1PPJD

Bovine cytochrome bc1 complex with stigmatellin and antimycin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 73
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ppjD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ppjD01
3RLMA 1CCRA 1F1CA 4RSZA 4Y5RA 1WVEC 3CXHW 2FYUD 1SQPD 5KKZB 1CORA 3O1YA 3JBTB 1LFMA 4UB8V 5CYTR 4MU8A 1CHHA 1CIGA 1MG2D 3GW6A 3CU4A 3DMIA 1FHBA 1GDVA 1P84D 2N9JA 5EXQA 5TISV 4P4QB 4XYDB 5B5EV 5KAIV 1SQBD 2GC4D 1ETPA 2C1UA 4WQ7A 4AANA 1FI9A 1B7VA 3DR0A 2HV4A 1CRIA 1CO6A 2A06D 3L71D 2YCCA 3SJLA 1K3GA 1H32A 1I8OA 4WQ8A 1L0LD 1L9BC 451CA 2LITA 2N3BA 1CCHA 2I8FA 1RZ6A 1N15A 2JQRA 1LS9A 2FWLA 5DJQC 2L91A 1YFCA 3ORVA 1N50A 2RMZA 2N9YB 1K3HA 4EIDA 4JCGA 4FA9A 5CIHB 4L3HA 155CA 1CSXA 1CEDA 1W5CT 2ZBOA 1FCDC 2B4ZA 4L3GA 1GU2A 3HQ6A 1GJQA 3WFEC 1C52A 2JTIB 2GIWA 3ZIYA 3H1KD 1GKSA 5CIEB 1OAEA 2BPBB 2XTSB 3TF5A 1FJ0A 2CE0A 1QL4A 3ZOXA 1LMSA 1N9CA 1YEBA 3GG2A 3A0HV 1EZVD 3O0RC 1I6EA 1W2LA 1C75A 1BE3D 4V2KA 1DW3A 2MTAC 3WFCC 1CYIA 2B10B 2K9JB 4GEDB 1NTKD 1YNRA 3VRDA 3CX5D 1IO3A 1C2NA 4WQDA 2BCCD 4D6TD 1CTJA 1CXAA 3DP5A 1KV9A 5KLIB 1FI7A 1M6ZA 2DGEA 3FWLA 2C1DB 1AOFA 1LC1A 2ZONG 1H31A 4NFGB 1QKSA 4O1QA 2YIUB 1NU1D 2LIRA 2YK3A 1NIRA 1I54A 3SWSA 2GC7D 5C9MA 1E2RA 1H33B 1S6VB 2QJYB 3O20A 1COTA 4XXLA 2ZZS1 5C0ZA 2BH5X 3CWBD 1QYZA 2O3JA 2N9IA 2PACA 3H1HD 4WQ9A 4EIEA 1HZVA 1J3SA 1L0ND 4WQBA 2VHDA 1YICA 1S5LV 3A0BV 1IQCA 3RN0A 4O1WA 1H9XA 1VYDA 4Q5PA 2FRCA 5KAFV 4AALA 2IBZD 1H31B 3MK7C 1YIQA 3ITKA 1EB7A 3ZOWA 4H0JA 4YE1A 3L4OA 2C8SA 3PXTA 3NBSA 3L72D 1CTZA 2N3YA 1NTZD 4FAVA 1H1OA 1U74B 3M97X 5DFSA 1HJ4A 1DW2A 2BGVX 1KX7A 1FOCA 1AOQA 1CYCA 1HCMA 2AIUA 4N0KA 4L1QA 1GIWA 5DF5A 3O5CA 1NNOA 4EDFA 2ZOOA 1DVHA 4AX3A 5B66V 1HH7A 1LC2A 1C2RA 1RAQA 2KNCB 2Y0EA 3ZBMA 3CXHD 3KZIV 1I55A 1CSVA 2B12B 2FYNB 1KYOW 3HQ9A 1C6SA 1DT1A 1BGYD 1HZUA 5CIGB 2C9XB 1HRCA 3RN1A 3BCCD 1WEJF 3L74D 1E29A 1SQVD 1RAPA 2BLFB 3TYIA 2AI5A 1CXCA 1SQQD 3X39A 4H0KA 5AURA 2Y0DA 1YCCA 2MHMA 3VMAA 3H1JD 2DVHA 4GYDA 1YEAA 1AYGA 3VYMA 3TDKA 4FA1A 4FANA 2QG4A 1CTYA 3CX5W 4QAOA 4PWAA 4J20A 3ZOYA 1CRJA 5CIBB 3SVWA 2V07A 1I5TA 1NMLA 3H1LD 3L73D 1CNOA 3L75D 5DJQB 4DY9A 1A56A 2CA3B 1N90A 1CIFA 1DVVA 5E79V 1CRYA 2OZ1A 2CXBA 2CA4B 1QL3A 1H33A 5CIDB 2C1VA 2D0SA 1I6DA 2CE1A 4FA4A 3OA8B 1A2SA 2V08A 3L4MA 1M60A 2KS1A 3C2CA 4AAMA 1CRCA 1CSUA 1CHJA 3L70D 1A8CA 1YTCA 2ZXYA 3WFDC 1ZZHA 1F1FA 1NMIA 1PPJD 1QN2A 4PW9B 3TGUD 2L4DA 1DIIC 1KB9D 2EXVA 3OCDA 1H32B 3OCDB 1RZ5A 4PJ0V 1C6OA 351CA 4UB6V 1KX2A 2N18B 3OA8A 2BH4X 1IRWA 5GTHV 1C7MA 3PH2B 1DIQC 1CSWA 1PP9D 3PXWA 1R0QA 4LJIA 5GTIV 2B0ZB 1ZRTD 1MG3D 1JDLA 1CRHA 3PTZA 3WUIA 1L9JC 3PRJA 4FA5A 1OCDA 3A9FA 1AKKA 2C2CA 3NBTA 1E8EA 5TJHA 5IY51 1BCCD 2ORLA 1CHIA 1DW1A 2GB8B 3WU2V 1KYOD 3WC8A 1NTMD 3HQ7A 2Q3EA 1HJ3A 2AXTV 4WQEA 1C6RA 2JWAA 4A7PA 2Y0CA 2YQBA 3CP5A 3SXTA 3ZCFA 2QJPB 1BL9A 1KIBA 4KMGA 4WQAA 4EIFA 1M70A 1HROA 3WFBC 4U3FD 2N18C 3VNWA 3PLNA 1IZL0 1IRVA 2RN0A 3PHLA 1HJ5A 3ZOOA 2PCBB 1CRGA 2B11B 2QJKB 3MK7B 2OZ1B 3HQ8A 2D0WA 5CIFB 1MZ4A 3KHUA 3CYTI 5CICB 1U75B 4RJTA 1DW0A 1H9YA 1CC5A 3H1ID 1GQ1A 5B6QA 1CYJA 5KLVD 1FI3A 4WQCA 1I8PA 4IL6V 5H2FV 1KB0A 3NWVA 3RMZA 1CIEA 2C1DA 3SLEA 4AAOA 4PD4D 3PXSA 1CIHA 1SQXD 4FB1A 4K3IA 2BCNB 2PCCB 4EICA
chains in the Genus database with same CATH superfamily
1F1CA 5CMZA 2N1TA 3AE2C 1LFMA 2C0WA 3OA7A 4KT0J 3BCCJ 4W80A 4WY4D 1MG2D 3TK1A 3CU4A 3L72G 4YXWH 1ZW0A 1GDVA 1VQ4P 5TISV 1KB9E 4JF7A 3LW5H 5APWA 1BE3J 1ETPA 4AANA 2QSIA 2FY8A 1LJ2A 2WQYC 2A06D 3H6PA 2YCCA 5APSA 4HKZH 3USSA 2UWJE 1KN7A 4WQ8A 1L9BC 3T97A 1LTIC 2HR3A 1CCHA 2I8FA 2JQRA 5B5EH 1YFCA 3ORVA 3O6QA 1JOCA 1QL1A 3B5NA 3B8EB 1QGKB 3HUSB 1FU1A 2L5GB 3KZIE 155CA 2K9JA 1EDIA 1CSXA 2KYVA 1CEDA 3VYIA 3B4SA 2QEXP 3V4QA 4L3GA 2JTIB 3CWBJ 3EQ2A 1N73A 1OAEA 1RQUA 3TF5A 2YO3A 4BWNA 3H25A 1KQSO 2CE0A 1NYHA 2A45I 1LMSA 1N9CA 2IYOA 1YEBA 5AVRB 2E74B 3O0RC 1I6EA 3ZDMA 1KV4A 2OYIB 1G2CA 4OGQD 1IO3A 1G2CB 3AE7C 1AJYA 4Y99C 1RE3A 2KSEA 3AE1C 2JWDA 3DP5A 3FWLA 1SQQE 3HD7D 2C1DB 3HD7B 5AVZB 5KJ7A 2ZONG 3NTNA 1NTKK 1SLQA 4R4MA 4O1QA 1L0NE 1OW6A 1DH3A 1E2RA 1H33B 4IFFA 1N7LA 2SPZA 1EZVE 1P84I 3RBZA 3L74E 1YTZT 2N9IA 2FYUJ 4EYYQ 4WQBA 2VHDA 1YICA 3HE5A 3I5CA 1S5LV 3A0BV 1IQCA 1S4XA 3RN0A 4DJGA 4Q5PA 1Y9BA 1T2KC 5KAFV 2KZIA 2IBZD 1PP9G 1H31B 4OVNF 1HF9A 1EB7A 1VQ5P 1SQPG 3H1HJ 3FXDA 5KLVJ 4UB8H 3W67A 2WPQA 4ZKPA 2NPSA 2N3YA 1NTZD 3B71A 4FAVA 4NPDA 1FZCA 1DW2A 1FDOA 1SQQK 2BGVX 3RGUA 1BCCG 1FOCA 1AOQA 3L4FA 2QJPC 4L1QA 1URQD 1XTCC 3BRTB 2R3SA 4EDFA 3AE4C 2OTKE 4AX3A 1LTJB 3JCUH 5B66V 1LC2A 3CX5H 3ZBMA 2V7QJ 3HQ9A 3IN6A 4C7NA 1PGJA 5CIGB 3RN1A 3IAOA 3L74D 2HPCA 2OYHC 1KZUB 4D6TJ 2BLFB 3TYIA 3V2PA 1SVFA 2R32A 1CI6A 4L74A 4HJGH 2A45H 1E5WA 1PIXA 4H0KA 4LLHA 3CXHH 1X22A 1IJDB 2KXPB 1YCCA 3VMAA 2DVHA 1YEAA 1EDLA 3H1KG 1AYGA 3H1JE 3U1CA 1Q7YQ 3H1LE 1CTYA 2YXRB 1NTKJ 2JP3A 3AEEC 3K5BA 3ZOYA 5CIBB 2E74D 4H13C 2V07A 3SSUA 3H1IJ 1EZVG 1FZEA 1NKZB 1Y47A 4GKGA 1GU4A 3JCUE 4WVZA 1QX8A 4PV1D 5CIDB 4RO0A 1N7SC 2QE7H 3AE6C 3E7KA 1JO5A 3G6EP 5CCGD 2O01H 2FYUG 1RF0A 1U57A 2KZJA 3H1HE 3AEAC 2V4HA 3H1KJ 1SQBK 1L4AA 1CSUA 3M0DC 4ASWA 1L4AB 1CHJA 2ZXYA 1J1EB 2VRSA 4H44C 1J1DC 1NU1G 5GTHH 3TGUD 1KILE 2OTLP 2WITA 1H32B 1M7LA 1RF0C 4TLFA 1GL2D 3T97B 3CC4P 2IFMA 3EFGA 2M5AB 351CA 3D6YA 1M56D 2A45G 3FGAD 1ZV8A 1FC2C 1Q86Q 4YPCA 3I56P 2WT7A 3N4XA 3S9OA 1SQPJ 4JYCA 3D70A 1R0QA 3SWYA 5GTIV 2KP8A 4Y99B 3KQGA 4GOFA 3WUIA 4U3FE 1AKKA 3NBTA 1E8EA 2E43A 4JPZB 5IY51 1HJ0A 3CXHI 1CHIA 2BCCJ 2W8ZA 1DW1A 2GB8B 3WU2V 2Y9YA 3WC8A 3GF3A 5APXA 1UIIA 4WQEA 1C6RA 4IL6H 4C46A 1BE3G 3ZCFA 1BL9A 1ZR2A 4WQAA 1M70A 1NTKG 1NTME 2ZT9C 2H88C 1HROA 4U3FD 1QLED 3VNWA 3TYYA 2AEFA 3BCCG 1IZL0 1ZRTE 1SQVG 3PHLA 3WU2E 1EQ7A 5KLVE 2IPPA 5GTHE 1CRGA 1M8OB 1SQQG 2O1JA 2AEMA 2FXPA 1KORA 2FXOA 4AYCA 3V5BA 1GMJA 1JY3N 1H9YA 1S9KD 5B6QA 5E79E 3L75E 5KLVD 2KLUA 4PV1B 1SP4A 2HLOA 2WWWA 1HJBA 3MGNA 3CWBG 3H1LG 3L36A 4TT3H 2JDIH 3R2PA 1X79B 4AAOA 4ZNCA 1SQXK 3PXSA 2G3AA 1CIHA 1NTMJ 1VQ9P 1K05A 1LP1A 4EICA 3RLMA 1L0NJ 1CCRA 4H13D 4HH2A 4RSZA 3QWOC 5CJ4A 1CORA 2IYPA 4UB8V 3H1LJ 5CYTR 4XA4A 1CIGA 2E76D 1FHBA 4W7ZA 1PL5A 2WVRA 1N86A 2PGDA 1JTHB 1KYOH 4NPEA 1PPJG 3AE5C 3V2NA 1SQBD 2GC4D 4WQ7A 2GUVA 4RESB 1FJPA 2QM7A 4ZMDA 1WT6A 1H8AA 1YJ9P 1B7VA 3DR0A 2HV4A 3L71D 1LTJA 2LKMA 1X9VA 1FOSF 1NTMK 1L0LD 1JY3P 1N7SB 2CPBA 2KUBA 2YO2A 4PV1C 1FE6A 1KD1Q 1G1JA 2LITA 5DJQC 2L91A 2RMZA 2O01N 1K3HA 5L8RJ 3NXSA 5AW7B 3VP9A 1J1EC 3KXDA 4OGQB 1QEXA 2HODA 1W5CT 3G71P 3Q5PA 4N6JA 2KI7B 1GU2A 3L75J 1GJQA 4DT0A 4LGDE 2WSFH 2AXTE 1GKSA 5CIEB 2YMKA 5KAFE 1MKMA 1K8AQ 1JEKA 1J1DB 1FJ0A 3V2QA 1C75A 4PJ0H 1RH5B 3RL0D 2B10B 2PAJA 2K9JB 1BGYE 4GEDB 5AVUB 1NAFA 3CX5D 1C2NA 2C0XA 4OWFA 1CXAA 1BGYJ 3RK3B 1IFMA 4U7JA 1AOFA 4C7RA 3CL3D 1KMIZ 4JBZA 1S2EA 2N1TC 3TNUA 1PGOA 4I7ZB 5CCHC 3TNUB 3RK2D 2PFXA 1HVVA 1SQQJ 2YK3A 1SFCB 2LR2A 1VQ8P 1I54A 2QM8A 2O1KA 2GC7D 1S6VB 2N9BA 2QJYB 4K3AA 3H1IG 1VF5C 3CCLP 3O20A 1COTA 2ZZS1 1LTSC 2BASA 3VMXA 2FYUE 1AFOA 2O3JA 2PACA 3H1HD 4WQ9A 1LTGC 2B89A 2ZT9D 1J3SA 5AW0B 1PP9E 1OXZA 4O1WA 5BU8B 1VYDA 2FRCA 1PFIA 2ZT9B 1DX7A 2H8PD 2IX7C 2C8SA 3PXTA 3V2RA 3NBSA 3F5HA 1H1OA 5CHXA 3M97X 4I7ZC 3P7KA 1IFJA 1CI6B 4DZOA 1KX7A 2P7JA 1HGZA 3CPWO 3A0BH 1S5LH 1IFIA 1CYCA 1HCMA 5DF5A 2WSCH 1VPCA 2QJYC 2ZOOA 1DVHA 1LWUC 1PV3A 2KB7P 1C2RA 1L0NK 4N78E 1HTLC 1J2JB 3G3ZA 3AEBC 4YXDC 1I55A 1CSVA 1M1JB 1NAYA 3L35A 1DT1A 1BGYD 2NPSB 1YIJP 3CCEP 3L71J 1EZVI 1AVOA 3RK2B 1WEJF 1E29A 4I1LA 2BEQD 1RE4A 3B5NB 3X39A 4HB1A 5AURA 1BCCJ 1JY3O 1DD3A 2K3RA 2B88A 3KZIH 4KJMA 1FDMA 4FA1A 1LWUB 3CX5W 1S72P 4KHXA 4QAOA 3RL0B 2QIWA 1W2EA 2W83C 4I2LC 3SVWA 1I5TA 3O8ZA 3L73D 5DJUB 1L0LK 1CNOA 3L75D 3AE3C 5DJQB 1RQVA 3U59A 2WMMA 3W68A 2CA3B 1JM0A 2OZ1A 3KPEA 1M90Q 1SQPK 3V6IA 2YNYA 1PGQA 2C1VA 2BCCG 5AVYB 4D6TG 3B5NC 1N2DC 2WPRA 3KDPB 1I6DA 5M1BA 1URQA 2J5UA 4FA4A 2V08A 1P84E 3BCCE 1FZAA 4IFDK 1VQOP 4OGQC 3H1JJ 5KAFH 3L70D 3WFDC 1T3JA 1ZZHA 1LTAC 1F1FA 2Z5IA 2QVAA 1QN2A 5CCHA 4AQRD 2L4DA 3RK3E 1DIIC 2EXVA 3OCDA 4R4LA 5CBOA 4O9BA 5AVSB 1L4AC 4OH8B 2A06G 4H44B 4PJ0V 3G9RA 3RL0C 2P67A 4UB6V 1MUUA 3L71E 2BH4X 4Z1MH 1IRWA 5KAIE 3U1AA 5GTHV 3P8CD 3RK3C 2MJZA 1JMBA 1C7MA 1FZBA 1GW4A 1CSWA 3VP8A 2JJLA 3PXWA 4LJIA 2W90A 1UIXA 2B0ZB 1FBMA 1ZRTD 1FS0E 1LTTC 1KQGB 2KSJA 3GF7A 3L74J 4I6MC 3RL0g 3VTPC 3VOPA 2C2CA 3A0HE 1HUCA 5TJHA 2M5AA 2FFDC 2N1TD 1R8EA 2ORLA 2E5YA 4ASVA 1KYOD 1NTMD 2YIUC 3O6QB 1HJ3A 2AXTV 3NMDA 4A7PA 1DIPA 2Y0CA 2NPSD 3CP5A 1SQXJ 5AVQB 2QJPB 3RK3D 5K5GB 2E74C 5KAIH 2YXQB 3S1KA 4EIFA 3CMAP 3WFBC 3D71A 3HTKA 2OYIC 3L72J 3CCVP 4BXLA 4C7NB 3AE9C 2ZVNB 1HJ5A 2IBZI 3ZOOA 1USDA 3H1IE 2B11B 1N7SD 3CD6P 2QJKB 3MK7B 2OZ1B 3HQ8A 2D0WA 4L76A 2NRGA 1USEA 3H1JG 5CICB 1NKNA 2J58A 5AVWB 2BCCE 1CC5A 1GQ1A 2FFDB 2ZXXA 5GTIE 2KS1B 1FI3A 4WQCA 3BVHA 4IL6V 3AEGC 1M1JC 3RMZA 2B9BA 4WY4B 5CBNA 2C1DA 2NPSC 3WU2H 1U7JA 1EXIA 1JMMA 1T3UA 3MZWB 1CZQA 3FWNA 5TISH 2BCNB 2PCCB 1S1CX 1WVEC 3CXHW 4DCKA 1SQPD 1ZXGA 1R5LA 3O1YA 1VQ7P 3RK2C 3II6A 2C9NY 2P58A 3GW6A 4QMAA 2XNXA 1P84D 1NTZK 2K88A 1JB0J 5B5EV 2E76C 5KAIV 2XNDH 2C1UA 2HODB 3L70E 1FI9A 1IC2A 1CRIA 2WZ7A 1S5LX 3R4YA 1H32A 1I8OA 1IK9A 3P32A 5CCGA 1K73Q 3A7OA 1NWQA 1EXJA 1JY2P 451CA 1LT1A 3WUTA 2FKWB 2N3BA 3FXEA 1GL2A 1WRGA 1LS9A 2FWLA 3HUSA 2N9YB 3L74G 1MFZA 4JCGA 2M0BA 2R44A 5C39A 5CIHB 2YKPA 1AQ5A 2E76B 3HRNA 3M0DA 1T2KD 2AEJA 2ZBOA 1KFNA 1H89A 1CSBA 2B4ZA 1OMIA 3WMM0 3HQ6A 1C52A 1NU1K 3A5TA 3H1KD 2W6JH 1ZMEC 1NTZJ 3CI9A 4ZKUA 3VMZA 3M9QA 1QL4A 4IL6E 1L0LE 3GG2A 3A0HV 1EZVD 1K04A 3BASA 3MD0A 1T6AA 1DW3A 2MTAC 3WFCC 1CYIA 1BCCE 1YNRA 3VRDA 4WQDA 1CTJA 4YTPC 1SS1A 2IFNA 3CLQA 1GD2E 4W7YA 1RF1C 5KLIB 2YMYA 2DGEA 1OZHA 1SQBE 4NFGB 1QKSA 4NPFX 2YIUB 4GIFA 2Q5UA 1GDTA 1NU1D 1NIRA 2E75D 1JNMA 2P2UA 3CWBE 1NOHA 3OW2O 4XXLA 5C0ZA 1L4AD 1KYOE 1OX3A 1NHLA 1QYZA 1PGPA 3CMEP 4EIEA 3HE5B 1L0ND 1SQXG 4GOEA 1H9XA 5H2FE 4AALA 2QJKC 3MK7C 1YIQA 3ZOWA 2ZYAA 3L4OA 5AW4B 2ZYDA 2KNCA 1GTWA 2Q3IA 3MUDC 3L72D 4IOIH 1GL2B 4BRYA 2CPSA 5AW5B 1AVYA 3L72E 2JKVA 3BATA 2H43A 1KQFB 4LC1A 5B66H 1DEEG 5CCGC 3O5CA 1NNOA 2AXTH 1MFTA 2ITAA 3M06A 1N7SA 2WPVB 2Y0EA 1GU5A 1LTJC 1FOSE 3HUSC 1EDJA 2FYNB 2OYOA 1YQ3C 4H0LB 2C9XB 3CXHE 3BCCD 1Z56A 1SQVD 2FYZA 2YKQA 3G4SP 1RAPA 2FYUK 1Q82Q 2AI5A 3RBXA 1CXCA 1P84H 1SQQD 5B66E 1DEBA 1OWAA 3F89A 3QH9A 1URQB 3FX0A 2WSSH 2M8RA 3VYMA 2PP6A 3IR9A 4FANA 2QG4A 3P8CE 4H13B 2KOGA 3HE4B 3WUVA 4PWAA 3HD7A 5KLVG 4J20A 1E79H 5KLVK 1JUNA 3CC7P 1EC5A 1NMLA 3H1LD 2E75C 1WMKA 4RKUJ 3GHGC 4D6TE 3H32B 2C9LY 2CA4B 2R3CA 1H33A 4B86A 2KK7A 2D0SA 2XU6A 4PD4E 3HD7C 2IZ0A 3WUUA 1ZLLA 2CE1A 3OA8B 1NGMB 3L4MA 2M3EA 5APVA 2MKVA 5APUA 1LNQA 1OVUA 3TGUE 1A8CA 3D0WA 5AW8B 1SQVE 3JC22 1PPJD 3GLMA 2E75B 1SQBG 3ABVC 5AW3B 1VQNP 1KB9D 3L37A 1SFCA 3Q3DA 1X8YA 2WPSA 3L71G 5H2FH 1RZ5A 2W27A 2ZAEB 3S4RA 1L0LG 4BRYB 3OAKA 2A06E 1KX2A 1KFMA 2WT7B 1RF1B 5KLIC 5CJ0A 3PH2B 3GHGB 1DIQC 1PP9D 2IBZG 2H89C 2NZ2A 3MTUE 5EFWB 1MG3D 3SWFA 1JDLA 2D2CB 1CRHA 5GTIH 1L9JC 4FA5A 2HYNA 1OCDA 3A9FA 1NTZG 3MHVA 1KILD 2HPCB 1KILB 2Q7CA 1BCCD 1LTBC 1YBKA 1SQXE 2J59M 2DW3A 1HGVA 2GM4A 3HQ7A 2ZYGA 1KB9I 2JWAA 3CCUP 4UB6E 1Q81Q 2M3BA 2QRXA 2XV5A 4H0LD 2XZRA 4IFMA 1LGHB 2I8DA 2ZXEB 1BDCA 1QL2A 1BSNA 3MIWA 4GODA 3Q5RA 4M3LA 1FZFA 1KIBA 1N8RQ 2XKMA 3C9IA 4GT1A 5AW6B 2D2CC 3SWKA 2JEEA 1IRVA 2RN0A 1GL2C 3P8MC 1AA0A 1KQLA 1VDFA 3KYQA 3CCRP 1VQMP 5CIFB 2E42A 1XTGB 1YJNP 3KHUA 2FBWC 3TGUJ 2BEZF 2N1TB 1U75B 4RJTA 1DD4A 2B87B 2LXCB 1FZCC 2B87A 1DW0A 3H1ID 2GA1A 1ZP0C 1OW7A 1G1IA 1NVOA 2WSCJ 5H2FV 1PZQA 1KB0A 1VF5B 2FYNC 2Q1KA 2HG5D 3H1HG 3SLEA 1LT9A 4H0LC 2WSEH 3AEDC 3MP7B 2WSFJ 2P1JA 1VF5D 4WY4C 5AVTB 2OQQA 1N73C 1D7MA 4Y5RA 3H1KE 2FYUD 1Y8AA 5KKZB 2OGUA 3LW5J 3JBTB 2K9YA 4MU8A 1SQPE 1CHHA 1KB9H 1FZCB 3C1LA 1RF1A 1CW5A 1M57D 3DMIA 4CPGA 1A02J 2N9JA 5EXQA 3UIAA 2ZFCA 1YHQP 3CCSP 4P4QB 3GMAA 4XYDB 3TGUG 2YKOA 2KLVA 4XFJA 1CO6A 3M9HA 4MN4C 3SJLA 1K3GA 2ZVOB 1N73B 4WWIA 1VQKP 4XE5B 3CX5E 1RZ6A 1N15A 1NTZE 1U7MA 4N3YB 4JQ0D 5BVZA 1N50A 1VQPP 4Y28J 4EIDA 3Q2YA 3SFDC 4FA9A 5AW2B 2OYIA 4L3HA 1FZGA 3TSIA 2D2CD 2R5BA 2KIKA 1FCDC 4L75A 3WFEC 1JCCA 5AW9B 2GIWA 2IDBA 3ZIYA 3HE4A 2BPBB 1YI2P 2XTSB 1ZN5A 2W6AA 1M1JA 2AXCA 2W6BA 3LIDA 1JCDA 3ZOXA 1KTMA 2JO1A 1S9KE 1IO4A 1FDIA 1PP9J 2HFED 3EWKA 1W2LA 1A02F 3IF4A 1BE3D 4V2KA 1OW8A 1NTKD 1SFCD 3JSVC 4U3FG 2BCCD 4D6TD 1JY2O 1KV9A 1FI7A 1M6ZA 1K9MQ 1LT9B 1FAVA 1LC1A 1L2PA 1OFCX 1VQLP 1H31A 3PP5A 1LP1B 2Q9IA 2ZJSE 3L70G 1SQBJ 2LIRA 1GZLA 2LXBA 2V7QH 3SWSA 2PRRA 3CCJP 5C9MA 2P10A 1R5SA 5E79H 4EI2A 1KILC 2QA4P 1JY2N 2FXMA 4WB4A 2BH5X 2G8YA 3CWBD 4EIJA 1RY3A 2JR8A 1H0TB 2FFDA 2IZ1A 1HZVA 2E5TA 1X0TA 1BDDA 2K1AA 2Z4EA 1YITP 2K37A 5AVXB 3AECC 5DJTB 3ITKA 1TU3F 1IFDA 1AV1A 4H0JA 4YE1A 3M0AA 2CK3H 3PH0A 2Z5HA 3VN0A 3D6ZA 1LT9C 1CTZA 1HBWA 2OTJP 1KC8Q 1U74B 5DFSA 1RE4C 1HJ4A 3IFMA 1BE3E 1VL2A 1QVFO 1NTMG 2AIUA 4N0KA 1GIWA 3L73E 3A3YB 4PJ0E 3SFEC 4WBAA 2WSEJ 1HH7A 2I1KA 1RAQA 5KKZC 2KNCB 3CXHD 3KZIV 1QVGO 2B12B 1KYOW 1C6SA 1YQ4C 1KYOI 1HZUA 1HRCA 1PPJE 5BU5A 5KTBA 2WTYA 3H32A 1EDKA 3AE8C 1NU1J 3CCMP 3E1RA 4UB8E 2Y0DA 1GK4A 2MHMA 4HYTB 3H1JD 1SQVJ 5APYA 4GYDA 4L73A 5AVVB 1YJWP 3TDKA 1NTKE 1YYCA 1URQC 1CRJA 5APTA 3B5ND 4EOTA 4DY9A 1A56A 3M91A 1N90A 1CIFA 1DVVA 5E79V 1CRYA 1H88A 2CXBA 1VQ6P 1QL3A 3L70J 5CCHD 2Q6QA 3Q5SA 1S3JA 1ZOYC 3CCQP 2RH0A 4H44D 1A2SA 4PD4H 1L0LJ 1JTHA 1M60A 2KS1A 5B5EE 1SQVK 3C2CA 4AAMA 3E1IA 1CRCA 1SFCC 3EFFK 1RHZB 1YTCA 1MZ9A 1NMIA 1W2BO 4PW9B 1OIPA 1MV8A 2OYHA 5KJ7C 3PJSK 1NU1E 1NJIQ 3OCDB 2H7HA 1W5CE 1C6OA 4UB6H 3I55P 5KJ7D 3AEFC 1T8ZA 1KILA 2N18B 3OA8A 5APQA 2IBZE 4N78D 3OJAB 1OVRA 4GDOA 1IFPA 1NH4A 1GW3A 3PTZA 1M1KQ 3PRJA 1ZR4A 2RKLA 2OARA 1GK6A 2XDJA 3M9BA 3LIEA 1AQTA 4AUWA 1S5LE 3A0BE 3MUDA 2O01J 2Q3EA 2GUSA 1IK7A 3GHGA 1OVVA 3A2AA 2Y9ZA 3N7NA 2YQBA 2I1JA 4PD4I 3SXTA 3BRVB 3CC2P 1Q90D 4KMGA 1LWUA 2N18C 3HTKB 1BGYG 3PLNA 1HWTC 1BSHA 4U3FJ 1Q2NA 1HH0A 2PCBB 2R5DA 1MZ4A 3V4WA 4K35A 1IZNB 1IFNA 3CYTI 1FJKA 1YTZI 4IL6X 1NO4A 3C8VA 1RE3C 3Q1MA 1H0TA 3L73J 4JYBA 1CYJA 3CX5I 1I8PA 4WY4A 3L73G 3A0HH 5TISE 3NWVA 3L75G 1CIEA 2POHA 4DOJA 1L0NG 5AW1B 4PD4D 3VMYA 1SQXD 4FB1A 3NFQA 2OYHB 4K3IA
chains in the Genus database with same CATH topology
3RLMA 1CCRA 1F1CA 4RSZA 4Y5RA 1WVEC 3CXHW 2FYUD 1SQPD 5KKZB 1CORA 3O1YA 3JBTB 1LFMA 4UB8V 5CYTR 4MU8A 1CHHA 1CIGA 1MG2D 3GW6A 3CU4A 3DMIA 1FHBA 1GDVA 1P84D 2N9JA 5EXQA 5TISV 4P4QB 4XYDB 5B5EV 5KAIV 1SQBD 2GC4D 1ETPA 2C1UA 4WQ7A 4AANA 1FI9A 1B7VA 3DR0A 2HV4A 1CRIA 1CO6A 2A06D 3L71D 2YCCA 3SJLA 1K3GA 1H32A 1I8OA 4WQ8A 1L0LD 1L9BC 451CA 2LITA 2N3BA 1CCHA 2I8FA 1RZ6A 1N15A 2JQRA 1LS9A 2FWLA 5DJQC 2L91A 1YFCA 3ORVA 1N50A 2RMZA 2N9YB 1K3HA 4EIDA 4JCGA 4FA9A 5CIHB 4L3HA 155CA 1CSXA 1CEDA 1W5CT 2ZBOA 1FCDC 2B4ZA 4L3GA 1GU2A 3HQ6A 1GJQA 3WFEC 1C52A 2JTIB 2GIWA 3ZIYA 3H1KD 1GKSA 5CIEB 1OAEA 2BPBB 2XTSB 3TF5A 1FJ0A 2CE0A 1QL4A 3ZOXA 1LMSA 1N9CA 1YEBA 3GG2A 3A0HV 1EZVD 3O0RC 1I6EA 1W2LA 1C75A 1BE3D 4V2KA 1DW3A 2MTAC 3WFCC 1CYIA 2B10B 2K9JB 4GEDB 1NTKD 1YNRA 3VRDA 3CX5D 1IO3A 1C2NA 4WQDA 2BCCD 4D6TD 1CTJA 1CXAA 3DP5A 1KV9A 5KLIB 1FI7A 1M6ZA 2DGEA 3FWLA 2C1DB 1AOFA 1LC1A 2ZONG 1H31A 4NFGB 1QKSA 4O1QA 2YIUB 1NU1D 2LIRA 2YK3A 1NIRA 1I54A 3SWSA 2GC7D 5C9MA 1E2RA 1H33B 1S6VB 2QJYB 3O20A 1COTA 4XXLA 2ZZS1 5C0ZA 2BH5X 3CWBD 1QYZA 2O3JA 2N9IA 2PACA 3H1HD 4WQ9A 4EIEA 1HZVA 1J3SA 1L0ND 4WQBA 2VHDA 1YICA 1S5LV 3A0BV 1IQCA 3RN0A 4O1WA 1H9XA 1VYDA 4Q5PA 2FRCA 5KAFV 4AALA 2IBZD 1H31B 3MK7C 1YIQA 3ITKA 1EB7A 3ZOWA 4H0JA 4YE1A 3L4OA 2C8SA 3PXTA 3NBSA 3L72D 1CTZA 2N3YA 1NTZD 4FAVA 1H1OA 1U74B 3M97X 5DFSA 1HJ4A 1DW2A 2BGVX 1KX7A 1FOCA 1AOQA 1CYCA 1HCMA 2AIUA 4N0KA 4L1QA 1GIWA 5DF5A 3O5CA 1NNOA 4EDFA 2ZOOA 1DVHA 4AX3A 5B66V 1HH7A 1LC2A 1C2RA 1RAQA 2KNCB 2Y0EA 3ZBMA 3CXHD 3KZIV 1I55A 1CSVA 2B12B 2FYNB 1KYOW 3HQ9A 1C6SA 1DT1A 1BGYD 1HZUA 5CIGB 2C9XB 1HRCA 3RN1A 3BCCD 1WEJF 3L74D 1E29A 1SQVD 1RAPA 2BLFB 3TYIA 2AI5A 1CXCA 1SQQD 3X39A 4H0KA 5AURA 2Y0DA 1YCCA 2MHMA 3VMAA 3H1JD 2DVHA 4GYDA 1YEAA 1AYGA 3VYMA 3TDKA 4FA1A 4FANA 2QG4A 1CTYA 3CX5W 4QAOA 4PWAA 4J20A 3ZOYA 1CRJA 5CIBB 3SVWA 2V07A 1I5TA 1NMLA 3H1LD 3L73D 1CNOA 3L75D 5DJQB 4DY9A 1A56A 2CA3B 1N90A 1CIFA 1DVVA 5E79V 1CRYA 2OZ1A 2CXBA 2CA4B 1QL3A 1H33A 5CIDB 2C1VA 2D0SA 1I6DA 2CE1A 4FA4A 3OA8B 1A2SA 2V08A 3L4MA 1M60A 2KS1A 3C2CA 4AAMA 1CRCA 1CSUA 1CHJA 3L70D 1A8CA 1YTCA 2ZXYA 3WFDC 1ZZHA 1F1FA 1NMIA 1PPJD 1QN2A 4PW9B 3TGUD 2L4DA 1DIIC 1KB9D 2EXVA 3OCDA 1H32B 3OCDB 1RZ5A 4PJ0V 1C6OA 351CA 4UB6V 1KX2A 2N18B 3OA8A 2BH4X 1IRWA 5GTHV 1C7MA 3PH2B 1DIQC 1CSWA 1PP9D 3PXWA 1R0QA 4LJIA 5GTIV 2B0ZB 1ZRTD 1MG3D 1JDLA 1CRHA 3PTZA 3WUIA 1L9JC 3PRJA 4FA5A 1OCDA 3A9FA 1AKKA 2C2CA 3NBTA 1E8EA 5TJHA 5IY51 1BCCD 2ORLA 1CHIA 1DW1A 2GB8B 3WU2V 1KYOD 3WC8A 1NTMD 3HQ7A 2Q3EA 1HJ3A 2AXTV 4WQEA 1C6RA 2JWAA 4A7PA 2Y0CA 2YQBA 3CP5A 3SXTA 3ZCFA 2QJPB 1BL9A 1KIBA 4KMGA 4WQAA 4EIFA 1M70A 1HROA 3WFBC 4U3FD 2N18C 3VNWA 3PLNA 1IZL0 1IRVA 2RN0A 3PHLA 1HJ5A 3ZOOA 2PCBB 1CRGA 2B11B 2QJKB 3MK7B 2OZ1B 3HQ8A 2D0WA 5CIFB 1MZ4A 3KHUA 3CYTI 5CICB 1U75B 4RJTA 1DW0A 1H9YA 1CC5A 3H1ID 1GQ1A 5B6QA 1CYJA 5KLVD 1FI3A 4WQCA 1I8PA 4IL6V 5H2FV 1KB0A 3NWVA 3RMZA 1CIEA 2C1DA 3SLEA 4AAOA 4PD4D 3PXSA 1CIHA 1SQXD 4FB1A 4K3IA 2BCNB 2PCCB 4EICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLM A;  1CCR A;  1F1C A;  4RSZ A;  4Y5R A;  1WVE C;  3CXH W;  2FYU D;  1SQP D;  5KKZ B;  1COR A;  3O1Y A;  3JBT B;  1LFM A;  4UB8 V;  5CYT R;  4MU8 A;  1CHH A;  1CIG A;  1MG2 D;  3GW6 A;  3CU4 A;  3DMI A;  1FHB A;  1GDV A;  1P84 D;  2N9J A;  5EXQ A;  5TIS V;  4P4Q B;  4XYD B;  5B5E V;  5KAI V;  1SQB D;  2GC4 D;  1ETP A;  2C1U A;  4WQ7 A;  4AAN A;  1FI9 A;  1B7V A;  3DR0 A;  2HV4 A;  1CRI A;  1CO6 A;  2A06 D;  3L71 D;  2YCC A;  3SJL A;  1K3G A;  1H32 A;  1I8O A;  4WQ8 A;  1L0L D;  1L9B C;  451C A;  2LIT A;  2N3B A;  1CCH A;  2I8F A;  1RZ6 A;  1N15 A;  2JQR A;  1LS9 A;  2FWL A;  5DJQ C;  2L91 A;  1YFC A;  3ORV A;  1N50 A;  2RMZ A;  2N9Y B;  1K3H A;  4EID A;  4JCG A;  4FA9 A;  5CIH B;  4L3H A;  155C A;  1CSX A;  1CED A;  1W5C T;  2ZBO A;  1FCD C;  2B4Z A;  4L3G A;  1GU2 A;  3HQ6 A;  1GJQ A;  3WFE C;  1C52 A;  2JTI B;  2GIW A;  3ZIY A;  3H1K D;  1GKS A;  5CIE B;  1OAE A;  2BPB B;  2XTS B;  3TF5 A;  1FJ0 A;  2CE0 A;  1QL4 A;  3ZOX A;  1LMS A;  1N9C A;  1YEB A;  3GG2 A;  3A0H V;  1EZV D;  3O0R C;  1I6E A;  1W2L A;  1C75 A;  1BE3 D;  4V2K A;  1DW3 A;  2MTA C;  3WFC C;  1CYI A;  2B10 B;  2K9J B;  4GED B;  1NTK D;  1YNR A;  3VRD A;  3CX5 D;  1IO3 A;  1C2N A;  4WQD A;  2BCC D;  4D6T D;  1CTJ A;  1CXA A;  3DP5 A;  1KV9 A;  5KLI B;  1FI7 A;  1M6Z A;  2DGE A;  3FWL A;  2C1D B;  1AOF A;  1LC1 A;  2ZON G;  1H31 A;  4NFG B;  1QKS A;  4O1Q A;  2YIU B;  1NU1 D;  2LIR A;  2YK3 A;  1NIR A;  1I54 A;  3SWS A;  2GC7 D;  5C9M A;  1E2R A;  1H33 B;  1S6V B;  2QJY B;  3O20 A;  1COT A;  4XXL A;  2ZZS 1;  5C0Z A;  2BH5 X;  3CWB D;  1QYZ A;  2O3J A;  2N9I A;  2PAC A;  3H1H D;  4WQ9 A;  4EIE A;  1HZV A;  1J3S A;  1L0N D;  4WQB A;  2VHD A;  1YIC A;  1S5L V;  3A0B V;  1IQC A;  3RN0 A;  4O1W A;  1H9X A;  1VYD A;  4Q5P A;  2FRC A;  5KAF V;  4AAL A;  2IBZ D;  1H31 B;  3MK7 C;  1YIQ A;  3ITK A;  1EB7 A;  3ZOW A;  4H0J A;  4YE1 A;  3L4O A;  2C8S A;  3PXT A;  3NBS A;  3L72 D;  1CTZ A;  2N3Y A;  1NTZ D;  4FAV A;  1H1O A;  1U74 B;  3M97 X;  5DFS A;  1HJ4 A;  1DW2 A;  2BGV X;  1KX7 A;  1FOC A;  1AOQ A;  1CYC A;  1HCM A;  2AIU A;  4N0K A;  4L1Q A;  1GIW A;  5DF5 A;  3O5C A;  1NNO A;  4EDF A;  2ZOO A;  1DVH A;  4AX3 A;  5B66 V;  1HH7 A;  1LC2 A;  1C2R A;  1RAQ A;  2KNC B;  2Y0E A;  3ZBM A;  3CXH D;  3KZI V;  1I55 A;  1CSV A;  2B12 B;  2FYN B;  1KYO W;  3HQ9 A;  1C6S A;  1DT1 A;  1BGY D;  1HZU A;  5CIG B;  2C9X B;  1HRC A;  3RN1 A;  3BCC D;  1WEJ F;  3L74 D;  1E29 A;  1SQV D;  1RAP A;  2BLF B;  3TYI A;  2AI5 A;  1CXC A;  1SQQ D;  3X39 A;  4H0K A;  5AUR A;  2Y0D A;  1YCC A;  2MHM A;  3VMA A;  3H1J D;  2DVH A;  4GYD A;  1YEA A;  1AYG A;  3VYM A;  3TDK A;  4FA1 A;  4FAN A;  2QG4 A;  1CTY A;  3CX5 W;  4QAO A;  4PWA A;  4J20 A;  3ZOY A;  1CRJ A;  5CIB B;  3SVW A;  2V07 A;  1I5T A;  1NML A;  3H1L D;  3L73 D;  1CNO A;  3L75 D;  5DJQ B;  4DY9 A;  1A56 A;  2CA3 B;  1N90 A;  1CIF A;  1DVV A;  5E79 V;  1CRY A;  2OZ1 A;  2CXB A;  2CA4 B;  1QL3 A;  1H33 A;  5CID B;  2C1V A;  2D0S A;  1I6D A;  2CE1 A;  4FA4 A;  3OA8 B;  1A2S A;  2V08 A;  3L4M A;  1M60 A;  2KS1 A;  3C2C A;  4AAM A;  1CRC A;  1CSU A;  1CHJ A;  3L70 D;  1A8C A;  1YTC A;  2ZXY A;  3WFD C;  1ZZH A;  1F1F A;  1NMI A;  1PPJ D;  1QN2 A;  4PW9 B;  3TGU D;  2L4D A;  1DII C;  1KB9 D;  2EXV A;  3OCD A;  1H32 B;  3OCD B;  1RZ5 A;  4PJ0 V;  1C6O A;  351C A;  4UB6 V;  1KX2 A;  2N18 B;  3OA8 A;  2BH4 X;  1IRW A;  5GTH V;  1C7M A;  3PH2 B;  1DIQ C;  1CSW A;  1PP9 D;  3PXW A;  1R0Q A;  4LJI A;  5GTI V;  2B0Z B;  1ZRT D;  1MG3 D;  1JDL A;  1CRH A;  3PTZ A;  3WUI A;  1L9J C;  3PRJ A;  4FA5 A;  1OCD A;  3A9F A;  1AKK A;  2C2C A;  3NBT A;  1E8E A;  5TJH A;  5IY5 1;  1BCC D;  2ORL A;  1CHI A;  1DW1 A;  2GB8 B;  3WU2 V;  1KYO D;  3WC8 A;  1NTM D;  3HQ7 A;  2Q3E A;  1HJ3 A;  2AXT V;  4WQE A;  1C6R A;  2JWA A;  4A7P A;  2Y0C A;  2YQB A;  3CP5 A;  3SXT A;  3ZCF A;  2QJP B;  1BL9 A;  1KIB A;  4KMG A;  4WQA A;  4EIF A;  1M70 A;  1HRO A;  3WFB C;  4U3F D;  2N18 C;  3VNW A;  3PLN A;  1IZL 0;  1IRV A;  2RN0 A;  3PHL A;  1HJ5 A;  3ZOO A;  2PCB B;  1CRG A;  2B11 B;  2QJK B;  3MK7 B;  2OZ1 B;  3HQ8 A;  2D0W A;  5CIF B;  1MZ4 A;  3KHU A;  3CYT I;  5CIC B;  1U75 B;  4RJT A;  1DW0 A;  1H9Y A;  1CC5 A;  3H1I D;  1GQ1 A;  5B6Q A;  1CYJ A;  5KLV D;  1FI3 A;  4WQC A;  1I8P A;  4IL6 V;  5H2F V;  1KB0 A;  3NWV A;  3RMZ A;  1CIE A;  2C1D A;  3SLE A;  4AAO A;  4PD4 D;  3PXS A;  1CIH A;  1SQX D;  4FB1 A;  4K3I A;  2BCN B;  2PCC B;  4EIC A; 
#chains in the Genus database with same CATH topology
 1F1C A;  5CMZ A;  2N1T A;  3AE2 C;  1LFM A;  2C0W A;  3OA7 A;  4KT0 J;  3BCC J;  4W80 A;  4WY4 D;  1MG2 D;  3TK1 A;  3CU4 A;  3L72 G;  4YXW H;  1ZW0 A;  1GDV A;  1VQ4 P;  5TIS V;  1KB9 E;  4JF7 A;  3LW5 H;  5APW A;  1BE3 J;  1ETP A;  4AAN A;  2QSI A;  2FY8 A;  1LJ2 A;  2WQY C;  2A06 D;  3H6P A;  2YCC A;  5APS A;  4HKZ H;  3USS A;  2UWJ E;  1KN7 A;  4WQ8 A;  1L9B C;  3T97 A;  1LTI C;  2HR3 A;  1CCH A;  2I8F A;  2JQR A;  5B5E H;  1YFC A;  3ORV A;  3O6Q A;  1JOC A;  1QL1 A;  3B5N A;  3B8E B;  1QGK B;  3HUS B;  1FU1 A;  2L5G B;  3KZI E;  155C A;  2K9J A;  1EDI A;  1CSX A;  2KYV A;  1CED A;  3VYI A;  3B4S A;  2QEX P;  3V4Q A;  4L3G A;  2JTI B;  3CWB J;  3EQ2 A;  1N73 A;  1OAE A;  1RQU A;  3TF5 A;  2YO3 A;  4BWN A;  3H25 A;  1KQS O;  2CE0 A;  1NYH A;  2A45 I;  1LMS A;  1N9C A;  2IYO A;  1YEB A;  5AVR B;  2E74 B;  3O0R C;  1I6E A;  3ZDM A;  1KV4 A;  2OYI B;  1G2C A;  4OGQ D;  1IO3 A;  1G2C B;  3AE7 C;  1AJY A;  4Y99 C;  1RE3 A;  2KSE A;  3AE1 C;  2JWD A;  3DP5 A;  3FWL A;  1SQQ E;  3HD7 D;  2C1D B;  3HD7 B;  5AVZ B;  5KJ7 A;  2ZON G;  3NTN A;  1NTK K;  1SLQ A;  4R4M A;  4O1Q A;  1L0N E;  1OW6 A;  1DH3 A;  1E2R A;  1H33 B;  4IFF A;  1N7L A;  2SPZ A;  1EZV E;  1P84 I;  3RBZ A;  3L74 E;  1YTZ T;  2N9I A;  2FYU J;  4EYY Q;  4WQB A;  2VHD A;  1YIC A;  3HE5 A;  3I5C A;  1S5L V;  3A0B V;  1IQC A;  1S4X A;  3RN0 A;  4DJG A;  4Q5P A;  1Y9B A;  1T2K C;  5KAF V;  2KZI A;  2IBZ D;  1PP9 G;  1H31 B;  4OVN F;  1HF9 A;  1EB7 A;  1VQ5 P;  1SQP G;  3H1H J;  3FXD A;  5KLV J;  4UB8 H;  3W67 A;  2WPQ A;  4ZKP A;  2NPS A;  2N3Y A;  1NTZ D;  3B71 A;  4FAV A;  4NPD A;  1FZC A;  1DW2 A;  1FDO A;  1SQQ K;  2BGV X;  3RGU A;  1BCC G;  1FOC A;  1AOQ A;  3L4F A;  2QJP C;  4L1Q A;  1URQ D;  1XTC C;  3BRT B;  2R3S A;  4EDF A;  3AE4 C;  2OTK E;  4AX3 A;  1LTJ B;  3JCU H;  5B66 V;  1LC2 A;  3CX5 H;  3ZBM A;  2V7Q J;  3HQ9 A;  3IN6 A;  4C7N A;  1PGJ A;  5CIG B;  3RN1 A;  3IAO A;  3L74 D;  2HPC A;  2OYH C;  1KZU B;  4D6T J;  2BLF B;  3TYI A;  3V2P A;  1SVF A;  2R32 A;  1CI6 A;  4L74 A;  4HJG H;  2A45 H;  1E5W A;  1PIX A;  4H0K A;  4LLH A;  3CXH H;  1X22 A;  1IJD B;  2KXP B;  1YCC A;  3VMA A;  2DVH A;  1YEA A;  1EDL A;  3H1K G;  1AYG A;  3H1J E;  3U1C A;  1Q7Y Q;  3H1L E;  1CTY A;  2YXR B;  1NTK J;  2JP3 A;  3AEE C;  3K5B A;  3ZOY A;  5CIB B;  2E74 D;  4H13 C;  2V07 A;  3SSU A;  3H1I J;  1EZV G;  1FZE A;  1NKZ B;  1Y47 A;  4GKG A;  1GU4 A;  3JCU E;  4WVZ A;  1QX8 A;  4PV1 D;  5CID B;  4RO0 A;  1N7S C;  2QE7 H;  3AE6 C;  3E7K A;  1JO5 A;  3G6E P;  5CCG D;  2O01 H;  2FYU G;  1RF0 A;  1U57 A;  2KZJ A;  3H1H E;  3AEA C;  2V4H A;  3H1K J;  1SQB K;  1L4A A;  1CSU A;  3M0D C;  4ASW A;  1L4A B;  1CHJ A;  2ZXY A;  1J1E B;  2VRS A;  4H44 C;  1J1D C;  1NU1 G;  5GTH H;  3TGU D;  1KIL E;  2OTL P;  2WIT A;  1H32 B;  1M7L A;  1RF0 C;  4TLF A;  1GL2 D;  3T97 B;  3CC4 P;  2IFM A;  3EFG A;  2M5A B;  351C A;  3D6Y A;  1M56 D;  2A45 G;  3FGA D;  1ZV8 A;  1FC2 C;  1Q86 Q;  4YPC A;  3I56 P;  2WT7 A;  3N4X A;  3S9O A;  1SQP J;  4JYC A;  3D70 A;  1R0Q A;  3SWY A;  5GTI V;  2KP8 A;  4Y99 B;  3KQG A;  4GOF A;  3WUI A;  4U3F E;  1AKK A;  3NBT A;  1E8E A;  2E43 A;  4JPZ B;  5IY5 1;  1HJ0 A;  3CXH I;  1CHI A;  2BCC J;  2W8Z A;  1DW1 A;  2GB8 B;  3WU2 V;  2Y9Y A;  3WC8 A;  3GF3 A;  5APX A;  1UII A;  4WQE A;  1C6R A;  4IL6 H;  4C46 A;  1BE3 G;  3ZCF A;  1BL9 A;  1ZR2 A;  4WQA A;  1M70 A;  1NTK G;  1NTM E;  2ZT9 C;  2H88 C;  1HRO A;  4U3F D;  1QLE D;  3VNW A;  3TYY A;  2AEF A;  3BCC G;  1IZL 0;  1ZRT E;  1SQV G;  3PHL A;  3WU2 E;  1EQ7 A;  5KLV E;  2IPP A;  5GTH E;  1CRG A;  1M8O B;  1SQQ G;  2O1J A;  2AEM A;  2FXP A;  1KOR A;  2FXO A;  4AYC A;  3V5B A;  1GMJ A;  1JY3 N;  1H9Y A;  1S9K D;  5B6Q A;  5E79 E;  3L75 E;  5KLV D;  2KLU A;  4PV1 B;  1SP4 A;  2HLO A;  2WWW A;  1HJB A;  3MGN A;  3CWB G;  3H1L G;  3L36 A;  4TT3 H;  2JDI H;  3R2P A;  1X79 B;  4AAO A;  4ZNC A;  1SQX K;  3PXS A;  2G3A A;  1CIH A;  1NTM J;  1VQ9 P;  1K05 A;  1LP1 A;  4EIC A;  3RLM A;  1L0N J;  1CCR A;  4H13 D;  4HH2 A;  4RSZ A;  3QWO C;  5CJ4 A;  1COR A;  2IYP A;  4UB8 V;  3H1L J;  5CYT R;  4XA4 A;  1CIG A;  2E76 D;  1FHB A;  4W7Z A;  1PL5 A;  2WVR A;  1N86 A;  2PGD A;  1JTH B;  1KYO H;  4NPE A;  1PPJ G;  3AE5 C;  3V2N A;  1SQB D;  2GC4 D;  4WQ7 A;  2GUV A;  4RES B;  1FJP A;  2QM7 A;  4ZMD A;  1WT6 A;  1H8A A;  1YJ9 P;  1B7V A;  3DR0 A;  2HV4 A;  3L71 D;  1LTJ A;  2LKM A;  1X9V A;  1FOS F;  1NTM K;  1L0L D;  1JY3 P;  1N7S B;  2CPB A;  2KUB A;  2YO2 A;  4PV1 C;  1FE6 A;  1KD1 Q;  1G1J A;  2LIT A;  5DJQ C;  2L91 A;  2RMZ A;  2O01 N;  1K3H A;  5L8R J;  3NXS A;  5AW7 B;  3VP9 A;  1J1E C;  3KXD A;  4OGQ B;  1QEX A;  2HOD A;  1W5C T;  3G71 P;  3Q5P A;  4N6J A;  2KI7 B;  1GU2 A;  3L75 J;  1GJQ A;  4DT0 A;  4LGD E;  2WSF H;  2AXT E;  1GKS A;  5CIE B;  2YMK A;  5KAF E;  1MKM A;  1K8A Q;  1JEK A;  1J1D B;  1FJ0 A;  3V2Q A;  1C75 A;  4PJ0 H;  1RH5 B;  3RL0 D;  2B10 B;  2PAJ A;  2K9J B;  1BGY E;  4GED B;  5AVU B;  1NAF A;  3CX5 D;  1C2N A;  2C0X A;  4OWF A;  1CXA A;  1BGY J;  3RK3 B;  1IFM A;  4U7J A;  1AOF A;  4C7R A;  3CL3 D;  1KMI Z;  4JBZ A;  1S2E A;  2N1T C;  3TNU A;  1PGO A;  4I7Z B;  5CCH C;  3TNU B;  3RK2 D;  2PFX A;  1HVV A;  1SQQ J;  2YK3 A;  1SFC B;  2LR2 A;  1VQ8 P;  1I54 A;  2QM8 A;  2O1K A;  2GC7 D;  1S6V B;  2N9B A;  2QJY B;  4K3A A;  3H1I G;  1VF5 C;  3CCL P;  3O20 A;  1COT A;  2ZZS 1;  1LTS C;  2BAS A;  3VMX A;  2FYU E;  1AFO A;  2O3J A;  2PAC A;  3H1H D;  4WQ9 A;  1LTG C;  2B89 A;  2ZT9 D;  1J3S A;  5AW0 B;  1PP9 E;  1OXZ A;  4O1W A;  5BU8 B;  1VYD A;  2FRC A;  1PFI A;  2ZT9 B;  1DX7 A;  2H8P D;  2IX7 C;  2C8S A;  3PXT A;  3V2R A;  3NBS A;  3F5H A;  1H1O A;  5CHX A;  3M97 X;  4I7Z C;  3P7K A;  1IFJ A;  1CI6 B;  4DZO A;  1KX7 A;  2P7J A;  1HGZ A;  3CPW O;  3A0B H;  1S5L H;  1IFI A;  1CYC A;  1HCM A;  5DF5 A;  2WSC H;  1VPC A;  2QJY C;  2ZOO A;  1DVH A;  1LWU C;  1PV3 A;  2KB7 P;  1C2R A;  1L0N K;  4N78 E;  1HTL C;  1J2J B;  3G3Z A;  3AEB C;  4YXD C;  1I55 A;  1CSV A;  1M1J B;  1NAY A;  3L35 A;  1DT1 A;  1BGY D;  2NPS B;  1YIJ P;  3CCE P;  3L71 J;  1EZV I;  1AVO A;  3RK2 B;  1WEJ F;  1E29 A;  4I1L A;  2BEQ D;  1RE4 A;  3B5N B;  3X39 A;  4HB1 A;  5AUR A;  1BCC J;  1JY3 O;  1DD3 A;  2K3R A;  2B88 A;  3KZI H;  4KJM A;  1FDM A;  4FA1 A;  1LWU B;  3CX5 W;  1S72 P;  4KHX A;  4QAO A;  3RL0 B;  2QIW A;  1W2E A;  2W83 C;  4I2L C;  3SVW A;  1I5T A;  3O8Z A;  3L73 D;  5DJU B;  1L0L K;  1CNO A;  3L75 D;  3AE3 C;  5DJQ B;  1RQV A;  3U59 A;  2WMM A;  3W68 A;  2CA3 B;  1JM0 A;  2OZ1 A;  3KPE A;  1M90 Q;  1SQP K;  3V6I A;  2YNY A;  1PGQ A;  2C1V A;  2BCC G;  5AVY B;  4D6T G;  3B5N C;  1N2D C;  2WPR A;  3KDP B;  1I6D A;  5M1B A;  1URQ A;  2J5U A;  4FA4 A;  2V08 A;  1P84 E;  3BCC E;  1FZA A;  4IFD K;  1VQO P;  4OGQ C;  3H1J J;  5KAF H;  3L70 D;  3WFD C;  1T3J A;  1ZZH A;  1LTA C;  1F1F A;  2Z5I A;  2QVA A;  1QN2 A;  5CCH A;  4AQR D;  2L4D A;  3RK3 E;  1DII C;  2EXV A;  3OCD A;  4R4L A;  5CBO A;  4O9B A;  5AVS B;  1L4A C;  4OH8 B;  2A06 G;  4H44 B;  4PJ0 V;  3G9R A;  3RL0 C;  2P67 A;  4UB6 V;  1MUU A;  3L71 E;  2BH4 X;  4Z1M H;  1IRW A;  5KAI E;  3U1A A;  5GTH V;  3P8C D;  3RK3 C;  2MJZ A;  1JMB A;  1C7M A;  1FZB A;  1GW4 A;  1CSW A;  3VP8 A;  2JJL A;  3PXW A;  4LJI A;  2W90 A;  1UIX A;  2B0Z B;  1FBM A;  1ZRT D;  1FS0 E;  1LTT C;  1KQG B;  2KSJ A;  3GF7 A;  3L74 J;  4I6M C;  3RL0 g;  3VTP C;  3VOP A;  2C2C A;  3A0H E;  1HUC A;  5TJH A;  2M5A A;  2FFD C;  2N1T D;  1R8E A;  2ORL A;  2E5Y A;  4ASV A;  1KYO D;  1NTM D;  2YIU C;  3O6Q B;  1HJ3 A;  2AXT V;  3NMD A;  4A7P A;  1DIP A;  2Y0C A;  2NPS D;  3CP5 A;  1SQX J;  5AVQ B;  2QJP B;  3RK3 D;  5K5G B;  2E74 C;  5KAI H;  2YXQ B;  3S1K A;  4EIF A;  3CMA P;  3WFB C;  3D71 A;  3HTK A;  2OYI C;  3L72 J;  3CCV P;  4BXL A;  4C7N B;  3AE9 C;  2ZVN B;  1HJ5 A;  2IBZ I;  3ZOO A;  1USD A;  3H1I E;  2B11 B;  1N7S D;  3CD6 P;  2QJK B;  3MK7 B;  2OZ1 B;  3HQ8 A;  2D0W A;  4L76 A;  2NRG A;  1USE A;  3H1J G;  5CIC B;  1NKN A;  2J58 A;  5AVW B;  2BCC E;  1CC5 A;  1GQ1 A;  2FFD B;  2ZXX A;  5GTI E;  2KS1 B;  1FI3 A;  4WQC A;  3BVH A;  4IL6 V;  3AEG C;  1M1J C;  3RMZ A;  2B9B A;  4WY4 B;  5CBN A;  2C1D A;  2NPS C;  3WU2 H;  1U7J A;  1EXI A;  1JMM A;  1T3U A;  3MZW B;  1CZQ A;  3FWN A;  5TIS H;  2BCN B;  2PCC B;  1S1C X;  1WVE C;  3CXH W;  4DCK A;  1SQP D;  1ZXG A;  1R5L A;  3O1Y A;  1VQ7 P;  3RK2 C;  3II6 A;  2C9N Y;  2P58 A;  3GW6 A;  4QMA A;  2XNX A;  1P84 D;  1NTZ K;  2K88 A;  1JB0 J;  5B5E V;  2E76 C;  5KAI V;  2XND H;  2C1U A;  2HOD B;  3L70 E;  1FI9 A;  1IC2 A;  1CRI A;  2WZ7 A;  1S5L X;  3R4Y A;  1H32 A;  1I8O A;  1IK9 A;  3P32 A;  5CCG A;  1K73 Q;  3A7O A;  1NWQ A;  1EXJ A;  1JY2 P;  451C A;  1LT1 A;  3WUT A;  2FKW B;  2N3B A;  3FXE A;  1GL2 A;  1WRG A;  1LS9 A;  2FWL A;  3HUS A;  2N9Y B;  3L74 G;  1MFZ A;  4JCG A;  2M0B A;  2R44 A;  5C39 A;  5CIH B;  2YKP A;  1AQ5 A;  2E76 B;  3HRN A;  3M0D A;  1T2K D;  2AEJ A;  2ZBO A;  1KFN A;  1H89 A;  1CSB A;  2B4Z A;  1OMI A;  3WMM 0;  3HQ6 A;  1C52 A;  1NU1 K;  3A5T A;  3H1K D;  2W6J H;  1ZME C;  1NTZ J;  3CI9 A;  4ZKU A;  3VMZ A;  3M9Q A;  1QL4 A;  4IL6 E;  1L0L E;  3GG2 A;  3A0H V;  1EZV D;  1K04 A;  3BAS A;  3MD0 A;  1T6A A;  1DW3 A;  2MTA C;  3WFC C;  1CYI A;  1BCC E;  1YNR A;  3VRD A;  4WQD A;  1CTJ A;  4YTP C;  1SS1 A;  2IFN A;  3CLQ A;  1GD2 E;  4W7Y A;  1RF1 C;  5KLI B;  2YMY A;  2DGE A;  1OZH A;  1SQB E;  4NFG B;  1QKS A;  4NPF X;  2YIU B;  4GIF A;  2Q5U A;  1GDT A;  1NU1 D;  1NIR A;  2E75 D;  1JNM A;  2P2U A;  3CWB E;  1NOH A;  3OW2 O;  4XXL A;  5C0Z A;  1L4A D;  1KYO E;  1OX3 A;  1NHL A;  1QYZ A;  1PGP A;  3CME P;  4EIE A;  3HE5 B;  1L0N D;  1SQX G;  4GOE A;  1H9X A;  5H2F E;  4AAL A;  2QJK C;  3MK7 C;  1YIQ A;  3ZOW A;  2ZYA A;  3L4O A;  5AW4 B;  2ZYD A;  2KNC A;  1GTW A;  2Q3I A;  3MUD C;  3L72 D;  4IOI H;  1GL2 B;  4BRY A;  2CPS A;  5AW5 B;  1AVY A;  3L72 E;  2JKV A;  3BAT A;  2H43 A;  1KQF B;  4LC1 A;  5B66 H;  1DEE G;  5CCG C;  3O5C A;  1NNO A;  2AXT H;  1MFT A;  2ITA A;  3M06 A;  1N7S A;  2WPV B;  2Y0E A;  1GU5 A;  1LTJ C;  1FOS E;  3HUS C;  1EDJ A;  2FYN B;  2OYO A;  1YQ3 C;  4H0L B;  2C9X B;  3CXH E;  3BCC D;  1Z56 A;  1SQV D;  2FYZ A;  2YKQ A;  3G4S P;  1RAP A;  2FYU K;  1Q82 Q;  2AI5 A;  3RBX A;  1CXC A;  1P84 H;  1SQQ D;  5B66 E;  1DEB A;  1OWA A;  3F89 A;  3QH9 A;  1URQ B;  3FX0 A;  2WSS H;  2M8R A;  3VYM A;  2PP6 A;  3IR9 A;  4FAN A;  2QG4 A;  3P8C E;  4H13 B;  2KOG A;  3HE4 B;  3WUV A;  4PWA A;  3HD7 A;  5KLV G;  4J20 A;  1E79 H;  5KLV K;  1JUN A;  3CC7 P;  1EC5 A;  1NML A;  3H1L D;  2E75 C;  1WMK A;  4RKU J;  3GHG C;  4D6T E;  3H32 B;  2C9L Y;  2CA4 B;  2R3C A;  1H33 A;  4B86 A;  2KK7 A;  2D0S A;  2XU6 A;  4PD4 E;  3HD7 C;  2IZ0 A;  3WUU A;  1ZLL A;  2CE1 A;  3OA8 B;  1NGM B;  3L4M A;  2M3E A;  5APV A;  2MKV A;  5APU A;  1LNQ A;  1OVU A;  3TGU E;  1A8C A;  3D0W A;  5AW8 B;  1SQV E;  3JC2 2;  1PPJ D;  3GLM A;  2E75 B;  1SQB G;  3ABV C;  5AW3 B;  1VQN P;  1KB9 D;  3L37 A;  1SFC A;  3Q3D A;  1X8Y A;  2WPS A;  3L71 G;  5H2F H;  1RZ5 A;  2W27 A;  2ZAE B;  3S4R A;  1L0L G;  4BRY B;  3OAK A;  2A06 E;  1KX2 A;  1KFM A;  2WT7 B;  1RF1 B;  5KLI C;  5CJ0 A;  3PH2 B;  3GHG B;  1DIQ C;  1PP9 D;  2IBZ G;  2H89 C;  2NZ2 A;  3MTU E;  5EFW B;  1MG3 D;  3SWF A;  1JDL A;  2D2C B;  1CRH A;  5GTI H;  1L9J C;  4FA5 A;  2HYN A;  1OCD A;  3A9F A;  1NTZ G;  3MHV A;  1KIL D;  2HPC B;  1KIL B;  2Q7C A;  1BCC D;  1LTB C;  1YBK A;  1SQX E;  2J59 M;  2DW3 A;  1HGV A;  2GM4 A;  3HQ7 A;  2ZYG A;  1KB9 I;  2JWA A;  3CCU P;  4UB6 E;  1Q81 Q;  2M3B A;  2QRX A;  2XV5 A;  4H0L D;  2XZR A;  4IFM A;  1LGH B;  2I8D A;  2ZXE B;  1BDC A;  1QL2 A;  1BSN A;  3MIW A;  4GOD A;  3Q5R A;  4M3L A;  1FZF A;  1KIB A;  1N8R Q;  2XKM A;  3C9I A;  4GT1 A;  5AW6 B;  2D2C C;  3SWK A;  2JEE A;  1IRV A;  2RN0 A;  1GL2 C;  3P8M C;  1AA0 A;  1KQL A;  1VDF A;  3KYQ A;  3CCR P;  1VQM P;  5CIF B;  2E42 A;  1XTG B;  1YJN P;  3KHU A;  2FBW C;  3TGU J;  2BEZ F;  2N1T B;  1U75 B;  4RJT A;  1DD4 A;  2B87 B;  2LXC B;  1FZC C;  2B87 A;  1DW0 A;  3H1I D;  2GA1 A;  1ZP0 C;  1OW7 A;  1G1I A;  1NVO A;  2WSC J;  5H2F V;  1PZQ A;  1KB0 A;  1VF5 B;  2FYN C;  2Q1K A;  2HG5 D;  3H1H G;  3SLE A;  1LT9 A;  4H0L C;  2WSE H;  3AED C;  3MP7 B;  2WSF J;  2P1J A;  1VF5 D;  4WY4 C;  5AVT B;  2OQQ A;  1N73 C;  1D7M A;  4Y5R A;  3H1K E;  2FYU D;  1Y8A A;  5KKZ B;  2OGU A;  3LW5 J;  3JBT B;  2K9Y A;  4MU8 A;  1SQP E;  1CHH A;  1KB9 H;  1FZC B;  3C1L A;  1RF1 A;  1CW5 A;  1M57 D;  3DMI A;  4CPG A;  1A02 J;  2N9J A;  5EXQ A;  3UIA A;  2ZFC A;  1YHQ P;  3CCS P;  4P4Q B;  3GMA A;  4XYD B;  3TGU G;  2YKO A;  2KLV A;  4XFJ A;  1CO6 A;  3M9H A;  4MN4 C;  3SJL A;  1K3G A;  2ZVO B;  1N73 B;  4WWI A;  1VQK P;  4XE5 B;  3CX5 E;  1RZ6 A;  1N15 A;  1NTZ E;  1U7M A;  4N3Y B;  4JQ0 D;  5BVZ A;  1N50 A;  1VQP P;  4Y28 J;  4EID A;  3Q2Y A;  3SFD C;  4FA9 A;  5AW2 B;  2OYI A;  4L3H A;  1FZG A;  3TSI A;  2D2C D;  2R5B A;  2KIK A;  1FCD C;  4L75 A;  3WFE C;  1JCC A;  5AW9 B;  2GIW A;  2IDB A;  3ZIY A;  3HE4 A;  2BPB B;  1YI2 P;  2XTS B;  1ZN5 A;  2W6A A;  1M1J A;  2AXC A;  2W6B A;  3LID A;  1JCD A;  3ZOX A;  1KTM A;  2JO1 A;  1S9K E;  1IO4 A;  1FDI A;  1PP9 J;  2HFE D;  3EWK A;  1W2L A;  1A02 F;  3IF4 A;  1BE3 D;  4V2K A;  1OW8 A;  1NTK D;  1SFC D;  3JSV C;  4U3F G;  2BCC D;  4D6T D;  1JY2 O;  1KV9 A;  1FI7 A;  1M6Z A;  1K9M Q;  1LT9 B;  1FAV A;  1LC1 A;  1L2P A;  1OFC X;  1VQL P;  1H31 A;  3PP5 A;  1LP1 B;  2Q9I A;  2ZJS E;  3L70 G;  1SQB J;  2LIR A;  1GZL A;  2LXB A;  2V7Q H;  3SWS A;  2PRR A;  3CCJ P;  5C9M A;  2P10 A;  1R5S A;  5E79 H;  4EI2 A;  1KIL C;  2QA4 P;  1JY2 N;  2FXM A;  4WB4 A;  2BH5 X;  2G8Y A;  3CWB D;  4EIJ A;  1RY3 A;  2JR8 A;  1H0T B;  2FFD A;  2IZ1 A;  1HZV A;  2E5T A;  1X0T A;  1BDD A;  2K1A A;  2Z4E A;  1YIT P;  2K37 A;  5AVX B;  3AEC C;  5DJT B;  3ITK A;  1TU3 F;  1IFD A;  1AV1 A;  4H0J A;  4YE1 A;  3M0A A;  2CK3 H;  3PH0 A;  2Z5H A;  3VN0 A;  3D6Z A;  1LT9 C;  1CTZ A;  1HBW A;  2OTJ P;  1KC8 Q;  1U74 B;  5DFS A;  1RE4 C;  1HJ4 A;  3IFM A;  1BE3 E;  1VL2 A;  1QVF O;  1NTM G;  2AIU A;  4N0K A;  1GIW A;  3L73 E;  3A3Y B;  4PJ0 E;  3SFE C;  4WBA A;  2WSE J;  1HH7 A;  2I1K A;  1RAQ A;  5KKZ C;  2KNC B;  3CXH D;  3KZI V;  1QVG O;  2B12 B;  1KYO W;  1C6S A;  1YQ4 C;  1KYO I;  1HZU A;  1HRC A;  1PPJ E;  5BU5 A;  5KTB A;  2WTY A;  3H32 A;  1EDK A;  3AE8 C;  1NU1 J;  3CCM P;  3E1R A;  4UB8 E;  2Y0D A;  1GK4 A;  2MHM A;  4HYT B;  3H1J D;  1SQV J;  5APY A;  4GYD A;  4L73 A;  5AVV B;  1YJW P;  3TDK A;  1NTK E;  1YYC A;  1URQ C;  1CRJ A;  5APT A;  3B5N D;  4EOT A;  4DY9 A;  1A56 A;  3M91 A;  1N90 A;  1CIF A;  1DVV A;  5E79 V;  1CRY A;  1H88 A;  2CXB A;  1VQ6 P;  1QL3 A;  3L70 J;  5CCH D;  2Q6Q A;  3Q5S A;  1S3J A;  1ZOY C;  3CCQ P;  2RH0 A;  4H44 D;  1A2S A;  4PD4 H;  1L0L J;  1JTH A;  1M60 A;  2KS1 A;  5B5E E;  1SQV K;  3C2C A;  4AAM A;  3E1I A;  1CRC A;  1SFC C;  3EFF K;  1RHZ B;  1YTC A;  1MZ9 A;  1NMI A;  1W2B O;  4PW9 B;  1OIP A;  1MV8 A;  2OYH A;  5KJ7 C;  3PJS K;  1NU1 E;  1NJI Q;  3OCD B;  2H7H A;  1W5C E;  1C6O A;  4UB6 H;  3I55 P;  5KJ7 D;  3AEF C;  1T8Z A;  1KIL A;  2N18 B;  3OA8 A;  5APQ A;  2IBZ E;  4N78 D;  3OJA B;  1OVR A;  4GDO A;  1IFP A;  1NH4 A;  1GW3 A;  3PTZ A;  1M1K Q;  3PRJ A;  1ZR4 A;  2RKL A;  2OAR A;  1GK6 A;  2XDJ A;  3M9B A;  3LIE A;  1AQT A;  4AUW A;  1S5L E;  3A0B E;  3MUD A;  2O01 J;  2Q3E A;  2GUS A;  1IK7 A;  3GHG A;  1OVV A;  3A2A A;  2Y9Z A;  3N7N A;  2YQB A;  2I1J A;  4PD4 I;  3SXT A;  3BRV B;  3CC2 P;  1Q90 D;  4KMG A;  1LWU A;  2N18 C;  3HTK B;  1BGY G;  3PLN A;  1HWT C;  1BSH A;  4U3F J;  1Q2N A;  1HH0 A;  2PCB B;  2R5D A;  1MZ4 A;  3V4W A;  4K35 A;  1IZN B;  1IFN A;  3CYT I;  1FJK A;  1YTZ I;  4IL6 X;  1NO4 A;  3C8V A;  1RE3 C;  3Q1M A;  1H0T A;  3L73 J;  4JYB A;  1CYJ A;  3CX5 I;  1I8P A;  4WY4 A;  3L73 G;  3A0H H;  5TIS E;  3NWV A;  3L75 G;  1CIE A;  2POH A;  4DOJ A;  1L0N G;  5AW1 B;  4PD4 D;  3VMY A;  1SQX D;  4FB1 A;  3NFQ A;  2OYH B;  4K3I A; 
#chains in the Genus database with same CATH homology
 3RLM A;  1CCR A;  1F1C A;  4RSZ A;  4Y5R A;  1WVE C;  3CXH W;  2FYU D;  1SQP D;  5KKZ B;  1COR A;  3O1Y A;  3JBT B;  1LFM A;  4UB8 V;  5CYT R;  4MU8 A;  1CHH A;  1CIG A;  1MG2 D;  3GW6 A;  3CU4 A;  3DMI A;  1FHB A;  1GDV A;  1P84 D;  2N9J A;  5EXQ A;  5TIS V;  4P4Q B;  4XYD B;  5B5E V;  5KAI V;  1SQB D;  2GC4 D;  1ETP A;  2C1U A;  4WQ7 A;  4AAN A;  1FI9 A;  1B7V A;  3DR0 A;  2HV4 A;  1CRI A;  1CO6 A;  2A06 D;  3L71 D;  2YCC A;  3SJL A;  1K3G A;  1H32 A;  1I8O A;  4WQ8 A;  1L0L D;  1L9B C;  451C A;  2LIT A;  2N3B A;  1CCH A;  2I8F A;  1RZ6 A;  1N15 A;  2JQR A;  1LS9 A;  2FWL A;  5DJQ C;  2L91 A;  1YFC A;  3ORV A;  1N50 A;  2RMZ A;  2N9Y B;  1K3H A;  4EID A;  4JCG A;  4FA9 A;  5CIH B;  4L3H A;  155C A;  1CSX A;  1CED A;  1W5C T;  2ZBO A;  1FCD C;  2B4Z A;  4L3G A;  1GU2 A;  3HQ6 A;  1GJQ A;  3WFE C;  1C52 A;  2JTI B;  2GIW A;  3ZIY A;  3H1K D;  1GKS A;  5CIE B;  1OAE A;  2BPB B;  2XTS B;  3TF5 A;  1FJ0 A;  2CE0 A;  1QL4 A;  3ZOX A;  1LMS A;  1N9C A;  1YEB A;  3GG2 A;  3A0H V;  1EZV D;  3O0R C;  1I6E A;  1W2L A;  1C75 A;  1BE3 D;  4V2K A;  1DW3 A;  2MTA C;  3WFC C;  1CYI A;  2B10 B;  2K9J B;  4GED B;  1NTK D;  1YNR A;  3VRD A;  3CX5 D;  1IO3 A;  1C2N A;  4WQD A;  2BCC D;  4D6T D;  1CTJ A;  1CXA A;  3DP5 A;  1KV9 A;  5KLI B;  1FI7 A;  1M6Z A;  2DGE A;  3FWL A;  2C1D B;  1AOF A;  1LC1 A;  2ZON G;  1H31 A;  4NFG B;  1QKS A;  4O1Q A;  2YIU B;  1NU1 D;  2LIR A;  2YK3 A;  1NIR A;  1I54 A;  3SWS A;  2GC7 D;  5C9M A;  1E2R A;  1H33 B;  1S6V B;  2QJY B;  3O20 A;  1COT A;  4XXL A;  2ZZS 1;  5C0Z A;  2BH5 X;  3CWB D;  1QYZ A;  2O3J A;  2N9I A;  2PAC A;  3H1H D;  4WQ9 A;  4EIE A;  1HZV A;  1J3S A;  1L0N D;  4WQB A;  2VHD A;  1YIC A;  1S5L V;  3A0B V;  1IQC A;  3RN0 A;  4O1W A;  1H9X A;  1VYD A;  4Q5P A;  2FRC A;  5KAF V;  4AAL A;  2IBZ D;  1H31 B;  3MK7 C;  1YIQ A;  3ITK A;  1EB7 A;  3ZOW A;  4H0J A;  4YE1 A;  3L4O A;  2C8S A;  3PXT A;  3NBS A;  3L72 D;  1CTZ A;  2N3Y A;  1NTZ D;  4FAV A;  1H1O A;  1U74 B;  3M97 X;  5DFS A;  1HJ4 A;  1DW2 A;  2BGV X;  1KX7 A;  1FOC A;  1AOQ A;  1CYC A;  1HCM A;  2AIU A;  4N0K A;  4L1Q A;  1GIW A;  5DF5 A;  3O5C A;  1NNO A;  4EDF A;  2ZOO A;  1DVH A;  4AX3 A;  5B66 V;  1HH7 A;  1LC2 A;  1C2R A;  1RAQ A;  2KNC B;  2Y0E A;  3ZBM A;  3CXH D;  3KZI V;  1I55 A;  1CSV A;  2B12 B;  2FYN B;  1KYO W;  3HQ9 A;  1C6S A;  1DT1 A;  1BGY D;  1HZU A;  5CIG B;  2C9X B;  1HRC A;  3RN1 A;  3BCC D;  1WEJ F;  3L74 D;  1E29 A;  1SQV D;  1RAP A;  2BLF B;  3TYI A;  2AI5 A;  1CXC A;  1SQQ D;  3X39 A;  4H0K A;  5AUR A;  2Y0D A;  1YCC A;  2MHM A;  3VMA A;  3H1J D;  2DVH A;  4GYD A;  1YEA A;  1AYG A;  3VYM A;  3TDK A;  4FA1 A;  4FAN A;  2QG4 A;  1CTY A;  3CX5 W;  4QAO A;  4PWA A;  4J20 A;  3ZOY A;  1CRJ A;  5CIB B;  3SVW A;  2V07 A;  1I5T A;  1NML A;  3H1L D;  3L73 D;  1CNO A;  3L75 D;  5DJQ B;  4DY9 A;  1A56 A;  2CA3 B;  1N90 A;  1CIF A;  1DVV A;  5E79 V;  1CRY A;  2OZ1 A;  2CXB A;  2CA4 B;  1QL3 A;  1H33 A;  5CID B;  2C1V A;  2D0S A;  1I6D A;  2CE1 A;  4FA4 A;  3OA8 B;  1A2S A;  2V08 A;  3L4M A;  1M60 A;  2KS1 A;  3C2C A;  4AAM A;  1CRC A;  1CSU A;  1CHJ A;  3L70 D;  1A8C A;  1YTC A;  2ZXY A;  3WFD C;  1ZZH A;  1F1F A;  1NMI A;  1PPJ D;  1QN2 A;  4PW9 B;  3TGU D;  2L4D A;  1DII C;  1KB9 D;  2EXV A;  3OCD A;  1H32 B;  3OCD B;  1RZ5 A;  4PJ0 V;  1C6O A;  351C A;  4UB6 V;  1KX2 A;  2N18 B;  3OA8 A;  2BH4 X;  1IRW A;  5GTH V;  1C7M A;  3PH2 B;  1DIQ C;  1CSW A;  1PP9 D;  3PXW A;  1R0Q A;  4LJI A;  5GTI V;  2B0Z B;  1ZRT D;  1MG3 D;  1JDL A;  1CRH A;  3PTZ A;  3WUI A;  1L9J C;  3PRJ A;  4FA5 A;  1OCD A;  3A9F A;  1AKK A;  2C2C A;  3NBT A;  1E8E A;  5TJH A;  5IY5 1;  1BCC D;  2ORL A;  1CHI A;  1DW1 A;  2GB8 B;  3WU2 V;  1KYO D;  3WC8 A;  1NTM D;  3HQ7 A;  2Q3E A;  1HJ3 A;  2AXT V;  4WQE A;  1C6R A;  2JWA A;  4A7P A;  2Y0C A;  2YQB A;  3CP5 A;  3SXT A;  3ZCF A;  2QJP B;  1BL9 A;  1KIB A;  4KMG A;  4WQA A;  4EIF A;  1M70 A;  1HRO A;  3WFB C;  4U3F D;  2N18 C;  3VNW A;  3PLN A;  1IZL 0;  1IRV A;  2RN0 A;  3PHL A;  1HJ5 A;  3ZOO A;  2PCB B;  1CRG A;  2B11 B;  2QJK B;  3MK7 B;  2OZ1 B;  3HQ8 A;  2D0W A;  5CIF B;  1MZ4 A;  3KHU A;  3CYT I;  5CIC B;  1U75 B;  4RJT A;  1DW0 A;  1H9Y A;  1CC5 A;  3H1I D;  1GQ1 A;  5B6Q A;  1CYJ A;  5KLV D;  1FI3 A;  4WQC A;  1I8P A;  4IL6 V;  5H2F V;  1KB0 A;  3NWV A;  3RMZ A;  1CIE A;  2C1D A;  3SLE A;  4AAO A;  4PD4 D;  3PXS A;  1CIH A;  1SQX D;  4FB1 A;  4K3I A;  2BCN B;  2PCC B;  4EIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...