3CX5D

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
248
structure length
248
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 71
structure length 248
sequence length 248
chains with identical sequence O
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cx5D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cx5D02
3X39A 2L91A 1KB9D 3C2CA 1I6DA 1CO6A 2B0ZB 1IQCA 3ZIYA 1KB0A 3ZOWA 1H32B 5CYTR 3KZIV 2N9YB 4EIDA 2N9IA 2BCNB 1QL4A 2JWAA 2JQRA 5DJQC 3SLEA 1CRYA 5EXQA 3H1HD 3O0RC 1CORA 5H2FV 1ZRTD 3DR0A 4XXLA 3OCDA 4J20A 4RSZA 1A56A 2QJPB 5C0ZA 1HJ3A 2CA4B 2XTSB 1CTYA 2AI5A 1DW3A 1FI3A 3ZOXA 2LITA 1C75A 1E8EA 2V07A 1NTMD 2AIUA 1A8CA 3PXSA 3H1ID 2N3BA 2KS1A 1FI7A 1DIQC 1PP9D 4PD4D 1M60A 2BCCD 1OCDA 4FA4A 1WVEC 1QYZA 4FA1A 1E29A 1DW0A 4WQ7A 3L75D 4YE1A 1OAEA 3TGUD 1LMSA 1BGYD 2N18C 1CRGA 1MG3D 3JBTB 3RN1A 2DGEA 1YFCA 5DJQB 4U3FD 1SQBD 1SQXD 4AANA 2GIWA 3L74D 4L3GA 3L73D 1H32A 1KYOW 1YEBA 3VYMA 3WU2V 4WQ9A 1GJQA 1NMLA 2I8FA 1I8OA 4FB1A 4NFGB 1FI9A 2ZXYA 1BE3D 5C9MA 1NTZD 1C2NA 1RAQA 1I8PA 1HCMA 1C6OA 2Y0DA 5DFSA 4AALA 1SQVD 4AX3A 4UB8V 1L0LD 3TDKA 1P84D 3PH2B 1LC2A 1CSXA 4WQEA 3DP5A 2FYNB 3MK7C 2C1DA 1DT1A 1L9JC 1RZ6A 1LS9A 2V08A 3PXWA 3CXHW 3HQ8A 1GIWA 1L9BC 2B12B 1FJ0A 2CXBA 1AOQA 1HJ5A 3ORVA 1IRWA 1IO3A 1VYDA 1YTCA 1KX2A 2KNCB 2N18B 2PACA 3PTZA 1L0ND 2JTIB 4H0KA 1B7VA 1DW2A 3CXHD 1GDVA 1NIRA 1PPJD 1I55A 1EB7A 1CIHA 4GEDB 2ZONG 3L4MA 3H1KD 1QN2A 1AOFA 1MZ4A 1LC1A 2LIRA 1N15A 2OZ1B 5B6QA 1GQ1A 4Q5PA 2IBZD 4XYDB 1CNOA 5CIFB 4L3HA 1CYIA 1A2SA 2B4ZA 2B11B 3SVWA 1FHBA 1NMIA 4K3IA 1C7MA 3ZBMA 1M6ZA 1C2RA 2C8SA 5CIGB 4AAMA 1NNOA 1YICA 2YK3A 1KIBA 2DVHA 1H31B 1QL3A 1SQPD 2N9JA 4O1WA 2A06D 3L4OA 3OA8A 1K3HA 1CTZA 4PJ0V 4KMGA 1S5LV 1WEJF 3CWBD 1H9YA 1CTJA 1HZUA 1YEAA 1IRVA 3RMZA 4N0KA 1CCRA 2HV4A 1F1FA 4EDFA 4MU8A 1COTA 5B66V 3SWSA 2AXTV 1R0QA 1CYJA 4WQBA 3CX5D 4JCGA 4PW9B 2B10B 4FA9A 3VMAA 1EZVD 4H0JA 5KAIV 5CIDB 1U74B 4V2KA 1CHIA 2BH4X 1CXAA 2C1VA 5KLIB 1HH7A 1CSUA 1C6SA 1U75B 1I6EA 2QJKB 5CIHB 2GC7D 451CA 5GTIV 4PWAA 1HROA 1F1CA 2OZ1A 2K9JB 3WUIA 2ZBOA 4L1QA 1GKSA 4EIFA 1BCCD 3PXTA 4WQDA 5KAFV 1GU2A 3PHLA 1YNRA 1N90A 3ITKA 2VHDA 1KX7A 3CYTI 1IZL0 1W5CT 3O1YA 1CRIA 5KLVD 1CC5A 3HQ7A 1H9XA 1DVHA 2GB8B 2YIUB 3RLMA 2L4DA 1CIFA 5DF5A 5GTHV 2O3JA 2CE0A 3O20A 3BCCD 2FYUD 2N3YA 3A0HV 2CA3B 5IY51 4DY9A 1CRHA 1CIEA 1W2LA 4Y5RA 3ZOYA 2FRCA 1RZ5A 1CIGA 3ZCFA 4AAOA 1N50A 1H33B 1AKKA 3HQ9A 351CA 4FA5A 2EXVA 2RMZA 5CIBB 3TF5A 1CSWA 1ETPA 2D0WA 5TISV 1E2RA 1CCHA 4EIEA 2Q3EA 1DVVA 1YIQA 3PLNA 2YCCA 3SJLA 4GYDA 3L70D 5E79V 3CU4A 2Y0CA 2ZOOA 2MTAC 3MK7B 1KV9A 2BGVX 1DIIC 3WFDC 3L72D 3A9FA 4WQ8A 1CRCA 1HZVA 1NTKD 1ZZHA 2C1DB 3CX5W 2GC4D 4FAVA 1K3GA 4WQCA 3CP5A 3GW6A 2QJYB 1M70A 1CEDA 4RJTA 3WFBC 5B5EV 1BL9A 3M97X 1CHHA 4UB6V 4D6TD 4P4QB 1LFMA 5KKZB 1H1OA 2BPBB 1CXCA 5TJHA 1I54A 2BH5X 3GG2A 1JDLA 3L71D 2MHMA 3NBSA 4EICA 4A7PA 3O5CA 2C1UA 3HQ6A 4QAOA 3OCDB 5CICB 1NU1D 4FANA 1C6RA 2CE1A 1C52A 3ZOOA 4LJIA 2ZZS1 1CHJA 1N9CA 1RAPA 1QKSA 3VNWA 3NBTA 5CIEB 1S6VB 3PRJA 155CA 3WC8A 1CRJA 2YQBA 3KHUA 2PCBB 2FWLA 1H33A 2PCCB 2D0SA 3NWVA 1SQQD 2RN0A 1HRCA 1FCDC 1MG2D 3TYIA 3WFCC 3FWLA 3RN0A 1KYOD 1CSVA 2Y0EA 1CYCA 3H1JD 3OA8B 1J3SA 3A0BV 2C9XB 3DMIA 2QG4A 1AYGA 2ORLA 4IL6V 2BLFB 4WQAA 1H31A 1HJ4A 3WFEC 5AURA 1I5TA 3SXTA 3H1LD 4O1QA 1DW1A 3VRDA 1FOCA 1YCCA 2C2CA
chains in the Genus database with same CATH superfamily
3E1IA 2E75B 1KILB 3NFQA 1I6DA 3ZIYA 3LIEA 1N7SD 5CYTR 4EYYQ 1AQTA 4XFJA 3KZIV 2N9YB 1VQ4P 1KYOH 3CCMP 5DJQC 3SFDC 1CRYA 3O0RC 3H25A 1LTGC 1BSNA 3QWOC 5H2FV 2ZYGA 5AVSB 4J20A 1A56A 5C0ZA 2JDIH 5KLIC 2POHA 4WY4C 1CTYA 1H0TB 1DW3A 2H7HA 1KMIZ 3MUDC 4IOIH 1VQ6P 2LITA 1LWUC 1E8EA 3VMXA 2N1TC 3TNUB 1HGVA 1S5LE 2AIUA 2WPQA 3PXSA 4ZNCA 1YI2P 3KYQA 3CXHH 4PD4D 3AEAC 4HKZH 3T97A 2HPCA 4JYBA 1OCDA 3CL3D 2HODA 1DIPA 3JC22 1QYZA 1PPJE 3CWBG 1R8EA 4N6JA 2QIWA 1DW0A 3H1IJ 3PJSK 5KAIE 2YIUC 3IAOA 3JBTB 4LLHA 1YFCA 1KILA 2WITA 5DJQB 3V6IA 2C9LY 4AANA 2WQYC 4PV1C 5GTIE 1ZOYC 5AW4B 3RK2D 2Q5UA 3H1IE 2I8FA 1YTZT 2YO2A 1FI9A 4WY4B 1SQXJ 1KILE 1PGQA 5C9MA 1NTZG 1AFOA 1NTZD 1UIIA 1RAQA 2KSEA 2WSCJ 1C6OA 3RL0C 2N1TB 2HG5D 3LIDA 1RE3A 3UIAA 3TDKA 1P84D 1GL2A 5CJ0A 1AVOA 4Y99C 2Q6QA 1BCCG 3P8MC 1SQXE 3TNUA 1JO5A 3BRVB 1ZR4A 1L0LJ 3MHVA 3HQ8A 1L9BC 1JY3P 4HYTB 2QJYC 2CXBA 2P58A 3C8VA 3M9HA 1VYDA 2W83C 2IZ0A 4AYCA 3OW2O 2ZYDA 2JWDA 1E79H 1PPJD 5TISH 3H1KG 4OVNF 3L4MA 1L0LE 3H1KD 1GTWA 3AEFC 3CC2P 2D2CC 1DD4A 3CCJP 1OFCX 1SQXK 2IBZG 5B6QA 3HD7B 2IBZD 4XYDB 5CIFB 3H6PA 4PJ0H 2B11B 4XE5B 1C7MA 3HUSA 3ZBMA 2KYVA 3M0DA 3I55P 2YKOA 1NNOA 1QX8A 2DVHA 4UB6H 4Y99B 1RE4A 1W2EA 2E75D 1KILD 3OA8A 1PGJA 4KMGA 1LTSC 1L0LK 4PD4I 1H9YA 4I6MC 5AW9B 1CTJA 5AVUB 2R44A 2NZ2A 1IRVA 1D7MA 1CCRA 3GMAA 1F1FA 1J1EB 1COTA 1SFCA 3E1RA 3LW5H 4FA9A 3V2PA 1FZCA 1YIJP 5KJ7C 1CXAA 1FE6A 4N78D 3SFEC 2ZT9B 1U75B 1NO4A 1DD3A 2O01J 1K9MQ 2WSFJ 3FGAD 4BRYA 2GC7D 3O8ZA 4IL6H 3A0BE 4QMAA 1JEKA 2I1JA 2OYHC 1CI6B 2KB7P 3NXSA 3HD7A 2ZBOA 1GKSA 1P84I 4WQDA 5CCGA 3U1AA 4RKUJ 1S5LX 4I2LC 1W5CT 1M1JA 2G8YA 1CRIA 3H1LG 2WMMA 3D0WA 4BWNA 3G6EP 1TU3F 2BEZF 5GTHV 3M06A 3SWKA 3VP9A 3USSA 1Y47A 4WBAA 1VL2A 5KLVJ 1VQ9P 4Y5RA 3ZOYA 2YNYA 3H32B 1EC5A 1NKNA 3AE5C 1KORA 4L73A 1YTZI 2IYPA 2EXVA 1KYOE 2RMZA 3TF5A 3IN6A 3MTUE 2IBZI 5TISV 5KLVE 1NU1K 4EIEA 3B4SA 2C0XA 2E76B 1S4XA 1N73A 5B5EE 3CU4A 1SFCD 1LNQA 3SWFA 2BGVX 2R5DA 3GF3A 3O6QB 4WVZA 4WQ8A 1JY3N 1KN7A 3CX5W 2E5TA 1RF0A 4FAVA 1K3GA 3CP5A 4HJGH 2FFDC 1M70A 4HH2A 1OWAA 4H13B 3PP5A 2BCCG 4W7ZA 4UB6V 4P4QB 2Q7CA 2M3EA 1H1OA 2E74D 1CSBA 1CXCA 5KLVK 1LTIC 3GG2A 2MJZA 4MN4C 3WU2H 2MHMA 3NBSA 3HQ6A 4QAOA 1NU1G 5CICB 1NU1D 3HD7D 3W68A 2WPSA 2IX7C 1A02J 4I1LA 2W27A 2FXMA 2KUBA 5CCGD 1IFPA 2ZZS1 3L71J 3VNWA 1JCDA 5CIEB 3WC8A 5BU8B 2PCBB 1JOCA 3L74J 3CPWO 1FCDC 3FWLA 3OJAB 1KYOD 1CYCA 1J3SA 3L71E 2ORLA 1OX3A 4IL6V 4TLFA 4WQAA 3N7NA 1FDMA 1HJ4A 1QLED 2AEJA 4O1QA 1L4AC 4DZOA 3X39A 2IZ1A 3KQGA 3H1JJ 1ZN5A 3L74E 3C2CA 5H2FH 5DJUB 1GW4A 3ZOWA 1H32B 1Q81Q 2ZT9D 2BCNB 2JQRA 1JM0A 1OW7A 3AE6C 1IK7A 3H1JE 1OW8A 2M0BA 1N2DC 3A7OA 3TYYA 4XXLA 1S72P 4RSZA 2E42A 1VPCA 2HYNA 1U57A 3WUVA 2BEQD 2XTSB 3KXDA 3CCQP 3Q1MA 3ZOXA 4H0LD 1NH4A 1RF1C 1M90Q 4PJ0E 1IJDB 1A8CA 3CC7P 1ZLLA 1G2CA 1URQB 2N3BA 1LTBC 3IFMA 1L4AB 4FA4A 1WVEC 4FA1A 3D71A 2CPBA 1E29A 1KQLA 3L75G 4RO0A 4WQ7A 3L75D 4YE1A 3TGUG 5CCHC 3TGUD 1BGYG 1LMSA 1BGYD 4DJGA 2OTKE 1CRGA 1T2KC 3RN1A 5AVQB 2IFNA 1SQBG 3CWBJ 3L74G 1SQBD 3L74D 1EZVG 2KOGA 4KT0J 3EWKA 2OYIC 1GU5A 1H32A 2I1KA 3WU2V 2PAJA 2E76D 4GODA 1I8OA 4PD4E 4NFGB 1FJKA 2ZXYA 2A06E 1YQ3C 3CWBE 5KAFE 1I8PA 5AVYB 1RF1B 1HTLC 1JB0J 2RKLA 1KTMA 3CMEP 4H13D 1KYOI 3P8CD 1S3JA 1NTZJ 3L36A 1QEXA 2C1DA 1L9JC 1DEBA 1LS9A 1GIWA 2B12B 2H43A 4OGQB 3ZDMA 1URQA 3GLMA 1AOQA 1K05A 1IO3A 2CK3H 1BCCJ 1YTCA 2PACA 2JTIB 1NTZE 1B7VA 2FYUG 5AVWB 2QSIA 2CPSA 2XKMA 1I55A 4GKGA 1CIHA 3U1CA 1AQ5A 1P84E 1PV3A 2IFMA 1AOFA 4L74A 3CXHI 3R2PA 3AEBC 2LIRA 1N15A 4WWIA 1X9VA 5E79H 2OZ1B 1BCCE 1OVVA 1FZEA 4Q5PA 1OVRA 4NPEA 5AVVB 3GHGB 3AE1C 2ZVOB 3H1KJ 2B4ZA 3SVWA 3Q3DA 1Q82Q 4K3IA 2W6JH 1XTCC 3RK3B 2WZ7A 4IFMA 3FWNA 1YICA 1SQPG 2WPRA 2YK3A 1NTZK 1H31B 1SQPD 4LGDE 2A06G 1NYHA 2A06D 1K3HA 1CTZA 3CWBD 1DEEG 3MZWB 1X0TA 3H1KE 2R3SA 1HZUA 3AEGC 1SLQA 3E7KA 3OA7A 1AA0A 1VQNP 3TSIA 1OZHA 2QRXA 5B66V 2IBZE 2AXTV 3B71A 4WQBA 2B10B 1G1IA 1K04A 1BDDA 2OGUA 5CIDB 1JMBA 2BH4X 1FZCC 1ZXGA 1EZVI 1YJ9P 5KLIB 1OVUA 1HH7A 1Z56A 1C6SA 2WSEH 1PIXA 451CA 1FC2C 1LWUB 4B86A 1HWTC 3VMYA 2QJPC 2V4HA 1URQD 3D70A 1JUNA 1IFIA 1H0TA 2OZ1A 2J5UA 1L4AD 5GTHH 4L1QA 2KS1B 4EIFA 3GHGA 1KC8Q 1YHQP 4C7RA 1BCCD 3PXTA 5APYA 5AVXB 1GU2A 4W80A 3PHLA 1YNRA 2YKPA 2VHDA 3EQ2A 1KX7A 2GUVA 3V2RA 1VQPP 1HBWA 1QGKB 3AEEC 3BATA 4N78E 1DVHA 2YIUB 2YMYA 1CZQA 2QM8A 2CE0A 3KZIE 5AW3B 3BCCG 4NPDA 3BCCD 3PH0A 1BSHA 1ZP0C 3A0HV 3CD6P 2ITAA 1LTAC 1VQ5P 2Z5IA 5H2FE 4PV1B 2M5AB 1OXZA 3H1LJ 1LT9C 1VF5C 1S2EA 3ZCFA 1E5WA 3RGUA 351CA 2WPVB 2E43A 4H44C 2B87B 4YTPC 1ETPA 3RL0B 5APQA 1E2RA 1CCHA 3F5HA 1RHZB 2P1JA 4WY4A 3B5NC 3H1LE 1LP1B 4GYDA 5E79V 3MUDA 2ZOOA 1LWUA 2N1TA 1M7LA 1NTKG 1CRCA 1HZVA 1NTKD 4OGQD 2GC4D 4WQCA 2RH0A 2OQQA 2KXPB 2QJYB 5CCHD 2NPSC 3TK1A 4RJTA 3WFBC 5B5EV 2XDJA 1QVFO 1EDJA 1BL9A 2BASA 3M9BA 1LFMA 4K3AA 3II6A 2QM7A 1M1KQ 1KFMA 2I8DA 1ZRTE 2BH5X 3G4SP 2C1UA 1FOSF 2D2CB 2BCCJ 2O01N 1VF5B 1AV1A 1S1CX 4U3FG 2CE1A 1W5CE 3F89A 1JTHB 5AVTB 3RK3D 4UB8H 3S1KA 1SP4A 4R4MA 1NU1J 3PRJA 1JNMA 4N3YB 4C7NB 1CRJA 4JBZA 1QVGO 3KHUA 1NJIQ 2FWLA 2K1AA 2BCCE 2KI7B 1GMJA 1HRCA 5KTBA 2B87A 4IFFA 3U59A 5APTA 1GU4A 1LTJC 3L4FA 1KD1Q 2KLVA 2IPPA 2QG4A 3N4XA 1CW5A 2BLFB 2NPSB 4YXDC 1LP1A 1NU1E 5AURA 1I5TA 2K37A 3H1LD 2QVAA 1DW1A 3VRDA 1FOCA 5CMZA 1T6AA 2C2CA 3MGNA 3OAKA 3FXDA 2Z5HA 1USEA 1CO6A 2B0ZB 1GZLA 1IQCA 2IYOA 1EDIA 3Q2YA 1KB9I 4WY4D 1Q90D 2N9IA 2JWAA 3CLQA 3H1HG 4K35A 5EXQA 2VRSA 3SSUA 1VQLP 3H1HD 1CORA 1OIPA 2N1TD 5AVZB 1ZRTD 3L37A 3KDPB 1N7SC 2OYHB 2N9BA 2CA4B 1L0NJ 1KB9H 2AI5A 5AW0B 3HE4B 2NRGA 1JTHA 1PL5A 3BVHA 3S9OA 2LXCB 1NTMG 4GIFA 1LTJB 1NTMD 4HB1A 1CI6A 4C7NA 3MP7B 2FKWB 1PP9G 1DIQC 1NAFA 1PP9D 2FYNC 1M60A 1L0NE 2BCCD 5M1BA 3CXHE 2KLUA 1SQVK 4JYCA 4PV1D 5KAIH 1MFZA 2FXPA 3G71P 1M8OB 2FBWC 2L5GB 2H88C 1J1DC 3HTKB 1FZGA 1MG3D 2DGEA 1FZAA 1HJ0A 2WSEJ 3L73G 2GIWA 1WRGA 4L3GA 2HFED 3L73D 3L75J 3RL0D 4ZMDA 2QEXP 1KYOW 3TGUJ 5KJ7A 3VYMA 2Z4EA 1BGYJ 3H32A 2P10A 4FB1A 1L0NK 5L8RJ 1BE3G 2C0WA 1SQBJ 1H88A 5AVRB 1BE3D 4DCKA 1HCMA 3CCEP 2Y0DA 2DW3A 3L75E 5DFSA 1SQVG 4AALA 3V4QA 1EQ7A 1SQVD 2OYHA 4UB8V 1S9KE 3TGUE 2FFDB 2XU6A 1BGYE 3RK2C 2JP3A 3HE4A 4DOJA 1LC2A 3NTNA 1VDFA 2B89A 2FYNB 3MK7C 3O6QA 1SQBE 5GTHE 2WSCH 1HGZA 1RZ6A 2V08A 1EZVE 4Y28J 2ZAEB 3CXHW 3MIWA 4R4LA 2D2CD 2W6BA 2XV5A 1IRWA 2IDBA 3AE4C 1J1DB 1KX2A 2KNCB 1L0NG 3PTZA 1L0ND 1YYCA 1GW3A 3CXHD 1GDVA 1EDKA 4IFDK 1EB7A 5CHXA 3Q5PA 2MKVA 1QN2A 1T3JA 3HTKA 5TISE 1LC1A 3WUUA 1ZMEC 3P8CE 3CC4P 1SQBK 1GQ1A 2FYUJ 2QJKC 1CNOA 1MKMA 2WTYA 2K88A 1IFJA 1MUUA 1JMMA 1M6ZA 5CIGB 4AAMA 2PRRA 5B66H 4YXWH 1KIBA 2AXTH 2KP8A 2N9JA 4O1WA 3P32A 2FYUE 2QE7H 3LW5J 5APWA 3L4OA 4UB6E 1S5LV 1QL2A 1G1JA 2FFDA 5KJ7D 2K9YA 3AE3C 1YEAA 3RMZA 1S9KD 1SQPJ 1PFIA 4EDFA 1DX7A 3NMDA 3SWSA 5C39A 1R0QA 1KILC 4GOFA 3VMAA 1EZVD 4H0JA 5KAIV 1NGMB 1CHIA 3JSVC 3CX5I 3FXEA 2KNCA 2C1VA 1YJNP 5AW5B 1SQPE 1CSUA 2FYUK 3JCUH 2J58A 1I6EA 2QJKB 3CCLP 4EOTA 4ZKUA 5GTIV 2XNXA 3A0BH 1HJBA 4PWAA 2YMKA 1YJWP 1HVVA 4TT3H 1HROA 1RE3C 1GL2C 1YBKA 4IL6E 3VMZA 1HF9A 3CX5H 1SQQG 2O01H 4JF7A 2PGDA 2WSFH 5DJTB 3A0HH 1HH0A 2HPCB 1N90A 3AEDC 2P7JA 1JCCA 3A2AA 1MZ9A 3CYTI 1IZL0 1CC5A 2WVRA 3HQ7A 5AW1B 1SQPK 3RLMA 1FZBA 2L4DA 3VTPC 1CIFA 1L4AA 5DF5A 1IC2A 3L35A 4C46A 2JEEA 1FS0E 2FYUD 2N3YA 2QA4P 2YXQB 3C1LA 2R3CA 2CA3B 3ABVC 5IY51 4L76A 2OYIB 4DY9A 2GUSA 2E5YA 1CIEA 2LKMA 1W2LA 2C9NY 3BCCJ 1IFDA 1N50A 1AKKA 3HQ9A 3V4WA 1JY2O 1H89A 3FX0A 4DT0A 2D0WA 5EFWB 5AW2B 3CCUP 3HUSC 4GOEA 2Q3EA 3M0DC 3CI9A 5B5EH 1DVVA 4EIJA 1YIQA 1GL2B 4I7ZC 2YCCA 3SJLA 1Q2NA 3L70G 3V2QA 3L70D 2KZJA 3BCCE 5CBOA 2V7QH 1M56D 1RE4C 3L72G 1KB9E 4GT1A 1RF1A 3WFDC 3L72D 3A3YB 3A9FA 4KJMA 1ZZHA 3K5BA 2Y9YA 3GW6A 1CEDA 1JY2N 1VQMP 3M97X 4D6TG 2OARA 4D6TD 3VN0A 3P7KA 1SFCC 1NTKJ 4AUWA 2G3AA 2BPBB 2YO3A 1I54A 1WMKA 4RESB 3RBZA 1EXJA 3G9RA 3BRTB 1JDLA 1H8AA 5CCHA 4EICA 2HLOA 5AW7B 3WU2E 3OCDB 1KFNA 1AJYA 3SWYA 3G3ZA 2WT7B 1AVYA 4LJIA 1NTKE 2OYIA 2Q3IA 2E74C 1CHJA 2WSSH 1DH3A 5K5GB 2UWJE 3HUSB 4JPZB 2ZXEB 1OMIA 3HD7C 2D0SA 3NWVA 4I7ZB 4U3FJ 2RN0A 1R5LA 3RL0g 1X8YA 1KV4A 3TYIA 4YPCA 1LT1A 5CCGC 3RN0A 1CSVA 3OA8B 1T3UA 3A0BV 2C9XB 2GM4A 4GDOA 1M1JC 1VQOP 1H31A 3WFEC 4ZKPA 1GK4A 4Z1MH 4U3FE 1NTKK 2L91A 3CCSP 1SFCB 1KB9D 3RK3E 1GK6A 2YKQA 1KB0A 1FAVA 3M0AA 1UIXA 2ZXXA 1FDOA 1KQFB 1FZCB 2FY8A 1J1EC 4EIDA 1QL4A 1X22A 3SLEA 1N86A 1A02F 3V2NA 1GD2E 3BASA 1PPJG 2K3RA 2E74B 2Y9ZA 3DR0A 4BRYB 3OCDA 3IF4A 2QJPB 2A45G 1EDLA 2WT7A 1XTGB 1HJ3A 4LC1A 2ZVNB 4BXLA 5AW8B 2ZT9C 3H1HJ 1N73C 1Y8AA 1FI3A 1YITP 1LGHB 4L75A 3D6ZA 1C75A 4NPFX 2V07A 1RF0C 1SS1A 1L2PA 1NHLA 4IL6X 3I56P 3H1IG 3H1ID 1M1JB 2PFXA 2KS1A 1FI7A 1T2KD 3H1HE 3Q5SA 5APSA 5B66E 2WWWA 2AXTE 4OH8B 1NTMJ 4H0LC 2Q9IA 1KZUB 2B88A 1USDA 1OAEA 1PP9J 1NAYA 3QH9A 1LT9B 2N18C 2ZYAA 2M3BA 3CCRP 1SQXG 4U3FD 1SQXD 1YQ4C 1U7MA 1NTME 4H44B 2M5AA 2FXOA 1YEBA 4PD4H 4WQ9A 1GL2D 1ZR2A 1GJQA 1SVFA 1NMLA 2W6AA 1PP9E 3WMM0 3B5NB 2LR2A 3IR9A 5KAFH 1N73B 3L73J 1C2NA 3JCUE 3W67A 2H8PD 1L0LG 4AX3A 1L0LD 3PH2B 2E76C 2XZRA 3V5BA 1BE3J 1NWQA 1CSXA 4WQEA 3DP5A 3M9QA 1OW6A 3CX5E 3HRNA 1DT1A 2PP6A 2AEFA 1NTMK 3L73E 1SQVJ 4H0LB 3PXWA 3A0HE 1FJ0A 4KHXA 1HJ5A 5AW6B 3ORVA 1X79B 5CJ4A 1IK9A 4H13C 2JKVA 1BE3E 2JR8A 2OTJP 2N18B 1IFNA 4H0KA 1PGOA 4EI2A 1DW2A 3A5TA 1BDCA 1EXIA 1P84H 1NIRA 2JO1A 2KSJA 4GEDB 1SQVE 2ZONG 3AE2C 1IO4A 1NKZB 3CMAP 1MZ4A 1LT9A 1JY3O 4CPGA 1FBMA 3VOPA 1VQ8P 2SPZA 2A45I 5E79E 4L3HA 2V7QJ 1S5LH 2XNDH 3VYIA 1CYIA 1A2SA 1ZW0A 1T8ZA 1FHBA 4JQ0D 1NMIA 1C2RA 3B5NA 2C8SA 5APXA 1QL3A 1MFTA 1RQVA 2KIKA 3AECC 4PJ0V 2LXBA 2B9BA 1N8RQ 3AE7C 1WEJF 2A45H 2FYZA 2NPSA 1FJPA 1NOHA 2HR3A 4N0KA 4ASWA 2R5BA 1Q7YQ 2HV4A 4MU8A 2JJLA 3Q5RA 1LJ2A 1J2JB 1CYJA 3CX5D 4JCGA 5CBNA 5GTIH 4PW9B 2OTLP 1PZQA 4OWFA 2O1JA 5BU5A 1U74B 4V2KA 1FU1A 2W8ZA 3HE5B 2KK7A 3C9IA 1N7SB 2P67A 5CIHB 1NVOA 3VP8A 1LTTC 1F1CA 2K9JB 3WUIA 1G2CB 5KAFV 1K73Q 1LTJA 3ITKA 1RQUA 3RBXA 4O9BA 1K8AQ 5KLVG 3O1YA 1WT6A 5KLVD 1H9XA 1URQC 1VF5D 3KZIH 2GB8B 1SQQJ 1JY2P 1N7LA 3D6YA 5KKZC 2O3JA 1GDTA 2OYOA 3O20A 2YXRB 4H44D 2W90A 3EFGA 2M8RA 4XA4A 1IFMA 1RY3A 3GF7A 5BVZA 1CRHA 3B5ND 2FRCA 2H89C 1QL1A 1SQQE 3M91A 1RZ5A 1CIGA 4AQRD 4AAOA 1H33B 4FA5A 4WB4A 5CIBB 2O1KA 1HUCA 4M3LA 1PGPA 1CSWA 1VQKP 3HE5A 2ZJSE 2NPSD 1N7SA 1U7JA 1FOSE 2R32A 3RK2B 3PLNA 2Y0CA 2MTAC 3MK7B 1KV9A 1DIIC 2C1DB 1W2BO 2K9JA 4ASVA 3KPEA 1SQQK 3L70J 1FDIA 1M57D 1CHHA 1IZNB 3L72J 5KKZB 4U7JA 3AE9C 2E75C 5TJHA 5APUA 4OGQC 3L71G 3L71D 4A7PA 3O5CA 2GA1A 3S4RA 2ZFCA 4D6TJ 4FANA 3L70E 5APVA 1R5SA 1C6RA 1C52A 3L72E 3ZOOA 2AXCA 1KQSO 3MD0A 1N9CA 1RAPA 1QKSA 1Y9BA 3R4YA 1RH5B 1VQ7P 3NBTA 2Q1KA 1S6VB 1ZV8A 155CA 4UB8E 2YQBA 3WUTA 1H33A 3AE8C 4D6TE 2PCCB 1KQGB 1SQQD 1FZFA 1MG2D 3GHGC 3WFCC 3I5CA 2J59M 3T97B 3H1JG 2Y0EA 2HODB 3H1JD 3B8EB 2KZIA 3DMIA 3RK3C 1Q86Q 1AYGA 4W7YA 2P2UA 1MV8A 3SXTA 3EFFK 1YCCA 2AEMA 3CCVP
chains in the Genus database with same CATH topology
3X39A 2L91A 1KB9D 3C2CA 1I6DA 1CO6A 2B0ZB 1IQCA 3ZIYA 1KB0A 3ZOWA 1H32B 5CYTR 3KZIV 2N9YB 4EIDA 2N9IA 2BCNB 1QL4A 2JWAA 2JQRA 5DJQC 3SLEA 1CRYA 5EXQA 3H1HD 3O0RC 1CORA 5H2FV 1ZRTD 3DR0A 4XXLA 3OCDA 4J20A 4RSZA 1A56A 2QJPB 5C0ZA 1HJ3A 2CA4B 2XTSB 1CTYA 2AI5A 1DW3A 1FI3A 3ZOXA 2LITA 1C75A 1E8EA 2V07A 1NTMD 2AIUA 1A8CA 3PXSA 3H1ID 2N3BA 2KS1A 1FI7A 1DIQC 1PP9D 4PD4D 1M60A 2BCCD 1OCDA 4FA4A 1WVEC 1QYZA 4FA1A 1E29A 1DW0A 4WQ7A 3L75D 4YE1A 1OAEA 3TGUD 1LMSA 1BGYD 2N18C 1CRGA 1MG3D 3JBTB 3RN1A 2DGEA 1YFCA 5DJQB 4U3FD 1SQBD 1SQXD 4AANA 2GIWA 3L74D 4L3GA 3L73D 1H32A 1KYOW 1YEBA 3VYMA 3WU2V 4WQ9A 1GJQA 1NMLA 2I8FA 1I8OA 4FB1A 4NFGB 1FI9A 2ZXYA 1BE3D 5C9MA 1NTZD 1C2NA 1RAQA 1I8PA 1HCMA 1C6OA 2Y0DA 5DFSA 4AALA 1SQVD 4AX3A 4UB8V 1L0LD 3TDKA 1P84D 3PH2B 1LC2A 1CSXA 4WQEA 3DP5A 2FYNB 3MK7C 2C1DA 1DT1A 1L9JC 1RZ6A 1LS9A 2V08A 3PXWA 3CXHW 3HQ8A 1GIWA 1L9BC 2B12B 1FJ0A 2CXBA 1AOQA 1HJ5A 3ORVA 1IRWA 1IO3A 1VYDA 1YTCA 1KX2A 2KNCB 2N18B 2PACA 3PTZA 1L0ND 2JTIB 4H0KA 1B7VA 1DW2A 3CXHD 1GDVA 1NIRA 1PPJD 1I55A 1EB7A 1CIHA 4GEDB 2ZONG 3L4MA 3H1KD 1QN2A 1AOFA 1MZ4A 1LC1A 2LIRA 1N15A 2OZ1B 5B6QA 1GQ1A 4Q5PA 2IBZD 4XYDB 1CNOA 5CIFB 4L3HA 1CYIA 1A2SA 2B4ZA 2B11B 3SVWA 1FHBA 1NMIA 4K3IA 1C7MA 3ZBMA 1M6ZA 1C2RA 2C8SA 5CIGB 4AAMA 1NNOA 1YICA 2YK3A 1KIBA 2DVHA 1H31B 1QL3A 1SQPD 2N9JA 4O1WA 2A06D 3L4OA 3OA8A 1K3HA 1CTZA 4PJ0V 4KMGA 1S5LV 1WEJF 3CWBD 1H9YA 1CTJA 1HZUA 1YEAA 1IRVA 3RMZA 4N0KA 1CCRA 2HV4A 1F1FA 4EDFA 4MU8A 1COTA 5B66V 3SWSA 2AXTV 1R0QA 1CYJA 4WQBA 3CX5D 4JCGA 4PW9B 2B10B 4FA9A 3VMAA 1EZVD 4H0JA 5KAIV 5CIDB 1U74B 4V2KA 1CHIA 2BH4X 1CXAA 2C1VA 5KLIB 1HH7A 1CSUA 1C6SA 1U75B 1I6EA 2QJKB 5CIHB 2GC7D 451CA 5GTIV 4PWAA 1HROA 1F1CA 2OZ1A 2K9JB 3WUIA 2ZBOA 4L1QA 1GKSA 4EIFA 1BCCD 3PXTA 4WQDA 5KAFV 1GU2A 3PHLA 1YNRA 1N90A 3ITKA 2VHDA 1KX7A 3CYTI 1IZL0 1W5CT 3O1YA 1CRIA 5KLVD 1CC5A 3HQ7A 1H9XA 1DVHA 2GB8B 2YIUB 3RLMA 2L4DA 1CIFA 5DF5A 5GTHV 2O3JA 2CE0A 3O20A 3BCCD 2FYUD 2N3YA 3A0HV 2CA3B 5IY51 4DY9A 1CRHA 1CIEA 1W2LA 4Y5RA 3ZOYA 2FRCA 1RZ5A 1CIGA 3ZCFA 4AAOA 1N50A 1H33B 1AKKA 3HQ9A 351CA 4FA5A 2EXVA 2RMZA 5CIBB 3TF5A 1CSWA 1ETPA 2D0WA 5TISV 1E2RA 1CCHA 4EIEA 2Q3EA 1DVVA 1YIQA 3PLNA 2YCCA 3SJLA 4GYDA 3L70D 5E79V 3CU4A 2Y0CA 2ZOOA 2MTAC 3MK7B 1KV9A 2BGVX 1DIIC 3WFDC 3L72D 3A9FA 4WQ8A 1CRCA 1HZVA 1NTKD 1ZZHA 2C1DB 3CX5W 2GC4D 4FAVA 1K3GA 4WQCA 3CP5A 3GW6A 2QJYB 1M70A 1CEDA 4RJTA 3WFBC 5B5EV 1BL9A 3M97X 1CHHA 4UB6V 4D6TD 4P4QB 1LFMA 5KKZB 1H1OA 2BPBB 1CXCA 5TJHA 1I54A 2BH5X 3GG2A 1JDLA 3L71D 2MHMA 3NBSA 4EICA 4A7PA 3O5CA 2C1UA 3HQ6A 4QAOA 3OCDB 5CICB 1NU1D 4FANA 1C6RA 2CE1A 1C52A 3ZOOA 4LJIA 2ZZS1 1CHJA 1N9CA 1RAPA 1QKSA 3VNWA 3NBTA 5CIEB 1S6VB 3PRJA 155CA 3WC8A 1CRJA 2YQBA 3KHUA 2PCBB 2FWLA 1H33A 2PCCB 2D0SA 3NWVA 1SQQD 2RN0A 1HRCA 1FCDC 1MG2D 3TYIA 3WFCC 3FWLA 3RN0A 1KYOD 1CSVA 2Y0EA 1CYCA 3H1JD 3OA8B 1J3SA 3A0BV 2C9XB 3DMIA 2QG4A 1AYGA 2ORLA 4IL6V 2BLFB 4WQAA 1H31A 1HJ4A 3WFEC 5AURA 1I5TA 3SXTA 3H1LD 4O1QA 1DW1A 3VRDA 1FOCA 1YCCA 2C2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X39 A;  2L91 A;  1KB9 D;  3C2C A;  1I6D A;  1CO6 A;  2B0Z B;  1IQC A;  3ZIY A;  1KB0 A;  3ZOW A;  1H32 B;  5CYT R;  3KZI V;  2N9Y B;  4EID A;  2N9I A;  2BCN B;  1QL4 A;  2JWA A;  2JQR A;  5DJQ C;  3SLE A;  1CRY A;  5EXQ A;  3H1H D;  3O0R C;  1COR A;  5H2F V;  1ZRT D;  3DR0 A;  4XXL A;  3OCD A;  4J20 A;  4RSZ A;  1A56 A;  2QJP B;  5C0Z A;  1HJ3 A;  2CA4 B;  2XTS B;  1CTY A;  2AI5 A;  1DW3 A;  1FI3 A;  3ZOX A;  2LIT A;  1C75 A;  1E8E A;  2V07 A;  1NTM D;  2AIU A;  1A8C A;  3PXS A;  3H1I D;  2N3B A;  2KS1 A;  1FI7 A;  1DIQ C;  1PP9 D;  4PD4 D;  1M60 A;  2BCC D;  1OCD A;  4FA4 A;  1WVE C;  1QYZ A;  4FA1 A;  1E29 A;  1DW0 A;  4WQ7 A;  3L75 D;  4YE1 A;  1OAE A;  3TGU D;  1LMS A;  1BGY D;  2N18 C;  1CRG A;  1MG3 D;  3JBT B;  3RN1 A;  2DGE A;  1YFC A;  5DJQ B;  4U3F D;  1SQB D;  1SQX D;  4AAN A;  2GIW A;  3L74 D;  4L3G A;  3L73 D;  1H32 A;  1KYO W;  1YEB A;  3VYM A;  3WU2 V;  4WQ9 A;  1GJQ A;  1NML A;  2I8F A;  1I8O A;  4FB1 A;  4NFG B;  1FI9 A;  2ZXY A;  1BE3 D;  5C9M A;  1NTZ D;  1C2N A;  1RAQ A;  1I8P A;  1HCM A;  1C6O A;  2Y0D A;  5DFS A;  4AAL A;  1SQV D;  4AX3 A;  4UB8 V;  1L0L D;  3TDK A;  1P84 D;  3PH2 B;  1LC2 A;  1CSX A;  4WQE A;  3DP5 A;  2FYN B;  3MK7 C;  2C1D A;  1DT1 A;  1L9J C;  1RZ6 A;  1LS9 A;  2V08 A;  3PXW A;  3CXH W;  3HQ8 A;  1GIW A;  1L9B C;  2B12 B;  1FJ0 A;  2CXB A;  1AOQ A;  1HJ5 A;  3ORV A;  1IRW A;  1IO3 A;  1VYD A;  1YTC A;  1KX2 A;  2KNC B;  2N18 B;  2PAC A;  3PTZ A;  1L0N D;  2JTI B;  4H0K A;  1B7V A;  1DW2 A;  3CXH D;  1GDV A;  1NIR A;  1PPJ D;  1I55 A;  1EB7 A;  1CIH A;  4GED B;  2ZON G;  3L4M A;  3H1K D;  1QN2 A;  1AOF A;  1MZ4 A;  1LC1 A;  2LIR A;  1N15 A;  2OZ1 B;  5B6Q A;  1GQ1 A;  4Q5P A;  2IBZ D;  4XYD B;  1CNO A;  5CIF B;  4L3H A;  1CYI A;  1A2S A;  2B4Z A;  2B11 B;  3SVW A;  1FHB A;  1NMI A;  4K3I A;  1C7M A;  3ZBM A;  1M6Z A;  1C2R A;  2C8S A;  5CIG B;  4AAM A;  1NNO A;  1YIC A;  2YK3 A;  1KIB A;  2DVH A;  1H31 B;  1QL3 A;  1SQP D;  2N9J A;  4O1W A;  2A06 D;  3L4O A;  3OA8 A;  1K3H A;  1CTZ A;  4PJ0 V;  4KMG A;  1S5L V;  1WEJ F;  3CWB D;  1H9Y A;  1CTJ A;  1HZU A;  1YEA A;  1IRV A;  3RMZ A;  4N0K A;  1CCR A;  2HV4 A;  1F1F A;  4EDF A;  4MU8 A;  1COT A;  5B66 V;  3SWS A;  2AXT V;  1R0Q A;  1CYJ A;  4WQB A;  3CX5 D;  4JCG A;  4PW9 B;  2B10 B;  4FA9 A;  3VMA A;  1EZV D;  4H0J A;  5KAI V;  5CID B;  1U74 B;  4V2K A;  1CHI A;  2BH4 X;  1CXA A;  2C1V A;  5KLI B;  1HH7 A;  1CSU A;  1C6S A;  1U75 B;  1I6E A;  2QJK B;  5CIH B;  2GC7 D;  451C A;  5GTI V;  4PWA A;  1HRO A;  1F1C A;  2OZ1 A;  2K9J B;  3WUI A;  2ZBO A;  4L1Q A;  1GKS A;  4EIF A;  1BCC D;  3PXT A;  4WQD A;  5KAF V;  1GU2 A;  3PHL A;  1YNR A;  1N90 A;  3ITK A;  2VHD A;  1KX7 A;  3CYT I;  1IZL 0;  1W5C T;  3O1Y A;  1CRI A;  5KLV D;  1CC5 A;  3HQ7 A;  1H9X A;  1DVH A;  2GB8 B;  2YIU B;  3RLM A;  2L4D A;  1CIF A;  5DF5 A;  5GTH V;  2O3J A;  2CE0 A;  3O20 A;  3BCC D;  2FYU D;  2N3Y A;  3A0H V;  2CA3 B;  5IY5 1;  4DY9 A;  1CRH A;  1CIE A;  1W2L A;  4Y5R A;  3ZOY A;  2FRC A;  1RZ5 A;  1CIG A;  3ZCF A;  4AAO A;  1N50 A;  1H33 B;  1AKK A;  3HQ9 A;  351C A;  4FA5 A;  2EXV A;  2RMZ A;  5CIB B;  3TF5 A;  1CSW A;  1ETP A;  2D0W A;  5TIS V;  1E2R A;  1CCH A;  4EIE A;  2Q3E A;  1DVV A;  1YIQ A;  3PLN A;  2YCC A;  3SJL A;  4GYD A;  3L70 D;  5E79 V;  3CU4 A;  2Y0C A;  2ZOO A;  2MTA C;  3MK7 B;  1KV9 A;  2BGV X;  1DII C;  3WFD C;  3L72 D;  3A9F A;  4WQ8 A;  1CRC A;  1HZV A;  1NTK D;  1ZZH A;  2C1D B;  3CX5 W;  2GC4 D;  4FAV A;  1K3G A;  4WQC A;  3CP5 A;  3GW6 A;  2QJY B;  1M70 A;  1CED A;  4RJT A;  3WFB C;  5B5E V;  1BL9 A;  3M97 X;  1CHH A;  4UB6 V;  4D6T D;  4P4Q B;  1LFM A;  5KKZ B;  1H1O A;  2BPB B;  1CXC A;  5TJH A;  1I54 A;  2BH5 X;  3GG2 A;  1JDL A;  3L71 D;  2MHM A;  3NBS A;  4EIC A;  4A7P A;  3O5C A;  2C1U A;  3HQ6 A;  4QAO A;  3OCD B;  5CIC B;  1NU1 D;  4FAN A;  1C6R A;  2CE1 A;  1C52 A;  3ZOO A;  4LJI A;  2ZZS 1;  1CHJ A;  1N9C A;  1RAP A;  1QKS A;  3VNW A;  3NBT A;  5CIE B;  1S6V B;  3PRJ A;  155C A;  3WC8 A;  1CRJ A;  2YQB A;  3KHU A;  2PCB B;  2FWL A;  1H33 A;  2PCC B;  2D0S A;  3NWV A;  1SQQ D;  2RN0 A;  1HRC A;  1FCD C;  1MG2 D;  3TYI A;  3WFC C;  3FWL A;  3RN0 A;  1KYO D;  1CSV A;  2Y0E A;  1CYC A;  3H1J D;  3OA8 B;  1J3S A;  3A0B V;  2C9X B;  3DMI A;  2QG4 A;  1AYG A;  2ORL A;  4IL6 V;  2BLF B;  4WQA A;  1H31 A;  1HJ4 A;  3WFE C;  5AUR A;  1I5T A;  3SXT A;  3H1L D;  4O1Q A;  1DW1 A;  3VRD A;  1FOC A;  1YCC A;  2C2C A; 
#chains in the Genus database with same CATH topology
 3E1I A;  2E75 B;  1KIL B;  3NFQ A;  1I6D A;  3ZIY A;  3LIE A;  1N7S D;  5CYT R;  4EYY Q;  1AQT A;  4XFJ A;  3KZI V;  2N9Y B;  1VQ4 P;  1KYO H;  3CCM P;  5DJQ C;  3SFD C;  1CRY A;  3O0R C;  3H25 A;  1LTG C;  1BSN A;  3QWO C;  5H2F V;  2ZYG A;  5AVS B;  4J20 A;  1A56 A;  5C0Z A;  2JDI H;  5KLI C;  2POH A;  4WY4 C;  1CTY A;  1H0T B;  1DW3 A;  2H7H A;  1KMI Z;  3MUD C;  4IOI H;  1VQ6 P;  2LIT A;  1LWU C;  1E8E A;  3VMX A;  2N1T C;  3TNU B;  1HGV A;  1S5L E;  2AIU A;  2WPQ A;  3PXS A;  4ZNC A;  1YI2 P;  3KYQ A;  3CXH H;  4PD4 D;  3AEA C;  4HKZ H;  3T97 A;  2HPC A;  4JYB A;  1OCD A;  3CL3 D;  2HOD A;  1DIP A;  3JC2 2;  1QYZ A;  1PPJ E;  3CWB G;  1R8E A;  4N6J A;  2QIW A;  1DW0 A;  3H1I J;  3PJS K;  5KAI E;  2YIU C;  3IAO A;  3JBT B;  4LLH A;  1YFC A;  1KIL A;  2WIT A;  5DJQ B;  3V6I A;  2C9L Y;  4AAN A;  2WQY C;  4PV1 C;  5GTI E;  1ZOY C;  5AW4 B;  3RK2 D;  2Q5U A;  3H1I E;  2I8F A;  1YTZ T;  2YO2 A;  1FI9 A;  4WY4 B;  1SQX J;  1KIL E;  1PGQ A;  5C9M A;  1NTZ G;  1AFO A;  1NTZ D;  1UII A;  1RAQ A;  2KSE A;  2WSC J;  1C6O A;  3RL0 C;  2N1T B;  2HG5 D;  3LID A;  1RE3 A;  3UIA A;  3TDK A;  1P84 D;  1GL2 A;  5CJ0 A;  1AVO A;  4Y99 C;  2Q6Q A;  1BCC G;  3P8M C;  1SQX E;  3TNU A;  1JO5 A;  3BRV B;  1ZR4 A;  1L0L J;  3MHV A;  3HQ8 A;  1L9B C;  1JY3 P;  4HYT B;  2QJY C;  2CXB A;  2P58 A;  3C8V A;  3M9H A;  1VYD A;  2W83 C;  2IZ0 A;  4AYC A;  3OW2 O;  2ZYD A;  2JWD A;  1E79 H;  1PPJ D;  5TIS H;  3H1K G;  4OVN F;  3L4M A;  1L0L E;  3H1K D;  1GTW A;  3AEF C;  3CC2 P;  2D2C C;  1DD4 A;  3CCJ P;  1OFC X;  1SQX K;  2IBZ G;  5B6Q A;  3HD7 B;  2IBZ D;  4XYD B;  5CIF B;  3H6P A;  4PJ0 H;  2B11 B;  4XE5 B;  1C7M A;  3HUS A;  3ZBM A;  2KYV A;  3M0D A;  3I55 P;  2YKO A;  1NNO A;  1QX8 A;  2DVH A;  4UB6 H;  4Y99 B;  1RE4 A;  1W2E A;  2E75 D;  1KIL D;  3OA8 A;  1PGJ A;  4KMG A;  1LTS C;  1L0L K;  4PD4 I;  1H9Y A;  4I6M C;  5AW9 B;  1CTJ A;  5AVU B;  2R44 A;  2NZ2 A;  1IRV A;  1D7M A;  1CCR A;  3GMA A;  1F1F A;  1J1E B;  1COT A;  1SFC A;  3E1R A;  3LW5 H;  4FA9 A;  3V2P A;  1FZC A;  1YIJ P;  5KJ7 C;  1CXA A;  1FE6 A;  4N78 D;  3SFE C;  2ZT9 B;  1U75 B;  1NO4 A;  1DD3 A;  2O01 J;  1K9M Q;  2WSF J;  3FGA D;  4BRY A;  2GC7 D;  3O8Z A;  4IL6 H;  3A0B E;  4QMA A;  1JEK A;  2I1J A;  2OYH C;  1CI6 B;  2KB7 P;  3NXS A;  3HD7 A;  2ZBO A;  1GKS A;  1P84 I;  4WQD A;  5CCG A;  3U1A A;  4RKU J;  1S5L X;  4I2L C;  1W5C T;  1M1J A;  2G8Y A;  1CRI A;  3H1L G;  2WMM A;  3D0W A;  4BWN A;  3G6E P;  1TU3 F;  2BEZ F;  5GTH V;  3M06 A;  3SWK A;  3VP9 A;  3USS A;  1Y47 A;  4WBA A;  1VL2 A;  5KLV J;  1VQ9 P;  4Y5R A;  3ZOY A;  2YNY A;  3H32 B;  1EC5 A;  1NKN A;  3AE5 C;  1KOR A;  4L73 A;  1YTZ I;  2IYP A;  2EXV A;  1KYO E;  2RMZ A;  3TF5 A;  3IN6 A;  3MTU E;  2IBZ I;  5TIS V;  5KLV E;  1NU1 K;  4EIE A;  3B4S A;  2C0X A;  2E76 B;  1S4X A;  1N73 A;  5B5E E;  3CU4 A;  1SFC D;  1LNQ A;  3SWF A;  2BGV X;  2R5D A;  3GF3 A;  3O6Q B;  4WVZ A;  4WQ8 A;  1JY3 N;  1KN7 A;  3CX5 W;  2E5T A;  1RF0 A;  4FAV A;  1K3G A;  3CP5 A;  4HJG H;  2FFD C;  1M70 A;  4HH2 A;  1OWA A;  4H13 B;  3PP5 A;  2BCC G;  4W7Z A;  4UB6 V;  4P4Q B;  2Q7C A;  2M3E A;  1H1O A;  2E74 D;  1CSB A;  1CXC A;  5KLV K;  1LTI C;  3GG2 A;  2MJZ A;  4MN4 C;  3WU2 H;  2MHM A;  3NBS A;  3HQ6 A;  4QAO A;  1NU1 G;  5CIC B;  1NU1 D;  3HD7 D;  3W68 A;  2WPS A;  2IX7 C;  1A02 J;  4I1L A;  2W27 A;  2FXM A;  2KUB A;  5CCG D;  1IFP A;  2ZZS 1;  3L71 J;  3VNW A;  1JCD A;  5CIE B;  3WC8 A;  5BU8 B;  2PCB B;  1JOC A;  3L74 J;  3CPW O;  1FCD C;  3FWL A;  3OJA B;  1KYO D;  1CYC A;  1J3S A;  3L71 E;  2ORL A;  1OX3 A;  4IL6 V;  4TLF A;  4WQA A;  3N7N A;  1FDM A;  1HJ4 A;  1QLE D;  2AEJ A;  4O1Q A;  1L4A C;  4DZO A;  3X39 A;  2IZ1 A;  3KQG A;  3H1J J;  1ZN5 A;  3L74 E;  3C2C A;  5H2F H;  5DJU B;  1GW4 A;  3ZOW A;  1H32 B;  1Q81 Q;  2ZT9 D;  2BCN B;  2JQR A;  1JM0 A;  1OW7 A;  3AE6 C;  1IK7 A;  3H1J E;  1OW8 A;  2M0B A;  1N2D C;  3A7O A;  3TYY A;  4XXL A;  1S72 P;  4RSZ A;  2E42 A;  1VPC A;  2HYN A;  1U57 A;  3WUV A;  2BEQ D;  2XTS B;  3KXD A;  3CCQ P;  3Q1M A;  3ZOX A;  4H0L D;  1NH4 A;  1RF1 C;  1M90 Q;  4PJ0 E;  1IJD B;  1A8C A;  3CC7 P;  1ZLL A;  1G2C A;  1URQ B;  2N3B A;  1LTB C;  3IFM A;  1L4A B;  4FA4 A;  1WVE C;  4FA1 A;  3D71 A;  2CPB A;  1E29 A;  1KQL A;  3L75 G;  4RO0 A;  4WQ7 A;  3L75 D;  4YE1 A;  3TGU G;  5CCH C;  3TGU D;  1BGY G;  1LMS A;  1BGY D;  4DJG A;  2OTK E;  1CRG A;  1T2K C;  3RN1 A;  5AVQ B;  2IFN A;  1SQB G;  3CWB J;  3L74 G;  1SQB D;  3L74 D;  1EZV G;  2KOG A;  4KT0 J;  3EWK A;  2OYI C;  1GU5 A;  1H32 A;  2I1K A;  3WU2 V;  2PAJ A;  2E76 D;  4GOD A;  1I8O A;  4PD4 E;  4NFG B;  1FJK A;  2ZXY A;  2A06 E;  1YQ3 C;  3CWB E;  5KAF E;  1I8P A;  5AVY B;  1RF1 B;  1HTL C;  1JB0 J;  2RKL A;  1KTM A;  3CME P;  4H13 D;  1KYO I;  3P8C D;  1S3J A;  1NTZ J;  3L36 A;  1QEX A;  2C1D A;  1L9J C;  1DEB A;  1LS9 A;  1GIW A;  2B12 B;  2H43 A;  4OGQ B;  3ZDM A;  1URQ A;  3GLM A;  1AOQ A;  1K05 A;  1IO3 A;  2CK3 H;  1BCC J;  1YTC A;  2PAC A;  2JTI B;  1NTZ E;  1B7V A;  2FYU G;  5AVW B;  2QSI A;  2CPS A;  2XKM A;  1I55 A;  4GKG A;  1CIH A;  3U1C A;  1AQ5 A;  1P84 E;  1PV3 A;  2IFM A;  1AOF A;  4L74 A;  3CXH I;  3R2P A;  3AEB C;  2LIR A;  1N15 A;  4WWI A;  1X9V A;  5E79 H;  2OZ1 B;  1BCC E;  1OVV A;  1FZE A;  4Q5P A;  1OVR A;  4NPE A;  5AVV B;  3GHG B;  3AE1 C;  2ZVO B;  3H1K J;  2B4Z A;  3SVW A;  3Q3D A;  1Q82 Q;  4K3I A;  2W6J H;  1XTC C;  3RK3 B;  2WZ7 A;  4IFM A;  3FWN A;  1YIC A;  1SQP G;  2WPR A;  2YK3 A;  1NTZ K;  1H31 B;  1SQP D;  4LGD E;  2A06 G;  1NYH A;  2A06 D;  1K3H A;  1CTZ A;  3CWB D;  1DEE G;  3MZW B;  1X0T A;  3H1K E;  2R3S A;  1HZU A;  3AEG C;  1SLQ A;  3E7K A;  3OA7 A;  1AA0 A;  1VQN P;  3TSI A;  1OZH A;  2QRX A;  5B66 V;  2IBZ E;  2AXT V;  3B71 A;  4WQB A;  2B10 B;  1G1I A;  1K04 A;  1BDD A;  2OGU A;  5CID B;  1JMB A;  2BH4 X;  1FZC C;  1ZXG A;  1EZV I;  1YJ9 P;  5KLI B;  1OVU A;  1HH7 A;  1Z56 A;  1C6S A;  2WSE H;  1PIX A;  451C A;  1FC2 C;  1LWU B;  4B86 A;  1HWT C;  3VMY A;  2QJP C;  2V4H A;  1URQ D;  3D70 A;  1JUN A;  1IFI A;  1H0T A;  2OZ1 A;  2J5U A;  1L4A D;  5GTH H;  4L1Q A;  2KS1 B;  4EIF A;  3GHG A;  1KC8 Q;  1YHQ P;  4C7R A;  1BCC D;  3PXT A;  5APY A;  5AVX B;  1GU2 A;  4W80 A;  3PHL A;  1YNR A;  2YKP A;  2VHD A;  3EQ2 A;  1KX7 A;  2GUV A;  3V2R A;  1VQP P;  1HBW A;  1QGK B;  3AEE C;  3BAT A;  4N78 E;  1DVH A;  2YIU B;  2YMY A;  1CZQ A;  2QM8 A;  2CE0 A;  3KZI E;  5AW3 B;  3BCC G;  4NPD A;  3BCC D;  3PH0 A;  1BSH A;  1ZP0 C;  3A0H V;  3CD6 P;  2ITA A;  1LTA C;  1VQ5 P;  2Z5I A;  5H2F E;  4PV1 B;  2M5A B;  1OXZ A;  3H1L J;  1LT9 C;  1VF5 C;  1S2E A;  3ZCF A;  1E5W A;  3RGU A;  351C A;  2WPV B;  2E43 A;  4H44 C;  2B87 B;  4YTP C;  1ETP A;  3RL0 B;  5APQ A;  1E2R A;  1CCH A;  3F5H A;  1RHZ B;  2P1J A;  4WY4 A;  3B5N C;  3H1L E;  1LP1 B;  4GYD A;  5E79 V;  3MUD A;  2ZOO A;  1LWU A;  2N1T A;  1M7L A;  1NTK G;  1CRC A;  1HZV A;  1NTK D;  4OGQ D;  2GC4 D;  4WQC A;  2RH0 A;  2OQQ A;  2KXP B;  2QJY B;  5CCH D;  2NPS C;  3TK1 A;  4RJT A;  3WFB C;  5B5E V;  2XDJ A;  1QVF O;  1EDJ A;  1BL9 A;  2BAS A;  3M9B A;  1LFM A;  4K3A A;  3II6 A;  2QM7 A;  1M1K Q;  1KFM A;  2I8D A;  1ZRT E;  2BH5 X;  3G4S P;  2C1U A;  1FOS F;  2D2C B;  2BCC J;  2O01 N;  1VF5 B;  1AV1 A;  1S1C X;  4U3F G;  2CE1 A;  1W5C E;  3F89 A;  1JTH B;  5AVT B;  3RK3 D;  4UB8 H;  3S1K A;  1SP4 A;  4R4M A;  1NU1 J;  3PRJ A;  1JNM A;  4N3Y B;  4C7N B;  1CRJ A;  4JBZ A;  1QVG O;  3KHU A;  1NJI Q;  2FWL A;  2K1A A;  2BCC E;  2KI7 B;  1GMJ A;  1HRC A;  5KTB A;  2B87 A;  4IFF A;  3U59 A;  5APT A;  1GU4 A;  1LTJ C;  3L4F A;  1KD1 Q;  2KLV A;  2IPP A;  2QG4 A;  3N4X A;  1CW5 A;  2BLF B;  2NPS B;  4YXD C;  1LP1 A;  1NU1 E;  5AUR A;  1I5T A;  2K37 A;  3H1L D;  2QVA A;  1DW1 A;  3VRD A;  1FOC A;  5CMZ A;  1T6A A;  2C2C A;  3MGN A;  3OAK A;  3FXD A;  2Z5H A;  1USE A;  1CO6 A;  2B0Z B;  1GZL A;  1IQC A;  2IYO A;  1EDI A;  3Q2Y A;  1KB9 I;  4WY4 D;  1Q90 D;  2N9I A;  2JWA A;  3CLQ A;  3H1H G;  4K35 A;  5EXQ A;  2VRS A;  3SSU A;  1VQL P;  3H1H D;  1COR A;  1OIP A;  2N1T D;  5AVZ B;  1ZRT D;  3L37 A;  3KDP B;  1N7S C;  2OYH B;  2N9B A;  2CA4 B;  1L0N J;  1KB9 H;  2AI5 A;  5AW0 B;  3HE4 B;  2NRG A;  1JTH A;  1PL5 A;  3BVH A;  3S9O A;  2LXC B;  1NTM G;  4GIF A;  1LTJ B;  1NTM D;  4HB1 A;  1CI6 A;  4C7N A;  3MP7 B;  2FKW B;  1PP9 G;  1DIQ C;  1NAF A;  1PP9 D;  2FYN C;  1M60 A;  1L0N E;  2BCC D;  5M1B A;  3CXH E;  2KLU A;  1SQV K;  4JYC A;  4PV1 D;  5KAI H;  1MFZ A;  2FXP A;  3G71 P;  1M8O B;  2FBW C;  2L5G B;  2H88 C;  1J1D C;  3HTK B;  1FZG A;  1MG3 D;  2DGE A;  1FZA A;  1HJ0 A;  2WSE J;  3L73 G;  2GIW A;  1WRG A;  4L3G A;  2HFE D;  3L73 D;  3L75 J;  3RL0 D;  4ZMD A;  2QEX P;  1KYO W;  3TGU J;  5KJ7 A;  3VYM A;  2Z4E A;  1BGY J;  3H32 A;  2P10 A;  4FB1 A;  1L0N K;  5L8R J;  1BE3 G;  2C0W A;  1SQB J;  1H88 A;  5AVR B;  1BE3 D;  4DCK A;  1HCM A;  3CCE P;  2Y0D A;  2DW3 A;  3L75 E;  5DFS A;  1SQV G;  4AAL A;  3V4Q A;  1EQ7 A;  1SQV D;  2OYH A;  4UB8 V;  1S9K E;  3TGU E;  2FFD B;  2XU6 A;  1BGY E;  3RK2 C;  2JP3 A;  3HE4 A;  4DOJ A;  1LC2 A;  3NTN A;  1VDF A;  2B89 A;  2FYN B;  3MK7 C;  3O6Q A;  1SQB E;  5GTH E;  2WSC H;  1HGZ A;  1RZ6 A;  2V08 A;  1EZV E;  4Y28 J;  2ZAE B;  3CXH W;  3MIW A;  4R4L A;  2D2C D;  2W6B A;  2XV5 A;  1IRW A;  2IDB A;  3AE4 C;  1J1D B;  1KX2 A;  2KNC B;  1L0N G;  3PTZ A;  1L0N D;  1YYC A;  1GW3 A;  3CXH D;  1GDV A;  1EDK A;  4IFD K;  1EB7 A;  5CHX A;  3Q5P A;  2MKV A;  1QN2 A;  1T3J A;  3HTK A;  5TIS E;  1LC1 A;  3WUU A;  1ZME C;  3P8C E;  3CC4 P;  1SQB K;  1GQ1 A;  2FYU J;  2QJK C;  1CNO A;  1MKM A;  2WTY A;  2K88 A;  1IFJ A;  1MUU A;  1JMM A;  1M6Z A;  5CIG B;  4AAM A;  2PRR A;  5B66 H;  4YXW H;  1KIB A;  2AXT H;  2KP8 A;  2N9J A;  4O1W A;  3P32 A;  2FYU E;  2QE7 H;  3LW5 J;  5APW A;  3L4O A;  4UB6 E;  1S5L V;  1QL2 A;  1G1J A;  2FFD A;  5KJ7 D;  2K9Y A;  3AE3 C;  1YEA A;  3RMZ A;  1S9K D;  1SQP J;  1PFI A;  4EDF A;  1DX7 A;  3NMD A;  3SWS A;  5C39 A;  1R0Q A;  1KIL C;  4GOF A;  3VMA A;  1EZV D;  4H0J A;  5KAI V;  1NGM B;  1CHI A;  3JSV C;  3CX5 I;  3FXE A;  2KNC A;  2C1V A;  1YJN P;  5AW5 B;  1SQP E;  1CSU A;  2FYU K;  3JCU H;  2J58 A;  1I6E A;  2QJK B;  3CCL P;  4EOT A;  4ZKU A;  5GTI V;  2XNX A;  3A0B H;  1HJB A;  4PWA A;  2YMK A;  1YJW P;  1HVV A;  4TT3 H;  1HRO A;  1RE3 C;  1GL2 C;  1YBK A;  4IL6 E;  3VMZ A;  1HF9 A;  3CX5 H;  1SQQ G;  2O01 H;  4JF7 A;  2PGD A;  2WSF H;  5DJT B;  3A0H H;  1HH0 A;  2HPC B;  1N90 A;  3AED C;  2P7J A;  1JCC A;  3A2A A;  1MZ9 A;  3CYT I;  1IZL 0;  1CC5 A;  2WVR A;  3HQ7 A;  5AW1 B;  1SQP K;  3RLM A;  1FZB A;  2L4D A;  3VTP C;  1CIF A;  1L4A A;  5DF5 A;  1IC2 A;  3L35 A;  4C46 A;  2JEE A;  1FS0 E;  2FYU D;  2N3Y A;  2QA4 P;  2YXQ B;  3C1L A;  2R3C A;  2CA3 B;  3ABV C;  5IY5 1;  4L76 A;  2OYI B;  4DY9 A;  2GUS A;  2E5Y A;  1CIE A;  2LKM A;  1W2L A;  2C9N Y;  3BCC J;  1IFD A;  1N50 A;  1AKK A;  3HQ9 A;  3V4W A;  1JY2 O;  1H89 A;  3FX0 A;  4DT0 A;  2D0W A;  5EFW B;  5AW2 B;  3CCU P;  3HUS C;  4GOE A;  2Q3E A;  3M0D C;  3CI9 A;  5B5E H;  1DVV A;  4EIJ A;  1YIQ A;  1GL2 B;  4I7Z C;  2YCC A;  3SJL A;  1Q2N A;  3L70 G;  3V2Q A;  3L70 D;  2KZJ A;  3BCC E;  5CBO A;  2V7Q H;  1M56 D;  1RE4 C;  3L72 G;  1KB9 E;  4GT1 A;  1RF1 A;  3WFD C;  3L72 D;  3A3Y B;  3A9F A;  4KJM A;  1ZZH A;  3K5B A;  2Y9Y A;  3GW6 A;  1CED A;  1JY2 N;  1VQM P;  3M97 X;  4D6T G;  2OAR A;  4D6T D;  3VN0 A;  3P7K A;  1SFC C;  1NTK J;  4AUW A;  2G3A A;  2BPB B;  2YO3 A;  1I54 A;  1WMK A;  4RES B;  3RBZ A;  1EXJ A;  3G9R A;  3BRT B;  1JDL A;  1H8A A;  5CCH A;  4EIC A;  2HLO A;  5AW7 B;  3WU2 E;  3OCD B;  1KFN A;  1AJY A;  3SWY A;  3G3Z A;  2WT7 B;  1AVY A;  4LJI A;  1NTK E;  2OYI A;  2Q3I A;  2E74 C;  1CHJ A;  2WSS H;  1DH3 A;  5K5G B;  2UWJ E;  3HUS B;  4JPZ B;  2ZXE B;  1OMI A;  3HD7 C;  2D0S A;  3NWV A;  4I7Z B;  4U3F J;  2RN0 A;  1R5L A;  3RL0 g;  1X8Y A;  1KV4 A;  3TYI A;  4YPC A;  1LT1 A;  5CCG C;  3RN0 A;  1CSV A;  3OA8 B;  1T3U A;  3A0B V;  2C9X B;  2GM4 A;  4GDO A;  1M1J C;  1VQO P;  1H31 A;  3WFE C;  4ZKP A;  1GK4 A;  4Z1M H;  4U3F E;  1NTK K;  2L91 A;  3CCS P;  1SFC B;  1KB9 D;  3RK3 E;  1GK6 A;  2YKQ A;  1KB0 A;  1FAV A;  3M0A A;  1UIX A;  2ZXX A;  1FDO A;  1KQF B;  1FZC B;  2FY8 A;  1J1E C;  4EID A;  1QL4 A;  1X22 A;  3SLE A;  1N86 A;  1A02 F;  3V2N A;  1GD2 E;  3BAS A;  1PPJ G;  2K3R A;  2E74 B;  2Y9Z A;  3DR0 A;  4BRY B;  3OCD A;  3IF4 A;  2QJP B;  2A45 G;  1EDL A;  2WT7 A;  1XTG B;  1HJ3 A;  4LC1 A;  2ZVN B;  4BXL A;  5AW8 B;  2ZT9 C;  3H1H J;  1N73 C;  1Y8A A;  1FI3 A;  1YIT P;  1LGH B;  4L75 A;  3D6Z A;  1C75 A;  4NPF X;  2V07 A;  1RF0 C;  1SS1 A;  1L2P A;  1NHL A;  4IL6 X;  3I56 P;  3H1I G;  3H1I D;  1M1J B;  2PFX A;  2KS1 A;  1FI7 A;  1T2K D;  3H1H E;  3Q5S A;  5APS A;  5B66 E;  2WWW A;  2AXT E;  4OH8 B;  1NTM J;  4H0L C;  2Q9I A;  1KZU B;  2B88 A;  1USD A;  1OAE A;  1PP9 J;  1NAY A;  3QH9 A;  1LT9 B;  2N18 C;  2ZYA A;  2M3B A;  3CCR P;  1SQX G;  4U3F D;  1SQX D;  1YQ4 C;  1U7M A;  1NTM E;  4H44 B;  2M5A A;  2FXO A;  1YEB A;  4PD4 H;  4WQ9 A;  1GL2 D;  1ZR2 A;  1GJQ A;  1SVF A;  1NML A;  2W6A A;  1PP9 E;  3WMM 0;  3B5N B;  2LR2 A;  3IR9 A;  5KAF H;  1N73 B;  3L73 J;  1C2N A;  3JCU E;  3W67 A;  2H8P D;  1L0L G;  4AX3 A;  1L0L D;  3PH2 B;  2E76 C;  2XZR A;  3V5B A;  1BE3 J;  1NWQ A;  1CSX A;  4WQE A;  3DP5 A;  3M9Q A;  1OW6 A;  3CX5 E;  3HRN A;  1DT1 A;  2PP6 A;  2AEF A;  1NTM K;  3L73 E;  1SQV J;  4H0L B;  3PXW A;  3A0H E;  1FJ0 A;  4KHX A;  1HJ5 A;  5AW6 B;  3ORV A;  1X79 B;  5CJ4 A;  1IK9 A;  4H13 C;  2JKV A;  1BE3 E;  2JR8 A;  2OTJ P;  2N18 B;  1IFN A;  4H0K A;  1PGO A;  4EI2 A;  1DW2 A;  3A5T A;  1BDC A;  1EXI A;  1P84 H;  1NIR A;  2JO1 A;  2KSJ A;  4GED B;  1SQV E;  2ZON G;  3AE2 C;  1IO4 A;  1NKZ B;  3CMA P;  1MZ4 A;  1LT9 A;  1JY3 O;  4CPG A;  1FBM A;  3VOP A;  1VQ8 P;  2SPZ A;  2A45 I;  5E79 E;  4L3H A;  2V7Q J;  1S5L H;  2XND H;  3VYI A;  1CYI A;  1A2S A;  1ZW0 A;  1T8Z A;  1FHB A;  4JQ0 D;  1NMI A;  1C2R A;  3B5N A;  2C8S A;  5APX A;  1QL3 A;  1MFT A;  1RQV A;  2KIK A;  3AEC C;  4PJ0 V;  2LXB A;  2B9B A;  1N8R Q;  3AE7 C;  1WEJ F;  2A45 H;  2FYZ A;  2NPS A;  1FJP A;  1NOH A;  2HR3 A;  4N0K A;  4ASW A;  2R5B A;  1Q7Y Q;  2HV4 A;  4MU8 A;  2JJL A;  3Q5R A;  1LJ2 A;  1J2J B;  1CYJ A;  3CX5 D;  4JCG A;  5CBN A;  5GTI H;  4PW9 B;  2OTL P;  1PZQ A;  4OWF A;  2O1J A;  5BU5 A;  1U74 B;  4V2K A;  1FU1 A;  2W8Z A;  3HE5 B;  2KK7 A;  3C9I A;  1N7S B;  2P67 A;  5CIH B;  1NVO A;  3VP8 A;  1LTT C;  1F1C A;  2K9J B;  3WUI A;  1G2C B;  5KAF V;  1K73 Q;  1LTJ A;  3ITK A;  1RQU A;  3RBX A;  4O9B A;  1K8A Q;  5KLV G;  3O1Y A;  1WT6 A;  5KLV D;  1H9X A;  1URQ C;  1VF5 D;  3KZI H;  2GB8 B;  1SQQ J;  1JY2 P;  1N7L A;  3D6Y A;  5KKZ C;  2O3J A;  1GDT A;  2OYO A;  3O20 A;  2YXR B;  4H44 D;  2W90 A;  3EFG A;  2M8R A;  4XA4 A;  1IFM A;  1RY3 A;  3GF7 A;  5BVZ A;  1CRH A;  3B5N D;  2FRC A;  2H89 C;  1QL1 A;  1SQQ E;  3M91 A;  1RZ5 A;  1CIG A;  4AQR D;  4AAO A;  1H33 B;  4FA5 A;  4WB4 A;  5CIB B;  2O1K A;  1HUC A;  4M3L A;  1PGP A;  1CSW A;  1VQK P;  3HE5 A;  2ZJS E;  2NPS D;  1N7S A;  1U7J A;  1FOS E;  2R32 A;  3RK2 B;  3PLN A;  2Y0C A;  2MTA C;  3MK7 B;  1KV9 A;  1DII C;  2C1D B;  1W2B O;  2K9J A;  4ASV A;  3KPE A;  1SQQ K;  3L70 J;  1FDI A;  1M57 D;  1CHH A;  1IZN B;  3L72 J;  5KKZ B;  4U7J A;  3AE9 C;  2E75 C;  5TJH A;  5APU A;  4OGQ C;  3L71 G;  3L71 D;  4A7P A;  3O5C A;  2GA1 A;  3S4R A;  2ZFC A;  4D6T J;  4FAN A;  3L70 E;  5APV A;  1R5S A;  1C6R A;  1C52 A;  3L72 E;  3ZOO A;  2AXC A;  1KQS O;  3MD0 A;  1N9C A;  1RAP A;  1QKS A;  1Y9B A;  3R4Y A;  1RH5 B;  1VQ7 P;  3NBT A;  2Q1K A;  1S6V B;  1ZV8 A;  155C A;  4UB8 E;  2YQB A;  3WUT A;  1H33 A;  3AE8 C;  4D6T E;  2PCC B;  1KQG B;  1SQQ D;  1FZF A;  1MG2 D;  3GHG C;  3WFC C;  3I5C A;  2J59 M;  3T97 B;  3H1J G;  2Y0E A;  2HOD B;  3H1J D;  3B8E B;  2KZI A;  3DMI A;  3RK3 C;  1Q86 Q;  1AYG A;  4W7Y A;  2P2U A;  1MV8 A;  3SXT A;  3EFF K;  1YCC A;  2AEM A;  3CCV P; 
#chains in the Genus database with same CATH homology
 3X39 A;  2L91 A;  1KB9 D;  3C2C A;  1I6D A;  1CO6 A;  2B0Z B;  1IQC A;  3ZIY A;  1KB0 A;  3ZOW A;  1H32 B;  5CYT R;  3KZI V;  2N9Y B;  4EID A;  2N9I A;  2BCN B;  1QL4 A;  2JWA A;  2JQR A;  5DJQ C;  3SLE A;  1CRY A;  5EXQ A;  3H1H D;  3O0R C;  1COR A;  5H2F V;  1ZRT D;  3DR0 A;  4XXL A;  3OCD A;  4J20 A;  4RSZ A;  1A56 A;  2QJP B;  5C0Z A;  1HJ3 A;  2CA4 B;  2XTS B;  1CTY A;  2AI5 A;  1DW3 A;  1FI3 A;  3ZOX A;  2LIT A;  1C75 A;  1E8E A;  2V07 A;  1NTM D;  2AIU A;  1A8C A;  3PXS A;  3H1I D;  2N3B A;  2KS1 A;  1FI7 A;  1DIQ C;  1PP9 D;  4PD4 D;  1M60 A;  2BCC D;  1OCD A;  4FA4 A;  1WVE C;  1QYZ A;  4FA1 A;  1E29 A;  1DW0 A;  4WQ7 A;  3L75 D;  4YE1 A;  1OAE A;  3TGU D;  1LMS A;  1BGY D;  2N18 C;  1CRG A;  1MG3 D;  3JBT B;  3RN1 A;  2DGE A;  1YFC A;  5DJQ B;  4U3F D;  1SQB D;  1SQX D;  4AAN A;  2GIW A;  3L74 D;  4L3G A;  3L73 D;  1H32 A;  1KYO W;  1YEB A;  3VYM A;  3WU2 V;  4WQ9 A;  1GJQ A;  1NML A;  2I8F A;  1I8O A;  4FB1 A;  4NFG B;  1FI9 A;  2ZXY A;  1BE3 D;  5C9M A;  1NTZ D;  1C2N A;  1RAQ A;  1I8P A;  1HCM A;  1C6O A;  2Y0D A;  5DFS A;  4AAL A;  1SQV D;  4AX3 A;  4UB8 V;  1L0L D;  3TDK A;  1P84 D;  3PH2 B;  1LC2 A;  1CSX A;  4WQE A;  3DP5 A;  2FYN B;  3MK7 C;  2C1D A;  1DT1 A;  1L9J C;  1RZ6 A;  1LS9 A;  2V08 A;  3PXW A;  3CXH W;  3HQ8 A;  1GIW A;  1L9B C;  2B12 B;  1FJ0 A;  2CXB A;  1AOQ A;  1HJ5 A;  3ORV A;  1IRW A;  1IO3 A;  1VYD A;  1YTC A;  1KX2 A;  2KNC B;  2N18 B;  2PAC A;  3PTZ A;  1L0N D;  2JTI B;  4H0K A;  1B7V A;  1DW2 A;  3CXH D;  1GDV A;  1NIR A;  1PPJ D;  1I55 A;  1EB7 A;  1CIH A;  4GED B;  2ZON G;  3L4M A;  3H1K D;  1QN2 A;  1AOF A;  1MZ4 A;  1LC1 A;  2LIR A;  1N15 A;  2OZ1 B;  5B6Q A;  1GQ1 A;  4Q5P A;  2IBZ D;  4XYD B;  1CNO A;  5CIF B;  4L3H A;  1CYI A;  1A2S A;  2B4Z A;  2B11 B;  3SVW A;  1FHB A;  1NMI A;  4K3I A;  1C7M A;  3ZBM A;  1M6Z A;  1C2R A;  2C8S A;  5CIG B;  4AAM A;  1NNO A;  1YIC A;  2YK3 A;  1KIB A;  2DVH A;  1H31 B;  1QL3 A;  1SQP D;  2N9J A;  4O1W A;  2A06 D;  3L4O A;  3OA8 A;  1K3H A;  1CTZ A;  4PJ0 V;  4KMG A;  1S5L V;  1WEJ F;  3CWB D;  1H9Y A;  1CTJ A;  1HZU A;  1YEA A;  1IRV A;  3RMZ A;  4N0K A;  1CCR A;  2HV4 A;  1F1F A;  4EDF A;  4MU8 A;  1COT A;  5B66 V;  3SWS A;  2AXT V;  1R0Q A;  1CYJ A;  4WQB A;  3CX5 D;  4JCG A;  4PW9 B;  2B10 B;  4FA9 A;  3VMA A;  1EZV D;  4H0J A;  5KAI V;  5CID B;  1U74 B;  4V2K A;  1CHI A;  2BH4 X;  1CXA A;  2C1V A;  5KLI B;  1HH7 A;  1CSU A;  1C6S A;  1U75 B;  1I6E A;  2QJK B;  5CIH B;  2GC7 D;  451C A;  5GTI V;  4PWA A;  1HRO A;  1F1C A;  2OZ1 A;  2K9J B;  3WUI A;  2ZBO A;  4L1Q A;  1GKS A;  4EIF A;  1BCC D;  3PXT A;  4WQD A;  5KAF V;  1GU2 A;  3PHL A;  1YNR A;  1N90 A;  3ITK A;  2VHD A;  1KX7 A;  3CYT I;  1IZL 0;  1W5C T;  3O1Y A;  1CRI A;  5KLV D;  1CC5 A;  3HQ7 A;  1H9X A;  1DVH A;  2GB8 B;  2YIU B;  3RLM A;  2L4D A;  1CIF A;  5DF5 A;  5GTH V;  2O3J A;  2CE0 A;  3O20 A;  3BCC D;  2FYU D;  2N3Y A;  3A0H V;  2CA3 B;  5IY5 1;  4DY9 A;  1CRH A;  1CIE A;  1W2L A;  4Y5R A;  3ZOY A;  2FRC A;  1RZ5 A;  1CIG A;  3ZCF A;  4AAO A;  1N50 A;  1H33 B;  1AKK A;  3HQ9 A;  351C A;  4FA5 A;  2EXV A;  2RMZ A;  5CIB B;  3TF5 A;  1CSW A;  1ETP A;  2D0W A;  5TIS V;  1E2R A;  1CCH A;  4EIE A;  2Q3E A;  1DVV A;  1YIQ A;  3PLN A;  2YCC A;  3SJL A;  4GYD A;  3L70 D;  5E79 V;  3CU4 A;  2Y0C A;  2ZOO A;  2MTA C;  3MK7 B;  1KV9 A;  2BGV X;  1DII C;  3WFD C;  3L72 D;  3A9F A;  4WQ8 A;  1CRC A;  1HZV A;  1NTK D;  1ZZH A;  2C1D B;  3CX5 W;  2GC4 D;  4FAV A;  1K3G A;  4WQC A;  3CP5 A;  3GW6 A;  2QJY B;  1M70 A;  1CED A;  4RJT A;  3WFB C;  5B5E V;  1BL9 A;  3M97 X;  1CHH A;  4UB6 V;  4D6T D;  4P4Q B;  1LFM A;  5KKZ B;  1H1O A;  2BPB B;  1CXC A;  5TJH A;  1I54 A;  2BH5 X;  3GG2 A;  1JDL A;  3L71 D;  2MHM A;  3NBS A;  4EIC A;  4A7P A;  3O5C A;  2C1U A;  3HQ6 A;  4QAO A;  3OCD B;  5CIC B;  1NU1 D;  4FAN A;  1C6R A;  2CE1 A;  1C52 A;  3ZOO A;  4LJI A;  2ZZS 1;  1CHJ A;  1N9C A;  1RAP A;  1QKS A;  3VNW A;  3NBT A;  5CIE B;  1S6V B;  3PRJ A;  155C A;  3WC8 A;  1CRJ A;  2YQB A;  3KHU A;  2PCB B;  2FWL A;  1H33 A;  2PCC B;  2D0S A;  3NWV A;  1SQQ D;  2RN0 A;  1HRC A;  1FCD C;  1MG2 D;  3TYI A;  3WFC C;  3FWL A;  3RN0 A;  1KYO D;  1CSV A;  2Y0E A;  1CYC A;  3H1J D;  3OA8 B;  1J3S A;  3A0B V;  2C9X B;  3DMI A;  2QG4 A;  1AYG A;  2ORL A;  4IL6 V;  2BLF B;  4WQA A;  1H31 A;  1HJ4 A;  3WFE C;  5AUR A;  1I5T A;  3SXT A;  3H1L D;  4O1Q A;  1DW1 A;  3VRD A;  1FOC A;  1YCC A;  2C2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...