3CX5D

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
248
structure length
248
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 248
sequence length 248
chains with identical sequence O
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3cx5D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3cx5D02
1CRHA 1ZRTD 1SQPD 5B6QA 1CORA 5KAFV 2GB8B 2BH4X 1C75A 155CA 4D6TD 1CRGA 1WEJF 1QYZA 3CU4A 3WFDC 1I54A 1FI3A 1FI9A 1FI7A 1COTA 1BE3D 5KAIV 4XYDB 1YIQA 1PPJD 2ZOOA 5KKZB 4RSZA 3NWVA 1RZ6A 2CE0A 5EXQA 1I5TA 1NMIA 5CIEB 2MTAC 1CIHA 1I8PA 2KNCB 4WQBA 3VMAA 3PXWA 4WQAA 3H1ID 1KYOW 1NTKD 1CHHA 3HQ9A 5C9MA 2C9XB 1B7VA 1EZVD 4RJTA 1CRCA 5DFSA 1CYCA 1CTYA 1L0ND 3TF5A 4UB6V 1N90A 3A9FA 3BCCD 2B10B 1QL3A 2PACA 1DW0A 1H31A 2N9YB 1NMLA 4K3IA 1H9XA 2KS1A 2C1DB 3WU2V 2Y0DA 1N50A 4L3GA 3SWSA 1CXCA 2AIUA 1HJ3A 2B0ZB 2CXBA 3DR0A 2BGVX 1RAPA 2N18B 2PCBB 2JWAA 5B5EV 3H1HD 1KB0A 3ITKA 4AANA 1KIBA 4U3FD 3OCDA 1ETPA 3GG2A 2B12B 2N3YA 3ZCFA 3NBSA 1E2RA 1YEAA 1A2SA 1CYIA 4EIEA 1DVVA 3L4MA 1CO6A 4EDFA 1RAQA 1BL9A 1GIWA 1NTMD 1OCDA 4EICA 2LITA 4FANA 1DVHA 1IZL0 2AXTV 2B11B 2YK3A 4AAOA 3JBTB 4FAVA 1CRYA 5C0ZA 2C1DA 2AI5A 4L1QA 1HJ4A 1CSXA 1I6EA 5TJHA 4MU8A 2L91A 3L71D 1J3SA 1I6DA 1MG3D 3OA8A 1CTJA 2ZXYA 3RN1A 2ZBOA 1CTZA 1PP9D 1H33B 5CIDB 1HZUA 3WFCC 2PCCB 3H1JD 4QAOA 1HROA 1FOCA 4H0KA 4J20A 1IRWA 2HV4A 3O5CA 4AX3A 1CEDA 1CC5A 3PXSA 1KV9A 5CYTR 3ZOOA 1M70A 3SJLA 3DMIA 4XXLA 1BGYD 3KZIV 4AAMA 4WQ9A 4WQEA 1CIEA 4GYDA 4FB1A 2GC4D 2XTSB 4UB8V 1DT1A 3O1YA 4FA5A 4N0KA 3L4OA 1I8OA 2ORLA 5CIGB 1L0LD 1H32B 1I55A 1W2LA 2V07A 2QJYB 1GJQA 2FYUD 4O1QA 2QG4A 5CIHB 1FJ0A 1HJ5A 4H0JA 1IRVA 4PD4D 1HH7A 1LMSA 2YIUB 1K3HA 5GTIV 4KMGA 2C1UA 5CICB 2C2CA 3HQ8A 5E79V 1CYJA 2CA3B 451CA 1KX7A 2A06D 4Y5RA 1CXAA 1HRCA 2BH5X 2C8SA 3CX5D 3ZBMA 4V2KA 1NU1D 1IQCA 2JQRA 1A8CA 1YTCA 1OAEA 5DJQC 1IO3A 2CA4B 4JCGA 2BCCD 2BLFB 2QJPB 3H1LD 1SQVD 2OZ1B 1LFMA 3VNWA 3FWLA 4WQ8A 4PWAA 1K3GA 1DW3A 1H32A 351CA 3L70D 4FA9A 3PLNA 2K9JB 3TDKA 3MK7C 1A56A 1C6OA 3HQ6A 3H1KD 1CHJA 3L72D 1U74B 3GW6A 5DF5A 2CE1A 5IY51 3O20A 3L75D 1LC2A 4A7PA 1EB7A 2FYNB 1YEBA 3ZIYA 4EIDA 3ZOYA 3SLEA 3PRJA 4AALA 1C6SA 1M60A 2V08A 3L74D 3O0RC 1FCDC 4WQDA 5KLIB 1FHBA 4DY9A 1NTZD 3WFBC 1SQQD 1CIGA 3RLMA 3RN0A 2N9JA 3X39A 2GC7D 2D0WA 3WFEC 2BCNB 2C1VA 4NFGB 1KYOD 2YQBA 4LJIA 1CRIA 5TISV 3DP5A 1MZ4A 2YCCA 1DIIC 3PXTA 4WQ7A 2IBZD 1H31B 3WC8A 1L9JC 2O3JA 1AOQA 1YCCA 4EIFA 1YICA 3WUIA 2QJKB 1VYDA 1L9BC 1C6RA 1QN2A 1F1FA 4FA4A 2FRCA 1CSVA 5KLVD 3CYTI 1YFCA 2DVHA 2Y0EA 4FA1A 2FWLA 4P4QB 1DW1A 2DGEA 3OCDB 5CIFB 3A0BV 1GDVA 5B66V 1P84D 1E29A 2VHDA 1DIQC 1H9YA 1GKSA 2B4ZA 1H33A 5H2FV 3CWBD 2I8FA 3C2CA 3VRDA 2EXVA 1LC1A 2L4DA 1H1OA 5CIBB 3SXTA 3HQ7A 3SVWA 1CCRA 1ZZHA 3L73D 5GTHV 1QL4A 2N18C 1CNOA 1SQBD 2RMZA 3PH2B 1QKSA 2N9IA 3TGUD 2D0SA 1N15A 4WQCA 1S5LV 1RZ5A 4L3HA 3ZOWA 2N3BA 3RMZA 3CXHD 2ZZS1 4PW9B 1BCCD 4O1WA 1YNRA 3PTZA 3ORVA 5DJQB 4YE1A 3OA8B 1JDLA 3NBTA 2Y0CA 3KHUA 1CSWA 1HCMA 1C2RA 3ZOXA 3PHLA 1MG2D 2RN0A 1NIRA 3CX5W 1W5CT 2BPBB 1HZVA 2Q3EA 1SQXD 1LS9A 1C2NA 1C7MA 3A0HV 1KX2A 1E8EA 1AKKA 1CHIA 1U75B 1C52A 3MK7B 4IL6V 5AURA 1KB9D 2GIWA 1AOFA 3CXHW 1CIFA 1N9CA 3M97X 1DW2A 1CSUA 4Q5PA 1CRJA 1GU2A 1R0QA 3VYMA 3TYIA 2MHMA 2LIRA 3CP5A 2ZONG 4GEDB 1WVEC 1S6VB 1M6ZA 2OZ1A 4PJ0V 1NNOA 2JTIB 1GQ1A 1CCHA 1AYGA 1F1CA
chains in the Genus database with same CATH superfamily
3OW2O 3GHGB 2ZAEB 3H1LJ 3L36A 1T6AA 5B6QA 1WRGA 1NOHA 3KZIE 1OXZA 2SPZA 4YXWH 3W67A 3CI9A 1LTTC 1ZR2A 2V7QH 3CC2P 3H32B 4D6TD 1KQGB 3WFDC 1I54A 1U7JA 3WMM0 3L72J 3H25A 3LW5J 3ZDMA 3HD7C 5EXQA 4WY4A 5CIEB 3H6PA 2ZYAA 1CIHA 3PXWA 2E42A 1OVUA 1URQB 2KOGA 1OMIA 5APWA 3CCRP 2E74C 4OGQC 5GTHH 1HGVA 2R3CA 1B7VA 2ZFCA 5CJ0A 4D6TE 1IJDB 5E79E 1IFIA 3MZWB 1CRCA 5DFSA 4MN4C 3GF7A 3HE4A 1CTYA 2CPSA 5BVZA 2Q9IA 4Z1MH 1YJNP 3TNUB 1QL3A 1DW0A 2K37A 2KLUA 1NTKK 1N50A 1H0TB 3TYYA 2WWWA 2OGUA 1YHQP 2AIUA 3B5NA 2QJPC 1K73Q 1HJ3A 2B0ZB 1GL2D 5AVXB 5B5EV 3EFFK 2QVAA 2WPVB 1AA0A 2FYUE 3Q5RA 2FFDA 3OCDA 1ETPA 3H1KG 2XZRA 4R4MA 3CCQP 3GG2A 2N3YA 3ABVC 4EYYQ 1FJPA 2R5DA 1YIJP 1CYIA 1Z56A 3RK3E 2AXTH 3PP5A 3L4FA 2FYNC 2Z5IA 4WWIA 3OA7A 1N73B 1LTBC 4EICA 1JCDA 4WY4C 1DVHA 3IR9A 1IZL0 2AXTV 3L74G 2YK3A 3EWKA 2KIKA 1SQVE 2B87A 5CCGD 1NTZG 3RBXA 1SQQG 3HRNA 1HJ4A 5KLIC 2WSEJ 2IYPA 2R3SA 1CSXA 2C0WA 5TJHA 4MU8A 1X0TA 1NTMK 1J3SA 1I6DA 3OA8A 1ZP0C 5KAIH 1QVGO 2QM8A 1S5LX 1HZUA 3L70J 4IOIH 1YJ9P 2PCCB 4JQ0D 1KB9H 1JO5A 2NPSB 3H1JD 1HROA 1FOCA 3B5NC 3H1KJ 2HV4A 5KLVG 3G71P 2KYVA 4RO0A 3ZOOA 3NTNA 3SJLA 2N1TB 4XXLA 3TK1A 3TSIA 1BGYD 1YYCA 3KZIV 1MFTA 1CIEA 4GYDA 1KQSO 2FFDC 2POHA 2YNYA 1R5LA 1JMBA 3RK3C 4H13D 2KXPB 3QH9A 3O1YA 2KP8A 4UB6H 1I8OA 3CWBG 2H88C 4BXLA 1QL2A 3H1JE 3L74J 4IL6X 1RQUA 2QJYB 1KYOE 1HJ5A 1SP4A 5E79H 1SQQJ 1IRVA 2L5GB 5AVUB 4KMGA 3H32A 3JCUH 4XFJA 1L0LK 3HQ8A 5E79V 3USSA 2CA3B 1KX7A 1K9MQ 4Y5RA 2C8SA 1DH3A 1H88A 4V2KA 4C7RA 1RF0A 2BCCD 3G4SP 1LGHB 1NH4A 1MFZA 5AVYB 4EIJA 2KB7P 1K3GA 5EFWB 2HLOA 1H32A 4PV1B 2QE7H 3RL0D 351CA 2PAJA 4C46A 1NU1K 1T8ZA 3MK7C 3AEGC 1N7SD 1A56A 1C6OA 3WUUA 5DJTB 1CHJA 5DF5A 3TNUA 3MIWA 3L75D 3L73J 1H0TA 1BCCE 4EIDA 1ZR4A 1KTMA 2H89C 1C6SA 5KAFE 1YI2P 4OH8B 1T3JA 2V08A 4WQDA 1ZV8A 1VPCA 3WUVA 4DY9A 3WFBC 1BSNA 2FY8A 1JY2P 1SFCD 1FJKA 2GC7D 3D6ZA 1YITP 1VQ7P 2BCNB 2K9JA 1MZ4A 1N73A 1SVFA 1AJYA 3CD6P 1RF0C 1L9JC 1NVOA 1AOQA 1NTKG 1JY3O 1LWUB 1GU4A 2KSJA 1C6RA 2P10A 1QN2A 2DVHA 1HTLC 1WT6A 3N7NA 4FA1A 4P4QB 1ZRTE 1L0NG 2E75C 1GTWA 3R2PA 3Q5PA 4I6MC 1OW7A 2LXCB 1DIQC 1H9YA 4W80A 4M3LA 1JEKA 3CXHI 2I8FA 3C2CA 2NPSA 1LC1A 1BE3E 1PPJE 5CIBB 1OVRA 3PJSK 1QL4A 4U3FG 1SQBD 2KI7B 3RK2D 3Q2YA 2N1TA 2ZJSE 3TGUD 3G9RA 1N15A 3ZOWA 2N3BA 4IFDK 2NRGA 2W8ZA 1RQVA 1BGYJ 2IPPA 1J1EB 2ZXXA 4YE1A 2O01H 1S3JA 2A45I 1G1IA 2O1KA 1NTMG 2M5AA 3AE1C 1CSWA 1HCMA 2FXMA 1N73C 3BCCE 1X8YA 1MG2D 2RN0A 2OYIB 1H8AA 1HZVA 1L0NJ 1SQXD 2Q3EA 1SS1A 1GDTA 2Q5UA 1CHIA 1U75B 3JC22 4H44D 5AURA 1AOFA 1DW2A 4Q5PA 1KYOI 3L71G 1CRJA 1VQNP 2ZT9D 3O8ZA 4YXDC 1GU2A 1YQ4C 1PP9G 2WPSA 3TYIA 3P32A 3CP5A 5TISH 2ZONG 4O9BA 3P8MC 1M6ZA 3GMAA 2JTIB 4I2LC 1GQ1A 1CCHA 3RL0g 2NPSC 3AE7C 4ASVA 1EDKA 1SQPD 2VRSA 2Y9YA 1IK7A 1WMKA 3A7OA 5KAFV 1LJ2A 4UB8E 2N1TC 1LTJB 4OVNF 2Q1KA 1CW5A 1FC2C 3CU4A 2AEJA 1RF1B 3A0BH 4YPCA 3M9QA 1COTA 1DD4A 1L0LG 4LC1A 5APVA 4L73A 2HYNA 2Q7CA 1JY2N 4GKGA 5KKZB 2B88A 1VQ4P 1RZ6A 2CE0A 2R44A 2FFDB 1I8PA 2QJYC 3EQ2A 2KNCB 1R8EA 1M90Q 1VF5D 3H1ID 1UIIA 1AVYA 2WITA 1CHHA 4W7ZA 2C9XB 1EZVD 1FZGA 1AQ5A 1S5LH 1XTGB 2YMYA 1PP9J 1NU1G 2W83C 4BRYB 3HD7D 3M0DA 1N90A 1H89A 3A9FA 2FXPA 1S9KE 1ZW0A 2N9YB 4AQRD 1NMLA 4K3IA 3H1LG 2KS1A 2HFED 2Y0DA 4L3GA 4K35A 4JF7A 1PL5A 4HH2A 1CXCA 2E74D 4OGQD 1LWUA 3I55P 1JNMA 2BGVX 1RAPA 1T2KC 2N18B 2PCBB 5CCHA 3H1HD 3ITKA 4AANA 2BEQD 4PV1C 3FXDA 3A0HH 1HH0A 3U1CA 2PP6A 2XU6A 3L72G 1QVFO 4IL6H 3ZCFA 1EDIA 5AVQB 2OQQA 3B4SA 1DVVA 3AE4C 4GDOA 3GLMA 2YXRB 1Y9BA 3WUTA 1GW3A 3CX5E 3CCUP 1GIWA 1OCDA 4PJ0H 1L4AA 1QX8A 4AAOA 4FAVA 1CRYA 5C0ZA 1Q81Q 5AVVB 1NU1J 3N4XA 2M0BA 2E5TA 2OYOA 2L91A 3HE5B 1J2JB 1NAFA 4QMAA 2IBZG 3H1KE 3M0DC 4WY4D 1CTZA 5CMZA 3CCLP 3WFCC 2OYIA 3AEFC 3MHVA 1LWUC 4DOJA 3AEBC 1KQFB 2MJZA 5CCHC 1M70A 1AQTA 1M56D 1SQXJ 3DMIA 1YTZT 4ZNCA 5B66E 3D71A 3GF3A 3S1KA 2JR8A 2YKPA 4WQ9A 4WQEA 3NMDA 2V7QJ 2QIWA 4UB8V 4PD4I 3V6IA 5H2FE 4I1LA 5APXA 3AE8C 1NTZE 1OZHA 5CIGB 1SQQE 3SWKA 1H32B 3V4WA 2B9BA 2E75B 1PZQA 3VMYA 3B5ND 2V07A 4IFMA 2FYUD 3Q3DA 2LXBA 3SWYA 5CIHB 5KJ7A 4H0JA 4KT0J 1NGMB 1L4AC 2YIUB 4WBAA 5B5EH 4XE5B 1SQPJ 3R4YA 1LTJA 3RK3D 5CICB 1U7MA 1FS0E 3MTUE 1RF1A 3OJAB 2E76C 2A06D 1IZNB 5KLVE 3S4RA 1UIXA 2OTJP 5AW0B 1L0NK 3L70G 3CCEP 1IQCA 1P84H 1A8CA 1J1EC 3JSVC 1OAEA 2AEMA 1IO3A 4KHXA 2G3AA 2KNCA 2BLFB 5CBNA 1SQVD 3AEDC 2OZ1B 1OIPA 3FWLA 3CWBE 1IFNA 4DT0A 4PWAA 2OYIC 2FBWC 2IX7C 2QSIA 4FA9A 3PLNA 2A06E 2K9JB 1M1JA 1GU5A 2W6JH 2V4HA 4IFFA 3HQ6A 2QA4P 1U74B 4BRYA 4Y28J 3D6YA 2ZYDA 3AEAC 4A7PA 2KUBA 1J1DB 4WB4A 2OTKE 1N8RQ 1EB7A 3CXHE 1VQLP 3G6EP 1OX3A 3ZIYA 3LIEA 1IO4A 4AALA 1W5CE 3NXSA 1M60A 1MZ9A 4AUWA 3VP8A 5KJ7C 1FE6A 4JYBA 3H1HJ 2WMMA 1LTJC 3K5BA 2YO2A 3KZIH 1CI6B 3E7KA 4L76A 1RF1C 1E79H 1KYOD 4LJIA 1NYHA 3CC7P 3DP5A 5KKZC 1H31B 3UIAA 4AYCA 2P1JA 1IK9A 5CJ4A 3D70A 2YO3A 1YICA 1FOSF 1NHLA 1VYDA 1L9BC 1JUNA 5B66H 1Y8AA 5AW7B 2FRCA 3CYTI 2FWLA 1KV4A 3HE5A 2M5AB 3L73G 5C39A 3CX5I 5CIFB 1M1JC 1VL2A 4GIFA 4K3AA 5B66V 2NZ2A 1E29A 5AW3B 3WU2E 1DD3A 5H2FV 1HGZA 2ZVNB 2EXVA 1URQD 2L4DA 3HQ7A 1QEXA 1CCRA 3MUDA 1ZZHA 2HPCB 2N18C 4D6TJ 2YKQA 4WQCA 4GOFA 2QRXA 1IFMA 3RMZA 1NTKE 4DZOA 1BCCD 1W2BO 1PV3A 1HJBA 4WVZA 5BU8B 1M1KQ 5AW5B 2OYHA 4DCKA 5DJQB 3M91A 1L0NE 1JDLA 1K04A 5AW1B 2LKMA 1SQBK 1C2RA 4GODA 4EOTA 3VMZA 2FYUJ 2PRRA 1FZCB 3MGNA 5APYA 1KX2A 1LP1B 4B86A 2WPQA 2I1KA 2YKOA 1CIFA 3M97X 4H0LB 4U3FE 1K05A 4JYCA 1SQXK 1WVEC 2OZ1A 2XDJA 5L8RJ 1NNOA 1JMMA 2R32A 1Q82Q 4JPZB 1ZXGA 1ZRTD 2D2CB 2P2UA 3MUDC 4RKUJ 1NTME 1RE3A 1BGYG 3HTKA 2GB8B 2KS1B 3B8EB 155CA 4BWNA 1CRGA 3F89A 4DJGA 1WEJF 1QYZA 2A45H 2CK3H 1FI3A 1ZMEC 5KTBA 1FI9A 1BE3D 1YIQA 1PPJD 2ZOOA 1SQPK 4RSZA 2NPSD 2OYHC 3NWVA 1HBWA 1I5TA 4L74A 1NMIA 2MTAC 5APQA 3L71E 3FXEA 4KJMA 4WQBA 3VTPC 1KD1Q 1FBMA 5GTIE 1PP9E 5AVTB 2N1TD 5C9MA 5AW6B 4RJTA 2HR3A 2YIUC 1KYOH 3SFEC 3E1RA 3II6A 4ZKPA 1LTSC 3C8VA 3CCJP 1CI6A 1SLQA 2I1JA 1CSBA 3TF5A 1L4AB 5APUA 3U59A 3CLQA 1X9VA 3BCCD 2B10B 3H1JJ 1Q86Q 2PACA 1H31A 2BCCG 4RESB 1H9XA 3WU2V 1OW8A 1EXJA 3A3YB 2E76B 1L0LE 1AFOA 2JWAA 1GMJA 3P8CE 4Y99B 1DEBA 1KIBA 4TLFA 3CL3D 1M57D 1RE3C 2B12B 4PD4E 1YJWP 3KPEA 1E2RA 3L75G 1BDDA 3C9IA 1S1CX 1J1DC 5AVSB 3L4MA 1JM0A 2AEFA 2HG5D 4EDFA 2O01J 1RAQA 1T2KD 1MUUA 1BL9A 1W2EA 2H43A 1L2PA 1NU1E 4FANA 2HPCA 4PV1D 1NKZB 1KILB 3JBTB 3H1LE 2C1DA 5KAFH 2J58A 1JY3P 1GK4A 1NAYA 2BCCJ 1AVOA 1HUCA 1MKMA 3G3ZA 1BCCJ 3V4QA 1CTJA 2ZXYA 3RN1A 1KZUB 3L72E 1Y47A 1HF9A 1H33B 2HODB 1ZOYC 2IZ0A 2JEEA 1FZCA 2AXCA 1KORA 3VOPA 4J20A 4H0KA 1LP1A 1BDCA 1CC5A 2K88A 3L75J 2FKWB 1S9KD 1EXIA 4FB1A 2GC4D 1QGKB 1U57A 2QM7A 3CCVP 4FA5A 4N0KA 3Q1MA 3L4OA 3E1IA 2QEXP 1I55A 4C7NA 2C9LY 1EDLA 2W27A 2JDIH 5GTHE 1M1JB 2Y9ZA 4O1QA 2QG4A 3D0WA 1FJ0A 1PIXA 5CCHD 1SQBG 1RHZB 3AECC 3V2RA 2IBZE 1HH7A 1VQ6P 3TGUG 2XKMA 1GL2B 5GTIV 2C2CA 3T97A 451CA 1QL1A 1FDIA 2FYUK 3CX5D 2W90A 2JQRA 3L37A 5APTA 2WPRA 5DJQC 1LNQA 4JBZA 1LFMA 3VNWA 1USDA 2K1AA 1SQXG 4HJGH 2M3BA 4EI2A 1X79B 2DW3A 1FZCC 1DW3A 1A02J 3L70D 1EQ7A 3BRVB 5AW9B 1USEA 3H1KD 1FZFA 1ZN5A 4H0LC 1GD2E 5IY51 2IFNA 3O20A 3AE9C 1YEBA 1SQBJ 3CC4P 4N3YB 1JOCA 2OARA 3TGUJ 1SQPG 3NFQA 3L70E 1K8AQ 3SLEA 3PRJA 1AV1A 3CCMP 4I7ZB 2D2CC 3L74D 3O0RC 2LR2A 1FHBA 3L35A 1NTZD 3CMEP 1SQQD 4N78E 5KAIE 1CIGA 3RN0A 3KDPB 4UB8H 2C1VA 4NFGB 1KB9E 2YQBA 3LW5H 4H13B 2YCCA 1DIIC 1VF5C 1JY3N 3SWFA 4WQ7A 1OVVA 4ZKUA 1TU3F 2GUVA 4N6JA 2PGDA 3L74E 3B71A 5KJ7D 2O3JA 1KILA 2G8YA 3H1IG 1FAVA 3BRTB 3WUIA 2QJKB 1EZVG 2R5BA 3SSUA 2RKLA 1KILE 2OYHB 5KLVD 1YQ3C 4UB6E 5AVWB 4R4LA 2DGEA 2XV5A 1GDVA 1VQ9P 4YTPC 2Q6QA 2WSSH 3KQGA 2J5UA 1GKSA 2B4ZA 1H33A 2HODA 3CWBD 5AVZB 1FZEA 3IAOA 3OAKA 3SXTA 1A02F 3CCSP 2OTLP 3H1HG 3L73D 3JCUE 5GTHV 4XA4A 3BATA 4Y99C 1FDMA 3CMAP 2N9IA 2XNDH 2M3EA 3RL0B 1RZ5A 4L3HA 5BU5A 2Z5HA 1MV8A 3CXHD 4NPEA 1VQOP 1N7SB 1M8OB 4O1WA 3M9HA 3ORVA 3H1IJ 2B89A 3NBTA 2Y0CA 3L73E 3MP7B 3KHUA 3HTKB 3I56P 2JO1A 1NIRA 4ASWA 2BPBB 1HWTC 1KILC 1GL2A 1C2NA 3KYQA 3CX5H 3CPWO 1E8EA 1C52A 2WSEH 1NJIQ 2GIWA 4TT3H 3CXHW 1N9CA 1GZLA 1SFCB 1DIPA 3M0AA 1R0QA 2IBZI 3RBZA 3VYMA 3HUSB 2MKVA 1VQ8P 2E5YA 2MHMA 2LIRA 2KK7A 3VYIA 4GEDB 4D6TG 1S6VB 1XTCC 3FGAD 1G1JA 3VMXA 1CRHA 1VQPP 1N2DC 1CORA 5CCGA 2IDBA 5AW2B 1FZAA 2WSCH 2BH4X 1C75A 5M1BA 1P84I 1S72P 1NO4A 2IFMA 4CPGA 1EZVI 1R5SA 1FI7A 5KAIV 4XYDB 2C0XA 2FYUG 5H2FH 3VMAA 1JY2O 2WSCJ 4WQAA 1KQLA 1BSHA 1DX7A 1KYOW 1NTKD 1VQMP 1NKNA 3HQ9A 1N7LA 1GL2C 2K3RA 1CYCA 1S2EA 3RK2B 1KFMA 2A06G 3IN6A 1VDFA 1L0ND 3GHGA 3M06A 1NTZJ 4UB6V 3F5HA 2E75D 1BGYE 1RH5B 2WSFH 1HJ0A 2C1DB 1SQVG 3SWSA 3V2PA 2CXBA 3DR0A 2RH0A 1G2CB 3EFGA 1KB0A 2FXOA 1KB9I 4U3FD 2KSEA 4LGDE 2WSFJ 2WT7B 5KLVJ 2E43A 5CCGC 1LTIC 3NBSA 1URQA 4H44B 1YEAA 1PGQA 1A2SA 4EIEA 1JTHB 5K5GB 1FU1A 1CO6A 2ZT9B 1VQKP 2A45G 4GOEA 1NTMD 2LITA 3CWBJ 2KLVA 2ZYGA 3CXHH 2M8RA 2B11B 1OWAA 2WQYC 4I7ZC 2BCCE 2WVRA 3S9OA 2I8DA 1VQ5P 2AI5A 4L1QA 4C7NB 3BVHA 3O6QB 3H1JG 1N7SA 1RE4A 1LT9B 1M7LA 1I6EA 5TISE 4LLHA 4L75A 1SQVJ 3L71D 3GHGC 1MG3D 2ZVOB 2YMKA 2ZBOA 4H13C 1N86A 1EDJA 1PP9D 5CIDB 3L75E 3AE5C 3T97B 2Z4EA 4QAOA 1CZQA 1IRWA 1GW4A 3O5CA 2QJKC 4AX3A 1VF5B 1CEDA 3PXSA 1KV9A 5CYTR 1KFNA 3A0BE 1KMIZ 4AAMA 2Q3IA 2JKVA 4OWFA 3AE6C 3VN0A 1SFCA 1IFJA 2KZIA 2XTSB 1DT1A 2GA1A 3HUSA 1URQC 4W7YA 2ORLA 5APSA 1L0LD 3MD0A 3HD7B 1IFPA 3P8CD 1W2LA 3VP9A 1D7MA 1EC5A 1GJQA 3W68A 3WU2H 1RY3A 2WZ7A 2E74B 4OGQB 3IFMA 1S5LE 4PD4D 3PH0A 1LMSA 1K3HA 2C1UA 3RL0C 1BCCG 5DJUB 3M9BA 1CYJA 1QLED 1CXAA 1HRCA 1N7SC 2BH5X 2P58A 1RE4C 3ZBMA 2FYZA 1NU1D 1YTCA 2KZJA 1JB0J 2JJLA 2CA4B 3A2AA 1ZLLA 4JCGA 3H1LD 2QJPB 3FX0A 2GM4A 3C1LA 3A0HE 1NWQA 4WQ8A 4IL6E 2K9YA 1NTKJ 3FWNA 4GT1A 3TDKA 4HYTB 3P7KA 1SQBE 3L72D 3GW6A 2IZ1A 2CE1A 2N9BA 1PGPA 1KN7A 3TGUE 1LC2A 1SFCC 2BASA 1E5WA 4PJ0E 3BASA 2FYNB 3HUSC 2J59M 1YBKA 1FZBA 1PGJA 1YTZI 4WY4B 3SFDC 3ZOYA 1G2CA 3QWOC 2C9NY 1PFIA 1FCDC 3AE2C 1S4XA 1HVVA 2WT7A 1IC2A 2O01N 5KLIB 2H7HA 4H0LD 4ZMDA 2W6AA 2P7JA 5CHXA 4U3FJ 1SQXE 3Q5SA 1LT1A 3RLMA 2N9JA 3HE4B 1JTHA 3X39A 1BE3G 2D0WA 3WFEC 1PPJG 2P67A 1LTAC 1CRIA 5TISV 2CPBA 3PXTA 4NPFX 2IBZD 3WC8A 2D2CD 1YCCA 4EIFA 3B5NB 1NTZK 2W6BA 1SQQK 1NTMJ 3U1AA 1F1FA 4FA4A 1Q90D 1CSVA 3KXDA 4U7JA 3O6QA 3V2NA 1YFCA 2Y0EA 1SQPE 1LT9A 2JWDA 5GTIH 1DW1A 3RK2C 1FOSE 3OCDB 2GUSA 3IF4A 3RK3B 3A0BV 3V2QA 3BCCG 1P84D 2IYOA 2VHDA 2UWJE 3RGUA 3L71J 3VRDA 5KLVK 5B5EE 1Q2NA 1H1OA 3SVWA 1CNOA 4HKZH 2ZXEB 2JP3A 2RMZA 3PH2B 1QKSA 1OW6A 1BE3J 2D0SA 1S5LV 1X22A 2B87B 5AW4B 1P84E 1L4AD 1Q7YQ 2ITAA 3H1IE 1FDOA 2H8PD 2ZZS1 4PW9B 4NPDA 1EZVE 3AEEC 4H44C 3V5BA 2YXQB 1OFCX 1YNRA 3HD7A 3PTZA 4PD4H 2XNXA 3AE3C 3OA8B 2E76D 2O1JA 1T3UA 2ZT9C 2AXTE 1L0LJ 3A5TA 3ZOXA 3PHLA 2BEZF 4HB1A 5AW8B 1GK6A 3CX5W 1SQVK 1W5CT 1KC8Q 1LS9A 4N78D 1C7MA 2WTYA 3A0HV 1AKKA 3MK7B 3BCCJ 4IL6V 1KB9D 1LTGC 5AVRB 3H1HE 2PFXA 1CSUA 1LT9C 1IFDA 3LIDA 5CBOA 3I5CA 4PJ0V 1JCCA 1DEEG 1PGOA 1KILD 1AYGA 1F1CA
chains in the Genus database with same CATH topology
1CRHA 1ZRTD 1SQPD 5B6QA 1CORA 5KAFV 2GB8B 2BH4X 1C75A 155CA 4D6TD 1CRGA 1WEJF 1QYZA 3CU4A 3WFDC 1I54A 1FI3A 1FI9A 1FI7A 1COTA 1BE3D 5KAIV 4XYDB 1YIQA 1PPJD 2ZOOA 5KKZB 4RSZA 3NWVA 1RZ6A 2CE0A 5EXQA 1I5TA 1NMIA 5CIEB 2MTAC 1CIHA 1I8PA 2KNCB 4WQBA 3VMAA 3PXWA 4WQAA 3H1ID 1KYOW 1NTKD 1CHHA 3HQ9A 5C9MA 2C9XB 1B7VA 1EZVD 4RJTA 1CRCA 5DFSA 1CYCA 1CTYA 1L0ND 3TF5A 4UB6V 1N90A 3A9FA 3BCCD 2B10B 1QL3A 2PACA 1DW0A 1H31A 2N9YB 1NMLA 4K3IA 1H9XA 2KS1A 2C1DB 3WU2V 2Y0DA 1N50A 4L3GA 3SWSA 1CXCA 2AIUA 1HJ3A 2B0ZB 2CXBA 3DR0A 2BGVX 1RAPA 2N18B 2PCBB 2JWAA 5B5EV 3H1HD 1KB0A 3ITKA 4AANA 1KIBA 4U3FD 3OCDA 1ETPA 3GG2A 2B12B 2N3YA 3ZCFA 3NBSA 1E2RA 1YEAA 1A2SA 1CYIA 4EIEA 1DVVA 3L4MA 1CO6A 4EDFA 1RAQA 1BL9A 1GIWA 1NTMD 1OCDA 4EICA 2LITA 4FANA 1DVHA 1IZL0 2AXTV 2B11B 2YK3A 4AAOA 3JBTB 4FAVA 1CRYA 5C0ZA 2C1DA 2AI5A 4L1QA 1HJ4A 1CSXA 1I6EA 5TJHA 4MU8A 2L91A 3L71D 1J3SA 1I6DA 1MG3D 3OA8A 1CTJA 2ZXYA 3RN1A 2ZBOA 1CTZA 1PP9D 1H33B 5CIDB 1HZUA 3WFCC 2PCCB 3H1JD 4QAOA 1HROA 1FOCA 4H0KA 4J20A 1IRWA 2HV4A 3O5CA 4AX3A 1CEDA 1CC5A 3PXSA 1KV9A 5CYTR 3ZOOA 1M70A 3SJLA 3DMIA 4XXLA 1BGYD 3KZIV 4AAMA 4WQ9A 4WQEA 1CIEA 4GYDA 4FB1A 2GC4D 2XTSB 4UB8V 1DT1A 3O1YA 4FA5A 4N0KA 3L4OA 1I8OA 2ORLA 5CIGB 1L0LD 1H32B 1I55A 1W2LA 2V07A 2QJYB 1GJQA 2FYUD 4O1QA 2QG4A 5CIHB 1FJ0A 1HJ5A 4H0JA 1IRVA 4PD4D 1HH7A 1LMSA 2YIUB 1K3HA 5GTIV 4KMGA 2C1UA 5CICB 2C2CA 3HQ8A 5E79V 1CYJA 2CA3B 451CA 1KX7A 2A06D 4Y5RA 1CXAA 1HRCA 2BH5X 2C8SA 3CX5D 3ZBMA 4V2KA 1NU1D 1IQCA 2JQRA 1A8CA 1YTCA 1OAEA 5DJQC 1IO3A 2CA4B 4JCGA 2BCCD 2BLFB 2QJPB 3H1LD 1SQVD 2OZ1B 1LFMA 3VNWA 3FWLA 4WQ8A 4PWAA 1K3GA 1DW3A 1H32A 351CA 3L70D 4FA9A 3PLNA 2K9JB 3TDKA 3MK7C 1A56A 1C6OA 3HQ6A 3H1KD 1CHJA 3L72D 1U74B 3GW6A 5DF5A 2CE1A 5IY51 3O20A 3L75D 1LC2A 4A7PA 1EB7A 2FYNB 1YEBA 3ZIYA 4EIDA 3ZOYA 3SLEA 3PRJA 4AALA 1C6SA 1M60A 2V08A 3L74D 3O0RC 1FCDC 4WQDA 5KLIB 1FHBA 4DY9A 1NTZD 3WFBC 1SQQD 1CIGA 3RLMA 3RN0A 2N9JA 3X39A 2GC7D 2D0WA 3WFEC 2BCNB 2C1VA 4NFGB 1KYOD 2YQBA 4LJIA 1CRIA 5TISV 3DP5A 1MZ4A 2YCCA 1DIIC 3PXTA 4WQ7A 2IBZD 1H31B 3WC8A 1L9JC 2O3JA 1AOQA 1YCCA 4EIFA 1YICA 3WUIA 2QJKB 1VYDA 1L9BC 1C6RA 1QN2A 1F1FA 4FA4A 2FRCA 1CSVA 5KLVD 3CYTI 1YFCA 2DVHA 2Y0EA 4FA1A 2FWLA 4P4QB 1DW1A 2DGEA 3OCDB 5CIFB 3A0BV 1GDVA 5B66V 1P84D 1E29A 2VHDA 1DIQC 1H9YA 1GKSA 2B4ZA 1H33A 5H2FV 3CWBD 2I8FA 3C2CA 3VRDA 2EXVA 1LC1A 2L4DA 1H1OA 5CIBB 3SXTA 3HQ7A 3SVWA 1CCRA 1ZZHA 3L73D 5GTHV 1QL4A 2N18C 1CNOA 1SQBD 2RMZA 3PH2B 1QKSA 2N9IA 3TGUD 2D0SA 1N15A 4WQCA 1S5LV 1RZ5A 4L3HA 3ZOWA 2N3BA 3RMZA 3CXHD 2ZZS1 4PW9B 1BCCD 4O1WA 1YNRA 3PTZA 3ORVA 5DJQB 4YE1A 3OA8B 1JDLA 3NBTA 2Y0CA 3KHUA 1CSWA 1HCMA 1C2RA 3ZOXA 3PHLA 1MG2D 2RN0A 1NIRA 3CX5W 1W5CT 2BPBB 1HZVA 2Q3EA 1SQXD 1LS9A 1C2NA 1C7MA 3A0HV 1KX2A 1E8EA 1AKKA 1CHIA 1U75B 1C52A 3MK7B 4IL6V 5AURA 1KB9D 2GIWA 1AOFA 3CXHW 1CIFA 1N9CA 3M97X 1DW2A 1CSUA 4Q5PA 1CRJA 1GU2A 1R0QA 3VYMA 3TYIA 2MHMA 2LIRA 3CP5A 2ZONG 4GEDB 1WVEC 1S6VB 1M6ZA 2OZ1A 4PJ0V 1NNOA 2JTIB 1GQ1A 1CCHA 1AYGA 1F1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRH A;  1ZRT D;  1SQP D;  5B6Q A;  1COR A;  5KAF V;  2GB8 B;  2BH4 X;  1C75 A;  155C A;  4D6T D;  1CRG A;  1WEJ F;  1QYZ A;  3CU4 A;  3WFD C;  1I54 A;  1FI3 A;  1FI9 A;  1FI7 A;  1COT A;  1BE3 D;  5KAI V;  4XYD B;  1YIQ A;  1PPJ D;  2ZOO A;  5KKZ B;  4RSZ A;  3NWV A;  1RZ6 A;  2CE0 A;  5EXQ A;  1I5T A;  1NMI A;  5CIE B;  2MTA C;  1CIH A;  1I8P A;  2KNC B;  4WQB A;  3VMA A;  3PXW A;  4WQA A;  3H1I D;  1KYO W;  1NTK D;  1CHH A;  3HQ9 A;  5C9M A;  2C9X B;  1B7V A;  1EZV D;  4RJT A;  1CRC A;  5DFS A;  1CYC A;  1CTY A;  1L0N D;  3TF5 A;  4UB6 V;  1N90 A;  3A9F A;  3BCC D;  2B10 B;  1QL3 A;  2PAC A;  1DW0 A;  1H31 A;  2N9Y B;  1NML A;  4K3I A;  1H9X A;  2KS1 A;  2C1D B;  3WU2 V;  2Y0D A;  1N50 A;  4L3G A;  3SWS A;  1CXC A;  2AIU A;  1HJ3 A;  2B0Z B;  2CXB A;  3DR0 A;  2BGV X;  1RAP A;  2N18 B;  2PCB B;  2JWA A;  5B5E V;  3H1H D;  1KB0 A;  3ITK A;  4AAN A;  1KIB A;  4U3F D;  3OCD A;  1ETP A;  3GG2 A;  2B12 B;  2N3Y A;  3ZCF A;  3NBS A;  1E2R A;  1YEA A;  1A2S A;  1CYI A;  4EIE A;  1DVV A;  3L4M A;  1CO6 A;  4EDF A;  1RAQ A;  1BL9 A;  1GIW A;  1NTM D;  1OCD A;  4EIC A;  2LIT A;  4FAN A;  1DVH A;  1IZL 0;  2AXT V;  2B11 B;  2YK3 A;  4AAO A;  3JBT B;  4FAV A;  1CRY A;  5C0Z A;  2C1D A;  2AI5 A;  4L1Q A;  1HJ4 A;  1CSX A;  1I6E A;  5TJH A;  4MU8 A;  2L91 A;  3L71 D;  1J3S A;  1I6D A;  1MG3 D;  3OA8 A;  1CTJ A;  2ZXY A;  3RN1 A;  2ZBO A;  1CTZ A;  1PP9 D;  1H33 B;  5CID B;  1HZU A;  3WFC C;  2PCC B;  3H1J D;  4QAO A;  1HRO A;  1FOC A;  4H0K A;  4J20 A;  1IRW A;  2HV4 A;  3O5C A;  4AX3 A;  1CED A;  1CC5 A;  3PXS A;  1KV9 A;  5CYT R;  3ZOO A;  1M70 A;  3SJL A;  3DMI A;  4XXL A;  1BGY D;  3KZI V;  4AAM A;  4WQ9 A;  4WQE A;  1CIE A;  4GYD A;  4FB1 A;  2GC4 D;  2XTS B;  4UB8 V;  1DT1 A;  3O1Y A;  4FA5 A;  4N0K A;  3L4O A;  1I8O A;  2ORL A;  5CIG B;  1L0L D;  1H32 B;  1I55 A;  1W2L A;  2V07 A;  2QJY B;  1GJQ A;  2FYU D;  4O1Q A;  2QG4 A;  5CIH B;  1FJ0 A;  1HJ5 A;  4H0J A;  1IRV A;  4PD4 D;  1HH7 A;  1LMS A;  2YIU B;  1K3H A;  5GTI V;  4KMG A;  2C1U A;  5CIC B;  2C2C A;  3HQ8 A;  5E79 V;  1CYJ A;  2CA3 B;  451C A;  1KX7 A;  2A06 D;  4Y5R A;  1CXA A;  1HRC A;  2BH5 X;  2C8S A;  3CX5 D;  3ZBM A;  4V2K A;  1NU1 D;  1IQC A;  2JQR A;  1A8C A;  1YTC A;  1OAE A;  5DJQ C;  1IO3 A;  2CA4 B;  4JCG A;  2BCC D;  2BLF B;  2QJP B;  3H1L D;  1SQV D;  2OZ1 B;  1LFM A;  3VNW A;  3FWL A;  4WQ8 A;  4PWA A;  1K3G A;  1DW3 A;  1H32 A;  351C A;  3L70 D;  4FA9 A;  3PLN A;  2K9J B;  3TDK A;  3MK7 C;  1A56 A;  1C6O A;  3HQ6 A;  3H1K D;  1CHJ A;  3L72 D;  1U74 B;  3GW6 A;  5DF5 A;  2CE1 A;  5IY5 1;  3O20 A;  3L75 D;  1LC2 A;  4A7P A;  1EB7 A;  2FYN B;  1YEB A;  3ZIY A;  4EID A;  3ZOY A;  3SLE A;  3PRJ A;  4AAL A;  1C6S A;  1M60 A;  2V08 A;  3L74 D;  3O0R C;  1FCD C;  4WQD A;  5KLI B;  1FHB A;  4DY9 A;  1NTZ D;  3WFB C;  1SQQ D;  1CIG A;  3RLM A;  3RN0 A;  2N9J A;  3X39 A;  2GC7 D;  2D0W A;  3WFE C;  2BCN B;  2C1V A;  4NFG B;  1KYO D;  2YQB A;  4LJI A;  1CRI A;  5TIS V;  3DP5 A;  1MZ4 A;  2YCC A;  1DII C;  3PXT A;  4WQ7 A;  2IBZ D;  1H31 B;  3WC8 A;  1L9J C;  2O3J A;  1AOQ A;  1YCC A;  4EIF A;  1YIC A;  3WUI A;  2QJK B;  1VYD A;  1L9B C;  1C6R A;  1QN2 A;  1F1F A;  4FA4 A;  2FRC A;  1CSV A;  5KLV D;  3CYT I;  1YFC A;  2DVH A;  2Y0E A;  4FA1 A;  2FWL A;  4P4Q B;  1DW1 A;  2DGE A;  3OCD B;  5CIF B;  3A0B V;  1GDV A;  5B66 V;  1P84 D;  1E29 A;  2VHD A;  1DIQ C;  1H9Y A;  1GKS A;  2B4Z A;  1H33 A;  5H2F V;  3CWB D;  2I8F A;  3C2C A;  3VRD A;  2EXV A;  1LC1 A;  2L4D A;  1H1O A;  5CIB B;  3SXT A;  3HQ7 A;  3SVW A;  1CCR A;  1ZZH A;  3L73 D;  5GTH V;  1QL4 A;  2N18 C;  1CNO A;  1SQB D;  2RMZ A;  3PH2 B;  1QKS A;  2N9I A;  3TGU D;  2D0S A;  1N15 A;  4WQC A;  1S5L V;  1RZ5 A;  4L3H A;  3ZOW A;  2N3B A;  3RMZ A;  3CXH D;  2ZZS 1;  4PW9 B;  1BCC D;  4O1W A;  1YNR A;  3PTZ A;  3ORV A;  5DJQ B;  4YE1 A;  3OA8 B;  1JDL A;  3NBT A;  2Y0C A;  3KHU A;  1CSW A;  1HCM A;  1C2R A;  3ZOX A;  3PHL A;  1MG2 D;  2RN0 A;  1NIR A;  3CX5 W;  1W5C T;  2BPB B;  1HZV A;  2Q3E A;  1SQX D;  1LS9 A;  1C2N A;  1C7M A;  3A0H V;  1KX2 A;  1E8E A;  1AKK A;  1CHI A;  1U75 B;  1C52 A;  3MK7 B;  4IL6 V;  5AUR A;  1KB9 D;  2GIW A;  1AOF A;  3CXH W;  1CIF A;  1N9C A;  3M97 X;  1DW2 A;  1CSU A;  4Q5P A;  1CRJ A;  1GU2 A;  1R0Q A;  3VYM A;  3TYI A;  2MHM A;  2LIR A;  3CP5 A;  2ZON G;  4GED B;  1WVE C;  1S6V B;  1M6Z A;  2OZ1 A;  4PJ0 V;  1NNO A;  2JTI B;  1GQ1 A;  1CCH A;  1AYG A;  1F1C A; 
#chains in the Genus database with same CATH topology
 3OW2 O;  3GHG B;  2ZAE B;  3H1L J;  3L36 A;  1T6A A;  5B6Q A;  1WRG A;  1NOH A;  3KZI E;  1OXZ A;  2SPZ A;  4YXW H;  3W67 A;  3CI9 A;  1LTT C;  1ZR2 A;  2V7Q H;  3CC2 P;  3H32 B;  4D6T D;  1KQG B;  3WFD C;  1I54 A;  1U7J A;  3WMM 0;  3L72 J;  3H25 A;  3LW5 J;  3ZDM A;  3HD7 C;  5EXQ A;  4WY4 A;  5CIE B;  3H6P A;  2ZYA A;  1CIH A;  3PXW A;  2E42 A;  1OVU A;  1URQ B;  2KOG A;  1OMI A;  5APW A;  3CCR P;  2E74 C;  4OGQ C;  5GTH H;  1HGV A;  2R3C A;  1B7V A;  2ZFC A;  5CJ0 A;  4D6T E;  1IJD B;  5E79 E;  1IFI A;  3MZW B;  1CRC A;  5DFS A;  4MN4 C;  3GF7 A;  3HE4 A;  1CTY A;  2CPS A;  5BVZ A;  2Q9I A;  4Z1M H;  1YJN P;  3TNU B;  1QL3 A;  1DW0 A;  2K37 A;  2KLU A;  1NTK K;  1N50 A;  1H0T B;  3TYY A;  2WWW A;  2OGU A;  1YHQ P;  2AIU A;  3B5N A;  2QJP C;  1K73 Q;  1HJ3 A;  2B0Z B;  1GL2 D;  5AVX B;  5B5E V;  3EFF K;  2QVA A;  2WPV B;  1AA0 A;  2FYU E;  3Q5R A;  2FFD A;  3OCD A;  1ETP A;  3H1K G;  2XZR A;  4R4M A;  3CCQ P;  3GG2 A;  2N3Y A;  3ABV C;  4EYY Q;  1FJP A;  2R5D A;  1YIJ P;  1CYI A;  1Z56 A;  3RK3 E;  2AXT H;  3PP5 A;  3L4F A;  2FYN C;  2Z5I A;  4WWI A;  3OA7 A;  1N73 B;  1LTB C;  4EIC A;  1JCD A;  4WY4 C;  1DVH A;  3IR9 A;  1IZL 0;  2AXT V;  3L74 G;  2YK3 A;  3EWK A;  2KIK A;  1SQV E;  2B87 A;  5CCG D;  1NTZ G;  3RBX A;  1SQQ G;  3HRN A;  1HJ4 A;  5KLI C;  2WSE J;  2IYP A;  2R3S A;  1CSX A;  2C0W A;  5TJH A;  4MU8 A;  1X0T A;  1NTM K;  1J3S A;  1I6D A;  3OA8 A;  1ZP0 C;  5KAI H;  1QVG O;  2QM8 A;  1S5L X;  1HZU A;  3L70 J;  4IOI H;  1YJ9 P;  2PCC B;  4JQ0 D;  1KB9 H;  1JO5 A;  2NPS B;  3H1J D;  1HRO A;  1FOC A;  3B5N C;  3H1K J;  2HV4 A;  5KLV G;  3G71 P;  2KYV A;  4RO0 A;  3ZOO A;  3NTN A;  3SJL A;  2N1T B;  4XXL A;  3TK1 A;  3TSI A;  1BGY D;  1YYC A;  3KZI V;  1MFT A;  1CIE A;  4GYD A;  1KQS O;  2FFD C;  2POH A;  2YNY A;  1R5L A;  1JMB A;  3RK3 C;  4H13 D;  2KXP B;  3QH9 A;  3O1Y A;  2KP8 A;  4UB6 H;  1I8O A;  3CWB G;  2H88 C;  4BXL A;  1QL2 A;  3H1J E;  3L74 J;  4IL6 X;  1RQU A;  2QJY B;  1KYO E;  1HJ5 A;  1SP4 A;  5E79 H;  1SQQ J;  1IRV A;  2L5G B;  5AVU B;  4KMG A;  3H32 A;  3JCU H;  4XFJ A;  1L0L K;  3HQ8 A;  5E79 V;  3USS A;  2CA3 B;  1KX7 A;  1K9M Q;  4Y5R A;  2C8S A;  1DH3 A;  1H88 A;  4V2K A;  4C7R A;  1RF0 A;  2BCC D;  3G4S P;  1LGH B;  1NH4 A;  1MFZ A;  5AVY B;  4EIJ A;  2KB7 P;  1K3G A;  5EFW B;  2HLO A;  1H32 A;  4PV1 B;  2QE7 H;  3RL0 D;  351C A;  2PAJ A;  4C46 A;  1NU1 K;  1T8Z A;  3MK7 C;  3AEG C;  1N7S D;  1A56 A;  1C6O A;  3WUU A;  5DJT B;  1CHJ A;  5DF5 A;  3TNU A;  3MIW A;  3L75 D;  3L73 J;  1H0T A;  1BCC E;  4EID A;  1ZR4 A;  1KTM A;  2H89 C;  1C6S A;  5KAF E;  1YI2 P;  4OH8 B;  1T3J A;  2V08 A;  4WQD A;  1ZV8 A;  1VPC A;  3WUV A;  4DY9 A;  3WFB C;  1BSN A;  2FY8 A;  1JY2 P;  1SFC D;  1FJK A;  2GC7 D;  3D6Z A;  1YIT P;  1VQ7 P;  2BCN B;  2K9J A;  1MZ4 A;  1N73 A;  1SVF A;  1AJY A;  3CD6 P;  1RF0 C;  1L9J C;  1NVO A;  1AOQ A;  1NTK G;  1JY3 O;  1LWU B;  1GU4 A;  2KSJ A;  1C6R A;  2P10 A;  1QN2 A;  2DVH A;  1HTL C;  1WT6 A;  3N7N A;  4FA1 A;  4P4Q B;  1ZRT E;  1L0N G;  2E75 C;  1GTW A;  3R2P A;  3Q5P A;  4I6M C;  1OW7 A;  2LXC B;  1DIQ C;  1H9Y A;  4W80 A;  4M3L A;  1JEK A;  3CXH I;  2I8F A;  3C2C A;  2NPS A;  1LC1 A;  1BE3 E;  1PPJ E;  5CIB B;  1OVR A;  3PJS K;  1QL4 A;  4U3F G;  1SQB D;  2KI7 B;  3RK2 D;  3Q2Y A;  2N1T A;  2ZJS E;  3TGU D;  3G9R A;  1N15 A;  3ZOW A;  2N3B A;  4IFD K;  2NRG A;  2W8Z A;  1RQV A;  1BGY J;  2IPP A;  1J1E B;  2ZXX A;  4YE1 A;  2O01 H;  1S3J A;  2A45 I;  1G1I A;  2O1K A;  1NTM G;  2M5A A;  3AE1 C;  1CSW A;  1HCM A;  2FXM A;  1N73 C;  3BCC E;  1X8Y A;  1MG2 D;  2RN0 A;  2OYI B;  1H8A A;  1HZV A;  1L0N J;  1SQX D;  2Q3E A;  1SS1 A;  1GDT A;  2Q5U A;  1CHI A;  1U75 B;  3JC2 2;  4H44 D;  5AUR A;  1AOF A;  1DW2 A;  4Q5P A;  1KYO I;  3L71 G;  1CRJ A;  1VQN P;  2ZT9 D;  3O8Z A;  4YXD C;  1GU2 A;  1YQ4 C;  1PP9 G;  2WPS A;  3TYI A;  3P32 A;  3CP5 A;  5TIS H;  2ZON G;  4O9B A;  3P8M C;  1M6Z A;  3GMA A;  2JTI B;  4I2L C;  1GQ1 A;  1CCH A;  3RL0 g;  2NPS C;  3AE7 C;  4ASV A;  1EDK A;  1SQP D;  2VRS A;  2Y9Y A;  1IK7 A;  1WMK A;  3A7O A;  5KAF V;  1LJ2 A;  4UB8 E;  2N1T C;  1LTJ B;  4OVN F;  2Q1K A;  1CW5 A;  1FC2 C;  3CU4 A;  2AEJ A;  1RF1 B;  3A0B H;  4YPC A;  3M9Q A;  1COT A;  1DD4 A;  1L0L G;  4LC1 A;  5APV A;  4L73 A;  2HYN A;  2Q7C A;  1JY2 N;  4GKG A;  5KKZ B;  2B88 A;  1VQ4 P;  1RZ6 A;  2CE0 A;  2R44 A;  2FFD B;  1I8P A;  2QJY C;  3EQ2 A;  2KNC B;  1R8E A;  1M90 Q;  1VF5 D;  3H1I D;  1UII A;  1AVY A;  2WIT A;  1CHH A;  4W7Z A;  2C9X B;  1EZV D;  1FZG A;  1AQ5 A;  1S5L H;  1XTG B;  2YMY A;  1PP9 J;  1NU1 G;  2W83 C;  4BRY B;  3HD7 D;  3M0D A;  1N90 A;  1H89 A;  3A9F A;  2FXP A;  1S9K E;  1ZW0 A;  2N9Y B;  4AQR D;  1NML A;  4K3I A;  3H1L G;  2KS1 A;  2HFE D;  2Y0D A;  4L3G A;  4K35 A;  4JF7 A;  1PL5 A;  4HH2 A;  1CXC A;  2E74 D;  4OGQ D;  1LWU A;  3I55 P;  1JNM A;  2BGV X;  1RAP A;  1T2K C;  2N18 B;  2PCB B;  5CCH A;  3H1H D;  3ITK A;  4AAN A;  2BEQ D;  4PV1 C;  3FXD A;  3A0H H;  1HH0 A;  3U1C A;  2PP6 A;  2XU6 A;  3L72 G;  1QVF O;  4IL6 H;  3ZCF A;  1EDI A;  5AVQ B;  2OQQ A;  3B4S A;  1DVV A;  3AE4 C;  4GDO A;  3GLM A;  2YXR B;  1Y9B A;  3WUT A;  1GW3 A;  3CX5 E;  3CCU P;  1GIW A;  1OCD A;  4PJ0 H;  1L4A A;  1QX8 A;  4AAO A;  4FAV A;  1CRY A;  5C0Z A;  1Q81 Q;  5AVV B;  1NU1 J;  3N4X A;  2M0B A;  2E5T A;  2OYO A;  2L91 A;  3HE5 B;  1J2J B;  1NAF A;  4QMA A;  2IBZ G;  3H1K E;  3M0D C;  4WY4 D;  1CTZ A;  5CMZ A;  3CCL P;  3WFC C;  2OYI A;  3AEF C;  3MHV A;  1LWU C;  4DOJ A;  3AEB C;  1KQF B;  2MJZ A;  5CCH C;  1M70 A;  1AQT A;  1M56 D;  1SQX J;  3DMI A;  1YTZ T;  4ZNC A;  5B66 E;  3D71 A;  3GF3 A;  3S1K A;  2JR8 A;  2YKP A;  4WQ9 A;  4WQE A;  3NMD A;  2V7Q J;  2QIW A;  4UB8 V;  4PD4 I;  3V6I A;  5H2F E;  4I1L A;  5APX A;  3AE8 C;  1NTZ E;  1OZH A;  5CIG B;  1SQQ E;  3SWK A;  1H32 B;  3V4W A;  2B9B A;  2E75 B;  1PZQ A;  3VMY A;  3B5N D;  2V07 A;  4IFM A;  2FYU D;  3Q3D A;  2LXB A;  3SWY A;  5CIH B;  5KJ7 A;  4H0J A;  4KT0 J;  1NGM B;  1L4A C;  2YIU B;  4WBA A;  5B5E H;  4XE5 B;  1SQP J;  3R4Y A;  1LTJ A;  3RK3 D;  5CIC B;  1U7M A;  1FS0 E;  3MTU E;  1RF1 A;  3OJA B;  2E76 C;  2A06 D;  1IZN B;  5KLV E;  3S4R A;  1UIX A;  2OTJ P;  5AW0 B;  1L0N K;  3L70 G;  3CCE P;  1IQC A;  1P84 H;  1A8C A;  1J1E C;  3JSV C;  1OAE A;  2AEM A;  1IO3 A;  4KHX A;  2G3A A;  2KNC A;  2BLF B;  5CBN A;  1SQV D;  3AED C;  2OZ1 B;  1OIP A;  3FWL A;  3CWB E;  1IFN A;  4DT0 A;  4PWA A;  2OYI C;  2FBW C;  2IX7 C;  2QSI A;  4FA9 A;  3PLN A;  2A06 E;  2K9J B;  1M1J A;  1GU5 A;  2W6J H;  2V4H A;  4IFF A;  3HQ6 A;  2QA4 P;  1U74 B;  4BRY A;  4Y28 J;  3D6Y A;  2ZYD A;  3AEA C;  4A7P A;  2KUB A;  1J1D B;  4WB4 A;  2OTK E;  1N8R Q;  1EB7 A;  3CXH E;  1VQL P;  3G6E P;  1OX3 A;  3ZIY A;  3LIE A;  1IO4 A;  4AAL A;  1W5C E;  3NXS A;  1M60 A;  1MZ9 A;  4AUW A;  3VP8 A;  5KJ7 C;  1FE6 A;  4JYB A;  3H1H J;  2WMM A;  1LTJ C;  3K5B A;  2YO2 A;  3KZI H;  1CI6 B;  3E7K A;  4L76 A;  1RF1 C;  1E79 H;  1KYO D;  4LJI A;  1NYH A;  3CC7 P;  3DP5 A;  5KKZ C;  1H31 B;  3UIA A;  4AYC A;  2P1J A;  1IK9 A;  5CJ4 A;  3D70 A;  2YO3 A;  1YIC A;  1FOS F;  1NHL A;  1VYD A;  1L9B C;  1JUN A;  5B66 H;  1Y8A A;  5AW7 B;  2FRC A;  3CYT I;  2FWL A;  1KV4 A;  3HE5 A;  2M5A B;  3L73 G;  5C39 A;  3CX5 I;  5CIF B;  1M1J C;  1VL2 A;  4GIF A;  4K3A A;  5B66 V;  2NZ2 A;  1E29 A;  5AW3 B;  3WU2 E;  1DD3 A;  5H2F V;  1HGZ A;  2ZVN B;  2EXV A;  1URQ D;  2L4D A;  3HQ7 A;  1QEX A;  1CCR A;  3MUD A;  1ZZH A;  2HPC B;  2N18 C;  4D6T J;  2YKQ A;  4WQC A;  4GOF A;  2QRX A;  1IFM A;  3RMZ A;  1NTK E;  4DZO A;  1BCC D;  1W2B O;  1PV3 A;  1HJB A;  4WVZ A;  5BU8 B;  1M1K Q;  5AW5 B;  2OYH A;  4DCK A;  5DJQ B;  3M91 A;  1L0N E;  1JDL A;  1K04 A;  5AW1 B;  2LKM A;  1SQB K;  1C2R A;  4GOD A;  4EOT A;  3VMZ A;  2FYU J;  2PRR A;  1FZC B;  3MGN A;  5APY A;  1KX2 A;  1LP1 B;  4B86 A;  2WPQ A;  2I1K A;  2YKO A;  1CIF A;  3M97 X;  4H0L B;  4U3F E;  1K05 A;  4JYC A;  1SQX K;  1WVE C;  2OZ1 A;  2XDJ A;  5L8R J;  1NNO A;  1JMM A;  2R32 A;  1Q82 Q;  4JPZ B;  1ZXG A;  1ZRT D;  2D2C B;  2P2U A;  3MUD C;  4RKU J;  1NTM E;  1RE3 A;  1BGY G;  3HTK A;  2GB8 B;  2KS1 B;  3B8E B;  155C A;  4BWN A;  1CRG A;  3F89 A;  4DJG A;  1WEJ F;  1QYZ A;  2A45 H;  2CK3 H;  1FI3 A;  1ZME C;  5KTB A;  1FI9 A;  1BE3 D;  1YIQ A;  1PPJ D;  2ZOO A;  1SQP K;  4RSZ A;  2NPS D;  2OYH C;  3NWV A;  1HBW A;  1I5T A;  4L74 A;  1NMI A;  2MTA C;  5APQ A;  3L71 E;  3FXE A;  4KJM A;  4WQB A;  3VTP C;  1KD1 Q;  1FBM A;  5GTI E;  1PP9 E;  5AVT B;  2N1T D;  5C9M A;  5AW6 B;  4RJT A;  2HR3 A;  2YIU C;  1KYO H;  3SFE C;  3E1R A;  3II6 A;  4ZKP A;  1LTS C;  3C8V A;  3CCJ P;  1CI6 A;  1SLQ A;  2I1J A;  1CSB A;  3TF5 A;  1L4A B;  5APU A;  3U59 A;  3CLQ A;  1X9V A;  3BCC D;  2B10 B;  3H1J J;  1Q86 Q;  2PAC A;  1H31 A;  2BCC G;  4RES B;  1H9X A;  3WU2 V;  1OW8 A;  1EXJ A;  3A3Y B;  2E76 B;  1L0L E;  1AFO A;  2JWA A;  1GMJ A;  3P8C E;  4Y99 B;  1DEB A;  1KIB A;  4TLF A;  3CL3 D;  1M57 D;  1RE3 C;  2B12 B;  4PD4 E;  1YJW P;  3KPE A;  1E2R A;  3L75 G;  1BDD A;  3C9I A;  1S1C X;  1J1D C;  5AVS B;  3L4M A;  1JM0 A;  2AEF A;  2HG5 D;  4EDF A;  2O01 J;  1RAQ A;  1T2K D;  1MUU A;  1BL9 A;  1W2E A;  2H43 A;  1L2P A;  1NU1 E;  4FAN A;  2HPC A;  4PV1 D;  1NKZ B;  1KIL B;  3JBT B;  3H1L E;  2C1D A;  5KAF H;  2J58 A;  1JY3 P;  1GK4 A;  1NAY A;  2BCC J;  1AVO A;  1HUC A;  1MKM A;  3G3Z A;  1BCC J;  3V4Q A;  1CTJ A;  2ZXY A;  3RN1 A;  1KZU B;  3L72 E;  1Y47 A;  1HF9 A;  1H33 B;  2HOD B;  1ZOY C;  2IZ0 A;  2JEE A;  1FZC A;  2AXC A;  1KOR A;  3VOP A;  4J20 A;  4H0K A;  1LP1 A;  1BDC A;  1CC5 A;  2K88 A;  3L75 J;  2FKW B;  1S9K D;  1EXI A;  4FB1 A;  2GC4 D;  1QGK B;  1U57 A;  2QM7 A;  3CCV P;  4FA5 A;  4N0K A;  3Q1M A;  3L4O A;  3E1I A;  2QEX P;  1I55 A;  4C7N A;  2C9L Y;  1EDL A;  2W27 A;  2JDI H;  5GTH E;  1M1J B;  2Y9Z A;  4O1Q A;  2QG4 A;  3D0W A;  1FJ0 A;  1PIX A;  5CCH D;  1SQB G;  1RHZ B;  3AEC C;  3V2R A;  2IBZ E;  1HH7 A;  1VQ6 P;  3TGU G;  2XKM A;  1GL2 B;  5GTI V;  2C2C A;  3T97 A;  451C A;  1QL1 A;  1FDI A;  2FYU K;  3CX5 D;  2W90 A;  2JQR A;  3L37 A;  5APT A;  2WPR A;  5DJQ C;  1LNQ A;  4JBZ A;  1LFM A;  3VNW A;  1USD A;  2K1A A;  1SQX G;  4HJG H;  2M3B A;  4EI2 A;  1X79 B;  2DW3 A;  1FZC C;  1DW3 A;  1A02 J;  3L70 D;  1EQ7 A;  3BRV B;  5AW9 B;  1USE A;  3H1K D;  1FZF A;  1ZN5 A;  4H0L C;  1GD2 E;  5IY5 1;  2IFN A;  3O20 A;  3AE9 C;  1YEB A;  1SQB J;  3CC4 P;  4N3Y B;  1JOC A;  2OAR A;  3TGU J;  1SQP G;  3NFQ A;  3L70 E;  1K8A Q;  3SLE A;  3PRJ A;  1AV1 A;  3CCM P;  4I7Z B;  2D2C C;  3L74 D;  3O0R C;  2LR2 A;  1FHB A;  3L35 A;  1NTZ D;  3CME P;  1SQQ D;  4N78 E;  5KAI E;  1CIG A;  3RN0 A;  3KDP B;  4UB8 H;  2C1V A;  4NFG B;  1KB9 E;  2YQB A;  3LW5 H;  4H13 B;  2YCC A;  1DII C;  1VF5 C;  1JY3 N;  3SWF A;  4WQ7 A;  1OVV A;  4ZKU A;  1TU3 F;  2GUV A;  4N6J A;  2PGD A;  3L74 E;  3B71 A;  5KJ7 D;  2O3J A;  1KIL A;  2G8Y A;  3H1I G;  1FAV A;  3BRT B;  3WUI A;  2QJK B;  1EZV G;  2R5B A;  3SSU A;  2RKL A;  1KIL E;  2OYH B;  5KLV D;  1YQ3 C;  4UB6 E;  5AVW B;  4R4L A;  2DGE A;  2XV5 A;  1GDV A;  1VQ9 P;  4YTP C;  2Q6Q A;  2WSS H;  3KQG A;  2J5U A;  1GKS A;  2B4Z A;  1H33 A;  2HOD A;  3CWB D;  5AVZ B;  1FZE A;  3IAO A;  3OAK A;  3SXT A;  1A02 F;  3CCS P;  2OTL P;  3H1H G;  3L73 D;  3JCU E;  5GTH V;  4XA4 A;  3BAT A;  4Y99 C;  1FDM A;  3CMA P;  2N9I A;  2XND H;  2M3E A;  3RL0 B;  1RZ5 A;  4L3H A;  5BU5 A;  2Z5H A;  1MV8 A;  3CXH D;  4NPE A;  1VQO P;  1N7S B;  1M8O B;  4O1W A;  3M9H A;  3ORV A;  3H1I J;  2B89 A;  3NBT A;  2Y0C A;  3L73 E;  3MP7 B;  3KHU A;  3HTK B;  3I56 P;  2JO1 A;  1NIR A;  4ASW A;  2BPB B;  1HWT C;  1KIL C;  1GL2 A;  1C2N A;  3KYQ A;  3CX5 H;  3CPW O;  1E8E A;  1C52 A;  2WSE H;  1NJI Q;  2GIW A;  4TT3 H;  3CXH W;  1N9C A;  1GZL A;  1SFC B;  1DIP A;  3M0A A;  1R0Q A;  2IBZ I;  3RBZ A;  3VYM A;  3HUS B;  2MKV A;  1VQ8 P;  2E5Y A;  2MHM A;  2LIR A;  2KK7 A;  3VYI A;  4GED B;  4D6T G;  1S6V B;  1XTC C;  3FGA D;  1G1J A;  3VMX A;  1CRH A;  1VQP P;  1N2D C;  1COR A;  5CCG A;  2IDB A;  5AW2 B;  1FZA A;  2WSC H;  2BH4 X;  1C75 A;  5M1B A;  1P84 I;  1S72 P;  1NO4 A;  2IFM A;  4CPG A;  1EZV I;  1R5S A;  1FI7 A;  5KAI V;  4XYD B;  2C0X A;  2FYU G;  5H2F H;  3VMA A;  1JY2 O;  2WSC J;  4WQA A;  1KQL A;  1BSH A;  1DX7 A;  1KYO W;  1NTK D;  1VQM P;  1NKN A;  3HQ9 A;  1N7L A;  1GL2 C;  2K3R A;  1CYC A;  1S2E A;  3RK2 B;  1KFM A;  2A06 G;  3IN6 A;  1VDF A;  1L0N D;  3GHG A;  3M06 A;  1NTZ J;  4UB6 V;  3F5H A;  2E75 D;  1BGY E;  1RH5 B;  2WSF H;  1HJ0 A;  2C1D B;  1SQV G;  3SWS A;  3V2P A;  2CXB A;  3DR0 A;  2RH0 A;  1G2C B;  3EFG A;  1KB0 A;  2FXO A;  1KB9 I;  4U3F D;  2KSE A;  4LGD E;  2WSF J;  2WT7 B;  5KLV J;  2E43 A;  5CCG C;  1LTI C;  3NBS A;  1URQ A;  4H44 B;  1YEA A;  1PGQ A;  1A2S A;  4EIE A;  1JTH B;  5K5G B;  1FU1 A;  1CO6 A;  2ZT9 B;  1VQK P;  2A45 G;  4GOE A;  1NTM D;  2LIT A;  3CWB J;  2KLV A;  2ZYG A;  3CXH H;  2M8R A;  2B11 B;  1OWA A;  2WQY C;  4I7Z C;  2BCC E;  2WVR A;  3S9O A;  2I8D A;  1VQ5 P;  2AI5 A;  4L1Q A;  4C7N B;  3BVH A;  3O6Q B;  3H1J G;  1N7S A;  1RE4 A;  1LT9 B;  1M7L A;  1I6E A;  5TIS E;  4LLH A;  4L75 A;  1SQV J;  3L71 D;  3GHG C;  1MG3 D;  2ZVO B;  2YMK A;  2ZBO A;  4H13 C;  1N86 A;  1EDJ A;  1PP9 D;  5CID B;  3L75 E;  3AE5 C;  3T97 B;  2Z4E A;  4QAO A;  1CZQ A;  1IRW A;  1GW4 A;  3O5C A;  2QJK C;  4AX3 A;  1VF5 B;  1CED A;  3PXS A;  1KV9 A;  5CYT R;  1KFN A;  3A0B E;  1KMI Z;  4AAM A;  2Q3I A;  2JKV A;  4OWF A;  3AE6 C;  3VN0 A;  1SFC A;  1IFJ A;  2KZI A;  2XTS B;  1DT1 A;  2GA1 A;  3HUS A;  1URQ C;  4W7Y A;  2ORL A;  5APS A;  1L0L D;  3MD0 A;  3HD7 B;  1IFP A;  3P8C D;  1W2L A;  3VP9 A;  1D7M A;  1EC5 A;  1GJQ A;  3W68 A;  3WU2 H;  1RY3 A;  2WZ7 A;  2E74 B;  4OGQ B;  3IFM A;  1S5L E;  4PD4 D;  3PH0 A;  1LMS A;  1K3H A;  2C1U A;  3RL0 C;  1BCC G;  5DJU B;  3M9B A;  1CYJ A;  1QLE D;  1CXA A;  1HRC A;  1N7S C;  2BH5 X;  2P58 A;  1RE4 C;  3ZBM A;  2FYZ A;  1NU1 D;  1YTC A;  2KZJ A;  1JB0 J;  2JJL A;  2CA4 B;  3A2A A;  1ZLL A;  4JCG A;  3H1L D;  2QJP B;  3FX0 A;  2GM4 A;  3C1L A;  3A0H E;  1NWQ A;  4WQ8 A;  4IL6 E;  2K9Y A;  1NTK J;  3FWN A;  4GT1 A;  3TDK A;  4HYT B;  3P7K A;  1SQB E;  3L72 D;  3GW6 A;  2IZ1 A;  2CE1 A;  2N9B A;  1PGP A;  1KN7 A;  3TGU E;  1LC2 A;  1SFC C;  2BAS A;  1E5W A;  4PJ0 E;  3BAS A;  2FYN B;  3HUS C;  2J59 M;  1YBK A;  1FZB A;  1PGJ A;  1YTZ I;  4WY4 B;  3SFD C;  3ZOY A;  1G2C A;  3QWO C;  2C9N Y;  1PFI A;  1FCD C;  3AE2 C;  1S4X A;  1HVV A;  2WT7 A;  1IC2 A;  2O01 N;  5KLI B;  2H7H A;  4H0L D;  4ZMD A;  2W6A A;  2P7J A;  5CHX A;  4U3F J;  1SQX E;  3Q5S A;  1LT1 A;  3RLM A;  2N9J A;  3HE4 B;  1JTH A;  3X39 A;  1BE3 G;  2D0W A;  3WFE C;  1PPJ G;  2P67 A;  1LTA C;  1CRI A;  5TIS V;  2CPB A;  3PXT A;  4NPF X;  2IBZ D;  3WC8 A;  2D2C D;  1YCC A;  4EIF A;  3B5N B;  1NTZ K;  2W6B A;  1SQQ K;  1NTM J;  3U1A A;  1F1F A;  4FA4 A;  1Q90 D;  1CSV A;  3KXD A;  4U7J A;  3O6Q A;  3V2N A;  1YFC A;  2Y0E A;  1SQP E;  1LT9 A;  2JWD A;  5GTI H;  1DW1 A;  3RK2 C;  1FOS E;  3OCD B;  2GUS A;  3IF4 A;  3RK3 B;  3A0B V;  3V2Q A;  3BCC G;  1P84 D;  2IYO A;  2VHD A;  2UWJ E;  3RGU A;  3L71 J;  3VRD A;  5KLV K;  5B5E E;  1Q2N A;  1H1O A;  3SVW A;  1CNO A;  4HKZ H;  2ZXE B;  2JP3 A;  2RMZ A;  3PH2 B;  1QKS A;  1OW6 A;  1BE3 J;  2D0S A;  1S5L V;  1X22 A;  2B87 B;  5AW4 B;  1P84 E;  1L4A D;  1Q7Y Q;  2ITA A;  3H1I E;  1FDO A;  2H8P D;  2ZZS 1;  4PW9 B;  4NPD A;  1EZV E;  3AEE C;  4H44 C;  3V5B A;  2YXQ B;  1OFC X;  1YNR A;  3HD7 A;  3PTZ A;  4PD4 H;  2XNX A;  3AE3 C;  3OA8 B;  2E76 D;  2O1J A;  1T3U A;  2ZT9 C;  2AXT E;  1L0L J;  3A5T A;  3ZOX A;  3PHL A;  2BEZ F;  4HB1 A;  5AW8 B;  1GK6 A;  3CX5 W;  1SQV K;  1W5C T;  1KC8 Q;  1LS9 A;  4N78 D;  1C7M A;  2WTY A;  3A0H V;  1AKK A;  3MK7 B;  3BCC J;  4IL6 V;  1KB9 D;  1LTG C;  5AVR B;  3H1H E;  2PFX A;  1CSU A;  1LT9 C;  1IFD A;  3LID A;  5CBO A;  3I5C A;  4PJ0 V;  1JCC A;  1DEE G;  1PGO A;  1KIL D;  1AYG A;  1F1C A; 
#chains in the Genus database with same CATH homology
 1CRH A;  1ZRT D;  1SQP D;  5B6Q A;  1COR A;  5KAF V;  2GB8 B;  2BH4 X;  1C75 A;  155C A;  4D6T D;  1CRG A;  1WEJ F;  1QYZ A;  3CU4 A;  3WFD C;  1I54 A;  1FI3 A;  1FI9 A;  1FI7 A;  1COT A;  1BE3 D;  5KAI V;  4XYD B;  1YIQ A;  1PPJ D;  2ZOO A;  5KKZ B;  4RSZ A;  3NWV A;  1RZ6 A;  2CE0 A;  5EXQ A;  1I5T A;  1NMI A;  5CIE B;  2MTA C;  1CIH A;  1I8P A;  2KNC B;  4WQB A;  3VMA A;  3PXW A;  4WQA A;  3H1I D;  1KYO W;  1NTK D;  1CHH A;  3HQ9 A;  5C9M A;  2C9X B;  1B7V A;  1EZV D;  4RJT A;  1CRC A;  5DFS A;  1CYC A;  1CTY A;  1L0N D;  3TF5 A;  4UB6 V;  1N90 A;  3A9F A;  3BCC D;  2B10 B;  1QL3 A;  2PAC A;  1DW0 A;  1H31 A;  2N9Y B;  1NML A;  4K3I A;  1H9X A;  2KS1 A;  2C1D B;  3WU2 V;  2Y0D A;  1N50 A;  4L3G A;  3SWS A;  1CXC A;  2AIU A;  1HJ3 A;  2B0Z B;  2CXB A;  3DR0 A;  2BGV X;  1RAP A;  2N18 B;  2PCB B;  2JWA A;  5B5E V;  3H1H D;  1KB0 A;  3ITK A;  4AAN A;  1KIB A;  4U3F D;  3OCD A;  1ETP A;  3GG2 A;  2B12 B;  2N3Y A;  3ZCF A;  3NBS A;  1E2R A;  1YEA A;  1A2S A;  1CYI A;  4EIE A;  1DVV A;  3L4M A;  1CO6 A;  4EDF A;  1RAQ A;  1BL9 A;  1GIW A;  1NTM D;  1OCD A;  4EIC A;  2LIT A;  4FAN A;  1DVH A;  1IZL 0;  2AXT V;  2B11 B;  2YK3 A;  4AAO A;  3JBT B;  4FAV A;  1CRY A;  5C0Z A;  2C1D A;  2AI5 A;  4L1Q A;  1HJ4 A;  1CSX A;  1I6E A;  5TJH A;  4MU8 A;  2L91 A;  3L71 D;  1J3S A;  1I6D A;  1MG3 D;  3OA8 A;  1CTJ A;  2ZXY A;  3RN1 A;  2ZBO A;  1CTZ A;  1PP9 D;  1H33 B;  5CID B;  1HZU A;  3WFC C;  2PCC B;  3H1J D;  4QAO A;  1HRO A;  1FOC A;  4H0K A;  4J20 A;  1IRW A;  2HV4 A;  3O5C A;  4AX3 A;  1CED A;  1CC5 A;  3PXS A;  1KV9 A;  5CYT R;  3ZOO A;  1M70 A;  3SJL A;  3DMI A;  4XXL A;  1BGY D;  3KZI V;  4AAM A;  4WQ9 A;  4WQE A;  1CIE A;  4GYD A;  4FB1 A;  2GC4 D;  2XTS B;  4UB8 V;  1DT1 A;  3O1Y A;  4FA5 A;  4N0K A;  3L4O A;  1I8O A;  2ORL A;  5CIG B;  1L0L D;  1H32 B;  1I55 A;  1W2L A;  2V07 A;  2QJY B;  1GJQ A;  2FYU D;  4O1Q A;  2QG4 A;  5CIH B;  1FJ0 A;  1HJ5 A;  4H0J A;  1IRV A;  4PD4 D;  1HH7 A;  1LMS A;  2YIU B;  1K3H A;  5GTI V;  4KMG A;  2C1U A;  5CIC B;  2C2C A;  3HQ8 A;  5E79 V;  1CYJ A;  2CA3 B;  451C A;  1KX7 A;  2A06 D;  4Y5R A;  1CXA A;  1HRC A;  2BH5 X;  2C8S A;  3CX5 D;  3ZBM A;  4V2K A;  1NU1 D;  1IQC A;  2JQR A;  1A8C A;  1YTC A;  1OAE A;  5DJQ C;  1IO3 A;  2CA4 B;  4JCG A;  2BCC D;  2BLF B;  2QJP B;  3H1L D;  1SQV D;  2OZ1 B;  1LFM A;  3VNW A;  3FWL A;  4WQ8 A;  4PWA A;  1K3G A;  1DW3 A;  1H32 A;  351C A;  3L70 D;  4FA9 A;  3PLN A;  2K9J B;  3TDK A;  3MK7 C;  1A56 A;  1C6O A;  3HQ6 A;  3H1K D;  1CHJ A;  3L72 D;  1U74 B;  3GW6 A;  5DF5 A;  2CE1 A;  5IY5 1;  3O20 A;  3L75 D;  1LC2 A;  4A7P A;  1EB7 A;  2FYN B;  1YEB A;  3ZIY A;  4EID A;  3ZOY A;  3SLE A;  3PRJ A;  4AAL A;  1C6S A;  1M60 A;  2V08 A;  3L74 D;  3O0R C;  1FCD C;  4WQD A;  5KLI B;  1FHB A;  4DY9 A;  1NTZ D;  3WFB C;  1SQQ D;  1CIG A;  3RLM A;  3RN0 A;  2N9J A;  3X39 A;  2GC7 D;  2D0W A;  3WFE C;  2BCN B;  2C1V A;  4NFG B;  1KYO D;  2YQB A;  4LJI A;  1CRI A;  5TIS V;  3DP5 A;  1MZ4 A;  2YCC A;  1DII C;  3PXT A;  4WQ7 A;  2IBZ D;  1H31 B;  3WC8 A;  1L9J C;  2O3J A;  1AOQ A;  1YCC A;  4EIF A;  1YIC A;  3WUI A;  2QJK B;  1VYD A;  1L9B C;  1C6R A;  1QN2 A;  1F1F A;  4FA4 A;  2FRC A;  1CSV A;  5KLV D;  3CYT I;  1YFC A;  2DVH A;  2Y0E A;  4FA1 A;  2FWL A;  4P4Q B;  1DW1 A;  2DGE A;  3OCD B;  5CIF B;  3A0B V;  1GDV A;  5B66 V;  1P84 D;  1E29 A;  2VHD A;  1DIQ C;  1H9Y A;  1GKS A;  2B4Z A;  1H33 A;  5H2F V;  3CWB D;  2I8F A;  3C2C A;  3VRD A;  2EXV A;  1LC1 A;  2L4D A;  1H1O A;  5CIB B;  3SXT A;  3HQ7 A;  3SVW A;  1CCR A;  1ZZH A;  3L73 D;  5GTH V;  1QL4 A;  2N18 C;  1CNO A;  1SQB D;  2RMZ A;  3PH2 B;  1QKS A;  2N9I A;  3TGU D;  2D0S A;  1N15 A;  4WQC A;  1S5L V;  1RZ5 A;  4L3H A;  3ZOW A;  2N3B A;  3RMZ A;  3CXH D;  2ZZS 1;  4PW9 B;  1BCC D;  4O1W A;  1YNR A;  3PTZ A;  3ORV A;  5DJQ B;  4YE1 A;  3OA8 B;  1JDL A;  3NBT A;  2Y0C A;  3KHU A;  1CSW A;  1HCM A;  1C2R A;  3ZOX A;  3PHL A;  1MG2 D;  2RN0 A;  1NIR A;  3CX5 W;  1W5C T;  2BPB B;  1HZV A;  2Q3E A;  1SQX D;  1LS9 A;  1C2N A;  1C7M A;  3A0H V;  1KX2 A;  1E8E A;  1AKK A;  1CHI A;  1U75 B;  1C52 A;  3MK7 B;  4IL6 V;  5AUR A;  1KB9 D;  2GIW A;  1AOF A;  3CXH W;  1CIF A;  1N9C A;  3M97 X;  1DW2 A;  1CSU A;  4Q5P A;  1CRJ A;  1GU2 A;  1R0Q A;  3VYM A;  3TYI A;  2MHM A;  2LIR A;  3CP5 A;  2ZON G;  4GED B;  1WVE C;  1S6V B;  1M6Z A;  2OZ1 A;  4PJ0 V;  1NNO A;  2JTI B;  1GQ1 A;  1CCH A;  1AYG A;  1F1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...