3CX5D

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
248
structure length
248
Chain Sequence
b'MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 71
structure length 248
sequence length 248
chains with identical sequence O
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cx5D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cx5D02
1CTJA 1BGYD 2PACA 3KZIV 1CIFA 5DJQB 3CWBD 1JDLA 2ZONG 1CSUA 5CIBB 1DW3A 1P84D 2I8FA 1AOQA 2Y0DA 1DW2A 1KX2A 4WQ9A 1VYDA 3RN0A 5CYTR 1F1CA 351CA 3NBSA 1K3GA 1RAPA 2KNCB 2KS1A 4PD4D 3M97X 4IL6V 4V2KA 1WVEC 2BCNB 3L71D 2MHMA 1DVHA 3ZOWA 1S6VB 1C75A 2FYNB 1A2SA 1H32B 3PTZA 2ORLA 5CICB 1HH7A 4K3IA 5CIDB 2K9JB 4AX3A 3X39A 1I54A 1IRWA 1H32A 4U3FD 2JQRA 1MZ4A 2EXVA 1LC2A 3PH2B 1RAQA 2N9JA 3O0RC 2JTIB 1L0ND 2LIRA 2B4ZA 4L3GA 2YIUB 3O20A 2B11B 5EXQA 1FJ0A 5CIGB 3A9FA 1BCCD 1DIIC 3WC8A 3WFCC 3CU4A 1SQVD 1H9YA 1ETPA 1LFMA 3RN1A 1I6DA 2OZ1A 1AKKA 2V08A 2MTAC 3SVWA 3GG2A 1J3SA 2XTSB 1CYCA 1YTCA 2AIUA 3H1LD 1CHIA 5E79V 3ORVA 1YIQA 1CORA 2C1DB 3DR0A 3HQ7A 1HZVA 3SLEA 1NTZD 4NFGB 1OCDA 3ZOYA 1H33B 4DY9A 4AAMA 4RJTA 4FANA 2V07A 1COTA 2B0ZB 3ZOXA 3CYTI 4H0KA 1H33A 1IRVA 3RMZA 3WFBC 2AI5A 1FHBA 4FB1A 2PCCB 1C7MA 1H9XA 4KMGA 3O5CA 1H31B 1N90A 1NIRA 4EIFA 3ZCFA 3MK7C 1H31A 2CA3B 5KKZB 1CTYA 4JCGA 1QKSA 1NMIA 2D0WA 1L9BC 2LITA 1PP9D 2A06D 1A8CA 1YEAA 4GEDB 3VMAA 1EZVD 2ZOOA 4WQBA 3L75D 1BE3D 1CHJA 1CSVA 4PJ0V 4AALA 3ZBMA 5B5EV 1E29A 1QL4A 1N9CA 4UB8V 3CP5A 1QL3A 3C2CA 1N50A 3NBTA 4GYDA 4O1QA 4P4QB 3H1ID 1SQPD 3H1JD 4WQ8A 2N18B 1HZUA 1AOFA 1A56A 1CXCA 2GC4D 1CRIA 2CXBA 2Y0EA 5DJQC 1NNOA 2QJPB 2YQBA 2CE0A 2BH4X 1OAEA 2QG4A 5DFSA 2GC7D 1U75B 1EB7A 1YCCA 2IBZD 451CA 2RN0A 2B10B 4QAOA 1CRGA 1DW0A 2FYUD 3PXTA 1I5TA 1KB9D 1I8PA 1KX7A 2Q3EA 4PWAA 4O1WA 1K3HA 3H1HD 3JBTB 1W2LA 1C2NA 3A0BV 1LMSA 1CYJA 3PXWA 2L4DA 3HQ6A 2OZ1B 2Y0CA 2GB8B 4PW9B 4MU8A 5TISV 5GTIV 1RZ6A 3OA8B 1NU1D 2N3YA 4Q5PA 1CRYA 3L4MA 1KV9A 2N3BA 4EIDA 4FA5A 1CNOA 1CIGA 5KAFV 3VYMA 3OA8A 1CC5A 1GKSA 5IY51 1ZZHA 1GQ1A 1YEBA 1NTKD 2RMZA 3L73D 1KYOD 1L0LD 1KYOW 3L72D 3DMIA 1N15A 3PRJA 4RSZA 1I8OA 1CTZA 2C8SA 5CIHB 4A7PA 5KLVD 3CX5W 1PPJD 5KLIB 2QJYB 3PLNA 3TF5A 1M70A 1CRCA 4L1QA 2ZBOA 4EDFA 5B66V 3SWSA 1GU2A 4FA9A 2CA4B 4XYDB 2N9IA 3WUIA 3OCDA 2BCCD 1QYZA 2D0SA 3PXSA 1BL9A 5C0ZA 3CXHD 1HJ4A 3CXHW 1CRHA 1DW1A 1CYIA 2AXTV 5B6QA 1HJ3A 1S5LV 2DGEA 1R0QA 1E8EA 4D6TD 1W5CT 1MG2D 1QN2A 4UB6V 1NMLA 5AURA 3FWLA 1GDVA 4AANA 2QJKB 1DVVA 2O3JA 3NWVA 2GIWA 2N9YB 1CIHA 1IZL0 4WQCA 5C9MA 1I55A 3VRDA 3KHUA 1CIEA 3ZOOA 1AYGA 4EICA 1SQQD 1I6EA 3TDKA 1F1FA 2C1VA 4EIEA 2BGVX 1HCMA 1CRJA 3VNWA 1KIBA 1IQCA 1FI3A 3SJLA 1HJ5A 1YICA 2BH5X 3HQ9A 1C52A 2C1UA 4Y5RA 4AAOA 3PHLA 3H1KD 3WFEC 1YNRA 1C6OA 2ZXYA 5H2FV 2ZZS1 4YE1A 4FA4A 1IO3A 1FI9A 3WU2V 3WFDC 1CHHA 2N18C 5GTHV 1WEJF 2FWLA 1YFCA 1LC1A 4WQDA 4N0KA 3DP5A 3HQ8A 3TGUD 1C6RA 1MG3D 4WQAA 1CCRA 3ZIYA 1B7VA 1C6SA 4LJIA 5DF5A 1SQXD 3L4OA 2PCBB 1M6ZA 1L9JC 2BLFB 1NTMD 2BPBB 3RLMA 1LS9A 3SXTA 1HROA 3L74D 4L3HA 3ITKA 155CA 4WQ7A 5CIEB 2DVHA 2FRCA 3CX5D 2C2CA 5TJHA 1FI7A 4FA1A 3GW6A 1M60A 4WQEA 1GJQA 1CO6A 2CE1A 3MK7B 2YCCA 3O1YA 1ZRTD 1CSXA 1H1OA 4J20A 1C2RA 2L91A 2VHDA 3BCCD 3OCDB 1E2RA 1FCDC 1HRCA 1DT1A 5KAIV 2C1DA 4H0JA 1U74B 2HV4A 3A0HV 4FAVA 1KB0A 4XXLA 2JWAA 1FOCA 1DIQC 1CCHA 1CXAA 3L70D 2YK3A 1SQBD 5CIFB 2B12B 1GIWA 1CSWA 3TYIA 1CEDA 2C9XB 1RZ5A
chains in the Genus database with same CATH superfamily
1BGYD 4QMAA 3WUUA 1CIFA 4ZMDA 3HRNA 1NTMK 1GZLA 1Z56A 1WMKA 3H1KE 2OARA 5CIBB 2OTJP 4JYCA 2YO2A 2V7QJ 2I8FA 4O9BA 3CL3D 4WQ9A 4PJ0E 3VP9A 1VYDA 3RN0A 4I6MC 1JM0A 2YXRB 3JCUH 3C8VA 3R2PA 4U3FJ 1SQBG 1LJ2A 1RAPA 3M97X 4Y28J 1WVEC 3Q1MA 4OVNF 2K37A 1DVHA 2YO3A 1NTME 2W27A 3RK2B 2FYNB 2WQYC 4XFJA 1QL2A 1H32B 2JP3A 3GHGC 4EI2A 3B5ND 2IFMA 5CICB 4K3IA 3CWBG 1NKZB 3CCVP 1EDJA 1H32A 1BCCJ 1PPJE 1M1JC 2JQRA 2Z5HA 4H13C 1EXJA 4HH2A 3CPWO 1NOHA 4NPDA 4DJGA 1JEKA 5CCGA 1EXIA 2JTIB 3H1LJ 2B4ZA 4ZKPA 2B11B 3A9FA 5AW7B 1SQVD 3RN1A 2N1TD 2R44A 2V08A 1HBWA 2E76C 3AE2C 4XE5B 1N7SA 2KSEA 1J3SA 1T2KD 2B9BA 2AXCA 1K8AQ 4U3FG 3D6ZA 2B87B 1R5LA 1VQ6P 1NTZD 3HUSA 2IX7C 4AAMA 4YXDC 3AE4C 3FXDA 3ZOXA 3L74G 1RY3A 1IRVA 2M5AA 1BCCG 2AI5A 3M0DA 1FDOA 1P84E 2M0BA 3P7KA 3O5CA 1QVFO 4EIFA 4H0LC 5KAIE 3ZCFA 3MK7C 2D0WA 1L9BC 3CXHI 1PP9D 1L0NK 1E5WA 1YEAA 3H1IJ 2C9LY 3H1JJ 2KLVA 3L71J 3L75D 3RL0g 1CHJA 3Q2YA 4PV1C 2KP8A 4PJ0V 4L73A 3V5BA 4LC1A 4HKZH 1FJKA 3KZIE 4BXLA 5AW8B 2E74D 3NBTA 2FBWC 2Q9IA 2WSFJ 1HZUA 2BASA 1RH5B 1AV1A 1L0NE 2SPZA 1P84I 1GK6A 2QJPB 1J1EB 1Q2NA 4NPFX 2A06G 2YMYA 2FKWB 1WRGA 1GW3A 2QG4A 1MUUA 2IDBA 1U75B 1EZVG 3VMYA 2IBZD 1NU1J 2B10B 1VQ4P 1NAFA 4IL6E 2YKOA 1M90Q 2NPSD 3P32A 3FXEA 1HF9A 1KX7A 1NHLA 4PWAA 3L73J 4O1WA 1K3HA 1YHQP 5TISH 1KQLA 3CXHH 3L72J 1LMSA 3T97A 1OVRA 1RF1A 5APXA 3EFGA 2OZ1B 3H1IG 2HYNA 5TISV 3H1JG 5GTHE 3RK2C 3L71G 1RE4A 5KLVJ 2PP6A 2N3BA 3VYMA 1GKSA 1ZZHA 2Q3IA 1GQ1A 5APVA 1KYOD 1Q90D 1KYOW 4R4MA 3AE1C 3E1RA 1I8OA 5CCGC 2C8SA 1S1CX 5CIHB 3VTPC 1T3UA 1NH4A 1OW8A 4WY4B 3TF5A 3CCJP 4WY4A 3R4YA 2D2CB 2XNDH 1FAVA 5AVWB 5E79E 1SFCB 2QIWA 1OMIA 3I56P 4K35A 1YJ9P 3OCDA 1SFCA 1QYZA 2FYUK 5DJTB 2A45I 3L73G 1BL9A 1OXZA 3L72G 1IK7A 1DW1A 2KI7B 1VQNP 1PFIA 2QVAA 3L36A 1VQ9P 4OWFA 2ZAEB 1E8EA 5KLVG 2E42A 4JF7A 1ZOYC 1W5CT 1QN2A 4HJGH 3EQ2A 1PZQA 4OGQD 1FZEA 1DEBA 1SP4A 1NTKK 3G6EP 1JY3P 1L0LK 1IZL0 1AVYA 2FYUE 3IAOA 2HODA 2ZT9D 1ZMEC 3VRDA 3H1HE 3H1KJ 1W2BO 1SQQD 2JR8A 5B5EE 2C1VA 4EIEA 2BGVX 1KD1Q 1CRJA 1FBMA 1KIBA 2W8ZA 1IQCA 3AE6C 1H0TA 1YICA 3Q5RA 1NO4A 3AE7C 1NTKE 2KNCA 3OJAB 1M56D 3A0BH 4H44D 3H1LE 1GMJA 1L0LE 1FS0E 2WT7B 1C6OA 4C7NB 5H2FV 2XZRA 1K73Q 2HFED 4YE1A 1NTMJ 2KZJA 2WSCH 4C7NA 1JTHB 3WFDC 1CHHA 5GTHV 1KILE 1OIPA 1LC1A 4N0KA 3FX0A 3CLQA 1URQA 1C6RA 1CCRA 3ZIYA 1J1EC 2QJPC 1OX3A 4N78E 1SQXD 3L4OA 4GT1A 2M3BA 3KYQA 3VYIA 1M6ZA 1KILA 3S9OA 1HJBA 1HTLC 1IZNB 3RLMA 3M9BA 3SXTA 2JO1A 3P8MC 3L74D 2W90A 1VQ8P 4IOIH 3U1AA 3H1KG 2WITA 3CC2P 1QEXA 2GUVA 1RE4C 1CO6A 3N7NA 1H1OA 4J20A 4D6TE 2VHDA 3CCUP 3A0HH 3CCRP 3E1IA 1S5LH 4C46A 3A0HV 1L4AA 1NTMG 2V7QH 3C1LA 5K5GB 2M8RA 4XXLA 1PGQA 2JWAA 2FXMA 3JSVC 2E43A 4RKUJ 1FOCA 4I1LA 1S72P 4WY4C 2K3RA 4N3YB 2UWJE 1JNMA 2GA1A 5CIFB 1NU1K 1Q81Q 1GW4A 2D2CC 5AW4B 5APSA 1OZHA 1RZ5A 1OVUA 2FXOA 1SFCC 1YI2P 3RBZA 2Q7CA 1RQVA 2KK7A 3MUDA 1JCDA 3G71P 5AW2B 2RKLA 2Y0DA 4UB6E 2XKMA 1KX2A 4EYYQ 5APTA 2HR3A 1LTIC 4AQRD 1IFNA 1NU1E 4W80A 3A3YB 2OGUA 3I55P 3L71D 5KJ7A 3WU2H 3ZOWA 1A2SA 1L0NJ 2IFNA 3PTZA 2ORLA 1FJPA 5CIDB 2K9JB 4AX3A 3CX5E 2QEXP 5BU5A 2K9JA 1LC2A 1N73B 3JCUE 2CPBA 1ZRTE 4H13D 1BDCA 1N73A 3O0RC 1DIPA 2LIRA 1FZGA 1VQMP 3CI9A 1U7JA 3WFCC 3CCMP 1H9YA 1ETPA 2ZJSE 2P67A 1I6DA 1X0TA 5GTIE 1AKKA 1LTJB 4DOJA 1X9VA 2WSEJ 1FZFA 3SVWA 3GG2A 2E76D 5AVSB 1YTCA 3L70E 1S2EA 2WPVB 1GU5A 1CORA 2C1DB 1LNQA 3DR0A 5AVZB 2BEQD 3VP8A 1BGYE 3CX5I 4NFGB 1SS1A 3ABVC 1L0NG 4FANA 1R8EA 4ASVA 4PV1B 5CBNA 1KV4A 1COTA 1SVFA 1PGOA 3JC22 3CYTI 4H0KA 3WFBC 3VOPA 1FHBA 2PCCB 1C7MA 1H9XA 1H31B 1PGPA 1NIRA 2P10A 2WSFH 2XV5A 5CMZA 1H31A 1KB9H 4JCGA 1QKSA 4H0LD 3OW2O 2LITA 3LW5J 1FU1A 1A8CA 1FZCB 1N2DC 1KFMA 3G4SP 1SQVK 2A45G 1FZCA 1BE3D 2OTKE 3TSIA 3CP5A 3SFEC 1KZUB 1N50A 1Y8AA 4GYDA 1A02F 5APYA 3B5NA 2CK3H 2FYUJ 1SQPD 4WQ8A 1NTZK 2Y0EA 2CXBA 4IFDK 2E5TA 3MUDC 1N7LA 3H1HJ 2ZVNB 3M91A 4BWNA 1J2JB 1SQVE 2BH4X 2R3CA 4CPGA 2GC7D 1EC5A 2RN0A 1CW5A 1JB0J 1G1JA 1DW0A 1I5TA 3D71A 5KTBA 1I8PA 4N6JA 2Y9ZA 4KT0J 1NTKJ 2WPSA 5KJ7C 1DD3A 1L0LJ 4GDOA 1CYJA 4ZNCA 1GL2B 2GB8B 1NTZE 5KAFH 2DW3A 5GTIV 1N7SB 1RZ6A 2N3YA 1GL2A 1CRYA 1IC2A 4EIDA 5KAFV 3RK2D 1T3JA 3RK3E 3VN0A 5AVVB 1X8YA 1USDA 3P8CD 2YMKA 3RK3B 1N73C 1CTZA 3QH9A 2FYUG 2O1JA 3HUSB 4A7PA 2IYOA 4GODA 5CCGD 1WT6A 2K88A 1PPJD 2MJZA 3W67A 3W68A 3H1HG 2M5AB 3PLNA 1M70A 2Z5IA 4GIFA 2ZYAA 4L1QA 2KSJA 3AEFC 4EDFA 2J58A 1HH0A 4TT3H 3TK1A 3L75E 1LTJC 3CCEP 4D6TJ 1G2CA 1BSNA 2BCCD 1HJ0A 3SWFA 1NTKG 1LWUB 3CXHD 1ZN5A 3H1LG 3CXHW 1L0LG 4PD4E 1EDKA 2H88C 5AW9B 1LWUA 2E75B 4PJ0H 3PJSK 3WUVA 1KTMA 1GDTA 2WZ7A 2W83C 1IFDA 2QJKB 1DVVA 2IBZE 3H6PA 4W7YA 4WQCA 1HWTC 3U1CA 2WWWA 5C9MA 1ZXGA 1YIJP 2OTLP 4I2LC 4Y99B 1FZCC 2NPSA 1J1DB 1FI3A 3SSUA 4JBZA 2WPRA 4UB8E 1FE6A 2KXPB 2BH5X 4D6TG 1RHZB 1C52A 4PD4I 4AAOA 2YKQA 1KYOE 1IFJA 2JKVA 3B5NC 3T97B 1RF1B 2ZZS1 1ZR4A 2LKMA 2FWLA 3Q5PA 4WQDA 2PGDA 2IBZI 3TGUD 1C6SA 4WVZA 4LJIA 3S1KA 1MFTA 2PCBB 2QM8A 1K9MQ 5AW6B 3ZDMA 2BPBB 3HTKA 3BCCJ 1JY2N 155CA 5CIEB 1AFOA 3BRTB 3FGAD 2AEMA 1FI7A 2ZYDA 2GM4A 2KOGA 5AVTB 3MGNA 1GJQA 1GL2C 1P84H 3CC4P 1SQQK 1YQ3C 2JEEA 1H8AA 2H43A 2KIKA 1N7SC 1C2RA 3NFQA 5KAIH 4B86A 1KYOI 3OCDB 2R5DA 3L70J 1NU1G 1JY2O 2JJLA 5KAIV 3PP5A 2W6JH 4H0JA 1BGYJ 2WMMA 3RK3C 3A5TA 4FAVA 1DEEG 1KB0A 2ZFCA 3HUSC 4L76A 1LTGC 1K05A 1CXAA 1SQBD 1SQQE 3KZIH 5AVXB 1T6AA 1VQKP 3M0DC 4WY4D 3SWYA 1CEDA 2C9XB 1CTJA 3KZIV 2PACA 3BASA 2D2CD 2HODB 3CWBD 1SFCD 1VQOP 4RO0A 1SLQA 1JDLA 1LWUC 3WUTA 1KQSO 1H0TB 2JWDA 2E75C 5CYTR 1F1CA 1OVVA 1VDFA 351CA 3L70G 3NBSA 3AEDC 1K3GA 1OFCX 4HYTB 2RH0A 1LP1A 2KNCB 2KS1A 1SQXE 4IL6V 5H2FH 2MKVA 1PL5A 2BCNB 3SFDC 2QJKC 1BGYG 3AEBC 2A45H 2WSEH 5GTHH 5AVYB 3V4QA 3X39A 1URQB 1I54A 3BATA 4WB4A 4U3FD 1SQVJ 4Y99C 3PH2B 1LT9B 1KILB 1J1DC 1IO4A 1RAQA 2YNYA 2N9JA 4R4LA 1LT9A 3USSA 1N86A 3RL0B 1S4XA 4L3GA 2FFDB 5EXQA 4C7RA 1FJ0A 1BCCD 2ITAA 2FY8A 1LFMA 4L74A 2FFDA 1NTZJ 1RF1C 3CC7P 3O8ZA 2ZXXA 5E79H 2H7HA 3G9RA 1CYCA 2C0WA 5AW0B 1OWAA 2AIUA 3H1LD 3RBXA 5E79V 3ORVA 3LW5H 5AW5B 1HZVA 1L4AB 3C9IA 1YBKA 1Q86Q 2YIUC 4RJTA 4YXWH 2V07A 5M1BA 2Q6QA 1U57A 1PIXA 3RMZA 5B66E 1EDLA 1SQVG 4FB1A 4KMGA 5AVUB 3L75J 1PV3A 1N90A 3D6YA 1CTYA 1M1KQ 1NMIA 2O01J 4W7ZA 2FXPA 1USEA 2VRSA 2A06D 2AXTE 5CHXA 5B5EH 4IFMA 1NTZG 3MP7B 1EZVD 2ZOOA 4WQBA 1CSVA 5CJ4A 3ZBMA 5B5EV 3HD7B 1VF5B 3OAKA 1N9CA 3HD7A 1FDMA 3C2CA 2WPQA 4O1QA 4IL6X 3H1ID 3L4FA 3H1JD 1D7MA 2N18B 1A56A 1CXCA 3AEAC 3FWNA 2GC4D 1VQ5P 1NNOA 2YQBA 1M1JA 1QGKB 3MIWA 1OAEA 5DFSA 1EB7A 451CA 3L75G 3H32B 1HGVA 4QAOA 1KB9D 3H32A 4K3AA 2LXBA 2Q3EA 3TNUB 3BCCE 1W2EA 1QLED 1RF0A 1W2LA 2HPCB 3TNUA 1ZV8A 5KJ7D 1X79B 4MU8A 2E5YA 2P1JA 1U7MA 1NU1D 2HPCA 3L4MA 1OW7A 1KV9A 4FA5A 1CSBA 1QVGO 4U7JA 2QA4P 2AEFA 1S9KD 1URQC 3L73D 3II6A 1UIXA 3L72D 3HE5B 3IF4A 2IBZG 1LT9C 1TU3F 4L75A 1KILC 1AA0A 4JYBA 3HE5A 4DZOA 4GOFA 4YPCA 5KLVD 3CX5W 1SQPK 1YJNP 3RL0C 5KLIB 2FFDC 2QJYB 2YXQB 1FC2C 1M57D 1CRCA 2ZBOA 5CCHA 5B66V 3SWSA 3F89A 1BE3E 1DD4A 2N9IA 3WUIA 1JMMA 4EOTA 3A7OA 3PXSA 1AJYA 2KB7P 2WVRA 1RE3A 2H8PD 1IK9A 2AXTV 1KQFB 1SQPE 4UB6H 1L4AC 1E79H 1FOSF 1MG2D 2JDIH 4UB6V 5AURA 1SQQJ 2CPSA 3B4SA 1GDVA 2KLUA 3M06A 4PV1D 1NJIQ 3NWVA 3GLMA 3B5NB 2GIWA 2XDJA 3B8EB 1PGJA 1CIHA 1JY3N 1ZLLA 3EWKA 2OQQA 2KZIA 1XTCC 4HB1A 1I55A 2G8YA 2W6AA 2QM7A 1CIEA 3CX5H 1CI6B 2N9BA 4EICA 2BEZF 4AYCA 1I6EA 1F1FA 2QSIA 1VL2A 5AVQB 3VNWA 1CI6A 3SJLA 1ZP0C 5APWA 3IR9A 3HQ9A 1W5CE 3HD7C 1JY3O 2N1TB 4Y5RA 2AEJA 3PHLA 3H1KD 1HGZA 1SQXJ 1VF5C 3CD6P 1YNRA 2ZXYA 3P8CE 1H88A 1KMIZ 2K9YA 2N1TA 4FA4A 3D70A 5GTIH 3L74J 2N18C 3HE4B 1WEJF 1JO5A 1K04A 3HE4A 3D0WA 3HQ8A 1SQQG 3AEGC 3A2AA 1AQTA 1T8ZA 3RGUA 1L9JC 1JOCA 1NTMD 1ZW0A 5DJUB 1HUCA 1LS9A 1HROA 2BCCE 4L3HA 2HG5D 3Q3DA 1RF0C 2DVHA 5AW1B 1M8OB 5TISE 3CCSP 3CXHE 4ZKUA 3GMAA 2C2CA 3GW6A 1PP9E 1YQ4C 3QWOC 5AVRB 3AECC 2YCCA 2P7JA 3O1YA 1CSXA 1MFZA 1GL2D 2L91A 1G2CB 3IFMA 1NVOA 2I8DA 1E2RA 1N7SD 2M3EA 1FCDC 3I5CA 1JMBA 1SQXG 1MV8A 1AQ5A 2B87A 2HV4A 1YITP 3RK3D 2E74B 4JPZB 1LTAC 3VMXA 5CCHC 5KLIC 2QJYC 1Y47A 3G3ZA 1GIWA 2W6BA 4I7ZB 3TYIA 2PRRA 3V2QA 5DJQB 3WMM0 1RE3C 2ZYGA 2ZONG 1CSUA 3KPEA 1GK4A 1KQGB 1DW3A 2IYPA 1KORA 3M0AA 2OYOA 1P84D 2NPSB 1AOQA 2OYIB 1DW2A 3MTUE 5APUA 3NTNA 4EIJA 2PAJA 3IN6A 4DT0A 2OYIA 1YTZI 2E75D 3V4WA 3TGUE 2YKPA 4LLHA 4PD4D 4IFFA 4V2KA 3K5BA 2Q1KA 2MHMA 2C9NY 1S6VB 1C75A 2I1KA 1BDDA 1N8RQ 1HH7A 2C0XA 1IRWA 2WTYA 1MZ4A 2EXVA 1SQBK 2R32A 1L2PA 3V2NA 3HTKB 2POHA 1S3JA 3LIDA 5H2FE 1L0ND 2ZVOB 3MHVA 3AE3C 2GUSA 2YIUB 1NKNA 3O20A 3A0BE 4YTPC 3CMAP 2N1TC 5CIGB 1DIIC 3WC8A 3CU4A 3L37A 4BRYB 2FYNC 2OZ1A 1T2KC 2MTAC 4BRYA 4TLFA 2XTSB 3S4RA 1AVOA 1SQBE 1CHIA 4WWIA 2O01H 1YIQA 4MN4C 1OW6A 1IJDB 5CJ0A 2ZXEB 3HQ7A 3SLEA 4PD4H 1NWQA 1GU4A 1GTWA 3GF7A 1OCDA 3ZOYA 4KHXA 1H33B 4DY9A 4OGQB 3CWBE 2B0ZB 2NRGA 2XNXA 4NPEA 1H33A 2IZ0A 2R3SA 2ZT9B 1VQ7P 1BE3J 3V2RA 4OH8B 2Y9YA 1Y9BA 3E7KA 5BU8B 2CA3B 5KKZB 1G1IA 1A02J 2V4HA 1MZ9A 1SQXK 1YJWP 3A0HE 3V6IA 2P2UA 1HVVA 3BCCG 4GEDB 1S5LE 2OYHB 3VMAA 1SQPJ 2OYHA 4AALA 4UB8H 2O01N 4H44B 3CCLP 1E29A 1QL4A 2E74C 4U3FE 2QRXA 1LP1B 4UB8V 1QL3A 2KS1B 4IL6H 1KYOH 4P4QB 3AE9C 4I7ZC 1EDIA 1AOFA 2FYZA 1CRIA 3L74E 5DJQC 1GD2E 1ZR2A 2CE0A 1BCCE 1R5SA 5AW3B 1DH3A 1NAYA 5BVZA 1Q7YQ 5CBOA 2NPSC 1YCCA 2J59M 2OYIC 1BE3G 1CRGA 3PXTA 2FYUD 4M3LA 1EQ7A 1NGMB 1IFIA 3H1HD 3JBTB 2WT7A 1C2NA 3A0BV 1VQLP 3PXWA 1IFMA 2L4DA 3HQ6A 2Y0CA 3N4XA 3WU2E 1UIIA 4PW9B 3KQGA 1SQPG 3OA8B 4AUWA 3BRVB 4Q5PA 1JTHA 1FDIA 4KJMA 1CNOA 1CIGA 3OA8A 1CC5A 1YTZT 5IY51 1JCCA 4ASWA 5EFWB 1YEBA 3V2PA 3SWKA 1NTKD 2RMZA 2K1AA 1L0LD 3DMIA 1URQD 1N15A 2KYVA 3PRJA 4RSZA 2BCCJ 1MKMA 3AE5C 1KILD 2A06E 2XU6A 3RL0D 3B71A 1PP9J 4N78D 3TYYA 1GU2A 2R5BA 2G3AA 1EZVE 4FA9A 2CA4B 4XYDB 1Q82Q 3GF3A 2Q5UA 2D0SA 5C0ZA 1HJ4A 2LR2A 1CZQA 2B88A 2NZ2A 1CRHA 1CYIA 4GKGA 5B6QA 1RQUA 3H1IE 1HJ3A 1S5LV 2WSSH 3H1JE 2DGEA 3L71E 1R0QA 4LGDE 4XA4A 4D6TD 3H25A 1L4AD 1PPJG 3U59A 4OGQC 1NMLA 3FWLA 3NMDA 4AANA 2O3JA 2ZT9C 2N9YB 3GHGB 1BSHA 1H89A 1KB9E 3KDPB 2H89C 2BCCG 4GOEA 5KKZC 2O1KA 3KHUA 3GHGA 4JQ0D 1EZVI 5KLVK 3ZOOA 1M1JB 1AYGA 2HLOA 2I1JA 2LXCB 2QE7H 4H13B 3TDKA 5APQA 3BVHA 1PP9G 3M9QA 1HCMA 2OYHC 1HJ5A 1VQPP 3CCQP 2C1UA 4DCKA 4H44C 3M9HA 3TGUJ 1IFPA 2IZ1A 3OA7A 1KFNA 3L35A 1S9KE 2P58A 3L73E 3HD7D 3WFEC 3L72E 1XTGB 2E76B 1VF5D 2PFXA 1FI9A 1IO3A 3WU2V 3KXDA 5KLVE 5C39A 3VMZA 1YFCA 1LGHB 1KC8Q 3DP5A 1MG3D 4WQAA 1B7VA 5DF5A 3MZWB 2J5UA 1KB9I 3PH0A 2KUBA 1QL1A 2BLFB 1JY2P 3UIAA 1VPCA 4WQ7A 5L8RJ 2FRCA 3CX5D 3AE8C 3MD0A 1FOSE 5TJHA 1LTTC 4FA1A 5B66H 2Z4EA 1M60A 4WQEA 5KAFE 2WSCJ 3CMEP 1LTJA 1QX8A 3Q5SA 4H0LB 2CE1A 3MK7B 1ZRTD 1FZBA 1NYHA 3BCCD 1SQBJ 2B89A 3EFFK 1X22A 3TGUG 1HRCA 1DT1A 1KN7A 2C1DA 4WBAA 2AXTH 1LTBC 1U74B 4RESB 3F5HA 1S5LX 1JUNA 3CWBJ 1DIQC 1FZAA 1CCHA 3L70D 1YYCA 3LIEA 3O6QB 2IPPA 3NXSA 2YK3A 3AEEC 1LTSC 4Z1MH 1M7LA 2B12B 1LT1A 3O6QA 1CSWA 5CCHD 2L5GB 3ITKA 1DX7A
chains in the Genus database with same CATH topology
1CTJA 1BGYD 2PACA 3KZIV 1CIFA 5DJQB 3CWBD 1JDLA 2ZONG 1CSUA 5CIBB 1DW3A 1P84D 2I8FA 1AOQA 2Y0DA 1DW2A 1KX2A 4WQ9A 1VYDA 3RN0A 5CYTR 1F1CA 351CA 3NBSA 1K3GA 1RAPA 2KNCB 2KS1A 4PD4D 3M97X 4IL6V 4V2KA 1WVEC 2BCNB 3L71D 2MHMA 1DVHA 3ZOWA 1S6VB 1C75A 2FYNB 1A2SA 1H32B 3PTZA 2ORLA 5CICB 1HH7A 4K3IA 5CIDB 2K9JB 4AX3A 3X39A 1I54A 1IRWA 1H32A 4U3FD 2JQRA 1MZ4A 2EXVA 1LC2A 3PH2B 1RAQA 2N9JA 3O0RC 2JTIB 1L0ND 2LIRA 2B4ZA 4L3GA 2YIUB 3O20A 2B11B 5EXQA 1FJ0A 5CIGB 3A9FA 1BCCD 1DIIC 3WC8A 3WFCC 3CU4A 1SQVD 1H9YA 1ETPA 1LFMA 3RN1A 1I6DA 2OZ1A 1AKKA 2V08A 2MTAC 3SVWA 3GG2A 1J3SA 2XTSB 1CYCA 1YTCA 2AIUA 3H1LD 1CHIA 5E79V 3ORVA 1YIQA 1CORA 2C1DB 3DR0A 3HQ7A 1HZVA 3SLEA 1NTZD 4NFGB 1OCDA 3ZOYA 1H33B 4DY9A 4AAMA 4RJTA 4FANA 2V07A 1COTA 2B0ZB 3ZOXA 3CYTI 4H0KA 1H33A 1IRVA 3RMZA 3WFBC 2AI5A 1FHBA 4FB1A 2PCCB 1C7MA 1H9XA 4KMGA 3O5CA 1H31B 1N90A 1NIRA 4EIFA 3ZCFA 3MK7C 1H31A 2CA3B 5KKZB 1CTYA 4JCGA 1QKSA 1NMIA 2D0WA 1L9BC 2LITA 1PP9D 2A06D 1A8CA 1YEAA 4GEDB 3VMAA 1EZVD 2ZOOA 4WQBA 3L75D 1BE3D 1CHJA 1CSVA 4PJ0V 4AALA 3ZBMA 5B5EV 1E29A 1QL4A 1N9CA 4UB8V 3CP5A 1QL3A 3C2CA 1N50A 3NBTA 4GYDA 4O1QA 4P4QB 3H1ID 1SQPD 3H1JD 4WQ8A 2N18B 1HZUA 1AOFA 1A56A 1CXCA 2GC4D 1CRIA 2CXBA 2Y0EA 5DJQC 1NNOA 2QJPB 2YQBA 2CE0A 2BH4X 1OAEA 2QG4A 5DFSA 2GC7D 1U75B 1EB7A 1YCCA 2IBZD 451CA 2RN0A 2B10B 4QAOA 1CRGA 1DW0A 2FYUD 3PXTA 1I5TA 1KB9D 1I8PA 1KX7A 2Q3EA 4PWAA 4O1WA 1K3HA 3H1HD 3JBTB 1W2LA 1C2NA 3A0BV 1LMSA 1CYJA 3PXWA 2L4DA 3HQ6A 2OZ1B 2Y0CA 2GB8B 4PW9B 4MU8A 5TISV 5GTIV 1RZ6A 3OA8B 1NU1D 2N3YA 4Q5PA 1CRYA 3L4MA 1KV9A 2N3BA 4EIDA 4FA5A 1CNOA 1CIGA 5KAFV 3VYMA 3OA8A 1CC5A 1GKSA 5IY51 1ZZHA 1GQ1A 1YEBA 1NTKD 2RMZA 3L73D 1KYOD 1L0LD 1KYOW 3L72D 3DMIA 1N15A 3PRJA 4RSZA 1I8OA 1CTZA 2C8SA 5CIHB 4A7PA 5KLVD 3CX5W 1PPJD 5KLIB 2QJYB 3PLNA 3TF5A 1M70A 1CRCA 4L1QA 2ZBOA 4EDFA 5B66V 3SWSA 1GU2A 4FA9A 2CA4B 4XYDB 2N9IA 3WUIA 3OCDA 2BCCD 1QYZA 2D0SA 3PXSA 1BL9A 5C0ZA 3CXHD 1HJ4A 3CXHW 1CRHA 1DW1A 1CYIA 2AXTV 5B6QA 1HJ3A 1S5LV 2DGEA 1R0QA 1E8EA 4D6TD 1W5CT 1MG2D 1QN2A 4UB6V 1NMLA 5AURA 3FWLA 1GDVA 4AANA 2QJKB 1DVVA 2O3JA 3NWVA 2GIWA 2N9YB 1CIHA 1IZL0 4WQCA 5C9MA 1I55A 3VRDA 3KHUA 1CIEA 3ZOOA 1AYGA 4EICA 1SQQD 1I6EA 3TDKA 1F1FA 2C1VA 4EIEA 2BGVX 1HCMA 1CRJA 3VNWA 1KIBA 1IQCA 1FI3A 3SJLA 1HJ5A 1YICA 2BH5X 3HQ9A 1C52A 2C1UA 4Y5RA 4AAOA 3PHLA 3H1KD 3WFEC 1YNRA 1C6OA 2ZXYA 5H2FV 2ZZS1 4YE1A 4FA4A 1IO3A 1FI9A 3WU2V 3WFDC 1CHHA 2N18C 5GTHV 1WEJF 2FWLA 1YFCA 1LC1A 4WQDA 4N0KA 3DP5A 3HQ8A 3TGUD 1C6RA 1MG3D 4WQAA 1CCRA 3ZIYA 1B7VA 1C6SA 4LJIA 5DF5A 1SQXD 3L4OA 2PCBB 1M6ZA 1L9JC 2BLFB 1NTMD 2BPBB 3RLMA 1LS9A 3SXTA 1HROA 3L74D 4L3HA 3ITKA 155CA 4WQ7A 5CIEB 2DVHA 2FRCA 3CX5D 2C2CA 5TJHA 1FI7A 4FA1A 3GW6A 1M60A 4WQEA 1GJQA 1CO6A 2CE1A 3MK7B 2YCCA 3O1YA 1ZRTD 1CSXA 1H1OA 4J20A 1C2RA 2L91A 2VHDA 3BCCD 3OCDB 1E2RA 1FCDC 1HRCA 1DT1A 5KAIV 2C1DA 4H0JA 1U74B 2HV4A 3A0HV 4FAVA 1KB0A 4XXLA 2JWAA 1FOCA 1DIQC 1CCHA 1CXAA 3L70D 2YK3A 1SQBD 5CIFB 2B12B 1GIWA 1CSWA 3TYIA 1CEDA 2C9XB 1RZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTJ A;  1BGY D;  2PAC A;  3KZI V;  1CIF A;  5DJQ B;  3CWB D;  1JDL A;  2ZON G;  1CSU A;  5CIB B;  1DW3 A;  1P84 D;  2I8F A;  1AOQ A;  2Y0D A;  1DW2 A;  1KX2 A;  4WQ9 A;  1VYD A;  3RN0 A;  5CYT R;  1F1C A;  351C A;  3NBS A;  1K3G A;  1RAP A;  2KNC B;  2KS1 A;  4PD4 D;  3M97 X;  4IL6 V;  4V2K A;  1WVE C;  2BCN B;  3L71 D;  2MHM A;  1DVH A;  3ZOW A;  1S6V B;  1C75 A;  2FYN B;  1A2S A;  1H32 B;  3PTZ A;  2ORL A;  5CIC B;  1HH7 A;  4K3I A;  5CID B;  2K9J B;  4AX3 A;  3X39 A;  1I54 A;  1IRW A;  1H32 A;  4U3F D;  2JQR A;  1MZ4 A;  2EXV A;  1LC2 A;  3PH2 B;  1RAQ A;  2N9J A;  3O0R C;  2JTI B;  1L0N D;  2LIR A;  2B4Z A;  4L3G A;  2YIU B;  3O20 A;  2B11 B;  5EXQ A;  1FJ0 A;  5CIG B;  3A9F A;  1BCC D;  1DII C;  3WC8 A;  3WFC C;  3CU4 A;  1SQV D;  1H9Y A;  1ETP A;  1LFM A;  3RN1 A;  1I6D A;  2OZ1 A;  1AKK A;  2V08 A;  2MTA C;  3SVW A;  3GG2 A;  1J3S A;  2XTS B;  1CYC A;  1YTC A;  2AIU A;  3H1L D;  1CHI A;  5E79 V;  3ORV A;  1YIQ A;  1COR A;  2C1D B;  3DR0 A;  3HQ7 A;  1HZV A;  3SLE A;  1NTZ D;  4NFG B;  1OCD A;  3ZOY A;  1H33 B;  4DY9 A;  4AAM A;  4RJT A;  4FAN A;  2V07 A;  1COT A;  2B0Z B;  3ZOX A;  3CYT I;  4H0K A;  1H33 A;  1IRV A;  3RMZ A;  3WFB C;  2AI5 A;  1FHB A;  4FB1 A;  2PCC B;  1C7M A;  1H9X A;  4KMG A;  3O5C A;  1H31 B;  1N90 A;  1NIR A;  4EIF A;  3ZCF A;  3MK7 C;  1H31 A;  2CA3 B;  5KKZ B;  1CTY A;  4JCG A;  1QKS A;  1NMI A;  2D0W A;  1L9B C;  2LIT A;  1PP9 D;  2A06 D;  1A8C A;  1YEA A;  4GED B;  3VMA A;  1EZV D;  2ZOO A;  4WQB A;  3L75 D;  1BE3 D;  1CHJ A;  1CSV A;  4PJ0 V;  4AAL A;  3ZBM A;  5B5E V;  1E29 A;  1QL4 A;  1N9C A;  4UB8 V;  3CP5 A;  1QL3 A;  3C2C A;  1N50 A;  3NBT A;  4GYD A;  4O1Q A;  4P4Q B;  3H1I D;  1SQP D;  3H1J D;  4WQ8 A;  2N18 B;  1HZU A;  1AOF A;  1A56 A;  1CXC A;  2GC4 D;  1CRI A;  2CXB A;  2Y0E A;  5DJQ C;  1NNO A;  2QJP B;  2YQB A;  2CE0 A;  2BH4 X;  1OAE A;  2QG4 A;  5DFS A;  2GC7 D;  1U75 B;  1EB7 A;  1YCC A;  2IBZ D;  451C A;  2RN0 A;  2B10 B;  4QAO A;  1CRG A;  1DW0 A;  2FYU D;  3PXT A;  1I5T A;  1KB9 D;  1I8P A;  1KX7 A;  2Q3E A;  4PWA A;  4O1W A;  1K3H A;  3H1H D;  3JBT B;  1W2L A;  1C2N A;  3A0B V;  1LMS A;  1CYJ A;  3PXW A;  2L4D A;  3HQ6 A;  2OZ1 B;  2Y0C A;  2GB8 B;  4PW9 B;  4MU8 A;  5TIS V;  5GTI V;  1RZ6 A;  3OA8 B;  1NU1 D;  2N3Y A;  4Q5P A;  1CRY A;  3L4M A;  1KV9 A;  2N3B A;  4EID A;  4FA5 A;  1CNO A;  1CIG A;  5KAF V;  3VYM A;  3OA8 A;  1CC5 A;  1GKS A;  5IY5 1;  1ZZH A;  1GQ1 A;  1YEB A;  1NTK D;  2RMZ A;  3L73 D;  1KYO D;  1L0L D;  1KYO W;  3L72 D;  3DMI A;  1N15 A;  3PRJ A;  4RSZ A;  1I8O A;  1CTZ A;  2C8S A;  5CIH B;  4A7P A;  5KLV D;  3CX5 W;  1PPJ D;  5KLI B;  2QJY B;  3PLN A;  3TF5 A;  1M70 A;  1CRC A;  4L1Q A;  2ZBO A;  4EDF A;  5B66 V;  3SWS A;  1GU2 A;  4FA9 A;  2CA4 B;  4XYD B;  2N9I A;  3WUI A;  3OCD A;  2BCC D;  1QYZ A;  2D0S A;  3PXS A;  1BL9 A;  5C0Z A;  3CXH D;  1HJ4 A;  3CXH W;  1CRH A;  1DW1 A;  1CYI A;  2AXT V;  5B6Q A;  1HJ3 A;  1S5L V;  2DGE A;  1R0Q A;  1E8E A;  4D6T D;  1W5C T;  1MG2 D;  1QN2 A;  4UB6 V;  1NML A;  5AUR A;  3FWL A;  1GDV A;  4AAN A;  2QJK B;  1DVV A;  2O3J A;  3NWV A;  2GIW A;  2N9Y B;  1CIH A;  1IZL 0;  4WQC A;  5C9M A;  1I55 A;  3VRD A;  3KHU A;  1CIE A;  3ZOO A;  1AYG A;  4EIC A;  1SQQ D;  1I6E A;  3TDK A;  1F1F A;  2C1V A;  4EIE A;  2BGV X;  1HCM A;  1CRJ A;  3VNW A;  1KIB A;  1IQC A;  1FI3 A;  3SJL A;  1HJ5 A;  1YIC A;  2BH5 X;  3HQ9 A;  1C52 A;  2C1U A;  4Y5R A;  4AAO A;  3PHL A;  3H1K D;  3WFE C;  1YNR A;  1C6O A;  2ZXY A;  5H2F V;  2ZZS 1;  4YE1 A;  4FA4 A;  1IO3 A;  1FI9 A;  3WU2 V;  3WFD C;  1CHH A;  2N18 C;  5GTH V;  1WEJ F;  2FWL A;  1YFC A;  1LC1 A;  4WQD A;  4N0K A;  3DP5 A;  3HQ8 A;  3TGU D;  1C6R A;  1MG3 D;  4WQA A;  1CCR A;  3ZIY A;  1B7V A;  1C6S A;  4LJI A;  5DF5 A;  1SQX D;  3L4O A;  2PCB B;  1M6Z A;  1L9J C;  2BLF B;  1NTM D;  2BPB B;  3RLM A;  1LS9 A;  3SXT A;  1HRO A;  3L74 D;  4L3H A;  3ITK A;  155C A;  4WQ7 A;  5CIE B;  2DVH A;  2FRC A;  3CX5 D;  2C2C A;  5TJH A;  1FI7 A;  4FA1 A;  3GW6 A;  1M60 A;  4WQE A;  1GJQ A;  1CO6 A;  2CE1 A;  3MK7 B;  2YCC A;  3O1Y A;  1ZRT D;  1CSX A;  1H1O A;  4J20 A;  1C2R A;  2L91 A;  2VHD A;  3BCC D;  3OCD B;  1E2R A;  1FCD C;  1HRC A;  1DT1 A;  5KAI V;  2C1D A;  4H0J A;  1U74 B;  2HV4 A;  3A0H V;  4FAV A;  1KB0 A;  4XXL A;  2JWA A;  1FOC A;  1DIQ C;  1CCH A;  1CXA A;  3L70 D;  2YK3 A;  1SQB D;  5CIF B;  2B12 B;  1GIW A;  1CSW A;  3TYI A;  1CED A;  2C9X B;  1RZ5 A; 
#chains in the Genus database with same CATH topology
 1BGY D;  4QMA A;  3WUU A;  1CIF A;  4ZMD A;  3HRN A;  1NTM K;  1GZL A;  1Z56 A;  1WMK A;  3H1K E;  2OAR A;  5CIB B;  2OTJ P;  4JYC A;  2YO2 A;  2V7Q J;  2I8F A;  4O9B A;  3CL3 D;  4WQ9 A;  4PJ0 E;  3VP9 A;  1VYD A;  3RN0 A;  4I6M C;  1JM0 A;  2YXR B;  3JCU H;  3C8V A;  3R2P A;  4U3F J;  1SQB G;  1LJ2 A;  1RAP A;  3M97 X;  4Y28 J;  1WVE C;  3Q1M A;  4OVN F;  2K37 A;  1DVH A;  2YO3 A;  1NTM E;  2W27 A;  3RK2 B;  2FYN B;  2WQY C;  4XFJ A;  1QL2 A;  1H32 B;  2JP3 A;  3GHG C;  4EI2 A;  3B5N D;  2IFM A;  5CIC B;  4K3I A;  3CWB G;  1NKZ B;  3CCV P;  1EDJ A;  1H32 A;  1BCC J;  1PPJ E;  1M1J C;  2JQR A;  2Z5H A;  4H13 C;  1EXJ A;  4HH2 A;  3CPW O;  1NOH A;  4NPD A;  4DJG A;  1JEK A;  5CCG A;  1EXI A;  2JTI B;  3H1L J;  2B4Z A;  4ZKP A;  2B11 B;  3A9F A;  5AW7 B;  1SQV D;  3RN1 A;  2N1T D;  2R44 A;  2V08 A;  1HBW A;  2E76 C;  3AE2 C;  4XE5 B;  1N7S A;  2KSE A;  1J3S A;  1T2K D;  2B9B A;  2AXC A;  1K8A Q;  4U3F G;  3D6Z A;  2B87 B;  1R5L A;  1VQ6 P;  1NTZ D;  3HUS A;  2IX7 C;  4AAM A;  4YXD C;  3AE4 C;  3FXD A;  3ZOX A;  3L74 G;  1RY3 A;  1IRV A;  2M5A A;  1BCC G;  2AI5 A;  3M0D A;  1FDO A;  1P84 E;  2M0B A;  3P7K A;  3O5C A;  1QVF O;  4EIF A;  4H0L C;  5KAI E;  3ZCF A;  3MK7 C;  2D0W A;  1L9B C;  3CXH I;  1PP9 D;  1L0N K;  1E5W A;  1YEA A;  3H1I J;  2C9L Y;  3H1J J;  2KLV A;  3L71 J;  3L75 D;  3RL0 g;  1CHJ A;  3Q2Y A;  4PV1 C;  2KP8 A;  4PJ0 V;  4L73 A;  3V5B A;  4LC1 A;  4HKZ H;  1FJK A;  3KZI E;  4BXL A;  5AW8 B;  2E74 D;  3NBT A;  2FBW C;  2Q9I A;  2WSF J;  1HZU A;  2BAS A;  1RH5 B;  1AV1 A;  1L0N E;  2SPZ A;  1P84 I;  1GK6 A;  2QJP B;  1J1E B;  1Q2N A;  4NPF X;  2A06 G;  2YMY A;  2FKW B;  1WRG A;  1GW3 A;  2QG4 A;  1MUU A;  2IDB A;  1U75 B;  1EZV G;  3VMY A;  2IBZ D;  1NU1 J;  2B10 B;  1VQ4 P;  1NAF A;  4IL6 E;  2YKO A;  1M90 Q;  2NPS D;  3P32 A;  3FXE A;  1HF9 A;  1KX7 A;  1NHL A;  4PWA A;  3L73 J;  4O1W A;  1K3H A;  1YHQ P;  5TIS H;  1KQL A;  3CXH H;  3L72 J;  1LMS A;  3T97 A;  1OVR A;  1RF1 A;  5APX A;  3EFG A;  2OZ1 B;  3H1I G;  2HYN A;  5TIS V;  3H1J G;  5GTH E;  3RK2 C;  3L71 G;  1RE4 A;  5KLV J;  2PP6 A;  2N3B A;  3VYM A;  1GKS A;  1ZZH A;  2Q3I A;  1GQ1 A;  5APV A;  1KYO D;  1Q90 D;  1KYO W;  4R4M A;  3AE1 C;  3E1R A;  1I8O A;  5CCG C;  2C8S A;  1S1C X;  5CIH B;  3VTP C;  1T3U A;  1NH4 A;  1OW8 A;  4WY4 B;  3TF5 A;  3CCJ P;  4WY4 A;  3R4Y A;  2D2C B;  2XND H;  1FAV A;  5AVW B;  5E79 E;  1SFC B;  2QIW A;  1OMI A;  3I56 P;  4K35 A;  1YJ9 P;  3OCD A;  1SFC A;  1QYZ A;  2FYU K;  5DJT B;  2A45 I;  3L73 G;  1BL9 A;  1OXZ A;  3L72 G;  1IK7 A;  1DW1 A;  2KI7 B;  1VQN P;  1PFI A;  2QVA A;  3L36 A;  1VQ9 P;  4OWF A;  2ZAE B;  1E8E A;  5KLV G;  2E42 A;  4JF7 A;  1ZOY C;  1W5C T;  1QN2 A;  4HJG H;  3EQ2 A;  1PZQ A;  4OGQ D;  1FZE A;  1DEB A;  1SP4 A;  1NTK K;  3G6E P;  1JY3 P;  1L0L K;  1IZL 0;  1AVY A;  2FYU E;  3IAO A;  2HOD A;  2ZT9 D;  1ZME C;  3VRD A;  3H1H E;  3H1K J;  1W2B O;  1SQQ D;  2JR8 A;  5B5E E;  2C1V A;  4EIE A;  2BGV X;  1KD1 Q;  1CRJ A;  1FBM A;  1KIB A;  2W8Z A;  1IQC A;  3AE6 C;  1H0T A;  1YIC A;  3Q5R A;  1NO4 A;  3AE7 C;  1NTK E;  2KNC A;  3OJA B;  1M56 D;  3A0B H;  4H44 D;  3H1L E;  1GMJ A;  1L0L E;  1FS0 E;  2WT7 B;  1C6O A;  4C7N B;  5H2F V;  2XZR A;  1K73 Q;  2HFE D;  4YE1 A;  1NTM J;  2KZJ A;  2WSC H;  4C7N A;  1JTH B;  3WFD C;  1CHH A;  5GTH V;  1KIL E;  1OIP A;  1LC1 A;  4N0K A;  3FX0 A;  3CLQ A;  1URQ A;  1C6R A;  1CCR A;  3ZIY A;  1J1E C;  2QJP C;  1OX3 A;  4N78 E;  1SQX D;  3L4O A;  4GT1 A;  2M3B A;  3KYQ A;  3VYI A;  1M6Z A;  1KIL A;  3S9O A;  1HJB A;  1HTL C;  1IZN B;  3RLM A;  3M9B A;  3SXT A;  2JO1 A;  3P8M C;  3L74 D;  2W90 A;  1VQ8 P;  4IOI H;  3U1A A;  3H1K G;  2WIT A;  3CC2 P;  1QEX A;  2GUV A;  1RE4 C;  1CO6 A;  3N7N A;  1H1O A;  4J20 A;  4D6T E;  2VHD A;  3CCU P;  3A0H H;  3CCR P;  3E1I A;  1S5L H;  4C46 A;  3A0H V;  1L4A A;  1NTM G;  2V7Q H;  3C1L A;  5K5G B;  2M8R A;  4XXL A;  1PGQ A;  2JWA A;  2FXM A;  3JSV C;  2E43 A;  4RKU J;  1FOC A;  4I1L A;  1S72 P;  4WY4 C;  2K3R A;  4N3Y B;  2UWJ E;  1JNM A;  2GA1 A;  5CIF B;  1NU1 K;  1Q81 Q;  1GW4 A;  2D2C C;  5AW4 B;  5APS A;  1OZH A;  1RZ5 A;  1OVU A;  2FXO A;  1SFC C;  1YI2 P;  3RBZ A;  2Q7C A;  1RQV A;  2KK7 A;  3MUD A;  1JCD A;  3G71 P;  5AW2 B;  2RKL A;  2Y0D A;  4UB6 E;  2XKM A;  1KX2 A;  4EYY Q;  5APT A;  2HR3 A;  1LTI C;  4AQR D;  1IFN A;  1NU1 E;  4W80 A;  3A3Y B;  2OGU A;  3I55 P;  3L71 D;  5KJ7 A;  3WU2 H;  3ZOW A;  1A2S A;  1L0N J;  2IFN A;  3PTZ A;  2ORL A;  1FJP A;  5CID B;  2K9J B;  4AX3 A;  3CX5 E;  2QEX P;  5BU5 A;  2K9J A;  1LC2 A;  1N73 B;  3JCU E;  2CPB A;  1ZRT E;  4H13 D;  1BDC A;  1N73 A;  3O0R C;  1DIP A;  2LIR A;  1FZG A;  1VQM P;  3CI9 A;  1U7J A;  3WFC C;  3CCM P;  1H9Y A;  1ETP A;  2ZJS E;  2P67 A;  1I6D A;  1X0T A;  5GTI E;  1AKK A;  1LTJ B;  4DOJ A;  1X9V A;  2WSE J;  1FZF A;  3SVW A;  3GG2 A;  2E76 D;  5AVS B;  1YTC A;  3L70 E;  1S2E A;  2WPV B;  1GU5 A;  1COR A;  2C1D B;  1LNQ A;  3DR0 A;  5AVZ B;  2BEQ D;  3VP8 A;  1BGY E;  3CX5 I;  4NFG B;  1SS1 A;  3ABV C;  1L0N G;  4FAN A;  1R8E A;  4ASV A;  4PV1 B;  5CBN A;  1KV4 A;  1COT A;  1SVF A;  1PGO A;  3JC2 2;  3CYT I;  4H0K A;  3WFB C;  3VOP A;  1FHB A;  2PCC B;  1C7M A;  1H9X A;  1H31 B;  1PGP A;  1NIR A;  2P10 A;  2WSF H;  2XV5 A;  5CMZ A;  1H31 A;  1KB9 H;  4JCG A;  1QKS A;  4H0L D;  3OW2 O;  2LIT A;  3LW5 J;  1FU1 A;  1A8C A;  1FZC B;  1N2D C;  1KFM A;  3G4S P;  1SQV K;  2A45 G;  1FZC A;  1BE3 D;  2OTK E;  3TSI A;  3CP5 A;  3SFE C;  1KZU B;  1N50 A;  1Y8A A;  4GYD A;  1A02 F;  5APY A;  3B5N A;  2CK3 H;  2FYU J;  1SQP D;  4WQ8 A;  1NTZ K;  2Y0E A;  2CXB A;  4IFD K;  2E5T A;  3MUD C;  1N7L A;  3H1H J;  2ZVN B;  3M91 A;  4BWN A;  1J2J B;  1SQV E;  2BH4 X;  2R3C A;  4CPG A;  2GC7 D;  1EC5 A;  2RN0 A;  1CW5 A;  1JB0 J;  1G1J A;  1DW0 A;  1I5T A;  3D71 A;  5KTB A;  1I8P A;  4N6J A;  2Y9Z A;  4KT0 J;  1NTK J;  2WPS A;  5KJ7 C;  1DD3 A;  1L0L J;  4GDO A;  1CYJ A;  4ZNC A;  1GL2 B;  2GB8 B;  1NTZ E;  5KAF H;  2DW3 A;  5GTI V;  1N7S B;  1RZ6 A;  2N3Y A;  1GL2 A;  1CRY A;  1IC2 A;  4EID A;  5KAF V;  3RK2 D;  1T3J A;  3RK3 E;  3VN0 A;  5AVV B;  1X8Y A;  1USD A;  3P8C D;  2YMK A;  3RK3 B;  1N73 C;  1CTZ A;  3QH9 A;  2FYU G;  2O1J A;  3HUS B;  4A7P A;  2IYO A;  4GOD A;  5CCG D;  1WT6 A;  2K88 A;  1PPJ D;  2MJZ A;  3W67 A;  3W68 A;  3H1H G;  2M5A B;  3PLN A;  1M70 A;  2Z5I A;  4GIF A;  2ZYA A;  4L1Q A;  2KSJ A;  3AEF C;  4EDF A;  2J58 A;  1HH0 A;  4TT3 H;  3TK1 A;  3L75 E;  1LTJ C;  3CCE P;  4D6T J;  1G2C A;  1BSN A;  2BCC D;  1HJ0 A;  3SWF A;  1NTK G;  1LWU B;  3CXH D;  1ZN5 A;  3H1L G;  3CXH W;  1L0L G;  4PD4 E;  1EDK A;  2H88 C;  5AW9 B;  1LWU A;  2E75 B;  4PJ0 H;  3PJS K;  3WUV A;  1KTM A;  1GDT A;  2WZ7 A;  2W83 C;  1IFD A;  2QJK B;  1DVV A;  2IBZ E;  3H6P A;  4W7Y A;  4WQC A;  1HWT C;  3U1C A;  2WWW A;  5C9M A;  1ZXG A;  1YIJ P;  2OTL P;  4I2L C;  4Y99 B;  1FZC C;  2NPS A;  1J1D B;  1FI3 A;  3SSU A;  4JBZ A;  2WPR A;  4UB8 E;  1FE6 A;  2KXP B;  2BH5 X;  4D6T G;  1RHZ B;  1C52 A;  4PD4 I;  4AAO A;  2YKQ A;  1KYO E;  1IFJ A;  2JKV A;  3B5N C;  3T97 B;  1RF1 B;  2ZZS 1;  1ZR4 A;  2LKM A;  2FWL A;  3Q5P A;  4WQD A;  2PGD A;  2IBZ I;  3TGU D;  1C6S A;  4WVZ A;  4LJI A;  3S1K A;  1MFT A;  2PCB B;  2QM8 A;  1K9M Q;  5AW6 B;  3ZDM A;  2BPB B;  3HTK A;  3BCC J;  1JY2 N;  155C A;  5CIE B;  1AFO A;  3BRT B;  3FGA D;  2AEM A;  1FI7 A;  2ZYD A;  2GM4 A;  2KOG A;  5AVT B;  3MGN A;  1GJQ A;  1GL2 C;  1P84 H;  3CC4 P;  1SQQ K;  1YQ3 C;  2JEE A;  1H8A A;  2H43 A;  2KIK A;  1N7S C;  1C2R A;  3NFQ A;  5KAI H;  4B86 A;  1KYO I;  3OCD B;  2R5D A;  3L70 J;  1NU1 G;  1JY2 O;  2JJL A;  5KAI V;  3PP5 A;  2W6J H;  4H0J A;  1BGY J;  2WMM A;  3RK3 C;  3A5T A;  4FAV A;  1DEE G;  1KB0 A;  2ZFC A;  3HUS C;  4L76 A;  1LTG C;  1K05 A;  1CXA A;  1SQB D;  1SQQ E;  3KZI H;  5AVX B;  1T6A A;  1VQK P;  3M0D C;  4WY4 D;  3SWY A;  1CED A;  2C9X B;  1CTJ A;  3KZI V;  2PAC A;  3BAS A;  2D2C D;  2HOD B;  3CWB D;  1SFC D;  1VQO P;  4RO0 A;  1SLQ A;  1JDL A;  1LWU C;  3WUT A;  1KQS O;  1H0T B;  2JWD A;  2E75 C;  5CYT R;  1F1C A;  1OVV A;  1VDF A;  351C A;  3L70 G;  3NBS A;  3AED C;  1K3G A;  1OFC X;  4HYT B;  2RH0 A;  1LP1 A;  2KNC B;  2KS1 A;  1SQX E;  4IL6 V;  5H2F H;  2MKV A;  1PL5 A;  2BCN B;  3SFD C;  2QJK C;  1BGY G;  3AEB C;  2A45 H;  2WSE H;  5GTH H;  5AVY B;  3V4Q A;  3X39 A;  1URQ B;  1I54 A;  3BAT A;  4WB4 A;  4U3F D;  1SQV J;  4Y99 C;  3PH2 B;  1LT9 B;  1KIL B;  1J1D C;  1IO4 A;  1RAQ A;  2YNY A;  2N9J A;  4R4L A;  1LT9 A;  3USS A;  1N86 A;  3RL0 B;  1S4X A;  4L3G A;  2FFD B;  5EXQ A;  4C7R A;  1FJ0 A;  1BCC D;  2ITA A;  2FY8 A;  1LFM A;  4L74 A;  2FFD A;  1NTZ J;  1RF1 C;  3CC7 P;  3O8Z A;  2ZXX A;  5E79 H;  2H7H A;  3G9R A;  1CYC A;  2C0W A;  5AW0 B;  1OWA A;  2AIU A;  3H1L D;  3RBX A;  5E79 V;  3ORV A;  3LW5 H;  5AW5 B;  1HZV A;  1L4A B;  3C9I A;  1YBK A;  1Q86 Q;  2YIU C;  4RJT A;  4YXW H;  2V07 A;  5M1B A;  2Q6Q A;  1U57 A;  1PIX A;  3RMZ A;  5B66 E;  1EDL A;  1SQV G;  4FB1 A;  4KMG A;  5AVU B;  3L75 J;  1PV3 A;  1N90 A;  3D6Y A;  1CTY A;  1M1K Q;  1NMI A;  2O01 J;  4W7Z A;  2FXP A;  1USE A;  2VRS A;  2A06 D;  2AXT E;  5CHX A;  5B5E H;  4IFM A;  1NTZ G;  3MP7 B;  1EZV D;  2ZOO A;  4WQB A;  1CSV A;  5CJ4 A;  3ZBM A;  5B5E V;  3HD7 B;  1VF5 B;  3OAK A;  1N9C A;  3HD7 A;  1FDM A;  3C2C A;  2WPQ A;  4O1Q A;  4IL6 X;  3H1I D;  3L4F A;  3H1J D;  1D7M A;  2N18 B;  1A56 A;  1CXC A;  3AEA C;  3FWN A;  2GC4 D;  1VQ5 P;  1NNO A;  2YQB A;  1M1J A;  1QGK B;  3MIW A;  1OAE A;  5DFS A;  1EB7 A;  451C A;  3L75 G;  3H32 B;  1HGV A;  4QAO A;  1KB9 D;  3H32 A;  4K3A A;  2LXB A;  2Q3E A;  3TNU B;  3BCC E;  1W2E A;  1QLE D;  1RF0 A;  1W2L A;  2HPC B;  3TNU A;  1ZV8 A;  5KJ7 D;  1X79 B;  4MU8 A;  2E5Y A;  2P1J A;  1U7M A;  1NU1 D;  2HPC A;  3L4M A;  1OW7 A;  1KV9 A;  4FA5 A;  1CSB A;  1QVG O;  4U7J A;  2QA4 P;  2AEF A;  1S9K D;  1URQ C;  3L73 D;  3II6 A;  1UIX A;  3L72 D;  3HE5 B;  3IF4 A;  2IBZ G;  1LT9 C;  1TU3 F;  4L75 A;  1KIL C;  1AA0 A;  4JYB A;  3HE5 A;  4DZO A;  4GOF A;  4YPC A;  5KLV D;  3CX5 W;  1SQP K;  1YJN P;  3RL0 C;  5KLI B;  2FFD C;  2QJY B;  2YXQ B;  1FC2 C;  1M57 D;  1CRC A;  2ZBO A;  5CCH A;  5B66 V;  3SWS A;  3F89 A;  1BE3 E;  1DD4 A;  2N9I A;  3WUI A;  1JMM A;  4EOT A;  3A7O A;  3PXS A;  1AJY A;  2KB7 P;  2WVR A;  1RE3 A;  2H8P D;  1IK9 A;  2AXT V;  1KQF B;  1SQP E;  4UB6 H;  1L4A C;  1E79 H;  1FOS F;  1MG2 D;  2JDI H;  4UB6 V;  5AUR A;  1SQQ J;  2CPS A;  3B4S A;  1GDV A;  2KLU A;  3M06 A;  4PV1 D;  1NJI Q;  3NWV A;  3GLM A;  3B5N B;  2GIW A;  2XDJ A;  3B8E B;  1PGJ A;  1CIH A;  1JY3 N;  1ZLL A;  3EWK A;  2OQQ A;  2KZI A;  1XTC C;  4HB1 A;  1I55 A;  2G8Y A;  2W6A A;  2QM7 A;  1CIE A;  3CX5 H;  1CI6 B;  2N9B A;  4EIC A;  2BEZ F;  4AYC A;  1I6E A;  1F1F A;  2QSI A;  1VL2 A;  5AVQ B;  3VNW A;  1CI6 A;  3SJL A;  1ZP0 C;  5APW A;  3IR9 A;  3HQ9 A;  1W5C E;  3HD7 C;  1JY3 O;  2N1T B;  4Y5R A;  2AEJ A;  3PHL A;  3H1K D;  1HGZ A;  1SQX J;  1VF5 C;  3CD6 P;  1YNR A;  2ZXY A;  3P8C E;  1H88 A;  1KMI Z;  2K9Y A;  2N1T A;  4FA4 A;  3D70 A;  5GTI H;  3L74 J;  2N18 C;  3HE4 B;  1WEJ F;  1JO5 A;  1K04 A;  3HE4 A;  3D0W A;  3HQ8 A;  1SQQ G;  3AEG C;  3A2A A;  1AQT A;  1T8Z A;  3RGU A;  1L9J C;  1JOC A;  1NTM D;  1ZW0 A;  5DJU B;  1HUC A;  1LS9 A;  1HRO A;  2BCC E;  4L3H A;  2HG5 D;  3Q3D A;  1RF0 C;  2DVH A;  5AW1 B;  1M8O B;  5TIS E;  3CCS P;  3CXH E;  4ZKU A;  3GMA A;  2C2C A;  3GW6 A;  1PP9 E;  1YQ4 C;  3QWO C;  5AVR B;  3AEC C;  2YCC A;  2P7J A;  3O1Y A;  1CSX A;  1MFZ A;  1GL2 D;  2L91 A;  1G2C B;  3IFM A;  1NVO A;  2I8D A;  1E2R A;  1N7S D;  2M3E A;  1FCD C;  3I5C A;  1JMB A;  1SQX G;  1MV8 A;  1AQ5 A;  2B87 A;  2HV4 A;  1YIT P;  3RK3 D;  2E74 B;  4JPZ B;  1LTA C;  3VMX A;  5CCH C;  5KLI C;  2QJY C;  1Y47 A;  3G3Z A;  1GIW A;  2W6B A;  4I7Z B;  3TYI A;  2PRR A;  3V2Q A;  5DJQ B;  3WMM 0;  1RE3 C;  2ZYG A;  2ZON G;  1CSU A;  3KPE A;  1GK4 A;  1KQG B;  1DW3 A;  2IYP A;  1KOR A;  3M0A A;  2OYO A;  1P84 D;  2NPS B;  1AOQ A;  2OYI B;  1DW2 A;  3MTU E;  5APU A;  3NTN A;  4EIJ A;  2PAJ A;  3IN6 A;  4DT0 A;  2OYI A;  1YTZ I;  2E75 D;  3V4W A;  3TGU E;  2YKP A;  4LLH A;  4PD4 D;  4IFF A;  4V2K A;  3K5B A;  2Q1K A;  2MHM A;  2C9N Y;  1S6V B;  1C75 A;  2I1K A;  1BDD A;  1N8R Q;  1HH7 A;  2C0X A;  1IRW A;  2WTY A;  1MZ4 A;  2EXV A;  1SQB K;  2R32 A;  1L2P A;  3V2N A;  3HTK B;  2POH A;  1S3J A;  3LID A;  5H2F E;  1L0N D;  2ZVO B;  3MHV A;  3AE3 C;  2GUS A;  2YIU B;  1NKN A;  3O20 A;  3A0B E;  4YTP C;  3CMA P;  2N1T C;  5CIG B;  1DII C;  3WC8 A;  3CU4 A;  3L37 A;  4BRY B;  2FYN C;  2OZ1 A;  1T2K C;  2MTA C;  4BRY A;  4TLF A;  2XTS B;  3S4R A;  1AVO A;  1SQB E;  1CHI A;  4WWI A;  2O01 H;  1YIQ A;  4MN4 C;  1OW6 A;  1IJD B;  5CJ0 A;  2ZXE B;  3HQ7 A;  3SLE A;  4PD4 H;  1NWQ A;  1GU4 A;  1GTW A;  3GF7 A;  1OCD A;  3ZOY A;  4KHX A;  1H33 B;  4DY9 A;  4OGQ B;  3CWB E;  2B0Z B;  2NRG A;  2XNX A;  4NPE A;  1H33 A;  2IZ0 A;  2R3S A;  2ZT9 B;  1VQ7 P;  1BE3 J;  3V2R A;  4OH8 B;  2Y9Y A;  1Y9B A;  3E7K A;  5BU8 B;  2CA3 B;  5KKZ B;  1G1I A;  1A02 J;  2V4H A;  1MZ9 A;  1SQX K;  1YJW P;  3A0H E;  3V6I A;  2P2U A;  1HVV A;  3BCC G;  4GED B;  1S5L E;  2OYH B;  3VMA A;  1SQP J;  2OYH A;  4AAL A;  4UB8 H;  2O01 N;  4H44 B;  3CCL P;  1E29 A;  1QL4 A;  2E74 C;  4U3F E;  2QRX A;  1LP1 B;  4UB8 V;  1QL3 A;  2KS1 B;  4IL6 H;  1KYO H;  4P4Q B;  3AE9 C;  4I7Z C;  1EDI A;  1AOF A;  2FYZ A;  1CRI A;  3L74 E;  5DJQ C;  1GD2 E;  1ZR2 A;  2CE0 A;  1BCC E;  1R5S A;  5AW3 B;  1DH3 A;  1NAY A;  5BVZ A;  1Q7Y Q;  5CBO A;  2NPS C;  1YCC A;  2J59 M;  2OYI C;  1BE3 G;  1CRG A;  3PXT A;  2FYU D;  4M3L A;  1EQ7 A;  1NGM B;  1IFI A;  3H1H D;  3JBT B;  2WT7 A;  1C2N A;  3A0B V;  1VQL P;  3PXW A;  1IFM A;  2L4D A;  3HQ6 A;  2Y0C A;  3N4X A;  3WU2 E;  1UII A;  4PW9 B;  3KQG A;  1SQP G;  3OA8 B;  4AUW A;  3BRV B;  4Q5P A;  1JTH A;  1FDI A;  4KJM A;  1CNO A;  1CIG A;  3OA8 A;  1CC5 A;  1YTZ T;  5IY5 1;  1JCC A;  4ASW A;  5EFW B;  1YEB A;  3V2P A;  3SWK A;  1NTK D;  2RMZ A;  2K1A A;  1L0L D;  3DMI A;  1URQ D;  1N15 A;  2KYV A;  3PRJ A;  4RSZ A;  2BCC J;  1MKM A;  3AE5 C;  1KIL D;  2A06 E;  2XU6 A;  3RL0 D;  3B71 A;  1PP9 J;  4N78 D;  3TYY A;  1GU2 A;  2R5B A;  2G3A A;  1EZV E;  4FA9 A;  2CA4 B;  4XYD B;  1Q82 Q;  3GF3 A;  2Q5U A;  2D0S A;  5C0Z A;  1HJ4 A;  2LR2 A;  1CZQ A;  2B88 A;  2NZ2 A;  1CRH A;  1CYI A;  4GKG A;  5B6Q A;  1RQU A;  3H1I E;  1HJ3 A;  1S5L V;  2WSS H;  3H1J E;  2DGE A;  3L71 E;  1R0Q A;  4LGD E;  4XA4 A;  4D6T D;  3H25 A;  1L4A D;  1PPJ G;  3U59 A;  4OGQ C;  1NML A;  3FWL A;  3NMD A;  4AAN A;  2O3J A;  2ZT9 C;  2N9Y B;  3GHG B;  1BSH A;  1H89 A;  1KB9 E;  3KDP B;  2H89 C;  2BCC G;  4GOE A;  5KKZ C;  2O1K A;  3KHU A;  3GHG A;  4JQ0 D;  1EZV I;  5KLV K;  3ZOO A;  1M1J B;  1AYG A;  2HLO A;  2I1J A;  2LXC B;  2QE7 H;  4H13 B;  3TDK A;  5APQ A;  3BVH A;  1PP9 G;  3M9Q A;  1HCM A;  2OYH C;  1HJ5 A;  1VQP P;  3CCQ P;  2C1U A;  4DCK A;  4H44 C;  3M9H A;  3TGU J;  1IFP A;  2IZ1 A;  3OA7 A;  1KFN A;  3L35 A;  1S9K E;  2P58 A;  3L73 E;  3HD7 D;  3WFE C;  3L72 E;  1XTG B;  2E76 B;  1VF5 D;  2PFX A;  1FI9 A;  1IO3 A;  3WU2 V;  3KXD A;  5KLV E;  5C39 A;  3VMZ A;  1YFC A;  1LGH B;  1KC8 Q;  3DP5 A;  1MG3 D;  4WQA A;  1B7V A;  5DF5 A;  3MZW B;  2J5U A;  1KB9 I;  3PH0 A;  2KUB A;  1QL1 A;  2BLF B;  1JY2 P;  3UIA A;  1VPC A;  4WQ7 A;  5L8R J;  2FRC A;  3CX5 D;  3AE8 C;  3MD0 A;  1FOS E;  5TJH A;  1LTT C;  4FA1 A;  5B66 H;  2Z4E A;  1M60 A;  4WQE A;  5KAF E;  2WSC J;  3CME P;  1LTJ A;  1QX8 A;  3Q5S A;  4H0L B;  2CE1 A;  3MK7 B;  1ZRT D;  1FZB A;  1NYH A;  3BCC D;  1SQB J;  2B89 A;  3EFF K;  1X22 A;  3TGU G;  1HRC A;  1DT1 A;  1KN7 A;  2C1D A;  4WBA A;  2AXT H;  1LTB C;  1U74 B;  4RES B;  3F5H A;  1S5L X;  1JUN A;  3CWB J;  1DIQ C;  1FZA A;  1CCH A;  3L70 D;  1YYC A;  3LIE A;  3O6Q B;  2IPP A;  3NXS A;  2YK3 A;  3AEE C;  1LTS C;  4Z1M H;  1M7L A;  2B12 B;  1LT1 A;  3O6Q A;  1CSW A;  5CCH D;  2L5G B;  3ITK A;  1DX7 A; 
#chains in the Genus database with same CATH homology
 1CTJ A;  1BGY D;  2PAC A;  3KZI V;  1CIF A;  5DJQ B;  3CWB D;  1JDL A;  2ZON G;  1CSU A;  5CIB B;  1DW3 A;  1P84 D;  2I8F A;  1AOQ A;  2Y0D A;  1DW2 A;  1KX2 A;  4WQ9 A;  1VYD A;  3RN0 A;  5CYT R;  1F1C A;  351C A;  3NBS A;  1K3G A;  1RAP A;  2KNC B;  2KS1 A;  4PD4 D;  3M97 X;  4IL6 V;  4V2K A;  1WVE C;  2BCN B;  3L71 D;  2MHM A;  1DVH A;  3ZOW A;  1S6V B;  1C75 A;  2FYN B;  1A2S A;  1H32 B;  3PTZ A;  2ORL A;  5CIC B;  1HH7 A;  4K3I A;  5CID B;  2K9J B;  4AX3 A;  3X39 A;  1I54 A;  1IRW A;  1H32 A;  4U3F D;  2JQR A;  1MZ4 A;  2EXV A;  1LC2 A;  3PH2 B;  1RAQ A;  2N9J A;  3O0R C;  2JTI B;  1L0N D;  2LIR A;  2B4Z A;  4L3G A;  2YIU B;  3O20 A;  2B11 B;  5EXQ A;  1FJ0 A;  5CIG B;  3A9F A;  1BCC D;  1DII C;  3WC8 A;  3WFC C;  3CU4 A;  1SQV D;  1H9Y A;  1ETP A;  1LFM A;  3RN1 A;  1I6D A;  2OZ1 A;  1AKK A;  2V08 A;  2MTA C;  3SVW A;  3GG2 A;  1J3S A;  2XTS B;  1CYC A;  1YTC A;  2AIU A;  3H1L D;  1CHI A;  5E79 V;  3ORV A;  1YIQ A;  1COR A;  2C1D B;  3DR0 A;  3HQ7 A;  1HZV A;  3SLE A;  1NTZ D;  4NFG B;  1OCD A;  3ZOY A;  1H33 B;  4DY9 A;  4AAM A;  4RJT A;  4FAN A;  2V07 A;  1COT A;  2B0Z B;  3ZOX A;  3CYT I;  4H0K A;  1H33 A;  1IRV A;  3RMZ A;  3WFB C;  2AI5 A;  1FHB A;  4FB1 A;  2PCC B;  1C7M A;  1H9X A;  4KMG A;  3O5C A;  1H31 B;  1N90 A;  1NIR A;  4EIF A;  3ZCF A;  3MK7 C;  1H31 A;  2CA3 B;  5KKZ B;  1CTY A;  4JCG A;  1QKS A;  1NMI A;  2D0W A;  1L9B C;  2LIT A;  1PP9 D;  2A06 D;  1A8C A;  1YEA A;  4GED B;  3VMA A;  1EZV D;  2ZOO A;  4WQB A;  3L75 D;  1BE3 D;  1CHJ A;  1CSV A;  4PJ0 V;  4AAL A;  3ZBM A;  5B5E V;  1E29 A;  1QL4 A;  1N9C A;  4UB8 V;  3CP5 A;  1QL3 A;  3C2C A;  1N50 A;  3NBT A;  4GYD A;  4O1Q A;  4P4Q B;  3H1I D;  1SQP D;  3H1J D;  4WQ8 A;  2N18 B;  1HZU A;  1AOF A;  1A56 A;  1CXC A;  2GC4 D;  1CRI A;  2CXB A;  2Y0E A;  5DJQ C;  1NNO A;  2QJP B;  2YQB A;  2CE0 A;  2BH4 X;  1OAE A;  2QG4 A;  5DFS A;  2GC7 D;  1U75 B;  1EB7 A;  1YCC A;  2IBZ D;  451C A;  2RN0 A;  2B10 B;  4QAO A;  1CRG A;  1DW0 A;  2FYU D;  3PXT A;  1I5T A;  1KB9 D;  1I8P A;  1KX7 A;  2Q3E A;  4PWA A;  4O1W A;  1K3H A;  3H1H D;  3JBT B;  1W2L A;  1C2N A;  3A0B V;  1LMS A;  1CYJ A;  3PXW A;  2L4D A;  3HQ6 A;  2OZ1 B;  2Y0C A;  2GB8 B;  4PW9 B;  4MU8 A;  5TIS V;  5GTI V;  1RZ6 A;  3OA8 B;  1NU1 D;  2N3Y A;  4Q5P A;  1CRY A;  3L4M A;  1KV9 A;  2N3B A;  4EID A;  4FA5 A;  1CNO A;  1CIG A;  5KAF V;  3VYM A;  3OA8 A;  1CC5 A;  1GKS A;  5IY5 1;  1ZZH A;  1GQ1 A;  1YEB A;  1NTK D;  2RMZ A;  3L73 D;  1KYO D;  1L0L D;  1KYO W;  3L72 D;  3DMI A;  1N15 A;  3PRJ A;  4RSZ A;  1I8O A;  1CTZ A;  2C8S A;  5CIH B;  4A7P A;  5KLV D;  3CX5 W;  1PPJ D;  5KLI B;  2QJY B;  3PLN A;  3TF5 A;  1M70 A;  1CRC A;  4L1Q A;  2ZBO A;  4EDF A;  5B66 V;  3SWS A;  1GU2 A;  4FA9 A;  2CA4 B;  4XYD B;  2N9I A;  3WUI A;  3OCD A;  2BCC D;  1QYZ A;  2D0S A;  3PXS A;  1BL9 A;  5C0Z A;  3CXH D;  1HJ4 A;  3CXH W;  1CRH A;  1DW1 A;  1CYI A;  2AXT V;  5B6Q A;  1HJ3 A;  1S5L V;  2DGE A;  1R0Q A;  1E8E A;  4D6T D;  1W5C T;  1MG2 D;  1QN2 A;  4UB6 V;  1NML A;  5AUR A;  3FWL A;  1GDV A;  4AAN A;  2QJK B;  1DVV A;  2O3J A;  3NWV A;  2GIW A;  2N9Y B;  1CIH A;  1IZL 0;  4WQC A;  5C9M A;  1I55 A;  3VRD A;  3KHU A;  1CIE A;  3ZOO A;  1AYG A;  4EIC A;  1SQQ D;  1I6E A;  3TDK A;  1F1F A;  2C1V A;  4EIE A;  2BGV X;  1HCM A;  1CRJ A;  3VNW A;  1KIB A;  1IQC A;  1FI3 A;  3SJL A;  1HJ5 A;  1YIC A;  2BH5 X;  3HQ9 A;  1C52 A;  2C1U A;  4Y5R A;  4AAO A;  3PHL A;  3H1K D;  3WFE C;  1YNR A;  1C6O A;  2ZXY A;  5H2F V;  2ZZS 1;  4YE1 A;  4FA4 A;  1IO3 A;  1FI9 A;  3WU2 V;  3WFD C;  1CHH A;  2N18 C;  5GTH V;  1WEJ F;  2FWL A;  1YFC A;  1LC1 A;  4WQD A;  4N0K A;  3DP5 A;  3HQ8 A;  3TGU D;  1C6R A;  1MG3 D;  4WQA A;  1CCR A;  3ZIY A;  1B7V A;  1C6S A;  4LJI A;  5DF5 A;  1SQX D;  3L4O A;  2PCB B;  1M6Z A;  1L9J C;  2BLF B;  1NTM D;  2BPB B;  3RLM A;  1LS9 A;  3SXT A;  1HRO A;  3L74 D;  4L3H A;  3ITK A;  155C A;  4WQ7 A;  5CIE B;  2DVH A;  2FRC A;  3CX5 D;  2C2C A;  5TJH A;  1FI7 A;  4FA1 A;  3GW6 A;  1M60 A;  4WQE A;  1GJQ A;  1CO6 A;  2CE1 A;  3MK7 B;  2YCC A;  3O1Y A;  1ZRT D;  1CSX A;  1H1O A;  4J20 A;  1C2R A;  2L91 A;  2VHD A;  3BCC D;  3OCD B;  1E2R A;  1FCD C;  1HRC A;  1DT1 A;  5KAI V;  2C1D A;  4H0J A;  1U74 B;  2HV4 A;  3A0H V;  4FAV A;  1KB0 A;  4XXL A;  2JWA A;  1FOC A;  1DIQ C;  1CCH A;  1CXA A;  3L70 D;  2YK3 A;  1SQB D;  5CIF B;  2B12 B;  1GIW A;  1CSW A;  3TYI A;  1CED A;  2C9X B;  1RZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...