1EZVD

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ezvD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ezvD01
2JQRA 5CICB 3RN0A 3RN1A 3A0HV 1H9YA 1A56A 1AKKA 4L1QA 1CCHA 2CE0A 4MU8A 1L0ND 5DF5A 2ZBOA 4PJ0V 5TISV 3HQ8A 3RLMA 2BCCD 2BH5X 2C1DB 155CA 2Y0DA 2N18B 1HJ5A 1I8OA 2PACA 5CIDB 1E8EA 3MK7B 1C6OA 2QG4A 1CIGA 1H33B 1GIWA 1U74B 4GYDA 4AANA 3PXWA 1W5CT 5B66V 4WQAA 2Y0EA 3CYTI 1YICA 1QL3A 1I5TA 2ZOOA 2YQBA 5KAFV 2V08A 3CXHD 2CXBA 1LC2A 1H1OA 3RMZA 2QJKB 1IZL0 1CIFA 2BPBB 3ZBMA 1GDVA 5CYTR 3NWVA 4U3FD 5KKZB 451CA 1RAQA 3VYMA 1KYOW 1FI9A 1DIIC 4FB1A 5CIFB 1C2RA 1N50A 4KMGA 1SQXD 3WC8A 4AX3A 1W2LA 1DIQC 4V2KA 5DFSA 4FA9A 4EDFA 3H1ID 1ZRTD 2ZXYA 3FWLA 1CRIA 1YIQA 3DP5A 1IQCA 1SQQD 3PXSA 3NBTA 1QN2A 1C6SA 4AAOA 4WQCA 2B10B 5KAIV 5GTHV 1C6RA 1S5LV 2ZONG 3O5CA 1CTJA 1CXAA 1CHHA 2I8FA 1NTZD 2QJPB 1N90A 1JDLA 3H1JD 1AOQA 3OCDA 1HJ3A 3H1HD 1F1CA 1FHBA 3SJLA 1C52A 1AOFA 2ZZS1 1FJ0A 3ORVA 1CRHA 2YCCA 4RJTA 1KYOD 1BCCD 4J20A 1NIRA 1KIBA 3C2CA 3SVWA 1DW2A 5KLVD 1AYGA 3VRDA 1L9JC 2D0SA 2DVHA 1L9BC 1CSXA 1CRYA 1DVHA 1LS9A 3MK7C 2D0WA 2C1DA 3O20A 4UB6V 1CYIA 2GB8B 3JBTB 2FYNB 1CTZA 2AIUA 1M6ZA 5DJQB 1GQ1A 1COTA 4FANA 1F1FA 2BCNB 2VHDA 1KV9A 3GW6A 4PW9B 3O1YA 4WQ8A 1CRCA 4UB8V 3CX5D 2RMZA 2A06D 1YTCA 1RZ5A 1CTYA 3BCCD 3L71D 4DY9A 4YE1A 4NFGB 1DVVA 3KHUA 1CYCA 2C1UA 2JTIB 2AXTV 1I6EA 2FWLA 1CORA 1K3HA 1SQBD 3L70D 2N9JA 1L0LD 3O0RC 5B6QA 1IO3A 1HROA 5H2FV 3WFCC 2V07A 1GJQA 2C1VA 3PRJA 4EIDA 1FI3A 1NU1D 5C0ZA 1B7VA 1CC5A 1WEJF 1NNOA 1H32A 1HZUA 1LFMA 3TYIA 4FA1A 1S6VB 1H31A 5TJHA 3ZOXA 1P84D 2C8SA 4WQEA 1DW0A 1SQVD 4WQ7A 4RSZA 1CSVA 1LMSA 2XTSB 3SLEA 3L75D 4PD4D 3KZIV 2C2CA 2ORLA 1HJ4A 4WQBA 3PXTA 1K3GA 2Y0CA 3OCDB 1CRGA 1HCMA 1KB0A 2BLFB 1HH7A 4O1QA 2CA3B 4LJIA 5CIHB 5EXQA 3WFEC 3OA8B 4H0JA 1PP9D 3CP5A 4Q5PA 4PWAA 5CIEB 3ZCFA 1ZZHA 4L3HA 3VMAA 2O3JA 1LC1A 2L91A 3M97X 1YCCA 2N9YB 5B5EV 1OCDA 4JCGA 3WUIA 351CA 2BGVX 1MG3D 3GG2A 1CCRA 1QL4A 1N9CA 2YK3A 1H33A 1IRVA 2EXVA 5DJQC 5GTIV 1NMLA 2CE1A 3A0BV 1HRCA 1M70A 1FCDC 2DGEA 2IBZD 1I8PA 2LIRA 3A9FA 2JWAA 3OA8A 4FAVA 3ZOYA 1I6DA 1CIEA 2PCCB 1H9XA 1C75A 1YFCA 2B4ZA 4A7PA 5AURA 1FI7A 2BH4X 1C2NA 3DMIA 3ITKA 2QJYB 4XXLA 5E79V 1CIHA 1GU2A 4N0KA 3SXTA 1MZ4A 1DW3A 2CA4B 3L73D 1ETPA 2N3YA 3H1KD 5CIGB 4AALA 3VNWA 2MHMA 1M60A 2GC7D 1CHIA 1BL9A 3SWSA 4IL6V 2FYUD 2AI5A 1CRJA 4FA4A 3H1LD 4QAOA 1A2SA 1CEDA 4EICA 5KLIB 2B11B 1YEAA 4P4QB 1CHJA 3HQ6A 2KS1A 2OZ1A 3DR0A 1CYJA 3PTZA 1U75B 3L4OA 2OZ1B 1BE3D 2HV4A 2RN0A 3ZIYA 2LITA 3PH2B 1CO6A 1CXCA 3CX5W 1RAPA 2MTAC 1GKSA 3HQ9A 5C9MA 1A8CA 1WVEC 1I55A 1E29A 1R0QA 3L4MA 4O1WA 1NTKD 2B12B 3CXHW 3HQ7A 1KB9D 1CSWA 5CIBB 1OAEA 2K9JB 1DW1A 1EB7A 2B0ZB 1I54A 1J3SA 3NBSA 2GC4D 3L72D 1C7MA 1QKSA 1FOCA 4Y5RA 3TF5A 1BGYD 2N18C 1QYZA 2Q3EA 1H32B 3WFBC 2GIWA 4AAMA 1CNOA 1DT1A 3CU4A 1EZVD 3WFDC 4WQ9A 4XYDB 1NMIA 2L4DA 1VYDA 2FRCA 4GEDB 1SQPD 2N9IA 2C9XB 1KX7A 3L74D 1YNRA 1N15A 3PLNA 4H0KA 3CWBD 1E2RA 1IRWA 3ZOWA 3ZOOA 3PHLA 4K3IA 1NTMD 1PPJD 4WQDA 2N3BA 3WU2V 1HZVA 1CSUA 2YIUB 3TDKA 4D6TD 1MG2D 4EIFA 3TGUD 4EIEA 2PCBB 2KNCB 3X39A 5IY51 1YEBA 1RZ6A 4FA5A 1KX2A 4L3GA 1H31B
chains in the Genus database with same CATH superfamily
5APTA 1JTHA 5CICB 2G3AA 1Z56A 1SQVK 2V7QH 1AKKA 2H8PD 3GF3A 3AE6C 1KYOE 5TISV 2BH5X 155CA 3JCUH 2JJLA 2N18B 3USSA 1U7JA 4ASWA 2W27A 1RF0A 1K05A 2W83C 2I8DA 1CIGA 1H33B 2ZT9D 2A06E 1N73A 1W2BO 1NTZJ 1JCCA 1NTKG 3RL0C 3CMAP 1N7SA 3AEFC 1GK4A 3Q1MA 3L74E 1FOSF 1A02J 1YICA 1QL3A 2ZOOA 4C7RA 5CCHA 3AEGC 3O6QB 2FFDC 3CC7P 3RMZA 2E43A 3SWKA 1BGYG 2E74D 3ZBMA 5KAFE 1GDVA 1HGVA 4R4MA 1AFOA 1LWUC 1VF5D 4U3FD 1KILB 3L36A 1KQSO 2GA1A 3L74J 1Q90D 1KYOW 4FB1A 5CIFB 1C2RA 3QH9A 1DIQC 4WVZA 5DFSA 4C46A 3H1ID 1S72P 1YIQA 1IQCA 2O01N 3H1LJ 2BCCJ 1G1JA 2R5DA 3H1KG 4WQCA 3M91A 5GTHV 1S5LV 2ZONG 1CHHA 1N90A 2P2UA 1JDLA 1HJ3A 1JB0J 3H1HD 3L70J 1FZGA 1LTJA 1URQB 1FHBA 5KAIE 1FDMA 1QL2A 1RF1C 2NPSC 1N73B 1NIRA 3C2CA 3M0AA 3SVWA 1DW2A 1AYGA 1NU1K 1GK6A 3IF4A 2NRGA 3VYIA 1LS9A 3MK7C 2C1DA 4LC1A 2GB8B 2FYNB 1QVGO 2B87A 3CC4P 1COTA 2YO2A 4FANA 2VRSA 1FZEA 1J1EC 3WUTA 1SQBJ 1KV9A 1EDJA 1NTME 3GW6A 1T3UA 1J1EB 5CCHD 1N8RQ 2HLOA 2R5BA 3HE5A 2XNXA 3CX5D 2RMZA 1RZ5A 3R2PA 1IO4A 3CL3D 2R44A 4NFGB 2C1UA 2ZYGA 1KB9H 1SQBD 3CCUP 1KQGB 1L0LD 3A2AA 2R3CA 1GJQA 1H0TA 3L37A 5C39A 3PRJA 1MKMA 2JDIH 3MZWB 1NNOA 1SQVE 1HZUA 3TYIA 4FA1A 1S9KE 1P84D 1KB9E 2C8SA 4WQEA 4U3FG 4H44B 4WQ7A 1AJYA 2E75C 2KK7A 4RSZA 2LXBA 5AW9B 3I56P 1K73Q 1PP9E 2XTSB 2FBWC 1QL1A 4AUWA 1L0LE 5KLVE 1PL5A 3KZIH 1LTSC 1W5CE 2P67A 3H1IG 3MUDA 3HD7D 3CP5A 1JMMA 2K88A 1PP9J 1H89A 5CIEB 4IFMA 4L3HA 1NTZE 1YQ4C 3WUUA 3U1AA 2R32A 1LC1A 2NZ2A 5B66H 1NTZG 2M5AA 351CA 2BGVX 1MG3D 1NU1E 4D6TJ 4RKUJ 2OYHC 1N9CA 2YK3A 5AW5B 1SQQG 1J2JB 2CE1A 1SQXE 2OTLP 2IDBA 3GLMA 1ZR2A 3CWBJ 4WWIA 1BCCE 4FAVA 3ZOYA 5GTIE 1L4AA 2IBZE 1BDCA 2DW3A 3AEBC 3H1HG 2BH4X 1C2NA 2QJYB 1R5LA 1CIHA 4N0KA 4PV1C 1JY3N 2J59M 1MZ4A 2KUBA 3U59A 2CA4B 3L73D 1ETPA 5CIGB 1GL2D 2Y9YA 1VQPP 1BL9A 1OXZA 2WSFH 1KTMA 2OYIC 3Q2YA 3RK3C 2BEQD 3ABVC 3RL0D 3H6PA 3E7KA 3TGUG 1N86A 2A45G 1VQLP 3A0HH 3B5NC 1YEAA 1VF5B 2M3EA 1Q7YQ 1CHJA 3CCRP 2V4HA 2E74B 1CYJA 1U75B 3L4OA 4GT1A 1BE3D 2OGUA 1NVOA 5AW7B 1E79H 3KZIE 4BXLA 1M1JA 2M5AB 2AEMA 1GKSA 3HQ9A 3IFMA 3CXHE 5AVYB 1WVEC 2P10A 3TGUE 4Z1MH 2K1AA 1R0QA 1T6AA 2JO1A 1NTKD 2ZT9B 2XZRA 1HH0A 1KQLA 2XV5A 2ZT9C 5AVZB 2P58A 1GD2E 3Q5RA 1OAEA 3PJSK 1YJNP 2ZVNB 3AE7C 2XDJA 1L2PA 4Y5RA 3V4WA 2KIKA 4YXWH 2OTJP 2FYUG 3RK2B 3P7KA 1Y9BA 3A0BE 1BDDA 3CCMP 1CNOA 1ZW0A 3CU4A 5CMZA 5CJ4A 2HPCB 1SVFA 2IPPA 5CCHC 1KX7A 4WY4B 2UWJE 1JY2N 3CWBD 4WY4C 5AW3B 1FJPA 1NTMD 1SQVG 1J1DC 2KOGA 4HB1A 2N3BA 1BSHA 2XU6A 2KNCB 3X39A 5IY51 3PH0A 1RZ6A 4FA5A 1KX2A 1JTHB 4IL6E 3CD6P 5APUA 1H9YA 1A56A 2HR3A 1MZ9A 4M3LA 3LW5J 2HG5D 2Z5IA 3L70G 1S4XA 2Q7CA 5AVUB 1HVVA 4PJ0V 1JMBA 3HTKA 2BCCD 1DD4A 3II6A 3B71A 3FX0A 2YKOA 3VOPA 1GW3A 4PV1B 3MK7B 4IL6X 1S2EA 2FY8A 1GIWA 2QJYC 1U74B 1G1IA 2YXQB 2H88C 1M90Q 1NU1G 1YHQP 1HWTC 1P84I 2FFDA 1IC2A 1URQD 1L4AB 2Y0EA 3CYTI 3EQ2A 5KAFV 2YQBA 2K9JA 2V08A 3CXHD 1FBMA 2JKVA 1OWAA 1H1OA 5B66E 2QJKB 4EOTA 1U57A 3CMEP 3UIAA 2N1TB 1BE3E 1SQVJ 3HUSB 1VQ7P 2LR2A 1T8ZA 3VTPC 5B5EH 3CCJP 1LT1A 1HGZA 1PIXA 2AEJA 2E75D 4XE5B 4AX3A 1DX7A 4V2KA 4FA9A 4XFJA 3NTNA 1CRIA 5GTHE 3OW2O 3PXSA 1X8YA 4HKZH 2FKWB 1N2DC 1C6SA 2YKPA 3BRVB 2WSEJ 2C9LY 4H13C 1FZCA 3RK3E 1H8AA 5KAIV 2E76C 1C6RA 2HFED 1CTJA 1ZRTE 2I8FA 5CBOA 2YNYA 3KXDA 1AOQA 1SQPK 3M9BA 4C7NB 1QVFO 3C1LA 2Q6QA 1VPCA 2C9NY 3TYYA 1AOFA 2ZZS1 1FJ0A 3ORVA 2YCCA 1UIIA 2GUSA 1KQFB 1KYOD 4GKGA 4RJTA 2GUVA 5KJ7C 2E75B 1GMJA 5L8RJ 3E1IA 3D6ZA 2IZ0A 2CPBA 2D0SA 1QX8A 1ZXGA 1VL2A 4NPFX 1CSXA 3OJAB 4TT3H 4Y99B 4L74A 4UB6V 5AW2B 2RKLA 1CTZA 2AIUA 5DJQB 4LLHA 1HF9A 1GQ1A 5M1BA 2K37A 3AEDC 1VQ4P 2IBZI 1MFZA 1KD1Q 4WQ8A 1CRCA 1LWUA 4DT0A 1GL2C 1CTYA 1XTGB 2WPVB 1JY3P 1DVVA 2Q1KA 2BCCE 4JBZA 1I6EA 1BSNA 1MV8A 3EFGA 2WSEH 2PRRA 3CX5H 1NAYA 5B6QA 1LTBC 3AE2C 1DEEG 1BGYE 2C1VA 1OW7A 4EIDA 1FI3A 2WZ7A 3FXDA 1VDFA 1B7VA 3HD7B 1KILC 1WEJF 1H32A 1PGPA 2W8ZA 1SFCC 3MGNA 4IFDK 4O9BA 1LFMA 1G2CA 5KAIH 2QM7A 1IJDB 1SQVD 1NTKE 2FYNC 3CWBG 3CCVP 4L75A 5CCGD 1L4AC 3H1JG 4UB6E 1YYCA 3W68A 3KZIV 1OZHA 5AVSB 2ORLA 1HJ4A 1K3GA 2IFNA 1GTWA 2E74C 2Y0CA 5CHXA 1HCMA 4GODA 2BLFB 1RQUA 4PD4E 1VF5C 3A5TA 4LJIA 3CI9A 4I7ZB 2PGDA 3OA8B 1FZBA 4JPZB 2A06G 1YITP 3S9OA 4PWAA 1SQQJ 3VMAA 4MN4C 3JSVC 1OVRA 4NPDA 2IYPA 1XTCC 4GIFA 3PP5A 1KILE 2R3SA 3M97X 1YCCA 3L4FA 5B5EV 1RH5B 2PAJA 3V2NA 1URQA 1ZP0C 3GG2A 1KILA 3BATA 1QL4A 1FZFA 1SFCA 1DEBA 5E79H 1HJ0A 1L0LJ 5GTIV 2JP3A 3A0BV 5CBNA 5APYA 2D2CB 2QIWA 3RK3B 2IBZD 2C0XA 2LXCB 2JWAA 1NO4A 2OTKE 4B86A 1NKNA 1M56D 1RQVA 2PCCB 2XKMA 2OQQA 3T97B 3KQGA 5AURA 3L74G 2B89A 2HODB 3ITKA 1EDIA 3MIWA 3ZDMA 3H1JE 3WU2H 3BVHA 3SXTA 3BRTB 2OYIA 2N3YA 3H1HJ 5BU8B 3VNWA 5E79E 1CHIA 1JO5A 4IL6V 3V2RA 3MP7B 1T3JA 4YTPC 1X0TA 1CEDA 3BCCJ 1GL2B 1LTGC 3G71P 2WT7A 4P4QB 1KFNA 2KS1A 4K35A 1NTMG 2E76B 4PJ0E 3S1KA 3VN0A 4U3FE 2OZ1B 2HV4A 2O1JA 5BVZA 1RE4A 4UB8H 2E5YA 1T2KD 3D70A 5KKZC 1SQPG 1A02F 1CXCA 1L4AD 1RAPA 4BRYA 2PFXA 1USDA 5C9MA 1URQC 5CJ0A 1N7SD 3FWNA 1CZQA 3V2PA 1I55A 3S4RA 2ZYDA 2FYUE 3KDPB 1GW4A 1GU4A 2AXTH 2NPSB 1EXJA 3L4MA 1AA0A 2H7HA 3L73E 3Q5PA 4PV1D 1KB9D 1QGKB 1KILD 4I2LC 1I54A 2GC4D 1GZLA 1C7MA 1QKSA 2BCCG 1FOCA 3VP8A 2H89C 2N9BA 2YKQA 1EXIA 2AXCA 3O8ZA 1FE6A 1H32B 4N78E 2GIWA 2B88A 1FU1A 3Q3DA 3HE4B 4HH2A 1DT1A 1EZVD 3WFDC 2ZXEB 3L75G 4EYYQ 1MUUA 4WQ9A 1JEKA 1FZCB 1JY2P 4XYDB 1NMIA 4GEDB 2N9IA 4WY4A 4OGQB 1BE3G 4WY4D 1N15A 1IRWA 3PHLA 4K3IA 1PV3A 5CCGA 4WQDA 3CCEP 3TDKA 5AW6B 1VQNP 1R5SA 1M1JB 3TGUD 5KTBA 1M1KQ 5AW0B 4W7ZA 2JQRA 1FOSE 2W6JH 4PD4I 4N3YB 2CE0A 4MU8A 1L0ND 3HTKB 4H0LB 1Y47A 3A0HE 3HQ8A 4OGQD 3MHVA 1PGJA 1CI6A 1IZNB 2Y0DA 4BWNA 1I8OA 2O1KA 5APXA 1IFIA 3TNUA 3H25A 3D71A 1C6OA 3L72E 2KYVA 4GYDA 3B8EB 2WSFJ 3RK2C 2IYOA 4ZMDA 1GDTA 4AANA 1LJ2A 4ZKPA 2KI7B 4BRYB 2WITA 4YPCA 2IX7C 1W5CT 5B66V 4WQAA 5APVA 1SQXJ 2J58A 2CXBA 1OVUA 1LC2A 3SWFA 3AE3C 4EI2A 1IZL0 3OA7A 1IFJA 2KLUA 2QM8A 3NWVA 3BASA 2ZAEB 5KKZB 2W6AA 3G6EP 2HYNA 2OARA 3VYMA 3L71E 3RL0B 3L73J 1NGMB 2NPSD 4R4LA 1N50A 4JYBA 1SQXD 1RF1B 1W2LA 3H1LG 1N7SB 1GL2A 2L5GB 2ZXYA 3FWLA 3NBTA 3SWYA 1VQ5P 2AXTE 1N7LA 1KV4A 4AAOA 1K8AQ 1JUNA 3O5CA 5H2FE 2QJPB 2OYOA 1BE3J 1EQ7A 2YO3A 3H1IE 2QJPC 3SJLA 1LTJB 1FDIA 4AQRD 2OYIB 4DOJA 1JY2O 4JYCA 1BCCD 5DJUB 1IK9A 1WMKA 1LTAC 2NPSA 1L9JC 2DVHA 3LIEA 3D6YA 1L9BC 1DVHA 2D0WA 2I1JA 1DD3A 3O20A 3B5NB 1CSBA 2CPSA 1WRGA 1NKZB 3TSIA 1NH4A 1M6ZA 2QSIA 5B5EE 3HUSC 1SS1A 1SQBG 5AVVB 2PP6A 4ZNCA 1F1FA 2A45I 2VHDA 2W6BA 1CI6B 4OWFA 4PW9B 3CLQA 5DJTB 1ZN5A 3O1YA 4UB8V 4DY9A 4YE1A 3KHUA 1CYCA 1FZAA 2AXTV 1PGQA 1CORA 3SFEC 1SQBE 3AEAC 1YJWP 3A0BH 3O0RC 2CK3H 2G8YA 5H2FV 2W90A 3F89A 3WFCC 3L35A 1OW8A 4WB4A 3RBZA 1FAVA 1NU1D 4C7NA 4K3AA 3P32A 1NTZK 3AECC 3EFFK 1LWUB 3RK2D 1S6VB 3M06A 5TJHA 3ZOXA 3LW5H 2KZIA 1VQ9P 2KZJA 4LGDE 4RESB 3IR9A 1EZVE 1PZQA 4OGQC 3I5CA 3SLEA 2GM4A 3L75D 4PD4D 2C2CA 4WQBA 1MFTA 2WSSH 3PXTA 2WPSA 1CRGA 1RHZB 1KB0A 2Z5HA 4O1QA 5CIHB 1RE3A 3WFEC 4D6TG 4H0JA 1LP1A 1SQXG 1PP9D 2ZFCA 3FXEA 1NJIQ 2FFDB 4L73A 3C9IA 5KAFH 3H32B 2O3JA 3SFDC 1S3JA 2M3BA 1L0NG 2L91A 1LNQA 2N9YB 1NTMJ 3M9HA 1OCDA 4JCGA 2OYHA 3JC22 1SFCB 1CCRA 4IFFA 4JQ0D 1GU5A 1Q2NA 2EXVA 1HJBA 1YIJP 4HJGH 1H88A 3M9QA 3L73G 2FYUJ 1KN7A 1HRCA 1M70A 2K3RA 2DGEA 2FYUK 3V2QA 3G4SP 2LIRA 3A9FA 3OA8A 5AW1B 1T2KC 1NHLA 2V7QJ 1CIEA 1SLQA 4W80A 1VQKP 4GDOA 1FI7A 2AEFA 2E5TA 2IFMA 2WPQA 1IFNA 3CCSP 5E79V 4U3FJ 5AVWB 5AVTB 1GU2A 1LTIC 1W2EA 1DW3A 3V4QA 3H1KD 4I7ZC 1DH3A 3CCQP 3G9RA 1YTZI 3SWSA 5BU5A 1CRJA 5KLVG 2J5UA 3H1LD 4QAOA 3HD7C 1A2SA 4DCKA 1HTLC 2WT7B 2B11B 1S1CX 2QEXP 1OVVA 2OZ1A 3DR0A 3B5NA 1M1JC 2K9YA 3GMAA 2RN0A 1VQOP 1OX3A 3ZIYA 1DIPA 4HYTB 3PH2B 1L0NK 1QEXA 1FJKA 1CO6A 1VQMP 3HRNA 3KYQA 1PGOA 2D2CD 1AVYA 2ZJSE 4DZOA 1A8CA 1NAFA 1LT9B 4OH8B 2Q3IA 1JCDA 4YXDC 1NTKK 3AEEC 3CXHW 3I55P 2N1TD 5CIBB 4H13D 4W7YA 1PPJG 2K9JB 2WMMA 2ITAA 1DW1A 1EB7A 2B0ZB 3SSUA 3T97A 1SQPJ 2JWDA 2N18C 2C0WA 1AQ5A 4WBAA 1ZMEC 3JCUE 3R4YA 4EIJA 1JNMA 1J1DB 3HD7A 1LP1B 3A7OA 4AAMA 1IFMA 3Q5SA 1JM0A 3VMYA 2L4DA 2FRCA 1SQPD 4KHXA 4D6TE 2C9XB 5APSA 3L74D 1YNRA 2OYHB 1JY3O 2WQYC 5CCGC 3PLNA 3ZOWA 3ZOOA 1IK7A 2YIUC 5KLVJ 1PPJD 3CX5I 1HZVA 1X9VA 2JEEA 1PP9G 2YIUB 4D6TD 2FXOA 2KNCA 2ZYAA 2PCBB 1RE4C 1YEBA 2POHA 3WMM0 3D0WA 4L3GA 1H31B 3RN0A 3RN1A 3A0HV 2I1KA 3H1KJ 4L1QA 2P7JA 4N78D 1CCHA 1OIPA 3MD0A 5EFWB 2WPRA 3B4SA 5DF5A 2ZBOA 3H32A 3RLMA 2C1DB 2N1TA 4L76A 1HJ5A 5CIDB 2PACA 3K5BA 1P84H 1E8EA 4IOIH 1RY3A 2QG4A 1Q82Q 1BCCG 4KJMA 3LIDA 4UB8E 3TGUJ 1NYHA 4ASVA 3PXWA 1Q86Q 3EWKA 4I1LA 1I5TA 4TLFA 2LKMA 3WUVA 3O6QA 2A45H 5AVXB 2O01J 2QRXA 1CIFA 2BPBB 5AW4B 1OMIA 2KP8A 5CYTR 1OW6A 4H13B 2XNDH 3AE5C 4AYCA 451CA 1RAQA 1EZVI 5AVRB 1AVOA 1FI9A 1DIIC 2KLVA 5KJ7D 4KMGA 5TISH 3WC8A 1VQ8P 4EDFA 2WSCH 3H1HE 1ZRTD 1X79B 3DP5A 1SQQD 5KLIC 4U7JA 1QN2A 1ZV8A 4OVNF 3E1RA 1NTMK 2B10B 1AV1A 2N1TC 1KORA 1CXAA 1SP4A 1H0TB 1NTZD 1SQQE 2B9BA 5AVQB 3H1JD 2H43A 3OCDA 1F1CA 3L71G 1M57D 2YXRB 3BCCG 1L0NJ 1S5LE 1C52A 1ZLLA 1CRHA 4J20A 1KIBA 2IBZG 3GHGC 5KLVD 3VP9A 3VRDA 5KJ7A 3GHGB 1CW5A 3CXHI 1AQTA 1CRYA 1HBWA 1CYIA 4XA4A 3JBTB 4H44C 3TNUB 2SPZA 1LTTC 4H0LC 2RH0A 2BCNB 1Y8AA 2KSJA 3H1IJ 3L75J 1LT9C 1BCCJ 1PFIA 2A06D 1YTCA 2Q9IA 1SQPE 3BCCD 4Y99C 2JR8A 3L71D 4UB6H 5APWA 1K04A 3IN6A 1U7MA 1R8EA 2JTIB 3P8MC 2FWLA 1K3HA 2E42A 3RL0g 3L70D 2N9JA 1YBKA 2WTYA 1L0LG 3L75E 1IO3A 1HROA 1LTJC 2V07A 4I6MC 4Y28J 2ZVOB 5AW8B 3VMXA 3AE9C 5KLVK 4KT0J 1RF1A 5C0ZA 3L71J 1CC5A 5GTHH 3G3ZA 3CX5E 4NPEA 1D7MA 3NFQA 4RO0A 5APQA 1PPJE 1H31A 3CWBE 3CC2P 2MJZA 3A3YB 1DW0A 3V5BA 1FDOA 1KC8Q 3CCLP 1M7LA 3GHGA 2YMKA 1LGHB 1CSVA 1LMSA 1YTZT 3AE8C 4ZKUA 3GF7A 2KS1B 1Q81Q 1HUCA 1SQXK 1L0NE 3AE4C 1EC5A 3L70E 1IFPA 1LT9A 3OCDB 2IZ1A 1YQ3C 1YI2P 1HH7A 3W67A 3IAOA 2CA3B 3U1CA 2KSEA 5EXQA 3H1JJ 2O01H 2QVAA 3TK1A 4Q5PA 1KYOI 3MTUE 3C8VA 3ZCFA 1ZZHA 1BGYJ 1FC2C 1IFDA 1QLED 1P84E 2HODA 1E5WA 2E76D 4JF7A 3CXHH 3WUIA 1FS0E 1EZVG 1NWQA 3P8CE 3NXSA 2WSCJ 3NMDA 1NTKJ 1H33A 1IRVA 2FXPA 5DJQC 2QA4P 1NMLA 2WWWA 3QWOC 4GOFA 1FCDC 1I8PA 3CPWO 3KPEA 1I6DA 1S5LX 1H9XA 2BASA 1C75A 1YFCA 2B4ZA 4A7PA 3BCCE 3AE1C 3VMZA 4GOEA 5GTIH 2BEZF 3DMIA 4XXLA 3B5ND 2M8RA 3H1LE 4CPGA 4AALA 3MUDC 2MHMA 3RK3D 1M60A 2GC7D 5K5GB 4PJ0H 3H1KE 2FYUD 2AI5A 2D2CC 4FA4A 1SQBK 1X22A 1YJ9P 4EICA 5KLIB 1KFMA 1K9MQ 1RE3C 1UIXA 2FXMA 1OFCX 3HQ6A 3RBXA 2Y9ZA 4DJGA 3PTZA 1L0LK 1SQQK 2LITA 3WU2E 2KXPB 3CX5W 5H2FH 2MTAC 2P1JA 1KZUB 1EDKA 2ZXXA 2FYZA 4N6JA 4QMAA 3P8CD 1E29A 2WVRA 1USEA 3M0DC 4O1WA 1TU3F 2B12B 1SFCD 3HQ7A 2Z4EA 1CSWA 2YMYA 1J3SA 3NBSA 3OAKA 5TISE 3L72D 1FZCC 4IL6H 3N4XA 3V6IA 2B87B 3FGAD 1N7SC 3TF5A 1BGYD 3HE5B 1RF0C 1QYZA 2Q3EA 1NU1J 1KMIZ 1N73C 2M0BA 3WFBC 1S5LH 1NOHA 2KB7P 2QE7H 1WT6A 1VQ6P 3L72J 2MKVA 1ZR4A 2Q5UA 3HE4A 1VYDA 1M8OB 3F5HA 2HPCA 4PD4H 1EDLA 4H0KA 1S9KD 4H0LD 1E2RA 3L72G 3HUSA 2QJKC 4H44D 3RGUA 3N7NA 3WU2V 1KYOH 1JOCA 1CSUA 1MG2D 1KB9I 4EIFA 4EIEA 1ZOYC 1G2CB 3M0DA
chains in the Genus database with same CATH topology
2JQRA 5CICB 3RN0A 3RN1A 3A0HV 1H9YA 1A56A 1AKKA 4L1QA 1CCHA 2CE0A 4MU8A 1L0ND 5DF5A 2ZBOA 4PJ0V 5TISV 3HQ8A 3RLMA 2BCCD 2BH5X 2C1DB 155CA 2Y0DA 2N18B 1HJ5A 1I8OA 2PACA 5CIDB 1E8EA 3MK7B 1C6OA 2QG4A 1CIGA 1H33B 1GIWA 1U74B 4GYDA 4AANA 3PXWA 1W5CT 5B66V 4WQAA 2Y0EA 3CYTI 1YICA 1QL3A 1I5TA 2ZOOA 2YQBA 5KAFV 2V08A 3CXHD 2CXBA 1LC2A 1H1OA 3RMZA 2QJKB 1IZL0 1CIFA 2BPBB 3ZBMA 1GDVA 5CYTR 3NWVA 4U3FD 5KKZB 451CA 1RAQA 3VYMA 1KYOW 1FI9A 1DIIC 4FB1A 5CIFB 1C2RA 1N50A 4KMGA 1SQXD 3WC8A 4AX3A 1W2LA 1DIQC 4V2KA 5DFSA 4FA9A 4EDFA 3H1ID 1ZRTD 2ZXYA 3FWLA 1CRIA 1YIQA 3DP5A 1IQCA 1SQQD 3PXSA 3NBTA 1QN2A 1C6SA 4AAOA 4WQCA 2B10B 5KAIV 5GTHV 1C6RA 1S5LV 2ZONG 3O5CA 1CTJA 1CXAA 1CHHA 2I8FA 1NTZD 2QJPB 1N90A 1JDLA 3H1JD 1AOQA 3OCDA 1HJ3A 3H1HD 1F1CA 1FHBA 3SJLA 1C52A 1AOFA 2ZZS1 1FJ0A 3ORVA 1CRHA 2YCCA 4RJTA 1KYOD 1BCCD 4J20A 1NIRA 1KIBA 3C2CA 3SVWA 1DW2A 5KLVD 1AYGA 3VRDA 1L9JC 2D0SA 2DVHA 1L9BC 1CSXA 1CRYA 1DVHA 1LS9A 3MK7C 2D0WA 2C1DA 3O20A 4UB6V 1CYIA 2GB8B 3JBTB 2FYNB 1CTZA 2AIUA 1M6ZA 5DJQB 1GQ1A 1COTA 4FANA 1F1FA 2BCNB 2VHDA 1KV9A 3GW6A 4PW9B 3O1YA 4WQ8A 1CRCA 4UB8V 3CX5D 2RMZA 2A06D 1YTCA 1RZ5A 1CTYA 3BCCD 3L71D 4DY9A 4YE1A 4NFGB 1DVVA 3KHUA 1CYCA 2C1UA 2JTIB 2AXTV 1I6EA 2FWLA 1CORA 1K3HA 1SQBD 3L70D 2N9JA 1L0LD 3O0RC 5B6QA 1IO3A 1HROA 5H2FV 3WFCC 2V07A 1GJQA 2C1VA 3PRJA 4EIDA 1FI3A 1NU1D 5C0ZA 1B7VA 1CC5A 1WEJF 1NNOA 1H32A 1HZUA 1LFMA 3TYIA 4FA1A 1S6VB 1H31A 5TJHA 3ZOXA 1P84D 2C8SA 4WQEA 1DW0A 1SQVD 4WQ7A 4RSZA 1CSVA 1LMSA 2XTSB 3SLEA 3L75D 4PD4D 3KZIV 2C2CA 2ORLA 1HJ4A 4WQBA 3PXTA 1K3GA 2Y0CA 3OCDB 1CRGA 1HCMA 1KB0A 2BLFB 1HH7A 4O1QA 2CA3B 4LJIA 5CIHB 5EXQA 3WFEC 3OA8B 4H0JA 1PP9D 3CP5A 4Q5PA 4PWAA 5CIEB 3ZCFA 1ZZHA 4L3HA 3VMAA 2O3JA 1LC1A 2L91A 3M97X 1YCCA 2N9YB 5B5EV 1OCDA 4JCGA 3WUIA 351CA 2BGVX 1MG3D 3GG2A 1CCRA 1QL4A 1N9CA 2YK3A 1H33A 1IRVA 2EXVA 5DJQC 5GTIV 1NMLA 2CE1A 3A0BV 1HRCA 1M70A 1FCDC 2DGEA 2IBZD 1I8PA 2LIRA 3A9FA 2JWAA 3OA8A 4FAVA 3ZOYA 1I6DA 1CIEA 2PCCB 1H9XA 1C75A 1YFCA 2B4ZA 4A7PA 5AURA 1FI7A 2BH4X 1C2NA 3DMIA 3ITKA 2QJYB 4XXLA 5E79V 1CIHA 1GU2A 4N0KA 3SXTA 1MZ4A 1DW3A 2CA4B 3L73D 1ETPA 2N3YA 3H1KD 5CIGB 4AALA 3VNWA 2MHMA 1M60A 2GC7D 1CHIA 1BL9A 3SWSA 4IL6V 2FYUD 2AI5A 1CRJA 4FA4A 3H1LD 4QAOA 1A2SA 1CEDA 4EICA 5KLIB 2B11B 1YEAA 4P4QB 1CHJA 3HQ6A 2KS1A 2OZ1A 3DR0A 1CYJA 3PTZA 1U75B 3L4OA 2OZ1B 1BE3D 2HV4A 2RN0A 3ZIYA 2LITA 3PH2B 1CO6A 1CXCA 3CX5W 1RAPA 2MTAC 1GKSA 3HQ9A 5C9MA 1A8CA 1WVEC 1I55A 1E29A 1R0QA 3L4MA 4O1WA 1NTKD 2B12B 3CXHW 3HQ7A 1KB9D 1CSWA 5CIBB 1OAEA 2K9JB 1DW1A 1EB7A 2B0ZB 1I54A 1J3SA 3NBSA 2GC4D 3L72D 1C7MA 1QKSA 1FOCA 4Y5RA 3TF5A 1BGYD 2N18C 1QYZA 2Q3EA 1H32B 3WFBC 2GIWA 4AAMA 1CNOA 1DT1A 3CU4A 1EZVD 3WFDC 4WQ9A 4XYDB 1NMIA 2L4DA 1VYDA 2FRCA 4GEDB 1SQPD 2N9IA 2C9XB 1KX7A 3L74D 1YNRA 1N15A 3PLNA 4H0KA 3CWBD 1E2RA 1IRWA 3ZOWA 3ZOOA 3PHLA 4K3IA 1NTMD 1PPJD 4WQDA 2N3BA 3WU2V 1HZVA 1CSUA 2YIUB 3TDKA 4D6TD 1MG2D 4EIFA 3TGUD 4EIEA 2PCBB 2KNCB 3X39A 5IY51 1YEBA 1RZ6A 4FA5A 1KX2A 4L3GA 1H31B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQR A;  5CIC B;  3RN0 A;  3RN1 A;  3A0H V;  1H9Y A;  1A56 A;  1AKK A;  4L1Q A;  1CCH A;  2CE0 A;  4MU8 A;  1L0N D;  5DF5 A;  2ZBO A;  4PJ0 V;  5TIS V;  3HQ8 A;  3RLM A;  2BCC D;  2BH5 X;  2C1D B;  155C A;  2Y0D A;  2N18 B;  1HJ5 A;  1I8O A;  2PAC A;  5CID B;  1E8E A;  3MK7 B;  1C6O A;  2QG4 A;  1CIG A;  1H33 B;  1GIW A;  1U74 B;  4GYD A;  4AAN A;  3PXW A;  1W5C T;  5B66 V;  4WQA A;  2Y0E A;  3CYT I;  1YIC A;  1QL3 A;  1I5T A;  2ZOO A;  2YQB A;  5KAF V;  2V08 A;  3CXH D;  2CXB A;  1LC2 A;  1H1O A;  3RMZ A;  2QJK B;  1IZL 0;  1CIF A;  2BPB B;  3ZBM A;  1GDV A;  5CYT R;  3NWV A;  4U3F D;  5KKZ B;  451C A;  1RAQ A;  3VYM A;  1KYO W;  1FI9 A;  1DII C;  4FB1 A;  5CIF B;  1C2R A;  1N50 A;  4KMG A;  1SQX D;  3WC8 A;  4AX3 A;  1W2L A;  1DIQ C;  4V2K A;  5DFS A;  4FA9 A;  4EDF A;  3H1I D;  1ZRT D;  2ZXY A;  3FWL A;  1CRI A;  1YIQ A;  3DP5 A;  1IQC A;  1SQQ D;  3PXS A;  3NBT A;  1QN2 A;  1C6S A;  4AAO A;  4WQC A;  2B10 B;  5KAI V;  5GTH V;  1C6R A;  1S5L V;  2ZON G;  3O5C A;  1CTJ A;  1CXA A;  1CHH A;  2I8F A;  1NTZ D;  2QJP B;  1N90 A;  1JDL A;  3H1J D;  1AOQ A;  3OCD A;  1HJ3 A;  3H1H D;  1F1C A;  1FHB A;  3SJL A;  1C52 A;  1AOF A;  2ZZS 1;  1FJ0 A;  3ORV A;  1CRH A;  2YCC A;  4RJT A;  1KYO D;  1BCC D;  4J20 A;  1NIR A;  1KIB A;  3C2C A;  3SVW A;  1DW2 A;  5KLV D;  1AYG A;  3VRD A;  1L9J C;  2D0S A;  2DVH A;  1L9B C;  1CSX A;  1CRY A;  1DVH A;  1LS9 A;  3MK7 C;  2D0W A;  2C1D A;  3O20 A;  4UB6 V;  1CYI A;  2GB8 B;  3JBT B;  2FYN B;  1CTZ A;  2AIU A;  1M6Z A;  5DJQ B;  1GQ1 A;  1COT A;  4FAN A;  1F1F A;  2BCN B;  2VHD A;  1KV9 A;  3GW6 A;  4PW9 B;  3O1Y A;  4WQ8 A;  1CRC A;  4UB8 V;  3CX5 D;  2RMZ A;  2A06 D;  1YTC A;  1RZ5 A;  1CTY A;  3BCC D;  3L71 D;  4DY9 A;  4YE1 A;  4NFG B;  1DVV A;  3KHU A;  1CYC A;  2C1U A;  2JTI B;  2AXT V;  1I6E A;  2FWL A;  1COR A;  1K3H A;  1SQB D;  3L70 D;  2N9J A;  1L0L D;  3O0R C;  5B6Q A;  1IO3 A;  1HRO A;  5H2F V;  3WFC C;  2V07 A;  1GJQ A;  2C1V A;  3PRJ A;  4EID A;  1FI3 A;  1NU1 D;  5C0Z A;  1B7V A;  1CC5 A;  1WEJ F;  1NNO A;  1H32 A;  1HZU A;  1LFM A;  3TYI A;  4FA1 A;  1S6V B;  1H31 A;  5TJH A;  3ZOX A;  1P84 D;  2C8S A;  4WQE A;  1DW0 A;  1SQV D;  4WQ7 A;  4RSZ A;  1CSV A;  1LMS A;  2XTS B;  3SLE A;  3L75 D;  4PD4 D;  3KZI V;  2C2C A;  2ORL A;  1HJ4 A;  4WQB A;  3PXT A;  1K3G A;  2Y0C A;  3OCD B;  1CRG A;  1HCM A;  1KB0 A;  2BLF B;  1HH7 A;  4O1Q A;  2CA3 B;  4LJI A;  5CIH B;  5EXQ A;  3WFE C;  3OA8 B;  4H0J A;  1PP9 D;  3CP5 A;  4Q5P A;  4PWA A;  5CIE B;  3ZCF A;  1ZZH A;  4L3H A;  3VMA A;  2O3J A;  1LC1 A;  2L91 A;  3M97 X;  1YCC A;  2N9Y B;  5B5E V;  1OCD A;  4JCG A;  3WUI A;  351C A;  2BGV X;  1MG3 D;  3GG2 A;  1CCR A;  1QL4 A;  1N9C A;  2YK3 A;  1H33 A;  1IRV A;  2EXV A;  5DJQ C;  5GTI V;  1NML A;  2CE1 A;  3A0B V;  1HRC A;  1M70 A;  1FCD C;  2DGE A;  2IBZ D;  1I8P A;  2LIR A;  3A9F A;  2JWA A;  3OA8 A;  4FAV A;  3ZOY A;  1I6D A;  1CIE A;  2PCC B;  1H9X A;  1C75 A;  1YFC A;  2B4Z A;  4A7P A;  5AUR A;  1FI7 A;  2BH4 X;  1C2N A;  3DMI A;  3ITK A;  2QJY B;  4XXL A;  5E79 V;  1CIH A;  1GU2 A;  4N0K A;  3SXT A;  1MZ4 A;  1DW3 A;  2CA4 B;  3L73 D;  1ETP A;  2N3Y A;  3H1K D;  5CIG B;  4AAL A;  3VNW A;  2MHM A;  1M60 A;  2GC7 D;  1CHI A;  1BL9 A;  3SWS A;  4IL6 V;  2FYU D;  2AI5 A;  1CRJ A;  4FA4 A;  3H1L D;  4QAO A;  1A2S A;  1CED A;  4EIC A;  5KLI B;  2B11 B;  1YEA A;  4P4Q B;  1CHJ A;  3HQ6 A;  2KS1 A;  2OZ1 A;  3DR0 A;  1CYJ A;  3PTZ A;  1U75 B;  3L4O A;  2OZ1 B;  1BE3 D;  2HV4 A;  2RN0 A;  3ZIY A;  2LIT A;  3PH2 B;  1CO6 A;  1CXC A;  3CX5 W;  1RAP A;  2MTA C;  1GKS A;  3HQ9 A;  5C9M A;  1A8C A;  1WVE C;  1I55 A;  1E29 A;  1R0Q A;  3L4M A;  4O1W A;  1NTK D;  2B12 B;  3CXH W;  3HQ7 A;  1KB9 D;  1CSW A;  5CIB B;  1OAE A;  2K9J B;  1DW1 A;  1EB7 A;  2B0Z B;  1I54 A;  1J3S A;  3NBS A;  2GC4 D;  3L72 D;  1C7M A;  1QKS A;  1FOC A;  4Y5R A;  3TF5 A;  1BGY D;  2N18 C;  1QYZ A;  2Q3E A;  1H32 B;  3WFB C;  2GIW A;  4AAM A;  1CNO A;  1DT1 A;  3CU4 A;  1EZV D;  3WFD C;  4WQ9 A;  4XYD B;  1NMI A;  2L4D A;  1VYD A;  2FRC A;  4GED B;  1SQP D;  2N9I A;  2C9X B;  1KX7 A;  3L74 D;  1YNR A;  1N15 A;  3PLN A;  4H0K A;  3CWB D;  1E2R A;  1IRW A;  3ZOW A;  3ZOO A;  3PHL A;  4K3I A;  1NTM D;  1PPJ D;  4WQD A;  2N3B A;  3WU2 V;  1HZV A;  1CSU A;  2YIU B;  3TDK A;  4D6T D;  1MG2 D;  4EIF A;  3TGU D;  4EIE A;  2PCB B;  2KNC B;  3X39 A;  5IY5 1;  1YEB A;  1RZ6 A;  4FA5 A;  1KX2 A;  4L3G A;  1H31 B; 
#chains in the Genus database with same CATH topology
 5APT A;  1JTH A;  5CIC B;  2G3A A;  1Z56 A;  1SQV K;  2V7Q H;  1AKK A;  2H8P D;  3GF3 A;  3AE6 C;  1KYO E;  5TIS V;  2BH5 X;  155C A;  3JCU H;  2JJL A;  2N18 B;  3USS A;  1U7J A;  4ASW A;  2W27 A;  1RF0 A;  1K05 A;  2W83 C;  2I8D A;  1CIG A;  1H33 B;  2ZT9 D;  2A06 E;  1N73 A;  1W2B O;  1NTZ J;  1JCC A;  1NTK G;  3RL0 C;  3CMA P;  1N7S A;  3AEF C;  1GK4 A;  3Q1M A;  3L74 E;  1FOS F;  1A02 J;  1YIC A;  1QL3 A;  2ZOO A;  4C7R A;  5CCH A;  3AEG C;  3O6Q B;  2FFD C;  3CC7 P;  3RMZ A;  2E43 A;  3SWK A;  1BGY G;  2E74 D;  3ZBM A;  5KAF E;  1GDV A;  1HGV A;  4R4M A;  1AFO A;  1LWU C;  1VF5 D;  4U3F D;  1KIL B;  3L36 A;  1KQS O;  2GA1 A;  3L74 J;  1Q90 D;  1KYO W;  4FB1 A;  5CIF B;  1C2R A;  3QH9 A;  1DIQ C;  4WVZ A;  5DFS A;  4C46 A;  3H1I D;  1S72 P;  1YIQ A;  1IQC A;  2O01 N;  3H1L J;  2BCC J;  1G1J A;  2R5D A;  3H1K G;  4WQC A;  3M91 A;  5GTH V;  1S5L V;  2ZON G;  1CHH A;  1N90 A;  2P2U A;  1JDL A;  1HJ3 A;  1JB0 J;  3H1H D;  3L70 J;  1FZG A;  1LTJ A;  1URQ B;  1FHB A;  5KAI E;  1FDM A;  1QL2 A;  1RF1 C;  2NPS C;  1N73 B;  1NIR A;  3C2C A;  3M0A A;  3SVW A;  1DW2 A;  1AYG A;  1NU1 K;  1GK6 A;  3IF4 A;  2NRG A;  3VYI A;  1LS9 A;  3MK7 C;  2C1D A;  4LC1 A;  2GB8 B;  2FYN B;  1QVG O;  2B87 A;  3CC4 P;  1COT A;  2YO2 A;  4FAN A;  2VRS A;  1FZE A;  1J1E C;  3WUT A;  1SQB J;  1KV9 A;  1EDJ A;  1NTM E;  3GW6 A;  1T3U A;  1J1E B;  5CCH D;  1N8R Q;  2HLO A;  2R5B A;  3HE5 A;  2XNX A;  3CX5 D;  2RMZ A;  1RZ5 A;  3R2P A;  1IO4 A;  3CL3 D;  2R44 A;  4NFG B;  2C1U A;  2ZYG A;  1KB9 H;  1SQB D;  3CCU P;  1KQG B;  1L0L D;  3A2A A;  2R3C A;  1GJQ A;  1H0T A;  3L37 A;  5C39 A;  3PRJ A;  1MKM A;  2JDI H;  3MZW B;  1NNO A;  1SQV E;  1HZU A;  3TYI A;  4FA1 A;  1S9K E;  1P84 D;  1KB9 E;  2C8S A;  4WQE A;  4U3F G;  4H44 B;  4WQ7 A;  1AJY A;  2E75 C;  2KK7 A;  4RSZ A;  2LXB A;  5AW9 B;  3I56 P;  1K73 Q;  1PP9 E;  2XTS B;  2FBW C;  1QL1 A;  4AUW A;  1L0L E;  5KLV E;  1PL5 A;  3KZI H;  1LTS C;  1W5C E;  2P67 A;  3H1I G;  3MUD A;  3HD7 D;  3CP5 A;  1JMM A;  2K88 A;  1PP9 J;  1H89 A;  5CIE B;  4IFM A;  4L3H A;  1NTZ E;  1YQ4 C;  3WUU A;  3U1A A;  2R32 A;  1LC1 A;  2NZ2 A;  5B66 H;  1NTZ G;  2M5A A;  351C A;  2BGV X;  1MG3 D;  1NU1 E;  4D6T J;  4RKU J;  2OYH C;  1N9C A;  2YK3 A;  5AW5 B;  1SQQ G;  1J2J B;  2CE1 A;  1SQX E;  2OTL P;  2IDB A;  3GLM A;  1ZR2 A;  3CWB J;  4WWI A;  1BCC E;  4FAV A;  3ZOY A;  5GTI E;  1L4A A;  2IBZ E;  1BDC A;  2DW3 A;  3AEB C;  3H1H G;  2BH4 X;  1C2N A;  2QJY B;  1R5L A;  1CIH A;  4N0K A;  4PV1 C;  1JY3 N;  2J59 M;  1MZ4 A;  2KUB A;  3U59 A;  2CA4 B;  3L73 D;  1ETP A;  5CIG B;  1GL2 D;  2Y9Y A;  1VQP P;  1BL9 A;  1OXZ A;  2WSF H;  1KTM A;  2OYI C;  3Q2Y A;  3RK3 C;  2BEQ D;  3ABV C;  3RL0 D;  3H6P A;  3E7K A;  3TGU G;  1N86 A;  2A45 G;  1VQL P;  3A0H H;  3B5N C;  1YEA A;  1VF5 B;  2M3E A;  1Q7Y Q;  1CHJ A;  3CCR P;  2V4H A;  2E74 B;  1CYJ A;  1U75 B;  3L4O A;  4GT1 A;  1BE3 D;  2OGU A;  1NVO A;  5AW7 B;  1E79 H;  3KZI E;  4BXL A;  1M1J A;  2M5A B;  2AEM A;  1GKS A;  3HQ9 A;  3IFM A;  3CXH E;  5AVY B;  1WVE C;  2P10 A;  3TGU E;  4Z1M H;  2K1A A;  1R0Q A;  1T6A A;  2JO1 A;  1NTK D;  2ZT9 B;  2XZR A;  1HH0 A;  1KQL A;  2XV5 A;  2ZT9 C;  5AVZ B;  2P58 A;  1GD2 E;  3Q5R A;  1OAE A;  3PJS K;  1YJN P;  2ZVN B;  3AE7 C;  2XDJ A;  1L2P A;  4Y5R A;  3V4W A;  2KIK A;  4YXW H;  2OTJ P;  2FYU G;  3RK2 B;  3P7K A;  1Y9B A;  3A0B E;  1BDD A;  3CCM P;  1CNO A;  1ZW0 A;  3CU4 A;  5CMZ A;  5CJ4 A;  2HPC B;  1SVF A;  2IPP A;  5CCH C;  1KX7 A;  4WY4 B;  2UWJ E;  1JY2 N;  3CWB D;  4WY4 C;  5AW3 B;  1FJP A;  1NTM D;  1SQV G;  1J1D C;  2KOG A;  4HB1 A;  2N3B A;  1BSH A;  2XU6 A;  2KNC B;  3X39 A;  5IY5 1;  3PH0 A;  1RZ6 A;  4FA5 A;  1KX2 A;  1JTH B;  4IL6 E;  3CD6 P;  5APU A;  1H9Y A;  1A56 A;  2HR3 A;  1MZ9 A;  4M3L A;  3LW5 J;  2HG5 D;  2Z5I A;  3L70 G;  1S4X A;  2Q7C A;  5AVU B;  1HVV A;  4PJ0 V;  1JMB A;  3HTK A;  2BCC D;  1DD4 A;  3II6 A;  3B71 A;  3FX0 A;  2YKO A;  3VOP A;  1GW3 A;  4PV1 B;  3MK7 B;  4IL6 X;  1S2E A;  2FY8 A;  1GIW A;  2QJY C;  1U74 B;  1G1I A;  2YXQ B;  2H88 C;  1M90 Q;  1NU1 G;  1YHQ P;  1HWT C;  1P84 I;  2FFD A;  1IC2 A;  1URQ D;  1L4A B;  2Y0E A;  3CYT I;  3EQ2 A;  5KAF V;  2YQB A;  2K9J A;  2V08 A;  3CXH D;  1FBM A;  2JKV A;  1OWA A;  1H1O A;  5B66 E;  2QJK B;  4EOT A;  1U57 A;  3CME P;  3UIA A;  2N1T B;  1BE3 E;  1SQV J;  3HUS B;  1VQ7 P;  2LR2 A;  1T8Z A;  3VTP C;  5B5E H;  3CCJ P;  1LT1 A;  1HGZ A;  1PIX A;  2AEJ A;  2E75 D;  4XE5 B;  4AX3 A;  1DX7 A;  4V2K A;  4FA9 A;  4XFJ A;  3NTN A;  1CRI A;  5GTH E;  3OW2 O;  3PXS A;  1X8Y A;  4HKZ H;  2FKW B;  1N2D C;  1C6S A;  2YKP A;  3BRV B;  2WSE J;  2C9L Y;  4H13 C;  1FZC A;  3RK3 E;  1H8A A;  5KAI V;  2E76 C;  1C6R A;  2HFE D;  1CTJ A;  1ZRT E;  2I8F A;  5CBO A;  2YNY A;  3KXD A;  1AOQ A;  1SQP K;  3M9B A;  4C7N B;  1QVF O;  3C1L A;  2Q6Q A;  1VPC A;  2C9N Y;  3TYY A;  1AOF A;  2ZZS 1;  1FJ0 A;  3ORV A;  2YCC A;  1UII A;  2GUS A;  1KQF B;  1KYO D;  4GKG A;  4RJT A;  2GUV A;  5KJ7 C;  2E75 B;  1GMJ A;  5L8R J;  3E1I A;  3D6Z A;  2IZ0 A;  2CPB A;  2D0S A;  1QX8 A;  1ZXG A;  1VL2 A;  4NPF X;  1CSX A;  3OJA B;  4TT3 H;  4Y99 B;  4L74 A;  4UB6 V;  5AW2 B;  2RKL A;  1CTZ A;  2AIU A;  5DJQ B;  4LLH A;  1HF9 A;  1GQ1 A;  5M1B A;  2K37 A;  3AED C;  1VQ4 P;  2IBZ I;  1MFZ A;  1KD1 Q;  4WQ8 A;  1CRC A;  1LWU A;  4DT0 A;  1GL2 C;  1CTY A;  1XTG B;  2WPV B;  1JY3 P;  1DVV A;  2Q1K A;  2BCC E;  4JBZ A;  1I6E A;  1BSN A;  1MV8 A;  3EFG A;  2WSE H;  2PRR A;  3CX5 H;  1NAY A;  5B6Q A;  1LTB C;  3AE2 C;  1DEE G;  1BGY E;  2C1V A;  1OW7 A;  4EID A;  1FI3 A;  2WZ7 A;  3FXD A;  1VDF A;  1B7V A;  3HD7 B;  1KIL C;  1WEJ F;  1H32 A;  1PGP A;  2W8Z A;  1SFC C;  3MGN A;  4IFD K;  4O9B A;  1LFM A;  1G2C A;  5KAI H;  2QM7 A;  1IJD B;  1SQV D;  1NTK E;  2FYN C;  3CWB G;  3CCV P;  4L75 A;  5CCG D;  1L4A C;  3H1J G;  4UB6 E;  1YYC A;  3W68 A;  3KZI V;  1OZH A;  5AVS B;  2ORL A;  1HJ4 A;  1K3G A;  2IFN A;  1GTW A;  2E74 C;  2Y0C A;  5CHX A;  1HCM A;  4GOD A;  2BLF B;  1RQU A;  4PD4 E;  1VF5 C;  3A5T A;  4LJI A;  3CI9 A;  4I7Z B;  2PGD A;  3OA8 B;  1FZB A;  4JPZ B;  2A06 G;  1YIT P;  3S9O A;  4PWA A;  1SQQ J;  3VMA A;  4MN4 C;  3JSV C;  1OVR A;  4NPD A;  2IYP A;  1XTC C;  4GIF A;  3PP5 A;  1KIL E;  2R3S A;  3M97 X;  1YCC A;  3L4F A;  5B5E V;  1RH5 B;  2PAJ A;  3V2N A;  1URQ A;  1ZP0 C;  3GG2 A;  1KIL A;  3BAT A;  1QL4 A;  1FZF A;  1SFC A;  1DEB A;  5E79 H;  1HJ0 A;  1L0L J;  5GTI V;  2JP3 A;  3A0B V;  5CBN A;  5APY A;  2D2C B;  2QIW A;  3RK3 B;  2IBZ D;  2C0X A;  2LXC B;  2JWA A;  1NO4 A;  2OTK E;  4B86 A;  1NKN A;  1M56 D;  1RQV A;  2PCC B;  2XKM A;  2OQQ A;  3T97 B;  3KQG A;  5AUR A;  3L74 G;  2B89 A;  2HOD B;  3ITK A;  1EDI A;  3MIW A;  3ZDM A;  3H1J E;  3WU2 H;  3BVH A;  3SXT A;  3BRT B;  2OYI A;  2N3Y A;  3H1H J;  5BU8 B;  3VNW A;  5E79 E;  1CHI A;  1JO5 A;  4IL6 V;  3V2R A;  3MP7 B;  1T3J A;  4YTP C;  1X0T A;  1CED A;  3BCC J;  1GL2 B;  1LTG C;  3G71 P;  2WT7 A;  4P4Q B;  1KFN A;  2KS1 A;  4K35 A;  1NTM G;  2E76 B;  4PJ0 E;  3S1K A;  3VN0 A;  4U3F E;  2OZ1 B;  2HV4 A;  2O1J A;  5BVZ A;  1RE4 A;  4UB8 H;  2E5Y A;  1T2K D;  3D70 A;  5KKZ C;  1SQP G;  1A02 F;  1CXC A;  1L4A D;  1RAP A;  4BRY A;  2PFX A;  1USD A;  5C9M A;  1URQ C;  5CJ0 A;  1N7S D;  3FWN A;  1CZQ A;  3V2P A;  1I55 A;  3S4R A;  2ZYD A;  2FYU E;  3KDP B;  1GW4 A;  1GU4 A;  2AXT H;  2NPS B;  1EXJ A;  3L4M A;  1AA0 A;  2H7H A;  3L73 E;  3Q5P A;  4PV1 D;  1KB9 D;  1QGK B;  1KIL D;  4I2L C;  1I54 A;  2GC4 D;  1GZL A;  1C7M A;  1QKS A;  2BCC G;  1FOC A;  3VP8 A;  2H89 C;  2N9B A;  2YKQ A;  1EXI A;  2AXC A;  3O8Z A;  1FE6 A;  1H32 B;  4N78 E;  2GIW A;  2B88 A;  1FU1 A;  3Q3D A;  3HE4 B;  4HH2 A;  1DT1 A;  1EZV D;  3WFD C;  2ZXE B;  3L75 G;  4EYY Q;  1MUU A;  4WQ9 A;  1JEK A;  1FZC B;  1JY2 P;  4XYD B;  1NMI A;  4GED B;  2N9I A;  4WY4 A;  4OGQ B;  1BE3 G;  4WY4 D;  1N15 A;  1IRW A;  3PHL A;  4K3I A;  1PV3 A;  5CCG A;  4WQD A;  3CCE P;  3TDK A;  5AW6 B;  1VQN P;  1R5S A;  1M1J B;  3TGU D;  5KTB A;  1M1K Q;  5AW0 B;  4W7Z A;  2JQR A;  1FOS E;  2W6J H;  4PD4 I;  4N3Y B;  2CE0 A;  4MU8 A;  1L0N D;  3HTK B;  4H0L B;  1Y47 A;  3A0H E;  3HQ8 A;  4OGQ D;  3MHV A;  1PGJ A;  1CI6 A;  1IZN B;  2Y0D A;  4BWN A;  1I8O A;  2O1K A;  5APX A;  1IFI A;  3TNU A;  3H25 A;  3D71 A;  1C6O A;  3L72 E;  2KYV A;  4GYD A;  3B8E B;  2WSF J;  3RK2 C;  2IYO A;  4ZMD A;  1GDT A;  4AAN A;  1LJ2 A;  4ZKP A;  2KI7 B;  4BRY B;  2WIT A;  4YPC A;  2IX7 C;  1W5C T;  5B66 V;  4WQA A;  5APV A;  1SQX J;  2J58 A;  2CXB A;  1OVU A;  1LC2 A;  3SWF A;  3AE3 C;  4EI2 A;  1IZL 0;  3OA7 A;  1IFJ A;  2KLU A;  2QM8 A;  3NWV A;  3BAS A;  2ZAE B;  5KKZ B;  2W6A A;  3G6E P;  2HYN A;  2OAR A;  3VYM A;  3L71 E;  3RL0 B;  3L73 J;  1NGM B;  2NPS D;  4R4L A;  1N50 A;  4JYB A;  1SQX D;  1RF1 B;  1W2L A;  3H1L G;  1N7S B;  1GL2 A;  2L5G B;  2ZXY A;  3FWL A;  3NBT A;  3SWY A;  1VQ5 P;  2AXT E;  1N7L A;  1KV4 A;  4AAO A;  1K8A Q;  1JUN A;  3O5C A;  5H2F E;  2QJP B;  2OYO A;  1BE3 J;  1EQ7 A;  2YO3 A;  3H1I E;  2QJP C;  3SJL A;  1LTJ B;  1FDI A;  4AQR D;  2OYI B;  4DOJ A;  1JY2 O;  4JYC A;  1BCC D;  5DJU B;  1IK9 A;  1WMK A;  1LTA C;  2NPS A;  1L9J C;  2DVH A;  3LIE A;  3D6Y A;  1L9B C;  1DVH A;  2D0W A;  2I1J A;  1DD3 A;  3O20 A;  3B5N B;  1CSB A;  2CPS A;  1WRG A;  1NKZ B;  3TSI A;  1NH4 A;  1M6Z A;  2QSI A;  5B5E E;  3HUS C;  1SS1 A;  1SQB G;  5AVV B;  2PP6 A;  4ZNC A;  1F1F A;  2A45 I;  2VHD A;  2W6B A;  1CI6 B;  4OWF A;  4PW9 B;  3CLQ A;  5DJT B;  1ZN5 A;  3O1Y A;  4UB8 V;  4DY9 A;  4YE1 A;  3KHU A;  1CYC A;  1FZA A;  2AXT V;  1PGQ A;  1COR A;  3SFE C;  1SQB E;  3AEA C;  1YJW P;  3A0B H;  3O0R C;  2CK3 H;  2G8Y A;  5H2F V;  2W90 A;  3F89 A;  3WFC C;  3L35 A;  1OW8 A;  4WB4 A;  3RBZ A;  1FAV A;  1NU1 D;  4C7N A;  4K3A A;  3P32 A;  1NTZ K;  3AEC C;  3EFF K;  1LWU B;  3RK2 D;  1S6V B;  3M06 A;  5TJH A;  3ZOX A;  3LW5 H;  2KZI A;  1VQ9 P;  2KZJ A;  4LGD E;  4RES B;  3IR9 A;  1EZV E;  1PZQ A;  4OGQ C;  3I5C A;  3SLE A;  2GM4 A;  3L75 D;  4PD4 D;  2C2C A;  4WQB A;  1MFT A;  2WSS H;  3PXT A;  2WPS A;  1CRG A;  1RHZ B;  1KB0 A;  2Z5H A;  4O1Q A;  5CIH B;  1RE3 A;  3WFE C;  4D6T G;  4H0J A;  1LP1 A;  1SQX G;  1PP9 D;  2ZFC A;  3FXE A;  1NJI Q;  2FFD B;  4L73 A;  3C9I A;  5KAF H;  3H32 B;  2O3J A;  3SFD C;  1S3J A;  2M3B A;  1L0N G;  2L91 A;  1LNQ A;  2N9Y B;  1NTM J;  3M9H A;  1OCD A;  4JCG A;  2OYH A;  3JC2 2;  1SFC B;  1CCR A;  4IFF A;  4JQ0 D;  1GU5 A;  1Q2N A;  2EXV A;  1HJB A;  1YIJ P;  4HJG H;  1H88 A;  3M9Q A;  3L73 G;  2FYU J;  1KN7 A;  1HRC A;  1M70 A;  2K3R A;  2DGE A;  2FYU K;  3V2Q A;  3G4S P;  2LIR A;  3A9F A;  3OA8 A;  5AW1 B;  1T2K C;  1NHL A;  2V7Q J;  1CIE A;  1SLQ A;  4W80 A;  1VQK P;  4GDO A;  1FI7 A;  2AEF A;  2E5T A;  2IFM A;  2WPQ A;  1IFN A;  3CCS P;  5E79 V;  4U3F J;  5AVW B;  5AVT B;  1GU2 A;  1LTI C;  1W2E A;  1DW3 A;  3V4Q A;  3H1K D;  4I7Z C;  1DH3 A;  3CCQ P;  3G9R A;  1YTZ I;  3SWS A;  5BU5 A;  1CRJ A;  5KLV G;  2J5U A;  3H1L D;  4QAO A;  3HD7 C;  1A2S A;  4DCK A;  1HTL C;  2WT7 B;  2B11 B;  1S1C X;  2QEX P;  1OVV A;  2OZ1 A;  3DR0 A;  3B5N A;  1M1J C;  2K9Y A;  3GMA A;  2RN0 A;  1VQO P;  1OX3 A;  3ZIY A;  1DIP A;  4HYT B;  3PH2 B;  1L0N K;  1QEX A;  1FJK A;  1CO6 A;  1VQM P;  3HRN A;  3KYQ A;  1PGO A;  2D2C D;  1AVY A;  2ZJS E;  4DZO A;  1A8C A;  1NAF A;  1LT9 B;  4OH8 B;  2Q3I A;  1JCD A;  4YXD C;  1NTK K;  3AEE C;  3CXH W;  3I55 P;  2N1T D;  5CIB B;  4H13 D;  4W7Y A;  1PPJ G;  2K9J B;  2WMM A;  2ITA A;  1DW1 A;  1EB7 A;  2B0Z B;  3SSU A;  3T97 A;  1SQP J;  2JWD A;  2N18 C;  2C0W A;  1AQ5 A;  4WBA A;  1ZME C;  3JCU E;  3R4Y A;  4EIJ A;  1JNM A;  1J1D B;  3HD7 A;  1LP1 B;  3A7O A;  4AAM A;  1IFM A;  3Q5S A;  1JM0 A;  3VMY A;  2L4D A;  2FRC A;  1SQP D;  4KHX A;  4D6T E;  2C9X B;  5APS A;  3L74 D;  1YNR A;  2OYH B;  1JY3 O;  2WQY C;  5CCG C;  3PLN A;  3ZOW A;  3ZOO A;  1IK7 A;  2YIU C;  5KLV J;  1PPJ D;  3CX5 I;  1HZV A;  1X9V A;  2JEE A;  1PP9 G;  2YIU B;  4D6T D;  2FXO A;  2KNC A;  2ZYA A;  2PCB B;  1RE4 C;  1YEB A;  2POH A;  3WMM 0;  3D0W A;  4L3G A;  1H31 B;  3RN0 A;  3RN1 A;  3A0H V;  2I1K A;  3H1K J;  4L1Q A;  2P7J A;  4N78 D;  1CCH A;  1OIP A;  3MD0 A;  5EFW B;  2WPR A;  3B4S A;  5DF5 A;  2ZBO A;  3H32 A;  3RLM A;  2C1D B;  2N1T A;  4L76 A;  1HJ5 A;  5CID B;  2PAC A;  3K5B A;  1P84 H;  1E8E A;  4IOI H;  1RY3 A;  2QG4 A;  1Q82 Q;  1BCC G;  4KJM A;  3LID A;  4UB8 E;  3TGU J;  1NYH A;  4ASV A;  3PXW A;  1Q86 Q;  3EWK A;  4I1L A;  1I5T A;  4TLF A;  2LKM A;  3WUV A;  3O6Q A;  2A45 H;  5AVX B;  2O01 J;  2QRX A;  1CIF A;  2BPB B;  5AW4 B;  1OMI A;  2KP8 A;  5CYT R;  1OW6 A;  4H13 B;  2XND H;  3AE5 C;  4AYC A;  451C A;  1RAQ A;  1EZV I;  5AVR B;  1AVO A;  1FI9 A;  1DII C;  2KLV A;  5KJ7 D;  4KMG A;  5TIS H;  3WC8 A;  1VQ8 P;  4EDF A;  2WSC H;  3H1H E;  1ZRT D;  1X79 B;  3DP5 A;  1SQQ D;  5KLI C;  4U7J A;  1QN2 A;  1ZV8 A;  4OVN F;  3E1R A;  1NTM K;  2B10 B;  1AV1 A;  2N1T C;  1KOR A;  1CXA A;  1SP4 A;  1H0T B;  1NTZ D;  1SQQ E;  2B9B A;  5AVQ B;  3H1J D;  2H43 A;  3OCD A;  1F1C A;  3L71 G;  1M57 D;  2YXR B;  3BCC G;  1L0N J;  1S5L E;  1C52 A;  1ZLL A;  1CRH A;  4J20 A;  1KIB A;  2IBZ G;  3GHG C;  5KLV D;  3VP9 A;  3VRD A;  5KJ7 A;  3GHG B;  1CW5 A;  3CXH I;  1AQT A;  1CRY A;  1HBW A;  1CYI A;  4XA4 A;  3JBT B;  4H44 C;  3TNU B;  2SPZ A;  1LTT C;  4H0L C;  2RH0 A;  2BCN B;  1Y8A A;  2KSJ A;  3H1I J;  3L75 J;  1LT9 C;  1BCC J;  1PFI A;  2A06 D;  1YTC A;  2Q9I A;  1SQP E;  3BCC D;  4Y99 C;  2JR8 A;  3L71 D;  4UB6 H;  5APW A;  1K04 A;  3IN6 A;  1U7M A;  1R8E A;  2JTI B;  3P8M C;  2FWL A;  1K3H A;  2E42 A;  3RL0 g;  3L70 D;  2N9J A;  1YBK A;  2WTY A;  1L0L G;  3L75 E;  1IO3 A;  1HRO A;  1LTJ C;  2V07 A;  4I6M C;  4Y28 J;  2ZVO B;  5AW8 B;  3VMX A;  3AE9 C;  5KLV K;  4KT0 J;  1RF1 A;  5C0Z A;  3L71 J;  1CC5 A;  5GTH H;  3G3Z A;  3CX5 E;  4NPE A;  1D7M A;  3NFQ A;  4RO0 A;  5APQ A;  1PPJ E;  1H31 A;  3CWB E;  3CC2 P;  2MJZ A;  3A3Y B;  1DW0 A;  3V5B A;  1FDO A;  1KC8 Q;  3CCL P;  1M7L A;  3GHG A;  2YMK A;  1LGH B;  1CSV A;  1LMS A;  1YTZ T;  3AE8 C;  4ZKU A;  3GF7 A;  2KS1 B;  1Q81 Q;  1HUC A;  1SQX K;  1L0N E;  3AE4 C;  1EC5 A;  3L70 E;  1IFP A;  1LT9 A;  3OCD B;  2IZ1 A;  1YQ3 C;  1YI2 P;  1HH7 A;  3W67 A;  3IAO A;  2CA3 B;  3U1C A;  2KSE A;  5EXQ A;  3H1J J;  2O01 H;  2QVA A;  3TK1 A;  4Q5P A;  1KYO I;  3MTU E;  3C8V A;  3ZCF A;  1ZZH A;  1BGY J;  1FC2 C;  1IFD A;  1QLE D;  1P84 E;  2HOD A;  1E5W A;  2E76 D;  4JF7 A;  3CXH H;  3WUI A;  1FS0 E;  1EZV G;  1NWQ A;  3P8C E;  3NXS A;  2WSC J;  3NMD A;  1NTK J;  1H33 A;  1IRV A;  2FXP A;  5DJQ C;  2QA4 P;  1NML A;  2WWW A;  3QWO C;  4GOF A;  1FCD C;  1I8P A;  3CPW O;  3KPE A;  1I6D A;  1S5L X;  1H9X A;  2BAS A;  1C75 A;  1YFC A;  2B4Z A;  4A7P A;  3BCC E;  3AE1 C;  3VMZ A;  4GOE A;  5GTI H;  2BEZ F;  3DMI A;  4XXL A;  3B5N D;  2M8R A;  3H1L E;  4CPG A;  4AAL A;  3MUD C;  2MHM A;  3RK3 D;  1M60 A;  2GC7 D;  5K5G B;  4PJ0 H;  3H1K E;  2FYU D;  2AI5 A;  2D2C C;  4FA4 A;  1SQB K;  1X22 A;  1YJ9 P;  4EIC A;  5KLI B;  1KFM A;  1K9M Q;  1RE3 C;  1UIX A;  2FXM A;  1OFC X;  3HQ6 A;  3RBX A;  2Y9Z A;  4DJG A;  3PTZ A;  1L0L K;  1SQQ K;  2LIT A;  3WU2 E;  2KXP B;  3CX5 W;  5H2F H;  2MTA C;  2P1J A;  1KZU B;  1EDK A;  2ZXX A;  2FYZ A;  4N6J A;  4QMA A;  3P8C D;  1E29 A;  2WVR A;  1USE A;  3M0D C;  4O1W A;  1TU3 F;  2B12 B;  1SFC D;  3HQ7 A;  2Z4E A;  1CSW A;  2YMY A;  1J3S A;  3NBS A;  3OAK A;  5TIS E;  3L72 D;  1FZC C;  4IL6 H;  3N4X A;  3V6I A;  2B87 B;  3FGA D;  1N7S C;  3TF5 A;  1BGY D;  3HE5 B;  1RF0 C;  1QYZ A;  2Q3E A;  1NU1 J;  1KMI Z;  1N73 C;  2M0B A;  3WFB C;  1S5L H;  1NOH A;  2KB7 P;  2QE7 H;  1WT6 A;  1VQ6 P;  3L72 J;  2MKV A;  1ZR4 A;  2Q5U A;  3HE4 A;  1VYD A;  1M8O B;  3F5H A;  2HPC A;  4PD4 H;  1EDL A;  4H0K A;  1S9K D;  4H0L D;  1E2R A;  3L72 G;  3HUS A;  2QJK C;  4H44 D;  3RGU A;  3N7N A;  3WU2 V;  1KYO H;  1JOC A;  1CSU A;  1MG2 D;  1KB9 I;  4EIF A;  4EIE A;  1ZOY C;  1G2C B;  3M0D A; 
#chains in the Genus database with same CATH homology
 2JQR A;  5CIC B;  3RN0 A;  3RN1 A;  3A0H V;  1H9Y A;  1A56 A;  1AKK A;  4L1Q A;  1CCH A;  2CE0 A;  4MU8 A;  1L0N D;  5DF5 A;  2ZBO A;  4PJ0 V;  5TIS V;  3HQ8 A;  3RLM A;  2BCC D;  2BH5 X;  2C1D B;  155C A;  2Y0D A;  2N18 B;  1HJ5 A;  1I8O A;  2PAC A;  5CID B;  1E8E A;  3MK7 B;  1C6O A;  2QG4 A;  1CIG A;  1H33 B;  1GIW A;  1U74 B;  4GYD A;  4AAN A;  3PXW A;  1W5C T;  5B66 V;  4WQA A;  2Y0E A;  3CYT I;  1YIC A;  1QL3 A;  1I5T A;  2ZOO A;  2YQB A;  5KAF V;  2V08 A;  3CXH D;  2CXB A;  1LC2 A;  1H1O A;  3RMZ A;  2QJK B;  1IZL 0;  1CIF A;  2BPB B;  3ZBM A;  1GDV A;  5CYT R;  3NWV A;  4U3F D;  5KKZ B;  451C A;  1RAQ A;  3VYM A;  1KYO W;  1FI9 A;  1DII C;  4FB1 A;  5CIF B;  1C2R A;  1N50 A;  4KMG A;  1SQX D;  3WC8 A;  4AX3 A;  1W2L A;  1DIQ C;  4V2K A;  5DFS A;  4FA9 A;  4EDF A;  3H1I D;  1ZRT D;  2ZXY A;  3FWL A;  1CRI A;  1YIQ A;  3DP5 A;  1IQC A;  1SQQ D;  3PXS A;  3NBT A;  1QN2 A;  1C6S A;  4AAO A;  4WQC A;  2B10 B;  5KAI V;  5GTH V;  1C6R A;  1S5L V;  2ZON G;  3O5C A;  1CTJ A;  1CXA A;  1CHH A;  2I8F A;  1NTZ D;  2QJP B;  1N90 A;  1JDL A;  3H1J D;  1AOQ A;  3OCD A;  1HJ3 A;  3H1H D;  1F1C A;  1FHB A;  3SJL A;  1C52 A;  1AOF A;  2ZZS 1;  1FJ0 A;  3ORV A;  1CRH A;  2YCC A;  4RJT A;  1KYO D;  1BCC D;  4J20 A;  1NIR A;  1KIB A;  3C2C A;  3SVW A;  1DW2 A;  5KLV D;  1AYG A;  3VRD A;  1L9J C;  2D0S A;  2DVH A;  1L9B C;  1CSX A;  1CRY A;  1DVH A;  1LS9 A;  3MK7 C;  2D0W A;  2C1D A;  3O20 A;  4UB6 V;  1CYI A;  2GB8 B;  3JBT B;  2FYN B;  1CTZ A;  2AIU A;  1M6Z A;  5DJQ B;  1GQ1 A;  1COT A;  4FAN A;  1F1F A;  2BCN B;  2VHD A;  1KV9 A;  3GW6 A;  4PW9 B;  3O1Y A;  4WQ8 A;  1CRC A;  4UB8 V;  3CX5 D;  2RMZ A;  2A06 D;  1YTC A;  1RZ5 A;  1CTY A;  3BCC D;  3L71 D;  4DY9 A;  4YE1 A;  4NFG B;  1DVV A;  3KHU A;  1CYC A;  2C1U A;  2JTI B;  2AXT V;  1I6E A;  2FWL A;  1COR A;  1K3H A;  1SQB D;  3L70 D;  2N9J A;  1L0L D;  3O0R C;  5B6Q A;  1IO3 A;  1HRO A;  5H2F V;  3WFC C;  2V07 A;  1GJQ A;  2C1V A;  3PRJ A;  4EID A;  1FI3 A;  1NU1 D;  5C0Z A;  1B7V A;  1CC5 A;  1WEJ F;  1NNO A;  1H32 A;  1HZU A;  1LFM A;  3TYI A;  4FA1 A;  1S6V B;  1H31 A;  5TJH A;  3ZOX A;  1P84 D;  2C8S A;  4WQE A;  1DW0 A;  1SQV D;  4WQ7 A;  4RSZ A;  1CSV A;  1LMS A;  2XTS B;  3SLE A;  3L75 D;  4PD4 D;  3KZI V;  2C2C A;  2ORL A;  1HJ4 A;  4WQB A;  3PXT A;  1K3G A;  2Y0C A;  3OCD B;  1CRG A;  1HCM A;  1KB0 A;  2BLF B;  1HH7 A;  4O1Q A;  2CA3 B;  4LJI A;  5CIH B;  5EXQ A;  3WFE C;  3OA8 B;  4H0J A;  1PP9 D;  3CP5 A;  4Q5P A;  4PWA A;  5CIE B;  3ZCF A;  1ZZH A;  4L3H A;  3VMA A;  2O3J A;  1LC1 A;  2L91 A;  3M97 X;  1YCC A;  2N9Y B;  5B5E V;  1OCD A;  4JCG A;  3WUI A;  351C A;  2BGV X;  1MG3 D;  3GG2 A;  1CCR A;  1QL4 A;  1N9C A;  2YK3 A;  1H33 A;  1IRV A;  2EXV A;  5DJQ C;  5GTI V;  1NML A;  2CE1 A;  3A0B V;  1HRC A;  1M70 A;  1FCD C;  2DGE A;  2IBZ D;  1I8P A;  2LIR A;  3A9F A;  2JWA A;  3OA8 A;  4FAV A;  3ZOY A;  1I6D A;  1CIE A;  2PCC B;  1H9X A;  1C75 A;  1YFC A;  2B4Z A;  4A7P A;  5AUR A;  1FI7 A;  2BH4 X;  1C2N A;  3DMI A;  3ITK A;  2QJY B;  4XXL A;  5E79 V;  1CIH A;  1GU2 A;  4N0K A;  3SXT A;  1MZ4 A;  1DW3 A;  2CA4 B;  3L73 D;  1ETP A;  2N3Y A;  3H1K D;  5CIG B;  4AAL A;  3VNW A;  2MHM A;  1M60 A;  2GC7 D;  1CHI A;  1BL9 A;  3SWS A;  4IL6 V;  2FYU D;  2AI5 A;  1CRJ A;  4FA4 A;  3H1L D;  4QAO A;  1A2S A;  1CED A;  4EIC A;  5KLI B;  2B11 B;  1YEA A;  4P4Q B;  1CHJ A;  3HQ6 A;  2KS1 A;  2OZ1 A;  3DR0 A;  1CYJ A;  3PTZ A;  1U75 B;  3L4O A;  2OZ1 B;  1BE3 D;  2HV4 A;  2RN0 A;  3ZIY A;  2LIT A;  3PH2 B;  1CO6 A;  1CXC A;  3CX5 W;  1RAP A;  2MTA C;  1GKS A;  3HQ9 A;  5C9M A;  1A8C A;  1WVE C;  1I55 A;  1E29 A;  1R0Q A;  3L4M A;  4O1W A;  1NTK D;  2B12 B;  3CXH W;  3HQ7 A;  1KB9 D;  1CSW A;  5CIB B;  1OAE A;  2K9J B;  1DW1 A;  1EB7 A;  2B0Z B;  1I54 A;  1J3S A;  3NBS A;  2GC4 D;  3L72 D;  1C7M A;  1QKS A;  1FOC A;  4Y5R A;  3TF5 A;  1BGY D;  2N18 C;  1QYZ A;  2Q3E A;  1H32 B;  3WFB C;  2GIW A;  4AAM A;  1CNO A;  1DT1 A;  3CU4 A;  1EZV D;  3WFD C;  4WQ9 A;  4XYD B;  1NMI A;  2L4D A;  1VYD A;  2FRC A;  4GED B;  1SQP D;  2N9I A;  2C9X B;  1KX7 A;  3L74 D;  1YNR A;  1N15 A;  3PLN A;  4H0K A;  3CWB D;  1E2R A;  1IRW A;  3ZOW A;  3ZOO A;  3PHL A;  4K3I A;  1NTM D;  1PPJ D;  4WQD A;  2N3B A;  3WU2 V;  1HZV A;  1CSU A;  2YIU B;  3TDK A;  4D6T D;  1MG2 D;  4EIF A;  3TGU D;  4EIE A;  2PCB B;  2KNC B;  3X39 A;  5IY5 1;  1YEB A;  1RZ6 A;  4FA5 A;  1KX2 A;  4L3G A;  1H31 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...