1EZVD

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ezvD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ezvD01
1CNOA 2FYNB 3L74D 451CA 3JBTB 3O0RC 1GDVA 4EIFA 1NMLA 3ZOXA 5KLIB 1QKSA 4PD4D 3CP5A 1M60A 4YE1A 4WQ7A 1J3SA 1AOQA 3RN0A 1FI7A 1CC5A 1CCRA 4UB8V 3WU2V 4RJTA 4KMGA 2ZZS1 1YEBA 1NMIA 2GC7D 2PACA 2B12B 1EB7A 3FWLA 1QYZA 4EIDA 1W2LA 3CWBD 1YEAA 1CRIA 1CIGA 2L91A 3OA8B 5C9MA 3NBSA 1FI9A 1BGYD 1H9XA 2MHMA 2OZ1A 5CYTR 1NTMD 2Y0DA 1S5LV 5AURA 4O1WA 2C1DA 5GTHV 4UB6V 3ZBMA 1W5CT 2ZOOA 1GKSA 2EXVA 2K9JB 3SJLA 3L70D 1K3GA 3PTZA 1CRHA 1AKKA 2YCCA 1HH7A 3DR0A 5CIBB 1C2RA 2GC4D 2Y0CA 4RSZA 2N9IA 3SLEA 1HJ5A 1C6SA 4P4QB 3H1KD 3L4MA 1WVEC 4AANA 2DGEA 2D0WA 4WQCA 2B11B 1DIQC 1I6DA 3M97X 1E8EA 1M70A 1RAQA 1BE3D 1SQQD 2BCCD 2YK3A 4EICA 3C2CA 3CX5D 1H31A 1I8PA 3BCCD 4FA5A 3VYMA 3CU4A 3WC8A 1DW0A 3WFBC 3H1JD 5DJQC 5TISV 1NU1D 1DVHA 2B4ZA 2D0SA 1RAPA 1DW3A 1N50A 1MG2D 2IBZD 1F1FA 5KLVD 1EZVD 1HZUA 3OCDB 3L4OA 4L1QA 1H9YA 3CYTI 1NTZD 1ZRTD 1L9BC 1QN2A 1KYOD 1AYGA 4FAVA 5GTIV 1I55A 2DVHA 3RLMA 2BH4X 1N90A 2XTSB 1FJ0A 3VNWA 1LMSA 1NNOA 1FHBA 1KYOW 2VHDA 3DMIA 1LC1A 2CXBA 2N3YA 2GB8B 1S6VB 5DF5A 3TDKA 1CRYA 1I54A 1P84D 2ORLA 1IRWA 2L4DA 2Q3EA 4FA1A 3HQ6A 3HQ9A 2MTAC 5CIGB 1GU2A 1U75B 1YFCA 2AXTV 4JCGA 3HQ7A 2V07A 1KB9D 2V08A 3MK7B 2B10B 3WFEC 1I8OA 4FA4A 2JWAA 2O3JA 1YIQA 2AI5A 1MZ4A 2PCBB 4L3GA 5CIEB 5EXQA 1CSXA 2RMZA 5H2FV 2QG4A 3OA8A 3ZOOA 155CA 1RZ5A 1ETPA 4AX3A 4EDFA 1FI3A 1CYIA 2N9YB 1NIRA 1M6ZA 5KAIV 1H32B 3L75D 1CSVA 3SWSA 4WQEA 3ZCFA 1CORA 4WQ9A 3PH2B 5CIHB 3L72D 1CEDA 4AAOA 2C8SA 4FB1A 1CTJA 4Y5RA 3ZOWA 2CE1A 5DFSA 5B5EV 2QJPB 1CHJA 3WFCC 1PP9D 4GEDB 1IQCA 1E29A 1DT1A 1OCDA 4WQDA 1QL3A 2C1VA 2N9JA 1CRGA 4O1QA 2RN0A 4NFGB 3O1YA 1CRJA 1R0QA 1A8CA 1L0ND 5KKZB 2KNCB 2Y0EA 1DIIC 4FA9A 3KHUA 3O5CA 2FRCA 1DW2A 4QAOA 3CX5W 1L0LD 1N15A 2BGVX 1KB0A 2LIRA 1FCDC 1A56A 1C6OA 1GIWA 2FWLA 2ZBOA 1H33B 1LS9A 2N18C 1LFMA 4N0KA 3A9FA 3RN1A 1C52A 1LC2A 2C1UA 3PHLA 1IO3A 4WQ8A 3A0BV 1CXAA 3L73D 2BCNB 2ZXYA 1KV9A 3OCDA 1CSUA 3WFDC 1SQBD 1CXCA 1HROA 2GIWA 1AOFA 1WEJF 1SQVD 1MG3D 4MU8A 3TF5A 4WQAA 1JDLA 1HZVA 1YNRA 3MK7C 4XYDB 4AALA 1CO6A 4IL6V 1C7MA 3PXWA 1CSWA 1HJ4A 3ITKA 1SQPD 2CA4B 3ZOYA 1CIEA 1E2RA 1CYJA 1CRCA 1H1OA 4L3HA 3GW6A 4K3IA 3RMZA 1C6RA 1YTCA 2YQBA 1YCCA 1KX7A 4H0JA 1QL4A 3TYIA 3DP5A 3GG2A 1I6EA 1HRCA 1CTZA 1N9CA 2ZONG 4V2KA 5CIFB 5CIDB 4AAMA 3VMAA 1OAEA 4EIEA 3NWVA 4LJIA 4XXLA 1KX2A 4FANA 2BPBB 2QJKB 2B0ZB 2JQRA 4PJ0V 2OZ1B 1GJQA 3PLNA 2PCCB 1GQ1A 1A2SA 1BL9A 1HCMA 3PXSA 3H1HD 3PXTA 2HV4A 1FOCA 2C1DB 1DW1A 1H32A 2A06D 1DVVA 4U3FD 1CIHA 1CHHA 4WQBA 4PWAA 1COTA 5KAFV 3CXHD 3X39A 1BCCD 3PRJA 1U74B 351CA 1C2NA 1IZL0 3CXHW 4GYDA 2JTIB 1NTKD 3WUIA 2AIUA 3O20A 2YIUB 2C9XB 5CICB 1IRVA 4Q5PA 1H31B 1SQXD 3KZIV 2CA3B 1CYCA 5B66V 2C2CA 5C0ZA 5TJHA 2LITA 4H0KA 2I8FA 2KS1A 3A0HV 3SXTA 3H1LD 1YICA 4A7PA 1H33A 4DY9A 1B7VA 1L9JC 3VRDA 3L71D 3HQ8A 1ZZHA 3H1ID 2BLFB 5IY51 1HJ3A 3TGUD 2BH5X 5E79V 4D6TD 1C75A 4J20A 5B6QA 1CTYA 1VYDA 1CCHA 3NBTA 4PW9B 2CE0A 1CHIA 1PPJD 2N3BA 1CIFA 1RZ6A 1KIBA 5DJQB 3ORVA 2FYUD 3ZIYA 1I5TA 2N18B 3SVWA 1K3HA 2QJYB 1F1CA
chains in the Genus database with same CATH superfamily
1CNOA 2FYNB 3LIEA 3RK3C 2B87A 5APSA 1NTMK 5APQA 1NMLA 1JEKA 3GF3A 1YITP 4PD4D 2Q1KA 3CP5A 1R5LA 2E74D 1OVRA 3AE5C 3RN0A 4L76A 4UB8V 4KMGA 5AW1B 1OFCX 2P7JA 1YEBA 2PFXA 2PACA 2M5AB 1MUUA 2ZVNB 1PGOA 1FOSE 2FXPA 1LT9C 1E5WA 3MIWA 1CIGA 1NKZB 3H1KE 1BGYD 2BEQD 1SFCB 1VQKP 3FXEA 5AURA 2C1DA 3M9HA 5GTHV 1SQQK 1HWTC 2O1JA 2J59M 2E5YA 3M9BA 3CC7P 1FJKA 1NU1G 3VYIA 2OTLP 3PTZA 1CRHA 1ZMEC 2I8DA 5K5GB 4H13B 1JTHB 5CIBB 4PV1B 4GOFA 3B5NA 2GC4D 2Y0CA 4RSZA 3KYQA 2E75C 3H1KD 3CI9A 3KZIH 1EZVE 1WVEC 1Q2NA 2DGEA 1OVUA 2B11B 1DIQC 1NTZK 3M97X 1DIPA 1IFMA 1X22A 3C2CA 4FA5A 2E76C 1GTWA 1L2PA 1NKNA 3CU4A 1LTIC 1DEEG 2UWJE 1DW0A 4ASVA 5DJQC 1EDJA 5AW7B 1ZOYC 4HH2A 3P8CE 4M3LA 4KJMA 1FZCA 1SQXJ 1MG2D 1EZVD 1UIIA 2QVAA 3L4OA 4LGDE 2YMKA 2XV5A 1L9BC 1NO4A 5GTIV 3CL3D 1NGMB 1GDTA 2W83C 3A5TA 1NU1J 1LMSA 3AEGC 1FHBA 3GHGB 2VHDA 1BDDA 2YNYA 1I54A 2ORLA 1ZXGA 2L4DA 2Q3EA 3T97A 2LXCB 5CJ4A 2MTAC 3P32A 3P8CD 5CIGB 2FYZA 1GU2A 1KFNA 3L75E 1U75B 2IYPA 4I1LA 3CMEP 3VMYA 4RO0A 1T2KC 4U7JA 1GL2B 1SFCC 4NPFX 3MK7B 1FDMA 1LTBC 2N1TA 1PP9E 3HD7A 3C8VA 2Z4EA 3L35A 2OYIA 2RMZA 1LP1A 1BE3G 2BCCG 3OA8A 155CA 3A7OA 2FY8A 4AX3A 4H13C 3RK2D 4DT0A 1L0NK 3VP9A 3H1JG 5KAIV 3L75D 3SWSA 2HODB 5CBOA 3A2AA 2GM4A 1WRGA 5CIHB 1VQOP 1LGHB 1L0LK 2ZYDA 3TK1A 1CTJA 2CE1A 5B5EV 2QJPB 2E74C 1PP9D 4GEDB 2WPRA 1CW5A 1IQCA 3MD0A 3W67A 4I2LC 4AYCA 1URQD 1RE3C 2SPZA 2XNDH 2RN0A 4QMAA 1R0QA 1SQBE 2M3BA 1DIIC 4XFJA 1SQVE 1FE6A 3Q5RA 2O01N 1R8EA 1EDIA 1SQPG 2BGVX 3BASA 1KB0A 1HJ0A 2LIRA 1A56A 1GIWA 1QGKB 1HH0A 2ZBOA 2JDIH 2N18C 2QJYC 3M91A 3U1AA 1AQTA 1IC2A 1AA0A 1LC2A 1BE3J 2BCCJ 2C1UA 3GHGC 3PHLA 1IO3A 4WQ8A 3GMAA 2N9BA 3M0DA 1YJWP 1SQBD 2W6BA 1CXCA 3H1JJ 1HROA 1FZAA 1WEJF 3AEDC 2IFNA 1N86A 1SQVD 1RQVA 3LIDA 1JOCA 3L4FA 3B5ND 1HZVA 1YNRA 1G2CB 3MK7C 4XYDB 2H88C 3JCUH 1KMIZ 2B87B 4OGQD 3ITKA 1CRCA 2OQQA 4L3HA 1WMKA 1NTME 2M3EA 1URQB 4U3FE 1KX7A 3TYIA 1BCCG 3KDPB 1N9CA 1FJPA 1QL2A 4YPCA 1AFOA 4EIEA 1QEXA 2WSFH 2QIWA 1MV8A 5APTA 4FANA 1NTKK 1X0TA 2A45H 2PCCB 1A2SA 2OTKE 3PXSA 2C1DB 5AW6B 1DW1A 1FC2C 2PAJA 4C7RA 1YTZT 1SS1A 4U3FD 1SQQE 3H1LG 2HLOA 2IX7C 1N7SA 1KV4A 3L71G 4JPZB 3WUUA 3X39A 2WTYA 4Y99B 4XE5B 4D6TG 1K9MQ 3B5NB 351CA 4GYDA 2JTIB 4HYTB 4OGQB 5CBNA 2WSSH 1VF5B 1YI2P 3O20A 1YBKA 1PPJE 4W7YA 2C9NY 3G9RA 2KNCA 5M1BA 4Q5PA 1LWUA 3CCVP 3RK2C 1BCCJ 5C0ZA 3C9IA 2NZ2A 2D2CB 2I8FA 2MJZA 2IBZI 4NPEA 3ABVC 1ZZHA 1HJ3A 1FZCB 1FS0E 4W80A 1JCDA 1M7LA 3FGAD 3V4QA 3NBTA 1PPJD 2W6JH 1VQ6P 3ORVA 1FU1A 1URQC 5CCHA 2IDBA 3IFMA 1BGYG 3H1LJ 3Q1MA 3L71J 1GW3A 4UB6E 2RKLA 3L73J 1PL5A 1GDVA 1KB9I 2ITAA 3RBZA 4Y28J 4TLFA 3NTNA 2JJLA 2IYOA 3IAOA 1AOQA 2E75D 1FI7A 2W27A 4RJTA 2ZZS1 2KOGA 2B12B 1X79B 1SLQA 2C0WA 2N1TB 3HD7B 2HR3A 3GF7A 1CRIA 2OYIB 2K9YA 1LP1B 1CI6B 3OA8B 5B66E 1FI9A 3EWKA 1N7LA 4Y99C 3V2QA 2Y0DA 2ZYGA 3B5NC 5APUA 3NXSA 4UB6V 5KAFH 3ZBMA 1L0NE 3BCCE 2EXVA 5BU5A 4OGQC 1VF5C 3SJLA 3CXHI 1S4XA 3UIAA 1Y47A 3JSVC 1EQ7A 1NU1K 2R44A 2BASA 2WPVB 2WSCH 1BGYJ 1NWQA 1EZVG 2D2CC 1KQLA 3SLEA 1C6SA 2IBZE 4P4QB 3VP8A 2FYUG 3L4MA 5CCGD 5KLVE 4XA4A 4AANA 5B66H 3E1IA 1USDA 4K3AA 3CWBG 3L74G 2J58A 2KK7A 1FZCC 1M70A 3Q2YA 4K35A 4EICA 3A0HH 3BCCD 3B71A 1FDIA 4WBAA 4H44B 3WFBC 1K73Q 1NTKJ 5E79H 1N8RQ 1DVHA 1RAPA 1FBMA 2KYVA 3FWNA 1Q7YQ 2GUVA 4KT0J 2O1KA 1N50A 2V7QJ 2IBZD 2PRRA 1F1FA 3WMM0 5KLVD 1KB9E 1H9YA 1QN2A 4PV1D 4FAVA 1JB0J 1BSNA 1HJBA 2DVHA 5GTHE 3RLMA 1H8AA 1H88A 1FJ0A 3VNWA 1NNOA 3DMIA 2GB8B 3HTKA 1S6VB 5DF5A 3TDKA 3HD7C 2YKQA 3E1RA 3L70G 4IFDK 2WQYC 3L75G 4PD4H 4FA1A 4UB8H 2LXBA 3CLQA 2QM8A 2WT7A 3M9QA 2KSJA 2AXTV 4DCKA 2I1JA 2FYUJ 3CCSP 1KB9D 3LW5H 3CWBJ 3MGNA 3L74J 1KB9H 1I8OA 2O3JA 2PCBB 3CXHE 1U7JA 2QG4A 5GTHH 3ZOOA 1KTMA 1RZ5A 2IZ1A 2P2UA 4BRYA 1KILA 1L4AA 2H89C 3V4WA 1S1CX 2N9YB 4O9BA 1WT6A 2OYHB 5CCHD 4WQEA 3ZCFA 4WQ9A 1YJNP 3PH2B 1CEDA 1N7SB 4Y5RA 1KZUB 3WFCC 1E29A 1S2EA 5GTIE 1ZW0A 2H8PD 4WQDA 1GL2D 2C1VA 1PGQA 1DD4A 4DOJA 5APXA 2N9JA 1SQBG 3O1YA 3L70J 1CRJA 4I7ZC 3O8ZA 1SQVG 2KNCB 4ZNCA 4IL6E 2KZIA 4ASWA 3M0DC 2Q5UA 1N73A 1A02F 1N15A 3P7KA 1N2DC 2YXRB 1VQ8P 1FCDC 1SQPK 2FYNC 3I55P 3A9FA 1QL1A 3BATA 5AVXB 3WUTA 1GW4A 1JCCA 5GTIH 2KP8A 5AW0B 3A0BV 4HJGH 1CXAA 2K3RA 3OCDA 1NH4A 4YXWH 1AOFA 4Z1MH 2O01J 3R2PA 5CCGC 2A45G 3MZWB 3V2PA 5KAIE 3SWFA 2IPPA 1CO6A 4IL6V 1C7MA 1EC5A 4NPDA 3L72G 5L8RJ 1HJ4A 5AVZB 1HVVA 2CA4B 1OW8A 3ZOYA 3RGUA 1CIEA 2KI7B 1E2RA 3H1HE 1CYJA 1VQLP 1KN7A 4U3FG 5B5EE 3G71P 1M1JA 1D7MA 3AEEC 2YQBA 1YCCA 2JR8A 4WY4A 2Q3IA 2R3CA 4WB4A 1SQVJ 2XNXA 2OYOA 1I6EA 1HRCA 1OWAA 2OYHC 4V2KA 1J2JB 5CIDB 2YKOA 1KORA 3VMAA 1Z56A 1YIJP 2FFDA 1OAEA 3NWVA 4LJIA 1RF0A 1OW6A 3P8MC 3D6YA 5KAIH 4PV1C 2B0ZB 4PJ0V 2ZT9B 1GU4A 1NOHA 1HCMA 1Q81Q 5AVVB 2WPSA 3H1HD 1FOCA 1PZQA 2HPCA 1SQXE 1H32A 1K04A 5B5EH 1DVVA 3V2RA 1Q82Q 3F5HA 1CHHA 4WQBA 2WSFJ 2E42A 1COTA 1Y8AA 1KILE 4BWNA 2ZXXA 3PRJA 1FZEA 2CK3H 1NU1E 4L75A 2Z5IA 3MP7B 3CX5I 2WWWA 2L5GB 3L72J 1AV1A 4U3FJ 1RE4A 1AJYA 4C7NA 2V4HA 1SQXD 5AVRB 3RL0g 1CYCA 1DD3A 1GMJA 2G3AA 4N6JA 2WPQA 2GA1A 1H89A 3SXTA 1YICA 5CCHC 1KQFB 1NHLA 1KILD 1L9JC 1YHQP 4HKZH 1KYOI 2Q9IA 1C75A 1M1KQ 4J20A 1VYDA 2CE0A 1CIFA 1GL2C 1KIBA 2R32A 2XDJA 3G3ZA 1LTAC 3NFQA 3D6ZA 3ZIYA 1S5LE 2M0BA 1KQSO 1VF5D 1F1CA 1K8AQ 2AEJA 3HTKB 451CA 3JBTB 3BRVB 5AW5B 1LTSC 1MFZA 3GLMA 5AW2B 3ZOXA 5KLIB 3SWYA 1QKSA 2WT7B 1M60A 3KXDA 2D2CD 4R4LA 4B86A 1CCRA 3WU2V 3N7NA 1DEBA 1NMIA 3IN6A 3FWLA 2P67A 3H6PA 1SQPJ 4EIDA 1W2LA 4OH8B 1YEAA 1MKMA 2FKWB 3AEBC 4ZMDA 2QJPC 2L91A 4JYCA 5C9MA 3NBSA 3OAKA 1IK7A 3O6QA 2WZ7A 1M8OB 2JO1A 4WWIA 1KILB 1L4AB 1NTMD 3H32A 1S5LV 2Q6QA 3D70A 4O1WA 4H0LB 5AVQB 1PIXA 4RESB 1BE3E 2BCCE 2BEZF 2P1JA 3CX5E 1LNQA 1JY2O 1GD2E 5TISE 1OMIA 2ZOOA 2Q7CA 3H1IG 1NAFA 1LT1A 1FDOA 3TGUG 1K3GA 2XZRA 3H1JE 5AW3B 3EFFK 1AKKA 1QVFO 3C1LA 4DJGA 1OIPA 3BVHA 2YCCA 1HH7A 3DR0A 1FAVA 3IR9A 1ZR4A 3CCLP 1C2RA 3N4XA 1VQ7P 1HJ5A 3HUSA 2N1TD 1NTZE 1ZRTE 1QX8A 3HD7D 1I6DA 1KYOE 2FYUK 1JM0A 1E79H 1E8EA 2G8YA 1BE3D 1SQQD 2BCCD 3CX5D 1H31A 1I8PA 2PP6A 1ZN5A 2WSCJ 2XKMA 3VYMA 3AECC 3I5CA 5EFWB 1N73B 3ZDMA 3WC8A 3H1JD 5TISV 3NMDA 4GT1A 1BSHA 2B4ZA 1T3JA 3FXDA 2D0SA 4IL6X 2HG5D 2QSIA 1DW3A 1RE3A 3PJSK 2K88A 4BXLA 2OARA 1HGVA 3OCDB 1T6AA 4L1QA 2JP3A 1NTZD 5H2FE 1ZRTD 2FBWC 1KYOD 4L73A 3I56P 2BH4X 1N90A 2XTSB 2LKMA 3H1IJ 2Y9YA 3TGUJ 1MZ9A 1KYOW 3T97B 2CXBA 4D6TJ 3D0WA 1CRYA 1XTGB 1M1JB 4ZKUA 3HQ6A 3AE8C 1YFCA 4H44D 1YJ9P 1PV3A 2Z5HA 4ZKPA 1KILC 1X9VA 4N78E 2V08A 3H1KG 2B10B 2C9LY 1YIQA 5H2FH 5EXQA 5CIEB 4L3GA 2FFDB 1CSXA 5H2FV 1JY3O 2ZYAA 1RHZB 4UB6H 2OTJP 2XU6A 4RKUJ 3SWKA 3VMZA 1FI3A 3LW5J 3HE5A 2HPCB 1M6ZA 4EOTA 3EQ2A 1H32B 1CSVA 1KQGB 2K9JA 1L0LE 4N78D 4FB1A 3S9OA 3ZOWA 3CCJP 5DFSA 2YO2A 1CHJA 3H1LE 1DT1A 3PH0A 3OW2O 1IO4A 1QL3A 4GODA 3L73E 1RQUA 3CC2P 4CPGA 1L0ND 1SQBK 2Y0EA 4C7NB 4FA9A 1SQVK 1JY3N 3KHUA 1DW2A 3Q5SA 1LJ2A 2AXTE 1L0LD 2C0XA 3CD6P 1LTJA 4I6MC 2WSEH 2H7HA 3H1KJ 3TNUA 4EIJA 3CCQP 1IK9A 5CJ0A 1UIXA 1CZQA 1EZVI 3G6EP 1N7SD 3L73D 1HF9A 3WFDC 2YMYA 1M1JC 2E76B 1OZHA 1RF1A 1IFJA 2W90A 1T3UA 3MUDA 2E43A 1SP4A 4MU8A 2N1TC 4WQAA 2KXPB 2WMMA 3V5BA 4MN4C 2OYIC 1M90Q 3FX0A 3Q3DA 3H25A 3H1HG 2AXTH 2AEFA 3PXWA 1NYHA 2FFDC 2VRSA 4YXDC 1RF0C 3GW6A 1ZR2A 4K3IA 3RMZA 1S5LX 3HE4A 4AQRD 3M06A 1YTCA 2A06E 1PGPA 5BVZA 1NJIQ 1PP9G 4GOEA 1VQMP 1IJDB 1R5SA 1URQA 1CTZA 2QEXP 1S72P 5CIFB 4AAMA 2HFED 1ZP0C 1J1EB 4XXLA 1EDKA 1KX2A 2BPBB 2ZFCA 2QJKB 3O6QB 2JQRA 1NTKE 3KZIE 3H32B 2ZVOB 3CCRP 1SQXG 3U59A 3KQGA 3PXTA 3M0AA 4AUWA 3VOPA 2A06D 2GUSA 2YKPA 3VTPC 4PWAA 3A0BE 1RE4C 3CXHD 2NRGA 4H44C 3CXHH 1QLED 1C2NA 1IZL0 3A3YB 2QM7A 3HUSB 3L75J 3CXHW 3H1HJ 2JEEA 5AVYB 1FOSF 1NTKD 2AIUA 1RH5B 1LWUB 1IZNB 2YIUB 5APVA 2KB7P 1S9KE 2C9XB 1USEA 3IF4A 1IRVA 1KD1Q 1QVGO 1EXJA 1H31B 1PP9J 3KZIV 2FYUE 1ZLLA 4HB1A 5TJHA 3CWBE 2V7QH 2ZT9D 4H0KA 3SSUA 2E74B 3L74E 2KS1A 2OGUA 1HTLC 1W2BO 1X8YA 1H33A 4GIFA 4A7PA 3A0BH 1B7VA 3VRDA 3HQ8A 4JYBA 2NPSA 3AE7C 1W5CE 1XTCC 2M8RA 5B6QA 1CCHA 2Y9ZA 4PJ0E 1CHIA 3W68A 2N3BA 3BRTB 1S9KD 4JBZA 4L74A 3D71A 4IL6H 5AVSB 4GDOA 1P84I 2FYUD 2N18B 1K3HA 1NTMG 3CWBD 2QJYB 4IOIH 3L74D 3O0RC 1OX3A 4EIFA 1YTZI 1MFTA 1SQBJ 1J1EC 2IZ0A 3K5BA 3L37A 2QJKC 4YE1A 5AW9B 4EYYQ 1DX7A 4WQ7A 3JC22 2R5BA 1J3SA 3L70E 1CC5A 4IFFA 2GC7D 1EB7A 2KLUA 5KJ7A 1IFDA 1QYZA 2CPBA 4PJ0H 1N7SC 2KUBA 3HRNA 1G1JA 2A45I 4IFMA 3II6A 3CC4P 2K1AA 1H9XA 3S1KA 2MHMA 3S4RA 3TSIA 3CCMP 2OZ1A 5CYTR 1CI6A 1SQQG 1NAYA 3HE5B 1HUCA 3HUSC 1W5CT 1LT9A 1GKSA 2K9JB 2ZAEB 3L70D 1LWUC 3KPEA 2YIUC 2B9BA 5APYA 3B8EB 1PPJG 3MTUE 2WVRA 1NTMJ 2N9IA 1EDLA 1NTZG 3E7KA 5KLVK 2D0WA 4WQCA 1EXIA 3R4YA 1RAQA 2YK3A 4LLHA 5AVWB 2KSEA 1GK6A 1L4AD 1LTJB 1H0TA 3TNUB 3WU2E 4H0LD 3AE6C 4YTPC 1P84E 1NU1D 3JCUE 1YQ3C 2AEMA 1VDFA 2O01H 2E5TA 2KZJA 2ZXEB 1SQQJ 1HZUA 1HGZA 3U1CA 2QA4P 3CYTI 1RF1B 1SVFA 1AYGA 3RK2B 1IFPA 1I55A 1YYCA 2YO3A 1FZBA 4N3YB 1LC1A 3WUVA 2N3YA 3AE2C 1P84D 1IRWA 3WU2H 1U57A 2JWDA 1P84H 3HQ9A 2ZT9C 3HE4B 3RL0D 4JCGA 2FXOA 1NTZJ 1VQPP 3QWOC 3HQ7A 3MHVA 3L72E 1J1DB 2V07A 1TU3F 2LR2A 5DJTB 5CCGA 3AE4C 2M5AA 4JF7A 4TT3H 3WFEC 4FA4A 2JWAA 1AVYA 3VN0A 2PGDA 2AI5A 1MZ4A 2AXCA 1S5LH 1JMBA 2NPSD 2CPSA 2MKVA 4BRYB 1VQ4P 1IFIA 1YQ4C 1ETPA 1GU5A 1KFMA 1L0NG 3BCCG 2R3SA 4EDFA 1SFCA 1CYIA 4W7ZA 1Y9BA 1NIRA 3RK3E 1L0LG 1OW7A 3USSA 1CORA 3L72D 4AAOA 2OYHA 1PGJA 1OXZA 2C8SA 4GKGA 2P10A 3CPWO 2IBZG 5APWA 5KLVG 2J5UA 1JTHA 3Q5PA 2FXMA 3L73G 4WY4D 1OCDA 1ZV8A 4OWFA 1LTJC 1CRGA 1IFNA 4O1QA 2P58A 4NFGB 3CCEP 1JUNA 4EI2A 1A8CA 2H43A 5KKZB 5KJ7D 1LTTC 2ZJSE 3CX5H 3RL0B 5KTBA 3RK3D 1CSBA 5TISH 5CHXA 3O5CA 2FRCA 3AEAC 4LC1A 4DZOA 4QAOA 3CX5W 1JNMA 1RF1C 2KS1B 1JY2N 5CMZA 2W6AA 1C6OA 2FWLA 3AE9C 1H33B 1LS9A 1RY3A 1SQPE 4KHXA 1DH3A 3MUDC 2IFMA 1LFMA 4N0KA 2B89A 3RN1A 2NPSB 4WVZA 1C52A 5KLIC 1PFIA 1L0NJ 3BCCJ 2BCNB 2B88A 2ZXYA 1KV9A 5AVUB 1CSUA 1KYOH 1JY2P 2WSEJ 2GIWA 5AW8B 1L0LJ 3SFEC 3AEFC 1VQ5P 1HBWA 3L36A 5BU8B 1MG3D 1J1DC 3TF5A 1Q86Q 1JDLA 3SFDC 4PD4I 3GHGA 4AALA 5KLVJ 1FZFA 3AE1C 1CSWA 5AW4B 1SQPD 1NVOA 2A06G 4JQ0D 3V6IA 1H1OA 4WY4B 3OJAB 2QE7H 1L4AC 1C6RA 5KAFE 4H0LC 4H0JA 1QL4A 1Q90D 3PP5A 1GL2A 3DP5A 3GG2A 1BCCE 2ZONG 2JKVA 2K37A 3RK3B 1NTKG 2E76D 2OZ1B 1GJQA 3PLNA 1VPCA 1GQ1A 2QRXA 1BL9A 2HV4A 2YXQB 4C46A 3A0HE 1S3JA 1LT9B 1SQXK 2RH0A 5C39A 1GK4A 2HODA 1CIHA 1W2EA 3VMXA 5KKZC 2I1KA 3RBXA 1VQ9P 1AQ5A 3RL0C 5KAFV 1N73C 1BCCD 1G1IA 1T8ZA 5E79E 1AVOA 4OVNF 5DJUB 3L71E 5AVTB 1K05A 1U74B 3H1IE 3TGUE 2W8ZA 4D6TE 3TYYA 3WUIA 3AE3C 1M56D 2NPSC 1U7MA 5CICB 3OA7A 2KIKA 3QH9A 2CA3B 5B66V 2DW3A 2C2CA 1BDCA 1FZGA 2LITA 2R5DA 2WITA 2POHA 1H0TB 1VL2A 3CMAP 2E75B 3A0HV 3EFGA 3V2NA 3CCUP 3B4SA 3H1LD 1M57D 4DY9A 1T2KD 3F89A 1VQNP 2HYNA 1JO5A 3L71D 1JY3P 1SFCD 1LTGC 4PD4E 3H1ID 4UB8E 2BLFB 5IY51 3TGUD 2BH5X 4I7ZB 1GZLA 5E79V 4D6TD 1A02J 1JMMA 1OVVA 1CTYA 3G4SP 4PW9B 4R4MA 4WY4C 1RZ6A 5DJQB 1KC8Q 4H13D 2KLVA 1G2CA 1I5TA 3SVWA 1BGYE 5KJ7C
chains in the Genus database with same CATH topology
1CNOA 2FYNB 3L74D 451CA 3JBTB 3O0RC 1GDVA 4EIFA 1NMLA 3ZOXA 5KLIB 1QKSA 4PD4D 3CP5A 1M60A 4YE1A 4WQ7A 1J3SA 1AOQA 3RN0A 1FI7A 1CC5A 1CCRA 4UB8V 3WU2V 4RJTA 4KMGA 2ZZS1 1YEBA 1NMIA 2GC7D 2PACA 2B12B 1EB7A 3FWLA 1QYZA 4EIDA 1W2LA 3CWBD 1YEAA 1CRIA 1CIGA 2L91A 3OA8B 5C9MA 3NBSA 1FI9A 1BGYD 1H9XA 2MHMA 2OZ1A 5CYTR 1NTMD 2Y0DA 1S5LV 5AURA 4O1WA 2C1DA 5GTHV 4UB6V 3ZBMA 1W5CT 2ZOOA 1GKSA 2EXVA 2K9JB 3SJLA 3L70D 1K3GA 3PTZA 1CRHA 1AKKA 2YCCA 1HH7A 3DR0A 5CIBB 1C2RA 2GC4D 2Y0CA 4RSZA 2N9IA 3SLEA 1HJ5A 1C6SA 4P4QB 3H1KD 3L4MA 1WVEC 4AANA 2DGEA 2D0WA 4WQCA 2B11B 1DIQC 1I6DA 3M97X 1E8EA 1M70A 1RAQA 1BE3D 1SQQD 2BCCD 2YK3A 4EICA 3C2CA 3CX5D 1H31A 1I8PA 3BCCD 4FA5A 3VYMA 3CU4A 3WC8A 1DW0A 3WFBC 3H1JD 5DJQC 5TISV 1NU1D 1DVHA 2B4ZA 2D0SA 1RAPA 1DW3A 1N50A 1MG2D 2IBZD 1F1FA 5KLVD 1EZVD 1HZUA 3OCDB 3L4OA 4L1QA 1H9YA 3CYTI 1NTZD 1ZRTD 1L9BC 1QN2A 1KYOD 1AYGA 4FAVA 5GTIV 1I55A 2DVHA 3RLMA 2BH4X 1N90A 2XTSB 1FJ0A 3VNWA 1LMSA 1NNOA 1FHBA 1KYOW 2VHDA 3DMIA 1LC1A 2CXBA 2N3YA 2GB8B 1S6VB 5DF5A 3TDKA 1CRYA 1I54A 1P84D 2ORLA 1IRWA 2L4DA 2Q3EA 4FA1A 3HQ6A 3HQ9A 2MTAC 5CIGB 1GU2A 1U75B 1YFCA 2AXTV 4JCGA 3HQ7A 2V07A 1KB9D 2V08A 3MK7B 2B10B 3WFEC 1I8OA 4FA4A 2JWAA 2O3JA 1YIQA 2AI5A 1MZ4A 2PCBB 4L3GA 5CIEB 5EXQA 1CSXA 2RMZA 5H2FV 2QG4A 3OA8A 3ZOOA 155CA 1RZ5A 1ETPA 4AX3A 4EDFA 1FI3A 1CYIA 2N9YB 1NIRA 1M6ZA 5KAIV 1H32B 3L75D 1CSVA 3SWSA 4WQEA 3ZCFA 1CORA 4WQ9A 3PH2B 5CIHB 3L72D 1CEDA 4AAOA 2C8SA 4FB1A 1CTJA 4Y5RA 3ZOWA 2CE1A 5DFSA 5B5EV 2QJPB 1CHJA 3WFCC 1PP9D 4GEDB 1IQCA 1E29A 1DT1A 1OCDA 4WQDA 1QL3A 2C1VA 2N9JA 1CRGA 4O1QA 2RN0A 4NFGB 3O1YA 1CRJA 1R0QA 1A8CA 1L0ND 5KKZB 2KNCB 2Y0EA 1DIIC 4FA9A 3KHUA 3O5CA 2FRCA 1DW2A 4QAOA 3CX5W 1L0LD 1N15A 2BGVX 1KB0A 2LIRA 1FCDC 1A56A 1C6OA 1GIWA 2FWLA 2ZBOA 1H33B 1LS9A 2N18C 1LFMA 4N0KA 3A9FA 3RN1A 1C52A 1LC2A 2C1UA 3PHLA 1IO3A 4WQ8A 3A0BV 1CXAA 3L73D 2BCNB 2ZXYA 1KV9A 3OCDA 1CSUA 3WFDC 1SQBD 1CXCA 1HROA 2GIWA 1AOFA 1WEJF 1SQVD 1MG3D 4MU8A 3TF5A 4WQAA 1JDLA 1HZVA 1YNRA 3MK7C 4XYDB 4AALA 1CO6A 4IL6V 1C7MA 3PXWA 1CSWA 1HJ4A 3ITKA 1SQPD 2CA4B 3ZOYA 1CIEA 1E2RA 1CYJA 1CRCA 1H1OA 4L3HA 3GW6A 4K3IA 3RMZA 1C6RA 1YTCA 2YQBA 1YCCA 1KX7A 4H0JA 1QL4A 3TYIA 3DP5A 3GG2A 1I6EA 1HRCA 1CTZA 1N9CA 2ZONG 4V2KA 5CIFB 5CIDB 4AAMA 3VMAA 1OAEA 4EIEA 3NWVA 4LJIA 4XXLA 1KX2A 4FANA 2BPBB 2QJKB 2B0ZB 2JQRA 4PJ0V 2OZ1B 1GJQA 3PLNA 2PCCB 1GQ1A 1A2SA 1BL9A 1HCMA 3PXSA 3H1HD 3PXTA 2HV4A 1FOCA 2C1DB 1DW1A 1H32A 2A06D 1DVVA 4U3FD 1CIHA 1CHHA 4WQBA 4PWAA 1COTA 5KAFV 3CXHD 3X39A 1BCCD 3PRJA 1U74B 351CA 1C2NA 1IZL0 3CXHW 4GYDA 2JTIB 1NTKD 3WUIA 2AIUA 3O20A 2YIUB 2C9XB 5CICB 1IRVA 4Q5PA 1H31B 1SQXD 3KZIV 2CA3B 1CYCA 5B66V 2C2CA 5C0ZA 5TJHA 2LITA 4H0KA 2I8FA 2KS1A 3A0HV 3SXTA 3H1LD 1YICA 4A7PA 1H33A 4DY9A 1B7VA 1L9JC 3VRDA 3L71D 3HQ8A 1ZZHA 3H1ID 2BLFB 5IY51 1HJ3A 3TGUD 2BH5X 5E79V 4D6TD 1C75A 4J20A 5B6QA 1CTYA 1VYDA 1CCHA 3NBTA 4PW9B 2CE0A 1CHIA 1PPJD 2N3BA 1CIFA 1RZ6A 1KIBA 5DJQB 3ORVA 2FYUD 3ZIYA 1I5TA 2N18B 3SVWA 1K3HA 2QJYB 1F1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CNO A;  2FYN B;  3L74 D;  451C A;  3JBT B;  3O0R C;  1GDV A;  4EIF A;  1NML A;  3ZOX A;  5KLI B;  1QKS A;  4PD4 D;  3CP5 A;  1M60 A;  4YE1 A;  4WQ7 A;  1J3S A;  1AOQ A;  3RN0 A;  1FI7 A;  1CC5 A;  1CCR A;  4UB8 V;  3WU2 V;  4RJT A;  4KMG A;  2ZZS 1;  1YEB A;  1NMI A;  2GC7 D;  2PAC A;  2B12 B;  1EB7 A;  3FWL A;  1QYZ A;  4EID A;  1W2L A;  3CWB D;  1YEA A;  1CRI A;  1CIG A;  2L91 A;  3OA8 B;  5C9M A;  3NBS A;  1FI9 A;  1BGY D;  1H9X A;  2MHM A;  2OZ1 A;  5CYT R;  1NTM D;  2Y0D A;  1S5L V;  5AUR A;  4O1W A;  2C1D A;  5GTH V;  4UB6 V;  3ZBM A;  1W5C T;  2ZOO A;  1GKS A;  2EXV A;  2K9J B;  3SJL A;  3L70 D;  1K3G A;  3PTZ A;  1CRH A;  1AKK A;  2YCC A;  1HH7 A;  3DR0 A;  5CIB B;  1C2R A;  2GC4 D;  2Y0C A;  4RSZ A;  2N9I A;  3SLE A;  1HJ5 A;  1C6S A;  4P4Q B;  3H1K D;  3L4M A;  1WVE C;  4AAN A;  2DGE A;  2D0W A;  4WQC A;  2B11 B;  1DIQ C;  1I6D A;  3M97 X;  1E8E A;  1M70 A;  1RAQ A;  1BE3 D;  1SQQ D;  2BCC D;  2YK3 A;  4EIC A;  3C2C A;  3CX5 D;  1H31 A;  1I8P A;  3BCC D;  4FA5 A;  3VYM A;  3CU4 A;  3WC8 A;  1DW0 A;  3WFB C;  3H1J D;  5DJQ C;  5TIS V;  1NU1 D;  1DVH A;  2B4Z A;  2D0S A;  1RAP A;  1DW3 A;  1N50 A;  1MG2 D;  2IBZ D;  1F1F A;  5KLV D;  1EZV D;  1HZU A;  3OCD B;  3L4O A;  4L1Q A;  1H9Y A;  3CYT I;  1NTZ D;  1ZRT D;  1L9B C;  1QN2 A;  1KYO D;  1AYG A;  4FAV A;  5GTI V;  1I55 A;  2DVH A;  3RLM A;  2BH4 X;  1N90 A;  2XTS B;  1FJ0 A;  3VNW A;  1LMS A;  1NNO A;  1FHB A;  1KYO W;  2VHD A;  3DMI A;  1LC1 A;  2CXB A;  2N3Y A;  2GB8 B;  1S6V B;  5DF5 A;  3TDK A;  1CRY A;  1I54 A;  1P84 D;  2ORL A;  1IRW A;  2L4D A;  2Q3E A;  4FA1 A;  3HQ6 A;  3HQ9 A;  2MTA C;  5CIG B;  1GU2 A;  1U75 B;  1YFC A;  2AXT V;  4JCG A;  3HQ7 A;  2V07 A;  1KB9 D;  2V08 A;  3MK7 B;  2B10 B;  3WFE C;  1I8O A;  4FA4 A;  2JWA A;  2O3J A;  1YIQ A;  2AI5 A;  1MZ4 A;  2PCB B;  4L3G A;  5CIE B;  5EXQ A;  1CSX A;  2RMZ A;  5H2F V;  2QG4 A;  3OA8 A;  3ZOO A;  155C A;  1RZ5 A;  1ETP A;  4AX3 A;  4EDF A;  1FI3 A;  1CYI A;  2N9Y B;  1NIR A;  1M6Z A;  5KAI V;  1H32 B;  3L75 D;  1CSV A;  3SWS A;  4WQE A;  3ZCF A;  1COR A;  4WQ9 A;  3PH2 B;  5CIH B;  3L72 D;  1CED A;  4AAO A;  2C8S A;  4FB1 A;  1CTJ A;  4Y5R A;  3ZOW A;  2CE1 A;  5DFS A;  5B5E V;  2QJP B;  1CHJ A;  3WFC C;  1PP9 D;  4GED B;  1IQC A;  1E29 A;  1DT1 A;  1OCD A;  4WQD A;  1QL3 A;  2C1V A;  2N9J A;  1CRG A;  4O1Q A;  2RN0 A;  4NFG B;  3O1Y A;  1CRJ A;  1R0Q A;  1A8C A;  1L0N D;  5KKZ B;  2KNC B;  2Y0E A;  1DII C;  4FA9 A;  3KHU A;  3O5C A;  2FRC A;  1DW2 A;  4QAO A;  3CX5 W;  1L0L D;  1N15 A;  2BGV X;  1KB0 A;  2LIR A;  1FCD C;  1A56 A;  1C6O A;  1GIW A;  2FWL A;  2ZBO A;  1H33 B;  1LS9 A;  2N18 C;  1LFM A;  4N0K A;  3A9F A;  3RN1 A;  1C52 A;  1LC2 A;  2C1U A;  3PHL A;  1IO3 A;  4WQ8 A;  3A0B V;  1CXA A;  3L73 D;  2BCN B;  2ZXY A;  1KV9 A;  3OCD A;  1CSU A;  3WFD C;  1SQB D;  1CXC A;  1HRO A;  2GIW A;  1AOF A;  1WEJ F;  1SQV D;  1MG3 D;  4MU8 A;  3TF5 A;  4WQA A;  1JDL A;  1HZV A;  1YNR A;  3MK7 C;  4XYD B;  4AAL A;  1CO6 A;  4IL6 V;  1C7M A;  3PXW A;  1CSW A;  1HJ4 A;  3ITK A;  1SQP D;  2CA4 B;  3ZOY A;  1CIE A;  1E2R A;  1CYJ A;  1CRC A;  1H1O A;  4L3H A;  3GW6 A;  4K3I A;  3RMZ A;  1C6R A;  1YTC A;  2YQB A;  1YCC A;  1KX7 A;  4H0J A;  1QL4 A;  3TYI A;  3DP5 A;  3GG2 A;  1I6E A;  1HRC A;  1CTZ A;  1N9C A;  2ZON G;  4V2K A;  5CIF B;  5CID B;  4AAM A;  3VMA A;  1OAE A;  4EIE A;  3NWV A;  4LJI A;  4XXL A;  1KX2 A;  4FAN A;  2BPB B;  2QJK B;  2B0Z B;  2JQR A;  4PJ0 V;  2OZ1 B;  1GJQ A;  3PLN A;  2PCC B;  1GQ1 A;  1A2S A;  1BL9 A;  1HCM A;  3PXS A;  3H1H D;  3PXT A;  2HV4 A;  1FOC A;  2C1D B;  1DW1 A;  1H32 A;  2A06 D;  1DVV A;  4U3F D;  1CIH A;  1CHH A;  4WQB A;  4PWA A;  1COT A;  5KAF V;  3CXH D;  3X39 A;  1BCC D;  3PRJ A;  1U74 B;  351C A;  1C2N A;  1IZL 0;  3CXH W;  4GYD A;  2JTI B;  1NTK D;  3WUI A;  2AIU A;  3O20 A;  2YIU B;  2C9X B;  5CIC B;  1IRV A;  4Q5P A;  1H31 B;  1SQX D;  3KZI V;  2CA3 B;  1CYC A;  5B66 V;  2C2C A;  5C0Z A;  5TJH A;  2LIT A;  4H0K A;  2I8F A;  2KS1 A;  3A0H V;  3SXT A;  3H1L D;  1YIC A;  4A7P A;  1H33 A;  4DY9 A;  1B7V A;  1L9J C;  3VRD A;  3L71 D;  3HQ8 A;  1ZZH A;  3H1I D;  2BLF B;  5IY5 1;  1HJ3 A;  3TGU D;  2BH5 X;  5E79 V;  4D6T D;  1C75 A;  4J20 A;  5B6Q A;  1CTY A;  1VYD A;  1CCH A;  3NBT A;  4PW9 B;  2CE0 A;  1CHI A;  1PPJ D;  2N3B A;  1CIF A;  1RZ6 A;  1KIB A;  5DJQ B;  3ORV A;  2FYU D;  3ZIY A;  1I5T A;  2N18 B;  3SVW A;  1K3H A;  2QJY B;  1F1C A; 
#chains in the Genus database with same CATH topology
 1CNO A;  2FYN B;  3LIE A;  3RK3 C;  2B87 A;  5APS A;  1NTM K;  5APQ A;  1NML A;  1JEK A;  3GF3 A;  1YIT P;  4PD4 D;  2Q1K A;  3CP5 A;  1R5L A;  2E74 D;  1OVR A;  3AE5 C;  3RN0 A;  4L76 A;  4UB8 V;  4KMG A;  5AW1 B;  1OFC X;  2P7J A;  1YEB A;  2PFX A;  2PAC A;  2M5A B;  1MUU A;  2ZVN B;  1PGO A;  1FOS E;  2FXP A;  1LT9 C;  1E5W A;  3MIW A;  1CIG A;  1NKZ B;  3H1K E;  1BGY D;  2BEQ D;  1SFC B;  1VQK P;  3FXE A;  5AUR A;  2C1D A;  3M9H A;  5GTH V;  1SQQ K;  1HWT C;  2O1J A;  2J59 M;  2E5Y A;  3M9B A;  3CC7 P;  1FJK A;  1NU1 G;  3VYI A;  2OTL P;  3PTZ A;  1CRH A;  1ZME C;  2I8D A;  5K5G B;  4H13 B;  1JTH B;  5CIB B;  4PV1 B;  4GOF A;  3B5N A;  2GC4 D;  2Y0C A;  4RSZ A;  3KYQ A;  2E75 C;  3H1K D;  3CI9 A;  3KZI H;  1EZV E;  1WVE C;  1Q2N A;  2DGE A;  1OVU A;  2B11 B;  1DIQ C;  1NTZ K;  3M97 X;  1DIP A;  1IFM A;  1X22 A;  3C2C A;  4FA5 A;  2E76 C;  1GTW A;  1L2P A;  1NKN A;  3CU4 A;  1LTI C;  1DEE G;  2UWJ E;  1DW0 A;  4ASV A;  5DJQ C;  1EDJ A;  5AW7 B;  1ZOY C;  4HH2 A;  3P8C E;  4M3L A;  4KJM A;  1FZC A;  1SQX J;  1MG2 D;  1EZV D;  1UII A;  2QVA A;  3L4O A;  4LGD E;  2YMK A;  2XV5 A;  1L9B C;  1NO4 A;  5GTI V;  3CL3 D;  1NGM B;  1GDT A;  2W83 C;  3A5T A;  1NU1 J;  1LMS A;  3AEG C;  1FHB A;  3GHG B;  2VHD A;  1BDD A;  2YNY A;  1I54 A;  2ORL A;  1ZXG A;  2L4D A;  2Q3E A;  3T97 A;  2LXC B;  5CJ4 A;  2MTA C;  3P32 A;  3P8C D;  5CIG B;  2FYZ A;  1GU2 A;  1KFN A;  3L75 E;  1U75 B;  2IYP A;  4I1L A;  3CME P;  3VMY A;  4RO0 A;  1T2K C;  4U7J A;  1GL2 B;  1SFC C;  4NPF X;  3MK7 B;  1FDM A;  1LTB C;  2N1T A;  1PP9 E;  3HD7 A;  3C8V A;  2Z4E A;  3L35 A;  2OYI A;  2RMZ A;  1LP1 A;  1BE3 G;  2BCC G;  3OA8 A;  155C A;  3A7O A;  2FY8 A;  4AX3 A;  4H13 C;  3RK2 D;  4DT0 A;  1L0N K;  3VP9 A;  3H1J G;  5KAI V;  3L75 D;  3SWS A;  2HOD B;  5CBO A;  3A2A A;  2GM4 A;  1WRG A;  5CIH B;  1VQO P;  1LGH B;  1L0L K;  2ZYD A;  3TK1 A;  1CTJ A;  2CE1 A;  5B5E V;  2QJP B;  2E74 C;  1PP9 D;  4GED B;  2WPR A;  1CW5 A;  1IQC A;  3MD0 A;  3W67 A;  4I2L C;  4AYC A;  1URQ D;  1RE3 C;  2SPZ A;  2XND H;  2RN0 A;  4QMA A;  1R0Q A;  1SQB E;  2M3B A;  1DII C;  4XFJ A;  1SQV E;  1FE6 A;  3Q5R A;  2O01 N;  1R8E A;  1EDI A;  1SQP G;  2BGV X;  3BAS A;  1KB0 A;  1HJ0 A;  2LIR A;  1A56 A;  1GIW A;  1QGK B;  1HH0 A;  2ZBO A;  2JDI H;  2N18 C;  2QJY C;  3M91 A;  3U1A A;  1AQT A;  1IC2 A;  1AA0 A;  1LC2 A;  1BE3 J;  2BCC J;  2C1U A;  3GHG C;  3PHL A;  1IO3 A;  4WQ8 A;  3GMA A;  2N9B A;  3M0D A;  1YJW P;  1SQB D;  2W6B A;  1CXC A;  3H1J J;  1HRO A;  1FZA A;  1WEJ F;  3AED C;  2IFN A;  1N86 A;  1SQV D;  1RQV A;  3LID A;  1JOC A;  3L4F A;  3B5N D;  1HZV A;  1YNR A;  1G2C B;  3MK7 C;  4XYD B;  2H88 C;  3JCU H;  1KMI Z;  2B87 B;  4OGQ D;  3ITK A;  1CRC A;  2OQQ A;  4L3H A;  1WMK A;  1NTM E;  2M3E A;  1URQ B;  4U3F E;  1KX7 A;  3TYI A;  1BCC G;  3KDP B;  1N9C A;  1FJP A;  1QL2 A;  4YPC A;  1AFO A;  4EIE A;  1QEX A;  2WSF H;  2QIW A;  1MV8 A;  5APT A;  4FAN A;  1NTK K;  1X0T A;  2A45 H;  2PCC B;  1A2S A;  2OTK E;  3PXS A;  2C1D B;  5AW6 B;  1DW1 A;  1FC2 C;  2PAJ A;  4C7R A;  1YTZ T;  1SS1 A;  4U3F D;  1SQQ E;  3H1L G;  2HLO A;  2IX7 C;  1N7S A;  1KV4 A;  3L71 G;  4JPZ B;  3WUU A;  3X39 A;  2WTY A;  4Y99 B;  4XE5 B;  4D6T G;  1K9M Q;  3B5N B;  351C A;  4GYD A;  2JTI B;  4HYT B;  4OGQ B;  5CBN A;  2WSS H;  1VF5 B;  1YI2 P;  3O20 A;  1YBK A;  1PPJ E;  4W7Y A;  2C9N Y;  3G9R A;  2KNC A;  5M1B A;  4Q5P A;  1LWU A;  3CCV P;  3RK2 C;  1BCC J;  5C0Z A;  3C9I A;  2NZ2 A;  2D2C B;  2I8F A;  2MJZ A;  2IBZ I;  4NPE A;  3ABV C;  1ZZH A;  1HJ3 A;  1FZC B;  1FS0 E;  4W80 A;  1JCD A;  1M7L A;  3FGA D;  3V4Q A;  3NBT A;  1PPJ D;  2W6J H;  1VQ6 P;  3ORV A;  1FU1 A;  1URQ C;  5CCH A;  2IDB A;  3IFM A;  1BGY G;  3H1L J;  3Q1M A;  3L71 J;  1GW3 A;  4UB6 E;  2RKL A;  3L73 J;  1PL5 A;  1GDV A;  1KB9 I;  2ITA A;  3RBZ A;  4Y28 J;  4TLF A;  3NTN A;  2JJL A;  2IYO A;  3IAO A;  1AOQ A;  2E75 D;  1FI7 A;  2W27 A;  4RJT A;  2ZZS 1;  2KOG A;  2B12 B;  1X79 B;  1SLQ A;  2C0W A;  2N1T B;  3HD7 B;  2HR3 A;  3GF7 A;  1CRI A;  2OYI B;  2K9Y A;  1LP1 B;  1CI6 B;  3OA8 B;  5B66 E;  1FI9 A;  3EWK A;  1N7L A;  4Y99 C;  3V2Q A;  2Y0D A;  2ZYG A;  3B5N C;  5APU A;  3NXS A;  4UB6 V;  5KAF H;  3ZBM A;  1L0N E;  3BCC E;  2EXV A;  5BU5 A;  4OGQ C;  1VF5 C;  3SJL A;  3CXH I;  1S4X A;  3UIA A;  1Y47 A;  3JSV C;  1EQ7 A;  1NU1 K;  2R44 A;  2BAS A;  2WPV B;  2WSC H;  1BGY J;  1NWQ A;  1EZV G;  2D2C C;  1KQL A;  3SLE A;  1C6S A;  2IBZ E;  4P4Q B;  3VP8 A;  2FYU G;  3L4M A;  5CCG D;  5KLV E;  4XA4 A;  4AAN A;  5B66 H;  3E1I A;  1USD A;  4K3A A;  3CWB G;  3L74 G;  2J58 A;  2KK7 A;  1FZC C;  1M70 A;  3Q2Y A;  4K35 A;  4EIC A;  3A0H H;  3BCC D;  3B71 A;  1FDI A;  4WBA A;  4H44 B;  3WFB C;  1K73 Q;  1NTK J;  5E79 H;  1N8R Q;  1DVH A;  1RAP A;  1FBM A;  2KYV A;  3FWN A;  1Q7Y Q;  2GUV A;  4KT0 J;  2O1K A;  1N50 A;  2V7Q J;  2IBZ D;  2PRR A;  1F1F A;  3WMM 0;  5KLV D;  1KB9 E;  1H9Y A;  1QN2 A;  4PV1 D;  4FAV A;  1JB0 J;  1BSN A;  1HJB A;  2DVH A;  5GTH E;  3RLM A;  1H8A A;  1H88 A;  1FJ0 A;  3VNW A;  1NNO A;  3DMI A;  2GB8 B;  3HTK A;  1S6V B;  5DF5 A;  3TDK A;  3HD7 C;  2YKQ A;  3E1R A;  3L70 G;  4IFD K;  2WQY C;  3L75 G;  4PD4 H;  4FA1 A;  4UB8 H;  2LXB A;  3CLQ A;  2QM8 A;  2WT7 A;  3M9Q A;  2KSJ A;  2AXT V;  4DCK A;  2I1J A;  2FYU J;  3CCS P;  1KB9 D;  3LW5 H;  3CWB J;  3MGN A;  3L74 J;  1KB9 H;  1I8O A;  2O3J A;  2PCB B;  3CXH E;  1U7J A;  2QG4 A;  5GTH H;  3ZOO A;  1KTM A;  1RZ5 A;  2IZ1 A;  2P2U A;  4BRY A;  1KIL A;  1L4A A;  2H89 C;  3V4W A;  1S1C X;  2N9Y B;  4O9B A;  1WT6 A;  2OYH B;  5CCH D;  4WQE A;  3ZCF A;  4WQ9 A;  1YJN P;  3PH2 B;  1CED A;  1N7S B;  4Y5R A;  1KZU B;  3WFC C;  1E29 A;  1S2E A;  5GTI E;  1ZW0 A;  2H8P D;  4WQD A;  1GL2 D;  2C1V A;  1PGQ A;  1DD4 A;  4DOJ A;  5APX A;  2N9J A;  1SQB G;  3O1Y A;  3L70 J;  1CRJ A;  4I7Z C;  3O8Z A;  1SQV G;  2KNC B;  4ZNC A;  4IL6 E;  2KZI A;  4ASW A;  3M0D C;  2Q5U A;  1N73 A;  1A02 F;  1N15 A;  3P7K A;  1N2D C;  2YXR B;  1VQ8 P;  1FCD C;  1SQP K;  2FYN C;  3I55 P;  3A9F A;  1QL1 A;  3BAT A;  5AVX B;  3WUT A;  1GW4 A;  1JCC A;  5GTI H;  2KP8 A;  5AW0 B;  3A0B V;  4HJG H;  1CXA A;  2K3R A;  3OCD A;  1NH4 A;  4YXW H;  1AOF A;  4Z1M H;  2O01 J;  3R2P A;  5CCG C;  2A45 G;  3MZW B;  3V2P A;  5KAI E;  3SWF A;  2IPP A;  1CO6 A;  4IL6 V;  1C7M A;  1EC5 A;  4NPD A;  3L72 G;  5L8R J;  1HJ4 A;  5AVZ B;  1HVV A;  2CA4 B;  1OW8 A;  3ZOY A;  3RGU A;  1CIE A;  2KI7 B;  1E2R A;  3H1H E;  1CYJ A;  1VQL P;  1KN7 A;  4U3F G;  5B5E E;  3G71 P;  1M1J A;  1D7M A;  3AEE C;  2YQB A;  1YCC A;  2JR8 A;  4WY4 A;  2Q3I A;  2R3C A;  4WB4 A;  1SQV J;  2XNX A;  2OYO A;  1I6E A;  1HRC A;  1OWA A;  2OYH C;  4V2K A;  1J2J B;  5CID B;  2YKO A;  1KOR A;  3VMA A;  1Z56 A;  1YIJ P;  2FFD A;  1OAE A;  3NWV A;  4LJI A;  1RF0 A;  1OW6 A;  3P8M C;  3D6Y A;  5KAI H;  4PV1 C;  2B0Z B;  4PJ0 V;  2ZT9 B;  1GU4 A;  1NOH A;  1HCM A;  1Q81 Q;  5AVV B;  2WPS A;  3H1H D;  1FOC A;  1PZQ A;  2HPC A;  1SQX E;  1H32 A;  1K04 A;  5B5E H;  1DVV A;  3V2R A;  1Q82 Q;  3F5H A;  1CHH A;  4WQB A;  2WSF J;  2E42 A;  1COT A;  1Y8A A;  1KIL E;  4BWN A;  2ZXX A;  3PRJ A;  1FZE A;  2CK3 H;  1NU1 E;  4L75 A;  2Z5I A;  3MP7 B;  3CX5 I;  2WWW A;  2L5G B;  3L72 J;  1AV1 A;  4U3F J;  1RE4 A;  1AJY A;  4C7N A;  2V4H A;  1SQX D;  5AVR B;  3RL0 g;  1CYC A;  1DD3 A;  1GMJ A;  2G3A A;  4N6J A;  2WPQ A;  2GA1 A;  1H89 A;  3SXT A;  1YIC A;  5CCH C;  1KQF B;  1NHL A;  1KIL D;  1L9J C;  1YHQ P;  4HKZ H;  1KYO I;  2Q9I A;  1C75 A;  1M1K Q;  4J20 A;  1VYD A;  2CE0 A;  1CIF A;  1GL2 C;  1KIB A;  2R32 A;  2XDJ A;  3G3Z A;  1LTA C;  3NFQ A;  3D6Z A;  3ZIY A;  1S5L E;  2M0B A;  1KQS O;  1VF5 D;  1F1C A;  1K8A Q;  2AEJ A;  3HTK B;  451C A;  3JBT B;  3BRV B;  5AW5 B;  1LTS C;  1MFZ A;  3GLM A;  5AW2 B;  3ZOX A;  5KLI B;  3SWY A;  1QKS A;  2WT7 B;  1M60 A;  3KXD A;  2D2C D;  4R4L A;  4B86 A;  1CCR A;  3WU2 V;  3N7N A;  1DEB A;  1NMI A;  3IN6 A;  3FWL A;  2P67 A;  3H6P A;  1SQP J;  4EID A;  1W2L A;  4OH8 B;  1YEA A;  1MKM A;  2FKW B;  3AEB C;  4ZMD A;  2QJP C;  2L91 A;  4JYC A;  5C9M A;  3NBS A;  3OAK A;  1IK7 A;  3O6Q A;  2WZ7 A;  1M8O B;  2JO1 A;  4WWI A;  1KIL B;  1L4A B;  1NTM D;  3H32 A;  1S5L V;  2Q6Q A;  3D70 A;  4O1W A;  4H0L B;  5AVQ B;  1PIX A;  4RES B;  1BE3 E;  2BCC E;  2BEZ F;  2P1J A;  3CX5 E;  1LNQ A;  1JY2 O;  1GD2 E;  5TIS E;  1OMI A;  2ZOO A;  2Q7C A;  3H1I G;  1NAF A;  1LT1 A;  1FDO A;  3TGU G;  1K3G A;  2XZR A;  3H1J E;  5AW3 B;  3EFF K;  1AKK A;  1QVF O;  3C1L A;  4DJG A;  1OIP A;  3BVH A;  2YCC A;  1HH7 A;  3DR0 A;  1FAV A;  3IR9 A;  1ZR4 A;  3CCL P;  1C2R A;  3N4X A;  1VQ7 P;  1HJ5 A;  3HUS A;  2N1T D;  1NTZ E;  1ZRT E;  1QX8 A;  3HD7 D;  1I6D A;  1KYO E;  2FYU K;  1JM0 A;  1E79 H;  1E8E A;  2G8Y A;  1BE3 D;  1SQQ D;  2BCC D;  3CX5 D;  1H31 A;  1I8P A;  2PP6 A;  1ZN5 A;  2WSC J;  2XKM A;  3VYM A;  3AEC C;  3I5C A;  5EFW B;  1N73 B;  3ZDM A;  3WC8 A;  3H1J D;  5TIS V;  3NMD A;  4GT1 A;  1BSH A;  2B4Z A;  1T3J A;  3FXD A;  2D0S A;  4IL6 X;  2HG5 D;  2QSI A;  1DW3 A;  1RE3 A;  3PJS K;  2K88 A;  4BXL A;  2OAR A;  1HGV A;  3OCD B;  1T6A A;  4L1Q A;  2JP3 A;  1NTZ D;  5H2F E;  1ZRT D;  2FBW C;  1KYO D;  4L73 A;  3I56 P;  2BH4 X;  1N90 A;  2XTS B;  2LKM A;  3H1I J;  2Y9Y A;  3TGU J;  1MZ9 A;  1KYO W;  3T97 B;  2CXB A;  4D6T J;  3D0W A;  1CRY A;  1XTG B;  1M1J B;  4ZKU A;  3HQ6 A;  3AE8 C;  1YFC A;  4H44 D;  1YJ9 P;  1PV3 A;  2Z5H A;  4ZKP A;  1KIL C;  1X9V A;  4N78 E;  2V08 A;  3H1K G;  2B10 B;  2C9L Y;  1YIQ A;  5H2F H;  5EXQ A;  5CIE B;  4L3G A;  2FFD B;  1CSX A;  5H2F V;  1JY3 O;  2ZYA A;  1RHZ B;  4UB6 H;  2OTJ P;  2XU6 A;  4RKU J;  3SWK A;  3VMZ A;  1FI3 A;  3LW5 J;  3HE5 A;  2HPC B;  1M6Z A;  4EOT A;  3EQ2 A;  1H32 B;  1CSV A;  1KQG B;  2K9J A;  1L0L E;  4N78 D;  4FB1 A;  3S9O A;  3ZOW A;  3CCJ P;  5DFS A;  2YO2 A;  1CHJ A;  3H1L E;  1DT1 A;  3PH0 A;  3OW2 O;  1IO4 A;  1QL3 A;  4GOD A;  3L73 E;  1RQU A;  3CC2 P;  4CPG A;  1L0N D;  1SQB K;  2Y0E A;  4C7N B;  4FA9 A;  1SQV K;  1JY3 N;  3KHU A;  1DW2 A;  3Q5S A;  1LJ2 A;  2AXT E;  1L0L D;  2C0X A;  3CD6 P;  1LTJ A;  4I6M C;  2WSE H;  2H7H A;  3H1K J;  3TNU A;  4EIJ A;  3CCQ P;  1IK9 A;  5CJ0 A;  1UIX A;  1CZQ A;  1EZV I;  3G6E P;  1N7S D;  3L73 D;  1HF9 A;  3WFD C;  2YMY A;  1M1J C;  2E76 B;  1OZH A;  1RF1 A;  1IFJ A;  2W90 A;  1T3U A;  3MUD A;  2E43 A;  1SP4 A;  4MU8 A;  2N1T C;  4WQA A;  2KXP B;  2WMM A;  3V5B A;  4MN4 C;  2OYI C;  1M90 Q;  3FX0 A;  3Q3D A;  3H25 A;  3H1H G;  2AXT H;  2AEF A;  3PXW A;  1NYH A;  2FFD C;  2VRS A;  4YXD C;  1RF0 C;  3GW6 A;  1ZR2 A;  4K3I A;  3RMZ A;  1S5L X;  3HE4 A;  4AQR D;  3M06 A;  1YTC A;  2A06 E;  1PGP A;  5BVZ A;  1NJI Q;  1PP9 G;  4GOE A;  1VQM P;  1IJD B;  1R5S A;  1URQ A;  1CTZ A;  2QEX P;  1S72 P;  5CIF B;  4AAM A;  2HFE D;  1ZP0 C;  1J1E B;  4XXL A;  1EDK A;  1KX2 A;  2BPB B;  2ZFC A;  2QJK B;  3O6Q B;  2JQR A;  1NTK E;  3KZI E;  3H32 B;  2ZVO B;  3CCR P;  1SQX G;  3U59 A;  3KQG A;  3PXT A;  3M0A A;  4AUW A;  3VOP A;  2A06 D;  2GUS A;  2YKP A;  3VTP C;  4PWA A;  3A0B E;  1RE4 C;  3CXH D;  2NRG A;  4H44 C;  3CXH H;  1QLE D;  1C2N A;  1IZL 0;  3A3Y B;  2QM7 A;  3HUS B;  3L75 J;  3CXH W;  3H1H J;  2JEE A;  5AVY B;  1FOS F;  1NTK D;  2AIU A;  1RH5 B;  1LWU B;  1IZN B;  2YIU B;  5APV A;  2KB7 P;  1S9K E;  2C9X B;  1USE A;  3IF4 A;  1IRV A;  1KD1 Q;  1QVG O;  1EXJ A;  1H31 B;  1PP9 J;  3KZI V;  2FYU E;  1ZLL A;  4HB1 A;  5TJH A;  3CWB E;  2V7Q H;  2ZT9 D;  4H0K A;  3SSU A;  2E74 B;  3L74 E;  2KS1 A;  2OGU A;  1HTL C;  1W2B O;  1X8Y A;  1H33 A;  4GIF A;  4A7P A;  3A0B H;  1B7V A;  3VRD A;  3HQ8 A;  4JYB A;  2NPS A;  3AE7 C;  1W5C E;  1XTC C;  2M8R A;  5B6Q A;  1CCH A;  2Y9Z A;  4PJ0 E;  1CHI A;  3W68 A;  2N3B A;  3BRT B;  1S9K D;  4JBZ A;  4L74 A;  3D71 A;  4IL6 H;  5AVS B;  4GDO A;  1P84 I;  2FYU D;  2N18 B;  1K3H A;  1NTM G;  3CWB D;  2QJY B;  4IOI H;  3L74 D;  3O0R C;  1OX3 A;  4EIF A;  1YTZ I;  1MFT A;  1SQB J;  1J1E C;  2IZ0 A;  3K5B A;  3L37 A;  2QJK C;  4YE1 A;  5AW9 B;  4EYY Q;  1DX7 A;  4WQ7 A;  3JC2 2;  2R5B A;  1J3S A;  3L70 E;  1CC5 A;  4IFF A;  2GC7 D;  1EB7 A;  2KLU A;  5KJ7 A;  1IFD A;  1QYZ A;  2CPB A;  4PJ0 H;  1N7S C;  2KUB A;  3HRN A;  1G1J A;  2A45 I;  4IFM A;  3II6 A;  3CC4 P;  2K1A A;  1H9X A;  3S1K A;  2MHM A;  3S4R A;  3TSI A;  3CCM P;  2OZ1 A;  5CYT R;  1CI6 A;  1SQQ G;  1NAY A;  3HE5 B;  1HUC A;  3HUS C;  1W5C T;  1LT9 A;  1GKS A;  2K9J B;  2ZAE B;  3L70 D;  1LWU C;  3KPE A;  2YIU C;  2B9B A;  5APY A;  3B8E B;  1PPJ G;  3MTU E;  2WVR A;  1NTM J;  2N9I A;  1EDL A;  1NTZ G;  3E7K A;  5KLV K;  2D0W A;  4WQC A;  1EXI A;  3R4Y A;  1RAQ A;  2YK3 A;  4LLH A;  5AVW B;  2KSE A;  1GK6 A;  1L4A D;  1LTJ B;  1H0T A;  3TNU B;  3WU2 E;  4H0L D;  3AE6 C;  4YTP C;  1P84 E;  1NU1 D;  3JCU E;  1YQ3 C;  2AEM A;  1VDF A;  2O01 H;  2E5T A;  2KZJ A;  2ZXE B;  1SQQ J;  1HZU A;  1HGZ A;  3U1C A;  2QA4 P;  3CYT I;  1RF1 B;  1SVF A;  1AYG A;  3RK2 B;  1IFP A;  1I55 A;  1YYC A;  2YO3 A;  1FZB A;  4N3Y B;  1LC1 A;  3WUV A;  2N3Y A;  3AE2 C;  1P84 D;  1IRW A;  3WU2 H;  1U57 A;  2JWD A;  1P84 H;  3HQ9 A;  2ZT9 C;  3HE4 B;  3RL0 D;  4JCG A;  2FXO A;  1NTZ J;  1VQP P;  3QWO C;  3HQ7 A;  3MHV A;  3L72 E;  1J1D B;  2V07 A;  1TU3 F;  2LR2 A;  5DJT B;  5CCG A;  3AE4 C;  2M5A A;  4JF7 A;  4TT3 H;  3WFE C;  4FA4 A;  2JWA A;  1AVY A;  3VN0 A;  2PGD A;  2AI5 A;  1MZ4 A;  2AXC A;  1S5L H;  1JMB A;  2NPS D;  2CPS A;  2MKV A;  4BRY B;  1VQ4 P;  1IFI A;  1YQ4 C;  1ETP A;  1GU5 A;  1KFM A;  1L0N G;  3BCC G;  2R3S A;  4EDF A;  1SFC A;  1CYI A;  4W7Z A;  1Y9B A;  1NIR A;  3RK3 E;  1L0L G;  1OW7 A;  3USS A;  1COR A;  3L72 D;  4AAO A;  2OYH A;  1PGJ A;  1OXZ A;  2C8S A;  4GKG A;  2P10 A;  3CPW O;  2IBZ G;  5APW A;  5KLV G;  2J5U A;  1JTH A;  3Q5P A;  2FXM A;  3L73 G;  4WY4 D;  1OCD A;  1ZV8 A;  4OWF A;  1LTJ C;  1CRG A;  1IFN A;  4O1Q A;  2P58 A;  4NFG B;  3CCE P;  1JUN A;  4EI2 A;  1A8C A;  2H43 A;  5KKZ B;  5KJ7 D;  1LTT C;  2ZJS E;  3CX5 H;  3RL0 B;  5KTB A;  3RK3 D;  1CSB A;  5TIS H;  5CHX A;  3O5C A;  2FRC A;  3AEA C;  4LC1 A;  4DZO A;  4QAO A;  3CX5 W;  1JNM A;  1RF1 C;  2KS1 B;  1JY2 N;  5CMZ A;  2W6A A;  1C6O A;  2FWL A;  3AE9 C;  1H33 B;  1LS9 A;  1RY3 A;  1SQP E;  4KHX A;  1DH3 A;  3MUD C;  2IFM A;  1LFM A;  4N0K A;  2B89 A;  3RN1 A;  2NPS B;  4WVZ A;  1C52 A;  5KLI C;  1PFI A;  1L0N J;  3BCC J;  2BCN B;  2B88 A;  2ZXY A;  1KV9 A;  5AVU B;  1CSU A;  1KYO H;  1JY2 P;  2WSE J;  2GIW A;  5AW8 B;  1L0L J;  3SFE C;  3AEF C;  1VQ5 P;  1HBW A;  3L36 A;  5BU8 B;  1MG3 D;  1J1D C;  3TF5 A;  1Q86 Q;  1JDL A;  3SFD C;  4PD4 I;  3GHG A;  4AAL A;  5KLV J;  1FZF A;  3AE1 C;  1CSW A;  5AW4 B;  1SQP D;  1NVO A;  2A06 G;  4JQ0 D;  3V6I A;  1H1O A;  4WY4 B;  3OJA B;  2QE7 H;  1L4A C;  1C6R A;  5KAF E;  4H0L C;  4H0J A;  1QL4 A;  1Q90 D;  3PP5 A;  1GL2 A;  3DP5 A;  3GG2 A;  1BCC E;  2ZON G;  2JKV A;  2K37 A;  3RK3 B;  1NTK G;  2E76 D;  2OZ1 B;  1GJQ A;  3PLN A;  1VPC A;  1GQ1 A;  2QRX A;  1BL9 A;  2HV4 A;  2YXQ B;  4C46 A;  3A0H E;  1S3J A;  1LT9 B;  1SQX K;  2RH0 A;  5C39 A;  1GK4 A;  2HOD A;  1CIH A;  1W2E A;  3VMX A;  5KKZ C;  2I1K A;  3RBX A;  1VQ9 P;  1AQ5 A;  3RL0 C;  5KAF V;  1N73 C;  1BCC D;  1G1I A;  1T8Z A;  5E79 E;  1AVO A;  4OVN F;  5DJU B;  3L71 E;  5AVT B;  1K05 A;  1U74 B;  3H1I E;  3TGU E;  2W8Z A;  4D6T E;  3TYY A;  3WUI A;  3AE3 C;  1M56 D;  2NPS C;  1U7M A;  5CIC B;  3OA7 A;  2KIK A;  3QH9 A;  2CA3 B;  5B66 V;  2DW3 A;  2C2C A;  1BDC A;  1FZG A;  2LIT A;  2R5D A;  2WIT A;  2POH A;  1H0T B;  1VL2 A;  3CMA P;  2E75 B;  3A0H V;  3EFG A;  3V2N A;  3CCU P;  3B4S A;  3H1L D;  1M57 D;  4DY9 A;  1T2K D;  3F89 A;  1VQN P;  2HYN A;  1JO5 A;  3L71 D;  1JY3 P;  1SFC D;  1LTG C;  4PD4 E;  3H1I D;  4UB8 E;  2BLF B;  5IY5 1;  3TGU D;  2BH5 X;  4I7Z B;  1GZL A;  5E79 V;  4D6T D;  1A02 J;  1JMM A;  1OVV A;  1CTY A;  3G4S P;  4PW9 B;  4R4M A;  4WY4 C;  1RZ6 A;  5DJQ B;  1KC8 Q;  4H13 D;  2KLV A;  1G2C A;  1I5T A;  3SVW A;  1BGY E;  5KJ7 C; 
#chains in the Genus database with same CATH homology
 1CNO A;  2FYN B;  3L74 D;  451C A;  3JBT B;  3O0R C;  1GDV A;  4EIF A;  1NML A;  3ZOX A;  5KLI B;  1QKS A;  4PD4 D;  3CP5 A;  1M60 A;  4YE1 A;  4WQ7 A;  1J3S A;  1AOQ A;  3RN0 A;  1FI7 A;  1CC5 A;  1CCR A;  4UB8 V;  3WU2 V;  4RJT A;  4KMG A;  2ZZS 1;  1YEB A;  1NMI A;  2GC7 D;  2PAC A;  2B12 B;  1EB7 A;  3FWL A;  1QYZ A;  4EID A;  1W2L A;  3CWB D;  1YEA A;  1CRI A;  1CIG A;  2L91 A;  3OA8 B;  5C9M A;  3NBS A;  1FI9 A;  1BGY D;  1H9X A;  2MHM A;  2OZ1 A;  5CYT R;  1NTM D;  2Y0D A;  1S5L V;  5AUR A;  4O1W A;  2C1D A;  5GTH V;  4UB6 V;  3ZBM A;  1W5C T;  2ZOO A;  1GKS A;  2EXV A;  2K9J B;  3SJL A;  3L70 D;  1K3G A;  3PTZ A;  1CRH A;  1AKK A;  2YCC A;  1HH7 A;  3DR0 A;  5CIB B;  1C2R A;  2GC4 D;  2Y0C A;  4RSZ A;  2N9I A;  3SLE A;  1HJ5 A;  1C6S A;  4P4Q B;  3H1K D;  3L4M A;  1WVE C;  4AAN A;  2DGE A;  2D0W A;  4WQC A;  2B11 B;  1DIQ C;  1I6D A;  3M97 X;  1E8E A;  1M70 A;  1RAQ A;  1BE3 D;  1SQQ D;  2BCC D;  2YK3 A;  4EIC A;  3C2C A;  3CX5 D;  1H31 A;  1I8P A;  3BCC D;  4FA5 A;  3VYM A;  3CU4 A;  3WC8 A;  1DW0 A;  3WFB C;  3H1J D;  5DJQ C;  5TIS V;  1NU1 D;  1DVH A;  2B4Z A;  2D0S A;  1RAP A;  1DW3 A;  1N50 A;  1MG2 D;  2IBZ D;  1F1F A;  5KLV D;  1EZV D;  1HZU A;  3OCD B;  3L4O A;  4L1Q A;  1H9Y A;  3CYT I;  1NTZ D;  1ZRT D;  1L9B C;  1QN2 A;  1KYO D;  1AYG A;  4FAV A;  5GTI V;  1I55 A;  2DVH A;  3RLM A;  2BH4 X;  1N90 A;  2XTS B;  1FJ0 A;  3VNW A;  1LMS A;  1NNO A;  1FHB A;  1KYO W;  2VHD A;  3DMI A;  1LC1 A;  2CXB A;  2N3Y A;  2GB8 B;  1S6V B;  5DF5 A;  3TDK A;  1CRY A;  1I54 A;  1P84 D;  2ORL A;  1IRW A;  2L4D A;  2Q3E A;  4FA1 A;  3HQ6 A;  3HQ9 A;  2MTA C;  5CIG B;  1GU2 A;  1U75 B;  1YFC A;  2AXT V;  4JCG A;  3HQ7 A;  2V07 A;  1KB9 D;  2V08 A;  3MK7 B;  2B10 B;  3WFE C;  1I8O A;  4FA4 A;  2JWA A;  2O3J A;  1YIQ A;  2AI5 A;  1MZ4 A;  2PCB B;  4L3G A;  5CIE B;  5EXQ A;  1CSX A;  2RMZ A;  5H2F V;  2QG4 A;  3OA8 A;  3ZOO A;  155C A;  1RZ5 A;  1ETP A;  4AX3 A;  4EDF A;  1FI3 A;  1CYI A;  2N9Y B;  1NIR A;  1M6Z A;  5KAI V;  1H32 B;  3L75 D;  1CSV A;  3SWS A;  4WQE A;  3ZCF A;  1COR A;  4WQ9 A;  3PH2 B;  5CIH B;  3L72 D;  1CED A;  4AAO A;  2C8S A;  4FB1 A;  1CTJ A;  4Y5R A;  3ZOW A;  2CE1 A;  5DFS A;  5B5E V;  2QJP B;  1CHJ A;  3WFC C;  1PP9 D;  4GED B;  1IQC A;  1E29 A;  1DT1 A;  1OCD A;  4WQD A;  1QL3 A;  2C1V A;  2N9J A;  1CRG A;  4O1Q A;  2RN0 A;  4NFG B;  3O1Y A;  1CRJ A;  1R0Q A;  1A8C A;  1L0N D;  5KKZ B;  2KNC B;  2Y0E A;  1DII C;  4FA9 A;  3KHU A;  3O5C A;  2FRC A;  1DW2 A;  4QAO A;  3CX5 W;  1L0L D;  1N15 A;  2BGV X;  1KB0 A;  2LIR A;  1FCD C;  1A56 A;  1C6O A;  1GIW A;  2FWL A;  2ZBO A;  1H33 B;  1LS9 A;  2N18 C;  1LFM A;  4N0K A;  3A9F A;  3RN1 A;  1C52 A;  1LC2 A;  2C1U A;  3PHL A;  1IO3 A;  4WQ8 A;  3A0B V;  1CXA A;  3L73 D;  2BCN B;  2ZXY A;  1KV9 A;  3OCD A;  1CSU A;  3WFD C;  1SQB D;  1CXC A;  1HRO A;  2GIW A;  1AOF A;  1WEJ F;  1SQV D;  1MG3 D;  4MU8 A;  3TF5 A;  4WQA A;  1JDL A;  1HZV A;  1YNR A;  3MK7 C;  4XYD B;  4AAL A;  1CO6 A;  4IL6 V;  1C7M A;  3PXW A;  1CSW A;  1HJ4 A;  3ITK A;  1SQP D;  2CA4 B;  3ZOY A;  1CIE A;  1E2R A;  1CYJ A;  1CRC A;  1H1O A;  4L3H A;  3GW6 A;  4K3I A;  3RMZ A;  1C6R A;  1YTC A;  2YQB A;  1YCC A;  1KX7 A;  4H0J A;  1QL4 A;  3TYI A;  3DP5 A;  3GG2 A;  1I6E A;  1HRC A;  1CTZ A;  1N9C A;  2ZON G;  4V2K A;  5CIF B;  5CID B;  4AAM A;  3VMA A;  1OAE A;  4EIE A;  3NWV A;  4LJI A;  4XXL A;  1KX2 A;  4FAN A;  2BPB B;  2QJK B;  2B0Z B;  2JQR A;  4PJ0 V;  2OZ1 B;  1GJQ A;  3PLN A;  2PCC B;  1GQ1 A;  1A2S A;  1BL9 A;  1HCM A;  3PXS A;  3H1H D;  3PXT A;  2HV4 A;  1FOC A;  2C1D B;  1DW1 A;  1H32 A;  2A06 D;  1DVV A;  4U3F D;  1CIH A;  1CHH A;  4WQB A;  4PWA A;  1COT A;  5KAF V;  3CXH D;  3X39 A;  1BCC D;  3PRJ A;  1U74 B;  351C A;  1C2N A;  1IZL 0;  3CXH W;  4GYD A;  2JTI B;  1NTK D;  3WUI A;  2AIU A;  3O20 A;  2YIU B;  2C9X B;  5CIC B;  1IRV A;  4Q5P A;  1H31 B;  1SQX D;  3KZI V;  2CA3 B;  1CYC A;  5B66 V;  2C2C A;  5C0Z A;  5TJH A;  2LIT A;  4H0K A;  2I8F A;  2KS1 A;  3A0H V;  3SXT A;  3H1L D;  1YIC A;  4A7P A;  1H33 A;  4DY9 A;  1B7V A;  1L9J C;  3VRD A;  3L71 D;  3HQ8 A;  1ZZH A;  3H1I D;  2BLF B;  5IY5 1;  1HJ3 A;  3TGU D;  2BH5 X;  5E79 V;  4D6T D;  1C75 A;  4J20 A;  5B6Q A;  1CTY A;  1VYD A;  1CCH A;  3NBT A;  4PW9 B;  2CE0 A;  1CHI A;  1PPJ D;  2N3B A;  1CIF A;  1RZ6 A;  1KIB A;  5DJQ B;  3ORV A;  2FYU D;  3ZIY A;  1I5T A;  2N18 B;  3SVW A;  1K3H A;  2QJY B;  1F1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...