1EZVD

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
b'MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ezvD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ezvD01
1N50A 2JWAA 1LS9A 1VYDA 1S5LV 1ZRTD 2N18B 3CWBD 1QL3A 2YCCA 1IRWA 4Q5PA 2BLFB 3SWSA 2KS1A 1FCDC 1R0QA 3PXWA 1KB9D 4GYDA 3HQ6A 3TYIA 2FRCA 3DR0A 1I6EA 1YFCA 1BL9A 3PH2B 1M6ZA 1L9JC 5DFSA 2KNCB 1ETPA 1SQQD 5CIDB 1I8PA 4EICA 4WQ7A 451CA 1LC1A 3TGUD 1CYJA 5KAFV 5KLVD 2GB8B 1NTKD 1KB0A 2N3BA 1A8CA 3ZBMA 5IY51 3O0RC 1CSWA 2C8SA 1H32B 1H33A 1CRIA 2CXBA 3L74D 2IBZD 1H9YA 1QN2A 1YEBA 3GG2A 4WQ8A 2AIUA 5AURA 2K9JB 4L3HA 3DMIA 1DIIC 2LIRA 2C1UA 2EXVA 4EIEA 2ZBOA 1KX7A 2GIWA 4WQAA 1CYCA 2DVHA 2C1VA 3JBTB 1H31B 5TJHA 1WVEC 1YIQA 1F1FA 5CIEB 1NTMD 1I8OA 1EB7A 3ZOWA 1C75A 3CXHD 5CYTR 2MTAC 2B11B 5C0ZA 1N90A 2N18C 2N9JA 3CXHW 1DT1A 3C2CA 5DF5A 1H32A 1L9BC 2Q3EA 1I55A 1HCMA 1S6VB 4XXLA 1JDLA 4V2KA 1IRVA 2BPBB 3H1LD 2CA4B 1LFMA 4PWAA 3RN0A 1CHIA 1NMIA 3RN1A 3H1JD 1IQCA 1N15A 2B4ZA 2CE0A 2QJYB 1LC2A 2ZONG 5C9MA 1MG3D 4YE1A 1NNOA 1BGYD 4FAVA 2Y0CA 2BGVX 1HJ5A 3L71D 3NBTA 1CXCA 4O1QA 1J3SA 1KX2A 1SQBD 3L70D 5KKZB 1CSVA 1FHBA 3CP5A 2V07A 2FWLA 3ITKA 3RMZA 1CHJA 3CYTI 4O1WA 4Y5RA 1M60A 3PHLA 1U74B 4EDFA 2RN0A 3VYMA 2CE1A 2XTSB 3ZCFA 3WUIA 1I54A 1NTZD 1RAQA 1CXAA 4WQBA 1KYOD 1YNRA 3ORVA 4UB8V 4FA1A 5DJQB 1E29A 3A9FA 1HZVA 1KYOW 1QKSA 3H1ID 1FOCA 2L4DA 2VHDA 1MG2D 1YEAA 2BCNB 1HZUA 2JQRA 1CIHA 3O1YA 3PLNA 1QYZA 4H0JA 3FWLA 4KMGA 3HQ7A 4D6TD 5EXQA 4AX3A 1FI9A 3L72D 4QAOA 2LITA 2C2CA 1U75B 3WFDC 3ZOXA 1DVHA 3X39A 5CIFB 3H1HD 1RZ5A 1CRHA 1C6RA 3TF5A 1GIWA 4EIDA 1P84D 3L75D 3A0HV 2ORLA 1CIFA 1AKKA 3H1KD 1NMLA 1I6DA 1DW3A 3ZOYA 4FB1A 4UB6V 1OAEA 1CYIA 4WQEA 1A56A 1M70A 5KAIV 1C2NA 3GW6A 1H9XA 1CCRA 3DP5A 1OCDA 2BH4X 4AAOA 3PXSA 1CRCA 2Y0EA 1DW0A 2OZ1A 3SLEA 2V08A 4LJIA 3ZOOA 4PW9B 2B0ZB 3VMAA 1CSUA 3WU2V 1HROA 1CTJA 1FJ0A 1YCCA 2FYUD 2L91A 2ZOOA 1AOQA 2Y0DA 3PRJA 1CCHA 1GU2A 5DJQC 1PPJD 2PCCB 1C6OA 1MZ4A 1CHHA 4XYDB 1DVVA 1IZL0 3HQ9A 1HJ4A 4PJ0V 2O3JA 1CTYA 2I8FA 3OA8B 4WQ9A 1B7VA 1GQ1A 1GKSA 3OCDB 2N3YA 3NBSA 4RSZA 2C9XB 3M97X 2N9YB 4J20A 5B66V 4GEDB 1H1OA 2AXTV 3SVWA 1RAPA 2D0WA 1CRJA 4NFGB 3O5CA 3WC8A 4AANA 2CA3B 1I5TA 1RZ6A 5CIBB 1KIBA 1SQXD 4IL6V 1K3GA 2GC4D 5B6QA 1YICA 4L1QA 1W5CT 5TISV 3CU4A 5KLIB 1FI3A 2GC7D 3RLMA 1NU1D 2HV4A 2FYNB 1DIQC 1N9CA 1DW2A 4U3FD 2ZXYA 2C1DB 1CRGA 4WQDA 1QL4A 1CRYA 2PACA 2QG4A 1WEJF 1CORA 2YK3A 4L3GA 1NIRA 4FANA 1CEDA 3OA8A 1L0ND 2AI5A 4FA9A 1CO6A 1A2SA 1L0LD 3OCDA 1FI7A 1E2RA 2PCBB 4P4QB 2JTIB 2OZ1B 3WFCC 1KV9A 5CICB 3SXTA 1EZVD 1SQVD 4AAMA 1CC5A 4N0KA 1CIGA 3L4OA 3KHUA 3PTZA 3PXTA 2N9IA 155CA 1PP9D 4FA5A 1IO3A 2BH5X 4FA4A 1HH7A 2QJPB 4PD4D 3VRDA 1E8EA 5GTIV 5E79V 4WQCA 3A0BV 2D0SA 2A06D 3MK7C 1K3HA 1YTCA 1COTA 2B10B 1C7MA 2ZZS1 2C1DA 4A7PA 1CIEA 4K3IA 1GDVA 1ZZHA 3WFBC 2B12B 3CX5D 5B5EV 4EIFA 1W2LA 1C6SA 1BE3D 3L73D 3NWVA 2QJKB 1F1CA 1SQPD 2YQBA 3CX5W 3ZIYA 1LMSA 1DW1A 1CSXA 3KZIV 3BCCD 2DGEA 1CNOA 4AALA 5GTHV 1AOFA 3L4MA 4H0KA 4RJTA 1BCCD 3MK7B 2MHMA 3HQ8A 3VNWA 2RMZA 1C2RA 1C52A 1AYGA 4DY9A 3TDKA 5CIGB 5CIHB 3WFEC 4MU8A 351CA 2YIUB 1CTZA 3SJLA 5H2FV 2BCCD 1H31A 1HRCA 1HJ3A 3O20A 4JCGA 1H33B 1GJQA
chains in the Genus database with same CATH superfamily
5KJ7C 2ZXXA 3GHGA 2BASA 3HE4A 3Q3DA 2E74D 1E5WA 2JWAA 1S5LV 2QJPC 3MHVA 4WWIA 2N18B 2W27A 1JEKA 5GTIH 1IRWA 2R3SA 4Q5PA 1LT9C 4L73A 5BU8B 1KB9D 4D6TJ 2M3EA 1Q7YQ 1M1KQ 3DR0A 1Y47A 2NPSD 3L72J 3CXHE 3TYYA 1IK9A 1M6ZA 1L9JC 3USSA 1SQQD 5CIDB 3D6YA 4YTPC 4ZKUA 4EICA 1KFNA 1MKMA 1LC1A 1YJNP 1NTKD 1U7JA 2E75C 3CCLP 1AVYA 3EQ2A 3G3ZA 1VQ7P 5IY51 2QJKC 1H32B 4HH2A 2IYPA 3H1LE 2A45H 4IFDK 3KZIH 2LXCB 2VRSA 3TNUB 4H44B 5AURA 1HBWA 3DMIA 3MGNA 2C1UA 2FYUK 2XKMA 1DX7A 2QM7A 4WQAA 2M5AB 2Q5UA 1L0NG 1K9MQ 2E74B 1H31B 1YYCA 1GD2E 1YIQA 1F1FA 5AVZB 2YXRB 1I8OA 1N7LA 4RO0A 2H89C 3HTKB 2R44A 4L76A 1SQXE 2B11B 1FBMA 3I56P 4DJGA 3CL3D 2NPSB 1DT1A 2WSCJ 2B87A 4Z1MH 2C9NY 3CXHH 1NU1E 2GUSA 2A06G 1JDLA 1K73Q 2Z5HA 3K5BA 1EDKA 3IF4A 3H1IE 2V4HA 3M9QA 5AW4B 1LFMA 2HFED 4ASWA 3KYQA 1N15A 1M1JC 2P1JA 2ZONG 1G2CA 4YE1A 1AJYA 1JNMA 1NNOA 2V7QH 2Y0CA 4HJGH 1HJ5A 3L71D 5CHXA 3P8CD 1S9KD 2Q1KA 1KX2A 4NPEA 5KKZB 2V07A 1S4XA 1FZCC 3ITKA 4OH8B 5CMZA 4GT1A 4W7ZA 3V4QA 3W67A 1L0LK 1PP9E 4PJ0E 3RBXA 1L0NJ 1FOSF 1RHZB 3CYTI 1NJIQ 1SP4A 3CCMP 3PHLA 1U74B 3L75E 1SQVK 4EDFA 5AW1B 3Q5PA 1IFIA 1AV1A 3VYMA 1LT1A 3WUIA 2FBWC 4XFJA 4WVZA 1NTZD 1FZFA 2WSEH 2FY8A 1YIJP 4IL6E 4UB8V 1RF1B 4EIJA 2BCCG 2VHDA 1FJPA 1QVFO 1HWTC 1USEA 1HZUA 1KZUB 2GA1A 2FYUE 3CWBG 3FWLA 4KMGA 1PPJE 1ZR2A 3RGUA 1N7SC 3M0DA 2OYHA 1LTJC 2KIKA 1A02F 2LITA 3G6EP 1U75B 3X39A 1SQPK 2QJYC 2J5UA 1WRGA 3CX5I 4QMAA 5KTBA 3IN6A 2WSSH 1CIFA 2YNYA 3I5CA 1GK6A 3TGUG 2A45G 3WUTA 1NH4A 3AEFC 3AEAC 1DW3A 3ZOYA 1NKZB 1CYIA 1C2NA 1S5LX 2PP6A 4HKZH 1CRCA 1N8RQ 4IL6H 1PL5A 2G3AA 2B0ZB 2BCCJ 2L5GB 1CSUA 5KLIC 1HROA 1CTJA 2L91A 5AVQB 2IZ0A 3PRJA 2PCCB 1K05A 1RE3A 3CWBJ 4XYDB 1CI6A 5KJ7D 4PJ0V 2M0BA 2RH0A 5KLVE 4WQ9A 1B7VA 4JYCA 1KILC 4GDOA 1GL2C 1ZOYC 1M57D 4K35A 3M97X 4H0LC 1VQKP 1SQQK 1WT6A 4TT3H 1EXJA 1NKNA 2FXOA 2YMKA 2IBZE 3O5CA 1HF9A 2CA3B 1NTKK 1RZ6A 1SQXD 4IL6V 5B6QA 1YICA 1URQD 3T97B 1LWUB 3H1LG 5H2FE 2A45I 1NU1D 5L8RJ 3A5TA 2FYNB 2JDIH 1U57A 1T6AA 3OW2O 4DCKA 1HGZA 1H89A 1CRGA 4WQDA 3AE5C 1CRYA 1WEJF 3CC4P 1CEDA 4L3GA 1SQBG 2W90A 3JCUH 3OA8A 4FA9A 1A2SA 3OCDA 1KFMA 1E2RA 4L75A 3FWNA 3CI9A 1KV9A 4W80A 3GHGC 1EZVD 1CC5A 3L4OA 1AFOA 3PXTA 2D2CC 155CA 1PP9D 1JY3P 1J1DC 1YITP 1UIIA 1HH7A 2H8PD 2QJPB 4WY4A 4PD4D 3VRDA 1FAVA 3RK2C 3CXHI 2ZT9C 3H1JE 1FOSE 2QIWA 3W68A 3H1IG 1H88A 1BGYE 2OTLP 2ZYDA 1AQTA 4A7PA 4AYCA 2FFDC 3H1LJ 3C9IA 1URQB 1CIEA 3HRNA 4K3IA 2KSJA 3V2RA 3O6QB 2B12B 5AVVB 3AE6C 5B5EV 1AVOA 3HUSA 1W2LA 3I55P 3G4SP 2QJKB 1SQBJ 2IFMA 3CX5W 1LMSA 3B5NA 1SFCA 3MIWA 1HVVA 3L75G 1SQQE 2PRRA 1CNOA 3SFDC 2Q6QA 4AALA 1EDLA 2G8YA 1AOFA 3KDPB 1YQ4C 2MHMA 1Q90D 2E5YA 2WSEJ 2RMZA 1NTZK 1S1CX 1AYGA 2OYIA 3Q5SA 5CCGA 2K3RA 1VQNP 5H2FV 2IPPA 3VP8A 4EI2A 1XTCC 3H1IJ 2O1KA 1T8ZA 2M8RA 3OJAB 2FYUG 3CCRP 1RF0A 3H1HE 1PPJG 2KB7P 3RL0D 1P84E 2BLFB 1WMKA 4AQRD 2KS1A 1NAFA 3JC22 4GYDA 4U7JA 1OZHA 2AEFA 3SFEC 3H1KE 1LTTC 2KNCB 4LC1A 3QH9A 4WQ7A 1KB9H 1X9VA 1UIXA 1N7SD 2KZIA 3NXSA 5KLVD 4GKGA 2GB8B 3HUSB 1CW5A 4K3AA 3O0RC 4RESB 1CSWA 1S72P 1CRIA 3BATA 3Q2YA 1M8OB 2QRXA 2IBZD 3MZWB 1VQLP 3E7KA 1QN2A 3GG2A 1FE6A 1GMJA 2K9JB 4U3FG 4L3HA 2P10A 1SS1A 1LTIC 1IFDA 3FX0A 2FYUJ 1L0LG 1WVEC 3VP9A 3LIEA 3WUVA 5AW6B 3V2QA 3OA7A 2LKMA 4H13D 1SQVG 1ZN5A 3ZOWA 1C75A 5CYTR 5AW7B 3RL0B 3A0HE 1P84H 1S5LH 4IL6X 5C0ZA 1OXZA 3EFFK 1JOCA 2N9JA 3CXHW 1H32A 3SWKA 2OYHC 2Q3EA 1HCMA 1Q81Q 4XXLA 1X0TA 2QVAA 5KAIE 3B4SA 1SQXK 3UIAA 3WMM0 3CCVP 1ZMEC 3TNUA 1J1EC 2P2UA 2K37A 1GL2D 3AE8C 2E76C 4H0LD 1LTJB 2CA4B 2OARA 4N3YB 3RN0A 2QM8A 1NMIA 3RN1A 1FJKA 3H1JD 1NU1K 2B4ZA 1LC2A 2QJYB 2H88C 1EC5A 5C9MA 1X22A 3RL0g 2M5AA 2XNDH 5K5GB 1JY2P 1BGYD 4FAVA 3NBTA 2ZYGA 2OTJP 4U3FJ 4PV1C 3AE2C 2HPCB 1FHBA 1BE3G 3HTKA 3RMZA 1OMIA 3TSIA 3M9HA 1SQPG 3N7NA 1L0LJ 4Y5RA 1M60A 2NPSA 2Z5IA 1SQVJ 5AVUB 1I54A 2MKVA 1RAQA 2XV5A 4H13B 5APQA 4TLFA 1ZR4A 1RE3C 1YNRA 2KOGA 1H8AA 1E79H 3A0HH 3LW5H 1NO4A 3V4WA 4YXDC 1NYHA 5TISE 1HZVA 2O1JA 2KXPB 2HODB 1KYOW 1QKSA 1JCDA 1FOCA 2OQQA 1NWQA 1HH0A 3AE7C 4UB8E 1IFPA 4Y99C 2I1JA 1W2EA 2BCNB 2GM4A 5KAIH 4IFFA 1N73B 2JQRA 2WTYA 1GL2B 3RK2D 2ZT9D 4H0LB 3VN0A 3L73E 1KMIZ 3PLNA 2WSFJ 3BCCE 4AX3A 1CZQA 1BCCE 5AW0B 1FDOA 3M9BA 1LTGC 1R5LA 3VOPA 3H1HD 1RZ5A 1CRHA 1DIPA 4HYTB 1BE3J 4KJMA 1P84D 1SQQG 3A0HV 1Q82Q 1SQPJ 2K1AA 1AKKA 3AE3C 1R8EA 1RF1A 1NTKG 3H1KD 2E5TA 1I6DA 2XDJA 1A56A 1M70A 1IZNB 5KAIV 3II6A 1H9XA 1OCDA 3L35A 5AVYB 2BH4X 1ZRTE 4N6JA 1GW3A 1BSNA 1LTAC 3SLEA 1VDFA 2V08A 4LJIA 3VMAA 2K88A 2ZYAA 1GTWA 3WU2V 1FJ0A 1YCCA 2E43A 1NVOA 1J1DB 3A2AA 2Y0DA 1GU2A 4UB8H 5DJQC 1MZ4A 3GF3A 3RK2B 2ZT9B 1K04A 3SWFA 2O3JA 1EZVE 1JTHB 1HJ0A 2N1TC 1GKSA 2CPBA 3NBSA 1L2PA 1FDMA 5GTHE 1RE4A 4J20A 2RKLA 2FFDB 1RY3A 3AE4C 1KB9I 1FZBA 5AVTB 4R4LA 2P7JA 2D0WA 4PD4E 3VMZA 3L74E 1CRJA 4NFGB 3WC8A 2IZ1A 5KLVK 5CIBB 1KIBA 3RK3C 1NTKJ 1U7MA 1GU5A 4L1QA 1HTLC 1OVVA 5TISV 1A02J 3CU4A 3CC2P 2BEQD 2FXMA 1DIQC 1J2JB 1GDTA 3L71G 1NTME 3HD7C 4GOFA 3LIDA 5CCGC 1VQ8P 5AW3B 1CO6A 1SVFA 3E1IA 5AW8B 4P4QB 2H43A 3WFCC 3SXTA 1IFMA 3PTZA 1P84I 2WZ7A 4FA5A 1NTZG 4JQ0D 4BRYB 5KAFE 1IO3A 2Q9IA 1FZAA 3T97A 1LWUA 1IO4A 3A7OA 5GTHH 3MK7C 4PJ0H 5CCHC 1L4AC 2WITA 1K3HA 1YTCA 4PD4H 4RKUJ 5AW5B 5C39A 3C1LA 1N2DC 4EOTA 1PIXA 1HJBA 2SPZA 2O01N 1IFJA 2O01J 1JCCA 1EDJA 2NRGA 2Y9YA 2C0XA 3JSVC 2E76D 3AE1C 3L71J 1MUUA 3AEEC 3L73D 3NWVA 3NTNA 1F1CA 2YQBA 1NGMB 4ZNCA 5KJ7A 1DW1A 1VQ9P 1CSXA 1VQOP 5B5EE 2KLVA 3BCCD 2K9YA 5GTHV 3L4MA 1BCCD 2JJLA 3NMDA 4NPDA 4PV1D 3LW5J 3M06A 1LT9A 1NTZJ 3TDKA 3SWYA 1VPCA 3WFEC 4MU8A 1URQA 3C8VA 4L74A 1HRCA 3TGUJ 3G71P 1VF5C 1H33B 1GJQA 3O6QA 3VTPC 3M0AA 1QL1A 3L72E 3V5BA 1ZRTD 5AW9B 1SLQA 2B89A 1QL3A 2R5DA 2YCCA 1MZ9A 2E75D 1HUCA 4OWFA 4AUWA 3SWSA 1R0QA 3PXWA 5APTA 3TYIA 1LGHB 1KC8Q 1BL9A 3PH2B 5DFSA 1RQVA 2QEXP 1JM0A 2XU6A 451CA 5KAFV 1YTZI 1KB0A 5B5EH 1Q2NA 3KQGA 1SQXG 3CMAP 3ZBMA 1DEBA 1KILE 2WMMA 1NOHA 2CXBA 4I7ZC 1T2KC 3L74D 1IK7A 1PGJA 2OTKE 1NU1G 2WVRA 1H9YA 2OYOA 1YEBA 4WQ8A 1BDDA 2IFNA 1LT9B 1DIIC 1GU4A 3P32A 5CBNA 4EIEA 2ZBOA 1M56D 4M3LA 1KX7A 1CYCA 2V7QJ 2DVHA 2C1VA 3JBTB 5TJHA 1BDCA 2YIUC 2KNCA 5H2FH 3MTUE 1QEXA 1NTMD 1EZVG 2ZXEB 2E75B 2YO3A 5KKZC 2IYOA 2MTAC 4Y99B 2WPVB 1N90A 1PP9G 4C7NB 1KQFB 3C2CA 5DF5A 1L9BC 3CCSP 4DOJA 4UB6E 1S6VB 2N1TD 1QL2A 1PFIA 1BSHA 2P67A 4LGDE 1TU3F 1SQXJ 2K9JA 4GIFA 4OGQC 2LR2A 1L0NE 1MG3D 1NU1J 2AXCA 1USDA 1Y8AA 1EDIA 3L70D 3WUUA 1PGPA 1S3JA 3CLQA 1YQ3C 3VMXA 2MJZA 3HD7D 1H0TB 4WBAA 2WSCH 2A06E 2UWJE 3U59A 2AXTE 4WQBA 5AVXB 1EZVI 1N7SA 1PP9J 4C7RA 3HE5B 1LTJA 1M1JB 4FA1A 2ZVNB 5DJQB 1E29A 3B8EB 1GZLA 3L75J 5M1BA 3FXDA 4I6MC 2P58A 4PD4I 2N1TB 4UB6H 5APUA 3CX5E 1PGQA 2R3CA 5APSA 4ASVA 1FZCB 1FS0E 2HPCA 3G9RA 4HB1A 5CCHD 4H0JA 1L4AD 2LXBA 3EWKA 3HQ7A 4ZMDA 4D6TD 5EXQA 4W7YA 2R5BA 2HLOA 3GMAA 1FI9A 1MFTA 3L72D 4QAOA 1Q86Q 3ZOXA 2C2CA 2B9BA 3WFDC 3H32B 1YJ9P 5CIFB 1C6RA 5DJUB 1GIWA 4EIDA 3VYIA 5AVSB 2ORLA 1LP1B 2QSIA 3VMYA 1DEEG 5KLVG 1JB0J 2HODA 5GTIE 3A0BE 4UB6V 2E42A 4WQEA 5DJTB 3GLMA 4YXWH 2AXTH 1GW4A 2KI7B 3TK1A 3DP5A 1FC2C 3M0DC 2XZRA 3AE9C 1N73A 2IBZG 1GL2A 3CWBE 2WT7B 2OZ1A 1Y9BA 2H7HA 4PW9B 4JYBA 3V6IA 1KILD 3M91A 1N7SB 2PGDA 1ZV8A 2ZOOA 2FYNC 1G1JA 4KHXA 1C6OA 3CX5H 1CHHA 1DVVA 3WU2E 1HJ4A 1VF5D 2I8FA 1L4AB 1GQ1A 4IFMA 2N3YA 3KZIE 3V2PA 4I2LC 3AEGC 1KN7A 1T3JA 2C9XB 5B66V 1H1OA 2AXTV 3SVWA 2KK7A 1RAPA 4YPCA 1OFCX 4AANA 1ZP0C 1I5TA 5KLVJ 1K3GA 2GC4D 1DH3A 2ZJSE 5KLIB 2GC7D 4KT0J 2HV4A 1IFNA 1YJWP 3H1JG 3A0BH 1N9CA 4IOIH 5AW2B 1BGYG 2D2CD 2ZXYA 5APYA 2C1DB 4B86A 3V2NA 3R2PA 3BVHA 1PZQA 4JBZA 4XA4A 2WPRA 2PACA 2IBZI 2QG4A 4BWNA 1T2KD 1NIRA 1JTHA 1KILB 1L0ND 2AI5A 1URQC 3D6ZA 1FI7A 1FDIA 2JTIB 2OZ1B 2R32A 5AVRB 2FFDA 2JKVA 1NTMK 4AAMA 3F89A 3KHUA 2N9IA 2OGUA 2WQYC 2XNXA 3WU2H 1KD1Q 1VF5B 4I1LA 3D0WA 2CPSA 2BH5X 4FA4A 3IAOA 2YKOA 1E8EA 5GTIV 3A0BV 2A06D 1RH5B 3AEBC 2YXQB 1X8YA 1C7MA 2J59M 1CSBA 1SQBE 2I8DA 3Q1MA 2JEEA 3S4RA 4N78D 3H1JJ 3CCEP 1JY3N 3GHGB 3WFBC 1VQ5P 3HE4B 3CX5D 1BGYJ 4WY4C 4EIFA 5TISH 4OGQD 1C6SA 2D2CB 3Q5RA 1VQPP 1NAYA 3H1HG 4I7ZB 4BRYA 1KYOE 3KZIV 2DGEA 3B71A 3IR9A 3NFQA 3VNWA 1QGKB 2Y9ZA 3H1KG 1C52A 2JO1A 4DT0A 2BEZF 4BXLA 5CIHB 1X79B 3A3YB 1SQQJ 3MUDA 351CA 2YIUB 1CTZA 2Z4EA 3HUSC 3SJLA 2BCCD 1MV8A 1W2BO 3O20A 3B5NC 1SFCC 2QE7H 1N50A 3P7KA 1LS9A 1VYDA 3PJSK 1D7MA 5AVWB 1JUNA 3CWBD 3S1KA 1S2EA 4DZOA 3FGAD 1FCDC 1JY3O 2OYIC 3HQ6A 2FRCA 5BVZA 1I6EA 1YFCA 1LTBC 1OW7A 3AEDC 1ETPA 4OGQB 1I8PA 1K8AQ 3H1HJ 1QLED 3TGUD 1CYJA 1YHQP 3RL0C 1KYOH 1RF0C 2N3BA 1A8CA 3P8MC 3H1KJ 2C8SA 2B87B 1H33A 1YI2P 1VQMP 3L37A 2IDBA 3H25A 2AIUA 3RK3E 2JR8A 2LIRA 3IFMA 2WPSA 5CBOA 2EXVA 2GIWA 1G2CB 1LTSC 4O9BA 1VQ4P 3L70E 2YO2A 1PGOA 4GODA 3PH0A 3EFGA 5CIEB 3RBZA 3MP7B 1EB7A 3CXHD 4MN4C 3L4FA 2J58A 2N18C 1T3UA 2WWWA 1I55A 2HG5D 3JCUE 4V2KA 1NHLA 1IC2A 1IRVA 2B88A 4H13C 4U3FE 3CCUP 2BPBB 3CPWO 3H1LD 3U1AA 4PWAA 1CHIA 1IQCA 4EYYQ 2CE0A 2W8ZA 1L0LE 5KAFH 5EFWB 3QWOC 2BGVX 4O1QA 1CXCA 2NZ2A 1J3SA 1SQVE 4D6TE 2Q7CA 1SQBD 1EXIA 1CSVA 3CP5A 1N73C 2FWLA 1L0NK 2W6JH 3L73G 1CHJA 4GOEA 4O1WA 4C7NA 2FKWB 3N4XA 2WPQA 2OYHB 3BCCG 4H44C 3OAKA 2RN0A 2CE1A 2XTSB 3ZCFA 1BCCG 2GUVA 2PFXA 1J1EB 1CXAA 2E76B 5APVA 1KYOD 1JY2N 3R4YA 2E74C 3ORVA 3L36A 3PP5A 3A9FA 2Q3IA 3H1ID 2L4DA 1M90Q 2HR3A 1MG2D 1YEAA 3SSUA 1KV4A 4PV1B 1RQUA 1FZEA 2NPSC 1CIHA 1BE3E 1R5SA 3O1YA 2W6AA 1QYZA 1SQPE 3AECC 2POHA 1H0TA 1DVHA 2HYNA 3TF5A 3L73J 4NPFX 3L75D 1FZGA 1CI6B 3HE5A 2W6BA 1AA0A 1M1JA 4OVNF 3BCCJ 1DD4A 4WY4D 4JPZB 1KTMA 1BCCJ 1G1IA 1NMLA 2JP3A 5E79E 4FB1A 1OAEA 3CCJP 3BRTB 1VL2A 2N1TA 3GW6A 2DW3A 1JY2O 1CCRA 1QX8A 3L74G 4AAOA 3PXSA 1FZCA 2Y0EA 3KPEA 1DW0A 3ZOOA 1KORA 2WSFH 3ZDMA 1KB9E 2FYUD 3S9OA 2N9BA 2ZVOB 1AOQA 1CCHA 3H32A 2ITAA 2ZAEB 1PPJD 2KZJA 1RF1C 4CPGA 2IX7C 1IZL0 3RK3D 3HQ9A 1NTMG 3B5ND 1SFCD 1CTYA 3OA8B 1HGVA 1LP1A 1MFZA 1NTKE 3OCDB 4RSZA 2N9YB 4GEDB 3HD7A 1OW6A 1AQ5A 2JWDA 5B66E 1KYOI 5CCGD 1KQGB 3BRVB 2WT7A 3D71A 2KP8A 4WY4B 1W5CT 1OVUA 1OWAA 1LJ2A 1JO5A 1FI3A 3E1RA 3RLMA 3H6PA 2KLUA 5E79H 1KQLA 4WB4A 3L74J 3CMEP 1DW2A 4N78E 2YKQA 4LLHA 1S5LE 4U3FD 2KUBA 1GK4A 2AEMA 1RE4C 1QL4A 4C46A 1ZW0A 3FXEA 2M3BA 1CORA 2YK3A 4FANA 5CCHA 3MUDC 1L4AA 3L70G 1DD3A 1L0LD 2PCBB 1OIPA 5CICB 2YKPA 1N86A 1SQVD 2KSEA 1OX3A 1ZLLA 4N0KA 1CIGA 3KXDA 5APWA 1NTMJ 3RK3B 1OVRA 2C9LY 3F5HA 3B5NB 1SFCB 1IJDB 2CK3H 1LNQA 5BU5A 3O8ZA 5E79V 2FYZA 4WQCA 2I1KA 2D0SA 1M7LA 3D70A 2C0WA 4XE5B 1W5CE 2BCCE 2OYIB 1COTA 3L71E 2B10B 3BASA 3HD7B 3P8CE 2ZZS1 2C1DA 1S9KE 5B66H 3ABVC 3GF7A 3U1CA 2AEJA 1JMMA 4R4MA 2KYVA 1KILA 1XTGB 5CJ0A 4JF7A 1GDVA 1YTZT 5CJ4A 1ZZHA 2FXPA 1OW8A 4D6TG 3CCQP 1SQBK 1LWUC 3L72G 1BE3D 4Y28J 1EQ7A 1NTZE 1SQPD 3L70J 3ZIYA 2KS1B 1PV3A 2ZFCA 1JMBA 1QVGO 4H0KA 4RJTA 3MD0A 3MK7B 3HQ8A 3TGUE 1ZXGA 1C2RA 4DY9A 2W83C 2YMYA 3CD6P 5CIGB 4H44D 1VQ6P 2PAJA 4ZKPA 1H31A 2QA4P 1Z56A 3CC7P 1YBKA 5APXA 1HJ3A 1FU1A 2O01H 4JCGA 1KQSO
chains in the Genus database with same CATH topology
1N50A 2JWAA 1LS9A 1VYDA 1S5LV 1ZRTD 2N18B 3CWBD 1QL3A 2YCCA 1IRWA 4Q5PA 2BLFB 3SWSA 2KS1A 1FCDC 1R0QA 3PXWA 1KB9D 4GYDA 3HQ6A 3TYIA 2FRCA 3DR0A 1I6EA 1YFCA 1BL9A 3PH2B 1M6ZA 1L9JC 5DFSA 2KNCB 1ETPA 1SQQD 5CIDB 1I8PA 4EICA 4WQ7A 451CA 1LC1A 3TGUD 1CYJA 5KAFV 5KLVD 2GB8B 1NTKD 1KB0A 2N3BA 1A8CA 3ZBMA 5IY51 3O0RC 1CSWA 2C8SA 1H32B 1H33A 1CRIA 2CXBA 3L74D 2IBZD 1H9YA 1QN2A 1YEBA 3GG2A 4WQ8A 2AIUA 5AURA 2K9JB 4L3HA 3DMIA 1DIIC 2LIRA 2C1UA 2EXVA 4EIEA 2ZBOA 1KX7A 2GIWA 4WQAA 1CYCA 2DVHA 2C1VA 3JBTB 1H31B 5TJHA 1WVEC 1YIQA 1F1FA 5CIEB 1NTMD 1I8OA 1EB7A 3ZOWA 1C75A 3CXHD 5CYTR 2MTAC 2B11B 5C0ZA 1N90A 2N18C 2N9JA 3CXHW 1DT1A 3C2CA 5DF5A 1H32A 1L9BC 2Q3EA 1I55A 1HCMA 1S6VB 4XXLA 1JDLA 4V2KA 1IRVA 2BPBB 3H1LD 2CA4B 1LFMA 4PWAA 3RN0A 1CHIA 1NMIA 3RN1A 3H1JD 1IQCA 1N15A 2B4ZA 2CE0A 2QJYB 1LC2A 2ZONG 5C9MA 1MG3D 4YE1A 1NNOA 1BGYD 4FAVA 2Y0CA 2BGVX 1HJ5A 3L71D 3NBTA 1CXCA 4O1QA 1J3SA 1KX2A 1SQBD 3L70D 5KKZB 1CSVA 1FHBA 3CP5A 2V07A 2FWLA 3ITKA 3RMZA 1CHJA 3CYTI 4O1WA 4Y5RA 1M60A 3PHLA 1U74B 4EDFA 2RN0A 3VYMA 2CE1A 2XTSB 3ZCFA 3WUIA 1I54A 1NTZD 1RAQA 1CXAA 4WQBA 1KYOD 1YNRA 3ORVA 4UB8V 4FA1A 5DJQB 1E29A 3A9FA 1HZVA 1KYOW 1QKSA 3H1ID 1FOCA 2L4DA 2VHDA 1MG2D 1YEAA 2BCNB 1HZUA 2JQRA 1CIHA 3O1YA 3PLNA 1QYZA 4H0JA 3FWLA 4KMGA 3HQ7A 4D6TD 5EXQA 4AX3A 1FI9A 3L72D 4QAOA 2LITA 2C2CA 1U75B 3WFDC 3ZOXA 1DVHA 3X39A 5CIFB 3H1HD 1RZ5A 1CRHA 1C6RA 3TF5A 1GIWA 4EIDA 1P84D 3L75D 3A0HV 2ORLA 1CIFA 1AKKA 3H1KD 1NMLA 1I6DA 1DW3A 3ZOYA 4FB1A 4UB6V 1OAEA 1CYIA 4WQEA 1A56A 1M70A 5KAIV 1C2NA 3GW6A 1H9XA 1CCRA 3DP5A 1OCDA 2BH4X 4AAOA 3PXSA 1CRCA 2Y0EA 1DW0A 2OZ1A 3SLEA 2V08A 4LJIA 3ZOOA 4PW9B 2B0ZB 3VMAA 1CSUA 3WU2V 1HROA 1CTJA 1FJ0A 1YCCA 2FYUD 2L91A 2ZOOA 1AOQA 2Y0DA 3PRJA 1CCHA 1GU2A 5DJQC 1PPJD 2PCCB 1C6OA 1MZ4A 1CHHA 4XYDB 1DVVA 1IZL0 3HQ9A 1HJ4A 4PJ0V 2O3JA 1CTYA 2I8FA 3OA8B 4WQ9A 1B7VA 1GQ1A 1GKSA 3OCDB 2N3YA 3NBSA 4RSZA 2C9XB 3M97X 2N9YB 4J20A 5B66V 4GEDB 1H1OA 2AXTV 3SVWA 1RAPA 2D0WA 1CRJA 4NFGB 3O5CA 3WC8A 4AANA 2CA3B 1I5TA 1RZ6A 5CIBB 1KIBA 1SQXD 4IL6V 1K3GA 2GC4D 5B6QA 1YICA 4L1QA 1W5CT 5TISV 3CU4A 5KLIB 1FI3A 2GC7D 3RLMA 1NU1D 2HV4A 2FYNB 1DIQC 1N9CA 1DW2A 4U3FD 2ZXYA 2C1DB 1CRGA 4WQDA 1QL4A 1CRYA 2PACA 2QG4A 1WEJF 1CORA 2YK3A 4L3GA 1NIRA 4FANA 1CEDA 3OA8A 1L0ND 2AI5A 4FA9A 1CO6A 1A2SA 1L0LD 3OCDA 1FI7A 1E2RA 2PCBB 4P4QB 2JTIB 2OZ1B 3WFCC 1KV9A 5CICB 3SXTA 1EZVD 1SQVD 4AAMA 1CC5A 4N0KA 1CIGA 3L4OA 3KHUA 3PTZA 3PXTA 2N9IA 155CA 1PP9D 4FA5A 1IO3A 2BH5X 4FA4A 1HH7A 2QJPB 4PD4D 3VRDA 1E8EA 5GTIV 5E79V 4WQCA 3A0BV 2D0SA 2A06D 3MK7C 1K3HA 1YTCA 1COTA 2B10B 1C7MA 2ZZS1 2C1DA 4A7PA 1CIEA 4K3IA 1GDVA 1ZZHA 3WFBC 2B12B 3CX5D 5B5EV 4EIFA 1W2LA 1C6SA 1BE3D 3L73D 3NWVA 2QJKB 1F1CA 1SQPD 2YQBA 3CX5W 3ZIYA 1LMSA 1DW1A 1CSXA 3KZIV 3BCCD 2DGEA 1CNOA 4AALA 5GTHV 1AOFA 3L4MA 4H0KA 4RJTA 1BCCD 3MK7B 2MHMA 3HQ8A 3VNWA 2RMZA 1C2RA 1C52A 1AYGA 4DY9A 3TDKA 5CIGB 5CIHB 3WFEC 4MU8A 351CA 2YIUB 1CTZA 3SJLA 5H2FV 2BCCD 1H31A 1HRCA 1HJ3A 3O20A 4JCGA 1H33B 1GJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N50 A;  2JWA A;  1LS9 A;  1VYD A;  1S5L V;  1ZRT D;  2N18 B;  3CWB D;  1QL3 A;  2YCC A;  1IRW A;  4Q5P A;  2BLF B;  3SWS A;  2KS1 A;  1FCD C;  1R0Q A;  3PXW A;  1KB9 D;  4GYD A;  3HQ6 A;  3TYI A;  2FRC A;  3DR0 A;  1I6E A;  1YFC A;  1BL9 A;  3PH2 B;  1M6Z A;  1L9J C;  5DFS A;  2KNC B;  1ETP A;  1SQQ D;  5CID B;  1I8P A;  4EIC A;  4WQ7 A;  451C A;  1LC1 A;  3TGU D;  1CYJ A;  5KAF V;  5KLV D;  2GB8 B;  1NTK D;  1KB0 A;  2N3B A;  1A8C A;  3ZBM A;  5IY5 1;  3O0R C;  1CSW A;  2C8S A;  1H32 B;  1H33 A;  1CRI A;  2CXB A;  3L74 D;  2IBZ D;  1H9Y A;  1QN2 A;  1YEB A;  3GG2 A;  4WQ8 A;  2AIU A;  5AUR A;  2K9J B;  4L3H A;  3DMI A;  1DII C;  2LIR A;  2C1U A;  2EXV A;  4EIE A;  2ZBO A;  1KX7 A;  2GIW A;  4WQA A;  1CYC A;  2DVH A;  2C1V A;  3JBT B;  1H31 B;  5TJH A;  1WVE C;  1YIQ A;  1F1F A;  5CIE B;  1NTM D;  1I8O A;  1EB7 A;  3ZOW A;  1C75 A;  3CXH D;  5CYT R;  2MTA C;  2B11 B;  5C0Z A;  1N90 A;  2N18 C;  2N9J A;  3CXH W;  1DT1 A;  3C2C A;  5DF5 A;  1H32 A;  1L9B C;  2Q3E A;  1I55 A;  1HCM A;  1S6V B;  4XXL A;  1JDL A;  4V2K A;  1IRV A;  2BPB B;  3H1L D;  2CA4 B;  1LFM A;  4PWA A;  3RN0 A;  1CHI A;  1NMI A;  3RN1 A;  3H1J D;  1IQC A;  1N15 A;  2B4Z A;  2CE0 A;  2QJY B;  1LC2 A;  2ZON G;  5C9M A;  1MG3 D;  4YE1 A;  1NNO A;  1BGY D;  4FAV A;  2Y0C A;  2BGV X;  1HJ5 A;  3L71 D;  3NBT A;  1CXC A;  4O1Q A;  1J3S A;  1KX2 A;  1SQB D;  3L70 D;  5KKZ B;  1CSV A;  1FHB A;  3CP5 A;  2V07 A;  2FWL A;  3ITK A;  3RMZ A;  1CHJ A;  3CYT I;  4O1W A;  4Y5R A;  1M60 A;  3PHL A;  1U74 B;  4EDF A;  2RN0 A;  3VYM A;  2CE1 A;  2XTS B;  3ZCF A;  3WUI A;  1I54 A;  1NTZ D;  1RAQ A;  1CXA A;  4WQB A;  1KYO D;  1YNR A;  3ORV A;  4UB8 V;  4FA1 A;  5DJQ B;  1E29 A;  3A9F A;  1HZV A;  1KYO W;  1QKS A;  3H1I D;  1FOC A;  2L4D A;  2VHD A;  1MG2 D;  1YEA A;  2BCN B;  1HZU A;  2JQR A;  1CIH A;  3O1Y A;  3PLN A;  1QYZ A;  4H0J A;  3FWL A;  4KMG A;  3HQ7 A;  4D6T D;  5EXQ A;  4AX3 A;  1FI9 A;  3L72 D;  4QAO A;  2LIT A;  2C2C A;  1U75 B;  3WFD C;  3ZOX A;  1DVH A;  3X39 A;  5CIF B;  3H1H D;  1RZ5 A;  1CRH A;  1C6R A;  3TF5 A;  1GIW A;  4EID A;  1P84 D;  3L75 D;  3A0H V;  2ORL A;  1CIF A;  1AKK A;  3H1K D;  1NML A;  1I6D A;  1DW3 A;  3ZOY A;  4FB1 A;  4UB6 V;  1OAE A;  1CYI A;  4WQE A;  1A56 A;  1M70 A;  5KAI V;  1C2N A;  3GW6 A;  1H9X A;  1CCR A;  3DP5 A;  1OCD A;  2BH4 X;  4AAO A;  3PXS A;  1CRC A;  2Y0E A;  1DW0 A;  2OZ1 A;  3SLE A;  2V08 A;  4LJI A;  3ZOO A;  4PW9 B;  2B0Z B;  3VMA A;  1CSU A;  3WU2 V;  1HRO A;  1CTJ A;  1FJ0 A;  1YCC A;  2FYU D;  2L91 A;  2ZOO A;  1AOQ A;  2Y0D A;  3PRJ A;  1CCH A;  1GU2 A;  5DJQ C;  1PPJ D;  2PCC B;  1C6O A;  1MZ4 A;  1CHH A;  4XYD B;  1DVV A;  1IZL 0;  3HQ9 A;  1HJ4 A;  4PJ0 V;  2O3J A;  1CTY A;  2I8F A;  3OA8 B;  4WQ9 A;  1B7V A;  1GQ1 A;  1GKS A;  3OCD B;  2N3Y A;  3NBS A;  4RSZ A;  2C9X B;  3M97 X;  2N9Y B;  4J20 A;  5B66 V;  4GED B;  1H1O A;  2AXT V;  3SVW A;  1RAP A;  2D0W A;  1CRJ A;  4NFG B;  3O5C A;  3WC8 A;  4AAN A;  2CA3 B;  1I5T A;  1RZ6 A;  5CIB B;  1KIB A;  1SQX D;  4IL6 V;  1K3G A;  2GC4 D;  5B6Q A;  1YIC A;  4L1Q A;  1W5C T;  5TIS V;  3CU4 A;  5KLI B;  1FI3 A;  2GC7 D;  3RLM A;  1NU1 D;  2HV4 A;  2FYN B;  1DIQ C;  1N9C A;  1DW2 A;  4U3F D;  2ZXY A;  2C1D B;  1CRG A;  4WQD A;  1QL4 A;  1CRY A;  2PAC A;  2QG4 A;  1WEJ F;  1COR A;  2YK3 A;  4L3G A;  1NIR A;  4FAN A;  1CED A;  3OA8 A;  1L0N D;  2AI5 A;  4FA9 A;  1CO6 A;  1A2S A;  1L0L D;  3OCD A;  1FI7 A;  1E2R A;  2PCB B;  4P4Q B;  2JTI B;  2OZ1 B;  3WFC C;  1KV9 A;  5CIC B;  3SXT A;  1EZV D;  1SQV D;  4AAM A;  1CC5 A;  4N0K A;  1CIG A;  3L4O A;  3KHU A;  3PTZ A;  3PXT A;  2N9I A;  155C A;  1PP9 D;  4FA5 A;  1IO3 A;  2BH5 X;  4FA4 A;  1HH7 A;  2QJP B;  4PD4 D;  3VRD A;  1E8E A;  5GTI V;  5E79 V;  4WQC A;  3A0B V;  2D0S A;  2A06 D;  3MK7 C;  1K3H A;  1YTC A;  1COT A;  2B10 B;  1C7M A;  2ZZS 1;  2C1D A;  4A7P A;  1CIE A;  4K3I A;  1GDV A;  1ZZH A;  3WFB C;  2B12 B;  3CX5 D;  5B5E V;  4EIF A;  1W2L A;  1C6S A;  1BE3 D;  3L73 D;  3NWV A;  2QJK B;  1F1C A;  1SQP D;  2YQB A;  3CX5 W;  3ZIY A;  1LMS A;  1DW1 A;  1CSX A;  3KZI V;  3BCC D;  2DGE A;  1CNO A;  4AAL A;  5GTH V;  1AOF A;  3L4M A;  4H0K A;  4RJT A;  1BCC D;  3MK7 B;  2MHM A;  3HQ8 A;  3VNW A;  2RMZ A;  1C2R A;  1C52 A;  1AYG A;  4DY9 A;  3TDK A;  5CIG B;  5CIH B;  3WFE C;  4MU8 A;  351C A;  2YIU B;  1CTZ A;  3SJL A;  5H2F V;  2BCC D;  1H31 A;  1HRC A;  1HJ3 A;  3O20 A;  4JCG A;  1H33 B;  1GJQ A; 
#chains in the Genus database with same CATH topology
 5KJ7 C;  2ZXX A;  3GHG A;  2BAS A;  3HE4 A;  3Q3D A;  2E74 D;  1E5W A;  2JWA A;  1S5L V;  2QJP C;  3MHV A;  4WWI A;  2N18 B;  2W27 A;  1JEK A;  5GTI H;  1IRW A;  2R3S A;  4Q5P A;  1LT9 C;  4L73 A;  5BU8 B;  1KB9 D;  4D6T J;  2M3E A;  1Q7Y Q;  1M1K Q;  3DR0 A;  1Y47 A;  2NPS D;  3L72 J;  3CXH E;  3TYY A;  1IK9 A;  1M6Z A;  1L9J C;  3USS A;  1SQQ D;  5CID B;  3D6Y A;  4YTP C;  4ZKU A;  4EIC A;  1KFN A;  1MKM A;  1LC1 A;  1YJN P;  1NTK D;  1U7J A;  2E75 C;  3CCL P;  1AVY A;  3EQ2 A;  3G3Z A;  1VQ7 P;  5IY5 1;  2QJK C;  1H32 B;  4HH2 A;  2IYP A;  3H1L E;  2A45 H;  4IFD K;  3KZI H;  2LXC B;  2VRS A;  3TNU B;  4H44 B;  5AUR A;  1HBW A;  3DMI A;  3MGN A;  2C1U A;  2FYU K;  2XKM A;  1DX7 A;  2QM7 A;  4WQA A;  2M5A B;  2Q5U A;  1L0N G;  1K9M Q;  2E74 B;  1H31 B;  1YYC A;  1GD2 E;  1YIQ A;  1F1F A;  5AVZ B;  2YXR B;  1I8O A;  1N7L A;  4RO0 A;  2H89 C;  3HTK B;  2R44 A;  4L76 A;  1SQX E;  2B11 B;  1FBM A;  3I56 P;  4DJG A;  3CL3 D;  2NPS B;  1DT1 A;  2WSC J;  2B87 A;  4Z1M H;  2C9N Y;  3CXH H;  1NU1 E;  2GUS A;  2A06 G;  1JDL A;  1K73 Q;  2Z5H A;  3K5B A;  1EDK A;  3IF4 A;  3H1I E;  2V4H A;  3M9Q A;  5AW4 B;  1LFM A;  2HFE D;  4ASW A;  3KYQ A;  1N15 A;  1M1J C;  2P1J A;  2ZON G;  1G2C A;  4YE1 A;  1AJY A;  1JNM A;  1NNO A;  2V7Q H;  2Y0C A;  4HJG H;  1HJ5 A;  3L71 D;  5CHX A;  3P8C D;  1S9K D;  2Q1K A;  1KX2 A;  4NPE A;  5KKZ B;  2V07 A;  1S4X A;  1FZC C;  3ITK A;  4OH8 B;  5CMZ A;  4GT1 A;  4W7Z A;  3V4Q A;  3W67 A;  1L0L K;  1PP9 E;  4PJ0 E;  3RBX A;  1L0N J;  1FOS F;  1RHZ B;  3CYT I;  1NJI Q;  1SP4 A;  3CCM P;  3PHL A;  1U74 B;  3L75 E;  1SQV K;  4EDF A;  5AW1 B;  3Q5P A;  1IFI A;  1AV1 A;  3VYM A;  1LT1 A;  3WUI A;  2FBW C;  4XFJ A;  4WVZ A;  1NTZ D;  1FZF A;  2WSE H;  2FY8 A;  1YIJ P;  4IL6 E;  4UB8 V;  1RF1 B;  4EIJ A;  2BCC G;  2VHD A;  1FJP A;  1QVF O;  1HWT C;  1USE A;  1HZU A;  1KZU B;  2GA1 A;  2FYU E;  3CWB G;  3FWL A;  4KMG A;  1PPJ E;  1ZR2 A;  3RGU A;  1N7S C;  3M0D A;  2OYH A;  1LTJ C;  2KIK A;  1A02 F;  2LIT A;  3G6E P;  1U75 B;  3X39 A;  1SQP K;  2QJY C;  2J5U A;  1WRG A;  3CX5 I;  4QMA A;  5KTB A;  3IN6 A;  2WSS H;  1CIF A;  2YNY A;  3I5C A;  1GK6 A;  3TGU G;  2A45 G;  3WUT A;  1NH4 A;  3AEF C;  3AEA C;  1DW3 A;  3ZOY A;  1NKZ B;  1CYI A;  1C2N A;  1S5L X;  2PP6 A;  4HKZ H;  1CRC A;  1N8R Q;  4IL6 H;  1PL5 A;  2G3A A;  2B0Z B;  2BCC J;  2L5G B;  1CSU A;  5KLI C;  1HRO A;  1CTJ A;  2L91 A;  5AVQ B;  2IZ0 A;  3PRJ A;  2PCC B;  1K05 A;  1RE3 A;  3CWB J;  4XYD B;  1CI6 A;  5KJ7 D;  4PJ0 V;  2M0B A;  2RH0 A;  5KLV E;  4WQ9 A;  1B7V A;  4JYC A;  1KIL C;  4GDO A;  1GL2 C;  1ZOY C;  1M57 D;  4K35 A;  3M97 X;  4H0L C;  1VQK P;  1SQQ K;  1WT6 A;  4TT3 H;  1EXJ A;  1NKN A;  2FXO A;  2YMK A;  2IBZ E;  3O5C A;  1HF9 A;  2CA3 B;  1NTK K;  1RZ6 A;  1SQX D;  4IL6 V;  5B6Q A;  1YIC A;  1URQ D;  3T97 B;  1LWU B;  3H1L G;  5H2F E;  2A45 I;  1NU1 D;  5L8R J;  3A5T A;  2FYN B;  2JDI H;  1U57 A;  1T6A A;  3OW2 O;  4DCK A;  1HGZ A;  1H89 A;  1CRG A;  4WQD A;  3AE5 C;  1CRY A;  1WEJ F;  3CC4 P;  1CED A;  4L3G A;  1SQB G;  2W90 A;  3JCU H;  3OA8 A;  4FA9 A;  1A2S A;  3OCD A;  1KFM A;  1E2R A;  4L75 A;  3FWN A;  3CI9 A;  1KV9 A;  4W80 A;  3GHG C;  1EZV D;  1CC5 A;  3L4O A;  1AFO A;  3PXT A;  2D2C C;  155C A;  1PP9 D;  1JY3 P;  1J1D C;  1YIT P;  1UII A;  1HH7 A;  2H8P D;  2QJP B;  4WY4 A;  4PD4 D;  3VRD A;  1FAV A;  3RK2 C;  3CXH I;  2ZT9 C;  3H1J E;  1FOS E;  2QIW A;  3W68 A;  3H1I G;  1H88 A;  1BGY E;  2OTL P;  2ZYD A;  1AQT A;  4A7P A;  4AYC A;  2FFD C;  3H1L J;  3C9I A;  1URQ B;  1CIE A;  3HRN A;  4K3I A;  2KSJ A;  3V2R A;  3O6Q B;  2B12 B;  5AVV B;  3AE6 C;  5B5E V;  1AVO A;  3HUS A;  1W2L A;  3I55 P;  3G4S P;  2QJK B;  1SQB J;  2IFM A;  3CX5 W;  1LMS A;  3B5N A;  1SFC A;  3MIW A;  1HVV A;  3L75 G;  1SQQ E;  2PRR A;  1CNO A;  3SFD C;  2Q6Q A;  4AAL A;  1EDL A;  2G8Y A;  1AOF A;  3KDP B;  1YQ4 C;  2MHM A;  1Q90 D;  2E5Y A;  2WSE J;  2RMZ A;  1NTZ K;  1S1C X;  1AYG A;  2OYI A;  3Q5S A;  5CCG A;  2K3R A;  1VQN P;  5H2F V;  2IPP A;  3VP8 A;  4EI2 A;  1XTC C;  3H1I J;  2O1K A;  1T8Z A;  2M8R A;  3OJA B;  2FYU G;  3CCR P;  1RF0 A;  3H1H E;  1PPJ G;  2KB7 P;  3RL0 D;  1P84 E;  2BLF B;  1WMK A;  4AQR D;  2KS1 A;  1NAF A;  3JC2 2;  4GYD A;  4U7J A;  1OZH A;  2AEF A;  3SFE C;  3H1K E;  1LTT C;  2KNC B;  4LC1 A;  3QH9 A;  4WQ7 A;  1KB9 H;  1X9V A;  1UIX A;  1N7S D;  2KZI A;  3NXS A;  5KLV D;  4GKG A;  2GB8 B;  3HUS B;  1CW5 A;  4K3A A;  3O0R C;  4RES B;  1CSW A;  1S72 P;  1CRI A;  3BAT A;  3Q2Y A;  1M8O B;  2QRX A;  2IBZ D;  3MZW B;  1VQL P;  3E7K A;  1QN2 A;  3GG2 A;  1FE6 A;  1GMJ A;  2K9J B;  4U3F G;  4L3H A;  2P10 A;  1SS1 A;  1LTI C;  1IFD A;  3FX0 A;  2FYU J;  1L0L G;  1WVE C;  3VP9 A;  3LIE A;  3WUV A;  5AW6 B;  3V2Q A;  3OA7 A;  2LKM A;  4H13 D;  1SQV G;  1ZN5 A;  3ZOW A;  1C75 A;  5CYT R;  5AW7 B;  3RL0 B;  3A0H E;  1P84 H;  1S5L H;  4IL6 X;  5C0Z A;  1OXZ A;  3EFF K;  1JOC A;  2N9J A;  3CXH W;  1H32 A;  3SWK A;  2OYH C;  2Q3E A;  1HCM A;  1Q81 Q;  4XXL A;  1X0T A;  2QVA A;  5KAI E;  3B4S A;  1SQX K;  3UIA A;  3WMM 0;  3CCV P;  1ZME C;  3TNU A;  1J1E C;  2P2U A;  2K37 A;  1GL2 D;  3AE8 C;  2E76 C;  4H0L D;  1LTJ B;  2CA4 B;  2OAR A;  4N3Y B;  3RN0 A;  2QM8 A;  1NMI A;  3RN1 A;  1FJK A;  3H1J D;  1NU1 K;  2B4Z A;  1LC2 A;  2QJY B;  2H88 C;  1EC5 A;  5C9M A;  1X22 A;  3RL0 g;  2M5A A;  2XND H;  5K5G B;  1JY2 P;  1BGY D;  4FAV A;  3NBT A;  2ZYG A;  2OTJ P;  4U3F J;  4PV1 C;  3AE2 C;  2HPC B;  1FHB A;  1BE3 G;  3HTK A;  3RMZ A;  1OMI A;  3TSI A;  3M9H A;  1SQP G;  3N7N A;  1L0L J;  4Y5R A;  1M60 A;  2NPS A;  2Z5I A;  1SQV J;  5AVU B;  1I54 A;  2MKV A;  1RAQ A;  2XV5 A;  4H13 B;  5APQ A;  4TLF A;  1ZR4 A;  1RE3 C;  1YNR A;  2KOG A;  1H8A A;  1E79 H;  3A0H H;  3LW5 H;  1NO4 A;  3V4W A;  4YXD C;  1NYH A;  5TIS E;  1HZV A;  2O1J A;  2KXP B;  2HOD B;  1KYO W;  1QKS A;  1JCD A;  1FOC A;  2OQQ A;  1NWQ A;  1HH0 A;  3AE7 C;  4UB8 E;  1IFP A;  4Y99 C;  2I1J A;  1W2E A;  2BCN B;  2GM4 A;  5KAI H;  4IFF A;  1N73 B;  2JQR A;  2WTY A;  1GL2 B;  3RK2 D;  2ZT9 D;  4H0L B;  3VN0 A;  3L73 E;  1KMI Z;  3PLN A;  2WSF J;  3BCC E;  4AX3 A;  1CZQ A;  1BCC E;  5AW0 B;  1FDO A;  3M9B A;  1LTG C;  1R5L A;  3VOP A;  3H1H D;  1RZ5 A;  1CRH A;  1DIP A;  4HYT B;  1BE3 J;  4KJM A;  1P84 D;  1SQQ G;  3A0H V;  1Q82 Q;  1SQP J;  2K1A A;  1AKK A;  3AE3 C;  1R8E A;  1RF1 A;  1NTK G;  3H1K D;  2E5T A;  1I6D A;  2XDJ A;  1A56 A;  1M70 A;  1IZN B;  5KAI V;  3II6 A;  1H9X A;  1OCD A;  3L35 A;  5AVY B;  2BH4 X;  1ZRT E;  4N6J A;  1GW3 A;  1BSN A;  1LTA C;  3SLE A;  1VDF A;  2V08 A;  4LJI A;  3VMA A;  2K88 A;  2ZYA A;  1GTW A;  3WU2 V;  1FJ0 A;  1YCC A;  2E43 A;  1NVO A;  1J1D B;  3A2A A;  2Y0D A;  1GU2 A;  4UB8 H;  5DJQ C;  1MZ4 A;  3GF3 A;  3RK2 B;  2ZT9 B;  1K04 A;  3SWF A;  2O3J A;  1EZV E;  1JTH B;  1HJ0 A;  2N1T C;  1GKS A;  2CPB A;  3NBS A;  1L2P A;  1FDM A;  5GTH E;  1RE4 A;  4J20 A;  2RKL A;  2FFD B;  1RY3 A;  3AE4 C;  1KB9 I;  1FZB A;  5AVT B;  4R4L A;  2P7J A;  2D0W A;  4PD4 E;  3VMZ A;  3L74 E;  1CRJ A;  4NFG B;  3WC8 A;  2IZ1 A;  5KLV K;  5CIB B;  1KIB A;  3RK3 C;  1NTK J;  1U7M A;  1GU5 A;  4L1Q A;  1HTL C;  1OVV A;  5TIS V;  1A02 J;  3CU4 A;  3CC2 P;  2BEQ D;  2FXM A;  1DIQ C;  1J2J B;  1GDT A;  3L71 G;  1NTM E;  3HD7 C;  4GOF A;  3LID A;  5CCG C;  1VQ8 P;  5AW3 B;  1CO6 A;  1SVF A;  3E1I A;  5AW8 B;  4P4Q B;  2H43 A;  3WFC C;  3SXT A;  1IFM A;  3PTZ A;  1P84 I;  2WZ7 A;  4FA5 A;  1NTZ G;  4JQ0 D;  4BRY B;  5KAF E;  1IO3 A;  2Q9I A;  1FZA A;  3T97 A;  1LWU A;  1IO4 A;  3A7O A;  5GTH H;  3MK7 C;  4PJ0 H;  5CCH C;  1L4A C;  2WIT A;  1K3H A;  1YTC A;  4PD4 H;  4RKU J;  5AW5 B;  5C39 A;  3C1L A;  1N2D C;  4EOT A;  1PIX A;  1HJB A;  2SPZ A;  2O01 N;  1IFJ A;  2O01 J;  1JCC A;  1EDJ A;  2NRG A;  2Y9Y A;  2C0X A;  3JSV C;  2E76 D;  3AE1 C;  3L71 J;  1MUU A;  3AEE C;  3L73 D;  3NWV A;  3NTN A;  1F1C A;  2YQB A;  1NGM B;  4ZNC A;  5KJ7 A;  1DW1 A;  1VQ9 P;  1CSX A;  1VQO P;  5B5E E;  2KLV A;  3BCC D;  2K9Y A;  5GTH V;  3L4M A;  1BCC D;  2JJL A;  3NMD A;  4NPD A;  4PV1 D;  3LW5 J;  3M06 A;  1LT9 A;  1NTZ J;  3TDK A;  3SWY A;  1VPC A;  3WFE C;  4MU8 A;  1URQ A;  3C8V A;  4L74 A;  1HRC A;  3TGU J;  3G71 P;  1VF5 C;  1H33 B;  1GJQ A;  3O6Q A;  3VTP C;  3M0A A;  1QL1 A;  3L72 E;  3V5B A;  1ZRT D;  5AW9 B;  1SLQ A;  2B89 A;  1QL3 A;  2R5D A;  2YCC A;  1MZ9 A;  2E75 D;  1HUC A;  4OWF A;  4AUW A;  3SWS A;  1R0Q A;  3PXW A;  5APT A;  3TYI A;  1LGH B;  1KC8 Q;  1BL9 A;  3PH2 B;  5DFS A;  1RQV A;  2QEX P;  1JM0 A;  2XU6 A;  451C A;  5KAF V;  1YTZ I;  1KB0 A;  5B5E H;  1Q2N A;  3KQG A;  1SQX G;  3CMA P;  3ZBM A;  1DEB A;  1KIL E;  2WMM A;  1NOH A;  2CXB A;  4I7Z C;  1T2K C;  3L74 D;  1IK7 A;  1PGJ A;  2OTK E;  1NU1 G;  2WVR A;  1H9Y A;  2OYO A;  1YEB A;  4WQ8 A;  1BDD A;  2IFN A;  1LT9 B;  1DII C;  1GU4 A;  3P32 A;  5CBN A;  4EIE A;  2ZBO A;  1M56 D;  4M3L A;  1KX7 A;  1CYC A;  2V7Q J;  2DVH A;  2C1V A;  3JBT B;  5TJH A;  1BDC A;  2YIU C;  2KNC A;  5H2F H;  3MTU E;  1QEX A;  1NTM D;  1EZV G;  2ZXE B;  2E75 B;  2YO3 A;  5KKZ C;  2IYO A;  2MTA C;  4Y99 B;  2WPV B;  1N90 A;  1PP9 G;  4C7N B;  1KQF B;  3C2C A;  5DF5 A;  1L9B C;  3CCS P;  4DOJ A;  4UB6 E;  1S6V B;  2N1T D;  1QL2 A;  1PFI A;  1BSH A;  2P67 A;  4LGD E;  1TU3 F;  1SQX J;  2K9J A;  4GIF A;  4OGQ C;  2LR2 A;  1L0N E;  1MG3 D;  1NU1 J;  2AXC A;  1USD A;  1Y8A A;  1EDI A;  3L70 D;  3WUU A;  1PGP A;  1S3J A;  3CLQ A;  1YQ3 C;  3VMX A;  2MJZ A;  3HD7 D;  1H0T B;  4WBA A;  2WSC H;  2A06 E;  2UWJ E;  3U59 A;  2AXT E;  4WQB A;  5AVX B;  1EZV I;  1N7S A;  1PP9 J;  4C7R A;  3HE5 B;  1LTJ A;  1M1J B;  4FA1 A;  2ZVN B;  5DJQ B;  1E29 A;  3B8E B;  1GZL A;  3L75 J;  5M1B A;  3FXD A;  4I6M C;  2P58 A;  4PD4 I;  2N1T B;  4UB6 H;  5APU A;  3CX5 E;  1PGQ A;  2R3C A;  5APS A;  4ASV A;  1FZC B;  1FS0 E;  2HPC A;  3G9R A;  4HB1 A;  5CCH D;  4H0J A;  1L4A D;  2LXB A;  3EWK A;  3HQ7 A;  4ZMD A;  4D6T D;  5EXQ A;  4W7Y A;  2R5B A;  2HLO A;  3GMA A;  1FI9 A;  1MFT A;  3L72 D;  4QAO A;  1Q86 Q;  3ZOX A;  2C2C A;  2B9B A;  3WFD C;  3H32 B;  1YJ9 P;  5CIF B;  1C6R A;  5DJU B;  1GIW A;  4EID A;  3VYI A;  5AVS B;  2ORL A;  1LP1 B;  2QSI A;  3VMY A;  1DEE G;  5KLV G;  1JB0 J;  2HOD A;  5GTI E;  3A0B E;  4UB6 V;  2E42 A;  4WQE A;  5DJT B;  3GLM A;  4YXW H;  2AXT H;  1GW4 A;  2KI7 B;  3TK1 A;  3DP5 A;  1FC2 C;  3M0D C;  2XZR A;  3AE9 C;  1N73 A;  2IBZ G;  1GL2 A;  3CWB E;  2WT7 B;  2OZ1 A;  1Y9B A;  2H7H A;  4PW9 B;  4JYB A;  3V6I A;  1KIL D;  3M91 A;  1N7S B;  2PGD A;  1ZV8 A;  2ZOO A;  2FYN C;  1G1J A;  4KHX A;  1C6O A;  3CX5 H;  1CHH A;  1DVV A;  3WU2 E;  1HJ4 A;  1VF5 D;  2I8F A;  1L4A B;  1GQ1 A;  4IFM A;  2N3Y A;  3KZI E;  3V2P A;  4I2L C;  3AEG C;  1KN7 A;  1T3J A;  2C9X B;  5B66 V;  1H1O A;  2AXT V;  3SVW A;  2KK7 A;  1RAP A;  4YPC A;  1OFC X;  4AAN A;  1ZP0 C;  1I5T A;  5KLV J;  1K3G A;  2GC4 D;  1DH3 A;  2ZJS E;  5KLI B;  2GC7 D;  4KT0 J;  2HV4 A;  1IFN A;  1YJW P;  3H1J G;  3A0B H;  1N9C A;  4IOI H;  5AW2 B;  1BGY G;  2D2C D;  2ZXY A;  5APY A;  2C1D B;  4B86 A;  3V2N A;  3R2P A;  3BVH A;  1PZQ A;  4JBZ A;  4XA4 A;  2WPR A;  2PAC A;  2IBZ I;  2QG4 A;  4BWN A;  1T2K D;  1NIR A;  1JTH A;  1KIL B;  1L0N D;  2AI5 A;  1URQ C;  3D6Z A;  1FI7 A;  1FDI A;  2JTI B;  2OZ1 B;  2R32 A;  5AVR B;  2FFD A;  2JKV A;  1NTM K;  4AAM A;  3F89 A;  3KHU A;  2N9I A;  2OGU A;  2WQY C;  2XNX A;  3WU2 H;  1KD1 Q;  1VF5 B;  4I1L A;  3D0W A;  2CPS A;  2BH5 X;  4FA4 A;  3IAO A;  2YKO A;  1E8E A;  5GTI V;  3A0B V;  2A06 D;  1RH5 B;  3AEB C;  2YXQ B;  1X8Y A;  1C7M A;  2J59 M;  1CSB A;  1SQB E;  2I8D A;  3Q1M A;  2JEE A;  3S4R A;  4N78 D;  3H1J J;  3CCE P;  1JY3 N;  3GHG B;  3WFB C;  1VQ5 P;  3HE4 B;  3CX5 D;  1BGY J;  4WY4 C;  4EIF A;  5TIS H;  4OGQ D;  1C6S A;  2D2C B;  3Q5R A;  1VQP P;  1NAY A;  3H1H G;  4I7Z B;  4BRY A;  1KYO E;  3KZI V;  2DGE A;  3B71 A;  3IR9 A;  3NFQ A;  3VNW A;  1QGK B;  2Y9Z A;  3H1K G;  1C52 A;  2JO1 A;  4DT0 A;  2BEZ F;  4BXL A;  5CIH B;  1X79 B;  3A3Y B;  1SQQ J;  3MUD A;  351C A;  2YIU B;  1CTZ A;  2Z4E A;  3HUS C;  3SJL A;  2BCC D;  1MV8 A;  1W2B O;  3O20 A;  3B5N C;  1SFC C;  2QE7 H;  1N50 A;  3P7K A;  1LS9 A;  1VYD A;  3PJS K;  1D7M A;  5AVW B;  1JUN A;  3CWB D;  3S1K A;  1S2E A;  4DZO A;  3FGA D;  1FCD C;  1JY3 O;  2OYI C;  3HQ6 A;  2FRC A;  5BVZ A;  1I6E A;  1YFC A;  1LTB C;  1OW7 A;  3AED C;  1ETP A;  4OGQ B;  1I8P A;  1K8A Q;  3H1H J;  1QLE D;  3TGU D;  1CYJ A;  1YHQ P;  3RL0 C;  1KYO H;  1RF0 C;  2N3B A;  1A8C A;  3P8M C;  3H1K J;  2C8S A;  2B87 B;  1H33 A;  1YI2 P;  1VQM P;  3L37 A;  2IDB A;  3H25 A;  2AIU A;  3RK3 E;  2JR8 A;  2LIR A;  3IFM A;  2WPS A;  5CBO A;  2EXV A;  2GIW A;  1G2C B;  1LTS C;  4O9B A;  1VQ4 P;  3L70 E;  2YO2 A;  1PGO A;  4GOD A;  3PH0 A;  3EFG A;  5CIE B;  3RBZ A;  3MP7 B;  1EB7 A;  3CXH D;  4MN4 C;  3L4F A;  2J58 A;  2N18 C;  1T3U A;  2WWW A;  1I55 A;  2HG5 D;  3JCU E;  4V2K A;  1NHL A;  1IC2 A;  1IRV A;  2B88 A;  4H13 C;  4U3F E;  3CCU P;  2BPB B;  3CPW O;  3H1L D;  3U1A A;  4PWA A;  1CHI A;  1IQC A;  4EYY Q;  2CE0 A;  2W8Z A;  1L0L E;  5KAF H;  5EFW B;  3QWO C;  2BGV X;  4O1Q A;  1CXC A;  2NZ2 A;  1J3S A;  1SQV E;  4D6T E;  2Q7C A;  1SQB D;  1EXI A;  1CSV A;  3CP5 A;  1N73 C;  2FWL A;  1L0N K;  2W6J H;  3L73 G;  1CHJ A;  4GOE A;  4O1W A;  4C7N A;  2FKW B;  3N4X A;  2WPQ A;  2OYH B;  3BCC G;  4H44 C;  3OAK A;  2RN0 A;  2CE1 A;  2XTS B;  3ZCF A;  1BCC G;  2GUV A;  2PFX A;  1J1E B;  1CXA A;  2E76 B;  5APV A;  1KYO D;  1JY2 N;  3R4Y A;  2E74 C;  3ORV A;  3L36 A;  3PP5 A;  3A9F A;  2Q3I A;  3H1I D;  2L4D A;  1M90 Q;  2HR3 A;  1MG2 D;  1YEA A;  3SSU A;  1KV4 A;  4PV1 B;  1RQU A;  1FZE A;  2NPS C;  1CIH A;  1BE3 E;  1R5S A;  3O1Y A;  2W6A A;  1QYZ A;  1SQP E;  3AEC C;  2POH A;  1H0T A;  1DVH A;  2HYN A;  3TF5 A;  3L73 J;  4NPF X;  3L75 D;  1FZG A;  1CI6 B;  3HE5 A;  2W6B A;  1AA0 A;  1M1J A;  4OVN F;  3BCC J;  1DD4 A;  4WY4 D;  4JPZ B;  1KTM A;  1BCC J;  1G1I A;  1NML A;  2JP3 A;  5E79 E;  4FB1 A;  1OAE A;  3CCJ P;  3BRT B;  1VL2 A;  2N1T A;  3GW6 A;  2DW3 A;  1JY2 O;  1CCR A;  1QX8 A;  3L74 G;  4AAO A;  3PXS A;  1FZC A;  2Y0E A;  3KPE A;  1DW0 A;  3ZOO A;  1KOR A;  2WSF H;  3ZDM A;  1KB9 E;  2FYU D;  3S9O A;  2N9B A;  2ZVO B;  1AOQ A;  1CCH A;  3H32 A;  2ITA A;  2ZAE B;  1PPJ D;  2KZJ A;  1RF1 C;  4CPG A;  2IX7 C;  1IZL 0;  3RK3 D;  3HQ9 A;  1NTM G;  3B5N D;  1SFC D;  1CTY A;  3OA8 B;  1HGV A;  1LP1 A;  1MFZ A;  1NTK E;  3OCD B;  4RSZ A;  2N9Y B;  4GED B;  3HD7 A;  1OW6 A;  1AQ5 A;  2JWD A;  5B66 E;  1KYO I;  5CCG D;  1KQG B;  3BRV B;  2WT7 A;  3D71 A;  2KP8 A;  4WY4 B;  1W5C T;  1OVU A;  1OWA A;  1LJ2 A;  1JO5 A;  1FI3 A;  3E1R A;  3RLM A;  3H6P A;  2KLU A;  5E79 H;  1KQL A;  4WB4 A;  3L74 J;  3CME P;  1DW2 A;  4N78 E;  2YKQ A;  4LLH A;  1S5L E;  4U3F D;  2KUB A;  1GK4 A;  2AEM A;  1RE4 C;  1QL4 A;  4C46 A;  1ZW0 A;  3FXE A;  2M3B A;  1COR A;  2YK3 A;  4FAN A;  5CCH A;  3MUD C;  1L4A A;  3L70 G;  1DD3 A;  1L0L D;  2PCB B;  1OIP A;  5CIC B;  2YKP A;  1N86 A;  1SQV D;  2KSE A;  1OX3 A;  1ZLL A;  4N0K A;  1CIG A;  3KXD A;  5APW A;  1NTM J;  3RK3 B;  1OVR A;  2C9L Y;  3F5H A;  3B5N B;  1SFC B;  1IJD B;  2CK3 H;  1LNQ A;  5BU5 A;  3O8Z A;  5E79 V;  2FYZ A;  4WQC A;  2I1K A;  2D0S A;  1M7L A;  3D70 A;  2C0W A;  4XE5 B;  1W5C E;  2BCC E;  2OYI B;  1COT A;  3L71 E;  2B10 B;  3BAS A;  3HD7 B;  3P8C E;  2ZZS 1;  2C1D A;  1S9K E;  5B66 H;  3ABV C;  3GF7 A;  3U1C A;  2AEJ A;  1JMM A;  4R4M A;  2KYV A;  1KIL A;  1XTG B;  5CJ0 A;  4JF7 A;  1GDV A;  1YTZ T;  5CJ4 A;  1ZZH A;  2FXP A;  1OW8 A;  4D6T G;  3CCQ P;  1SQB K;  1LWU C;  3L72 G;  1BE3 D;  4Y28 J;  1EQ7 A;  1NTZ E;  1SQP D;  3L70 J;  3ZIY A;  2KS1 B;  1PV3 A;  2ZFC A;  1JMB A;  1QVG O;  4H0K A;  4RJT A;  3MD0 A;  3MK7 B;  3HQ8 A;  3TGU E;  1ZXG A;  1C2R A;  4DY9 A;  2W83 C;  2YMY A;  3CD6 P;  5CIG B;  4H44 D;  1VQ6 P;  2PAJ A;  4ZKP A;  1H31 A;  2QA4 P;  1Z56 A;  3CC7 P;  1YBK A;  5APX A;  1HJ3 A;  1FU1 A;  2O01 H;  4JCG A;  1KQS O; 
#chains in the Genus database with same CATH homology
 1N50 A;  2JWA A;  1LS9 A;  1VYD A;  1S5L V;  1ZRT D;  2N18 B;  3CWB D;  1QL3 A;  2YCC A;  1IRW A;  4Q5P A;  2BLF B;  3SWS A;  2KS1 A;  1FCD C;  1R0Q A;  3PXW A;  1KB9 D;  4GYD A;  3HQ6 A;  3TYI A;  2FRC A;  3DR0 A;  1I6E A;  1YFC A;  1BL9 A;  3PH2 B;  1M6Z A;  1L9J C;  5DFS A;  2KNC B;  1ETP A;  1SQQ D;  5CID B;  1I8P A;  4EIC A;  4WQ7 A;  451C A;  1LC1 A;  3TGU D;  1CYJ A;  5KAF V;  5KLV D;  2GB8 B;  1NTK D;  1KB0 A;  2N3B A;  1A8C A;  3ZBM A;  5IY5 1;  3O0R C;  1CSW A;  2C8S A;  1H32 B;  1H33 A;  1CRI A;  2CXB A;  3L74 D;  2IBZ D;  1H9Y A;  1QN2 A;  1YEB A;  3GG2 A;  4WQ8 A;  2AIU A;  5AUR A;  2K9J B;  4L3H A;  3DMI A;  1DII C;  2LIR A;  2C1U A;  2EXV A;  4EIE A;  2ZBO A;  1KX7 A;  2GIW A;  4WQA A;  1CYC A;  2DVH A;  2C1V A;  3JBT B;  1H31 B;  5TJH A;  1WVE C;  1YIQ A;  1F1F A;  5CIE B;  1NTM D;  1I8O A;  1EB7 A;  3ZOW A;  1C75 A;  3CXH D;  5CYT R;  2MTA C;  2B11 B;  5C0Z A;  1N90 A;  2N18 C;  2N9J A;  3CXH W;  1DT1 A;  3C2C A;  5DF5 A;  1H32 A;  1L9B C;  2Q3E A;  1I55 A;  1HCM A;  1S6V B;  4XXL A;  1JDL A;  4V2K A;  1IRV A;  2BPB B;  3H1L D;  2CA4 B;  1LFM A;  4PWA A;  3RN0 A;  1CHI A;  1NMI A;  3RN1 A;  3H1J D;  1IQC A;  1N15 A;  2B4Z A;  2CE0 A;  2QJY B;  1LC2 A;  2ZON G;  5C9M A;  1MG3 D;  4YE1 A;  1NNO A;  1BGY D;  4FAV A;  2Y0C A;  2BGV X;  1HJ5 A;  3L71 D;  3NBT A;  1CXC A;  4O1Q A;  1J3S A;  1KX2 A;  1SQB D;  3L70 D;  5KKZ B;  1CSV A;  1FHB A;  3CP5 A;  2V07 A;  2FWL A;  3ITK A;  3RMZ A;  1CHJ A;  3CYT I;  4O1W A;  4Y5R A;  1M60 A;  3PHL A;  1U74 B;  4EDF A;  2RN0 A;  3VYM A;  2CE1 A;  2XTS B;  3ZCF A;  3WUI A;  1I54 A;  1NTZ D;  1RAQ A;  1CXA A;  4WQB A;  1KYO D;  1YNR A;  3ORV A;  4UB8 V;  4FA1 A;  5DJQ B;  1E29 A;  3A9F A;  1HZV A;  1KYO W;  1QKS A;  3H1I D;  1FOC A;  2L4D A;  2VHD A;  1MG2 D;  1YEA A;  2BCN B;  1HZU A;  2JQR A;  1CIH A;  3O1Y A;  3PLN A;  1QYZ A;  4H0J A;  3FWL A;  4KMG A;  3HQ7 A;  4D6T D;  5EXQ A;  4AX3 A;  1FI9 A;  3L72 D;  4QAO A;  2LIT A;  2C2C A;  1U75 B;  3WFD C;  3ZOX A;  1DVH A;  3X39 A;  5CIF B;  3H1H D;  1RZ5 A;  1CRH A;  1C6R A;  3TF5 A;  1GIW A;  4EID A;  1P84 D;  3L75 D;  3A0H V;  2ORL A;  1CIF A;  1AKK A;  3H1K D;  1NML A;  1I6D A;  1DW3 A;  3ZOY A;  4FB1 A;  4UB6 V;  1OAE A;  1CYI A;  4WQE A;  1A56 A;  1M70 A;  5KAI V;  1C2N A;  3GW6 A;  1H9X A;  1CCR A;  3DP5 A;  1OCD A;  2BH4 X;  4AAO A;  3PXS A;  1CRC A;  2Y0E A;  1DW0 A;  2OZ1 A;  3SLE A;  2V08 A;  4LJI A;  3ZOO A;  4PW9 B;  2B0Z B;  3VMA A;  1CSU A;  3WU2 V;  1HRO A;  1CTJ A;  1FJ0 A;  1YCC A;  2FYU D;  2L91 A;  2ZOO A;  1AOQ A;  2Y0D A;  3PRJ A;  1CCH A;  1GU2 A;  5DJQ C;  1PPJ D;  2PCC B;  1C6O A;  1MZ4 A;  1CHH A;  4XYD B;  1DVV A;  1IZL 0;  3HQ9 A;  1HJ4 A;  4PJ0 V;  2O3J A;  1CTY A;  2I8F A;  3OA8 B;  4WQ9 A;  1B7V A;  1GQ1 A;  1GKS A;  3OCD B;  2N3Y A;  3NBS A;  4RSZ A;  2C9X B;  3M97 X;  2N9Y B;  4J20 A;  5B66 V;  4GED B;  1H1O A;  2AXT V;  3SVW A;  1RAP A;  2D0W A;  1CRJ A;  4NFG B;  3O5C A;  3WC8 A;  4AAN A;  2CA3 B;  1I5T A;  1RZ6 A;  5CIB B;  1KIB A;  1SQX D;  4IL6 V;  1K3G A;  2GC4 D;  5B6Q A;  1YIC A;  4L1Q A;  1W5C T;  5TIS V;  3CU4 A;  5KLI B;  1FI3 A;  2GC7 D;  3RLM A;  1NU1 D;  2HV4 A;  2FYN B;  1DIQ C;  1N9C A;  1DW2 A;  4U3F D;  2ZXY A;  2C1D B;  1CRG A;  4WQD A;  1QL4 A;  1CRY A;  2PAC A;  2QG4 A;  1WEJ F;  1COR A;  2YK3 A;  4L3G A;  1NIR A;  4FAN A;  1CED A;  3OA8 A;  1L0N D;  2AI5 A;  4FA9 A;  1CO6 A;  1A2S A;  1L0L D;  3OCD A;  1FI7 A;  1E2R A;  2PCB B;  4P4Q B;  2JTI B;  2OZ1 B;  3WFC C;  1KV9 A;  5CIC B;  3SXT A;  1EZV D;  1SQV D;  4AAM A;  1CC5 A;  4N0K A;  1CIG A;  3L4O A;  3KHU A;  3PTZ A;  3PXT A;  2N9I A;  155C A;  1PP9 D;  4FA5 A;  1IO3 A;  2BH5 X;  4FA4 A;  1HH7 A;  2QJP B;  4PD4 D;  3VRD A;  1E8E A;  5GTI V;  5E79 V;  4WQC A;  3A0B V;  2D0S A;  2A06 D;  3MK7 C;  1K3H A;  1YTC A;  1COT A;  2B10 B;  1C7M A;  2ZZS 1;  2C1D A;  4A7P A;  1CIE A;  4K3I A;  1GDV A;  1ZZH A;  3WFB C;  2B12 B;  3CX5 D;  5B5E V;  4EIF A;  1W2L A;  1C6S A;  1BE3 D;  3L73 D;  3NWV A;  2QJK B;  1F1C A;  1SQP D;  2YQB A;  3CX5 W;  3ZIY A;  1LMS A;  1DW1 A;  1CSX A;  3KZI V;  3BCC D;  2DGE A;  1CNO A;  4AAL A;  5GTH V;  1AOF A;  3L4M A;  4H0K A;  4RJT A;  1BCC D;  3MK7 B;  2MHM A;  3HQ8 A;  3VNW A;  2RMZ A;  1C2R A;  1C52 A;  1AYG A;  4DY9 A;  3TDK A;  5CIG B;  5CIH B;  3WFE C;  4MU8 A;  351C A;  2YIU B;  1CTZ A;  3SJL A;  5H2F V;  2BCC D;  1H31 A;  1HRC A;  1HJ3 A;  3O20 A;  4JCG A;  1H33 B;  1GJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...