1PPJD

Bovine cytochrome bc1 complex with stigmatellin and antimycin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
total genus 73
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ppjD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ppjD01
1FCDC 2KS1A 1CCHA 2A06D 1C75A 2ZZS1 4Q5PA 1H31A 2FYUD 2O3JA 4WQ8A 1PPJD 1LMSA 4AX3A 1CHHA 4O1QA 2ORLA 1C6SA 1MG3D 1M70A 1N9CA 4GYDA 3PLNA 4MU8A 3SXTA 1YEBA 5AURA 1JDLA 2GB8B 4AAOA 1U74B 2ZXYA 1AYGA 1KB0A 1N15A 1YCCA 1SQVD 3WC8A 451CA 1COTA 2BPBB 4H0JA 1KB9D 1CO6A 3PRJA 2AXTV 3M97X 2PCBB 3H1JD 5E79V 1CTYA 1CIEA 4GEDB 1CSWA 1HZVA 5KLVD 3ZOXA 4PW9B 3RLMA 1WVEC 1CC5A 1C7MA 3PXTA 2B0ZB 3TDKA 3CXHD 3NBSA 3KZIV 5KAIV 3CYTI 3PH2B 3JBTB 2QJPB 2YQBA 2B11B 1S6VB 2BH5X 3HQ7A 4L3HA 1HJ5A 3PHLA 2DVHA 1DW2A 1WEJF 3O5CA 1C52A 4EIFA 5C0ZA 1RAPA 2C8SA 1AKKA 5DJQB 3PXWA 1CHIA 1BL9A 4WQBA 1I55A 5GTHV 3L4MA 5DJQC 4D6TD 1CHJA 2JTIB 1NTMD 1IRWA 1E2RA 1L9JC 3RN1A 1YFCA 1CRHA 2YCCA 3ZBMA 1HROA 4FB1A 1FI3A 2V07A 1QYZA 2OZ1B 2HV4A 5CIHB 4WQEA 2N18C 1LC1A 3DR0A 1I6EA 1NU1D 4WQ7A 1L9BC 3WFBC 2CA3B 2MTAC 4Y5RA 5IY51 1CNOA 5TISV 3A0BV 5CIFB 2LIRA 4LJIA 1B7VA 3HQ9A 3OCDA 2RMZA 5DFSA 2PCCB 3MK7C 5B5EV 2AIUA 2B12B 2FRCA 4XYDB 1BCCD 2V08A 3C2CA 3VYMA 4DY9A 1DT1A 4U3FD 5B66V 4FA5A 3L4OA 1CTJA 1M60A 4WQ9A 3H1HD 2DGEA 4N0KA 1CYIA 4EIDA 1NNOA 1CYJA 3VRDA 1DIQC 3H1KD 1S5LV 2QG4A 3FWLA 1QN2A 1P84D 2PACA 1HRCA 1CIGA 5B6QA 3VMAA 1C2RA 1RAQA 2CA4B 1CRGA 3L74D 5CIDB 2L4DA 1IZL0 1IO3A 2MHMA 3DP5A 2N9JA 3CU4A 3ZOOA 4FA9A 1C6OA 1L0LD 1H32A 2C1DB 3TGUD 2Y0EA 4EICA 1H33A 4RSZA 4UB6V 3ZCFA 1M6ZA 1SQPD 1GJQA 351CA 3OA8A 4KMGA 1CEDA 2ZOOA 4K3IA 1H9YA 1DW3A 1NTZD 1VYDA 2BCCD 4EDFA 1KYOW 4P4QB 4H0KA 3L71D 3NWVA 2BH4X 4AALA 1CSXA 1I5TA 1N90A 4JCGA 3O20A 4PWAA 1OCDA 2N9IA 3BCCD 4L1QA 5CIGB 1FI9A 1CYCA 1GDVA 2JQRA 3CX5W 1CCRA 1CXCA 4L3GA 1KX2A 4NFGB 1HH7A 1H31B 1KX7A 1CORA 1CSVA 2CXBA 3L72D 1I8PA 1SQBD 2BCNB 4A7PA 3H1LD 3WFEC 1SQXD 1KIBA 4O1WA 3ZOYA 2BGVX 1ETPA 2Q3EA 3PTZA 2EXVA 2Y0CA 2ZBOA 1HZUA 2LITA 3L75D 3TYIA 1DW0A 1CIHA 1FI7A 4AANA 1YNRA 1LFMA 2GC7D 1W2LA 2QJYB 1PP9D 1YTCA 3GG2A 3RMZA 2AI5A 1GQ1A 4FAVA 1IQCA 2JWAA 1RZ6A 2IBZD 1R0QA 3L73D 3CX5D 1ZRTD 2XTSB 1GIWA 3SJLA 1QL4A 3CXHW 5CIBB 1DIIC 3H1ID 3WFDC 4EIEA 1W5CT 2ZONG 2QJKB 1K3GA 2C2CA 1I8OA 5KAFV 2K9JB 1U75B 2CE0A 2GC4D 1HJ4A 3SLEA 2D0SA 4WQAA 2D0WA 3CP5A 1K3HA 2BLFB 5DF5A 4UB8V 1E29A 2OZ1A 4XXLA 1BGYD 1AOQA 1MG2D 3WU2V 1DVHA 5KLIB 1C2NA 4PD4D 5CYTR 3ITKA 4FANA 1DVVA 1CRCA 3GW6A 3A9FA 1FHBA 4FA4A 2C9XB 1CRJA 1CIFA 4WQCA 3TF5A 3HQ8A 1A8CA 2C1VA 2VHDA 1CSUA 1CXAA 2N9YB 1L0ND 2I8FA 3KHUA 3OCDB 1CRIA 4AAMA 1IRVA 1NMIA 4PJ0V 1H9XA 5C9MA 2C1UA 3PXSA 1EB7A 1FOCA 1LS9A 2CE1A 3RN0A 3A0HV 3X39A 1FJ0A 1ZZHA 2B4ZA 2FYNB 3WUIA 1RZ5A 1HJ3A 4RJTA 155CA 2GIWA 2YK3A 3O1YA 1YIQA 5EXQA 1I6DA 1NTKD 1A56A 1KV9A 1EZVD 5GTIV 3ORVA 2Y0DA 1F1CA 3ZIYA 1NMLA 3NBTA 3SWSA 3DMIA 1I54A 1CTZA 1HCMA 2L91A 1OAEA 5TJHA 2C1DA 3ZOWA 1YICA 1GU2A 1F1FA 2N18B 2FWLA 5KKZB 1GKSA 1H32B 2B10B 2YIUB 5H2FV 1H1OA 1H33B 2N3BA 1E8EA 1N50A 4V2KA 5CICB 1QL3A 1KYOD 1MZ4A 3SVWA 1AOFA 2KNCB 1YEAA 1A2SA 3CWBD 1J3SA 1BE3D 4WQDA 1CRYA 3HQ6A 3OA8B 3MK7B 4J20A 2N3YA 1SQQD 5CIEB 4IL6V 1NIRA 4QAOA 1DW1A 2RN0A 1C6RA 3O0RC 4FA1A 3WFCC 3L70D 4YE1A 1LC2A 1QKSA 3VNWA
chains in the Genus database with same CATH superfamily
1FCDC 2WSCJ 3FX0A 1CCHA 1C75A 1LTIC 2C0WA 2P1JA 1MFZA 1OW7A 2KLVA 1OVVA 2B87A 2POHA 3M9HA 5CHXA 1CHHA 4O1QA 1SLQA 1FDIA 3CI9A 2XZRA 1M70A 3RK3B 1FZGA 2KZIA 4H0LB 5AURA 1JDLA 2UWJE 4AAOA 1SQQJ 1QGKB 1N15A 3WC8A 2JR8A 3OJAB 2KUBA 2SPZA 1COTA 1OVUA 2N9BA 2FKWB 2AXTV 3L71E 5KJ7A 3H1JD 1YITP 1CTYA 3V2NA 4I7ZC 1GZLA 3PXTA 3I56P 2B0ZB 5APQA 3IF4A 1X22A 2XDJA 1KILB 3PH2B 1N2DC 2QEXP 2QJPB 3MUDA 1N8RQ 1PV3A 5B66E 2WITA 2KYVA 4TLFA 1IC2A 3KQGA 1C52A 1HGVA 4N3YB 1RAPA 1AKKA 1GL2D 1SQVJ 2K9JA 1I55A 5GTHV 4Y99B 2H43A 1IRWA 2GM4A 3OAKA 1L9JC 4OGQC 3ZBMA 1J1DC 1JTHA 2G8YA 1FI3A 1GL2C 3L70G 2OZ1B 2V7QH 4IFFA 5CIHB 3DR0A 3W68A 1EQ7A 1X79B 1I6EA 1NU1D 4WQ7A 3WFBC 1KYOE 5CCGC 2BEQD 5CIFB 5APTA 4O9BA 3OCDA 1KB9I 3W67A 5DFSA 3MK7C 3V2PA 1LTJB 1KQFB 2FRCA 2W8ZA 1M90Q 3CX5E 1OFCX 1U57A 4LLHA 3BRVB 4Z1MH 1CTJA 1AVOA 3CXHI 2LR2A 2DGEA 1NTMJ 1ZW0A 2V7QJ 4EIDA 3U1CA 1RF1C 1CYJA 2XNXA 3BASA 3P8MC 4YTPC 1LP1B 3EWKA 2N1TD 1P84D 3KXDA 1U7MA 4LGDE 2C9NY 3H1JG 5B6QA 3AEEC 2OTKE 5CBOA 2N1TC 3M06A 5AW4B 1CRGA 3L74D 4ZNCA 5KAIH 1IZL0 1IO3A 1JOCA 3ZOOA 1GK4A 2QRXA 1N86A 1RE3A 2QVAA 1W2BO 4IOIH 2JJLA 1FU1A 2W90A 5GTIH 2C1DB 4U3FJ 1SQVE 1RF0A 3LIEA 1VQNP 4I1LA 2FXPA 3G9RA 2KXPB 1JY3O 1SQPD 2KSEA 1RY3A 4KMGA 1AV1A 2BCCD 2IZ0A 4H0KA 3G3ZA 2PFXA 2Y9YA 1VQPP 1I5TA 1N90A 4JCGA 2YKPA 2GA1A 4PWAA 2N9IA 5CIGB 1NU1G 4KHXA 1OXZA 3A0BH 1LT9B 1CYCA 1GDVA 1KQGB 1EDJA 3HUSC 1HH7A 5B5EH 1M8OB 1H31B 2WVRA 4IL6H 1YJWP 3RBZA 1GD2E 1AVYA 2A45I 1AQ5A 2IFMA 1CORA 3WMM0 1E79H 1FC2C 3H1LD 2OQQA 4H44B 1YQ4C 2BGVX 1Z56A 1SFCB 4EYYQ 3CC2P 1D7MA 2HPCB 3L75D 3TYIA 1CIHA 1FI7A 4L76A 3EFFK 1URQB 2GC7D 1G1JA 3L74G 1W2LA 1BSNA 3QH9A 2YKOA 3CCSP 3HTKA 5KJ7C 3AEBC 3L72J 2JWAA 1FZAA 1SQBJ 2VRSA 1ZRTD 4EIJA 1SQXJ 2QE7H 2FYZA 3SSUA 2FFDB 3MUDC 3CMAP 1SQPG 3H1ID 4EIEA 4RO0A 2W6BA 3R4YA 3VTPC 2QJKB 3T97B 2C2CA 4BRYA 3SWYA 1VF5D 1XTGB 2CE0A 2BCCG 1HJ4A 4WQAA 2OYIA 3A3YB 2BLFB 3EFGA 5GTIE 1BGYD 1AOQA 3P32A 3WU2V 1PGOA 1BDCA 3TNUB 1GDTA 1CI6B 4C7NA 3ITKA 3VP8A 2QA4P 3L73J 4GODA 2K37A 1N73A 1KFMA 3HQ8A 1A8CA 2QM7A 1VQLP 5H2FE 2B9BA 3HD7B 4AAMA 2Q6QA 5C9MA 2R44A 3H1LG 4JYBA 3RGUA 2FXMA 1LS9A 2K9YA 1KB9H 3RN0A 1OMIA 3X39A 1YTZT 2KSJA 1ZZHA 2R5BA 3CX5I 1IZNB 1RZ5A 3L75G 2GIWA 2YK3A 1EDLA 3O1YA 1KZUB 1NTKD 2YNYA 3L72E 1R8EA 1Q2NA 1SQBE 2RKLA 1NMLA 3CCUP 2H89C 4OGQB 3M91A 1M1KQ 1VDFA 3DMIA 4IL6X 5BVZA 2BEZF 3B5NA 4GDOA 2Q1KA 1NU1E 1OAEA 1LWUA 1F1FA 2FWLA 4WWIA 1RE3C 3H1IG 5KKZC 5KAFH 1IFJA 5CICB 1NAFA 1QL3A 1KYOD 1MZ4A 3SVWA 1SS1A 1RF0C 4KJMA 1M56D 3PH0A 2WQYC 3MK7B 4J20A 2QJYC 1SQQD 3AE1C 4GKGA 4LC1A 2GUVA 1BGYG 1L4AC 2OYHC 1QLED 2AXTE 2KI7B 4QAOA 2IBZE 1SQVK 2RN0A 4FA1A 3B4SA 3L73E 4YE1A 1LC2A 4BWNA 5CJ0A 1QKSA 2KS1A 1S4XA 4Q5PA 1XTCC 1M1JA 3AEFC 2K1AA 3AEDC 3MP7B 2O3JA 1VPCA 3L74E 4WQ8A 2JWDA 1PPJD 3IFMA 4DJGA 4AX3A 2N1TB 3CWBJ 1N9CA 4GYDA 1BE3J 4MU8A 4HJGH 2L5GB 3AE5C 5GTHE 3VOPA 2ZXYA 2I1JA 3CCMP 1LNQA 1SQPE 3G6EP 1YCCA 2OYOA 3IN6A 1SQVD 2NPSA 1K9MQ 2GUSA 2JDIH 2K88A 451CA 1NTKG 3SFDC 2BPBB 4H13D 3CCVP 2PCBB 2D2CC 5E79V 1UIIA 3IAOA 3RLMA 1WVEC 1T3UA 2FYUJ 1C7MA 1JCCA 3TDKA 4H13C 3KZIV 3MZWB 3HE5B 2HLOA 4N6JA 5KAIV 3CYTI 5AVSB 4YXWH 4EI2A 2B11B 3V6IA 3ZDMA 1N7SD 2G3AA 1VQ5P 3PHLA 3CCRP 3KDPB 1WEJF 5AW0B 2HODA 4TT3H 2Q5UA 1EZVE 4DCKA 1S1CX 3H1LE 3L4MA 5AVQB 5DJQC 2B87B 1NTMD 1GW3A 4GOEA 3RL0B 2P10A 5KLVJ 3OW2O 2OYIC 4WQEA 3L75E 2N18C 2RH0A 2ZVNB 1LC1A 4JF7A 1L9BC 4PV1B 2E75B 1W5CE 1CNOA 5TISV 3CWBE 3A0BV 1PPJG 4LJIA 2RMZA 2PCCB 5B5EV 3VN0A 1N73C 4XYDB 2P58A 2V08A 3RK2C 3D6ZA 3C2CA 4DY9A 1DT1A 4U3FD 1HUCA 1ZRTE 3D0WA 3LIDA 3EQ2A 4JYCA 5KTBA 1KMIZ 3VRDA 3H1IE 1NHLA 1SQVG 1QL2A 2QG4A 3FWLA 1QN2A 1JY2N 1HRCA 1CIGA 3NMDA 3VMZA 2WPSA 3RK3E 4WVZA 1U7JA 4OVNF 3TK1A 1BGYE 1OIPA 4NPEA 5CIDB 2E74D 3B5ND 2MHMA 3NXSA 2WSEJ 4AUWA 1BCCJ 1NGMB 1H32A 2KZJA 1Q82Q 4EICA 3B5NC 3N7NA 3H1HJ 3P7KA 1S72P 1LWUC 1M6ZA 3NFQA 1SQBK 4PD4H 3OA8A 1X0TA 1G2CB 5KLVE 1NTMG 4K3IA 1VYDA 3CCJP 2IFNA 2MKVA 1NU1K 2O01N 4I2LC 2ZT9B 4L1QA 1R5SA 1NTKE 3S9OA 3KPEA 2Z4EA 2HYNA 2JQRA 1CCRA 1IK9A 3U59A 1L0LJ 1P84I 3TGUJ 2O01H 1M1JC 3CCQP 3L72D 2M3EA 2E76D 1SQBD 2E5TA 4HH2A 4JQ0D 4AQRD 2OTLP 3FXEA 1VQKP 3VMYA 1SQXD 4WBAA 2Y9ZA 1S5LH 1ZN5A 2NPSD 3I5CA 1LTSC 3G4SP 1JM0A 2DW3A 1ETPA 2Q3IA 2ZBOA 2ZYAA 1HZUA 5AVXB 1OW6A 3WU2E 3RL0g 1RQVA 1DEBA 3BCCJ 2NPSC 1SQQE 1QL1A 2LXCB 3GF7A 2O01J 3U1AA 4I6MC 5APUA 2IYPA 2QJYB 1BCCE 4BXLA 1YTCA 3GG2A 3OA7A 3RMZA 1L4AB 2OYHB 4FAVA 1IQCA 3H1HE 3TSIA 1SQPK 1ZR2A 2IBZD 1SVFA 1R0QA 3L73D 1WT6A 3H25A 3L37A 1IFMA 2NRGA 3N4XA 5E79H 3CC7P 4C7RA 3SJLA 1PPJE 3CXHW 5CIBB 3WFDC 5C39A 1QVGO 3KZIH 1W5CT 1FDMA 2ZONG 1LTAC 1I8OA 5KAFV 3GHGB 3V2RA 1VQ6P 2GC4D 3VYIA 2D0WA 1EZVI 3O6QB 5DF5A 2YMKA 2OZ1A 1QVFO 2AEFA 1MG2D 1L0LE 1NH4A 1RQUA 1E5WA 1FOSF 5CYTR 4B86A 4FANA 1DVVA 1FZCA 3JSVC 4FA4A 2C9XB 3TF5A 4WQCA 2VHDA 1CXAA 3WUVA 2N9YB 3L72G 1LTJA 2D2CB 3A5TA 1SQBG 1NMIA 4PJ0V 1H9XA 3S4RA 2R5DA 2WTYA 3PXSA 1EB7A 1SQXG 3IR9A 1FOCA 2CE1A 1H88A 5TISH 4WY4B 1FJ0A 1GK6A 1EXJA 1VL2A 3BCCE 1LP1A 3WUIA 3D6YA 3CCLP 155CA 2O1JA 3E1RA 5AW5B 1UIXA 1NTME 1IO4A 4MN4C 4R4LA 1EZVD 1ZOYC 2Y0DA 1F1CA 4RKUJ 5APWA 3ZIYA 4XA4A 1S9KE 1L0NJ 1S2EA 2IBZG 3L73G 4EOTA 2C1DA 3ZOWA 1YICA 2CPBA 1GU2A 1NJIQ 2N18B 4K35A 2B10B 1H1OA 1H33B 2N3BA 1PL5A 2OGUA 4V2KA 1LT1A 2KNCB 5EFWB 2YIUC 1YIJP 1YEAA 2I1KA 1OW8A 3CWBD 3MD0A 2J59M 1GU5A 1BE3D 4WQDA 1J1EC 1CRYA 4UB8H 4U3FE 1JB0J 2JP3A 1N73B 4HB1A 1HJ0A 5AW3B 2OARA 3RK2B 5CIEB 3GLMA 4IFMA 3VNWA 1HGZA 3WUTA 1LT9A 2KIKA 3KZIE 1N7SA 1DEEG 1K73Q 2FBWC 5KAIE 1NOHA 1H31A 2FYUD 3LW5H 1OZHA 1FOSE 3RK3D 2C0XA 1EDIA 1R5LA 1DD3A 2IZ1A 5BU5A 4H0LD 2NZ2A 3A0HH 1P84H 1VF5C 3Q3DA 4DOJA 1YHQP 3PLNA 3SXTA 3RK3C 1NTKK 2E43A 3BATA 1SFCA 1HBWA 1KB0A 2E42A 1ZR4A 1JY3N 2HPCA 1HVVA 1LWUB 2WPRA 1KYOI 1EZVG 4I7ZB 1CO6A 5AVUB 1L0NE 1MKMA 3M97X 3Q5RA 4ASVA 4GEDB 5KLVD 4PW9B 1KILD 3A0BE 1EC5A 1LGHB 3TYYA 4W7ZA 5B5EE 5AVZB 4IL6E 3JBTB 3CXHH 2FYNC 2BH5X 3HQ7A 2FFDA 1SQQK 3M0AA 1HJ5A 4N78E 1DW2A 3O5CA 3CWBG 2YO2A 4EIFA 1BE3G 2AEMA 1K04A 3PXWA 1A02J 2ZFCA 4DT0A 1PGJA 1KQLA 1J1DB 1SQXE 5BU8B 1GL2B 1CHJA 2JTIB 3B71A 3RN1A 4Y99C 3AECC 4NPFX 3D71A 4FB1A 1CW5A 3E7KA 1QYZA 1YTZI 3TNUA 1CI6A 4YXDC 1H0TA 2MTAC 4Y5RA 2FYUG 5IY51 1HF9A 2E5YA 2YMYA 3Q5PA 1JUNA 1B7VA 3HQ9A 1JEKA 1FZCC 2PAJA 1MFTA 3HD7A 3JCUH 2AIUA 1BCCD 1FZFA 2IX7C 1L0LK 4FA5A 3L4OA 1RF1B 1M60A 3H32B 2PP6A 4WQ9A 3H1HD 4D6TJ 4N0KA 3M9BA 3S1KA 1DIQC 1LJ2A 2O1KA 2A06E 1DH3A 1S5LV 1BDDA 1N7LA 1M57D 3AE9C 4PJ0H 1AFOA 2PACA 3JC22 1USDA 3BRTB 5KLVG 2B88A 3VMAA 1C2RA 3HE4B 2HODB 3CLQA 2L4DA 2A45H 3B8EB 4DZOA 1KQSO 4U7JA 3D70A 2ZYGA 2AEJA 3CPWO 4FA9A 1L0LD 3CL3D 1FE6A 3TGUD 2Y0EA 1IFIA 3L35A 4RSZA 4UB6V 3ZCFA 1NTMK 1VQ7P 1YBKA 5CCGA 1HTLC 4AYCA 1OWAA 1KB9E 3H1KJ 2HFED 1AQTA 2WPVB 1CEDA 1JNMA 2M5AB 1H9YA 2WPQA 3WUUA 3AE7C 4AALA 5AVWB 1CSXA 3GMAA 4KT0J 1WMKA 3BCCD 1Q90D 3HUSB 2WT7A 1FI9A 1CXCA 4NFGB 1EDKA 1KX2A 3C9IA 1LT9C 1SQQG 1N7SC 2WZ7A 1KX7A 2JEEA 5B66H 2CXBA 1CSVA 4D6TE 1BCCG 2BCNB 2ZAEB 1S9KD 4A7PA 4GIFA 1SFCD 5KAFE 3H1HG 4RESB 1NTZJ 3ZOYA 3L71J 1YQ3C 2Q3EA 2XU6A 1ZMEC 1TU3F 3AE6C 1URQD 1BE3E 1SFCC 1JMMA 2WSCH 5APVA 1YNRA 1T3JA 1PZQA 2M8RA 3VMXA 1MUUA 1PGPA 1LTGC 1KYOH 2R3CA 3L4FA 3HE5A 1GQ1A 1PIXA 4W7YA 5AVTB 1RZ6A 1L0LG 3A2AA 4YPCA 3CD6P 3TGUG 2XTSB 2FYUE 1GIWA 3M9QA 1FAVA 1NKNA 3CX5H 5DJUB 5AW8B 4JBZA 1FJPA 5DJTB 5CJ4A 2FFDC 2K9JB 1U75B 4OWFA 2K3RA 3SLEA 2QJKC 2D0SA 4UB8V 1VF5B 1Q7YQ 1JTHB 2E74C 1M7LA 1DVHA 3Q1MA 1C2NA 1PP9J 3BCCG 4L73A 1NKZB 1S3JA 3GW6A 2Q9IA 3A9FA 1FHBA 1KV4A 1CRJA 1CIFA 3HD7D 2C1VA 1SQXK 1CSUA 1WRGA 1IFDA 2B89A 2W27A 5AVYB 1KILE 1L0ND 2I8FA 2OTJP 3OCDB 1CRIA 3A7OA 1NTZE 5AW2B 1JY2P 5AVVB 2C1UA 3HD7C 3A0HV 1L2PA 1J2JB 1K05A 2IBZI 2ZYDA 2WSFH 2B4ZA 2FYNB 1Y47A 1HJ3A 1T8ZA 1USEA 2CK3H 4N78D 1YIQA 3AE3C 1KV9A 3HRNA 4OGQD 1KC8Q 4U3FG 1MV8A 4Y28J 4M3LA 3C8VA 2E76C 1I54A 1CTZA 1HCMA 1Q86Q 4HKZH 1H8AA 5TJHA 2C9LY 5KKZB 1BSHA 5CCGD 3SWKA 2P7JA 2WSFJ 1K8AQ 2H8PD 3C1LA 1E8EA 1OX3A 3FWNA 1ZP0C 4JPZB 1FBMA 3F5HA 1FZCB 1G2CA 4ZKUA 3H6PA 3HQ6A 3BVHA 2H88C 4GOFA 1KILA 1PP9E 1FDOA 4UB6H 3F89A 5AVRB 4W80A 1NIRA 1C6RA 2KLUA 2JO1A 3WFCC 1IJDB 3R2PA 2A06D 3MTUE 2ZZS1 2XV5A 3PP5A 2R32A 5APYA 5CCHA 2Z5HA 1L0NG 4ZKPA 5AW6B 2IDBA 1LMSA 1NAYA 1ZV8A 1GU4A 2ORLA 1C6SA 3AE4C 1MG3D 2CPSA 2R3SA 3TGUE 1YEBA 1X8YA 1NVOA 3E1IA 2GB8B 2V4HA 2ZXEB 4XFJA 4IFDK 1U74B 1ZXGA 5KLIC 2M3BA 1PGQA 1AYGA 4PD4E 1HH0A 5M1BA 3MHVA 3L70J 5K5GB 3AEGC 2XNDH 1KN7A 4H0JA 1KB9D 3PRJA 4OH8B 1YYCA 1CIEA 1CSWA 1HZVA 2P67A 3ZOXA 4H13B 1JO5A 1DX7A 1EXIA 1CC5A 1L4AA 2OYHA 3HTKB 3CXHD 3NBSA 2ZJSE 1HWTC 5H2FH 2YQBA 4NPDA 1S6VB 5L8RJ 1Y8AA 1IFPA 4L3HA 2DVHA 2LXBA 2AXCA 5C0ZA 2C8SA 1GW4A 3GHGA 5DJQB 1N7SB 1S5LE 1CHIA 1BL9A 4WQBA 4BRYB 3P8CD 4D6TD 3RL0D 3O6QA 1E2RA 5AW7B 1YFCA 1CRHA 2YCCA 2XKMA 2OYIB 1HROA 1IFNA 3H1JJ 2V07A 2P2UA 2FYUK 2HV4A 1JMBA 3O8ZA 3MIWA 2JKVA 4PV1D 3RL0C 2E75D 2A06G 1S5LX 4C7NB 1NWQA 2ITAA 1LTBC 2CA3B 1X9VA 1GMJA 2LIRA 4PV1C 3KYQA 2E75C 4UB6E 2WSSH 1KORA 5KJ7D 5APXA 5E79E 5CBNA 1T2KD 2B12B 3USSA 2Z5IA 3VYMA 5B66V 3CCEP 1G1IA 4WY4A 1VQMP 3L70E 1CYIA 1NNOA 1Q81Q 1T2KC 3H1KD 2J5UA 4L74A 5KLVK 1OVRA 2AXTH 2QM8A 1NTZK 1NU1J 5APSA 1RAQA 2Q7CA 2KOGA 2CA4B 3FGAD 3DP5A 2N9JA 1VQ9P 3CU4A 4H0LC 3V4QA 2E74B 2LKMA 3B5NB 2YO3A 1C6OA 2YXRB 3M0DA 4L75A 3I55P 1H33A 1RE4A 1URQA 2M0BA 2KNCA 1PFIA 3LW5J 5GTHH 1H0TB 1T6AA 2MJZA 1GJQA 5TISE 351CA 3H1JE 5AW1B 1SP4A 1DD4A 1A02F 2HR3A 4D6TG 2ZOOA 1NTZD 1DW3A 2W83C 4EDFA 1MZ9A 1KYOW 3GF3A 4P4QB 3CMEP 2ZT9D 3L71D 3NWVA 2BH4X 2KB7P 1KILC 2QJPC 3L74J 3O20A 1OCDA 4C46A 2ZT9C 3T97A 2KS1B 3CX5W 4L3GA 5CCHD 3K5BA 1M1JB 1ZLLA 1JY3P 2HG5D 1I8PA 1SQPJ 2YKQA 5CCHC 2W6JH 3AE8C 3RBXA 1CSBA 3WFEC 4ASWA 1KIBA 2E76B 4O1WA 4R4MA 4WB4A 2BCCJ 3H1KG 2W6AA 3V5BA 4UB8E 1HJBA 3PTZA 2EXVA 2Y0CA 1FZBA 2QIWA 1RHZB 2NPSB 2LITA 1DW0A 1FZEA 4PD4I 4AANA 2A45G 1VQOP 1LFMA 1L4AD 1LTJC 1PP9D 4QMAA 2AI5A 2H7HA 2PRRA 1KTMA 3SWFA 4K3AA 3V2QA 3CX5D 3H1LJ 2BASA 3NTNA 1GTWA 1QL4A 3A0HE 3II6A 1CZQA 1NO4A 4HYTB 1P84E 1DIIC 3QWOC 2WT7B 1K3GA 1IK7A 5AW9B 1JY2O 1NTZG 3L75J 1GL2A 1YI2P 4GT1A 3L71G 3GHGC 3Q5SA 3CP5A 1K3HA 1JCDA 1RH5B 1E29A 4XXLA 3UIAA 1VQ4P 2FXOA 5KLIB 4PD4D 1W2EA 2ZXXA 1CRCA 4ZMDA 2D2CD 1QX8A 2PGDA 2IPPA 3KHUA 1AA0A 3CXHE 3H1IJ 1IRVA 2BCCE 1FS0E 4WY4D 3Q2YA 3SFEC 1RF1A 3VP9A 3H32A 3PJSK 2I8DA 2KK7A 2QSIA 3G71P 2YXQB 4WY4C 3AE2C 1BGYJ 4CPGA 4RJTA 2KP8A 1DIPA 3P8CE 5EXQA 2N1TA 1I6DA 3L36A 4H44D 1A56A 4XE5B 5GTIV 1QEXA 3ORVA 3HE4A 2FY8A 1PP9G 3NBTA 3MGNA 3SWSA 4H44C 2IYOA 2L91A 3AEAC 1GKSA 2WWWA 2WMMA 1H32B 3JCUE 2YIUB 5H2FV 1KFNA 3V4WA 1KD1Q 3FXDA 1N50A 3M0DC 2J58A 1YJ9P 1VQ8P 1J1EB 1AOFA 3ABVC 1NYHA 1A2SA 1H89A 1J3SA 1RE4C 1URQC 1YJNP 2M5AA 3RK2D 3OA8B 2N3YA 1LTTC 1NTKJ 1Y9BA 3WU2H 2ZVOB 4PJ0E 4IL6V 3H1KE 5CMZA 1DW1A 3O0RC 1FJKA 2WSEH 3L70D 3CC4P 1AJYA 1L0NK 3HUSA
chains in the Genus database with same CATH topology
1FCDC 2KS1A 1CCHA 2A06D 1C75A 2ZZS1 4Q5PA 1H31A 2FYUD 2O3JA 4WQ8A 1PPJD 1LMSA 4AX3A 1CHHA 4O1QA 2ORLA 1C6SA 1MG3D 1M70A 1N9CA 4GYDA 3PLNA 4MU8A 3SXTA 1YEBA 5AURA 1JDLA 2GB8B 4AAOA 1U74B 2ZXYA 1AYGA 1KB0A 1N15A 1YCCA 1SQVD 3WC8A 451CA 1COTA 2BPBB 4H0JA 1KB9D 1CO6A 3PRJA 2AXTV 3M97X 2PCBB 3H1JD 5E79V 1CTYA 1CIEA 4GEDB 1CSWA 1HZVA 5KLVD 3ZOXA 4PW9B 3RLMA 1WVEC 1CC5A 1C7MA 3PXTA 2B0ZB 3TDKA 3CXHD 3NBSA 3KZIV 5KAIV 3CYTI 3PH2B 3JBTB 2QJPB 2YQBA 2B11B 1S6VB 2BH5X 3HQ7A 4L3HA 1HJ5A 3PHLA 2DVHA 1DW2A 1WEJF 3O5CA 1C52A 4EIFA 5C0ZA 1RAPA 2C8SA 1AKKA 5DJQB 3PXWA 1CHIA 1BL9A 4WQBA 1I55A 5GTHV 3L4MA 5DJQC 4D6TD 1CHJA 2JTIB 1NTMD 1IRWA 1E2RA 1L9JC 3RN1A 1YFCA 1CRHA 2YCCA 3ZBMA 1HROA 4FB1A 1FI3A 2V07A 1QYZA 2OZ1B 2HV4A 5CIHB 4WQEA 2N18C 1LC1A 3DR0A 1I6EA 1NU1D 4WQ7A 1L9BC 3WFBC 2CA3B 2MTAC 4Y5RA 5IY51 1CNOA 5TISV 3A0BV 5CIFB 2LIRA 4LJIA 1B7VA 3HQ9A 3OCDA 2RMZA 5DFSA 2PCCB 3MK7C 5B5EV 2AIUA 2B12B 2FRCA 4XYDB 1BCCD 2V08A 3C2CA 3VYMA 4DY9A 1DT1A 4U3FD 5B66V 4FA5A 3L4OA 1CTJA 1M60A 4WQ9A 3H1HD 2DGEA 4N0KA 1CYIA 4EIDA 1NNOA 1CYJA 3VRDA 1DIQC 3H1KD 1S5LV 2QG4A 3FWLA 1QN2A 1P84D 2PACA 1HRCA 1CIGA 5B6QA 3VMAA 1C2RA 1RAQA 2CA4B 1CRGA 3L74D 5CIDB 2L4DA 1IZL0 1IO3A 2MHMA 3DP5A 2N9JA 3CU4A 3ZOOA 4FA9A 1C6OA 1L0LD 1H32A 2C1DB 3TGUD 2Y0EA 4EICA 1H33A 4RSZA 4UB6V 3ZCFA 1M6ZA 1SQPD 1GJQA 351CA 3OA8A 4KMGA 1CEDA 2ZOOA 4K3IA 1H9YA 1DW3A 1NTZD 1VYDA 2BCCD 4EDFA 1KYOW 4P4QB 4H0KA 3L71D 3NWVA 2BH4X 4AALA 1CSXA 1I5TA 1N90A 4JCGA 3O20A 4PWAA 1OCDA 2N9IA 3BCCD 4L1QA 5CIGB 1FI9A 1CYCA 1GDVA 2JQRA 3CX5W 1CCRA 1CXCA 4L3GA 1KX2A 4NFGB 1HH7A 1H31B 1KX7A 1CORA 1CSVA 2CXBA 3L72D 1I8PA 1SQBD 2BCNB 4A7PA 3H1LD 3WFEC 1SQXD 1KIBA 4O1WA 3ZOYA 2BGVX 1ETPA 2Q3EA 3PTZA 2EXVA 2Y0CA 2ZBOA 1HZUA 2LITA 3L75D 3TYIA 1DW0A 1CIHA 1FI7A 4AANA 1YNRA 1LFMA 2GC7D 1W2LA 2QJYB 1PP9D 1YTCA 3GG2A 3RMZA 2AI5A 1GQ1A 4FAVA 1IQCA 2JWAA 1RZ6A 2IBZD 1R0QA 3L73D 3CX5D 1ZRTD 2XTSB 1GIWA 3SJLA 1QL4A 3CXHW 5CIBB 1DIIC 3H1ID 3WFDC 4EIEA 1W5CT 2ZONG 2QJKB 1K3GA 2C2CA 1I8OA 5KAFV 2K9JB 1U75B 2CE0A 2GC4D 1HJ4A 3SLEA 2D0SA 4WQAA 2D0WA 3CP5A 1K3HA 2BLFB 5DF5A 4UB8V 1E29A 2OZ1A 4XXLA 1BGYD 1AOQA 1MG2D 3WU2V 1DVHA 5KLIB 1C2NA 4PD4D 5CYTR 3ITKA 4FANA 1DVVA 1CRCA 3GW6A 3A9FA 1FHBA 4FA4A 2C9XB 1CRJA 1CIFA 4WQCA 3TF5A 3HQ8A 1A8CA 2C1VA 2VHDA 1CSUA 1CXAA 2N9YB 1L0ND 2I8FA 3KHUA 3OCDB 1CRIA 4AAMA 1IRVA 1NMIA 4PJ0V 1H9XA 5C9MA 2C1UA 3PXSA 1EB7A 1FOCA 1LS9A 2CE1A 3RN0A 3A0HV 3X39A 1FJ0A 1ZZHA 2B4ZA 2FYNB 3WUIA 1RZ5A 1HJ3A 4RJTA 155CA 2GIWA 2YK3A 3O1YA 1YIQA 5EXQA 1I6DA 1NTKD 1A56A 1KV9A 1EZVD 5GTIV 3ORVA 2Y0DA 1F1CA 3ZIYA 1NMLA 3NBTA 3SWSA 3DMIA 1I54A 1CTZA 1HCMA 2L91A 1OAEA 5TJHA 2C1DA 3ZOWA 1YICA 1GU2A 1F1FA 2N18B 2FWLA 5KKZB 1GKSA 1H32B 2B10B 2YIUB 5H2FV 1H1OA 1H33B 2N3BA 1E8EA 1N50A 4V2KA 5CICB 1QL3A 1KYOD 1MZ4A 3SVWA 1AOFA 2KNCB 1YEAA 1A2SA 3CWBD 1J3SA 1BE3D 4WQDA 1CRYA 3HQ6A 3OA8B 3MK7B 4J20A 2N3YA 1SQQD 5CIEB 4IL6V 1NIRA 4QAOA 1DW1A 2RN0A 1C6RA 3O0RC 4FA1A 3WFCC 3L70D 4YE1A 1LC2A 1QKSA 3VNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCD C;  2KS1 A;  1CCH A;  2A06 D;  1C75 A;  2ZZS 1;  4Q5P A;  1H31 A;  2FYU D;  2O3J A;  4WQ8 A;  1PPJ D;  1LMS A;  4AX3 A;  1CHH A;  4O1Q A;  2ORL A;  1C6S A;  1MG3 D;  1M70 A;  1N9C A;  4GYD A;  3PLN A;  4MU8 A;  3SXT A;  1YEB A;  5AUR A;  1JDL A;  2GB8 B;  4AAO A;  1U74 B;  2ZXY A;  1AYG A;  1KB0 A;  1N15 A;  1YCC A;  1SQV D;  3WC8 A;  451C A;  1COT A;  2BPB B;  4H0J A;  1KB9 D;  1CO6 A;  3PRJ A;  2AXT V;  3M97 X;  2PCB B;  3H1J D;  5E79 V;  1CTY A;  1CIE A;  4GED B;  1CSW A;  1HZV A;  5KLV D;  3ZOX A;  4PW9 B;  3RLM A;  1WVE C;  1CC5 A;  1C7M A;  3PXT A;  2B0Z B;  3TDK A;  3CXH D;  3NBS A;  3KZI V;  5KAI V;  3CYT I;  3PH2 B;  3JBT B;  2QJP B;  2YQB A;  2B11 B;  1S6V B;  2BH5 X;  3HQ7 A;  4L3H A;  1HJ5 A;  3PHL A;  2DVH A;  1DW2 A;  1WEJ F;  3O5C A;  1C52 A;  4EIF A;  5C0Z A;  1RAP A;  2C8S A;  1AKK A;  5DJQ B;  3PXW A;  1CHI A;  1BL9 A;  4WQB A;  1I55 A;  5GTH V;  3L4M A;  5DJQ C;  4D6T D;  1CHJ A;  2JTI B;  1NTM D;  1IRW A;  1E2R A;  1L9J C;  3RN1 A;  1YFC A;  1CRH A;  2YCC A;  3ZBM A;  1HRO A;  4FB1 A;  1FI3 A;  2V07 A;  1QYZ A;  2OZ1 B;  2HV4 A;  5CIH B;  4WQE A;  2N18 C;  1LC1 A;  3DR0 A;  1I6E A;  1NU1 D;  4WQ7 A;  1L9B C;  3WFB C;  2CA3 B;  2MTA C;  4Y5R A;  5IY5 1;  1CNO A;  5TIS V;  3A0B V;  5CIF B;  2LIR A;  4LJI A;  1B7V A;  3HQ9 A;  3OCD A;  2RMZ A;  5DFS A;  2PCC B;  3MK7 C;  5B5E V;  2AIU A;  2B12 B;  2FRC A;  4XYD B;  1BCC D;  2V08 A;  3C2C A;  3VYM A;  4DY9 A;  1DT1 A;  4U3F D;  5B66 V;  4FA5 A;  3L4O A;  1CTJ A;  1M60 A;  4WQ9 A;  3H1H D;  2DGE A;  4N0K A;  1CYI A;  4EID A;  1NNO A;  1CYJ A;  3VRD A;  1DIQ C;  3H1K D;  1S5L V;  2QG4 A;  3FWL A;  1QN2 A;  1P84 D;  2PAC A;  1HRC A;  1CIG A;  5B6Q A;  3VMA A;  1C2R A;  1RAQ A;  2CA4 B;  1CRG A;  3L74 D;  5CID B;  2L4D A;  1IZL 0;  1IO3 A;  2MHM A;  3DP5 A;  2N9J A;  3CU4 A;  3ZOO A;  4FA9 A;  1C6O A;  1L0L D;  1H32 A;  2C1D B;  3TGU D;  2Y0E A;  4EIC A;  1H33 A;  4RSZ A;  4UB6 V;  3ZCF A;  1M6Z A;  1SQP D;  1GJQ A;  351C A;  3OA8 A;  4KMG A;  1CED A;  2ZOO A;  4K3I A;  1H9Y A;  1DW3 A;  1NTZ D;  1VYD A;  2BCC D;  4EDF A;  1KYO W;  4P4Q B;  4H0K A;  3L71 D;  3NWV A;  2BH4 X;  4AAL A;  1CSX A;  1I5T A;  1N90 A;  4JCG A;  3O20 A;  4PWA A;  1OCD A;  2N9I A;  3BCC D;  4L1Q A;  5CIG B;  1FI9 A;  1CYC A;  1GDV A;  2JQR A;  3CX5 W;  1CCR A;  1CXC A;  4L3G A;  1KX2 A;  4NFG B;  1HH7 A;  1H31 B;  1KX7 A;  1COR A;  1CSV A;  2CXB A;  3L72 D;  1I8P A;  1SQB D;  2BCN B;  4A7P A;  3H1L D;  3WFE C;  1SQX D;  1KIB A;  4O1W A;  3ZOY A;  2BGV X;  1ETP A;  2Q3E A;  3PTZ A;  2EXV A;  2Y0C A;  2ZBO A;  1HZU A;  2LIT A;  3L75 D;  3TYI A;  1DW0 A;  1CIH A;  1FI7 A;  4AAN A;  1YNR A;  1LFM A;  2GC7 D;  1W2L A;  2QJY B;  1PP9 D;  1YTC A;  3GG2 A;  3RMZ A;  2AI5 A;  1GQ1 A;  4FAV A;  1IQC A;  2JWA A;  1RZ6 A;  2IBZ D;  1R0Q A;  3L73 D;  3CX5 D;  1ZRT D;  2XTS B;  1GIW A;  3SJL A;  1QL4 A;  3CXH W;  5CIB B;  1DII C;  3H1I D;  3WFD C;  4EIE A;  1W5C T;  2ZON G;  2QJK B;  1K3G A;  2C2C A;  1I8O A;  5KAF V;  2K9J B;  1U75 B;  2CE0 A;  2GC4 D;  1HJ4 A;  3SLE A;  2D0S A;  4WQA A;  2D0W A;  3CP5 A;  1K3H A;  2BLF B;  5DF5 A;  4UB8 V;  1E29 A;  2OZ1 A;  4XXL A;  1BGY D;  1AOQ A;  1MG2 D;  3WU2 V;  1DVH A;  5KLI B;  1C2N A;  4PD4 D;  5CYT R;  3ITK A;  4FAN A;  1DVV A;  1CRC A;  3GW6 A;  3A9F A;  1FHB A;  4FA4 A;  2C9X B;  1CRJ A;  1CIF A;  4WQC A;  3TF5 A;  3HQ8 A;  1A8C A;  2C1V A;  2VHD A;  1CSU A;  1CXA A;  2N9Y B;  1L0N D;  2I8F A;  3KHU A;  3OCD B;  1CRI A;  4AAM A;  1IRV A;  1NMI A;  4PJ0 V;  1H9X A;  5C9M A;  2C1U A;  3PXS A;  1EB7 A;  1FOC A;  1LS9 A;  2CE1 A;  3RN0 A;  3A0H V;  3X39 A;  1FJ0 A;  1ZZH A;  2B4Z A;  2FYN B;  3WUI A;  1RZ5 A;  1HJ3 A;  4RJT A;  155C A;  2GIW A;  2YK3 A;  3O1Y A;  1YIQ A;  5EXQ A;  1I6D A;  1NTK D;  1A56 A;  1KV9 A;  1EZV D;  5GTI V;  3ORV A;  2Y0D A;  1F1C A;  3ZIY A;  1NML A;  3NBT A;  3SWS A;  3DMI A;  1I54 A;  1CTZ A;  1HCM A;  2L91 A;  1OAE A;  5TJH A;  2C1D A;  3ZOW A;  1YIC A;  1GU2 A;  1F1F A;  2N18 B;  2FWL A;  5KKZ B;  1GKS A;  1H32 B;  2B10 B;  2YIU B;  5H2F V;  1H1O A;  1H33 B;  2N3B A;  1E8E A;  1N50 A;  4V2K A;  5CIC B;  1QL3 A;  1KYO D;  1MZ4 A;  3SVW A;  1AOF A;  2KNC B;  1YEA A;  1A2S A;  3CWB D;  1J3S A;  1BE3 D;  4WQD A;  1CRY A;  3HQ6 A;  3OA8 B;  3MK7 B;  4J20 A;  2N3Y A;  1SQQ D;  5CIE B;  4IL6 V;  1NIR A;  4QAO A;  1DW1 A;  2RN0 A;  1C6R A;  3O0R C;  4FA1 A;  3WFC C;  3L70 D;  4YE1 A;  1LC2 A;  1QKS A;  3VNW A; 
#chains in the Genus database with same CATH topology
 1FCD C;  2WSC J;  3FX0 A;  1CCH A;  1C75 A;  1LTI C;  2C0W A;  2P1J A;  1MFZ A;  1OW7 A;  2KLV A;  1OVV A;  2B87 A;  2POH A;  3M9H A;  5CHX A;  1CHH A;  4O1Q A;  1SLQ A;  1FDI A;  3CI9 A;  2XZR A;  1M70 A;  3RK3 B;  1FZG A;  2KZI A;  4H0L B;  5AUR A;  1JDL A;  2UWJ E;  4AAO A;  1SQQ J;  1QGK B;  1N15 A;  3WC8 A;  2JR8 A;  3OJA B;  2KUB A;  2SPZ A;  1COT A;  1OVU A;  2N9B A;  2FKW B;  2AXT V;  3L71 E;  5KJ7 A;  3H1J D;  1YIT P;  1CTY A;  3V2N A;  4I7Z C;  1GZL A;  3PXT A;  3I56 P;  2B0Z B;  5APQ A;  3IF4 A;  1X22 A;  2XDJ A;  1KIL B;  3PH2 B;  1N2D C;  2QEX P;  2QJP B;  3MUD A;  1N8R Q;  1PV3 A;  5B66 E;  2WIT A;  2KYV A;  4TLF A;  1IC2 A;  3KQG A;  1C52 A;  1HGV A;  4N3Y B;  1RAP A;  1AKK A;  1GL2 D;  1SQV J;  2K9J A;  1I55 A;  5GTH V;  4Y99 B;  2H43 A;  1IRW A;  2GM4 A;  3OAK A;  1L9J C;  4OGQ C;  3ZBM A;  1J1D C;  1JTH A;  2G8Y A;  1FI3 A;  1GL2 C;  3L70 G;  2OZ1 B;  2V7Q H;  4IFF A;  5CIH B;  3DR0 A;  3W68 A;  1EQ7 A;  1X79 B;  1I6E A;  1NU1 D;  4WQ7 A;  3WFB C;  1KYO E;  5CCG C;  2BEQ D;  5CIF B;  5APT A;  4O9B A;  3OCD A;  1KB9 I;  3W67 A;  5DFS A;  3MK7 C;  3V2P A;  1LTJ B;  1KQF B;  2FRC A;  2W8Z A;  1M90 Q;  3CX5 E;  1OFC X;  1U57 A;  4LLH A;  3BRV B;  4Z1M H;  1CTJ A;  1AVO A;  3CXH I;  2LR2 A;  2DGE A;  1NTM J;  1ZW0 A;  2V7Q J;  4EID A;  3U1C A;  1RF1 C;  1CYJ A;  2XNX A;  3BAS A;  3P8M C;  4YTP C;  1LP1 B;  3EWK A;  2N1T D;  1P84 D;  3KXD A;  1U7M A;  4LGD E;  2C9N Y;  3H1J G;  5B6Q A;  3AEE C;  2OTK E;  5CBO A;  2N1T C;  3M06 A;  5AW4 B;  1CRG A;  3L74 D;  4ZNC A;  5KAI H;  1IZL 0;  1IO3 A;  1JOC A;  3ZOO A;  1GK4 A;  2QRX A;  1N86 A;  1RE3 A;  2QVA A;  1W2B O;  4IOI H;  2JJL A;  1FU1 A;  2W90 A;  5GTI H;  2C1D B;  4U3F J;  1SQV E;  1RF0 A;  3LIE A;  1VQN P;  4I1L A;  2FXP A;  3G9R A;  2KXP B;  1JY3 O;  1SQP D;  2KSE A;  1RY3 A;  4KMG A;  1AV1 A;  2BCC D;  2IZ0 A;  4H0K A;  3G3Z A;  2PFX A;  2Y9Y A;  1VQP P;  1I5T A;  1N90 A;  4JCG A;  2YKP A;  2GA1 A;  4PWA A;  2N9I A;  5CIG B;  1NU1 G;  4KHX A;  1OXZ A;  3A0B H;  1LT9 B;  1CYC A;  1GDV A;  1KQG B;  1EDJ A;  3HUS C;  1HH7 A;  5B5E H;  1M8O B;  1H31 B;  2WVR A;  4IL6 H;  1YJW P;  3RBZ A;  1GD2 E;  1AVY A;  2A45 I;  1AQ5 A;  2IFM A;  1COR A;  3WMM 0;  1E79 H;  1FC2 C;  3H1L D;  2OQQ A;  4H44 B;  1YQ4 C;  2BGV X;  1Z56 A;  1SFC B;  4EYY Q;  3CC2 P;  1D7M A;  2HPC B;  3L75 D;  3TYI A;  1CIH A;  1FI7 A;  4L76 A;  3EFF K;  1URQ B;  2GC7 D;  1G1J A;  3L74 G;  1W2L A;  1BSN A;  3QH9 A;  2YKO A;  3CCS P;  3HTK A;  5KJ7 C;  3AEB C;  3L72 J;  2JWA A;  1FZA A;  1SQB J;  2VRS A;  1ZRT D;  4EIJ A;  1SQX J;  2QE7 H;  2FYZ A;  3SSU A;  2FFD B;  3MUD C;  3CMA P;  1SQP G;  3H1I D;  4EIE A;  4RO0 A;  2W6B A;  3R4Y A;  3VTP C;  2QJK B;  3T97 B;  2C2C A;  4BRY A;  3SWY A;  1VF5 D;  1XTG B;  2CE0 A;  2BCC G;  1HJ4 A;  4WQA A;  2OYI A;  3A3Y B;  2BLF B;  3EFG A;  5GTI E;  1BGY D;  1AOQ A;  3P32 A;  3WU2 V;  1PGO A;  1BDC A;  3TNU B;  1GDT A;  1CI6 B;  4C7N A;  3ITK A;  3VP8 A;  2QA4 P;  3L73 J;  4GOD A;  2K37 A;  1N73 A;  1KFM A;  3HQ8 A;  1A8C A;  2QM7 A;  1VQL P;  5H2F E;  2B9B A;  3HD7 B;  4AAM A;  2Q6Q A;  5C9M A;  2R44 A;  3H1L G;  4JYB A;  3RGU A;  2FXM A;  1LS9 A;  2K9Y A;  1KB9 H;  3RN0 A;  1OMI A;  3X39 A;  1YTZ T;  2KSJ A;  1ZZH A;  2R5B A;  3CX5 I;  1IZN B;  1RZ5 A;  3L75 G;  2GIW A;  2YK3 A;  1EDL A;  3O1Y A;  1KZU B;  1NTK D;  2YNY A;  3L72 E;  1R8E A;  1Q2N A;  1SQB E;  2RKL A;  1NML A;  3CCU P;  2H89 C;  4OGQ B;  3M91 A;  1M1K Q;  1VDF A;  3DMI A;  4IL6 X;  5BVZ A;  2BEZ F;  3B5N A;  4GDO A;  2Q1K A;  1NU1 E;  1OAE A;  1LWU A;  1F1F A;  2FWL A;  4WWI A;  1RE3 C;  3H1I G;  5KKZ C;  5KAF H;  1IFJ A;  5CIC B;  1NAF A;  1QL3 A;  1KYO D;  1MZ4 A;  3SVW A;  1SS1 A;  1RF0 C;  4KJM A;  1M56 D;  3PH0 A;  2WQY C;  3MK7 B;  4J20 A;  2QJY C;  1SQQ D;  3AE1 C;  4GKG A;  4LC1 A;  2GUV A;  1BGY G;  1L4A C;  2OYH C;  1QLE D;  2AXT E;  2KI7 B;  4QAO A;  2IBZ E;  1SQV K;  2RN0 A;  4FA1 A;  3B4S A;  3L73 E;  4YE1 A;  1LC2 A;  4BWN A;  5CJ0 A;  1QKS A;  2KS1 A;  1S4X A;  4Q5P A;  1XTC C;  1M1J A;  3AEF C;  2K1A A;  3AED C;  3MP7 B;  2O3J A;  1VPC A;  3L74 E;  4WQ8 A;  2JWD A;  1PPJ D;  3IFM A;  4DJG A;  4AX3 A;  2N1T B;  3CWB J;  1N9C A;  4GYD A;  1BE3 J;  4MU8 A;  4HJG H;  2L5G B;  3AE5 C;  5GTH E;  3VOP A;  2ZXY A;  2I1J A;  3CCM P;  1LNQ A;  1SQP E;  3G6E P;  1YCC A;  2OYO A;  3IN6 A;  1SQV D;  2NPS A;  1K9M Q;  2GUS A;  2JDI H;  2K88 A;  451C A;  1NTK G;  3SFD C;  2BPB B;  4H13 D;  3CCV P;  2PCB B;  2D2C C;  5E79 V;  1UII A;  3IAO A;  3RLM A;  1WVE C;  1T3U A;  2FYU J;  1C7M A;  1JCC A;  3TDK A;  4H13 C;  3KZI V;  3MZW B;  3HE5 B;  2HLO A;  4N6J A;  5KAI V;  3CYT I;  5AVS B;  4YXW H;  4EI2 A;  2B11 B;  3V6I A;  3ZDM A;  1N7S D;  2G3A A;  1VQ5 P;  3PHL A;  3CCR P;  3KDP B;  1WEJ F;  5AW0 B;  2HOD A;  4TT3 H;  2Q5U A;  1EZV E;  4DCK A;  1S1C X;  3H1L E;  3L4M A;  5AVQ B;  5DJQ C;  2B87 B;  1NTM D;  1GW3 A;  4GOE A;  3RL0 B;  2P10 A;  5KLV J;  3OW2 O;  2OYI C;  4WQE A;  3L75 E;  2N18 C;  2RH0 A;  2ZVN B;  1LC1 A;  4JF7 A;  1L9B C;  4PV1 B;  2E75 B;  1W5C E;  1CNO A;  5TIS V;  3CWB E;  3A0B V;  1PPJ G;  4LJI A;  2RMZ A;  2PCC B;  5B5E V;  3VN0 A;  1N73 C;  4XYD B;  2P58 A;  2V08 A;  3RK2 C;  3D6Z A;  3C2C A;  4DY9 A;  1DT1 A;  4U3F D;  1HUC A;  1ZRT E;  3D0W A;  3LID A;  3EQ2 A;  4JYC A;  5KTB A;  1KMI Z;  3VRD A;  3H1I E;  1NHL A;  1SQV G;  1QL2 A;  2QG4 A;  3FWL A;  1QN2 A;  1JY2 N;  1HRC A;  1CIG A;  3NMD A;  3VMZ A;  2WPS A;  3RK3 E;  4WVZ A;  1U7J A;  4OVN F;  3TK1 A;  1BGY E;  1OIP A;  4NPE A;  5CID B;  2E74 D;  3B5N D;  2MHM A;  3NXS A;  2WSE J;  4AUW A;  1BCC J;  1NGM B;  1H32 A;  2KZJ A;  1Q82 Q;  4EIC A;  3B5N C;  3N7N A;  3H1H J;  3P7K A;  1S72 P;  1LWU C;  1M6Z A;  3NFQ A;  1SQB K;  4PD4 H;  3OA8 A;  1X0T A;  1G2C B;  5KLV E;  1NTM G;  4K3I A;  1VYD A;  3CCJ P;  2IFN A;  2MKV A;  1NU1 K;  2O01 N;  4I2L C;  2ZT9 B;  4L1Q A;  1R5S A;  1NTK E;  3S9O A;  3KPE A;  2Z4E A;  2HYN A;  2JQR A;  1CCR A;  1IK9 A;  3U59 A;  1L0L J;  1P84 I;  3TGU J;  2O01 H;  1M1J C;  3CCQ P;  3L72 D;  2M3E A;  2E76 D;  1SQB D;  2E5T A;  4HH2 A;  4JQ0 D;  4AQR D;  2OTL P;  3FXE A;  1VQK P;  3VMY A;  1SQX D;  4WBA A;  2Y9Z A;  1S5L H;  1ZN5 A;  2NPS D;  3I5C A;  1LTS C;  3G4S P;  1JM0 A;  2DW3 A;  1ETP A;  2Q3I A;  2ZBO A;  2ZYA A;  1HZU A;  5AVX B;  1OW6 A;  3WU2 E;  3RL0 g;  1RQV A;  1DEB A;  3BCC J;  2NPS C;  1SQQ E;  1QL1 A;  2LXC B;  3GF7 A;  2O01 J;  3U1A A;  4I6M C;  5APU A;  2IYP A;  2QJY B;  1BCC E;  4BXL A;  1YTC A;  3GG2 A;  3OA7 A;  3RMZ A;  1L4A B;  2OYH B;  4FAV A;  1IQC A;  3H1H E;  3TSI A;  1SQP K;  1ZR2 A;  2IBZ D;  1SVF A;  1R0Q A;  3L73 D;  1WT6 A;  3H25 A;  3L37 A;  1IFM A;  2NRG A;  3N4X A;  5E79 H;  3CC7 P;  4C7R A;  3SJL A;  1PPJ E;  3CXH W;  5CIB B;  3WFD C;  5C39 A;  1QVG O;  3KZI H;  1W5C T;  1FDM A;  2ZON G;  1LTA C;  1I8O A;  5KAF V;  3GHG B;  3V2R A;  1VQ6 P;  2GC4 D;  3VYI A;  2D0W A;  1EZV I;  3O6Q B;  5DF5 A;  2YMK A;  2OZ1 A;  1QVF O;  2AEF A;  1MG2 D;  1L0L E;  1NH4 A;  1RQU A;  1E5W A;  1FOS F;  5CYT R;  4B86 A;  4FAN A;  1DVV A;  1FZC A;  3JSV C;  4FA4 A;  2C9X B;  3TF5 A;  4WQC A;  2VHD A;  1CXA A;  3WUV A;  2N9Y B;  3L72 G;  1LTJ A;  2D2C B;  3A5T A;  1SQB G;  1NMI A;  4PJ0 V;  1H9X A;  3S4R A;  2R5D A;  2WTY A;  3PXS A;  1EB7 A;  1SQX G;  3IR9 A;  1FOC A;  2CE1 A;  1H88 A;  5TIS H;  4WY4 B;  1FJ0 A;  1GK6 A;  1EXJ A;  1VL2 A;  3BCC E;  1LP1 A;  3WUI A;  3D6Y A;  3CCL P;  155C A;  2O1J A;  3E1R A;  5AW5 B;  1UIX A;  1NTM E;  1IO4 A;  4MN4 C;  4R4L A;  1EZV D;  1ZOY C;  2Y0D A;  1F1C A;  4RKU J;  5APW A;  3ZIY A;  4XA4 A;  1S9K E;  1L0N J;  1S2E A;  2IBZ G;  3L73 G;  4EOT A;  2C1D A;  3ZOW A;  1YIC A;  2CPB A;  1GU2 A;  1NJI Q;  2N18 B;  4K35 A;  2B10 B;  1H1O A;  1H33 B;  2N3B A;  1PL5 A;  2OGU A;  4V2K A;  1LT1 A;  2KNC B;  5EFW B;  2YIU C;  1YIJ P;  1YEA A;  2I1K A;  1OW8 A;  3CWB D;  3MD0 A;  2J59 M;  1GU5 A;  1BE3 D;  4WQD A;  1J1E C;  1CRY A;  4UB8 H;  4U3F E;  1JB0 J;  2JP3 A;  1N73 B;  4HB1 A;  1HJ0 A;  5AW3 B;  2OAR A;  3RK2 B;  5CIE B;  3GLM A;  4IFM A;  3VNW A;  1HGZ A;  3WUT A;  1LT9 A;  2KIK A;  3KZI E;  1N7S A;  1DEE G;  1K73 Q;  2FBW C;  5KAI E;  1NOH A;  1H31 A;  2FYU D;  3LW5 H;  1OZH A;  1FOS E;  3RK3 D;  2C0X A;  1EDI A;  1R5L A;  1DD3 A;  2IZ1 A;  5BU5 A;  4H0L D;  2NZ2 A;  3A0H H;  1P84 H;  1VF5 C;  3Q3D A;  4DOJ A;  1YHQ P;  3PLN A;  3SXT A;  3RK3 C;  1NTK K;  2E43 A;  3BAT A;  1SFC A;  1HBW A;  1KB0 A;  2E42 A;  1ZR4 A;  1JY3 N;  2HPC A;  1HVV A;  1LWU B;  2WPR A;  1KYO I;  1EZV G;  4I7Z B;  1CO6 A;  5AVU B;  1L0N E;  1MKM A;  3M97 X;  3Q5R A;  4ASV A;  4GED B;  5KLV D;  4PW9 B;  1KIL D;  3A0B E;  1EC5 A;  1LGH B;  3TYY A;  4W7Z A;  5B5E E;  5AVZ B;  4IL6 E;  3JBT B;  3CXH H;  2FYN C;  2BH5 X;  3HQ7 A;  2FFD A;  1SQQ K;  3M0A A;  1HJ5 A;  4N78 E;  1DW2 A;  3O5C A;  3CWB G;  2YO2 A;  4EIF A;  1BE3 G;  2AEM A;  1K04 A;  3PXW A;  1A02 J;  2ZFC A;  4DT0 A;  1PGJ A;  1KQL A;  1J1D B;  1SQX E;  5BU8 B;  1GL2 B;  1CHJ A;  2JTI B;  3B71 A;  3RN1 A;  4Y99 C;  3AEC C;  4NPF X;  3D71 A;  4FB1 A;  1CW5 A;  3E7K A;  1QYZ A;  1YTZ I;  3TNU A;  1CI6 A;  4YXD C;  1H0T A;  2MTA C;  4Y5R A;  2FYU G;  5IY5 1;  1HF9 A;  2E5Y A;  2YMY A;  3Q5P A;  1JUN A;  1B7V A;  3HQ9 A;  1JEK A;  1FZC C;  2PAJ A;  1MFT A;  3HD7 A;  3JCU H;  2AIU A;  1BCC D;  1FZF A;  2IX7 C;  1L0L K;  4FA5 A;  3L4O A;  1RF1 B;  1M60 A;  3H32 B;  2PP6 A;  4WQ9 A;  3H1H D;  4D6T J;  4N0K A;  3M9B A;  3S1K A;  1DIQ C;  1LJ2 A;  2O1K A;  2A06 E;  1DH3 A;  1S5L V;  1BDD A;  1N7L A;  1M57 D;  3AE9 C;  4PJ0 H;  1AFO A;  2PAC A;  3JC2 2;  1USD A;  3BRT B;  5KLV G;  2B88 A;  3VMA A;  1C2R A;  3HE4 B;  2HOD B;  3CLQ A;  2L4D A;  2A45 H;  3B8E B;  4DZO A;  1KQS O;  4U7J A;  3D70 A;  2ZYG A;  2AEJ A;  3CPW O;  4FA9 A;  1L0L D;  3CL3 D;  1FE6 A;  3TGU D;  2Y0E A;  1IFI A;  3L35 A;  4RSZ A;  4UB6 V;  3ZCF A;  1NTM K;  1VQ7 P;  1YBK A;  5CCG A;  1HTL C;  4AYC A;  1OWA A;  1KB9 E;  3H1K J;  2HFE D;  1AQT A;  2WPV B;  1CED A;  1JNM A;  2M5A B;  1H9Y A;  2WPQ A;  3WUU A;  3AE7 C;  4AAL A;  5AVW B;  1CSX A;  3GMA A;  4KT0 J;  1WMK A;  3BCC D;  1Q90 D;  3HUS B;  2WT7 A;  1FI9 A;  1CXC A;  4NFG B;  1EDK A;  1KX2 A;  3C9I A;  1LT9 C;  1SQQ G;  1N7S C;  2WZ7 A;  1KX7 A;  2JEE A;  5B66 H;  2CXB A;  1CSV A;  4D6T E;  1BCC G;  2BCN B;  2ZAE B;  1S9K D;  4A7P A;  4GIF A;  1SFC D;  5KAF E;  3H1H G;  4RES B;  1NTZ J;  3ZOY A;  3L71 J;  1YQ3 C;  2Q3E A;  2XU6 A;  1ZME C;  1TU3 F;  3AE6 C;  1URQ D;  1BE3 E;  1SFC C;  1JMM A;  2WSC H;  5APV A;  1YNR A;  1T3J A;  1PZQ A;  2M8R A;  3VMX A;  1MUU A;  1PGP A;  1LTG C;  1KYO H;  2R3C A;  3L4F A;  3HE5 A;  1GQ1 A;  1PIX A;  4W7Y A;  5AVT B;  1RZ6 A;  1L0L G;  3A2A A;  4YPC A;  3CD6 P;  3TGU G;  2XTS B;  2FYU E;  1GIW A;  3M9Q A;  1FAV A;  1NKN A;  3CX5 H;  5DJU B;  5AW8 B;  4JBZ A;  1FJP A;  5DJT B;  5CJ4 A;  2FFD C;  2K9J B;  1U75 B;  4OWF A;  2K3R A;  3SLE A;  2QJK C;  2D0S A;  4UB8 V;  1VF5 B;  1Q7Y Q;  1JTH B;  2E74 C;  1M7L A;  1DVH A;  3Q1M A;  1C2N A;  1PP9 J;  3BCC G;  4L73 A;  1NKZ B;  1S3J A;  3GW6 A;  2Q9I A;  3A9F A;  1FHB A;  1KV4 A;  1CRJ A;  1CIF A;  3HD7 D;  2C1V A;  1SQX K;  1CSU A;  1WRG A;  1IFD A;  2B89 A;  2W27 A;  5AVY B;  1KIL E;  1L0N D;  2I8F A;  2OTJ P;  3OCD B;  1CRI A;  3A7O A;  1NTZ E;  5AW2 B;  1JY2 P;  5AVV B;  2C1U A;  3HD7 C;  3A0H V;  1L2P A;  1J2J B;  1K05 A;  2IBZ I;  2ZYD A;  2WSF H;  2B4Z A;  2FYN B;  1Y47 A;  1HJ3 A;  1T8Z A;  1USE A;  2CK3 H;  4N78 D;  1YIQ A;  3AE3 C;  1KV9 A;  3HRN A;  4OGQ D;  1KC8 Q;  4U3F G;  1MV8 A;  4Y28 J;  4M3L A;  3C8V A;  2E76 C;  1I54 A;  1CTZ A;  1HCM A;  1Q86 Q;  4HKZ H;  1H8A A;  5TJH A;  2C9L Y;  5KKZ B;  1BSH A;  5CCG D;  3SWK A;  2P7J A;  2WSF J;  1K8A Q;  2H8P D;  3C1L A;  1E8E A;  1OX3 A;  3FWN A;  1ZP0 C;  4JPZ B;  1FBM A;  3F5H A;  1FZC B;  1G2C A;  4ZKU A;  3H6P A;  3HQ6 A;  3BVH A;  2H88 C;  4GOF A;  1KIL A;  1PP9 E;  1FDO A;  4UB6 H;  3F89 A;  5AVR B;  4W80 A;  1NIR A;  1C6R A;  2KLU A;  2JO1 A;  3WFC C;  1IJD B;  3R2P A;  2A06 D;  3MTU E;  2ZZS 1;  2XV5 A;  3PP5 A;  2R32 A;  5APY A;  5CCH A;  2Z5H A;  1L0N G;  4ZKP A;  5AW6 B;  2IDB A;  1LMS A;  1NAY A;  1ZV8 A;  1GU4 A;  2ORL A;  1C6S A;  3AE4 C;  1MG3 D;  2CPS A;  2R3S A;  3TGU E;  1YEB A;  1X8Y A;  1NVO A;  3E1I A;  2GB8 B;  2V4H A;  2ZXE B;  4XFJ A;  4IFD K;  1U74 B;  1ZXG A;  5KLI C;  2M3B A;  1PGQ A;  1AYG A;  4PD4 E;  1HH0 A;  5M1B A;  3MHV A;  3L70 J;  5K5G B;  3AEG C;  2XND H;  1KN7 A;  4H0J A;  1KB9 D;  3PRJ A;  4OH8 B;  1YYC A;  1CIE A;  1CSW A;  1HZV A;  2P67 A;  3ZOX A;  4H13 B;  1JO5 A;  1DX7 A;  1EXI A;  1CC5 A;  1L4A A;  2OYH A;  3HTK B;  3CXH D;  3NBS A;  2ZJS E;  1HWT C;  5H2F H;  2YQB A;  4NPD A;  1S6V B;  5L8R J;  1Y8A A;  1IFP A;  4L3H A;  2DVH A;  2LXB A;  2AXC A;  5C0Z A;  2C8S A;  1GW4 A;  3GHG A;  5DJQ B;  1N7S B;  1S5L E;  1CHI A;  1BL9 A;  4WQB A;  4BRY B;  3P8C D;  4D6T D;  3RL0 D;  3O6Q A;  1E2R A;  5AW7 B;  1YFC A;  1CRH A;  2YCC A;  2XKM A;  2OYI B;  1HRO A;  1IFN A;  3H1J J;  2V07 A;  2P2U A;  2FYU K;  2HV4 A;  1JMB A;  3O8Z A;  3MIW A;  2JKV A;  4PV1 D;  3RL0 C;  2E75 D;  2A06 G;  1S5L X;  4C7N B;  1NWQ A;  2ITA A;  1LTB C;  2CA3 B;  1X9V A;  1GMJ A;  2LIR A;  4PV1 C;  3KYQ A;  2E75 C;  4UB6 E;  2WSS H;  1KOR A;  5KJ7 D;  5APX A;  5E79 E;  5CBN A;  1T2K D;  2B12 B;  3USS A;  2Z5I A;  3VYM A;  5B66 V;  3CCE P;  1G1I A;  4WY4 A;  1VQM P;  3L70 E;  1CYI A;  1NNO A;  1Q81 Q;  1T2K C;  3H1K D;  2J5U A;  4L74 A;  5KLV K;  1OVR A;  2AXT H;  2QM8 A;  1NTZ K;  1NU1 J;  5APS A;  1RAQ A;  2Q7C A;  2KOG A;  2CA4 B;  3FGA D;  3DP5 A;  2N9J A;  1VQ9 P;  3CU4 A;  4H0L C;  3V4Q A;  2E74 B;  2LKM A;  3B5N B;  2YO3 A;  1C6O A;  2YXR B;  3M0D A;  4L75 A;  3I55 P;  1H33 A;  1RE4 A;  1URQ A;  2M0B A;  2KNC A;  1PFI A;  3LW5 J;  5GTH H;  1H0T B;  1T6A A;  2MJZ A;  1GJQ A;  5TIS E;  351C A;  3H1J E;  5AW1 B;  1SP4 A;  1DD4 A;  1A02 F;  2HR3 A;  4D6T G;  2ZOO A;  1NTZ D;  1DW3 A;  2W83 C;  4EDF A;  1MZ9 A;  1KYO W;  3GF3 A;  4P4Q B;  3CME P;  2ZT9 D;  3L71 D;  3NWV A;  2BH4 X;  2KB7 P;  1KIL C;  2QJP C;  3L74 J;  3O20 A;  1OCD A;  4C46 A;  2ZT9 C;  3T97 A;  2KS1 B;  3CX5 W;  4L3G A;  5CCH D;  3K5B A;  1M1J B;  1ZLL A;  1JY3 P;  2HG5 D;  1I8P A;  1SQP J;  2YKQ A;  5CCH C;  2W6J H;  3AE8 C;  3RBX A;  1CSB A;  3WFE C;  4ASW A;  1KIB A;  2E76 B;  4O1W A;  4R4M A;  4WB4 A;  2BCC J;  3H1K G;  2W6A A;  3V5B A;  4UB8 E;  1HJB A;  3PTZ A;  2EXV A;  2Y0C A;  1FZB A;  2QIW A;  1RHZ B;  2NPS B;  2LIT A;  1DW0 A;  1FZE A;  4PD4 I;  4AAN A;  2A45 G;  1VQO P;  1LFM A;  1L4A D;  1LTJ C;  1PP9 D;  4QMA A;  2AI5 A;  2H7H A;  2PRR A;  1KTM A;  3SWF A;  4K3A A;  3V2Q A;  3CX5 D;  3H1L J;  2BAS A;  3NTN A;  1GTW A;  1QL4 A;  3A0H E;  3II6 A;  1CZQ A;  1NO4 A;  4HYT B;  1P84 E;  1DII C;  3QWO C;  2WT7 B;  1K3G A;  1IK7 A;  5AW9 B;  1JY2 O;  1NTZ G;  3L75 J;  1GL2 A;  1YI2 P;  4GT1 A;  3L71 G;  3GHG C;  3Q5S A;  3CP5 A;  1K3H A;  1JCD A;  1RH5 B;  1E29 A;  4XXL A;  3UIA A;  1VQ4 P;  2FXO A;  5KLI B;  4PD4 D;  1W2E A;  2ZXX A;  1CRC A;  4ZMD A;  2D2C D;  1QX8 A;  2PGD A;  2IPP A;  3KHU A;  1AA0 A;  3CXH E;  3H1I J;  1IRV A;  2BCC E;  1FS0 E;  4WY4 D;  3Q2Y A;  3SFE C;  1RF1 A;  3VP9 A;  3H32 A;  3PJS K;  2I8D A;  2KK7 A;  2QSI A;  3G71 P;  2YXQ B;  4WY4 C;  3AE2 C;  1BGY J;  4CPG A;  4RJT A;  2KP8 A;  1DIP A;  3P8C E;  5EXQ A;  2N1T A;  1I6D A;  3L36 A;  4H44 D;  1A56 A;  4XE5 B;  5GTI V;  1QEX A;  3ORV A;  3HE4 A;  2FY8 A;  1PP9 G;  3NBT A;  3MGN A;  3SWS A;  4H44 C;  2IYO A;  2L91 A;  3AEA C;  1GKS A;  2WWW A;  2WMM A;  1H32 B;  3JCU E;  2YIU B;  5H2F V;  1KFN A;  3V4W A;  1KD1 Q;  3FXD A;  1N50 A;  3M0D C;  2J58 A;  1YJ9 P;  1VQ8 P;  1J1E B;  1AOF A;  3ABV C;  1NYH A;  1A2S A;  1H89 A;  1J3S A;  1RE4 C;  1URQ C;  1YJN P;  2M5A A;  3RK2 D;  3OA8 B;  2N3Y A;  1LTT C;  1NTK J;  1Y9B A;  3WU2 H;  2ZVO B;  4PJ0 E;  4IL6 V;  3H1K E;  5CMZ A;  1DW1 A;  3O0R C;  1FJK A;  2WSE H;  3L70 D;  3CC4 P;  1AJY A;  1L0N K;  3HUS A; 
#chains in the Genus database with same CATH homology
 1FCD C;  2KS1 A;  1CCH A;  2A06 D;  1C75 A;  2ZZS 1;  4Q5P A;  1H31 A;  2FYU D;  2O3J A;  4WQ8 A;  1PPJ D;  1LMS A;  4AX3 A;  1CHH A;  4O1Q A;  2ORL A;  1C6S A;  1MG3 D;  1M70 A;  1N9C A;  4GYD A;  3PLN A;  4MU8 A;  3SXT A;  1YEB A;  5AUR A;  1JDL A;  2GB8 B;  4AAO A;  1U74 B;  2ZXY A;  1AYG A;  1KB0 A;  1N15 A;  1YCC A;  1SQV D;  3WC8 A;  451C A;  1COT A;  2BPB B;  4H0J A;  1KB9 D;  1CO6 A;  3PRJ A;  2AXT V;  3M97 X;  2PCB B;  3H1J D;  5E79 V;  1CTY A;  1CIE A;  4GED B;  1CSW A;  1HZV A;  5KLV D;  3ZOX A;  4PW9 B;  3RLM A;  1WVE C;  1CC5 A;  1C7M A;  3PXT A;  2B0Z B;  3TDK A;  3CXH D;  3NBS A;  3KZI V;  5KAI V;  3CYT I;  3PH2 B;  3JBT B;  2QJP B;  2YQB A;  2B11 B;  1S6V B;  2BH5 X;  3HQ7 A;  4L3H A;  1HJ5 A;  3PHL A;  2DVH A;  1DW2 A;  1WEJ F;  3O5C A;  1C52 A;  4EIF A;  5C0Z A;  1RAP A;  2C8S A;  1AKK A;  5DJQ B;  3PXW A;  1CHI A;  1BL9 A;  4WQB A;  1I55 A;  5GTH V;  3L4M A;  5DJQ C;  4D6T D;  1CHJ A;  2JTI B;  1NTM D;  1IRW A;  1E2R A;  1L9J C;  3RN1 A;  1YFC A;  1CRH A;  2YCC A;  3ZBM A;  1HRO A;  4FB1 A;  1FI3 A;  2V07 A;  1QYZ A;  2OZ1 B;  2HV4 A;  5CIH B;  4WQE A;  2N18 C;  1LC1 A;  3DR0 A;  1I6E A;  1NU1 D;  4WQ7 A;  1L9B C;  3WFB C;  2CA3 B;  2MTA C;  4Y5R A;  5IY5 1;  1CNO A;  5TIS V;  3A0B V;  5CIF B;  2LIR A;  4LJI A;  1B7V A;  3HQ9 A;  3OCD A;  2RMZ A;  5DFS A;  2PCC B;  3MK7 C;  5B5E V;  2AIU A;  2B12 B;  2FRC A;  4XYD B;  1BCC D;  2V08 A;  3C2C A;  3VYM A;  4DY9 A;  1DT1 A;  4U3F D;  5B66 V;  4FA5 A;  3L4O A;  1CTJ A;  1M60 A;  4WQ9 A;  3H1H D;  2DGE A;  4N0K A;  1CYI A;  4EID A;  1NNO A;  1CYJ A;  3VRD A;  1DIQ C;  3H1K D;  1S5L V;  2QG4 A;  3FWL A;  1QN2 A;  1P84 D;  2PAC A;  1HRC A;  1CIG A;  5B6Q A;  3VMA A;  1C2R A;  1RAQ A;  2CA4 B;  1CRG A;  3L74 D;  5CID B;  2L4D A;  1IZL 0;  1IO3 A;  2MHM A;  3DP5 A;  2N9J A;  3CU4 A;  3ZOO A;  4FA9 A;  1C6O A;  1L0L D;  1H32 A;  2C1D B;  3TGU D;  2Y0E A;  4EIC A;  1H33 A;  4RSZ A;  4UB6 V;  3ZCF A;  1M6Z A;  1SQP D;  1GJQ A;  351C A;  3OA8 A;  4KMG A;  1CED A;  2ZOO A;  4K3I A;  1H9Y A;  1DW3 A;  1NTZ D;  1VYD A;  2BCC D;  4EDF A;  1KYO W;  4P4Q B;  4H0K A;  3L71 D;  3NWV A;  2BH4 X;  4AAL A;  1CSX A;  1I5T A;  1N90 A;  4JCG A;  3O20 A;  4PWA A;  1OCD A;  2N9I A;  3BCC D;  4L1Q A;  5CIG B;  1FI9 A;  1CYC A;  1GDV A;  2JQR A;  3CX5 W;  1CCR A;  1CXC A;  4L3G A;  1KX2 A;  4NFG B;  1HH7 A;  1H31 B;  1KX7 A;  1COR A;  1CSV A;  2CXB A;  3L72 D;  1I8P A;  1SQB D;  2BCN B;  4A7P A;  3H1L D;  3WFE C;  1SQX D;  1KIB A;  4O1W A;  3ZOY A;  2BGV X;  1ETP A;  2Q3E A;  3PTZ A;  2EXV A;  2Y0C A;  2ZBO A;  1HZU A;  2LIT A;  3L75 D;  3TYI A;  1DW0 A;  1CIH A;  1FI7 A;  4AAN A;  1YNR A;  1LFM A;  2GC7 D;  1W2L A;  2QJY B;  1PP9 D;  1YTC A;  3GG2 A;  3RMZ A;  2AI5 A;  1GQ1 A;  4FAV A;  1IQC A;  2JWA A;  1RZ6 A;  2IBZ D;  1R0Q A;  3L73 D;  3CX5 D;  1ZRT D;  2XTS B;  1GIW A;  3SJL A;  1QL4 A;  3CXH W;  5CIB B;  1DII C;  3H1I D;  3WFD C;  4EIE A;  1W5C T;  2ZON G;  2QJK B;  1K3G A;  2C2C A;  1I8O A;  5KAF V;  2K9J B;  1U75 B;  2CE0 A;  2GC4 D;  1HJ4 A;  3SLE A;  2D0S A;  4WQA A;  2D0W A;  3CP5 A;  1K3H A;  2BLF B;  5DF5 A;  4UB8 V;  1E29 A;  2OZ1 A;  4XXL A;  1BGY D;  1AOQ A;  1MG2 D;  3WU2 V;  1DVH A;  5KLI B;  1C2N A;  4PD4 D;  5CYT R;  3ITK A;  4FAN A;  1DVV A;  1CRC A;  3GW6 A;  3A9F A;  1FHB A;  4FA4 A;  2C9X B;  1CRJ A;  1CIF A;  4WQC A;  3TF5 A;  3HQ8 A;  1A8C A;  2C1V A;  2VHD A;  1CSU A;  1CXA A;  2N9Y B;  1L0N D;  2I8F A;  3KHU A;  3OCD B;  1CRI A;  4AAM A;  1IRV A;  1NMI A;  4PJ0 V;  1H9X A;  5C9M A;  2C1U A;  3PXS A;  1EB7 A;  1FOC A;  1LS9 A;  2CE1 A;  3RN0 A;  3A0H V;  3X39 A;  1FJ0 A;  1ZZH A;  2B4Z A;  2FYN B;  3WUI A;  1RZ5 A;  1HJ3 A;  4RJT A;  155C A;  2GIW A;  2YK3 A;  3O1Y A;  1YIQ A;  5EXQ A;  1I6D A;  1NTK D;  1A56 A;  1KV9 A;  1EZV D;  5GTI V;  3ORV A;  2Y0D A;  1F1C A;  3ZIY A;  1NML A;  3NBT A;  3SWS A;  3DMI A;  1I54 A;  1CTZ A;  1HCM A;  2L91 A;  1OAE A;  5TJH A;  2C1D A;  3ZOW A;  1YIC A;  1GU2 A;  1F1F A;  2N18 B;  2FWL A;  5KKZ B;  1GKS A;  1H32 B;  2B10 B;  2YIU B;  5H2F V;  1H1O A;  1H33 B;  2N3B A;  1E8E A;  1N50 A;  4V2K A;  5CIC B;  1QL3 A;  1KYO D;  1MZ4 A;  3SVW A;  1AOF A;  2KNC B;  1YEA A;  1A2S A;  3CWB D;  1J3S A;  1BE3 D;  4WQD A;  1CRY A;  3HQ6 A;  3OA8 B;  3MK7 B;  4J20 A;  2N3Y A;  1SQQ D;  5CIE B;  4IL6 V;  1NIR A;  4QAO A;  1DW1 A;  2RN0 A;  1C6R A;  3O0R C;  4FA1 A;  3WFC C;  3L70 D;  4YE1 A;  1LC2 A;  1QKS A;  3VNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...