 3VMAA 3DMIA 4WQ9A 1B7VA 1I8OA 3L71D 4EDFA 5H2FV 1E29A 1LC1A 1F1FA 4QAOA 4K3IA 1CRCA 2CE0A 2ZBOA 1MG2D 1CSWA 2A06D 3L72D 2FWLA 3H1KD 3TDKA 3PXWA 1MZ4A 1CRJA 4H0KA 3GW6A 3BCCD 1W5CT 3SLEA 4WQ7A 2D0SA 3WUIA 3ZCFA 2CE1A 2BPBB 2N18C 1M6ZA 1DT1A 3H1ID 3PHLA 1PPJD 3H1LD 1CIGA 1DIIC 5B66V 1EZVD 4AAMA 2C1DB 3WC8A 1COTA 2HV4A 1CSVA 1CYJA 2N9IA 1BE3D 3KZIV 3FWLA 1YFCA 1N50A 1LS9A 3HQ8A 5CIDB 3TYIA 1DIQC 3PXTA 3L74D 1CORA 1RAPA 1WVEC 1QL3A 1HZUA 5CIFB 5GTIV 1EB7A 4FA4A 2VHDA 2ZOOA 1DVHA 2XTSB 2N3BA 1A56A 2FYNB 2ORLA 1W2LA 2AXTV 4PWAA 1N90A 1H32B 4Q5PA 5DJQC 4YE1A 2MTAC 3CX5D 1QKSA 2Q3EA 2C1VA 3CP5A 1BL9A 1CTYA 2FYUD 3VRDA 3SJLA 4KMGA 2K9JB 4O1WA 3NBSA 4J20A 1AOQA 3PLNA 1GKSA 4FB1A 1BGYD 1CSXA 1DW2A 2GC4D 1CIEA 1NTKD 1YTCA 3ZBMA 2CXBA 4EIDA 3NWVA 1P84D 3OA8B 2OZ1B 4Y5RA 1N9CA 3HQ6A 4V2KA 1HZVA 1BCCD 4WQDA 1VYDA 1QN2A 2N9YB 1RZ5A 5DF5A 1MG3D 5TISV 1A2SA 3TF5A 1C75A 4N0KA 5AURA 1GJQA 5CIBB 1KYOD 3ZOYA 1AOFA 1DVVA 2MHMA 1CTJA 1GIWA 2GC7D 1L0ND 1RAQA 3SVWA 4FAVA 1H31A 2ZZS1 4DY9A 2D0WA 1YNRA 1DW1A 4L1QA 3M97X 1CNOA 5GTHV 4JCGA 1C2RA 3KHUA 1HCMA 3H1JD 1E2RA 1A8CA 5DJQB 1IRVA 5KAFV 2DGEA 5C0ZA 5IY51 1J3SA 1CCHA 1GU2A 2C8SA 1NTMD 2BH5X 4LJIA 2L4DA 4PD4D 4AX3A 1IRWA 3L73D 1KB9D 3OA8A 2B12B 4EIFA 2OZ1A 4RJTA 2QJPB 2BLFB 2O3JA 1CO6A 2C1UA 2B10B 2B4ZA 1FCDC 1M70A 4AALA 3OCDB 3L4OA 3O1YA 1CRGA 2YCCA 3VYMA 5CIHB 4XYDB 3SXTA 2KNCB 3C2CA 4UB6V 1SQPD 5KAIV 3CXHW 2QJYB 3ZIYA 1U75B 5CIEB 1AYGA 1L9JC 3A0HV 1YCCA 1SQQD 3O5CA 1CHIA 3HQ9A 2Y0DA 1CIHA 1CXAA 4O1QA 4EIEA 3JBTB 3WFEC 2L91A 3L4MA 5KKZB 4IL6V 1ETPA 1ZZHA 2C9XB 3O20A 3CYTI 1CHJA 1H9XA 1H33B 1OCDA 1LC2A 1NMLA 2BGVX 3WFCC 4D6TD 1YEAA 2CA4B 3MK7B 3L70D 2KS1A 1YICA 1R0QA 1KIBA 1N15A 1PP9D 3VNWA 3A0BV 3O0RC 1CEDA 1IQCA 2RMZA 1C7MA 5DFSA 4WQAA 2C1DA 1FJ0A 3RN0A 1CHHA 5B6QA 1YEBA 2LIRA 1QL4A 1SQVD 1KB0A 4XXLA 1H1OA 4EICA 3PRJA 4WQCA 1HJ3A 2JQRA 1CSUA 1KV9A 1LMSA 1IZL0 4L3GA 1AKKA 1H33A 3ZOWA 3TGUD 4PJ0V 2DVHA 1H32A 4U3FD 3DR0A 1C6RA 4GYDA 2Y0EA 5KLVD 3ZOXA 4FA9A 1CRHA 2RN0A 1DW0A 2BH4X 3MK7C 5C9MA 3ZOOA 1HH7A 1FI7A 1KX7A 1GQ1A 1GDVA 1CRYA 1CXCA 155CA 1I6EA 1M60A 3ITKA 5B5EV 4FA5A 1WEJF 1K3GA 4UB8V 3WFBC 2Y0CA 4L3HA 2B11B 4WQEA 3L75D 4NFGB 1C6SA 1ZRTD 1HJ4A 1E8EA 5TJHA 2N3YA 3CX5W 3PTZA 2YIUB 2QJKB 1I54A 2JTIB 1CC5A 2C2CA 5KLIB 1FOCA 2N9JA 3H1HD 2ZONG 1FI9A 4P4QB 1CYCA 451CA 1SQBD 1KX2A 1CTZA 2EXVA 1F1CA 1HJ5A 1I55A 2I8FA 2AI5A 2B0ZB 4AANA 2YQBA 4A7PA 1I6DA 1SQXD 2PCCB 4AAOA 3HQ7A 5CICB 1HRCA 1CCRA 1L0LD 1L9BC 1I8PA 351CA 2PACA 3A9FA 2YK3A 5CIGB 3X39A 1IO3A 2BCCD 1JDLA 2V08A 1C6OA 3WU2V 1KYOW 1H31B 1H9YA 5E79V 1HROA 2GB8B 5EXQA 3RN1A 1LFMA 3PXSA 2PCBB 3OCDA 4FANA 3CXHD 2AIUA 4GEDB 3CU4A 2FRCA 1S6VB 1I5TA 2JWAA 3RMZA 4MU8A 1OAEA 4PW9B 1CIFA 4WQBA 2ZXYA
chains in the Genus database with same CATH superfamily
2LITA 2M8RA 2M0BA 5KLIC 2N1TA 3B5ND 4Y28J 1OWAA 1NWQA 1MFZA 1RE3A 2NPSC 4JYCA 2BCNB 1BSNA 1C52A 1R8EA 2A45G 1Q2NA 4AYCA 3BATA 1NTZJ 3CWBD 1CYIA 2JEEA 3S4RA 3M0DA 3RBZA 1U74B 1CW5A 3GG2A 1FHBA 1S4XA 1USDA 3AEFC 3P7KA 1RQUA 2C9LY 3H1HG 4DOJA 4N6JA 4N78E 1F1FA 3A2AA 1PPJE 2ZBOA 2A06D 1M57D 1LTJA 3H1KD 3PXWA 4R4LA 4H0KA 3RK3D 3GW6A 1NGMB 2KXPB 1AQTA 3JC22 1NAYA 4WQ7A 3NTNA 1YITP 3U1AA 3HE4A 3RBXA 2P67A 2ZYDA 2N18C 2AEFA 1UIIA 2AXTH 3BASA 3CC4P 1NKZB 1S1CX 5CCGA 2C1DB 1CSVA 1PGQA 2W90A 4O9BA 1FDOA 1QGKB 2Q7CA 3PXTA 3L74D 1WVEC 1QL3A 1HZUA 1X79B 2POHA 2ZVOB 1EB7A 4FA4A 1NTKK 2K3RA 3RL0C 1D7MA 1DVHA 1A56A 2FYNB 2D2CB 5TISH 2AXTV 3G6EP 1WT6A 3V2NA 4YPCA 1IFDA 1KFNA 2K88A 5KJ7D 1BL9A 2FYUD 3VRDA 1VQ5P 2K9JB 4O1WA 1AOQA 3RL0g 3D6YA 4OGQB 2BEQD 5KLVG 3M9HA 1M1JC 2C0WA 1N2DC 4PJ0H 2H8PD 2CXBA 3AECC 3Q5RA 1BGYJ 1L0NE 2WITA 2XNXA 2R5DA 5KAFH 1N9CA 3HQ6A 2Z4EA 2QE7H 3W67A 4U3FE 2QM7A 5TISV 3LW5H 1N7LA 4N0KA 5AURA 2J59M 3CLQA 1DVVA 1CTJA 1AFOA 1KILD 1ZW0A 1MUUA 2Y9YA 1ZOYC 1ZR4A 2YKOA 2WTYA 1YNRA 2HPCA 1L0NJ 3CXHH 1GK6A 1JMBA 1SQBG 2O1KA 3TNUB 5KAIH 3CCJP 1Q82Q 5AW3B 1FZCA 5KAFV 1G2CB 3K5BA 1J3SA 1CCHA 4W7ZA 1NTMD 2WSFH 1CI6B 4LJIA 3L73D 1DEBA 1KQFB 2ZJSE 2OZ1A 3OJAB 4IL6H 1SQQK 2BLFB 3VMYA 2KK7A 1AA0A 2B10B 2Z5IA 2B4ZA 1FCDC 1M70A 2ZXXA 1A02F 3L4OA 3SSUA 1CRGA 1J1DB 3VYMA 3AE4C 2V4HA 3A0BH 5KAIV 3ZIYA 1U75B 1N86A 2HODA 1AYGA 4D6TE 1H0TB 2ZT9B 1BGYG 1VQNP 1SQPJ 3O8ZA 1FU1A 2WPSA 2BCCE 2N1TB 1QVFO 3JBTB 2L91A 1FZEA 3AE7C 1T3UA 4IL6V 3IFMA 1H9XA 3WFCC 2E43A 3HE5A 1ZR2A 5C39A 3L70D 1X0TA 3CWBG 1U57A 4OH8B 1YICA 3B5NC 1R0QA 2H89C 4D6TJ 1E79H 3A0BV 1CEDA 3NXSA 2QJPC 4GODA 2E76C 1LGHB 1C7MA 2OYIC 1Q86Q 1LTJB 2AXTE 1N73A 1YEBA 3B71A 3H1KG 1SQVD 3CCQP 1KB0A 3RK2C 2JQRA 3P8MC 1R5LA 4Z1MH 3M91A 1Q81Q 2GUSA 3L71E 4UB8H 1IZL0 1N8RQ 2WPVB 1AKKA 2DVHA 1JY2O 1VQOP 2NPSD 3SFEC 3MZWB 3D0WA 3HTKA 3LIDA 3BRVB 3MK7C 1SQPG 3L75E 5AVXB 2P10A 1CRYA 5AW4B 3H1LE 1M60A 2DW3A 4PJ0E 2C9NY 5BU8B 1K3GA 4UB8V 1EZVE 3WFBC 1EDLA 1HTLC 2Y0CA 1FAVA 1LTSC 4WQEA 1Y9BA 2FYUG 5APVA 1VQKP 3L75J 3TSIA 1CC5A 1JEKA 2XU6A 2N9JA 2JR8A 3H1HD 1FI9A 3G3ZA 2Y9ZA 451CA 1NKNA 5AVWB 3L35A 4L74A 2QA4P 1CTZA 1FDMA 2AI5A 2YQBA 1I6DA 1SQXD 4RESB 3HQ7A 5CICB 1CCRA 1I8PA 1GL2A 3V2PA 5KAIE 2IX7C 3A9FA 2YK3A 2R32A 2N9BA 1C6OA 1YJ9P 1KYOW 2R5BA 1NTKE 3VP9A 3LW5J 2HPCB 3VYIA 1VQPP 2P1JA 1YQ3C 1AVYA 3OCDA 3CL3D 3CU4A 4YTPC 3RL0D 1FZCB 2FRCA 2ZYAA 2J58A 2SPZA 2JWAA 4MU8A 1OAEA 4PW9B 1KILC 1NO4A 3AE1C 1CIFA 5GTHH 1OW7A 3FX0A 1URQA 2W8ZA 2ZXYA 1SS1A 3CCLP 1NNOA 1MV8A 1YHQP 1AVOA 1SQVJ 5APXA 2V07A 3A0BE 3L73G 1PFIA 1OW8A 1NTZD 4NPEA 2CA3B 1S2EA 2WSFJ 1HJBA 1VDFA 3ORVA 2FKWB 4IL6X 3E1IA 4K3AA 2HODB 3DMIA 1JY3O 4NPFX 3VN0A 1IK7A 1JM0A 3GLMA 2HR3A 1E29A 4K3IA 2KIKA 2O01N 2OTJP 4GKGA 3TDKA 2NRGA 1L2PA 1MZ4A 1CRJA 3Q5PA 4RO0A 3HE5B 1W5CT 4WBAA 3WUIA 2BPBB 3BCCJ 1M6ZA 1PL5A 3HUSC 1L0LK 2H7HA 1SQQE 1PPJD 2E75B 2FFDA 3H1IJ 3CX5I 4AAMA 1VQ7P 3WC8A 1FDIA 3KYQA 1N73B 4UB8E 1LS9A 4XE5B 2YO2A 3HQ8A 2M3EA 4XA4A 4DT0A 1KTMA 1OFCX 3TYIA 1SQVG 2FYUK 1DIQC 4C46A 1RAPA 1P84I 1SQXJ 5CIFB 2E74B 2O01H 1HH0A 4I1LA 2XZRA 1HF9A 5CMZA 2N3BA 3AEDC 1SFCA 4PWAA 2MTAC 3CX5D 3HD7B 1FOSF 3HTKB 2C1VA 1BCCE 3SJLA 1VQ4P 1VF5B 1NU1K 4H44B 4FB1A 1BGYD 3H6PA 1JY3P 4KT0J 1CSXA 1DW2A 2P2UA 2K9YA 1YTCA 3ZBMA 2ITAA 2NPSA 1K73Q 1P84D 2ZFCA 1AV1A 3AEAC 1ZMEC 1S3JA 2CK3H 3AE5C 4V2KA 3I55P 1HZVA 1CSBA 2KZJA 1J1DC 3L36A 4XFJA 1YTZI 2E76D 3M0AA 1BCCJ 3H1JE 1A2SA 3TF5A 1C75A 3G9RA 4PD4I 1GJQA 3BCCG 2ZT9C 1RF0C 1FJKA 1L0ND 4FAVA 4GOFA 3E7KA 1NTMK 1OIPA 1RE3C 3H1IG 3RK2D 2J5UA 4IFFA 1UIXA 4L1QA 3CI9A 1CNOA 4JCGA 2I1JA 1ZV8A 4C7RA 3CCSP 1PV3A 1LT9C 5BU5A 4EI2A 2YKPA 3IAOA 4DJGA 2KUBA 3A0HH 4H0LB 4MN4C 1GD2E 1JOCA 5C0ZA 3H1JJ 3V6IA 4NPDA 5IY51 3KXDA 1GU2A 1SQXG 4ASVA 1GL2B 2BH5X 4PD4D 1H8AA 4AX3A 1IRWA 3OA8A 3D6ZA 4EIFA 1QL1A 1YIJP 1VPCA 1JNMA 2KZIA 5AW6B 3CC2P 5GTHE 4AALA 3OCDB 5CIHB 1M56D 4ZKUA 3WU2H 3HD7D 1SQPD 5E79H 2IZ1A 1HJ0A 1KC8Q 4BXLA 3A0HV 1URQB 2CPBA 1CIHA 3Q3DA 1PP9E 3O6QA 4YXWH 3NFQA 4O1QA 4EIEA 4H13B 5CCGC 1NTZG 1CHJA 5AW5B 1LC2A 5AW8B 4PV1B 4Y99B 1G1IA 4D6TD 2CA4B 4UB6E 2WZ7A 1MFTA 4EOTA 1LWUB 3F5HA 1KIBA 1N15A 3FWNA 3OAKA 3GHGB 3CC7P 1M1KQ 2NZ2A 3VP8A 4RKUJ 1IQCA 2RMZA 1LT1A 1Z56A 2WSEH 4WY4B 2PGDA 1FJ0A 1K8AQ 4LC1A 2H88C 2KNCA 2WSSH 3TGUE 1RF1C 1QL4A 5AVTB 3CWBE 1FS0E 2CPSA 3PRJA 1K04A 1CSUA 1LMSA 1NAFA 2KLVA 1VQ9P 1PPJG 1L4AB 1H33A 3ZOWA 4PJ0V 5KKZC 1EDKA 1H32A 1KMIZ 2A06E 3WMM0 5AVVB 4WWIA 4FA9A 4U3FJ 3MP7B 3RK3E 4LGDE 5B66H 4B86A 5AW2B 3WUUA 4ZNCA 1NVOA 1N7SA 1RHZB 1SFCB 1IC2A 5CHXA 1FZCC 2ZXEB 1KYOH 2B11B 2D2CD 3L75D 1C6SA 3JCUH 1ZRTD 3P8CE 3VOPA 5GTIH 3QWOC 2BASA 1IFIA 1L0LE 5KLIB 3L74E 4OGQD 1FOCA 3USSA 2WT7A 1W5CE 3H32A 1GW4A 1WRGA 3CXHI 2ZVNB 1QL2A 3WUTA 2Q3IA 1I55A 4AANA 4A7PA 4GT1A 4AAOA 1WMKA 4ASWA 1KB9H 3B5NA 1BSHA 3ZDMA 2PACA 2A45H 3QH9A 3A0HE 1GW3A 5BVZA 1L0NG 1HROA 2BCCJ 3RN1A 3M9QA 4JQ0D 5AVYB 1DIPA 3CXHD 4U3FG 3AE9C 2YXRB 3S9OA 1I5TA 1NU1E 1U7MA 3RMZA 3BVHA 1DH3A 2IBZE 5KLVK 4HB1A 2M3BA 3EFGA 2N18B 1DW3A 3HE4B 2Q1KA 4FA1A 2E75C 3WU2E 3Q1MA 1FI3A 3NBTA 1NIRA 1Y47A 2QG4A 5E79E 4K35A 1GU5A 1M8OB 1SVFA 1NYHA 4JF7A 3GF7A 2JP3A 3WFDC 2B88A 2WVRA 1N73C 2JKVA 2GIWA 3L72E 4RSZA 1CRIA 1E5WA 1QYZA 1JB0J 1NU1J 2OYOA 1T8ZA 3PH2B 1OXZA 3VMAA 2HLOA 1AJYA 2O1JA 1YJWP 3TK1A 1B7VA 1NTME 1S5LE 1Q7YQ 3L73E 4HKZH 2OYHA 2ZT9D 1FC2C 1OVUA 3O6QB 1XTGB 4QAOA 3L37A 3M9BA 1CRCA 2CE0A 3L71J 2N1TD 2M5AA 2YKQA 2FWLA 1MKMA 3HD7C 1SQBK 1HWTC 1VF5C 3L72J 3BCCD 4H44C 1R5SA 3SLEA 1BE3E 4D6TG 2D0SA 2B87A 4BRYA 2H43A 4OVNF 3ABVC 2JWDA 1FZBA 3AE3C 3A5TA 1JUNA 2BCCG 3H1ID 3PHLA 5H2FE 1CIGA 1LTIC 5APSA 5KJ7A 2WSCH 3H1LJ 2YMYA 3S1KA 2HV4A 1CYJA 1YFCA 1N50A 1RE4C 2WSEJ 1BE3J 2XDJA 3G71P 3L70E 3CCUP 1CORA 1ZXGA 2W83C 1HBWA 4I2LC 3V2QA 2XTSB 5B66E 1W2LA 1FZGA 1H32B 2C0XA 4Q5PA 1FZAA 1FBMA 4YE1A 2ZAEB 2Q3EA 1AQ5A 3KZIE 5AVSB 1CTYA 3CCRP 5CCGD 1KILA 3PLNA 1OW6A 3CD6P 1GL2C 2GC4D 3SFDC 1KYOE 1S9KE 3JCUE 3L71G 2V7QH 5GTIE 2OZ1B 3WUVA 2RKLA 1NTKJ 1CZQA 1BCCD 4WQDA 1QN2A 1N7SB 2JJLA 2N9YB 1YTZT 1EC5A 2I1KA 1JCCA 5DF5A 1IO4A 2E5YA 2PP6A 3L75G 3V4WA 3ZOYA 1AOFA 2MHMA 1GIWA 1URQC 2Q5UA 3W68A 2IPPA 3SVWA 1J1EB 1H31A 2ZZS1 4DY9A 2D0WA 2WT7B 2OTKE 1KB9E 2VRSA 3H1LG 1M90Q 3H32B 4H13C 3M97X 5GTHV 1X22A 1C2RA 2FYNC 4UB6H 3SWFA 2D2CC 3H1JD 4JBZA 3CMAP 1LNQA 1TU3F 4Y99C 1A8CA 5DJQB 2K9JA 1IRVA 2DGEA 3P32A 1U7JA 1EXJA 3B5NB 1LWUC 4OGQC 4TT3H 3V2RA 3GHGC 3NMDA 1SQPK 2R3SA 3HUSA 3I56P 3PH0A 2B12B 3VMZA 5CCHC 1VQ6P 4N78D 2QJPB 3MGNA 3H1HE 2O3JA 4WY4C 1CO6A 2C1UA 5AW0B 3O1YA 1DEEG 4XYDB 2YO3A 4UB6V 1Y8AA 2LKMA 2ZYGA 2QJYB 5CIEB 1SP4A 1JMMA 2Q6QA 1PIXA 1YCCA 2WPQA 1NTKG 1CXAA 1L4AC 3TNUA 1SQQJ 3IR9A 1YJNP 2B9BA 5APWA 3E1RA 3MUDC 1ETPA 1ZZHA 2C9XB 3RK3B 4I7ZB 5CBNA 1OCDA 3R4YA 3MK7B 3G4SP 2KS1A 1VQ8P 1PP9D 3VNWA 3O0RC 1HVVA 3EQ2A 3Q2YA 2OYHB 1QX8A 1RH5B 4LLHA 1J2JB 2LXCB 2KOGA 5DFSA 1SFCC 2WMMA 2M5AB 3L4FA 5B6QA 3D71A 1LP1A 2KI7B 2LIRA 4R4MA 2OARA 1H88A 3VMXA 4WQCA 1HJ3A 5KLVE 1JY2N 1KQLA 2B87B 4BRYB 2KYVA 2WWWA 2N1TC 5B5EH 3U59A 3CCMP 3PP5A 1LT9A 4L3GA 5AVRB 3TGUD 2E75D 4U3FD 1W2EA 2HG5D 1OVRA 1YBKA 2Y0EA 3ZOXA 1CRHA 2RN0A 1DW0A 2BH4X 2IFMA 3M0DC 5C9MA 2WSCJ 1FI7A 5KLVJ 1JO5A 2R44A 1RY3A 1GTWA 2XNDH 2XV5A 1HUCA 1HGZA 1GQ1A 1GDVA 1SQQG 3AEBC 155CA 1JTHA 2KP8A 2P58A 1I6EA 2E74D 3ITKA 1IFNA 1SQBE 5B5EV 1KFMA 4FA5A 1T3JA 3AE2C 1LTJC 4L3HA 1H89A 4NFGB 1E8EA 4W80A 5TJHA 1ZP0C 1KILB 1LTAC 3CX5W 3PTZA 2YIUB 5AW9B 2QJKB 2JTIB 1VF5D 3IN6A 2C2CA 2QVAA 4H44D 1PGJA 4P4QB 4DCKA 1CYCA 3AE8C 1QVGO 5APTA 2EXVA 2GA1A 1F1CA 3SWKA 3P8CD 1HJ5A 2PAJA 1SQBJ 3MD0A 2I8FA 2W27A 1BCCG 1ZLLA 3N7NA 4QMAA 2V7QJ 3CX5E 2PCCB 1VQLP 1S5LH 1L0LD 1L9BC 2AEMA 1M1JA 3X39A 1BGYE 1SQVK 2BCCD 3T97A 1JDLA 5CBOA 3WU2V 1H31B 1H9YA 5E79V 2PFXA 1P84E 3AEGC 2KSJA 1PP9J 3TYYA 2GB8B 5EXQA 1KZUB 1LFMA 3PXSA 2PCBB 4GIFA 1M7LA 5AVUB 1RF1A 2IBZI 4AUWA 4HH2A 3H1JG 1BDCA 3EFFK 3HRNA 4H0LD 5H2FH 1SLQA 4WQBA 4BWNA 4WQ8A 1T2KD 3HUSB 1S5LV 3DP5A 1K3HA 1YIQA 1QEXA 3H25A 1GL2D 1NJIQ 2FBWC 2G3AA 5CYTR 1NMIA 2FXMA 2FYZA 2BEZF 1GMJA 4H0JA 2FFDB 3GMAA 1JY3N 1NU1D 1IZNB 4KJMA 3SWSA 3C1LA 1RZ6A 3R2PA 3U1CA 3H1KE 2IBZD 3TGUJ 3RLMA 1C2NA 1KN7A 3CWBJ 4WQ9A 1I8OA 3L71D 4PD4E 2QRXA 4EDFA 5H2FV 4YXDC 1EZVI 1URQD 1LC1A 3EWKA 3KZIH 1MG2D 1CSWA 3A3YB 3L72D 2IDBA 2RH0A 4EIJA 1RQVA 3B4SA 3FXEA 4H13D 3H1KJ 2O01J 3II6A 1SQPE 5EFWB 4PV1D 2KS1B 3ZCFA 2UWJE 1SQXK 2CE1A 1DT1A 1PP9G 2K37A 3H1LD 3UIAA 4I6MC 2NPSB 1DIIC 5B66V 1LTBC 4ZKPA 1EZVD 1X9VA 5CCHD 1N7SC 2W6JH 4IFMA 1FOSE 1COTA 1BDDA 2N9IA 1BE3D 4WY4D 3KZIV 3FWLA 5B5EE 1LP1B 2I8DA 1GZLA 3RGUA 5CIDB 2IFNA 1PGPA 2FYUE 2FY8A 1OZHA 1J1EC 1YI2P 5M1BA 1L0LJ 5GTIV 3L74J 2VHDA 2ZOOA 1OMIA 1LT9B 1EDIA 2ORLA 2OYIA 1N90A 1S72P 3KDPB 5DJQC 3TGUG 1L4AD 1QKSA 1NTZK 1K05A 1DD3A 3CCVP 3CP5A 1KYOI 1IK9A 1X8YA 4KMGA 3M06A 3NBSA 4J20A 1NHLA 2GM4A 1LTGC 1GKSA 3MHVA 2WPRA 4C7NA 2FYUJ 3N4XA 1CIEA 1NTKD 5APUA 3A7OA 2YNYA 3V5BA 4EIDA 3NWVA 3OA8B 4Y5RA 1KILE 1JTHB 1IFMA 2A06G 4JPZB 2MKVA 1VYDA 2HYNA 1RZ5A 1MG3D 5CJ0A 2AEJA 1SFCD 3PJSK 2QJYC 2L5GB 4HJGH 3MTUE 5K5GB 3JSVC 5CIBB 1KB9I 1KYOD 4JYBA 1S9KD 3IF4A 1USEA 2GC7D 1RAQA 2A45I 2W6BA 2E74C 1YYCA 1DW1A 3CCEP 3RK3C 3RL0B 4I7ZC 3KHUA 3HD7A 1HCMA 1E2RA 1GDTA 5TISE 1ZRTE 3C9IA 2C8SA 2E42A 4GOEA 2L4DA 1L0LG 1M1JB 1KB9D 3CMEP 3L74G 4AQRD 3T97B 4RJTA 2E5TA 2OYHC 3OW2O 1NTMJ 1HGVA 5AVQB 3L73J 1S5LX 2G8YA 1RF1B 2YCCA 4CPGA 3FGAD 3SXTA 3CPWO 2KNCB 3C2CA 5KAFE 1RE4A 3CXHW 1L9JC 4U7JA 1G1JA 3Q5SA 1SQQD 3O5CA 1CHIA 4KHXA 4WVZA 3HQ9A 2Y0DA 3LIEA 4M3LA 1FZFA 2QIWA 3WFEC 3L4MA 5KJ7C 5KKZB 4EYYQ 3O20A 3CYTI 4L75A 1H33B 2IYOA 1NMLA 2BGVX 3CXHE 1YEAA 4H0LC 1NU1G 1FE6A 2PRRA 2LXBA 1IJDB 1T2KC 1NOHA 1SQVE 2IBZG 3FXDA 3MIWA 2MJZA 1ZN5A 1IFJA 3L70J 3D70A 3OA7A 1OX3A 1JY2P 4W7YA 1QLED 3AE6C 1L0NK 4WQAA 2C1DA 3BRTB 3RN0A 4IL6E 1FJPA 1EQ7A 2FXPA 2XKMA 1CHHA 3L72G 2FXOA 4XXLA 1H1OA 4EICA 2YIUC 1EDJA 2QJKC 1DD4A 1NTMG 5AVZB 1KV9A 4ZMDA 4N3YB 3KPEA 3C8VA 1XTCC 3KQGA 3CX5H 2OQQA 2K1AA 2JDIH 2YMKA 4GDOA 3DR0A 1C6RA 4GYDA 1EZVG 1DX7A 2QSIA 1EXIA 3AEEC 4PV1C 5KLVD 2QM8A 1LWUA 1VL2A 3VTPC 1BE3G 3GHGA 3ZOOA 1KQSO 3BCCE 1HH7A 1P84H 3F89A 5AW1B 5CCHA 1KX7A 1KD1Q 5AW7B 5CJ4A 1CXCA 4WY4A 3H1IE 1W2BO 1GU4A 2B89A 1MZ9A 3SWYA 2KSEA 4HYTB 2E76B 3I5CA 2OYIB 1WEJF 1T6AA 5APYA 1A02J 1NH4A 4WB4A 1Q90D 1HJ4A 4IOIH 2JO1A 5L8RJ 2N3YA 5APQA 2P7JA 4L73A 2Z5HA 5KTBA 1KQGB 3L70G 1SQXE 3RK2B 1I54A 2W6AA 4C7NB 2GUVA 3V4QA 4DZOA 4L76A 2ZONG 2WQYC 1L4AA 1GK4A 1SQBD 1KX2A 3MUDA 1JCDA 2KB7P 5DJUB 3H1HJ 2FFDC 1YQ4C 4OWFA 1K9MQ 2IYPA 2B0ZB 2IZ0A 1OVVA 2OGUA 1KORA 1G2CA 1IFPA 4PD4H 3B8EB 1N7SD 1HRCA 2HFED 1KV4A 1PZQA 5DJTB 351CA 1CI6A 2QEXP 2OTLP 5CIGB 1IO3A 1LTTC 4TLFA 2V08A 2LR2A 3GF3A 2KLUA 2AXCA 4FANA 1LJ2A 1NTZE 2AIUA 2Q9IA 4GEDB 2R3CA 1PGOA 1S6VB 1H0TA 2YXQB 1RF0A 1VQMP 4IFDK
chains in the Genus database with same CATH topology
4WQ8A 1NNOA 2LITA 2N18B 1DW3A 1S5LV 3DP5A 1K3HA 1YIQA 2V07A 4FA1A 1FI3A 3NBTA 1NIRA 2QG4A 2BCNB 5CYTR 1C52A 1NMIA 1NTZD 2CA3B 4H0JA 1NU1D 3WFDC 3ORVA 3CWBD 1CYIA 3SWSA 2GIWA 1RZ6A 4RSZA 1U74B 1CRIA 3GG2A 2IBZD 1FHBA 3RLMA 1QYZA 1C2NA 3PH2B 3VMAA 3DMIA 4WQ9A 1B7VA 1I8OA 3L71D 4EDFA 5H2FV 1E29A 1LC1A 1F1FA 4QAOA 4K3IA 1CRCA 2CE0A 2ZBOA 1MG2D 1CSWA 2A06D 3L72D 2FWLA 3H1KD 3TDKA 3PXWA 1MZ4A 1CRJA 4H0KA 3GW6A 3BCCD 1W5CT 3SLEA 4WQ7A 2D0SA 3WUIA 3ZCFA 2CE1A 2BPBB 2N18C 1M6ZA 1DT1A 3H1ID 3PHLA 1PPJD 3H1LD 1CIGA 1DIIC 5B66V 1EZVD 4AAMA 2C1DB 3WC8A 1COTA 2HV4A 1CSVA 1CYJA 2N9IA 1BE3D 3KZIV 3FWLA 1YFCA 1N50A 1LS9A 3HQ8A 5CIDB 3TYIA 1DIQC 3PXTA 3L74D 1CORA 1RAPA 1WVEC 1QL3A 1HZUA 5CIFB 5GTIV 1EB7A 4FA4A 2VHDA 2ZOOA 1DVHA 2XTSB 2N3BA 1A56A 2FYNB 2ORLA 1W2LA 2AXTV 4PWAA 1N90A 1H32B 4Q5PA 5DJQC 4YE1A 2MTAC 3CX5D 1QKSA 2Q3EA 2C1VA 3CP5A 1BL9A 1CTYA 2FYUD 3VRDA 3SJLA 4KMGA 2K9JB 4O1WA 3NBSA 4J20A 1AOQA 3PLNA 1GKSA 4FB1A 1BGYD 1CSXA 1DW2A 2GC4D 1CIEA 1NTKD 1YTCA 3ZBMA 2CXBA 4EIDA 3NWVA 1P84D 3OA8B 2OZ1B 4Y5RA 1N9CA 3HQ6A 4V2KA 1HZVA 1BCCD 4WQDA 1VYDA 1QN2A 2N9YB 1RZ5A 5DF5A 1MG3D 5TISV 1A2SA 3TF5A 1C75A 4N0KA 5AURA 1GJQA 5CIBB 1KYOD 3ZOYA 1AOFA 1DVVA 2MHMA 1CTJA 1GIWA 2GC7D 1L0ND 1RAQA 3SVWA 4FAVA 1H31A 2ZZS1 4DY9A 2D0WA 1YNRA 1DW1A 4L1QA 3M97X 1CNOA 5GTHV 4JCGA 1C2RA 3KHUA 1HCMA 3H1JD 1E2RA 1A8CA 5DJQB 1IRVA 5KAFV 2DGEA 5C0ZA 5IY51 1J3SA 1CCHA 1GU2A 2C8SA 1NTMD 2BH5X 4LJIA 2L4DA 4PD4D 4AX3A 1IRWA 3L73D 1KB9D 3OA8A 2B12B 4EIFA 2OZ1A 4RJTA 2QJPB 2BLFB 2O3JA 1CO6A 2C1UA 2B10B 2B4ZA 1FCDC 1M70A 4AALA 3OCDB 3L4OA 3O1YA 1CRGA 2YCCA 3VYMA 5CIHB 4XYDB 3SXTA 2KNCB 3C2CA 4UB6V 1SQPD 5KAIV 3CXHW 2QJYB 3ZIYA 1U75B 5CIEB 1AYGA 1L9JC 3A0HV 1YCCA 1SQQD 3O5CA 1CHIA 3HQ9A 2Y0DA 1CIHA 1CXAA 4O1QA 4EIEA 3JBTB 3WFEC 2L91A 3L4MA 5KKZB 4IL6V 1ETPA 1ZZHA 2C9XB 3O20A 3CYTI 1CHJA 1H9XA 1H33B 1OCDA 1LC2A 1NMLA 2BGVX 3WFCC 4D6TD 1YEAA 2CA4B 3MK7B 3L70D 2KS1A 1YICA 1R0QA 1KIBA 1N15A 1PP9D 3VNWA 3A0BV 3O0RC 1CEDA 1IQCA 2RMZA 1C7MA 5DFSA 4WQAA 2C1DA 1FJ0A 3RN0A 1CHHA 5B6QA 1YEBA 2LIRA 1QL4A 1SQVD 1KB0A 4XXLA 1H1OA 4EICA 3PRJA 4WQCA 1HJ3A 2JQRA 1CSUA 1KV9A 1LMSA 1IZL0 4L3GA 1AKKA 1H33A 3ZOWA 3TGUD 4PJ0V 2DVHA 1H32A 4U3FD 3DR0A 1C6RA 4GYDA 2Y0EA 5KLVD 3ZOXA 4FA9A 1CRHA 2RN0A 1DW0A 2BH4X 3MK7C 5C9MA 3ZOOA 1HH7A 1FI7A 1KX7A 1GQ1A 1GDVA 1CRYA 1CXCA 155CA 1I6EA 1M60A 3ITKA 5B5EV 4FA5A 1WEJF 1K3GA 4UB8V 3WFBC 2Y0CA 4L3HA 2B11B 4WQEA 3L75D 4NFGB 1C6SA 1ZRTD 1HJ4A 1E8EA 5TJHA 2N3YA 3CX5W 3PTZA 2YIUB 2QJKB 1I54A 2JTIB 1CC5A 2C2CA 5KLIB 1FOCA 2N9JA 3H1HD 2ZONG 1FI9A 4P4QB 1CYCA 451CA 1SQBD 1KX2A 1CTZA 2EXVA 1F1CA 1HJ5A 1I55A 2I8FA 2AI5A 2B0ZB 4AANA 2YQBA 4A7PA 1I6DA 1SQXD 2PCCB 4AAOA 3HQ7A 5CICB 1HRCA 1CCRA 1L0LD 1L9BC 1I8PA 351CA 2PACA 3A9FA 2YK3A 5CIGB 3X39A 1IO3A 2BCCD 1JDLA 2V08A 1C6OA 3WU2V 1KYOW 1H31B 1H9YA 5E79V 1HROA 2GB8B 5EXQA 3RN1A 1LFMA 3PXSA 2PCBB 3OCDA 4FANA 3CXHD 2AIUA 4GEDB 3CU4A 2FRCA 1S6VB 1I5TA 2JWAA 3RMZA 4MU8A 1OAEA 4PW9B 1CIFA 4WQBA 2ZXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQ8 A;  1NNO A;  2LIT A;  2N18 B;  1DW3 A;  1S5L V;  3DP5 A;  1K3H A;  1YIQ A;  2V07 A;  4FA1 A;  1FI3 A;  3NBT A;  1NIR A;  2QG4 A;  2BCN B;  5CYT R;  1C52 A;  1NMI A;  1NTZ D;  2CA3 B;  4H0J A;  1NU1 D;  3WFD C;  3ORV A;  3CWB D;  1CYI A;  3SWS A;  2GIW A;  1RZ6 A;  4RSZ A;  1U74 B;  1CRI A;  3GG2 A;  2IBZ D;  1FHB A;  3RLM A;  1QYZ A;  1C2N A;  3PH2 B;  3VMA A;  3DMI A;  4WQ9 A;  1B7V A;  1I8O A;  3L71 D;  4EDF A;  5H2F V;  1E29 A;  1LC1 A;  1F1F A;  4QAO A;  4K3I A;  1CRC A;  2CE0 A;  2ZBO A;  1MG2 D;  1CSW A;  2A06 D;  3L72 D;  2FWL A;  3H1K D;  3TDK A;  3PXW A;  1MZ4 A;  1CRJ A;  4H0K A;  3GW6 A;  3BCC D;  1W5C T;  3SLE A;  4WQ7 A;  2D0S A;  3WUI A;  3ZCF A;  2CE1 A;  2BPB B;  2N18 C;  1M6Z A;  1DT1 A;  3H1I D;  3PHL A;  1PPJ D;  3H1L D;  1CIG A;  1DII C;  5B66 V;  1EZV D;  4AAM A;  2C1D B;  3WC8 A;  1COT A;  2HV4 A;  1CSV A;  1CYJ A;  2N9I A;  1BE3 D;  3KZI V;  3FWL A;  1YFC A;  1N50 A;  1LS9 A;  3HQ8 A;  5CID B;  3TYI A;  1DIQ C;  3PXT A;  3L74 D;  1COR A;  1RAP A;  1WVE C;  1QL3 A;  1HZU A;  5CIF B;  5GTI V;  1EB7 A;  4FA4 A;  2VHD A;  2ZOO A;  1DVH A;  2XTS B;  2N3B A;  1A56 A;  2FYN B;  2ORL A;  1W2L A;  2AXT V;  4PWA A;  1N90 A;  1H32 B;  4Q5P A;  5DJQ C;  4YE1 A;  2MTA C;  3CX5 D;  1QKS A;  2Q3E A;  2C1V A;  3CP5 A;  1BL9 A;  1CTY A;  2FYU D;  3VRD A;  3SJL A;  4KMG A;  2K9J B;  4O1W A;  3NBS A;  4J20 A;  1AOQ A;  3PLN A;  1GKS A;  4FB1 A;  1BGY D;  1CSX A;  1DW2 A;  2GC4 D;  1CIE A;  1NTK D;  1YTC A;  3ZBM A;  2CXB A;  4EID A;  3NWV A;  1P84 D;  3OA8 B;  2OZ1 B;  4Y5R A;  1N9C A;  3HQ6 A;  4V2K A;  1HZV A;  1BCC D;  4WQD A;  1VYD A;  1QN2 A;  2N9Y B;  1RZ5 A;  5DF5 A;  1MG3 D;  5TIS V;  1A2S A;  3TF5 A;  1C75 A;  4N0K A;  5AUR A;  1GJQ A;  5CIB B;  1KYO D;  3ZOY A;  1AOF A;  1DVV A;  2MHM A;  1CTJ A;  1GIW A;  2GC7 D;  1L0N D;  1RAQ A;  3SVW A;  4FAV A;  1H31 A;  2ZZS 1;  4DY9 A;  2D0W A;  1YNR A;  1DW1 A;  4L1Q A;  3M97 X;  1CNO A;  5GTH V;  4JCG A;  1C2R A;  3KHU A;  1HCM A;  3H1J D;  1E2R A;  1A8C A;  5DJQ B;  1IRV A;  5KAF V;  2DGE A;  5C0Z A;  5IY5 1;  1J3S A;  1CCH A;  1GU2 A;  2C8S A;  1NTM D;  2BH5 X;  4LJI A;  2L4D A;  4PD4 D;  4AX3 A;  1IRW A;  3L73 D;  1KB9 D;  3OA8 A;  2B12 B;  4EIF A;  2OZ1 A;  4RJT A;  2QJP B;  2BLF B;  2O3J A;  1CO6 A;  2C1U A;  2B10 B;  2B4Z A;  1FCD C;  1M70 A;  4AAL A;  3OCD B;  3L4O A;  3O1Y A;  1CRG A;  2YCC A;  3VYM A;  5CIH B;  4XYD B;  3SXT A;  2KNC B;  3C2C A;  4UB6 V;  1SQP D;  5KAI V;  3CXH W;  2QJY B;  3ZIY A;  1U75 B;  5CIE B;  1AYG A;  1L9J C;  3A0H V;  1YCC A;  1SQQ D;  3O5C A;  1CHI A;  3HQ9 A;  2Y0D A;  1CIH A;  1CXA A;  4O1Q A;  4EIE A;  3JBT B;  3WFE C;  2L91 A;  3L4M A;  5KKZ B;  4IL6 V;  1ETP A;  1ZZH A;  2C9X B;  3O20 A;  3CYT I;  1CHJ A;  1H9X A;  1H33 B;  1OCD A;  1LC2 A;  1NML A;  2BGV X;  3WFC C;  4D6T D;  1YEA A;  2CA4 B;  3MK7 B;  3L70 D;  2KS1 A;  1YIC A;  1R0Q A;  1KIB A;  1N15 A;  1PP9 D;  3VNW A;  3A0B V;  3O0R C;  1CED A;  1IQC A;  2RMZ A;  1C7M A;  5DFS A;  4WQA A;  2C1D A;  1FJ0 A;  3RN0 A;  1CHH A;  5B6Q A;  1YEB A;  2LIR A;  1QL4 A;  1SQV D;  1KB0 A;  4XXL A;  1H1O A;  4EIC A;  3PRJ A;  4WQC A;  1HJ3 A;  2JQR A;  1CSU A;  1KV9 A;  1LMS A;  1IZL 0;  4L3G A;  1AKK A;  1H33 A;  3ZOW A;  3TGU D;  4PJ0 V;  2DVH A;  1H32 A;  4U3F D;  3DR0 A;  1C6R A;  4GYD A;  2Y0E A;  5KLV D;  3ZOX A;  4FA9 A;  1CRH A;  2RN0 A;  1DW0 A;  2BH4 X;  3MK7 C;  5C9M A;  3ZOO A;  1HH7 A;  1FI7 A;  1KX7 A;  1GQ1 A;  1GDV A;  1CRY A;  1CXC A;  155C A;  1I6E A;  1M60 A;  3ITK A;  5B5E V;  4FA5 A;  1WEJ F;  1K3G A;  4UB8 V;  3WFB C;  2Y0C A;  4L3H A;  2B11 B;  4WQE A;  3L75 D;  4NFG B;  1C6S A;  1ZRT D;  1HJ4 A;  1E8E A;  5TJH A;  2N3Y A;  3CX5 W;  3PTZ A;  2YIU B;  2QJK B;  1I54 A;  2JTI B;  1CC5 A;  2C2C A;  5KLI B;  1FOC A;  2N9J A;  3H1H D;  2ZON G;  1FI9 A;  4P4Q B;  1CYC A;  451C A;  1SQB D;  1KX2 A;  1CTZ A;  2EXV A;  1F1C A;  1HJ5 A;  1I55 A;  2I8F A;  2AI5 A;  2B0Z B;  4AAN A;  2YQB A;  4A7P A;  1I6D A;  1SQX D;  2PCC B;  4AAO A;  3HQ7 A;  5CIC B;  1HRC A;  1CCR A;  1L0L D;  1L9B C;  1I8P A;  351C A;  2PAC A;  3A9F A;  2YK3 A;  5CIG B;  3X39 A;  1IO3 A;  2BCC D;  1JDL A;  2V08 A;  1C6O A;  3WU2 V;  1KYO W;  1H31 B;  1H9Y A;  5E79 V;  1HRO A;  2GB8 B;  5EXQ A;  3RN1 A;  1LFM A;  3PXS A;  2PCB B;  3OCD A;  4FAN A;  3CXH D;  2AIU A;  4GED B;  3CU4 A;  2FRC A;  1S6V B;  1I5T A;  2JWA A;  3RMZ A;  4MU8 A;  1OAE A;  4PW9 B;  1CIF A;  4WQB A;  2ZXY A; 
#chains in the Genus database with same CATH topology
 2LIT A;  2M8R A;  2M0B A;  5KLI C;  2N1T A;  3B5N D;  4Y28 J;  1OWA A;  1NWQ A;  1MFZ A;  1RE3 A;  2NPS C;  4JYC A;  2BCN B;  1BSN A;  1C52 A;  1R8E A;  2A45 G;  1Q2N A;  4AYC A;  3BAT A;  1NTZ J;  3CWB D;  1CYI A;  2JEE A;  3S4R A;  3M0D A;  3RBZ A;  1U74 B;  1CW5 A;  3GG2 A;  1FHB A;  1S4X A;  1USD A;  3AEF C;  3P7K A;  1RQU A;  2C9L Y;  3H1H G;  4DOJ A;  4N6J A;  4N78 E;  1F1F A;  3A2A A;  1PPJ E;  2ZBO A;  2A06 D;  1M57 D;  1LTJ A;  3H1K D;  3PXW A;  4R4L A;  4H0K A;  3RK3 D;  3GW6 A;  1NGM B;  2KXP B;  1AQT A;  3JC2 2;  1NAY A;  4WQ7 A;  3NTN A;  1YIT P;  3U1A A;  3HE4 A;  3RBX A;  2P67 A;  2ZYD A;  2N18 C;  2AEF A;  1UII A;  2AXT H;  3BAS A;  3CC4 P;  1NKZ B;  1S1C X;  5CCG A;  2C1D B;  1CSV A;  1PGQ A;  2W90 A;  4O9B A;  1FDO A;  1QGK B;  2Q7C A;  3PXT A;  3L74 D;  1WVE C;  1QL3 A;  1HZU A;  1X79 B;  2POH A;  2ZVO B;  1EB7 A;  4FA4 A;  1NTK K;  2K3R A;  3RL0 C;  1D7M A;  1DVH A;  1A56 A;  2FYN B;  2D2C B;  5TIS H;  2AXT V;  3G6E P;  1WT6 A;  3V2N A;  4YPC A;  1IFD A;  1KFN A;  2K88 A;  5KJ7 D;  1BL9 A;  2FYU D;  3VRD A;  1VQ5 P;  2K9J B;  4O1W A;  1AOQ A;  3RL0 g;  3D6Y A;  4OGQ B;  2BEQ D;  5KLV G;  3M9H A;  1M1J C;  2C0W A;  1N2D C;  4PJ0 H;  2H8P D;  2CXB A;  3AEC C;  3Q5R A;  1BGY J;  1L0N E;  2WIT A;  2XNX A;  2R5D A;  5KAF H;  1N9C A;  3HQ6 A;  2Z4E A;  2QE7 H;  3W67 A;  4U3F E;  2QM7 A;  5TIS V;  3LW5 H;  1N7L A;  4N0K A;  5AUR A;  2J59 M;  3CLQ A;  1DVV A;  1CTJ A;  1AFO A;  1KIL D;  1ZW0 A;  1MUU A;  2Y9Y A;  1ZOY C;  1ZR4 A;  2YKO A;  2WTY A;  1YNR A;  2HPC A;  1L0N J;  3CXH H;  1GK6 A;  1JMB A;  1SQB G;  2O1K A;  3TNU B;  5KAI H;  3CCJ P;  1Q82 Q;  5AW3 B;  1FZC A;  5KAF V;  1G2C B;  3K5B A;  1J3S A;  1CCH A;  4W7Z A;  1NTM D;  2WSF H;  1CI6 B;  4LJI A;  3L73 D;  1DEB A;  1KQF B;  2ZJS E;  2OZ1 A;  3OJA B;  4IL6 H;  1SQQ K;  2BLF B;  3VMY A;  2KK7 A;  1AA0 A;  2B10 B;  2Z5I A;  2B4Z A;  1FCD C;  1M70 A;  2ZXX A;  1A02 F;  3L4O A;  3SSU A;  1CRG A;  1J1D B;  3VYM A;  3AE4 C;  2V4H A;  3A0B H;  5KAI V;  3ZIY A;  1U75 B;  1N86 A;  2HOD A;  1AYG A;  4D6T E;  1H0T B;  2ZT9 B;  1BGY G;  1VQN P;  1SQP J;  3O8Z A;  1FU1 A;  2WPS A;  2BCC E;  2N1T B;  1QVF O;  3JBT B;  2L91 A;  1FZE A;  3AE7 C;  1T3U A;  4IL6 V;  3IFM A;  1H9X A;  3WFC C;  2E43 A;  3HE5 A;  1ZR2 A;  5C39 A;  3L70 D;  1X0T A;  3CWB G;  1U57 A;  4OH8 B;  1YIC A;  3B5N C;  1R0Q A;  2H89 C;  4D6T J;  1E79 H;  3A0B V;  1CED A;  3NXS A;  2QJP C;  4GOD A;  2E76 C;  1LGH B;  1C7M A;  2OYI C;  1Q86 Q;  1LTJ B;  2AXT E;  1N73 A;  1YEB A;  3B71 A;  3H1K G;  1SQV D;  3CCQ P;  1KB0 A;  3RK2 C;  2JQR A;  3P8M C;  1R5L A;  4Z1M H;  3M91 A;  1Q81 Q;  2GUS A;  3L71 E;  4UB8 H;  1IZL 0;  1N8R Q;  2WPV B;  1AKK A;  2DVH A;  1JY2 O;  1VQO P;  2NPS D;  3SFE C;  3MZW B;  3D0W A;  3HTK A;  3LID A;  3BRV B;  3MK7 C;  1SQP G;  3L75 E;  5AVX B;  2P10 A;  1CRY A;  5AW4 B;  3H1L E;  1M60 A;  2DW3 A;  4PJ0 E;  2C9N Y;  5BU8 B;  1K3G A;  4UB8 V;  1EZV E;  3WFB C;  1EDL A;  1HTL C;  2Y0C A;  1FAV A;  1LTS C;  4WQE A;  1Y9B A;  2FYU G;  5APV A;  1VQK P;  3L75 J;  3TSI A;  1CC5 A;  1JEK A;  2XU6 A;  2N9J A;  2JR8 A;  3H1H D;  1FI9 A;  3G3Z A;  2Y9Z A;  451C A;  1NKN A;  5AVW B;  3L35 A;  4L74 A;  2QA4 P;  1CTZ A;  1FDM A;  2AI5 A;  2YQB A;  1I6D A;  1SQX D;  4RES B;  3HQ7 A;  5CIC B;  1CCR A;  1I8P A;  1GL2 A;  3V2P A;  5KAI E;  2IX7 C;  3A9F A;  2YK3 A;  2R32 A;  2N9B A;  1C6O A;  1YJ9 P;  1KYO W;  2R5B A;  1NTK E;  3VP9 A;  3LW5 J;  2HPC B;  3VYI A;  1VQP P;  2P1J A;  1YQ3 C;  1AVY A;  3OCD A;  3CL3 D;  3CU4 A;  4YTP C;  3RL0 D;  1FZC B;  2FRC A;  2ZYA A;  2J58 A;  2SPZ A;  2JWA A;  4MU8 A;  1OAE A;  4PW9 B;  1KIL C;  1NO4 A;  3AE1 C;  1CIF A;  5GTH H;  1OW7 A;  3FX0 A;  1URQ A;  2W8Z A;  2ZXY A;  1SS1 A;  3CCL P;  1NNO A;  1MV8 A;  1YHQ P;  1AVO A;  1SQV J;  5APX A;  2V07 A;  3A0B E;  3L73 G;  1PFI A;  1OW8 A;  1NTZ D;  4NPE A;  2CA3 B;  1S2E A;  2WSF J;  1HJB A;  1VDF A;  3ORV A;  2FKW B;  4IL6 X;  3E1I A;  4K3A A;  2HOD B;  3DMI A;  1JY3 O;  4NPF X;  3VN0 A;  1IK7 A;  1JM0 A;  3GLM A;  2HR3 A;  1E29 A;  4K3I A;  2KIK A;  2O01 N;  2OTJ P;  4GKG A;  3TDK A;  2NRG A;  1L2P A;  1MZ4 A;  1CRJ A;  3Q5P A;  4RO0 A;  3HE5 B;  1W5C T;  4WBA A;  3WUI A;  2BPB B;  3BCC J;  1M6Z A;  1PL5 A;  3HUS C;  1L0L K;  2H7H A;  1SQQ E;  1PPJ D;  2E75 B;  2FFD A;  3H1I J;  3CX5 I;  4AAM A;  1VQ7 P;  3WC8 A;  1FDI A;  3KYQ A;  1N73 B;  4UB8 E;  1LS9 A;  4XE5 B;  2YO2 A;  3HQ8 A;  2M3E A;  4XA4 A;  4DT0 A;  1KTM A;  1OFC X;  3TYI A;  1SQV G;  2FYU K;  1DIQ C;  4C46 A;  1RAP A;  1P84 I;  1SQX J;  5CIF B;  2E74 B;  2O01 H;  1HH0 A;  4I1L A;  2XZR A;  1HF9 A;  5CMZ A;  2N3B A;  3AED C;  1SFC A;  4PWA A;  2MTA C;  3CX5 D;  3HD7 B;  1FOS F;  3HTK B;  2C1V A;  1BCC E;  3SJL A;  1VQ4 P;  1VF5 B;  1NU1 K;  4H44 B;  4FB1 A;  1BGY D;  3H6P A;  1JY3 P;  4KT0 J;  1CSX A;  1DW2 A;  2P2U A;  2K9Y A;  1YTC A;  3ZBM A;  2ITA A;  2NPS A;  1K73 Q;  1P84 D;  2ZFC A;  1AV1 A;  3AEA C;  1ZME C;  1S3J A;  2CK3 H;  3AE5 C;  4V2K A;  3I55 P;  1HZV A;  1CSB A;  2KZJ A;  1J1D C;  3L36 A;  4XFJ A;  1YTZ I;  2E76 D;  3M0A A;  1BCC J;  3H1J E;  1A2S A;  3TF5 A;  1C75 A;  3G9R A;  4PD4 I;  1GJQ A;  3BCC G;  2ZT9 C;  1RF0 C;  1FJK A;  1L0N D;  4FAV A;  4GOF A;  3E7K A;  1NTM K;  1OIP A;  1RE3 C;  3H1I G;  3RK2 D;  2J5U A;  4IFF A;  1UIX A;  4L1Q A;  3CI9 A;  1CNO A;  4JCG A;  2I1J A;  1ZV8 A;  4C7R A;  3CCS P;  1PV3 A;  1LT9 C;  5BU5 A;  4EI2 A;  2YKP A;  3IAO A;  4DJG A;  2KUB A;  3A0H H;  4H0L B;  4MN4 C;  1GD2 E;  1JOC A;  5C0Z A;  3H1J J;  3V6I A;  4NPD A;  5IY5 1;  3KXD A;  1GU2 A;  1SQX G;  4ASV A;  1GL2 B;  2BH5 X;  4PD4 D;  1H8A A;  4AX3 A;  1IRW A;  3OA8 A;  3D6Z A;  4EIF A;  1QL1 A;  1YIJ P;  1VPC A;  1JNM A;  2KZI A;  5AW6 B;  3CC2 P;  5GTH E;  4AAL A;  3OCD B;  5CIH B;  1M56 D;  4ZKU A;  3WU2 H;  3HD7 D;  1SQP D;  5E79 H;  2IZ1 A;  1HJ0 A;  1KC8 Q;  4BXL A;  3A0H V;  1URQ B;  2CPB A;  1CIH A;  3Q3D A;  1PP9 E;  3O6Q A;  4YXW H;  3NFQ A;  4O1Q A;  4EIE A;  4H13 B;  5CCG C;  1NTZ G;  1CHJ A;  5AW5 B;  1LC2 A;  5AW8 B;  4PV1 B;  4Y99 B;  1G1I A;  4D6T D;  2CA4 B;  4UB6 E;  2WZ7 A;  1MFT A;  4EOT A;  1LWU B;  3F5H A;  1KIB A;  1N15 A;  3FWN A;  3OAK A;  3GHG B;  3CC7 P;  1M1K Q;  2NZ2 A;  3VP8 A;  4RKU J;  1IQC A;  2RMZ A;  1LT1 A;  1Z56 A;  2WSE H;  4WY4 B;  2PGD A;  1FJ0 A;  1K8A Q;  4LC1 A;  2H88 C;  2KNC A;  2WSS H;  3TGU E;  1RF1 C;  1QL4 A;  5AVT B;  3CWB E;  1FS0 E;  2CPS A;  3PRJ A;  1K04 A;  1CSU A;  1LMS A;  1NAF A;  2KLV A;  1VQ9 P;  1PPJ G;  1L4A B;  1H33 A;  3ZOW A;  4PJ0 V;  5KKZ C;  1EDK A;  1H32 A;  1KMI Z;  2A06 E;  3WMM 0;  5AVV B;  4WWI A;  4FA9 A;  4U3F J;  3MP7 B;  3RK3 E;  4LGD E;  5B66 H;  4B86 A;  5AW2 B;  3WUU A;  4ZNC A;  1NVO A;  1N7S A;  1RHZ B;  1SFC B;  1IC2 A;  5CHX A;  1FZC C;  2ZXE B;  1KYO H;  2B11 B;  2D2C D;  3L75 D;  1C6S A;  3JCU H;  1ZRT D;  3P8C E;  3VOP A;  5GTI H;  3QWO C;  2BAS A;  1IFI A;  1L0L E;  5KLI B;  3L74 E;  4OGQ D;  1FOC A;  3USS A;  2WT7 A;  1W5C E;  3H32 A;  1GW4 A;  1WRG A;  3CXH I;  2ZVN B;  1QL2 A;  3WUT A;  2Q3I A;  1I55 A;  4AAN A;  4A7P A;  4GT1 A;  4AAO A;  1WMK A;  4ASW A;  1KB9 H;  3B5N A;  1BSH A;  3ZDM A;  2PAC A;  2A45 H;  3QH9 A;  3A0H E;  1GW3 A;  5BVZ A;  1L0N G;  1HRO A;  2BCC J;  3RN1 A;  3M9Q A;  4JQ0 D;  5AVY B;  1DIP A;  3CXH D;  4U3F G;  3AE9 C;  2YXR B;  3S9O A;  1I5T A;  1NU1 E;  1U7M A;  3RMZ A;  3BVH A;  1DH3 A;  2IBZ E;  5KLV K;  4HB1 A;  2M3B A;  3EFG A;  2N18 B;  1DW3 A;  3HE4 B;  2Q1K A;  4FA1 A;  2E75 C;  3WU2 E;  3Q1M A;  1FI3 A;  3NBT A;  1NIR A;  1Y47 A;  2QG4 A;  5E79 E;  4K35 A;  1GU5 A;  1M8O B;  1SVF A;  1NYH A;  4JF7 A;  3GF7 A;  2JP3 A;  3WFD C;  2B88 A;  2WVR A;  1N73 C;  2JKV A;  2GIW A;  3L72 E;  4RSZ A;  1CRI A;  1E5W A;  1QYZ A;  1JB0 J;  1NU1 J;  2OYO A;  1T8Z A;  3PH2 B;  1OXZ A;  3VMA A;  2HLO A;  1AJY A;  2O1J A;  1YJW P;  3TK1 A;  1B7V A;  1NTM E;  1S5L E;  1Q7Y Q;  3L73 E;  4HKZ H;  2OYH A;  2ZT9 D;  1FC2 C;  1OVU A;  3O6Q B;  1XTG B;  4QAO A;  3L37 A;  3M9B A;  1CRC A;  2CE0 A;  3L71 J;  2N1T D;  2M5A A;  2YKQ A;  2FWL A;  1MKM A;  3HD7 C;  1SQB K;  1HWT C;  1VF5 C;  3L72 J;  3BCC D;  4H44 C;  1R5S A;  3SLE A;  1BE3 E;  4D6T G;  2D0S A;  2B87 A;  4BRY A;  2H43 A;  4OVN F;  3ABV C;  2JWD A;  1FZB A;  3AE3 C;  3A5T A;  1JUN A;  2BCC G;  3H1I D;  3PHL A;  5H2F E;  1CIG A;  1LTI C;  5APS A;  5KJ7 A;  2WSC H;  3H1L J;  2YMY A;  3S1K A;  2HV4 A;  1CYJ A;  1YFC A;  1N50 A;  1RE4 C;  2WSE J;  1BE3 J;  2XDJ A;  3G71 P;  3L70 E;  3CCU P;  1COR A;  1ZXG A;  2W83 C;  1HBW A;  4I2L C;  3V2Q A;  2XTS B;  5B66 E;  1W2L A;  1FZG A;  1H32 B;  2C0X A;  4Q5P A;  1FZA A;  1FBM A;  4YE1 A;  2ZAE B;  2Q3E A;  1AQ5 A;  3KZI E;  5AVS B;  1CTY A;  3CCR P;  5CCG D;  1KIL A;  3PLN A;  1OW6 A;  3CD6 P;  1GL2 C;  2GC4 D;  3SFD C;  1KYO E;  1S9K E;  3JCU E;  3L71 G;  2V7Q H;  5GTI E;  2OZ1 B;  3WUV A;  2RKL A;  1NTK J;  1CZQ A;  1BCC D;  4WQD A;  1QN2 A;  1N7S B;  2JJL A;  2N9Y B;  1YTZ T;  1EC5 A;  2I1K A;  1JCC A;  5DF5 A;  1IO4 A;  2E5Y A;  2PP6 A;  3L75 G;  3V4W A;  3ZOY A;  1AOF A;  2MHM A;  1GIW A;  1URQ C;  2Q5U A;  3W68 A;  2IPP A;  3SVW A;  1J1E B;  1H31 A;  2ZZS 1;  4DY9 A;  2D0W A;  2WT7 B;  2OTK E;  1KB9 E;  2VRS A;  3H1L G;  1M90 Q;  3H32 B;  4H13 C;  3M97 X;  5GTH V;  1X22 A;  1C2R A;  2FYN C;  4UB6 H;  3SWF A;  2D2C C;  3H1J D;  4JBZ A;  3CMA P;  1LNQ A;  1TU3 F;  4Y99 C;  1A8C A;  5DJQ B;  2K9J A;  1IRV A;  2DGE A;  3P32 A;  1U7J A;  1EXJ A;  3B5N B;  1LWU C;  4OGQ C;  4TT3 H;  3V2R A;  3GHG C;  3NMD A;  1SQP K;  2R3S A;  3HUS A;  3I56 P;  3PH0 A;  2B12 B;  3VMZ A;  5CCH C;  1VQ6 P;  4N78 D;  2QJP B;  3MGN A;  3H1H E;  2O3J A;  4WY4 C;  1CO6 A;  2C1U A;  5AW0 B;  3O1Y A;  1DEE G;  4XYD B;  2YO3 A;  4UB6 V;  1Y8A A;  2LKM A;  2ZYG A;  2QJY B;  5CIE B;  1SP4 A;  1JMM A;  2Q6Q A;  1PIX A;  1YCC A;  2WPQ A;  1NTK G;  1CXA A;  1L4A C;  3TNU A;  1SQQ J;  3IR9 A;  1YJN P;  2B9B A;  5APW A;  3E1R A;  3MUD C;  1ETP A;  1ZZH A;  2C9X B;  3RK3 B;  4I7Z B;  5CBN A;  1OCD A;  3R4Y A;  3MK7 B;  3G4S P;  2KS1 A;  1VQ8 P;  1PP9 D;  3VNW A;  3O0R C;  1HVV A;  3EQ2 A;  3Q2Y A;  2OYH B;  1QX8 A;  1RH5 B;  4LLH A;  1J2J B;  2LXC B;  2KOG A;  5DFS A;  1SFC C;  2WMM A;  2M5A B;  3L4F A;  5B6Q A;  3D71 A;  1LP1 A;  2KI7 B;  2LIR A;  4R4M A;  2OAR A;  1H88 A;  3VMX A;  4WQC A;  1HJ3 A;  5KLV E;  1JY2 N;  1KQL A;  2B87 B;  4BRY B;  2KYV A;  2WWW A;  2N1T C;  5B5E H;  3U59 A;  3CCM P;  3PP5 A;  1LT9 A;  4L3G A;  5AVR B;  3TGU D;  2E75 D;  4U3F D;  1W2E A;  2HG5 D;  1OVR A;  1YBK A;  2Y0E A;  3ZOX A;  1CRH A;  2RN0 A;  1DW0 A;  2BH4 X;  2IFM A;  3M0D C;  5C9M A;  2WSC J;  1FI7 A;  5KLV J;  1JO5 A;  2R44 A;  1RY3 A;  1GTW A;  2XND H;  2XV5 A;  1HUC A;  1HGZ A;  1GQ1 A;  1GDV A;  1SQQ G;  3AEB C;  155C A;  1JTH A;  2KP8 A;  2P58 A;  1I6E A;  2E74 D;  3ITK A;  1IFN A;  1SQB E;  5B5E V;  1KFM A;  4FA5 A;  1T3J A;  3AE2 C;  1LTJ C;  4L3H A;  1H89 A;  4NFG B;  1E8E A;  4W80 A;  5TJH A;  1ZP0 C;  1KIL B;  1LTA C;  3CX5 W;  3PTZ A;  2YIU B;  5AW9 B;  2QJK B;  2JTI B;  1VF5 D;  3IN6 A;  2C2C A;  2QVA A;  4H44 D;  1PGJ A;  4P4Q B;  4DCK A;  1CYC A;  3AE8 C;  1QVG O;  5APT A;  2EXV A;  2GA1 A;  1F1C A;  3SWK A;  3P8C D;  1HJ5 A;  2PAJ A;  1SQB J;  3MD0 A;  2I8F A;  2W27 A;  1BCC G;  1ZLL A;  3N7N A;  4QMA A;  2V7Q J;  3CX5 E;  2PCC B;  1VQL P;  1S5L H;  1L0L D;  1L9B C;  2AEM A;  1M1J A;  3X39 A;  1BGY E;  1SQV K;  2BCC D;  3T97 A;  1JDL A;  5CBO A;  3WU2 V;  1H31 B;  1H9Y A;  5E79 V;  2PFX A;  1P84 E;  3AEG C;  2KSJ A;  1PP9 J;  3TYY A;  2GB8 B;  5EXQ A;  1KZU B;  1LFM A;  3PXS A;  2PCB B;  4GIF A;  1M7L A;  5AVU B;  1RF1 A;  2IBZ I;  4AUW A;  4HH2 A;  3H1J G;  1BDC A;  3EFF K;  3HRN A;  4H0L D;  5H2F H;  1SLQ A;  4WQB A;  4BWN A;  4WQ8 A;  1T2K D;  3HUS B;  1S5L V;  3DP5 A;  1K3H A;  1YIQ A;  1QEX A;  3H25 A;  1GL2 D;  1NJI Q;  2FBW C;  2G3A A;  5CYT R;  1NMI A;  2FXM A;  2FYZ A;  2BEZ F;  1GMJ A;  4H0J A;  2FFD B;  3GMA A;  1JY3 N;  1NU1 D;  1IZN B;  4KJM A;  3SWS A;  3C1L A;  1RZ6 A;  3R2P A;  3U1C A;  3H1K E;  2IBZ D;  3TGU J;  3RLM A;  1C2N A;  1KN7 A;  3CWB J;  4WQ9 A;  1I8O A;  3L71 D;  4PD4 E;  2QRX A;  4EDF A;  5H2F V;  4YXD C;  1EZV I;  1URQ D;  1LC1 A;  3EWK A;  3KZI H;  1MG2 D;  1CSW A;  3A3Y B;  3L72 D;  2IDB A;  2RH0 A;  4EIJ A;  1RQV A;  3B4S A;  3FXE A;  4H13 D;  3H1K J;  2O01 J;  3II6 A;  1SQP E;  5EFW B;  4PV1 D;  2KS1 B;  3ZCF A;  2UWJ E;  1SQX K;  2CE1 A;  1DT1 A;  1PP9 G;  2K37 A;  3H1L D;  3UIA A;  4I6M C;  2NPS B;  1DII C;  5B66 V;  1LTB C;  4ZKP A;  1EZV D;  1X9V A;  5CCH D;  1N7S C;  2W6J H;  4IFM A;  1FOS E;  1COT A;  1BDD A;  2N9I A;  1BE3 D;  4WY4 D;  3KZI V;  3FWL A;  5B5E E;  1LP1 B;  2I8D A;  1GZL A;  3RGU A;  5CID B;  2IFN A;  1PGP A;  2FYU E;  2FY8 A;  1OZH A;  1J1E C;  1YI2 P;  5M1B A;  1L0L J;  5GTI V;  3L74 J;  2VHD A;  2ZOO A;  1OMI A;  1LT9 B;  1EDI A;  2ORL A;  2OYI A;  1N90 A;  1S72 P;  3KDP B;  5DJQ C;  3TGU G;  1L4A D;  1QKS A;  1NTZ K;  1K05 A;  1DD3 A;  3CCV P;  3CP5 A;  1KYO I;  1IK9 A;  1X8Y A;  4KMG A;  3M06 A;  3NBS A;  4J20 A;  1NHL A;  2GM4 A;  1LTG C;  1GKS A;  3MHV A;  2WPR A;  4C7N A;  2FYU J;  3N4X A;  1CIE A;  1NTK D;  5APU A;  3A7O A;  2YNY A;  3V5B A;  4EID A;  3NWV A;  3OA8 B;  4Y5R A;  1KIL E;  1JTH B;  1IFM A;  2A06 G;  4JPZ B;  2MKV A;  1VYD A;  2HYN A;  1RZ5 A;  1MG3 D;  5CJ0 A;  2AEJ A;  1SFC D;  3PJS K;  2QJY C;  2L5G B;  4HJG H;  3MTU E;  5K5G B;  3JSV C;  5CIB B;  1KB9 I;  1KYO D;  4JYB A;  1S9K D;  3IF4 A;  1USE A;  2GC7 D;  1RAQ A;  2A45 I;  2W6B A;  2E74 C;  1YYC A;  1DW1 A;  3CCE P;  3RK3 C;  3RL0 B;  4I7Z C;  3KHU A;  3HD7 A;  1HCM A;  1E2R A;  1GDT A;  5TIS E;  1ZRT E;  3C9I A;  2C8S A;  2E42 A;  4GOE A;  2L4D A;  1L0L G;  1M1J B;  1KB9 D;  3CME P;  3L74 G;  4AQR D;  3T97 B;  4RJT A;  2E5T A;  2OYH C;  3OW2 O;  1NTM J;  1HGV A;  5AVQ B;  3L73 J;  1S5L X;  2G8Y A;  1RF1 B;  2YCC A;  4CPG A;  3FGA D;  3SXT A;  3CPW O;  2KNC B;  3C2C A;  5KAF E;  1RE4 A;  3CXH W;  1L9J C;  4U7J A;  1G1J A;  3Q5S A;  1SQQ D;  3O5C A;  1CHI A;  4KHX A;  4WVZ A;  3HQ9 A;  2Y0D A;  3LIE A;  4M3L A;  1FZF A;  2QIW A;  3WFE C;  3L4M A;  5KJ7 C;  5KKZ B;  4EYY Q;  3O20 A;  3CYT I;  4L75 A;  1H33 B;  2IYO A;  1NML A;  2BGV X;  3CXH E;  1YEA A;  4H0L C;  1NU1 G;  1FE6 A;  2PRR A;  2LXB A;  1IJD B;  1T2K C;  1NOH A;  1SQV E;  2IBZ G;  3FXD A;  3MIW A;  2MJZ A;  1ZN5 A;  1IFJ A;  3L70 J;  3D70 A;  3OA7 A;  1OX3 A;  1JY2 P;  4W7Y A;  1QLE D;  3AE6 C;  1L0N K;  4WQA A;  2C1D A;  3BRT B;  3RN0 A;  4IL6 E;  1FJP A;  1EQ7 A;  2FXP A;  2XKM A;  1CHH A;  3L72 G;  2FXO A;  4XXL A;  1H1O A;  4EIC A;  2YIU C;  1EDJ A;  2QJK C;  1DD4 A;  1NTM G;  5AVZ B;  1KV9 A;  4ZMD A;  4N3Y B;  3KPE A;  3C8V A;  1XTC C;  3KQG A;  3CX5 H;  2OQQ A;  2K1A A;  2JDI H;  2YMK A;  4GDO A;  3DR0 A;  1C6R A;  4GYD A;  1EZV G;  1DX7 A;  2QSI A;  1EXI A;  3AEE C;  4PV1 C;  5KLV D;  2QM8 A;  1LWU A;  1VL2 A;  3VTP C;  1BE3 G;  3GHG A;  3ZOO A;  1KQS O;  3BCC E;  1HH7 A;  1P84 H;  3F89 A;  5AW1 B;  5CCH A;  1KX7 A;  1KD1 Q;  5AW7 B;  5CJ4 A;  1CXC A;  4WY4 A;  3H1I E;  1W2B O;  1GU4 A;  2B89 A;  1MZ9 A;  3SWY A;  2KSE A;  4HYT B;  2E76 B;  3I5C A;  2OYI B;  1WEJ F;  1T6A A;  5APY A;  1A02 J;  1NH4 A;  4WB4 A;  1Q90 D;  1HJ4 A;  4IOI H;  2JO1 A;  5L8R J;  2N3Y A;  5APQ A;  2P7J A;  4L73 A;  2Z5H A;  5KTB A;  1KQG B;  3L70 G;  1SQX E;  3RK2 B;  1I54 A;  2W6A A;  4C7N B;  2GUV A;  3V4Q A;  4DZO A;  4L76 A;  2ZON G;  2WQY C;  1L4A A;  1GK4 A;  1SQB D;  1KX2 A;  3MUD A;  1JCD A;  2KB7 P;  5DJU B;  3H1H J;  2FFD C;  1YQ4 C;  4OWF A;  1K9M Q;  2IYP A;  2B0Z B;  2IZ0 A;  1OVV A;  2OGU A;  1KOR A;  1G2C A;  1IFP A;  4PD4 H;  3B8E B;  1N7S D;  1HRC A;  2HFE D;  1KV4 A;  1PZQ A;  5DJT B;  351C A;  1CI6 A;  2QEX P;  2OTL P;  5CIG B;  1IO3 A;  1LTT C;  4TLF A;  2V08 A;  2LR2 A;  3GF3 A;  2KLU A;  2AXC A;  4FAN A;  1LJ2 A;  1NTZ E;  2AIU A;  2Q9I A;  4GED B;  2R3C A;  1PGO A;  1S6V B;  1H0T A;  2YXQ B;  1RF0 A;  1VQM P;  4IFD K; 
#chains in the Genus database with same CATH homology
 4WQ8 A;  1NNO A;  2LIT A;  2N18 B;  1DW3 A;  1S5L V;  3DP5 A;  1K3H A;  1YIQ A;  2V07 A;  4FA1 A;  1FI3 A;  3NBT A;  1NIR A;  2QG4 A;  2BCN B;  5CYT R;  1C52 A;  1NMI A;  1NTZ D;  2CA3 B;  4H0J A;  1NU1 D;  3WFD C;  3ORV A;  3CWB D;  1CYI A;  3SWS A;  2GIW A;  1RZ6 A;  4RSZ A;  1U74 B;  1CRI A;  3GG2 A;  2IBZ D;  1FHB A;  3RLM A;  1QYZ A;  1C2N A;  3PH2 B;  3VMA A;  3DMI A;  4WQ9 A;  1B7V A;  1I8O A;  3L71 D;  4EDF A;  5H2F V;  1E29 A;  1LC1 A;  1F1F A;  4QAO A;  4K3I A;  1CRC A;  2CE0 A;  2ZBO A;  1MG2 D;  1CSW A;  2A06 D;  3L72 D;  2FWL A;  3H1K D;  3TDK A;  3PXW A;  1MZ4 A;  1CRJ A;  4H0K A;  3GW6 A;  3BCC D;  1W5C T;  3SLE A;  4WQ7 A;  2D0S A;  3WUI A;  3ZCF A;  2CE1 A;  2BPB B;  2N18 C;  1M6Z A;  1DT1 A;  3H1I D;  3PHL A;  1PPJ D;  3H1L D;  1CIG A;  1DII C;  5B66 V;  1EZV D;  4AAM A;  2C1D B;  3WC8 A;  1COT A;  2HV4 A;  1CSV A;  1CYJ A;  2N9I A;  1BE3 D;  3KZI V;  3FWL A;  1YFC A;  1N50 A;  1LS9 A;  3HQ8 A;  5CID B;  3TYI A;  1DIQ C;  3PXT A;  3L74 D;  1COR A;  1RAP A;  1WVE C;  1QL3 A;  1HZU A;  5CIF B;  5GTI V;  1EB7 A;  4FA4 A;  2VHD A;  2ZOO A;  1DVH A;  2XTS B;  2N3B A;  1A56 A;  2FYN B;  2ORL A;  1W2L A;  2AXT V;  4PWA A;  1N90 A;  1H32 B;  4Q5P A;  5DJQ C;  4YE1 A;  2MTA C;  3CX5 D;  1QKS A;  2Q3E A;  2C1V A;  3CP5 A;  1BL9 A;  1CTY A;  2FYU D;  3VRD A;  3SJL A;  4KMG A;  2K9J B;  4O1W A;  3NBS A;  4J20 A;  1AOQ A;  3PLN A;  1GKS A;  4FB1 A;  1BGY D;  1CSX A;  1DW2 A;  2GC4 D;  1CIE A;  1NTK D;  1YTC A;  3ZBM A;  2CXB A;  4EID A;  3NWV A;  1P84 D;  3OA8 B;  2OZ1 B;  4Y5R A;  1N9C A;  3HQ6 A;  4V2K A;  1HZV A;  1BCC D;  4WQD A;  1VYD A;  1QN2 A;  2N9Y B;  1RZ5 A;  5DF5 A;  1MG3 D;  5TIS V;  1A2S A;  3TF5 A;  1C75 A;  4N0K A;  5AUR A;  1GJQ A;  5CIB B;  1KYO D;  3ZOY A;  1AOF A;  1DVV A;  2MHM A;  1CTJ A;  1GIW A;  2GC7 D;  1L0N D;  1RAQ A;  3SVW A;  4FAV A;  1H31 A;  2ZZS 1;  4DY9 A;  2D0W A;  1YNR A;  1DW1 A;  4L1Q A;  3M97 X;  1CNO A;  5GTH V;  4JCG A;  1C2R A;  3KHU A;  1HCM A;  3H1J D;  1E2R A;  1A8C A;  5DJQ B;  1IRV A;  5KAF V;  2DGE A;  5C0Z A;  5IY5 1;  1J3S A;  1CCH A;  1GU2 A;  2C8S A;  1NTM D;  2BH5 X;  4LJI A;  2L4D A;  4PD4 D;  4AX3 A;  1IRW A;  3L73 D;  1KB9 D;  3OA8 A;  2B12 B;  4EIF A;  2OZ1 A;  4RJT A;  2QJP B;  2BLF B;  2O3J A;  1CO6 A;  2C1U A;  2B10 B;  2B4Z A;  1FCD C;  1M70 A;  4AAL A;  3OCD B;  3L4O A;  3O1Y A;  1CRG A;  2YCC A;  3VYM A;  5CIH B;  4XYD B;  3SXT A;  2KNC B;  3C2C A;  4UB6 V;  1SQP D;  5KAI V;  3CXH W;  2QJY B;  3ZIY A;  1U75 B;  5CIE B;  1AYG A;  1L9J C;  3A0H V;  1YCC A;  1SQQ D;  3O5C A;  1CHI A;  3HQ9 A;  2Y0D A;  1CIH A;  1CXA A;  4O1Q A;  4EIE A;  3JBT B;  3WFE C;  2L91 A;  3L4M A;  5KKZ B;  4IL6 V;  1ETP A;  1ZZH A;  2C9X B;  3O20 A;  3CYT I;  1CHJ A;  1H9X A;  1H33 B;  1OCD A;  1LC2 A;  1NML A;  2BGV X;  3WFC C;  4D6T D;  1YEA A;  2CA4 B;  3MK7 B;  3L70 D;  2KS1 A;  1YIC A;  1R0Q A;  1KIB A;  1N15 A;  1PP9 D;  3VNW A;  3A0B V;  3O0R C;  1CED A;  1IQC A;  2RMZ A;  1C7M A;  5DFS A;  4WQA A;  2C1D A;  1FJ0 A;  3RN0 A;  1CHH A;  5B6Q A;  1YEB A;  2LIR A;  1QL4 A;  1SQV D;  1KB0 A;  4XXL A;  1H1O A;  4EIC A;  3PRJ A;  4WQC A;  1HJ3 A;  2JQR A;  1CSU A;  1KV9 A;  1LMS A;  1IZL 0;  4L3G A;  1AKK A;  1H33 A;  3ZOW A;  3TGU D;  4PJ0 V;  2DVH A;  1H32 A;  4U3F D;  3DR0 A;  1C6R A;  4GYD A;  2Y0E A;  5KLV D;  3ZOX A;  4FA9 A;  1CRH A;  2RN0 A;  1DW0 A;  2BH4 X;  3MK7 C;  5C9M A;  3ZOO A;  1HH7 A;  1FI7 A;  1KX7 A;  1GQ1 A;  1GDV A;  1CRY A;  1CXC A;  155C A;  1I6E A;  1M60 A;  3ITK A;  5B5E V;  4FA5 A;  1WEJ F;  1K3G A;  4UB8 V;  3WFB C;  2Y0C A;  4L3H A;  2B11 B;  4WQE A;  3L75 D;  4NFG B;  1C6S A;  1ZRT D;  1HJ4 A;  1E8E A;  5TJH A;  2N3Y A;  3CX5 W;  3PTZ A;  2YIU B;  2QJK B;  1I54 A;  2JTI B;  1CC5 A;  2C2C A;  5KLI B;  1FOC A;  2N9J A;  3H1H D;  2ZON G;  1FI9 A;  4P4Q B;  1CYC A;  451C A;  1SQB D;  1KX2 A;  1CTZ A;  2EXV A;  1F1C A;  1HJ5 A;  1I55 A;  2I8F A;  2AI5 A;  2B0Z B;  4AAN A;  2YQB A;  4A7P A;  1I6D A;  1SQX D;  2PCC B;  4AAO A;  3HQ7 A;  5CIC B;  1HRC A;  1CCR A;  1L0L D;  1L9B C;  1I8P A;  351C A;  2PAC A;  3A9F A;  2YK3 A;  5CIG B;  3X39 A;  1IO3 A;  2BCC D;  1JDL A;  2V08 A;  1C6O A;  3WU2 V;  1KYO W;  1H31 B;  1H9Y A;  5E79 V;  1HRO A;  2GB8 B;  5EXQ A;  3RN1 A;  1LFM A;  3PXS A;  2PCB B;  3OCD A;  4FAN A;  3CXH D;  2AIU A;  4GED B;  3CU4 A;  2FRC A;  1S6V B;  1I5T A;  2JWA A;  3RMZ A;  4MU8 A;  1OAE A;  4PW9 B;  1CIF A;  4WQB A;  2ZXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...