1PPJD

Bovine cytochrome bc1 complex with stigmatellin and antimycin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 73
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ppjD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ppjD01
5KLVD 1CRIA 2BH5X 5E79V 3L74D 1LMSA 2FYNB 1NNOA 2ZONG 1H32B 1IZL0 1LC1A 1A56A 2A06D 1BL9A 4WQDA 4K3IA 4WQ9A 1NTMD 1KYOW 4EIDA 4Y5RA 3GW6A 1KX2A 1ZZHA 3DP5A 1CHHA 2CE1A 1A2SA 2YIUB 4V2KA 1FCDC 2N18B 3L75D 1CO6A 1CSXA 1DIIC 3O0RC 1GU2A 1E8EA 2V08A 3CU4A 3BCCD 4UB6V 2C1DB 3SXTA 3PTZA 1KYOD 1H31A 1A8CA 1CHIA 4AALA 1OCDA 2FRCA 1GJQA 4L3HA 1YICA 5TISV 1E29A 1NIRA 1KV9A 1MG2D 5KAFV 3L71D 2N3YA 3RN1A 1FI9A 2QJPB 1I8OA 3H1LD 1HJ5A 1F1CA 2BCNB 1HJ4A 2PCCB 4NFGB 4Q5PA 3CP5A 2ZBOA 3L4OA 2IBZD 3PXSA 3FWLA 1E2RA 1QKSA 2AI5A 4N0KA 2Y0EA 4MU8A 1RAPA 4FB1A 1NTZD 1IRWA 2GB8B 3PLNA 1NU1D 2ORLA 3H1ID 2YQBA 4H0KA 3SJLA 3RLMA 3NBTA 2CE0A 3A9FA 3SLEA 1I55A 3L73D 1EZVD 1C7MA 2YK3A 1DVVA 1LC2A 5AURA 1C75A 3VMAA 1GDVA 1CIEA 3ZOYA 451CA 3CXHW 1NMIA 4EICA 4U3FD 2BLFB 1AYGA 3OCDA 1YTCA 2CA4B 2C1VA 5CIBB 4AX3A 4P4QB 3CYTI 2QJKB 2EXVA 4QAOA 4FAVA 4PJ0V 2ZZS1 2B12B 2QG4A 3PHLA 1DW2A 2XTSB 1CEDA 1CHJA 3WUIA 1CYCA 1RZ5A 3CXHD 1WEJF 2MTAC 1IQCA 4FA5A 1SQPD 5CYTR 5CIDB 3ZCFA 1VYDA 1CCRA 3L4MA 1YNRA 1M6ZA 1CRYA 5DJQC 1H1OA 2PACA 3NWVA 1CRGA 1QN2A 1NMLA 1BCCD 1C52A 3DMIA 1H9YA 3O1YA 2CXBA 3ORVA 3ZBMA 3TF5A 2RMZA 1I6DA 2Q3EA 1DW1A 5CIEB 155CA 4IL6V 2B10B 3TGUD 1M70A 3X39A 2AIUA 4LJIA 2ZXYA 4XYDB 1CORA 1C6SA 1CTYA 5DJQB 5B6QA 2DVHA 2LITA 2V07A 2KS1A 2JWAA 2FYUD 4L1QA 1B7VA 3SVWA 1K3GA 1CTZA 2N9IA 1DT1A 1CCHA 1H33B 1RAQA 4D6TD 3C2CA 2C9XB 4EIFA 4L3GA 1H31B 1I8PA 3H1HD 1C2RA 1AOQA 1W2LA 4GEDB 5KKZB 3KHUA 5GTHV 5GTIV 3PXWA 1GIWA 1CC5A 1I6EA 1DW3A 1MG3D 1CIGA 1I54A 2OZ1B 2BGVX 1C6OA 3M97X 1LS9A 4AAMA 1CSWA 3WU2V 3O5CA 3WFBC 5EXQA 3VRDA 2N9YB 4YE1A 3HQ6A 3GG2A 2I8FA 3OA8A 3L72D 1YCCA 1QL3A 4DY9A 2FWLA 1YIQA 1I5TA 3CWBD 3MK7C 4FA4A 5B66V 3ZOOA 1CSUA 1BE3D 2VHDA 1SQBD 4H0JA 5CIHB 2BH4X 1YFCA 2CA3B 1S6VB 3PXTA 1H9XA 1N9CA 3TDKA 1CRHA 3SWSA 2D0SA 4PWAA 4WQBA 4WQEA 1L0LD 1HZUA 4AAOA 3H1KD 4XXLA 3WC8A 3HQ8A 1WVEC 4PD4D 1PP9D 3MK7B 4J20A 1BGYD 5CIFB 1HH7A 4WQCA 2MHMA 3OCDB 1DIQC 1H32A 1NTKD 5B5EV 1N50A 4FANA 1MZ4A 1SQVD 1K3HA 5DF5A 1OAEA 2PCBB 1C6RA 1P84D 4FA1A 1AKKA 4RSZA 1CXCA 5C0ZA 3PRJA 1HJ3A 2Y0DA 4PW9B 2K9JB 2JTIB 4EIEA 2B0ZB 3PH2B 2BCCD 4RJTA 1F1FA 1CTJA 1M60A 1GQ1A 2O3JA 2GIWA 2C1DA 1QYZA 1SQXD 3RMZA 3NBSA 3ZOXA 3WFEC 1N15A 1IO3A 1CNOA 1CIHA 1CRJA 3WFCC 4WQAA 2YCCA 3CX5W 2QJYB 2RN0A 1H33A 2C2CA 2B11B 2LIRA 4EDFA 4A7PA 5C9MA 1CYIA 1L9BC 4O1WA 3ZOWA 1CIFA 2BPBB 1L0ND 2L4DA 2DGEA 2OZ1A 1KX7A 1FI3A 1FJ0A 1EB7A 5TJHA 1YEBA 4GYDA 4WQ8A 1SQQD 2B4ZA 3CX5D 2KNCB 3H1JD 5KAIV 1PPJD 2AXTV 2C1UA 4FA9A 1YEAA 3HQ9A 1FI7A 1U75B 3RN0A 1QL4A 3O20A 1KIBA 3DR0A 1J3SA 1ETPA 1AOFA 2GC4D 1U74B 1HZVA 1DW0A 1R0QA 5DFSA 3L70D 5CICB 1HCMA 1N90A 5H2FV 1GKSA 1W5CT 2L91A 1IRVA 4WQ7A 2GC7D 1CRCA 1L9JC 1RZ6A 2HV4A 3OA8B 1DVHA 3ZIYA 3KZIV 3VNWA 351CA 4KMGA 3ITKA 1COTA 1FHBA 1KB9D 5CIGB 2C8SA 1HROA 1S5LV 1HRCA 2N3BA 5KLIB 2N9JA 3JBTB 1KB0A 1ZRTD 3WFDC 1C2NA 1CYJA 4AANA 4JCGA 3A0HV 3HQ7A 3A0BV 2Y0CA 3TYIA 3VYMA 5IY51 2ZOOA 2D0WA 2JQRA 1CXAA 1JDLA 1CSVA 4UB8V 1LFMA 2N18C 4O1QA 1FOCA
chains in the Genus database with same CATH superfamily
4L75A 1JY3P 2K37A 1A56A 2P2UA 1KB9H 2P10A 1YYCA 3CCEP 4WQ9A 4R4LA 1EQ7A 3GW6A 1KX2A 1ZZHA 3S4RA 3L74G 1ZMEC 3C9IA 1FCDC 1PIXA 1CO6A 1J1EC 1CSXA 5B66H 1A02J 1S9KE 2QJPC 1FDOA 3L74J 2P1JA 1LT9C 2V08A 3CU4A 1NU1K 3AE3C 3N7NA 1L0NE 1H31A 1PGJA 1FZFA 4C7NA 1K05A 3CCSP 1USDA 4L3HA 1YICA 1JB0J 5AW6B 3GHGC 3CCLP 2FXMA 4EYYQ 5B5EH 3WMM0 3HTKA 2ZBOA 2GM4A 3L4OA 3PXSA 3FWLA 1E2RA 2AI5A 1W2EA 2FYUG 2E43A 3FXEA 3A7OA 2WSFJ 2Y0EA 1T8ZA 2FY8A 4FB1A 2XNXA 2MKVA 3HE5A 2PRRA 1KYOH 3AEBC 1Q81Q 2ORLA 2WSFH 1EDIA 1EXJA 3NBTA 3A9FA 5AW9B 1I55A 2IBZG 1C7MA 3B5NA 3NFQA 3WUVA 4WY4C 1ZRTE 2C9LY 3T97B 2Y9YA 4NPDA 3CXHW 1NMIA 2WPVB 3LIEA 4RKUJ 3C1LA 3OCDA 3H1IG 2E76C 1JM0A 4P4QB 1GMJA 1NWQA 3L72G 3CYTI 2K3RA 4EI2A 5H2FE 4FAVA 2WTYA 2WMMA 2HODB 3CC7P 3H1IJ 5KLVE 4I7ZB 2QG4A 3L72J 5CHXA 3RGUA 4K3AA 1CHJA 3WUIA 3CXHD 2A06E 2WPQA 4W7YA 4FA5A 3Q1MA 5CYTR 1LP1A 2FYZA 3S1KA 1CSBA 3V6IA 1NTME 1CCRA 4JBZA 3LW5J 3H1KG 1NVOA 3A0BE 2WT7B 3LW5H 1CRGA 3G4SP 1BCCD 1IFIA 1KFNA 1G2CA 1OFCX 1OVVA 1T2KD 1QVGO 2HLOA 3ZBMA 2JEEA 1RF1B 3M0DC 3AEFC 1IK9A 5CIEB 2N9BA 5H2FH 3OW2O 1KD1Q 4LJIA 2ZXYA 3RL0C 4GIFA 4TT3H 2L5GB 1CTYA 1PFIA 2DVHA 4N78D 3CMEP 2FYUD 4L1QA 1YI2P 1DD3A 3HD7D 2KNCA 1SQBK 3AEGC 2G3AA 3TGUG 1X79B 3RL0g 1JOCA 1IK7A 1LT9A 3AE6C 3C2CA 3A0BH 4NPEA 2J5UA 3B4SA 3TNUB 3TGUJ 1AOQA 2E74C 4GEDB 5KKZB 1IFDA 1GW3A 1NTZE 1MG3D 1CIGA 1OXZA 3VMZA 2OZ1B 1C6OA 3M97X 2B87B 1T6AA 4AAMA 1CSWA 3WU2V 5E79H 2W83C 3L73E 3HQ6A 2SPZA 2IFNA 5KAFE 3GHGA 3PP5A 2I8FA 1T3UA 3L72D 4U7JA 5C39A 2FWLA 1NJIQ 3CWBD 2QVAA 1SQQG 2QRXA 5AW5B 1HTLC 1VQ9P 1YFCA 2UWJE 1S6VB 1NH4A 3TDKA 3D0WA 1FZBA 3Q5SA 3SWSA 1U7JA 1SVFA 4UB6H 3CCMP 4WQEA 3QH9A 4AAOA 3H1KD 1RF0C 4IL6X 1S1CX 4WY4A 1NAFA 1SQPE 4J20A 3KZIE 1BGYD 2H43A 5APQA 1FJPA 4WQCA 1FZAA 1SQVE 1H32A 3Q5RA 3LIDA 1VDFA 4L76A 1CW5A 2KI7B 2W8ZA 1K3HA 1OAEA 2FXOA 2B9BA 4H44C 2RKLA 3TYYA 1KQFB 3HUSB 3GF7A 1N7SB 1L4AB 1ZLLA 2YXRB 4YXWH 2YO3A 2WQYC 2B0ZB 1DD4A 2BCCD 1F1FA 1N2DC 1GQ1A 2GIWA 1S3JA 2C1DA 1SQXD 4DT0A 2OGUA 4WB4A 3AE5C 1SQVJ 3BVHA 3WFEC 1LNQA 1IO3A 1RHZB 2FFDB 1PV3A 1YQ4C 1LWUB 3CX5W 2ZYAA 1IFPA 2HR3A 2RN0A 2ZXXA 4OGQB 2B11B 3VOPA 2P58A 3M0DA 4A7PA 3II6A 2FKWB 3MTUE 2KLUA 4MN4C 3ZOWA 3L75G 1CIFA 1NYHA 1L0LK 1N7SD 1L4AD 1FI3A 1YEBA 1R5LA 4WQ8A 1SQQD 1MFTA 3CX5D 5AW8B 3H1JD 5KAIV 5M1BA 1VL2A 3L75J 2FBWC 4DOJA 3RK3B 3KYQA 2C1UA 1U75B 3WUUA 2W27A 1KIBA 1ETPA 3A5TA 4CPGA 1LTJB 2GC4D 1U74B 1JMBA 1KILE 1DW0A 3EFGA 1SLQA 1PPJG 4OGQD 2GC7D 2A45I 1HF9A 2IFMA 4GODA 5CCHD 3GLMA 2W6BA 1YJNP 4R4MA 3CXHI 3KZIV 3SFEC 4KMGA 3W67A 1PP9E 2FXPA 2KXPB 3V4WA 5L8RJ 1CI6A 3RL0D 5AVSB 1GK4A 1FBMA 3AE9C 1FE6A 3D6YA 3WFDC 1C2NA 3MZWB 1VQOP 1HJBA 1JCDA 4JCGA 3RK3D 3HQ7A 4O9BA 4EIJA 2OYHC 3MD0A 2ZOOA 1GTWA 1CXAA 1N86A 3MUDC 1LFMA 1FOCA 2M5AA 3NXSA 1ZW0A 1H0TA 1L2PA 1LMSA 2J59M 4WBAA 5CBNA 1IZL0 1L0NK 4GT1A 4WQDA 1QL2A 2GUSA 1IJDB 4Y5RA 3VYIA 3ZDMA 2CE1A 4V2KA 4H13B 3L75D 3VMYA 1EDLA 4YXDC 3G3ZA 3AE8C 3RBXA 1DIIC 1E8EA 1R5SA 3BCCD 4DZOA 4AALA 2H89C 4TLFA 4HJGH 1AQ5A 3TSIA 3UIAA 1GJQA 3R4YA 1E29A 2M8RA 1JCCA 3RN1A 3P32A 2POHA 1F1CA 2KK7A 1HJ4A 4BXLA 2PCCB 1JO5A 1GD2E 3CP5A 1BDCA 2ZYGA 4H44D 5CCGA 5AVYB 1QKSA 1D7MA 3BRVB 3GMAA 3V2QA 1LJ2A 1T2KC 2QM8A 3KQGA 3TK1A 2KZJA 4MU8A 1RAPA 4EOTA 1IRWA 5KLVK 1OW7A 5AVRB 3M91A 4D6TG 3RBZA 1BDDA 2CE0A 2IZ1A 1KB9E 4I7ZC 1DVVA 1LC2A 2Z4EA 4OWFA 4D6TJ 2N1TB 4Z1MH 2QIWA 2NPSB 3ZOYA 1NTMK 3HE4B 5APSA 2FYNC 3G71P 4EICA 1DX7A 4U3FD 2BLFB 1ZOYC 1YTCA 2CA4B 2C1VA 5CIBB 2K9YA 4AX3A 2XDJA 5B66E 1Q2NA 1JEKA 2EXVA 4QAOA 2YXQB 1FZCB 1VQ8P 4Y99B 1M1JB 3D71A 3L74E 3PHLA 1JY2O 3K5BA 3MIWA 2W6JH 4OH8B 3M0AA 1FOSF 1VQ4P 1RZ5A 1WEJF 1RF1C 4M3LA 2K9JA 5APVA 1FU1A 5K5GB 5CIDB 1VYDA 2OYHA 3L4MA 1YNRA 1M6ZA 5B5EE 2A45G 2N1TD 3NWVA 2NPSD 1QN2A 3MUDA 4K35A 3DMIA 2O01J 1NTKG 2CXBA 3ORVA 3RK2B 5AW4B 3H32B 2JKVA 2O01H 2ZFCA 4IFDK 1OW8A 1NTZK 2A45H 1KYOE 1NTKJ 1M70A 3I56P 4JQ0D 3CXHH 2AIUA 5KKZC 1OZHA 3CX5I 3O8ZA 2FYUE 1BCCG 5B6QA 5KJ7D 2LR2A 1FDMA 2KIKA 3BASA 3IFMA 1CTZA 1BCCJ 2PFXA 3IN6A 1RAQA 1HBWA 4D6TD 2IBZE 4EIFA 1H31B 3R2PA 3H1HD 3CCRP 3IF4A 4C7NB 3KHUA 5GTIV 4DCKA 2P7JA 2Q6QA 2R32A 4UB8H 1ZR4A 3H1IE 2M0BA 3O5CA 1OWAA 3WFBC 3L72E 5EXQA 2N9YB 2FYUJ 5TISE 1SQPK 3GG2A 1SQVK 3HTKB 1DIPA 1KN7A 2HG5D 4GDOA 5CBOA 1YIQA 1SP4A 5B66V 1CSUA 1BE3D 2VHDA 1QEXA 1J1DB 1EXIA 5CIHB 2BH4X 3HE5B 3PXTA 3CC4P 1Y47A 1LTIC 3H1KE 3B5NB 1MV8A 2HODA 3SWYA 1L0LD 3CWBG 4LGDE 1BGYE 4XXLA 4C7RA 3HUSC 1N7SC 1L4AC 3L70G 4PD4D 1S2EA 4BRYB 3MK7B 3HRNA 2ZAEB 3AEAC 1LTAC 3OCDB 3CWBJ 1NTKD 2R5BA 3HD7A 5TISH 5B5EV 3CCQP 2JJLA 4WWIA 4FANA 3L70J 5DF5A 2LXCB 2PCBB 2AXCA 1C6RA 2R44A 1P84D 1AKKA 4RSZA 1YIJP 2FFDC 3SSUA 3PRJA 1BGYG 1HJ3A 4XFJA 1LWUC 3EFFK 4ZKPA 3H1KJ 4H0LB 4W80A 2O1JA 1RF1A 4OGQC 3TGUE 1FAVA 3WU2H 1BGYJ 3PH2B 1ZV8A 4RJTA 5E79E 5CCHC 5AVZB 1AFOA 1QLED 2LKMA 1H89A 3JSVC 1N7LA 3ZOXA 2QSIA 1AV1A 1CNOA 1CIHA 1CRJA 3RK3C 2BCCG 2QJYB 4ZKUA 2C2CA 1S9KD 1SQXG 1IFNA 4JYBA 2ZYDA 2BCCJ 5BU5A 4PJ0H 1LTJC 4UB6E 1SQQE 3CX5E 1SQXJ 1L0ND 3USSA 2YNYA 2OZ1A 1KX7A 1EB7A 4H0LD 2KNCB 1QX8A 1JNMA 5EFWB 1PGPA 1URQB 5AVUB 1K8AQ 4FA9A 3HQ9A 2Q9IA 4XE5B 3DR0A 4GKGA 3A3YB 1JY2N 4JPZB 2MJZA 4GOEA 3L71G 1HZVA 2HPCA 5DFSA 2XZRA 3H1JG 3KXDA 3L70D 5CICB 2K88A 5H2FV 5APXA 1GKSA 3H1LG 2HYNA 1N8RQ 3AE1C 4WQ7A 2KLVA 1CRCA 1L9JC 1SQQJ 1K9MQ 2NZ2A 3H1JJ 2OARA 3ZIYA 4IL6H 3ITKA 1COTA 1FHBA 2H88C 1NAYA 3CX5H 1UIXA 2BEZF 2C8SA 1HROA 2Q3IA 1VQKP 5KLIB 1ZRTD 1NU1G 2QEXP 4AANA 3D6ZA 1G1JA 3A0BV 1URQD 3TYIA 4AYCA 1BSNA 1EZVG 1GW4A 1NU1J 2P67A 3Q2YA 5APWA 3B8EB 1FC2C 1JTHB 3VN0A 1JDLA 1PGQA 1CSVA 3HUSA 5KLVD 1CRIA 1IO4A 5E79V 1L4AA 1PZQA 5GTHH 2WITA 1NNOA 2ZONG 2W90A 3WUTA 1H32B 3CI9A 1UIIA 2A06D 3VTPC 1BL9A 1M1KQ 1JY2P 1Z56A 3ABVC 2OTJP 1NTMD 4EIDA 1GU4A 3L75E 4KHXA 1Y8AA 1CHHA 1M8OB 1A2SA 1YHQP 2N18B 3V4QA 5CJ4A 2XKMA 3O0RC 4UB6V 1VQMP 2C1DB 1WT6A 5CCHA 3SXTA 3PTZA 2NRGA 1QGKB 1H8AA 1A8CA 1CHIA 5CMZA 1N73C 1OCDA 2WVRA 3FGAD 1PPJE 1YITP 5KAFV 3L71D 2N3YA 3BCCG 1Q86Q 3H1LD 3L35A 1HJ5A 2BCNB 1NOHA 2N1TC 2NPSC 3BCCJ 2JO1A 4N0KA 1LTJA 1NTZD 2GB8B 3PLNA 1LTTC 4JF7A 1NU1D 3F5HA 3SJLA 2YQBA 1M57D 1S72P 4GOFA 4PD4I 1FZCC 2R3SA 3SLEA 2V7QJ 4Y99C 3L73D 1VF5B 1M1JC 1EZVD 2YK3A 4HKZH 4JYCA 4Y28J 2OYOA 5KJ7C 2V7QH 1C75A 3CCJP 3VMAA 3IR9A 2WSSH 1SS1A 2OTKE 2Q7CA 1P84I 1RQVA 2QJKB 3L4FA 2B12B 2YKQA 2YMKA 1NGMB 1CI6B 1SQBG 1MZ9A 4U3FG 2YKPA 2XTSB 1CEDA 1RF0A 2YMYA 3CC2P 3QWOC 1Q7YQ 1SQPD 2FYUK 5BVZA 2R3CA 4U3FJ 3ZCFA 2E75B 2GUVA 2C0WA 2AXTH 1CRYA 4N6JA 2D2CB 5AW0B 2AEFA 3F89A 2M5AB 1C52A 1H9YA 1H0TB 2C9NY 1TU3F 1DW1A 4I2LC 155CA 3AE2C 1XTGB 1KTMA 4XYDB 4PV1B 1CORA 2Z5IA 1C6SA 5DJQB 2KS1A 3CL3D 1B7VA 3SVWA 1S5LH 1K3GA 4D6TE 3P8CD 5APYA 1CCHA 1KILB 1NKZB 1H33B 3H1HE 3KPEA 2E75D 3A0HH 4RO0A 2C9XB 1YJWP 4L3GA 2D2CD 2Q1KA 1C2RA 1W2LA 1GIWA 3PXWA 1HGZA 1KQSO 1N73A 1J1DC 3I5CA 4H13D 1LS9A 1J2JB 3CD6P 1VQPP 1SFCB 3VRDA 3OA8A 3Q5PA 1HWTC 1M90Q 3H1HG 2O01N 1QL3A 4PV1D 2N1TA 1NHLA 2KB7P 2NPSA 3MK7C 4FA4A 2BEQD 4XA4A 1YTZT 3H1HJ 1SQBD 2I8DA 1GL2B 1KILD 1KV4A 4I1LA 2CA3B 4HYTB 3NMDA 5AW7B 2OYIB 1QL1A 3NTNA 1MUUA 3WC8A 3CXHE 1BE3G 1NTKE 1PP9D 4H0LC 4W7ZA 1HH7A 3Q3DA 1SFCD 2WWWA 2ZT9B 1BE3J 3O6QB 1OVRA 1Q90D 4DJGA 1L0LG 4WVZA 2K1AA 1BCCE 5CCGD 4FA1A 3M9QA 1LTSC 1FS0E 1RE4C 4YTPC 2KSJA 5GTIH 1L0LJ 3V2PA 4IFFA 2K9JB 2Z5HA 2QJYC 1GL2D 3H32A 2JTIB 4UB8E 3E1RA 5AW3B 1SQQK 3M9HA 1CTJA 2OYHB 4PD4H 3KDPB 1QYZA 4IFMA 4N78E 2GA1A 3JCUE 1KZUB 4RESB 3WFCC 4WQAA 2YCCA 2ZT9D 5DJTB 1Q82Q 1URQC 1P84H 3H25A 4NPFX 2WSEJ 2LIRA 3E1IA 2WSCJ 2WSEH 5C9MA 2WSCH 1L9BC 1T3JA 2BPBB 5AVWB 5TJHA 2G8YA 1FJ0A 2KZIA 2B4ZA 1EZVI 3RK2D 1OMIA 5AVXB 2H7HA 3OA7A 2E5TA 4L74A 2JR8A 1W2BO 3JC22 3I55P 3CWBE 3RN0A 1QL4A 1AVYA 1K73Q 3JCUH 1L0NG 3L70E 5KLIC 1AOFA 1VQ5P 2IYOA 3U1CA 3T97A 2QM7A 1BSHA 1YTZI 2M3EA 1N90A 1W5CT 1RQUA 1L0NJ 2L91A 3L36A 1IFMA 1RZ6A 4ASWA 3WU2E 4AUWA 1DVHA 3BRTB 5DJUB 351CA 1RH5B 1FJKA 2ZJSE 1PL5A 1KB9D 4ZNCA 1HRCA 1GDTA 4BRYA 1KB0A 1CYJA 3P8MC 3VP9A 3E7KA 2Y0CA 2I1JA 4HB1A 5IY51 2CK3H 2JQRA 2IX7C 5AW1B 1VQ6P 2OTLP 2WT7A 4UB8V 2N18C 4PJ0E 1KC8Q 2BH5X 1FOSE 3L74D 1ZR2A 2FYNB 2BCCE 2BASA 3HD7B 1LC1A 1OX3A 1LP1B 1SQXE 2CPSA 4ASVA 4K3IA 1OIPA 1KORA 3B5ND 1KYOW 4C46A 4L73A 1VPCA 5KLVG 3DP5A 1S4XA 3PH0A 5AW2B 2YIUB 1G2CB 2HFED 2PGDA 1RE4A 2C0XA 3D70A 2CPBA 2A06G 1RE3C 4KJMA 5KLVJ 1GU2A 3G6EP 1LTBC 1NTMG 3AEDC 1KYOD 1HGVA 3TNUA 2FRCA 3FX0A 3CMAP 3OAKA 4IL6E 3L71E 1DEBA 1YJ9P 1NTMJ 3H1JE 5TISV 1NIRA 1KV9A 2B87A 3H1LE 1MG2D 3M9BA 1EDJA 1J1EB 1FI9A 1FZEA 2QJPB 1URQA 3V2NA 2B89A 1I8OA 1VF5C 1JUNA 1LT9B 2RH0A 4NFGB 4Q5PA 3IAOA 1VQNP 1AJYA 2AEMA 2IBZD 5BU8B 2JDIH 1AVOA 1NU1E 2J58A 1GZLA 2WPRA 5APTA 5GTHE 3MGNA 2QJKC 3H1ID 4H0KA 1EZVE 3RLMA 1KQLA 3GF3A 3L71J 2B88A 3GHGB 2ITAA 5KAIE 3CLQA 4IOIH 5AURA 1DH3A 3H1LJ 1HUCA 3MP7B 2QA4P 4B86A 1GDVA 1CIEA 451CA 1CZQA 1KFMA 4N3YB 2HPCB 1NTZG 3RK3E 1WRGA 1AYGA 2E75C 3FWNA 3L73G 1NTZJ 1JY3O 4PJ0V 2D2CC 2ZZS1 1JTHA 1Y9BA 3W68A 2ZXEB 1DW2A 1XTCC 1AQTA 3L73J 4H13C 4WY4B 1N7SA 1CYCA 2MTAC 1IQCA 2V4HA 2IPPA 3AE7C 1FDIA 5KAFH 1EDKA 1NO4A 2E76B 3BATA 3P7KA 1X8YA 5KAIH 4PV1C 1HH0A 2OQQA 5DJQC 1H1OA 2PACA 3C8VA 3M06A 1NMLA 2WZ7A 2FFDA 3O1YA 1MFZA 1SQPG 1KILC 1LWUA 1EC5A 3TF5A 3CCUP 3BCCE 2RMZA 2E42A 1I6DA 1SQVG 2Q3EA 1E5WA 4IL6V 2B10B 3TGUD 1PGOA 3B71A 1SQPJ 3X39A 2PAJA 2AEJA 3KZIH 2KSEA 2XV5A 2LITA 2V07A 4WY4D 3P8CE 3AEEC 4BWNA 2JWAA 2JP3A 1QVFO 1GU5A 2ZVNB 1SFCC 2N9IA 1DT1A 3AECC 2E76D 1RE3A 4LC1A 1AA0A 2O1KA 1NKNA 4QMAA 4ZMDA 5CCGC 1ZP0C 1I8PA 4HH2A 2QE7H 3PJSK 5GTHV 3RL0B 2KP8A 1CC5A 1I6EA 1DW3A 2Y9ZA 1I54A 1OW6A 2BGVX 2DW3A 1GL2C 1K04A 1M56D 2IYPA 1KB9I 4YE1A 1NTKK 2OYIC 3MHVA 1LT1A 1YCCA 4DY9A 1U57A 1KQGB 1SQBE 3VP8A 2AXTE 4U3FE 1I5TA 1OVUA 1DEEG 2E74B 3CPWO 3ZOOA 2IZ0A 1ZXGA 1JMMA 4H0JA 2ZT9C 5AVTB 1G1IA 1H9XA 1N9CA 1CRHA 1W5CE 1R8EA 3S9OA 2D0SA 5CJ0A 1A02F 4PWAA 4WQBA 1WMKA 1HZUA 3N4XA 3HQ8A 1WVEC 3SWFA 1HVVA 3AE4C 5CIFB 3RK2C 2MHMA 1DIQC 2KYVA 3VMXA 3A2AA 1S5LE 1N50A 1SQBJ 1MZ4A 1SQVD 3U1AA 1VF5D 4YPCA 3A0HE 1U7MA 1CXCA 5C0ZA 1PP9G 2E74D 3OJAB 2Y0DA 4PW9B 1KMIZ 4EIEA 1KYOI 1PP9J 1IC2A 2IDBA 1M60A 2O3JA 4OVNF 3RMZA 1YQ3C 3NBSA 4H44B 1N15A 1VQ7P 2PP6A 4KT0J 4AQRD 2R5DA 2YO2A 1VQLP 2Q5UA 1IZNB 4I6MC 1FZGA 1KILA 2IBZI 1H33A 3EQ2A 1IFJA 4EDFA 1LGHB 1CYIA 4O1WA 2KS1B 2I1KA 2L4DA 2DGEA 1YBKA 2YKOA 4GYDA 5AVVB 4LLHA 2KOGA 1SFCA 1PPJD 1S5LX 1GK6A 1X22A 1LTGC 2AXTV 1JY3N 1YEAA 2JWDA 2E5YA 3B5NC 1FI7A 2H8PD 1X0TA 3U59A 1BE3E 3O20A 1J3SA 1N73B 3FXDA 3HE4A 1ZN5A 3H6PA 3SWKA 1R0QA 3V5BA 1HCMA 1GL2A 5GTIE 3L37A 2KUBA 2ZVOB 1IRVA 5KTBA 2HV4A 2XU6A 1L0LE 3OA8B 1HJ0A 2OYIA 1M7LA 3VNWA 2XNDH 2WPSA 1FZCA 4PD4E 3V2RA 2W6AA 1M1JA 1SQXK 5CIGB 1S5LV 1USEA 5KJ7A 2N3BA 2N9JA 3JBTB 3HD7C 3SFDC 5APUA 3O6QA 3A0HV 1E79H 3EWKA 3VYMA 1MKMA 1P84E 2LXBA 2VRSA 2D0WA 3CCVP 1RY3A 3G9RA 5AVQB 2M3BA 1X9VA 2YIUC 1H88A 4O1QA
chains in the Genus database with same CATH topology
5KLVD 1CRIA 2BH5X 5E79V 3L74D 1LMSA 2FYNB 1NNOA 2ZONG 1H32B 1IZL0 1LC1A 1A56A 2A06D 1BL9A 4WQDA 4K3IA 4WQ9A 1NTMD 1KYOW 4EIDA 4Y5RA 3GW6A 1KX2A 1ZZHA 3DP5A 1CHHA 2CE1A 1A2SA 2YIUB 4V2KA 1FCDC 2N18B 3L75D 1CO6A 1CSXA 1DIIC 3O0RC 1GU2A 1E8EA 2V08A 3CU4A 3BCCD 4UB6V 2C1DB 3SXTA 3PTZA 1KYOD 1H31A 1A8CA 1CHIA 4AALA 1OCDA 2FRCA 1GJQA 4L3HA 1YICA 5TISV 1E29A 1NIRA 1KV9A 1MG2D 5KAFV 3L71D 2N3YA 3RN1A 1FI9A 2QJPB 1I8OA 3H1LD 1HJ5A 1F1CA 2BCNB 1HJ4A 2PCCB 4NFGB 4Q5PA 3CP5A 2ZBOA 3L4OA 2IBZD 3PXSA 3FWLA 1E2RA 1QKSA 2AI5A 4N0KA 2Y0EA 4MU8A 1RAPA 4FB1A 1NTZD 1IRWA 2GB8B 3PLNA 1NU1D 2ORLA 3H1ID 2YQBA 4H0KA 3SJLA 3RLMA 3NBTA 2CE0A 3A9FA 3SLEA 1I55A 3L73D 1EZVD 1C7MA 2YK3A 1DVVA 1LC2A 5AURA 1C75A 3VMAA 1GDVA 1CIEA 3ZOYA 451CA 3CXHW 1NMIA 4EICA 4U3FD 2BLFB 1AYGA 3OCDA 1YTCA 2CA4B 2C1VA 5CIBB 4AX3A 4P4QB 3CYTI 2QJKB 2EXVA 4QAOA 4FAVA 4PJ0V 2ZZS1 2B12B 2QG4A 3PHLA 1DW2A 2XTSB 1CEDA 1CHJA 3WUIA 1CYCA 1RZ5A 3CXHD 1WEJF 2MTAC 1IQCA 4FA5A 1SQPD 5CYTR 5CIDB 3ZCFA 1VYDA 1CCRA 3L4MA 1YNRA 1M6ZA 1CRYA 5DJQC 1H1OA 2PACA 3NWVA 1CRGA 1QN2A 1NMLA 1BCCD 1C52A 3DMIA 1H9YA 3O1YA 2CXBA 3ORVA 3ZBMA 3TF5A 2RMZA 1I6DA 2Q3EA 1DW1A 5CIEB 155CA 4IL6V 2B10B 3TGUD 1M70A 3X39A 2AIUA 4LJIA 2ZXYA 4XYDB 1CORA 1C6SA 1CTYA 5DJQB 5B6QA 2DVHA 2LITA 2V07A 2KS1A 2JWAA 2FYUD 4L1QA 1B7VA 3SVWA 1K3GA 1CTZA 2N9IA 1DT1A 1CCHA 1H33B 1RAQA 4D6TD 3C2CA 2C9XB 4EIFA 4L3GA 1H31B 1I8PA 3H1HD 1C2RA 1AOQA 1W2LA 4GEDB 5KKZB 3KHUA 5GTHV 5GTIV 3PXWA 1GIWA 1CC5A 1I6EA 1DW3A 1MG3D 1CIGA 1I54A 2OZ1B 2BGVX 1C6OA 3M97X 1LS9A 4AAMA 1CSWA 3WU2V 3O5CA 3WFBC 5EXQA 3VRDA 2N9YB 4YE1A 3HQ6A 3GG2A 2I8FA 3OA8A 3L72D 1YCCA 1QL3A 4DY9A 2FWLA 1YIQA 1I5TA 3CWBD 3MK7C 4FA4A 5B66V 3ZOOA 1CSUA 1BE3D 2VHDA 1SQBD 4H0JA 5CIHB 2BH4X 1YFCA 2CA3B 1S6VB 3PXTA 1H9XA 1N9CA 3TDKA 1CRHA 3SWSA 2D0SA 4PWAA 4WQBA 4WQEA 1L0LD 1HZUA 4AAOA 3H1KD 4XXLA 3WC8A 3HQ8A 1WVEC 4PD4D 1PP9D 3MK7B 4J20A 1BGYD 5CIFB 1HH7A 4WQCA 2MHMA 3OCDB 1DIQC 1H32A 1NTKD 5B5EV 1N50A 4FANA 1MZ4A 1SQVD 1K3HA 5DF5A 1OAEA 2PCBB 1C6RA 1P84D 4FA1A 1AKKA 4RSZA 1CXCA 5C0ZA 3PRJA 1HJ3A 2Y0DA 4PW9B 2K9JB 2JTIB 4EIEA 2B0ZB 3PH2B 2BCCD 4RJTA 1F1FA 1CTJA 1M60A 1GQ1A 2O3JA 2GIWA 2C1DA 1QYZA 1SQXD 3RMZA 3NBSA 3ZOXA 3WFEC 1N15A 1IO3A 1CNOA 1CIHA 1CRJA 3WFCC 4WQAA 2YCCA 3CX5W 2QJYB 2RN0A 1H33A 2C2CA 2B11B 2LIRA 4EDFA 4A7PA 5C9MA 1CYIA 1L9BC 4O1WA 3ZOWA 1CIFA 2BPBB 1L0ND 2L4DA 2DGEA 2OZ1A 1KX7A 1FI3A 1FJ0A 1EB7A 5TJHA 1YEBA 4GYDA 4WQ8A 1SQQD 2B4ZA 3CX5D 2KNCB 3H1JD 5KAIV 1PPJD 2AXTV 2C1UA 4FA9A 1YEAA 3HQ9A 1FI7A 1U75B 3RN0A 1QL4A 3O20A 1KIBA 3DR0A 1J3SA 1ETPA 1AOFA 2GC4D 1U74B 1HZVA 1DW0A 1R0QA 5DFSA 3L70D 5CICB 1HCMA 1N90A 5H2FV 1GKSA 1W5CT 2L91A 1IRVA 4WQ7A 2GC7D 1CRCA 1L9JC 1RZ6A 2HV4A 3OA8B 1DVHA 3ZIYA 3KZIV 3VNWA 351CA 4KMGA 3ITKA 1COTA 1FHBA 1KB9D 5CIGB 2C8SA 1HROA 1S5LV 1HRCA 2N3BA 5KLIB 2N9JA 3JBTB 1KB0A 1ZRTD 3WFDC 1C2NA 1CYJA 4AANA 4JCGA 3A0HV 3HQ7A 3A0BV 2Y0CA 3TYIA 3VYMA 5IY51 2ZOOA 2D0WA 2JQRA 1CXAA 1JDLA 1CSVA 4UB8V 1LFMA 2N18C 4O1QA 1FOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV D;  1CRI A;  2BH5 X;  5E79 V;  3L74 D;  1LMS A;  2FYN B;  1NNO A;  2ZON G;  1H32 B;  1IZL 0;  1LC1 A;  1A56 A;  2A06 D;  1BL9 A;  4WQD A;  4K3I A;  4WQ9 A;  1NTM D;  1KYO W;  4EID A;  4Y5R A;  3GW6 A;  1KX2 A;  1ZZH A;  3DP5 A;  1CHH A;  2CE1 A;  1A2S A;  2YIU B;  4V2K A;  1FCD C;  2N18 B;  3L75 D;  1CO6 A;  1CSX A;  1DII C;  3O0R C;  1GU2 A;  1E8E A;  2V08 A;  3CU4 A;  3BCC D;  4UB6 V;  2C1D B;  3SXT A;  3PTZ A;  1KYO D;  1H31 A;  1A8C A;  1CHI A;  4AAL A;  1OCD A;  2FRC A;  1GJQ A;  4L3H A;  1YIC A;  5TIS V;  1E29 A;  1NIR A;  1KV9 A;  1MG2 D;  5KAF V;  3L71 D;  2N3Y A;  3RN1 A;  1FI9 A;  2QJP B;  1I8O A;  3H1L D;  1HJ5 A;  1F1C A;  2BCN B;  1HJ4 A;  2PCC B;  4NFG B;  4Q5P A;  3CP5 A;  2ZBO A;  3L4O A;  2IBZ D;  3PXS A;  3FWL A;  1E2R A;  1QKS A;  2AI5 A;  4N0K A;  2Y0E A;  4MU8 A;  1RAP A;  4FB1 A;  1NTZ D;  1IRW A;  2GB8 B;  3PLN A;  1NU1 D;  2ORL A;  3H1I D;  2YQB A;  4H0K A;  3SJL A;  3RLM A;  3NBT A;  2CE0 A;  3A9F A;  3SLE A;  1I55 A;  3L73 D;  1EZV D;  1C7M A;  2YK3 A;  1DVV A;  1LC2 A;  5AUR A;  1C75 A;  3VMA A;  1GDV A;  1CIE A;  3ZOY A;  451C A;  3CXH W;  1NMI A;  4EIC A;  4U3F D;  2BLF B;  1AYG A;  3OCD A;  1YTC A;  2CA4 B;  2C1V A;  5CIB B;  4AX3 A;  4P4Q B;  3CYT I;  2QJK B;  2EXV A;  4QAO A;  4FAV A;  4PJ0 V;  2ZZS 1;  2B12 B;  2QG4 A;  3PHL A;  1DW2 A;  2XTS B;  1CED A;  1CHJ A;  3WUI A;  1CYC A;  1RZ5 A;  3CXH D;  1WEJ F;  2MTA C;  1IQC A;  4FA5 A;  1SQP D;  5CYT R;  5CID B;  3ZCF A;  1VYD A;  1CCR A;  3L4M A;  1YNR A;  1M6Z A;  1CRY A;  5DJQ C;  1H1O A;  2PAC A;  3NWV A;  1CRG A;  1QN2 A;  1NML A;  1BCC D;  1C52 A;  3DMI A;  1H9Y A;  3O1Y A;  2CXB A;  3ORV A;  3ZBM A;  3TF5 A;  2RMZ A;  1I6D A;  2Q3E A;  1DW1 A;  5CIE B;  155C A;  4IL6 V;  2B10 B;  3TGU D;  1M70 A;  3X39 A;  2AIU A;  4LJI A;  2ZXY A;  4XYD B;  1COR A;  1C6S A;  1CTY A;  5DJQ B;  5B6Q A;  2DVH A;  2LIT A;  2V07 A;  2KS1 A;  2JWA A;  2FYU D;  4L1Q A;  1B7V A;  3SVW A;  1K3G A;  1CTZ A;  2N9I A;  1DT1 A;  1CCH A;  1H33 B;  1RAQ A;  4D6T D;  3C2C A;  2C9X B;  4EIF A;  4L3G A;  1H31 B;  1I8P A;  3H1H D;  1C2R A;  1AOQ A;  1W2L A;  4GED B;  5KKZ B;  3KHU A;  5GTH V;  5GTI V;  3PXW A;  1GIW A;  1CC5 A;  1I6E A;  1DW3 A;  1MG3 D;  1CIG A;  1I54 A;  2OZ1 B;  2BGV X;  1C6O A;  3M97 X;  1LS9 A;  4AAM A;  1CSW A;  3WU2 V;  3O5C A;  3WFB C;  5EXQ A;  3VRD A;  2N9Y B;  4YE1 A;  3HQ6 A;  3GG2 A;  2I8F A;  3OA8 A;  3L72 D;  1YCC A;  1QL3 A;  4DY9 A;  2FWL A;  1YIQ A;  1I5T A;  3CWB D;  3MK7 C;  4FA4 A;  5B66 V;  3ZOO A;  1CSU A;  1BE3 D;  2VHD A;  1SQB D;  4H0J A;  5CIH B;  2BH4 X;  1YFC A;  2CA3 B;  1S6V B;  3PXT A;  1H9X A;  1N9C A;  3TDK A;  1CRH A;  3SWS A;  2D0S A;  4PWA A;  4WQB A;  4WQE A;  1L0L D;  1HZU A;  4AAO A;  3H1K D;  4XXL A;  3WC8 A;  3HQ8 A;  1WVE C;  4PD4 D;  1PP9 D;  3MK7 B;  4J20 A;  1BGY D;  5CIF B;  1HH7 A;  4WQC A;  2MHM A;  3OCD B;  1DIQ C;  1H32 A;  1NTK D;  5B5E V;  1N50 A;  4FAN A;  1MZ4 A;  1SQV D;  1K3H A;  5DF5 A;  1OAE A;  2PCB B;  1C6R A;  1P84 D;  4FA1 A;  1AKK A;  4RSZ A;  1CXC A;  5C0Z A;  3PRJ A;  1HJ3 A;  2Y0D A;  4PW9 B;  2K9J B;  2JTI B;  4EIE A;  2B0Z B;  3PH2 B;  2BCC D;  4RJT A;  1F1F A;  1CTJ A;  1M60 A;  1GQ1 A;  2O3J A;  2GIW A;  2C1D A;  1QYZ A;  1SQX D;  3RMZ A;  3NBS A;  3ZOX A;  3WFE C;  1N15 A;  1IO3 A;  1CNO A;  1CIH A;  1CRJ A;  3WFC C;  4WQA A;  2YCC A;  3CX5 W;  2QJY B;  2RN0 A;  1H33 A;  2C2C A;  2B11 B;  2LIR A;  4EDF A;  4A7P A;  5C9M A;  1CYI A;  1L9B C;  4O1W A;  3ZOW A;  1CIF A;  2BPB B;  1L0N D;  2L4D A;  2DGE A;  2OZ1 A;  1KX7 A;  1FI3 A;  1FJ0 A;  1EB7 A;  5TJH A;  1YEB A;  4GYD A;  4WQ8 A;  1SQQ D;  2B4Z A;  3CX5 D;  2KNC B;  3H1J D;  5KAI V;  1PPJ D;  2AXT V;  2C1U A;  4FA9 A;  1YEA A;  3HQ9 A;  1FI7 A;  1U75 B;  3RN0 A;  1QL4 A;  3O20 A;  1KIB A;  3DR0 A;  1J3S A;  1ETP A;  1AOF A;  2GC4 D;  1U74 B;  1HZV A;  1DW0 A;  1R0Q A;  5DFS A;  3L70 D;  5CIC B;  1HCM A;  1N90 A;  5H2F V;  1GKS A;  1W5C T;  2L91 A;  1IRV A;  4WQ7 A;  2GC7 D;  1CRC A;  1L9J C;  1RZ6 A;  2HV4 A;  3OA8 B;  1DVH A;  3ZIY A;  3KZI V;  3VNW A;  351C A;  4KMG A;  3ITK A;  1COT A;  1FHB A;  1KB9 D;  5CIG B;  2C8S A;  1HRO A;  1S5L V;  1HRC A;  2N3B A;  5KLI B;  2N9J A;  3JBT B;  1KB0 A;  1ZRT D;  3WFD C;  1C2N A;  1CYJ A;  4AAN A;  4JCG A;  3A0H V;  3HQ7 A;  3A0B V;  2Y0C A;  3TYI A;  3VYM A;  5IY5 1;  2ZOO A;  2D0W A;  2JQR A;  1CXA A;  1JDL A;  1CSV A;  4UB8 V;  1LFM A;  2N18 C;  4O1Q A;  1FOC A; 
#chains in the Genus database with same CATH topology
 4L75 A;  1JY3 P;  2K37 A;  1A56 A;  2P2U A;  1KB9 H;  2P10 A;  1YYC A;  3CCE P;  4WQ9 A;  4R4L A;  1EQ7 A;  3GW6 A;  1KX2 A;  1ZZH A;  3S4R A;  3L74 G;  1ZME C;  3C9I A;  1FCD C;  1PIX A;  1CO6 A;  1J1E C;  1CSX A;  5B66 H;  1A02 J;  1S9K E;  2QJP C;  1FDO A;  3L74 J;  2P1J A;  1LT9 C;  2V08 A;  3CU4 A;  1NU1 K;  3AE3 C;  3N7N A;  1L0N E;  1H31 A;  1PGJ A;  1FZF A;  4C7N A;  1K05 A;  3CCS P;  1USD A;  4L3H A;  1YIC A;  1JB0 J;  5AW6 B;  3GHG C;  3CCL P;  2FXM A;  4EYY Q;  5B5E H;  3WMM 0;  3HTK A;  2ZBO A;  2GM4 A;  3L4O A;  3PXS A;  3FWL A;  1E2R A;  2AI5 A;  1W2E A;  2FYU G;  2E43 A;  3FXE A;  3A7O A;  2WSF J;  2Y0E A;  1T8Z A;  2FY8 A;  4FB1 A;  2XNX A;  2MKV A;  3HE5 A;  2PRR A;  1KYO H;  3AEB C;  1Q81 Q;  2ORL A;  2WSF H;  1EDI A;  1EXJ A;  3NBT A;  3A9F A;  5AW9 B;  1I55 A;  2IBZ G;  1C7M A;  3B5N A;  3NFQ A;  3WUV A;  4WY4 C;  1ZRT E;  2C9L Y;  3T97 B;  2Y9Y A;  4NPD A;  3CXH W;  1NMI A;  2WPV B;  3LIE A;  4RKU J;  3C1L A;  3OCD A;  3H1I G;  2E76 C;  1JM0 A;  4P4Q B;  1GMJ A;  1NWQ A;  3L72 G;  3CYT I;  2K3R A;  4EI2 A;  5H2F E;  4FAV A;  2WTY A;  2WMM A;  2HOD B;  3CC7 P;  3H1I J;  5KLV E;  4I7Z B;  2QG4 A;  3L72 J;  5CHX A;  3RGU A;  4K3A A;  1CHJ A;  3WUI A;  3CXH D;  2A06 E;  2WPQ A;  4W7Y A;  4FA5 A;  3Q1M A;  5CYT R;  1LP1 A;  2FYZ A;  3S1K A;  1CSB A;  3V6I A;  1NTM E;  1CCR A;  4JBZ A;  3LW5 J;  3H1K G;  1NVO A;  3A0B E;  2WT7 B;  3LW5 H;  1CRG A;  3G4S P;  1BCC D;  1IFI A;  1KFN A;  1G2C A;  1OFC X;  1OVV A;  1T2K D;  1QVG O;  2HLO A;  3ZBM A;  2JEE A;  1RF1 B;  3M0D C;  3AEF C;  1IK9 A;  5CIE B;  2N9B A;  5H2F H;  3OW2 O;  1KD1 Q;  4LJI A;  2ZXY A;  3RL0 C;  4GIF A;  4TT3 H;  2L5G B;  1CTY A;  1PFI A;  2DVH A;  4N78 D;  3CME P;  2FYU D;  4L1Q A;  1YI2 P;  1DD3 A;  3HD7 D;  2KNC A;  1SQB K;  3AEG C;  2G3A A;  3TGU G;  1X79 B;  3RL0 g;  1JOC A;  1IK7 A;  1LT9 A;  3AE6 C;  3C2C A;  3A0B H;  4NPE A;  2J5U A;  3B4S A;  3TNU B;  3TGU J;  1AOQ A;  2E74 C;  4GED B;  5KKZ B;  1IFD A;  1GW3 A;  1NTZ E;  1MG3 D;  1CIG A;  1OXZ A;  3VMZ A;  2OZ1 B;  1C6O A;  3M97 X;  2B87 B;  1T6A A;  4AAM A;  1CSW A;  3WU2 V;  5E79 H;  2W83 C;  3L73 E;  3HQ6 A;  2SPZ A;  2IFN A;  5KAF E;  3GHG A;  3PP5 A;  2I8F A;  1T3U A;  3L72 D;  4U7J A;  5C39 A;  2FWL A;  1NJI Q;  3CWB D;  2QVA A;  1SQQ G;  2QRX A;  5AW5 B;  1HTL C;  1VQ9 P;  1YFC A;  2UWJ E;  1S6V B;  1NH4 A;  3TDK A;  3D0W A;  1FZB A;  3Q5S A;  3SWS A;  1U7J A;  1SVF A;  4UB6 H;  3CCM P;  4WQE A;  3QH9 A;  4AAO A;  3H1K D;  1RF0 C;  4IL6 X;  1S1C X;  4WY4 A;  1NAF A;  1SQP E;  4J20 A;  3KZI E;  1BGY D;  2H43 A;  5APQ A;  1FJP A;  4WQC A;  1FZA A;  1SQV E;  1H32 A;  3Q5R A;  3LID A;  1VDF A;  4L76 A;  1CW5 A;  2KI7 B;  2W8Z A;  1K3H A;  1OAE A;  2FXO A;  2B9B A;  4H44 C;  2RKL A;  3TYY A;  1KQF B;  3HUS B;  3GF7 A;  1N7S B;  1L4A B;  1ZLL A;  2YXR B;  4YXW H;  2YO3 A;  2WQY C;  2B0Z B;  1DD4 A;  2BCC D;  1F1F A;  1N2D C;  1GQ1 A;  2GIW A;  1S3J A;  2C1D A;  1SQX D;  4DT0 A;  2OGU A;  4WB4 A;  3AE5 C;  1SQV J;  3BVH A;  3WFE C;  1LNQ A;  1IO3 A;  1RHZ B;  2FFD B;  1PV3 A;  1YQ4 C;  1LWU B;  3CX5 W;  2ZYA A;  1IFP A;  2HR3 A;  2RN0 A;  2ZXX A;  4OGQ B;  2B11 B;  3VOP A;  2P58 A;  3M0D A;  4A7P A;  3II6 A;  2FKW B;  3MTU E;  2KLU A;  4MN4 C;  3ZOW A;  3L75 G;  1CIF A;  1NYH A;  1L0L K;  1N7S D;  1L4A D;  1FI3 A;  1YEB A;  1R5L A;  4WQ8 A;  1SQQ D;  1MFT A;  3CX5 D;  5AW8 B;  3H1J D;  5KAI V;  5M1B A;  1VL2 A;  3L75 J;  2FBW C;  4DOJ A;  3RK3 B;  3KYQ A;  2C1U A;  1U75 B;  3WUU A;  2W27 A;  1KIB A;  1ETP A;  3A5T A;  4CPG A;  1LTJ B;  2GC4 D;  1U74 B;  1JMB A;  1KIL E;  1DW0 A;  3EFG A;  1SLQ A;  1PPJ G;  4OGQ D;  2GC7 D;  2A45 I;  1HF9 A;  2IFM A;  4GOD A;  5CCH D;  3GLM A;  2W6B A;  1YJN P;  4R4M A;  3CXH I;  3KZI V;  3SFE C;  4KMG A;  3W67 A;  1PP9 E;  2FXP A;  2KXP B;  3V4W A;  5L8R J;  1CI6 A;  3RL0 D;  5AVS B;  1GK4 A;  1FBM A;  3AE9 C;  1FE6 A;  3D6Y A;  3WFD C;  1C2N A;  3MZW B;  1VQO P;  1HJB A;  1JCD A;  4JCG A;  3RK3 D;  3HQ7 A;  4O9B A;  4EIJ A;  2OYH C;  3MD0 A;  2ZOO A;  1GTW A;  1CXA A;  1N86 A;  3MUD C;  1LFM A;  1FOC A;  2M5A A;  3NXS A;  1ZW0 A;  1H0T A;  1L2P A;  1LMS A;  2J59 M;  4WBA A;  5CBN A;  1IZL 0;  1L0N K;  4GT1 A;  4WQD A;  1QL2 A;  2GUS A;  1IJD B;  4Y5R A;  3VYI A;  3ZDM A;  2CE1 A;  4V2K A;  4H13 B;  3L75 D;  3VMY A;  1EDL A;  4YXD C;  3G3Z A;  3AE8 C;  3RBX A;  1DII C;  1E8E A;  1R5S A;  3BCC D;  4DZO A;  4AAL A;  2H89 C;  4TLF A;  4HJG H;  1AQ5 A;  3TSI A;  3UIA A;  1GJQ A;  3R4Y A;  1E29 A;  2M8R A;  1JCC A;  3RN1 A;  3P32 A;  2POH A;  1F1C A;  2KK7 A;  1HJ4 A;  4BXL A;  2PCC B;  1JO5 A;  1GD2 E;  3CP5 A;  1BDC A;  2ZYG A;  4H44 D;  5CCG A;  5AVY B;  1QKS A;  1D7M A;  3BRV B;  3GMA A;  3V2Q A;  1LJ2 A;  1T2K C;  2QM8 A;  3KQG A;  3TK1 A;  2KZJ A;  4MU8 A;  1RAP A;  4EOT A;  1IRW A;  5KLV K;  1OW7 A;  5AVR B;  3M91 A;  4D6T G;  3RBZ A;  1BDD A;  2CE0 A;  2IZ1 A;  1KB9 E;  4I7Z C;  1DVV A;  1LC2 A;  2Z4E A;  4OWF A;  4D6T J;  2N1T B;  4Z1M H;  2QIW A;  2NPS B;  3ZOY A;  1NTM K;  3HE4 B;  5APS A;  2FYN C;  3G71 P;  4EIC A;  1DX7 A;  4U3F D;  2BLF B;  1ZOY C;  1YTC A;  2CA4 B;  2C1V A;  5CIB B;  2K9Y A;  4AX3 A;  2XDJ A;  5B66 E;  1Q2N A;  1JEK A;  2EXV A;  4QAO A;  2YXQ B;  1FZC B;  1VQ8 P;  4Y99 B;  1M1J B;  3D71 A;  3L74 E;  3PHL A;  1JY2 O;  3K5B A;  3MIW A;  2W6J H;  4OH8 B;  3M0A A;  1FOS F;  1VQ4 P;  1RZ5 A;  1WEJ F;  1RF1 C;  4M3L A;  2K9J A;  5APV A;  1FU1 A;  5K5G B;  5CID B;  1VYD A;  2OYH A;  3L4M A;  1YNR A;  1M6Z A;  5B5E E;  2A45 G;  2N1T D;  3NWV A;  2NPS D;  1QN2 A;  3MUD A;  4K35 A;  3DMI A;  2O01 J;  1NTK G;  2CXB A;  3ORV A;  3RK2 B;  5AW4 B;  3H32 B;  2JKV A;  2O01 H;  2ZFC A;  4IFD K;  1OW8 A;  1NTZ K;  2A45 H;  1KYO E;  1NTK J;  1M70 A;  3I56 P;  4JQ0 D;  3CXH H;  2AIU A;  5KKZ C;  1OZH A;  3CX5 I;  3O8Z A;  2FYU E;  1BCC G;  5B6Q A;  5KJ7 D;  2LR2 A;  1FDM A;  2KIK A;  3BAS A;  3IFM A;  1CTZ A;  1BCC J;  2PFX A;  3IN6 A;  1RAQ A;  1HBW A;  4D6T D;  2IBZ E;  4EIF A;  1H31 B;  3R2P A;  3H1H D;  3CCR P;  3IF4 A;  4C7N B;  3KHU A;  5GTI V;  4DCK A;  2P7J A;  2Q6Q A;  2R32 A;  4UB8 H;  1ZR4 A;  3H1I E;  2M0B A;  3O5C A;  1OWA A;  3WFB C;  3L72 E;  5EXQ A;  2N9Y B;  2FYU J;  5TIS E;  1SQP K;  3GG2 A;  1SQV K;  3HTK B;  1DIP A;  1KN7 A;  2HG5 D;  4GDO A;  5CBO A;  1YIQ A;  1SP4 A;  5B66 V;  1CSU A;  1BE3 D;  2VHD A;  1QEX A;  1J1D B;  1EXI A;  5CIH B;  2BH4 X;  3HE5 B;  3PXT A;  3CC4 P;  1Y47 A;  1LTI C;  3H1K E;  3B5N B;  1MV8 A;  2HOD A;  3SWY A;  1L0L D;  3CWB G;  4LGD E;  1BGY E;  4XXL A;  4C7R A;  3HUS C;  1N7S C;  1L4A C;  3L70 G;  4PD4 D;  1S2E A;  4BRY B;  3MK7 B;  3HRN A;  2ZAE B;  3AEA C;  1LTA C;  3OCD B;  3CWB J;  1NTK D;  2R5B A;  3HD7 A;  5TIS H;  5B5E V;  3CCQ P;  2JJL A;  4WWI A;  4FAN A;  3L70 J;  5DF5 A;  2LXC B;  2PCB B;  2AXC A;  1C6R A;  2R44 A;  1P84 D;  1AKK A;  4RSZ A;  1YIJ P;  2FFD C;  3SSU A;  3PRJ A;  1BGY G;  1HJ3 A;  4XFJ A;  1LWU C;  3EFF K;  4ZKP A;  3H1K J;  4H0L B;  4W80 A;  2O1J A;  1RF1 A;  4OGQ C;  3TGU E;  1FAV A;  3WU2 H;  1BGY J;  3PH2 B;  1ZV8 A;  4RJT A;  5E79 E;  5CCH C;  5AVZ B;  1AFO A;  1QLE D;  2LKM A;  1H89 A;  3JSV C;  1N7L A;  3ZOX A;  2QSI A;  1AV1 A;  1CNO A;  1CIH A;  1CRJ A;  3RK3 C;  2BCC G;  2QJY B;  4ZKU A;  2C2C A;  1S9K D;  1SQX G;  1IFN A;  4JYB A;  2ZYD A;  2BCC J;  5BU5 A;  4PJ0 H;  1LTJ C;  4UB6 E;  1SQQ E;  3CX5 E;  1SQX J;  1L0N D;  3USS A;  2YNY A;  2OZ1 A;  1KX7 A;  1EB7 A;  4H0L D;  2KNC B;  1QX8 A;  1JNM A;  5EFW B;  1PGP A;  1URQ B;  5AVU B;  1K8A Q;  4FA9 A;  3HQ9 A;  2Q9I A;  4XE5 B;  3DR0 A;  4GKG A;  3A3Y B;  1JY2 N;  4JPZ B;  2MJZ A;  4GOE A;  3L71 G;  1HZV A;  2HPC A;  5DFS A;  2XZR A;  3H1J G;  3KXD A;  3L70 D;  5CIC B;  2K88 A;  5H2F V;  5APX A;  1GKS A;  3H1L G;  2HYN A;  1N8R Q;  3AE1 C;  4WQ7 A;  2KLV A;  1CRC A;  1L9J C;  1SQQ J;  1K9M Q;  2NZ2 A;  3H1J J;  2OAR A;  3ZIY A;  4IL6 H;  3ITK A;  1COT A;  1FHB A;  2H88 C;  1NAY A;  3CX5 H;  1UIX A;  2BEZ F;  2C8S A;  1HRO A;  2Q3I A;  1VQK P;  5KLI B;  1ZRT D;  1NU1 G;  2QEX P;  4AAN A;  3D6Z A;  1G1J A;  3A0B V;  1URQ D;  3TYI A;  4AYC A;  1BSN A;  1EZV G;  1GW4 A;  1NU1 J;  2P67 A;  3Q2Y A;  5APW A;  3B8E B;  1FC2 C;  1JTH B;  3VN0 A;  1JDL A;  1PGQ A;  1CSV A;  3HUS A;  5KLV D;  1CRI A;  1IO4 A;  5E79 V;  1L4A A;  1PZQ A;  5GTH H;  2WIT A;  1NNO A;  2ZON G;  2W90 A;  3WUT A;  1H32 B;  3CI9 A;  1UII A;  2A06 D;  3VTP C;  1BL9 A;  1M1K Q;  1JY2 P;  1Z56 A;  3ABV C;  2OTJ P;  1NTM D;  4EID A;  1GU4 A;  3L75 E;  4KHX A;  1Y8A A;  1CHH A;  1M8O B;  1A2S A;  1YHQ P;  2N18 B;  3V4Q A;  5CJ4 A;  2XKM A;  3O0R C;  4UB6 V;  1VQM P;  2C1D B;  1WT6 A;  5CCH A;  3SXT A;  3PTZ A;  2NRG A;  1QGK B;  1H8A A;  1A8C A;  1CHI A;  5CMZ A;  1N73 C;  1OCD A;  2WVR A;  3FGA D;  1PPJ E;  1YIT P;  5KAF V;  3L71 D;  2N3Y A;  3BCC G;  1Q86 Q;  3H1L D;  3L35 A;  1HJ5 A;  2BCN B;  1NOH A;  2N1T C;  2NPS C;  3BCC J;  2JO1 A;  4N0K A;  1LTJ A;  1NTZ D;  2GB8 B;  3PLN A;  1LTT C;  4JF7 A;  1NU1 D;  3F5H A;  3SJL A;  2YQB A;  1M57 D;  1S72 P;  4GOF A;  4PD4 I;  1FZC C;  2R3S A;  3SLE A;  2V7Q J;  4Y99 C;  3L73 D;  1VF5 B;  1M1J C;  1EZV D;  2YK3 A;  4HKZ H;  4JYC A;  4Y28 J;  2OYO A;  5KJ7 C;  2V7Q H;  1C75 A;  3CCJ P;  3VMA A;  3IR9 A;  2WSS H;  1SS1 A;  2OTK E;  2Q7C A;  1P84 I;  1RQV A;  2QJK B;  3L4F A;  2B12 B;  2YKQ A;  2YMK A;  1NGM B;  1CI6 B;  1SQB G;  1MZ9 A;  4U3F G;  2YKP A;  2XTS B;  1CED A;  1RF0 A;  2YMY A;  3CC2 P;  3QWO C;  1Q7Y Q;  1SQP D;  2FYU K;  5BVZ A;  2R3C A;  4U3F J;  3ZCF A;  2E75 B;  2GUV A;  2C0W A;  2AXT H;  1CRY A;  4N6J A;  2D2C B;  5AW0 B;  2AEF A;  3F89 A;  2M5A B;  1C52 A;  1H9Y A;  1H0T B;  2C9N Y;  1TU3 F;  1DW1 A;  4I2L C;  155C A;  3AE2 C;  1XTG B;  1KTM A;  4XYD B;  4PV1 B;  1COR A;  2Z5I A;  1C6S A;  5DJQ B;  2KS1 A;  3CL3 D;  1B7V A;  3SVW A;  1S5L H;  1K3G A;  4D6T E;  3P8C D;  5APY A;  1CCH A;  1KIL B;  1NKZ B;  1H33 B;  3H1H E;  3KPE A;  2E75 D;  3A0H H;  4RO0 A;  2C9X B;  1YJW P;  4L3G A;  2D2C D;  2Q1K A;  1C2R A;  1W2L A;  1GIW A;  3PXW A;  1HGZ A;  1KQS O;  1N73 A;  1J1D C;  3I5C A;  4H13 D;  1LS9 A;  1J2J B;  3CD6 P;  1VQP P;  1SFC B;  3VRD A;  3OA8 A;  3Q5P A;  1HWT C;  1M90 Q;  3H1H G;  2O01 N;  1QL3 A;  4PV1 D;  2N1T A;  1NHL A;  2KB7 P;  2NPS A;  3MK7 C;  4FA4 A;  2BEQ D;  4XA4 A;  1YTZ T;  3H1H J;  1SQB D;  2I8D A;  1GL2 B;  1KIL D;  1KV4 A;  4I1L A;  2CA3 B;  4HYT B;  3NMD A;  5AW7 B;  2OYI B;  1QL1 A;  3NTN A;  1MUU A;  3WC8 A;  3CXH E;  1BE3 G;  1NTK E;  1PP9 D;  4H0L C;  4W7Z A;  1HH7 A;  3Q3D A;  1SFC D;  2WWW A;  2ZT9 B;  1BE3 J;  3O6Q B;  1OVR A;  1Q90 D;  4DJG A;  1L0L G;  4WVZ A;  2K1A A;  1BCC E;  5CCG D;  4FA1 A;  3M9Q A;  1LTS C;  1FS0 E;  1RE4 C;  4YTP C;  2KSJ A;  5GTI H;  1L0L J;  3V2P A;  4IFF A;  2K9J B;  2Z5H A;  2QJY C;  1GL2 D;  3H32 A;  2JTI B;  4UB8 E;  3E1R A;  5AW3 B;  1SQQ K;  3M9H A;  1CTJ A;  2OYH B;  4PD4 H;  3KDP B;  1QYZ A;  4IFM A;  4N78 E;  2GA1 A;  3JCU E;  1KZU B;  4RES B;  3WFC C;  4WQA A;  2YCC A;  2ZT9 D;  5DJT B;  1Q82 Q;  1URQ C;  1P84 H;  3H25 A;  4NPF X;  2WSE J;  2LIR A;  3E1I A;  2WSC J;  2WSE H;  5C9M A;  2WSC H;  1L9B C;  1T3J A;  2BPB B;  5AVW B;  5TJH A;  2G8Y A;  1FJ0 A;  2KZI A;  2B4Z A;  1EZV I;  3RK2 D;  1OMI A;  5AVX B;  2H7H A;  3OA7 A;  2E5T A;  4L74 A;  2JR8 A;  1W2B O;  3JC2 2;  3I55 P;  3CWB E;  3RN0 A;  1QL4 A;  1AVY A;  1K73 Q;  3JCU H;  1L0N G;  3L70 E;  5KLI C;  1AOF A;  1VQ5 P;  2IYO A;  3U1C A;  3T97 A;  2QM7 A;  1BSH A;  1YTZ I;  2M3E A;  1N90 A;  1W5C T;  1RQU A;  1L0N J;  2L91 A;  3L36 A;  1IFM A;  1RZ6 A;  4ASW A;  3WU2 E;  4AUW A;  1DVH A;  3BRT B;  5DJU B;  351C A;  1RH5 B;  1FJK A;  2ZJS E;  1PL5 A;  1KB9 D;  4ZNC A;  1HRC A;  1GDT A;  4BRY A;  1KB0 A;  1CYJ A;  3P8M C;  3VP9 A;  3E7K A;  2Y0C A;  2I1J A;  4HB1 A;  5IY5 1;  2CK3 H;  2JQR A;  2IX7 C;  5AW1 B;  1VQ6 P;  2OTL P;  2WT7 A;  4UB8 V;  2N18 C;  4PJ0 E;  1KC8 Q;  2BH5 X;  1FOS E;  3L74 D;  1ZR2 A;  2FYN B;  2BCC E;  2BAS A;  3HD7 B;  1LC1 A;  1OX3 A;  1LP1 B;  1SQX E;  2CPS A;  4ASV A;  4K3I A;  1OIP A;  1KOR A;  3B5N D;  1KYO W;  4C46 A;  4L73 A;  1VPC A;  5KLV G;  3DP5 A;  1S4X A;  3PH0 A;  5AW2 B;  2YIU B;  1G2C B;  2HFE D;  2PGD A;  1RE4 A;  2C0X A;  3D70 A;  2CPB A;  2A06 G;  1RE3 C;  4KJM A;  5KLV J;  1GU2 A;  3G6E P;  1LTB C;  1NTM G;  3AED C;  1KYO D;  1HGV A;  3TNU A;  2FRC A;  3FX0 A;  3CMA P;  3OAK A;  4IL6 E;  3L71 E;  1DEB A;  1YJ9 P;  1NTM J;  3H1J E;  5TIS V;  1NIR A;  1KV9 A;  2B87 A;  3H1L E;  1MG2 D;  3M9B A;  1EDJ A;  1J1E B;  1FI9 A;  1FZE A;  2QJP B;  1URQ A;  3V2N A;  2B89 A;  1I8O A;  1VF5 C;  1JUN A;  1LT9 B;  2RH0 A;  4NFG B;  4Q5P A;  3IAO A;  1VQN P;  1AJY A;  2AEM A;  2IBZ D;  5BU8 B;  2JDI H;  1AVO A;  1NU1 E;  2J58 A;  1GZL A;  2WPR A;  5APT A;  5GTH E;  3MGN A;  2QJK C;  3H1I D;  4H0K A;  1EZV E;  3RLM A;  1KQL A;  3GF3 A;  3L71 J;  2B88 A;  3GHG B;  2ITA A;  5KAI E;  3CLQ A;  4IOI H;  5AUR A;  1DH3 A;  3H1L J;  1HUC A;  3MP7 B;  2QA4 P;  4B86 A;  1GDV A;  1CIE A;  451C A;  1CZQ A;  1KFM A;  4N3Y B;  2HPC B;  1NTZ G;  3RK3 E;  1WRG A;  1AYG A;  2E75 C;  3FWN A;  3L73 G;  1NTZ J;  1JY3 O;  4PJ0 V;  2D2C C;  2ZZS 1;  1JTH A;  1Y9B A;  3W68 A;  2ZXE B;  1DW2 A;  1XTC C;  1AQT A;  3L73 J;  4H13 C;  4WY4 B;  1N7S A;  1CYC A;  2MTA C;  1IQC A;  2V4H A;  2IPP A;  3AE7 C;  1FDI A;  5KAF H;  1EDK A;  1NO4 A;  2E76 B;  3BAT A;  3P7K A;  1X8Y A;  5KAI H;  4PV1 C;  1HH0 A;  2OQQ A;  5DJQ C;  1H1O A;  2PAC A;  3C8V A;  3M06 A;  1NML A;  2WZ7 A;  2FFD A;  3O1Y A;  1MFZ A;  1SQP G;  1KIL C;  1LWU A;  1EC5 A;  3TF5 A;  3CCU P;  3BCC E;  2RMZ A;  2E42 A;  1I6D A;  1SQV G;  2Q3E A;  1E5W A;  4IL6 V;  2B10 B;  3TGU D;  1PGO A;  3B71 A;  1SQP J;  3X39 A;  2PAJ A;  2AEJ A;  3KZI H;  2KSE A;  2XV5 A;  2LIT A;  2V07 A;  4WY4 D;  3P8C E;  3AEE C;  4BWN A;  2JWA A;  2JP3 A;  1QVF O;  1GU5 A;  2ZVN B;  1SFC C;  2N9I A;  1DT1 A;  3AEC C;  2E76 D;  1RE3 A;  4LC1 A;  1AA0 A;  2O1K A;  1NKN A;  4QMA A;  4ZMD A;  5CCG C;  1ZP0 C;  1I8P A;  4HH2 A;  2QE7 H;  3PJS K;  5GTH V;  3RL0 B;  2KP8 A;  1CC5 A;  1I6E A;  1DW3 A;  2Y9Z A;  1I54 A;  1OW6 A;  2BGV X;  2DW3 A;  1GL2 C;  1K04 A;  1M56 D;  2IYP A;  1KB9 I;  4YE1 A;  1NTK K;  2OYI C;  3MHV A;  1LT1 A;  1YCC A;  4DY9 A;  1U57 A;  1KQG B;  1SQB E;  3VP8 A;  2AXT E;  4U3F E;  1I5T A;  1OVU A;  1DEE G;  2E74 B;  3CPW O;  3ZOO A;  2IZ0 A;  1ZXG A;  1JMM A;  4H0J A;  2ZT9 C;  5AVT B;  1G1I A;  1H9X A;  1N9C A;  1CRH A;  1W5C E;  1R8E A;  3S9O A;  2D0S A;  5CJ0 A;  1A02 F;  4PWA A;  4WQB A;  1WMK A;  1HZU A;  3N4X A;  3HQ8 A;  1WVE C;  3SWF A;  1HVV A;  3AE4 C;  5CIF B;  3RK2 C;  2MHM A;  1DIQ C;  2KYV A;  3VMX A;  3A2A A;  1S5L E;  1N50 A;  1SQB J;  1MZ4 A;  1SQV D;  3U1A A;  1VF5 D;  4YPC A;  3A0H E;  1U7M A;  1CXC A;  5C0Z A;  1PP9 G;  2E74 D;  3OJA B;  2Y0D A;  4PW9 B;  1KMI Z;  4EIE A;  1KYO I;  1PP9 J;  1IC2 A;  2IDB A;  1M60 A;  2O3J A;  4OVN F;  3RMZ A;  1YQ3 C;  3NBS A;  4H44 B;  1N15 A;  1VQ7 P;  2PP6 A;  4KT0 J;  4AQR D;  2R5D A;  2YO2 A;  1VQL P;  2Q5U A;  1IZN B;  4I6M C;  1FZG A;  1KIL A;  2IBZ I;  1H33 A;  3EQ2 A;  1IFJ A;  4EDF A;  1LGH B;  1CYI A;  4O1W A;  2KS1 B;  2I1K A;  2L4D A;  2DGE A;  1YBK A;  2YKO A;  4GYD A;  5AVV B;  4LLH A;  2KOG A;  1SFC A;  1PPJ D;  1S5L X;  1GK6 A;  1X22 A;  1LTG C;  2AXT V;  1JY3 N;  1YEA A;  2JWD A;  2E5Y A;  3B5N C;  1FI7 A;  2H8P D;  1X0T A;  3U59 A;  1BE3 E;  3O20 A;  1J3S A;  1N73 B;  3FXD A;  3HE4 A;  1ZN5 A;  3H6P A;  3SWK A;  1R0Q A;  3V5B A;  1HCM A;  1GL2 A;  5GTI E;  3L37 A;  2KUB A;  2ZVO B;  1IRV A;  5KTB A;  2HV4 A;  2XU6 A;  1L0L E;  3OA8 B;  1HJ0 A;  2OYI A;  1M7L A;  3VNW A;  2XND H;  2WPS A;  1FZC A;  4PD4 E;  3V2R A;  2W6A A;  1M1J A;  1SQX K;  5CIG B;  1S5L V;  1USE A;  5KJ7 A;  2N3B A;  2N9J A;  3JBT B;  3HD7 C;  3SFD C;  5APU A;  3O6Q A;  3A0H V;  1E79 H;  3EWK A;  3VYM A;  1MKM A;  1P84 E;  2LXB A;  2VRS A;  2D0W A;  3CCV P;  1RY3 A;  3G9R A;  5AVQ B;  2M3B A;  1X9V A;  2YIU C;  1H88 A;  4O1Q A; 
#chains in the Genus database with same CATH homology
 5KLV D;  1CRI A;  2BH5 X;  5E79 V;  3L74 D;  1LMS A;  2FYN B;  1NNO A;  2ZON G;  1H32 B;  1IZL 0;  1LC1 A;  1A56 A;  2A06 D;  1BL9 A;  4WQD A;  4K3I A;  4WQ9 A;  1NTM D;  1KYO W;  4EID A;  4Y5R A;  3GW6 A;  1KX2 A;  1ZZH A;  3DP5 A;  1CHH A;  2CE1 A;  1A2S A;  2YIU B;  4V2K A;  1FCD C;  2N18 B;  3L75 D;  1CO6 A;  1CSX A;  1DII C;  3O0R C;  1GU2 A;  1E8E A;  2V08 A;  3CU4 A;  3BCC D;  4UB6 V;  2C1D B;  3SXT A;  3PTZ A;  1KYO D;  1H31 A;  1A8C A;  1CHI A;  4AAL A;  1OCD A;  2FRC A;  1GJQ A;  4L3H A;  1YIC A;  5TIS V;  1E29 A;  1NIR A;  1KV9 A;  1MG2 D;  5KAF V;  3L71 D;  2N3Y A;  3RN1 A;  1FI9 A;  2QJP B;  1I8O A;  3H1L D;  1HJ5 A;  1F1C A;  2BCN B;  1HJ4 A;  2PCC B;  4NFG B;  4Q5P A;  3CP5 A;  2ZBO A;  3L4O A;  2IBZ D;  3PXS A;  3FWL A;  1E2R A;  1QKS A;  2AI5 A;  4N0K A;  2Y0E A;  4MU8 A;  1RAP A;  4FB1 A;  1NTZ D;  1IRW A;  2GB8 B;  3PLN A;  1NU1 D;  2ORL A;  3H1I D;  2YQB A;  4H0K A;  3SJL A;  3RLM A;  3NBT A;  2CE0 A;  3A9F A;  3SLE A;  1I55 A;  3L73 D;  1EZV D;  1C7M A;  2YK3 A;  1DVV A;  1LC2 A;  5AUR A;  1C75 A;  3VMA A;  1GDV A;  1CIE A;  3ZOY A;  451C A;  3CXH W;  1NMI A;  4EIC A;  4U3F D;  2BLF B;  1AYG A;  3OCD A;  1YTC A;  2CA4 B;  2C1V A;  5CIB B;  4AX3 A;  4P4Q B;  3CYT I;  2QJK B;  2EXV A;  4QAO A;  4FAV A;  4PJ0 V;  2ZZS 1;  2B12 B;  2QG4 A;  3PHL A;  1DW2 A;  2XTS B;  1CED A;  1CHJ A;  3WUI A;  1CYC A;  1RZ5 A;  3CXH D;  1WEJ F;  2MTA C;  1IQC A;  4FA5 A;  1SQP D;  5CYT R;  5CID B;  3ZCF A;  1VYD A;  1CCR A;  3L4M A;  1YNR A;  1M6Z A;  1CRY A;  5DJQ C;  1H1O A;  2PAC A;  3NWV A;  1CRG A;  1QN2 A;  1NML A;  1BCC D;  1C52 A;  3DMI A;  1H9Y A;  3O1Y A;  2CXB A;  3ORV A;  3ZBM A;  3TF5 A;  2RMZ A;  1I6D A;  2Q3E A;  1DW1 A;  5CIE B;  155C A;  4IL6 V;  2B10 B;  3TGU D;  1M70 A;  3X39 A;  2AIU A;  4LJI A;  2ZXY A;  4XYD B;  1COR A;  1C6S A;  1CTY A;  5DJQ B;  5B6Q A;  2DVH A;  2LIT A;  2V07 A;  2KS1 A;  2JWA A;  2FYU D;  4L1Q A;  1B7V A;  3SVW A;  1K3G A;  1CTZ A;  2N9I A;  1DT1 A;  1CCH A;  1H33 B;  1RAQ A;  4D6T D;  3C2C A;  2C9X B;  4EIF A;  4L3G A;  1H31 B;  1I8P A;  3H1H D;  1C2R A;  1AOQ A;  1W2L A;  4GED B;  5KKZ B;  3KHU A;  5GTH V;  5GTI V;  3PXW A;  1GIW A;  1CC5 A;  1I6E A;  1DW3 A;  1MG3 D;  1CIG A;  1I54 A;  2OZ1 B;  2BGV X;  1C6O A;  3M97 X;  1LS9 A;  4AAM A;  1CSW A;  3WU2 V;  3O5C A;  3WFB C;  5EXQ A;  3VRD A;  2N9Y B;  4YE1 A;  3HQ6 A;  3GG2 A;  2I8F A;  3OA8 A;  3L72 D;  1YCC A;  1QL3 A;  4DY9 A;  2FWL A;  1YIQ A;  1I5T A;  3CWB D;  3MK7 C;  4FA4 A;  5B66 V;  3ZOO A;  1CSU A;  1BE3 D;  2VHD A;  1SQB D;  4H0J A;  5CIH B;  2BH4 X;  1YFC A;  2CA3 B;  1S6V B;  3PXT A;  1H9X A;  1N9C A;  3TDK A;  1CRH A;  3SWS A;  2D0S A;  4PWA A;  4WQB A;  4WQE A;  1L0L D;  1HZU A;  4AAO A;  3H1K D;  4XXL A;  3WC8 A;  3HQ8 A;  1WVE C;  4PD4 D;  1PP9 D;  3MK7 B;  4J20 A;  1BGY D;  5CIF B;  1HH7 A;  4WQC A;  2MHM A;  3OCD B;  1DIQ C;  1H32 A;  1NTK D;  5B5E V;  1N50 A;  4FAN A;  1MZ4 A;  1SQV D;  1K3H A;  5DF5 A;  1OAE A;  2PCB B;  1C6R A;  1P84 D;  4FA1 A;  1AKK A;  4RSZ A;  1CXC A;  5C0Z A;  3PRJ A;  1HJ3 A;  2Y0D A;  4PW9 B;  2K9J B;  2JTI B;  4EIE A;  2B0Z B;  3PH2 B;  2BCC D;  4RJT A;  1F1F A;  1CTJ A;  1M60 A;  1GQ1 A;  2O3J A;  2GIW A;  2C1D A;  1QYZ A;  1SQX D;  3RMZ A;  3NBS A;  3ZOX A;  3WFE C;  1N15 A;  1IO3 A;  1CNO A;  1CIH A;  1CRJ A;  3WFC C;  4WQA A;  2YCC A;  3CX5 W;  2QJY B;  2RN0 A;  1H33 A;  2C2C A;  2B11 B;  2LIR A;  4EDF A;  4A7P A;  5C9M A;  1CYI A;  1L9B C;  4O1W A;  3ZOW A;  1CIF A;  2BPB B;  1L0N D;  2L4D A;  2DGE A;  2OZ1 A;  1KX7 A;  1FI3 A;  1FJ0 A;  1EB7 A;  5TJH A;  1YEB A;  4GYD A;  4WQ8 A;  1SQQ D;  2B4Z A;  3CX5 D;  2KNC B;  3H1J D;  5KAI V;  1PPJ D;  2AXT V;  2C1U A;  4FA9 A;  1YEA A;  3HQ9 A;  1FI7 A;  1U75 B;  3RN0 A;  1QL4 A;  3O20 A;  1KIB A;  3DR0 A;  1J3S A;  1ETP A;  1AOF A;  2GC4 D;  1U74 B;  1HZV A;  1DW0 A;  1R0Q A;  5DFS A;  3L70 D;  5CIC B;  1HCM A;  1N90 A;  5H2F V;  1GKS A;  1W5C T;  2L91 A;  1IRV A;  4WQ7 A;  2GC7 D;  1CRC A;  1L9J C;  1RZ6 A;  2HV4 A;  3OA8 B;  1DVH A;  3ZIY A;  3KZI V;  3VNW A;  351C A;  4KMG A;  3ITK A;  1COT A;  1FHB A;  1KB9 D;  5CIG B;  2C8S A;  1HRO A;  1S5L V;  1HRC A;  2N3B A;  5KLI B;  2N9J A;  3JBT B;  1KB0 A;  1ZRT D;  3WFD C;  1C2N A;  1CYJ A;  4AAN A;  4JCG A;  3A0H V;  3HQ7 A;  3A0B V;  2Y0C A;  3TYI A;  3VYM A;  5IY5 1;  2ZOO A;  2D0W A;  2JQR A;  1CXA A;  1JDL A;  1CSV A;  4UB8 V;  1LFM A;  2N18 C;  4O1Q A;  1FOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...