1EZVD

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ezvD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ezvD01
1EZVD 3ORVA 4Q5PA 1CTJA 3WUIA 5CYTR 451CA 1H33B 2DVHA 2RN0A 2PCBB 3PLNA 1CYJA 1FI3A 3H1JD 3CP5A 1FOCA 1HROA 2BCNB 2L91A 3SJLA 1L0LD 1DW3A 2ZONG 2MHMA 3ZOOA 2N9JA 1WVEC 4WQ7A 3O1YA 4FA9A 3ZCFA 4L3GA 1YIQA 1DVHA 1CYCA 1K3HA 2CE0A 2IBZD 1GU2A 3MK7C 1ZRTD 3SWSA 2B11B 5IY51 2K9JB 1B7VA 1W2LA 4QAOA 2I8FA 4KMGA 4WQDA 2KS1A 1BL9A 2Y0EA 1N90A 4FA5A 1KYOW 1IRWA 3ZOXA 4GYDA 1HRCA 4AALA 1N9CA 1C2NA 4YE1A 3MK7B 1L9BC 3TDKA 2LITA 4EICA 1CNOA 1OCDA 1CCHA 3L4MA 1M70A 2C1UA 3KHUA 1FHBA 3KZIV 1QKSA 1DIQC 1F1CA 1QL4A 2FRCA 2BGVX 3GW6A 1HCMA 3CU4A 1GJQA 1C6RA 5CICB 5TJHA 5B6QA 3O0RC 3BCCD 1A8CA 1GKSA 2JQRA 4A7PA 155CA 2BH4X 1CSVA 5GTHV 1E29A 3RN1A 1HH7A 2AI5A 3WFCC 2PCCB 1CYIA 4XYDB 2FWLA 5CIFB 1KV9A 1W5CT 1L9JC 2BH5X 2N3YA 1CSWA 5DJQC 3FWLA 2CXBA 1E2RA 4PD4D 1FI7A 4L3HA 3H1HD 2JWAA 1H9XA 4UB8V 3PHLA 1MG2D 2C1DA 1BE3D 5C0ZA 3VMAA 4FB1A 4NFGB 5DJQB 1EB7A 2N3BA 3HQ8A 4RJTA 1CTZA 1J3SA 1NTZD 1H31A 1RAPA 1I6DA 1C52A 1QL3A 5KLVD 2B4ZA 3OCDB 1LMSA 3OCDA 5KAFV 1LC1A 3OA8B 4IL6V 4FANA 1OAEA 2N9YB 1H33A 3WC8A 1CHHA 2ZXYA 5E79V 4WQCA 3PH2B 1PP9D 2FYNB 2D0SA 3A9FA 5B5EV 2QG4A 1NNOA 5TISV 3PXWA 5H2FV 2B12B 3WFEC 1YICA 1A2SA 2ZOOA 2OZ1B 1DW2A 5CIDB 1NTKD 2EXVA 1CORA 4FA4A 3H1LD 3NBTA 1COTA 3WFDC 2LIRA 3VYMA 3X39A 1CC5A 5CIHB 1HZVA 4PW9B 2QJYB 4LJIA 3PTZA 3TGUD 1NU1D 1I8PA 3H1ID 5CIEB 3ZBMA 1CRIA 1U75B 4U3FD 5KAIV 3ZOYA 1GQ1A 1CXAA 4H0JA 3GG2A 1KIBA 4H0KA 2B10B 4GEDB 1CIFA 2GC7D 1QYZA 1KX7A 4WQ9A 3HQ6A 4MU8A 1LFMA 1N50A 4V2KA 3CWBD 3NWVA 3TF5A 2C2CA 4J20A 1LC2A 3C2CA 2ORLA 3HQ9A 1ZZHA 1KX2A 1HZUA 2VHDA 4Y5RA 2MTAC 2C1VA 1KB9D 3A0BV 4UB6V 4K3IA 3SVWA 351CA 2RMZA 4WQAA 1AYGA 1CIHA 3DR0A 1AOFA 1DVVA 1I5TA 1MG3D 3VRDA 4AX3A 4EIEA 3CX5D 5B66V 2V08A 2YCCA 2L4DA 1C6OA 3RLMA 3WFBC 3DP5A 1PPJD 3DMIA 3L71D 3HQ7A 4O1QA 1CSXA 1CHIA 1I8OA 1DIIC 1I55A 2AIUA 1CRHA 2CE1A 3CXHD 3O5CA 1GDVA 1H9YA 1E8EA 1IO3A 1CEDA 1KB0A 1SQVD 3ZOWA 1I6EA 3JBTB 1NTMD 1U74B 3CYTI 3CXHW 3PXSA 2KNCB 4L1QA 5EXQA 4WQEA 2BCCD 1CIEA 3OA8A 4AANA 3M97X 1SQPD 3SLEA 1F1FA 3RMZA 1FCDC 2C8SA 1QN2A 2ZZS1 3L74D 1A56A 2Y0CA 2C9XB 2N18C 1AOQA 2OZ1A 1IZL0 4WQ8A 4FAVA 1DW1A 2HV4A 1BGYD 5C9MA 3NBSA 1NMIA 3L4OA 2N18B 1R0QA 1DW0A 2BPBB 2GB8B 3PXTA 1I54A 1CRCA 1L0ND 4PWAA 5DFSA 1ETPA 3A0HV 2PACA 1MZ4A 2AXTV 5AURA 4AAOA 4FA1A 2CA4B 1M60A 1YCCA 2D0WA 4JCGA 4EDFA 2Y0DA 1AKKA 3ITKA 2DGEA 5DF5A 1RAQA 1S5LV 2V07A 1C6SA 1C75A 1CHJA 5KKZB 1M6ZA 1P84D 4EIDA 1CRJA 1C7MA 1KYOD 1FJ0A 1SQBD 1CRGA 1FI9A 1CSUA 3TYIA 1YTCA 1IRVA 2A06D 2YQBA 3VNWA 1NIRA 2FYUD 1YEAA 3O20A 2B0ZB 3WU2V 4WQBA 1NMLA 1YEBA 1JDLA 3ZIYA 3RN0A 5CIBB 1C2RA 3PRJA 2GIWA 2XTSB 3L72D 5GTIV 4XXLA 2N9IA 5KLIB 1CRYA 1IQCA 2Q3EA 2JTIB 1YNRA 1CXCA 1HJ5A 3CX5W 1H32B 1H32A 1CIGA 4AAMA 1RZ5A 1CO6A 4DY9A 3L73D 1LS9A 1K3GA 1SQQD 4EIFA 2QJKB 1BCCD 1RZ6A 1CCRA 4RSZA 1SQXD 2O3JA 3H1KD 4PJ0V 1YFCA 3SXTA 2GC4D 3L75D 4P4QB 3L70D 4D6TD 4N0KA 1HJ3A 1S6VB 2CA3B 1WEJF 1N15A 2YK3A 2C1DB 1VYDA 1HJ4A 1CTYA 5CIGB 1GIWA 2QJPB 2ZBOA 1H1OA 2BLFB 4O1WA 2YIUB 1DT1A 1H31B
chains in the Genus database with same CATH superfamily
1EZVD 1VQOP 1CTJA 3WUIA 4RESB 451CA 2IYPA 3B5NC 4JPZB 2IZ1A 1CYJA 3OA7A 1FI3A 2A06G 5AVRB 3CP5A 3HE4B 2BCNB 1HROA 1LWUB 1L0LD 2WVRA 1T3UA 2D2CC 1WVEC 3O1YA 4YXWH 5M1BA 2WSFJ 3RL0C 4OH8B 4L75A 3AEAC 1QX8A 4DOJA 1QGKB 1SQQE 2Y9ZA 1N73B 5IY51 1BCCE 1SFCB 2ZJSE 4CPGA 3H1KE 3V2PA 4WY4D 5E79H 1HRCA 3W67A 1N9CA 2CK3H 2V4HA 3M9HA 3L73G 4D6TE 3TDKA 5CCHC 4Y99B 2LITA 3GHGB 2N1TC 1CCHA 3T97B 3KZIV 1XTGB 1FOSF 1QL4A 3GW6A 1KV4A 5CICB 5B6QA 1IZNB 1N86A 4JYBA 4A7PA 155CA 3H6PA 2BH4X 3RN1A 4OGQD 4BRYA 2HODB 3RK3E 3H1JE 1S5LH 3WFCC 4LGDE 1CYIA 4L74A 2XNDH 2UWJE 1L4AA 2IZ0A 3SSUA 3W68A 3FWLA 5GTIE 1GDTA 1JY3O 3G4SP 5AVTB 1FI7A 1T3JA 2WT7B 2C1DA 2H89C 4KHXA 2WPVB 1LT9A 2XV5A 1ZRTE 1CI6A 1SLQA 1CTZA 1J3SA 1M1KQ 1H31A 1RAPA 3WUUA 4WBAA 1C52A 3AE8C 3KPEA 3D0WA 2QSIA 2C9LY 1OZHA 5KLVK 3OA8B 1JNMA 1CHHA 5E79V 3VN0A 4WQCA 1HBWA 1PP9D 3A9FA 3PXWA 5H2FV 2E74B 2JDIH 2XZRA 2B12B 3HE4A 1T2KD 3WFEC 1A2SA 1NKZB 1DW2A 5CIDB 4NPEA 2H7HA 4C7NB 1COTA 1IK7A 1NU1J 1CC5A 1GL2D 3JC22 1VQ6P 1GW3A 1EDJA 1Y47A 1IJDB 1RF0A 3TYYA 1OXZA 4B86A 3TGUD 3CI9A 4AQRD 3HUSB 1Y9BA 2QRXA 4AUWA 1ZN5A 2KIKA 2PGDA 2D2CB 1KQGB 1URQC 4H0JA 3M0AA 1SFCA 1L0NK 1DD4A 2WSCJ 3NTNA 2Q6QA 4K3AA 1KMIZ 1GTWA 3BCCG 1KX7A 4WQ9A 3HQ6A 1RE3A 1VQ4P 2K37A 3CWBD 1HWTC 3EFGA 2C2CA 1NVOA 4J20A 3H25A 3HE5A 3C2CA 3GHGA 1SQBK 1KX2A 2Q3IA 2OYHC 1KB9D 3BCCJ 3NMDA 2B88A 2A45H 3VRDA 4EIEA 1JY3P 3CX5D 4H0LB 3CCVP 2QVAA 4WB4A 1E79H 1VQPP 2XU6A 1AQ5A 1R8EA 1W2EA 1VQ8P 2I1KA 4XA4A 2ZAEB 1KFNA 1PPJD 2HODA 5KLVG 2FFDC 3PP5A 3AE4C 2K88A 1N7SD 1Q90D 1S4XA 2HFED 3H1LE 1U7JA 1CSXA 3LIDA 3A0BE 3GF3A 1I55A 3Q5RA 1IO4A 1VF5B 4PD4I 3O5CA 2WT7A 1NU1E 1KILB 1KD1Q 1CEDA 1VQ5P 1Y8AA 1KB0A 1SQVD 1K04A 2DW3A 1NTMK 3WMM0 1IFNA 2BCCD 2E5YA 4H13D 2KI7B 5GTIH 1IK9A 2W27A 3OA8A 1JUNA 3M97X 3EWKA 5AW8B 1FZCB 1F1FA 4O9BA 3RMZA 2WSFH 1QN2A 1NH4A 2ZZS1 1ZR4A 4GKGA 3U59A 1S9KE 2C9XB 4UB8E 1AOQA 3S4RA 4C7NA 2NPSD 2PAJA 4N78E 3MD0A 3G9RA 1RY3A 5CCGA 1FBMA 4JQ0D 4PJ0H 3NBSA 1L0NJ 3SFDC 1R0QA 1N2DC 3PJSK 3O6QB 1J1DC 4IL6X 4PWAA 1IFDA 2N9BA 2JP3A 4AAOA 4FA1A 1GZLA 1L0LK 1NAYA 1YCCA 4JCGA 1AKKA 2POHA 2GUSA 2BEZF 1SQBJ 1LTJA 5EFWB 1C75A 1CHJA 1URQB 5KKZB 1M57D 5AW7B 1MFZA 1CRJA 2R5BA 4PD4E 1FJPA 5BVZA 1BDDA 1CRGA 1CSUA 3AEBC 3U1AA 3L71G 1GK6A 3VNWA 1NIRA 2FYUD 1YEAA 3O20A 5APYA 4WQBA 3V2RA 1OW7A 3B4SA 1G1IA 3ZIYA 1ZOYC 1JEKA 3GMAA 3L72J 2OYHB 3A3YB 3HD7A 3B5ND 2O01N 3PH0A 3PRJA 3L71J 2WSEJ 2XTSB 3II6A 5GTIV 4XXLA 1NTMG 1PL5A 2Q3EA 1NKNA 1GD2E 1RZ5A 3P32A 3CC4P 3JSVC 3OW2O 1IFPA 1NJIQ 1SQPG 2HLOA 4UB6E 3RL0D 1K3GA 2FXOA 5CBNA 4EIFA 1K05A 1SQQK 1VQ7P 1H89A 3L74G 3L75J 1NTMJ 3P8CE 3LIEA 3VYIA 1SQXD 4PJ0V 1L0NE 1YFCA 1LT9C 5B66E 3VOPA 4P4QB 1H88A 4IFDK 3I56P 4JYCA 3L70D 4N0KA 2CA3B 2YK3A 1P84E 1DEEG 4GOFA 1SQBE 2ZVOB 2QJPB 3L74J 2C0WA 1H1OA 2YIUB 2N1TD 1M1JB 2OYOA 4Q5PA 1Z56A 1LWUC 5AVYB 1USDA 3R4YA 5DJUB 2E75B 1JMMA 3MP7B 3CL3D 2WSCH 1L0LJ 5AVUB 2GA1A 1RF0C 3SJLA 3L72E 4JBZA 2MHMA 1FDMA 3ZOOA 3L71E 2N9JA 4UB8H 2C0XA 1NO4A 1SFCC 4L3GA 1E5WA 3A7OA 1RE3C 2IBZD 3RGUA 3SWSA 2B11B 1KYOI 4M3LA 1B7VA 1W2LA 4N6JA 2KZIA 2KS1A 3AEGC 3GHGC 1JB0J 1KQFB 2Y0EA 1KYOW 2AEFA 1RH5B 4GYDA 1NTME 3L75E 4AALA 1CZQA 3HRNA 3MK7B 1SQQG 3KQGA 1BCCG 4PD4H 3L4MA 2C1UA 3KHUA 1FHBA 3H1KG 3IFMA 1RHZB 1JOCA 1DIQC 4LLHA 2A45G 3ABVC 3CCRP 4D6TG 2FRCA 2BGVX 5AW5B 1DEBA 4HJGH 2C9NY 1EZVE 1HCMA 1GJQA 1C6RA 2XNXA 3P7KA 1SQQJ 1T8ZA 3O0RC 1BCCJ 3AE1C 4N3YB 1E29A 4BRYB 4YTPC 2PCCB 4XYDB 2FWLA 1L0LE 1L4AB 1URQD 3RK3B 1KV9A 4BXLA 3Q5PA 5CMZA 1L9JC 1JTHB 2BH5X 2N3YA 2KLVA 4OWFA 1CSWA 4EIJA 1FZGA 2A45I 3MHVA 2JJLA 2HR3A 1FS0E 3GF7A 4L3HA 4W7YA 3H1JG 4UB6H 3H1HD 2JWAA 1H9XA 4UB8V 3PHLA 5AVQB 1MG2D 1LT9B 3B71A 1BE3D 1KYOE 1FU1A 3VMAA 3M06A 2P7JA 4ASVA 5DJQB 3CMEP 3HQ8A 1USEA 1SVFA 1LTIC 3IR9A 1M1JA 3ZDMA 5B66H 1NTZK 2E74C 5KAFV 1LC1A 3VMXA 3V4QA 1PP9J 3M9BA 3RK2B 2B9BA 3H1JJ 4WY4A 2ZXYA 4WVZA 3Q5SA 2FYNB 2R32A 1OVVA 5B5EV 1HGZA 5CCGC 3AEFC 3BRTB 3IN6A 3KXDA 3JCUE 3HUSC 1NTKD 2WITA 3OJAB 3NBTA 3WFDC 2LIRA 1KORA 3X39A 1VL2A 3TGUJ 4PW9B 3QWOC 1NWQA 2QJYB 3H1ID 4ZKUA 1QLED 1LTJC 2WWWA 2K9YA 4U3FD 1NU1K 3GG2A 4IL6E 1DD3A 3Q3DA 2J58A 1YIJP 1Q81Q 3CWBJ 2WSEH 5TISE 2ZYGA 3K5BA 2QM8A 1AJYA 3NWVA 3TF5A 3A5TA 2L5GB 2KK7A 3HE5B 1X79B 2O01J 2ORLA 1ZZHA 4Y5RA 3HD7C 4UB6V 4H0LC 1NAFA 351CA 3D71A 2QEXP 1AYGA 5KAIE 1CIHA 1H0TB 1AOFA 1AV1A 3RBZA 5KLIC 1W5CE 1R5SA 3H32A 5APVA 5B66V 1JY3N 2YCCA 2L4DA 1PP9E 1FZBA 1NTZG 4WWIA 3Q2YA 1BDCA 1VF5C 2CPSA 2KLUA 1KILC 1YITP 2PFXA 4O1QA 3MTUE 1FZFA 2E42A 1JTHA 1CHIA 1I8OA 1A02J 2AIUA 2CE1A 3CXHD 3O8ZA 3WU2H 3TGUE 1AVYA 4HKZH 1NTZJ 3KDPB 1I6EA 3JBTB 3H1LG 1RQVA 1SQXK 3CYTI 5AW1B 1FZCC 2BCCJ 4YXDC 4PV1D 3CC2P 2FKWB 2M0BA 1OFCX 1KZUB 5EXQA 1NU1G 2FXMA 1J1EB 2IPPA 3CWBE 3CCEP 2LKMA 4ZNCA 3TK1A 1KYOH 1ZW0A 3H1LJ 1KB9E 1A56A 1N8RQ 1X8YA 4EOTA 1IZL0 2FXPA 2AXCA 4WQ8A 2HV4A 1BGYD 3UIAA 2ITAA 3FXDA 3CX5E 1NMIA 3PXTA 2SPZA 2AEMA 5AW2B 5KKZC 2YKOA 1PPJE 1MZ4A 5AURA 3BATA 2HPCA 4EDFA 3JCUH 3S9OA 4K35A 1T6AA 1LTJB 1S5LV 1C6SA 1M6ZA 5APSA 4EIDA 1N7SA 1C7MA 1RQUA 2ZT9D 4HYTB 2FYUJ 5AVZB 2J5UA 1GU5A 2XKMA 2A06D 4IL6H 1K9MQ 1SQVE 3WU2V 2FBWC 1JO5A 1NMLA 1NTZE 1NOHA 1H0TA 4GDOA 3A0HE 2AXTE 5CIBB 3HD7B 2BCCE 1C2RA 1LJ2A 1YJ9P 1HJBA 1BSHA 1RF1A 4IFFA 2NRGA 5KLIB 1FZAA 3AE6C 2JTIB 1CXCA 4H44B 5AW6B 4ZKPA 2JEEA 4KT0J 1CO6A 5KAIH 2E76B 1KN7A 1SS1A 5CJ4A 1YTZI 3L73D 1SFCD 1SQXJ 2NPSA 2IDBA 1FE6A 4AYCA 1RZ6A 3HTKA 2B87A 3IF4A 3G6EP 2GC4D 3AE9C 2IX7C 2QJPC 2YIUC 1PV3A 1S6VB 2Q5UA 4BWNA 1N15A 1M1JC 2M8RA 3L35A 2JO1A 1L0NG 1GIWA 2WSSH 4WY4C 2AEJA 2BLFB 1RE4A 2PP6A 2E75C 2ZXEB 1IFMA 3KYQA 1YJNP 3D6ZA 1NHLA 3ORVA 2HG5D 2FYUE 2WZ7A 2E5TA 3VMYA 2KYVA 5DJTB 1SQBG 2DVHA 1YI2P 1ZV8A 1QVGO 2R5DA 3CPWO 1FOCA 1JY2O 2L91A 1LP1A 4L73A 1ZP0C 3RBXA 1DW3A 2E43A 3LW5J 1AQTA 2O01H 1NTKK 4FA9A 2P58A 2VRSA 2KZJA 1DVHA 4OGQC 4NPFX 1QVFO 1K3HA 3L72G 4C7RA 2CE0A 2KOGA 1P84I 1GU2A 3MK7C 3CX5H 3AE2C 2K9JB 4JF7A 2IBZI 4QAOA 2Q1KA 2RKLA 1JCDA 4WQDA 1D7MA 2KS1B 2BEQD 2R44A 1SQXE 3M9QA 3D70A 4FA5A 1ZXGA 1IRWA 2P10A 1LGHB 4XE5B 3AEDC 3L70E 3AE5C 4DJGA 2E74D 2G3AA 1KQSO 3D6YA 1OCDA 1M70A 5KJ7A 2WMMA 1QKSA 3CCLP 1FJKA 4ASWA 1LT1A 1ZR2A 3L75G 5CCGD 3BRVB 3F5HA 3CU4A 2OQQA 1UIIA 2D2CD 3BCCD 1L4AC 1A8CA 3RK3C 4RO0A 1J2JB 2JQRA 1CSVA 4R4LA 1HH7A 2AI5A 2MJZA 1QL2A 1EZVG 2JR8A 1DX7A 2MKVA 5AVVB 3KZIE 3N7NA 5DJQC 3E7KA 3H1HJ 3QH9A 2CXBA 1E2RA 4PD4D 1WMKA 4Y28J 4TLFA 1SP4A 3A0BH 5APTA 2OYIB 5CCHD 5C0ZA 1L0LG 2IBZE 3RK2C 4I7ZB 1GU4A 1JY2P 4RJTA 1AA0A 1I6DA 5KLVD 2FYNC 2YKPA 4H0LD 3AE3C 3OCDA 2V7QJ 1EZVI 4DCKA 2YMKA 2YNYA 4FANA 4WY4B 3WUVA 2N9YB 2ZYDA 2D0SA 3USSA 1NTKJ 2QG4A 3FWNA 1L2PA 2QJYC 1G1JA 1YICA 2ZOOA 2OTJP 2EXVA 4FA4A 3VYMA 1VF5D 3H1IJ 1HZVA 1KILD 3SWFA 4LJIA 3PTZA 1I8PA 3GLMA 3P8MC 3I55P 3P8CD 2JWDA 3ZOYA 1CXAA 2OARA 2K9JA 3R2PA 2W6JH 1GMJA 1Q7YQ 2I1JA 4OGQB 3C1LA 1CIFA 1W2BO 3C8VA 1QYZA 5H2FE 1LFMA 3S1KA 1N50A 4V2KA 1DH3A 2LXCB 3Q1MA 3H1HE 1LC2A 3HQ9A 2MTAC 1BE3E 2M3EA 3A0BV 1YTZT 2RMZA 1S2EA 1RF1C 3DR0A 1X9VA 1I5TA 4RKUJ 1EDKA 4AX3A 3H32B 4OVNF 1CW5A 3CCUP 1EC5A 2V08A 3EFFK 1IFIA 3RLMA 3DP5A 1UIXA 3DMIA 3L71D 1VQKP 2O1JA 1NTKE 1OWAA 1M56D 1PP9G 1CRHA 1S1CX 1FAVA 1GL2B 2W6AA 3H1IE 2OYIA 1FOSE 1IO3A 3CXHI 1Q2NA 4U3FE 4W80A 3MGNA 1J1EC 5AVWB 1VPCA 3IAOA 1NTMD 1U74B 1SQVK 2P2UA 3CXHW 2KUBA 3V5BA 5GTHE 2KNCB 1IC2A 4L1QA 3TGUG 4WQEA 1CIEA 4AANA 5CHXA 3M91A 2QIWA 3LW5H 1SQPD 3B8EB 1P84H 1K8AQ 1FCDC 1OX3A 2RH0A 3L74D 3E1RA 3VP9A 1YQ3C 1BGYJ 1AFOA 3AE7C 1FDIA 3CWBG 2KB7P 5C9MA 1U57A 1MKMA 2N18B 1DW0A 2BPBB 2GB8B 2LXBA 1I54A 1YHQP 1X22A 2HPCB 3SFEC 2CA4B 2M5AA 2Y0DA 3CD6P 3ITKA 4L76A 2V07A 1N7SB 2W90A 1KYOD 5KTBA 2W8ZA 1YTCA 1PPJG 3CXHE 3CMAP 4I1LA 3NXSA 2YQBA 1HTLC 4R4MA 1TU3F 1OW6A 5KJ7C 3CC7P 1HVVA 1KB9I 4GOEA 2E75D 1WRGA 2FYUK 2M3BA 1JDLA 4HH2A 2ZFCA 5H2FH 1R5LA 4IOIH 1WT6A 4H44C 2YXQB 2GIWA 1SQVG 4H13B 2E76C 3CX5I 1RF1B 1IQCA 3L36A 1HJ5A 3CX5W 1FDOA 5AW3B 2JKVA 2BCCG 1H32A 1CIGA 4AAMA 3L73J 2HYNA 3BVHA 1MUUA 4DY9A 2Z5IA 2NPSB 1LS9A 1SQQD 1BGYE 4EYYQ 1SQVJ 2QJKB 1BCCD 2O1KA 1GL2A 3FGAD 2V7QH 3HTKB 1KFMA 2P1JA 1PGPA 4RSZA 2B87B 2GUVA 2O3JA 3H1KD 3CLQA 4ZMDA 1VDFA 3C9IA 4D6TD 2P67A 1HF9A 1IFJA 2PRRA 2KNCA 3TNUA 1WEJF 1GK4A 1YQ4C 3MIWA 3F89A 1M8OB 1HJ4A 1CTYA 5CIGB 1DT1A 2YKQA 2YO2A 2A06E 3SWKA 2ZVNB 5CYTR 5GTHH 2Z4EA 5AVSB 4PJ0E 1H33B 2RN0A 2PCBB 3PLNA 2WPRA 4YPCA 1L4AD 3RK3D 5APQA 3H1JD 1JCCA 2FYUG 1LP1B 3B5NB 4DT0A 1LWUA 2ZONG 2QM7A 1LNQA 4WQ7A 3ZCFA 1YIQA 1CYCA 3V4WA 3L73E 2YMYA 4GIFA 1ZRTD 1N73A 3RL0B 2I8FA 4KMGA 1K73Q 1BL9A 1N90A 3RK2D 3ZOXA 1EDLA 1C2NA 4YE1A 1DIPA 1L9BC 4EICA 5TISH 1CNOA 3N4XA 2ZXXA 2NZ2A 1SQXG 3T97A 1S5LX 3CXHH 4I6MC 1F1CA 1G2CB 3V2NA 1JM0A 3L70G 1HH0A 2KXPB 2FY8A 3BASA 1OVRA 2N1TB 1BSNA 1Q86Q 4I2LC 5TJHA 3MUDA 4U7JA 1GKSA 1VQ9P 2Y9YA 5GTHV 1CSBA 2GM4A 3L70J 5CIFB 2OYIC 1W5CT 4I7ZC 2H43A 1X0TA 4GODA 2H8PD 3M0DA 5AW4B 2LR2A 4QMAA 3AEEC 4FB1A 5APUA 1HJ0A 5KLVJ 4NFGB 1EB7A 2N3BA 1LTGC 4TT3H 3RL0g 1NTZD 1JY2N 1QL3A 2B4ZA 3OCDB 1FC2C 1LMSA 3V2QA 4IL6V 1OAEA 2IBZG 2WPQA 2KSJA 1H33A 3WC8A 3PH2B 2OGUA 1EQ7A 1SQPK 1VQNP 1NNOA 5TISV 3OAKA 1A02F 4MN4C 2OZ1B 3B5NA 1CORA 3H1LD 2FYZA 1QL1A 1KB9H 2KSEA 2YXRB 1HGVA 3VTPC 5CIHB 2QA4P 1PZQA 1NU1D 3BCCE 1KTMA 5CIEB 3ZBMA 1CRIA 1OMIA 3HUSA 1U75B 5KAIV 5KAFE 1GQ1A 2H88C 3TSIA 2W83C 4IFMA 4XFJA 1KC8Q 1KIBA 4H0KA 2B10B 4GEDB 1VQLP 2G8YA 5B5EE 2GC7D 1M90Q 2Q9IA 3EQ2A 4MU8A 1MV8A 1EXIA 3AECC 2W6BA 1ZLLA 1HZUA 2VHDA 1YYCA 2C1VA 4PV1C 5C39A 1S9KD 5BU8B 4K3IA 3SVWA 1YBKA 1G2CA 4WQAA 3V6IA 1N7LA 2XDJA 5CCHA 3FX0A 5APXA 2R3CA 4N78D 5KLVE 1DVVA 1MG3D 2N1TA 3H1HG 3CCMP 4NPDA 5AVXB 1BE3G 1Q82Q 3A0HH 2KP8A 2AXTH 1U7MA 1T2KC 1C6OA 3WFBC 1FZEA 3WUTA 2K1AA 1EXJA 1YJWP 1OVUA 1LTAC 1GL2C 2I8DA 2R3SA 2B89A 3HQ7A 1MZ9A 3SWYA 3VMZA 1DIIC 2OTKE 1BE3J 1KILE 2FFDB 2Q7CA 2OTLP 1NGMB 1GDVA 1H9YA 1ZMEC 1E8EA 1MFTA 1KILA 2ZYAA 4LC1A 3ZOWA 1NTKG 5L8RJ 1PFIA 1PGJA 3PXSA 3HD7D 3NFQA 5KJ7D 2ZT9C 1SQPJ 3H1IG 3MZWB 4U3FG 3SLEA 1KQLA 1PGOA 1NYHA 1EDIA 1FZCA 4H44D 5AW9B 2C8SA 1LTTC 1GW4A 2E76D 3FXEA 1OW8A 2Y0CA 2N18C 2WQYC 2OZ1A 2BASA 5CBOA 2IYOA 4FAVA 1DW1A 1OIPA 4HB1A 4U3FJ 5APWA 5BU5A 3L4OA 4W7ZA 1XTCC 3E1IA 1N7SC 1CRCA 1L0ND 5DFSA 1ETPA 3O6QA 3CCSP 3A0HV 2PACA 2AXTV 2M5AB 5E79E 1N73C 1M60A 2D0WA 1QEXA 2WTYA 2DGEA 5DF5A 1RAQA 3G3ZA 1J1DB 1P84D 1URQA 1FJ0A 1SQBD 4EI2A 1FI9A 3TYIA 1IRVA 1H8AA 2YO3A 4Y99C 2J59M 3CCJP 5KAFH 1S3JA 3CCQP 3I5CA 2B0ZB 2CPBA 4H13C 1YEBA 4Z1MH 1VQMP 1LTBC 5B5EH 3RN0A 1AVOA 4PV1B 2OYHA 1HUCA 1S72P 2WPSA 3MUDC 1SQPE 1S5LE 3L72D 3L37A 2N9IA 1CRYA 2NPSC 1YNRA 3L4FA 2QJKC 3L74E 3U1CA 1H32B 2K3RA 5CJ0A 1LTSC 5K5GB 3VP8A 3WU2E 4GT1A 2Z5HA 3H1KJ 2FFDA 1JMBA 3M0DC 1CCRA 2IFMA 1PGQA 4D6TJ 3SXTA 3L75D 4DZOA 1RE4C 2IFNA 3A2AA 1BGYG 1HJ3A 3TNUB 3KZIH 3G71P 2C1DB 1VYDA 2QE7H 1M7LA 5AW0B 4C46A 1CI6B 2ZBOA 1PIXA 4O1WA 2ZT9B 1H31B 4KJMA
chains in the Genus database with same CATH topology
1EZVD 3ORVA 4Q5PA 1CTJA 3WUIA 5CYTR 451CA 1H33B 2DVHA 2RN0A 2PCBB 3PLNA 1CYJA 1FI3A 3H1JD 3CP5A 1FOCA 1HROA 2BCNB 2L91A 3SJLA 1L0LD 1DW3A 2ZONG 2MHMA 3ZOOA 2N9JA 1WVEC 4WQ7A 3O1YA 4FA9A 3ZCFA 4L3GA 1YIQA 1DVHA 1CYCA 1K3HA 2CE0A 2IBZD 1GU2A 3MK7C 1ZRTD 3SWSA 2B11B 5IY51 2K9JB 1B7VA 1W2LA 4QAOA 2I8FA 4KMGA 4WQDA 2KS1A 1BL9A 2Y0EA 1N90A 4FA5A 1KYOW 1IRWA 3ZOXA 4GYDA 1HRCA 4AALA 1N9CA 1C2NA 4YE1A 3MK7B 1L9BC 3TDKA 2LITA 4EICA 1CNOA 1OCDA 1CCHA 3L4MA 1M70A 2C1UA 3KHUA 1FHBA 3KZIV 1QKSA 1DIQC 1F1CA 1QL4A 2FRCA 2BGVX 3GW6A 1HCMA 3CU4A 1GJQA 1C6RA 5CICB 5TJHA 5B6QA 3O0RC 3BCCD 1A8CA 1GKSA 2JQRA 4A7PA 155CA 2BH4X 1CSVA 5GTHV 1E29A 3RN1A 1HH7A 2AI5A 3WFCC 2PCCB 1CYIA 4XYDB 2FWLA 5CIFB 1KV9A 1W5CT 1L9JC 2BH5X 2N3YA 1CSWA 5DJQC 3FWLA 2CXBA 1E2RA 4PD4D 1FI7A 4L3HA 3H1HD 2JWAA 1H9XA 4UB8V 3PHLA 1MG2D 2C1DA 1BE3D 5C0ZA 3VMAA 4FB1A 4NFGB 5DJQB 1EB7A 2N3BA 3HQ8A 4RJTA 1CTZA 1J3SA 1NTZD 1H31A 1RAPA 1I6DA 1C52A 1QL3A 5KLVD 2B4ZA 3OCDB 1LMSA 3OCDA 5KAFV 1LC1A 3OA8B 4IL6V 4FANA 1OAEA 2N9YB 1H33A 3WC8A 1CHHA 2ZXYA 5E79V 4WQCA 3PH2B 1PP9D 2FYNB 2D0SA 3A9FA 5B5EV 2QG4A 1NNOA 5TISV 3PXWA 5H2FV 2B12B 3WFEC 1YICA 1A2SA 2ZOOA 2OZ1B 1DW2A 5CIDB 1NTKD 2EXVA 1CORA 4FA4A 3H1LD 3NBTA 1COTA 3WFDC 2LIRA 3VYMA 3X39A 1CC5A 5CIHB 1HZVA 4PW9B 2QJYB 4LJIA 3PTZA 3TGUD 1NU1D 1I8PA 3H1ID 5CIEB 3ZBMA 1CRIA 1U75B 4U3FD 5KAIV 3ZOYA 1GQ1A 1CXAA 4H0JA 3GG2A 1KIBA 4H0KA 2B10B 4GEDB 1CIFA 2GC7D 1QYZA 1KX7A 4WQ9A 3HQ6A 4MU8A 1LFMA 1N50A 4V2KA 3CWBD 3NWVA 3TF5A 2C2CA 4J20A 1LC2A 3C2CA 2ORLA 3HQ9A 1ZZHA 1KX2A 1HZUA 2VHDA 4Y5RA 2MTAC 2C1VA 1KB9D 3A0BV 4UB6V 4K3IA 3SVWA 351CA 2RMZA 4WQAA 1AYGA 1CIHA 3DR0A 1AOFA 1DVVA 1I5TA 1MG3D 3VRDA 4AX3A 4EIEA 3CX5D 5B66V 2V08A 2YCCA 2L4DA 1C6OA 3RLMA 3WFBC 3DP5A 1PPJD 3DMIA 3L71D 3HQ7A 4O1QA 1CSXA 1CHIA 1I8OA 1DIIC 1I55A 2AIUA 1CRHA 2CE1A 3CXHD 3O5CA 1GDVA 1H9YA 1E8EA 1IO3A 1CEDA 1KB0A 1SQVD 3ZOWA 1I6EA 3JBTB 1NTMD 1U74B 3CYTI 3CXHW 3PXSA 2KNCB 4L1QA 5EXQA 4WQEA 2BCCD 1CIEA 3OA8A 4AANA 3M97X 1SQPD 3SLEA 1F1FA 3RMZA 1FCDC 2C8SA 1QN2A 2ZZS1 3L74D 1A56A 2Y0CA 2C9XB 2N18C 1AOQA 2OZ1A 1IZL0 4WQ8A 4FAVA 1DW1A 2HV4A 1BGYD 5C9MA 3NBSA 1NMIA 3L4OA 2N18B 1R0QA 1DW0A 2BPBB 2GB8B 3PXTA 1I54A 1CRCA 1L0ND 4PWAA 5DFSA 1ETPA 3A0HV 2PACA 1MZ4A 2AXTV 5AURA 4AAOA 4FA1A 2CA4B 1M60A 1YCCA 2D0WA 4JCGA 4EDFA 2Y0DA 1AKKA 3ITKA 2DGEA 5DF5A 1RAQA 1S5LV 2V07A 1C6SA 1C75A 1CHJA 5KKZB 1M6ZA 1P84D 4EIDA 1CRJA 1C7MA 1KYOD 1FJ0A 1SQBD 1CRGA 1FI9A 1CSUA 3TYIA 1YTCA 1IRVA 2A06D 2YQBA 3VNWA 1NIRA 2FYUD 1YEAA 3O20A 2B0ZB 3WU2V 4WQBA 1NMLA 1YEBA 1JDLA 3ZIYA 3RN0A 5CIBB 1C2RA 3PRJA 2GIWA 2XTSB 3L72D 5GTIV 4XXLA 2N9IA 5KLIB 1CRYA 1IQCA 2Q3EA 2JTIB 1YNRA 1CXCA 1HJ5A 3CX5W 1H32B 1H32A 1CIGA 4AAMA 1RZ5A 1CO6A 4DY9A 3L73D 1LS9A 1K3GA 1SQQD 4EIFA 2QJKB 1BCCD 1RZ6A 1CCRA 4RSZA 1SQXD 2O3JA 3H1KD 4PJ0V 1YFCA 3SXTA 2GC4D 3L75D 4P4QB 3L70D 4D6TD 4N0KA 1HJ3A 1S6VB 2CA3B 1WEJF 1N15A 2YK3A 2C1DB 1VYDA 1HJ4A 1CTYA 5CIGB 1GIWA 2QJPB 2ZBOA 1H1OA 2BLFB 4O1WA 2YIUB 1DT1A 1H31B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV D;  3ORV A;  4Q5P A;  1CTJ A;  3WUI A;  5CYT R;  451C A;  1H33 B;  2DVH A;  2RN0 A;  2PCB B;  3PLN A;  1CYJ A;  1FI3 A;  3H1J D;  3CP5 A;  1FOC A;  1HRO A;  2BCN B;  2L91 A;  3SJL A;  1L0L D;  1DW3 A;  2ZON G;  2MHM A;  3ZOO A;  2N9J A;  1WVE C;  4WQ7 A;  3O1Y A;  4FA9 A;  3ZCF A;  4L3G A;  1YIQ A;  1DVH A;  1CYC A;  1K3H A;  2CE0 A;  2IBZ D;  1GU2 A;  3MK7 C;  1ZRT D;  3SWS A;  2B11 B;  5IY5 1;  2K9J B;  1B7V A;  1W2L A;  4QAO A;  2I8F A;  4KMG A;  4WQD A;  2KS1 A;  1BL9 A;  2Y0E A;  1N90 A;  4FA5 A;  1KYO W;  1IRW A;  3ZOX A;  4GYD A;  1HRC A;  4AAL A;  1N9C A;  1C2N A;  4YE1 A;  3MK7 B;  1L9B C;  3TDK A;  2LIT A;  4EIC A;  1CNO A;  1OCD A;  1CCH A;  3L4M A;  1M70 A;  2C1U A;  3KHU A;  1FHB A;  3KZI V;  1QKS A;  1DIQ C;  1F1C A;  1QL4 A;  2FRC A;  2BGV X;  3GW6 A;  1HCM A;  3CU4 A;  1GJQ A;  1C6R A;  5CIC B;  5TJH A;  5B6Q A;  3O0R C;  3BCC D;  1A8C A;  1GKS A;  2JQR A;  4A7P A;  155C A;  2BH4 X;  1CSV A;  5GTH V;  1E29 A;  3RN1 A;  1HH7 A;  2AI5 A;  3WFC C;  2PCC B;  1CYI A;  4XYD B;  2FWL A;  5CIF B;  1KV9 A;  1W5C T;  1L9J C;  2BH5 X;  2N3Y A;  1CSW A;  5DJQ C;  3FWL A;  2CXB A;  1E2R A;  4PD4 D;  1FI7 A;  4L3H A;  3H1H D;  2JWA A;  1H9X A;  4UB8 V;  3PHL A;  1MG2 D;  2C1D A;  1BE3 D;  5C0Z A;  3VMA A;  4FB1 A;  4NFG B;  5DJQ B;  1EB7 A;  2N3B A;  3HQ8 A;  4RJT A;  1CTZ A;  1J3S A;  1NTZ D;  1H31 A;  1RAP A;  1I6D A;  1C52 A;  1QL3 A;  5KLV D;  2B4Z A;  3OCD B;  1LMS A;  3OCD A;  5KAF V;  1LC1 A;  3OA8 B;  4IL6 V;  4FAN A;  1OAE A;  2N9Y B;  1H33 A;  3WC8 A;  1CHH A;  2ZXY A;  5E79 V;  4WQC A;  3PH2 B;  1PP9 D;  2FYN B;  2D0S A;  3A9F A;  5B5E V;  2QG4 A;  1NNO A;  5TIS V;  3PXW A;  5H2F V;  2B12 B;  3WFE C;  1YIC A;  1A2S A;  2ZOO A;  2OZ1 B;  1DW2 A;  5CID B;  1NTK D;  2EXV A;  1COR A;  4FA4 A;  3H1L D;  3NBT A;  1COT A;  3WFD C;  2LIR A;  3VYM A;  3X39 A;  1CC5 A;  5CIH B;  1HZV A;  4PW9 B;  2QJY B;  4LJI A;  3PTZ A;  3TGU D;  1NU1 D;  1I8P A;  3H1I D;  5CIE B;  3ZBM A;  1CRI A;  1U75 B;  4U3F D;  5KAI V;  3ZOY A;  1GQ1 A;  1CXA A;  4H0J A;  3GG2 A;  1KIB A;  4H0K A;  2B10 B;  4GED B;  1CIF A;  2GC7 D;  1QYZ A;  1KX7 A;  4WQ9 A;  3HQ6 A;  4MU8 A;  1LFM A;  1N50 A;  4V2K A;  3CWB D;  3NWV A;  3TF5 A;  2C2C A;  4J20 A;  1LC2 A;  3C2C A;  2ORL A;  3HQ9 A;  1ZZH A;  1KX2 A;  1HZU A;  2VHD A;  4Y5R A;  2MTA C;  2C1V A;  1KB9 D;  3A0B V;  4UB6 V;  4K3I A;  3SVW A;  351C A;  2RMZ A;  4WQA A;  1AYG A;  1CIH A;  3DR0 A;  1AOF A;  1DVV A;  1I5T A;  1MG3 D;  3VRD A;  4AX3 A;  4EIE A;  3CX5 D;  5B66 V;  2V08 A;  2YCC A;  2L4D A;  1C6O A;  3RLM A;  3WFB C;  3DP5 A;  1PPJ D;  3DMI A;  3L71 D;  3HQ7 A;  4O1Q A;  1CSX A;  1CHI A;  1I8O A;  1DII C;  1I55 A;  2AIU A;  1CRH A;  2CE1 A;  3CXH D;  3O5C A;  1GDV A;  1H9Y A;  1E8E A;  1IO3 A;  1CED A;  1KB0 A;  1SQV D;  3ZOW A;  1I6E A;  3JBT B;  1NTM D;  1U74 B;  3CYT I;  3CXH W;  3PXS A;  2KNC B;  4L1Q A;  5EXQ A;  4WQE A;  2BCC D;  1CIE A;  3OA8 A;  4AAN A;  3M97 X;  1SQP D;  3SLE A;  1F1F A;  3RMZ A;  1FCD C;  2C8S A;  1QN2 A;  2ZZS 1;  3L74 D;  1A56 A;  2Y0C A;  2C9X B;  2N18 C;  1AOQ A;  2OZ1 A;  1IZL 0;  4WQ8 A;  4FAV A;  1DW1 A;  2HV4 A;  1BGY D;  5C9M A;  3NBS A;  1NMI A;  3L4O A;  2N18 B;  1R0Q A;  1DW0 A;  2BPB B;  2GB8 B;  3PXT A;  1I54 A;  1CRC A;  1L0N D;  4PWA A;  5DFS A;  1ETP A;  3A0H V;  2PAC A;  1MZ4 A;  2AXT V;  5AUR A;  4AAO A;  4FA1 A;  2CA4 B;  1M60 A;  1YCC A;  2D0W A;  4JCG A;  4EDF A;  2Y0D A;  1AKK A;  3ITK A;  2DGE A;  5DF5 A;  1RAQ A;  1S5L V;  2V07 A;  1C6S A;  1C75 A;  1CHJ A;  5KKZ B;  1M6Z A;  1P84 D;  4EID A;  1CRJ A;  1C7M A;  1KYO D;  1FJ0 A;  1SQB D;  1CRG A;  1FI9 A;  1CSU A;  3TYI A;  1YTC A;  1IRV A;  2A06 D;  2YQB A;  3VNW A;  1NIR A;  2FYU D;  1YEA A;  3O20 A;  2B0Z B;  3WU2 V;  4WQB A;  1NML A;  1YEB A;  1JDL A;  3ZIY A;  3RN0 A;  5CIB B;  1C2R A;  3PRJ A;  2GIW A;  2XTS B;  3L72 D;  5GTI V;  4XXL A;  2N9I A;  5KLI B;  1CRY A;  1IQC A;  2Q3E A;  2JTI B;  1YNR A;  1CXC A;  1HJ5 A;  3CX5 W;  1H32 B;  1H32 A;  1CIG A;  4AAM A;  1RZ5 A;  1CO6 A;  4DY9 A;  3L73 D;  1LS9 A;  1K3G A;  1SQQ D;  4EIF A;  2QJK B;  1BCC D;  1RZ6 A;  1CCR A;  4RSZ A;  1SQX D;  2O3J A;  3H1K D;  4PJ0 V;  1YFC A;  3SXT A;  2GC4 D;  3L75 D;  4P4Q B;  3L70 D;  4D6T D;  4N0K A;  1HJ3 A;  1S6V B;  2CA3 B;  1WEJ F;  1N15 A;  2YK3 A;  2C1D B;  1VYD A;  1HJ4 A;  1CTY A;  5CIG B;  1GIW A;  2QJP B;  2ZBO A;  1H1O A;  2BLF B;  4O1W A;  2YIU B;  1DT1 A;  1H31 B; 
#chains in the Genus database with same CATH topology
 1EZV D;  1VQO P;  1CTJ A;  3WUI A;  4RES B;  451C A;  2IYP A;  3B5N C;  4JPZ B;  2IZ1 A;  1CYJ A;  3OA7 A;  1FI3 A;  2A06 G;  5AVR B;  3CP5 A;  3HE4 B;  2BCN B;  1HRO A;  1LWU B;  1L0L D;  2WVR A;  1T3U A;  2D2C C;  1WVE C;  3O1Y A;  4YXW H;  5M1B A;  2WSF J;  3RL0 C;  4OH8 B;  4L75 A;  3AEA C;  1QX8 A;  4DOJ A;  1QGK B;  1SQQ E;  2Y9Z A;  1N73 B;  5IY5 1;  1BCC E;  1SFC B;  2ZJS E;  4CPG A;  3H1K E;  3V2P A;  4WY4 D;  5E79 H;  1HRC A;  3W67 A;  1N9C A;  2CK3 H;  2V4H A;  3M9H A;  3L73 G;  4D6T E;  3TDK A;  5CCH C;  4Y99 B;  2LIT A;  3GHG B;  2N1T C;  1CCH A;  3T97 B;  3KZI V;  1XTG B;  1FOS F;  1QL4 A;  3GW6 A;  1KV4 A;  5CIC B;  5B6Q A;  1IZN B;  1N86 A;  4JYB A;  4A7P A;  155C A;  3H6P A;  2BH4 X;  3RN1 A;  4OGQ D;  4BRY A;  2HOD B;  3RK3 E;  3H1J E;  1S5L H;  3WFC C;  4LGD E;  1CYI A;  4L74 A;  2XND H;  2UWJ E;  1L4A A;  2IZ0 A;  3SSU A;  3W68 A;  3FWL A;  5GTI E;  1GDT A;  1JY3 O;  3G4S P;  5AVT B;  1FI7 A;  1T3J A;  2WT7 B;  2C1D A;  2H89 C;  4KHX A;  2WPV B;  1LT9 A;  2XV5 A;  1ZRT E;  1CI6 A;  1SLQ A;  1CTZ A;  1J3S A;  1M1K Q;  1H31 A;  1RAP A;  3WUU A;  4WBA A;  1C52 A;  3AE8 C;  3KPE A;  3D0W A;  2QSI A;  2C9L Y;  1OZH A;  5KLV K;  3OA8 B;  1JNM A;  1CHH A;  5E79 V;  3VN0 A;  4WQC A;  1HBW A;  1PP9 D;  3A9F A;  3PXW A;  5H2F V;  2E74 B;  2JDI H;  2XZR A;  2B12 B;  3HE4 A;  1T2K D;  3WFE C;  1A2S A;  1NKZ B;  1DW2 A;  5CID B;  4NPE A;  2H7H A;  4C7N B;  1COT A;  1IK7 A;  1NU1 J;  1CC5 A;  1GL2 D;  3JC2 2;  1VQ6 P;  1GW3 A;  1EDJ A;  1Y47 A;  1IJD B;  1RF0 A;  3TYY A;  1OXZ A;  4B86 A;  3TGU D;  3CI9 A;  4AQR D;  3HUS B;  1Y9B A;  2QRX A;  4AUW A;  1ZN5 A;  2KIK A;  2PGD A;  2D2C B;  1KQG B;  1URQ C;  4H0J A;  3M0A A;  1SFC A;  1L0N K;  1DD4 A;  2WSC J;  3NTN A;  2Q6Q A;  4K3A A;  1KMI Z;  1GTW A;  3BCC G;  1KX7 A;  4WQ9 A;  3HQ6 A;  1RE3 A;  1VQ4 P;  2K37 A;  3CWB D;  1HWT C;  3EFG A;  2C2C A;  1NVO A;  4J20 A;  3H25 A;  3HE5 A;  3C2C A;  3GHG A;  1SQB K;  1KX2 A;  2Q3I A;  2OYH C;  1KB9 D;  3BCC J;  3NMD A;  2B88 A;  2A45 H;  3VRD A;  4EIE A;  1JY3 P;  3CX5 D;  4H0L B;  3CCV P;  2QVA A;  4WB4 A;  1E79 H;  1VQP P;  2XU6 A;  1AQ5 A;  1R8E A;  1W2E A;  1VQ8 P;  2I1K A;  4XA4 A;  2ZAE B;  1KFN A;  1PPJ D;  2HOD A;  5KLV G;  2FFD C;  3PP5 A;  3AE4 C;  2K88 A;  1N7S D;  1Q90 D;  1S4X A;  2HFE D;  3H1L E;  1U7J A;  1CSX A;  3LID A;  3A0B E;  3GF3 A;  1I55 A;  3Q5R A;  1IO4 A;  1VF5 B;  4PD4 I;  3O5C A;  2WT7 A;  1NU1 E;  1KIL B;  1KD1 Q;  1CED A;  1VQ5 P;  1Y8A A;  1KB0 A;  1SQV D;  1K04 A;  2DW3 A;  1NTM K;  3WMM 0;  1IFN A;  2BCC D;  2E5Y A;  4H13 D;  2KI7 B;  5GTI H;  1IK9 A;  2W27 A;  3OA8 A;  1JUN A;  3M97 X;  3EWK A;  5AW8 B;  1FZC B;  1F1F A;  4O9B A;  3RMZ A;  2WSF H;  1QN2 A;  1NH4 A;  2ZZS 1;  1ZR4 A;  4GKG A;  3U59 A;  1S9K E;  2C9X B;  4UB8 E;  1AOQ A;  3S4R A;  4C7N A;  2NPS D;  2PAJ A;  4N78 E;  3MD0 A;  3G9R A;  1RY3 A;  5CCG A;  1FBM A;  4JQ0 D;  4PJ0 H;  3NBS A;  1L0N J;  3SFD C;  1R0Q A;  1N2D C;  3PJS K;  3O6Q B;  1J1D C;  4IL6 X;  4PWA A;  1IFD A;  2N9B A;  2JP3 A;  4AAO A;  4FA1 A;  1GZL A;  1L0L K;  1NAY A;  1YCC A;  4JCG A;  1AKK A;  2POH A;  2GUS A;  2BEZ F;  1SQB J;  1LTJ A;  5EFW B;  1C75 A;  1CHJ A;  1URQ B;  5KKZ B;  1M57 D;  5AW7 B;  1MFZ A;  1CRJ A;  2R5B A;  4PD4 E;  1FJP A;  5BVZ A;  1BDD A;  1CRG A;  1CSU A;  3AEB C;  3U1A A;  3L71 G;  1GK6 A;  3VNW A;  1NIR A;  2FYU D;  1YEA A;  3O20 A;  5APY A;  4WQB A;  3V2R A;  1OW7 A;  3B4S A;  1G1I A;  3ZIY A;  1ZOY C;  1JEK A;  3GMA A;  3L72 J;  2OYH B;  3A3Y B;  3HD7 A;  3B5N D;  2O01 N;  3PH0 A;  3PRJ A;  3L71 J;  2WSE J;  2XTS B;  3II6 A;  5GTI V;  4XXL A;  1NTM G;  1PL5 A;  2Q3E A;  1NKN A;  1GD2 E;  1RZ5 A;  3P32 A;  3CC4 P;  3JSV C;  3OW2 O;  1IFP A;  1NJI Q;  1SQP G;  2HLO A;  4UB6 E;  3RL0 D;  1K3G A;  2FXO A;  5CBN A;  4EIF A;  1K05 A;  1SQQ K;  1VQ7 P;  1H89 A;  3L74 G;  3L75 J;  1NTM J;  3P8C E;  3LIE A;  3VYI A;  1SQX D;  4PJ0 V;  1L0N E;  1YFC A;  1LT9 C;  5B66 E;  3VOP A;  4P4Q B;  1H88 A;  4IFD K;  3I56 P;  4JYC A;  3L70 D;  4N0K A;  2CA3 B;  2YK3 A;  1P84 E;  1DEE G;  4GOF A;  1SQB E;  2ZVO B;  2QJP B;  3L74 J;  2C0W A;  1H1O A;  2YIU B;  2N1T D;  1M1J B;  2OYO A;  4Q5P A;  1Z56 A;  1LWU C;  5AVY B;  1USD A;  3R4Y A;  5DJU B;  2E75 B;  1JMM A;  3MP7 B;  3CL3 D;  2WSC H;  1L0L J;  5AVU B;  2GA1 A;  1RF0 C;  3SJL A;  3L72 E;  4JBZ A;  2MHM A;  1FDM A;  3ZOO A;  3L71 E;  2N9J A;  4UB8 H;  2C0X A;  1NO4 A;  1SFC C;  4L3G A;  1E5W A;  3A7O A;  1RE3 C;  2IBZ D;  3RGU A;  3SWS A;  2B11 B;  1KYO I;  4M3L A;  1B7V A;  1W2L A;  4N6J A;  2KZI A;  2KS1 A;  3AEG C;  3GHG C;  1JB0 J;  1KQF B;  2Y0E A;  1KYO W;  2AEF A;  1RH5 B;  4GYD A;  1NTM E;  3L75 E;  4AAL A;  1CZQ A;  3HRN A;  3MK7 B;  1SQQ G;  3KQG A;  1BCC G;  4PD4 H;  3L4M A;  2C1U A;  3KHU A;  1FHB A;  3H1K G;  3IFM A;  1RHZ B;  1JOC A;  1DIQ C;  4LLH A;  2A45 G;  3ABV C;  3CCR P;  4D6T G;  2FRC A;  2BGV X;  5AW5 B;  1DEB A;  4HJG H;  2C9N Y;  1EZV E;  1HCM A;  1GJQ A;  1C6R A;  2XNX A;  3P7K A;  1SQQ J;  1T8Z A;  3O0R C;  1BCC J;  3AE1 C;  4N3Y B;  1E29 A;  4BRY B;  4YTP C;  2PCC B;  4XYD B;  2FWL A;  1L0L E;  1L4A B;  1URQ D;  3RK3 B;  1KV9 A;  4BXL A;  3Q5P A;  5CMZ A;  1L9J C;  1JTH B;  2BH5 X;  2N3Y A;  2KLV A;  4OWF A;  1CSW A;  4EIJ A;  1FZG A;  2A45 I;  3MHV A;  2JJL A;  2HR3 A;  1FS0 E;  3GF7 A;  4L3H A;  4W7Y A;  3H1J G;  4UB6 H;  3H1H D;  2JWA A;  1H9X A;  4UB8 V;  3PHL A;  5AVQ B;  1MG2 D;  1LT9 B;  3B71 A;  1BE3 D;  1KYO E;  1FU1 A;  3VMA A;  3M06 A;  2P7J A;  4ASV A;  5DJQ B;  3CME P;  3HQ8 A;  1USE A;  1SVF A;  1LTI C;  3IR9 A;  1M1J A;  3ZDM A;  5B66 H;  1NTZ K;  2E74 C;  5KAF V;  1LC1 A;  3VMX A;  3V4Q A;  1PP9 J;  3M9B A;  3RK2 B;  2B9B A;  3H1J J;  4WY4 A;  2ZXY A;  4WVZ A;  3Q5S A;  2FYN B;  2R32 A;  1OVV A;  5B5E V;  1HGZ A;  5CCG C;  3AEF C;  3BRT B;  3IN6 A;  3KXD A;  3JCU E;  3HUS C;  1NTK D;  2WIT A;  3OJA B;  3NBT A;  3WFD C;  2LIR A;  1KOR A;  3X39 A;  1VL2 A;  3TGU J;  4PW9 B;  3QWO C;  1NWQ A;  2QJY B;  3H1I D;  4ZKU A;  1QLE D;  1LTJ C;  2WWW A;  2K9Y A;  4U3F D;  1NU1 K;  3GG2 A;  4IL6 E;  1DD3 A;  3Q3D A;  2J58 A;  1YIJ P;  1Q81 Q;  3CWB J;  2WSE H;  5TIS E;  2ZYG A;  3K5B A;  2QM8 A;  1AJY A;  3NWV A;  3TF5 A;  3A5T A;  2L5G B;  2KK7 A;  3HE5 B;  1X79 B;  2O01 J;  2ORL A;  1ZZH A;  4Y5R A;  3HD7 C;  4UB6 V;  4H0L C;  1NAF A;  351C A;  3D71 A;  2QEX P;  1AYG A;  5KAI E;  1CIH A;  1H0T B;  1AOF A;  1AV1 A;  3RBZ A;  5KLI C;  1W5C E;  1R5S A;  3H32 A;  5APV A;  5B66 V;  1JY3 N;  2YCC A;  2L4D A;  1PP9 E;  1FZB A;  1NTZ G;  4WWI A;  3Q2Y A;  1BDC A;  1VF5 C;  2CPS A;  2KLU A;  1KIL C;  1YIT P;  2PFX A;  4O1Q A;  3MTU E;  1FZF A;  2E42 A;  1JTH A;  1CHI A;  1I8O A;  1A02 J;  2AIU A;  2CE1 A;  3CXH D;  3O8Z A;  3WU2 H;  3TGU E;  1AVY A;  4HKZ H;  1NTZ J;  3KDP B;  1I6E A;  3JBT B;  3H1L G;  1RQV A;  1SQX K;  3CYT I;  5AW1 B;  1FZC C;  2BCC J;  4YXD C;  4PV1 D;  3CC2 P;  2FKW B;  2M0B A;  1OFC X;  1KZU B;  5EXQ A;  1NU1 G;  2FXM A;  1J1E B;  2IPP A;  3CWB E;  3CCE P;  2LKM A;  4ZNC A;  3TK1 A;  1KYO H;  1ZW0 A;  3H1L J;  1KB9 E;  1A56 A;  1N8R Q;  1X8Y A;  4EOT A;  1IZL 0;  2FXP A;  2AXC A;  4WQ8 A;  2HV4 A;  1BGY D;  3UIA A;  2ITA A;  3FXD A;  3CX5 E;  1NMI A;  3PXT A;  2SPZ A;  2AEM A;  5AW2 B;  5KKZ C;  2YKO A;  1PPJ E;  1MZ4 A;  5AUR A;  3BAT A;  2HPC A;  4EDF A;  3JCU H;  3S9O A;  4K35 A;  1T6A A;  1LTJ B;  1S5L V;  1C6S A;  1M6Z A;  5APS A;  4EID A;  1N7S A;  1C7M A;  1RQU A;  2ZT9 D;  4HYT B;  2FYU J;  5AVZ B;  2J5U A;  1GU5 A;  2XKM A;  2A06 D;  4IL6 H;  1K9M Q;  1SQV E;  3WU2 V;  2FBW C;  1JO5 A;  1NML A;  1NTZ E;  1NOH A;  1H0T A;  4GDO A;  3A0H E;  2AXT E;  5CIB B;  3HD7 B;  2BCC E;  1C2R A;  1LJ2 A;  1YJ9 P;  1HJB A;  1BSH A;  1RF1 A;  4IFF A;  2NRG A;  5KLI B;  1FZA A;  3AE6 C;  2JTI B;  1CXC A;  4H44 B;  5AW6 B;  4ZKP A;  2JEE A;  4KT0 J;  1CO6 A;  5KAI H;  2E76 B;  1KN7 A;  1SS1 A;  5CJ4 A;  1YTZ I;  3L73 D;  1SFC D;  1SQX J;  2NPS A;  2IDB A;  1FE6 A;  4AYC A;  1RZ6 A;  3HTK A;  2B87 A;  3IF4 A;  3G6E P;  2GC4 D;  3AE9 C;  2IX7 C;  2QJP C;  2YIU C;  1PV3 A;  1S6V B;  2Q5U A;  4BWN A;  1N15 A;  1M1J C;  2M8R A;  3L35 A;  2JO1 A;  1L0N G;  1GIW A;  2WSS H;  4WY4 C;  2AEJ A;  2BLF B;  1RE4 A;  2PP6 A;  2E75 C;  2ZXE B;  1IFM A;  3KYQ A;  1YJN P;  3D6Z A;  1NHL A;  3ORV A;  2HG5 D;  2FYU E;  2WZ7 A;  2E5T A;  3VMY A;  2KYV A;  5DJT B;  1SQB G;  2DVH A;  1YI2 P;  1ZV8 A;  1QVG O;  2R5D A;  3CPW O;  1FOC A;  1JY2 O;  2L91 A;  1LP1 A;  4L73 A;  1ZP0 C;  3RBX A;  1DW3 A;  2E43 A;  3LW5 J;  1AQT A;  2O01 H;  1NTK K;  4FA9 A;  2P58 A;  2VRS A;  2KZJ A;  1DVH A;  4OGQ C;  4NPF X;  1QVF O;  1K3H A;  3L72 G;  4C7R A;  2CE0 A;  2KOG A;  1P84 I;  1GU2 A;  3MK7 C;  3CX5 H;  3AE2 C;  2K9J B;  4JF7 A;  2IBZ I;  4QAO A;  2Q1K A;  2RKL A;  1JCD A;  4WQD A;  1D7M A;  2KS1 B;  2BEQ D;  2R44 A;  1SQX E;  3M9Q A;  3D70 A;  4FA5 A;  1ZXG A;  1IRW A;  2P10 A;  1LGH B;  4XE5 B;  3AED C;  3L70 E;  3AE5 C;  4DJG A;  2E74 D;  2G3A A;  1KQS O;  3D6Y A;  1OCD A;  1M70 A;  5KJ7 A;  2WMM A;  1QKS A;  3CCL P;  1FJK A;  4ASW A;  1LT1 A;  1ZR2 A;  3L75 G;  5CCG D;  3BRV B;  3F5H A;  3CU4 A;  2OQQ A;  1UII A;  2D2C D;  3BCC D;  1L4A C;  1A8C A;  3RK3 C;  4RO0 A;  1J2J B;  2JQR A;  1CSV A;  4R4L A;  1HH7 A;  2AI5 A;  2MJZ A;  1QL2 A;  1EZV G;  2JR8 A;  1DX7 A;  2MKV A;  5AVV B;  3KZI E;  3N7N A;  5DJQ C;  3E7K A;  3H1H J;  3QH9 A;  2CXB A;  1E2R A;  4PD4 D;  1WMK A;  4Y28 J;  4TLF A;  1SP4 A;  3A0B H;  5APT A;  2OYI B;  5CCH D;  5C0Z A;  1L0L G;  2IBZ E;  3RK2 C;  4I7Z B;  1GU4 A;  1JY2 P;  4RJT A;  1AA0 A;  1I6D A;  5KLV D;  2FYN C;  2YKP A;  4H0L D;  3AE3 C;  3OCD A;  2V7Q J;  1EZV I;  4DCK A;  2YMK A;  2YNY A;  4FAN A;  4WY4 B;  3WUV A;  2N9Y B;  2ZYD A;  2D0S A;  3USS A;  1NTK J;  2QG4 A;  3FWN A;  1L2P A;  2QJY C;  1G1J A;  1YIC A;  2ZOO A;  2OTJ P;  2EXV A;  4FA4 A;  3VYM A;  1VF5 D;  3H1I J;  1HZV A;  1KIL D;  3SWF A;  4LJI A;  3PTZ A;  1I8P A;  3GLM A;  3P8M C;  3I55 P;  3P8C D;  2JWD A;  3ZOY A;  1CXA A;  2OAR A;  2K9J A;  3R2P A;  2W6J H;  1GMJ A;  1Q7Y Q;  2I1J A;  4OGQ B;  3C1L A;  1CIF A;  1W2B O;  3C8V A;  1QYZ A;  5H2F E;  1LFM A;  3S1K A;  1N50 A;  4V2K A;  1DH3 A;  2LXC B;  3Q1M A;  3H1H E;  1LC2 A;  3HQ9 A;  2MTA C;  1BE3 E;  2M3E A;  3A0B V;  1YTZ T;  2RMZ A;  1S2E A;  1RF1 C;  3DR0 A;  1X9V A;  1I5T A;  4RKU J;  1EDK A;  4AX3 A;  3H32 B;  4OVN F;  1CW5 A;  3CCU P;  1EC5 A;  2V08 A;  3EFF K;  1IFI A;  3RLM A;  3DP5 A;  1UIX A;  3DMI A;  3L71 D;  1VQK P;  2O1J A;  1NTK E;  1OWA A;  1M56 D;  1PP9 G;  1CRH A;  1S1C X;  1FAV A;  1GL2 B;  2W6A A;  3H1I E;  2OYI A;  1FOS E;  1IO3 A;  3CXH I;  1Q2N A;  4U3F E;  4W80 A;  3MGN A;  1J1E C;  5AVW B;  1VPC A;  3IAO A;  1NTM D;  1U74 B;  1SQV K;  2P2U A;  3CXH W;  2KUB A;  3V5B A;  5GTH E;  2KNC B;  1IC2 A;  4L1Q A;  3TGU G;  4WQE A;  1CIE A;  4AAN A;  5CHX A;  3M91 A;  2QIW A;  3LW5 H;  1SQP D;  3B8E B;  1P84 H;  1K8A Q;  1FCD C;  1OX3 A;  2RH0 A;  3L74 D;  3E1R A;  3VP9 A;  1YQ3 C;  1BGY J;  1AFO A;  3AE7 C;  1FDI A;  3CWB G;  2KB7 P;  5C9M A;  1U57 A;  1MKM A;  2N18 B;  1DW0 A;  2BPB B;  2GB8 B;  2LXB A;  1I54 A;  1YHQ P;  1X22 A;  2HPC B;  3SFE C;  2CA4 B;  2M5A A;  2Y0D A;  3CD6 P;  3ITK A;  4L76 A;  2V07 A;  1N7S B;  2W90 A;  1KYO D;  5KTB A;  2W8Z A;  1YTC A;  1PPJ G;  3CXH E;  3CMA P;  4I1L A;  3NXS A;  2YQB A;  1HTL C;  4R4M A;  1TU3 F;  1OW6 A;  5KJ7 C;  3CC7 P;  1HVV A;  1KB9 I;  4GOE A;  2E75 D;  1WRG A;  2FYU K;  2M3B A;  1JDL A;  4HH2 A;  2ZFC A;  5H2F H;  1R5L A;  4IOI H;  1WT6 A;  4H44 C;  2YXQ B;  2GIW A;  1SQV G;  4H13 B;  2E76 C;  3CX5 I;  1RF1 B;  1IQC A;  3L36 A;  1HJ5 A;  3CX5 W;  1FDO A;  5AW3 B;  2JKV A;  2BCC G;  1H32 A;  1CIG A;  4AAM A;  3L73 J;  2HYN A;  3BVH A;  1MUU A;  4DY9 A;  2Z5I A;  2NPS B;  1LS9 A;  1SQQ D;  1BGY E;  4EYY Q;  1SQV J;  2QJK B;  1BCC D;  2O1K A;  1GL2 A;  3FGA D;  2V7Q H;  3HTK B;  1KFM A;  2P1J A;  1PGP A;  4RSZ A;  2B87 B;  2GUV A;  2O3J A;  3H1K D;  3CLQ A;  4ZMD A;  1VDF A;  3C9I A;  4D6T D;  2P67 A;  1HF9 A;  1IFJ A;  2PRR A;  2KNC A;  3TNU A;  1WEJ F;  1GK4 A;  1YQ4 C;  3MIW A;  3F89 A;  1M8O B;  1HJ4 A;  1CTY A;  5CIG B;  1DT1 A;  2YKQ A;  2YO2 A;  2A06 E;  3SWK A;  2ZVN B;  5CYT R;  5GTH H;  2Z4E A;  5AVS B;  4PJ0 E;  1H33 B;  2RN0 A;  2PCB B;  3PLN A;  2WPR A;  4YPC A;  1L4A D;  3RK3 D;  5APQ A;  3H1J D;  1JCC A;  2FYU G;  1LP1 B;  3B5N B;  4DT0 A;  1LWU A;  2ZON G;  2QM7 A;  1LNQ A;  4WQ7 A;  3ZCF A;  1YIQ A;  1CYC A;  3V4W A;  3L73 E;  2YMY A;  4GIF A;  1ZRT D;  1N73 A;  3RL0 B;  2I8F A;  4KMG A;  1K73 Q;  1BL9 A;  1N90 A;  3RK2 D;  3ZOX A;  1EDL A;  1C2N A;  4YE1 A;  1DIP A;  1L9B C;  4EIC A;  5TIS H;  1CNO A;  3N4X A;  2ZXX A;  2NZ2 A;  1SQX G;  3T97 A;  1S5L X;  3CXH H;  4I6M C;  1F1C A;  1G2C B;  3V2N A;  1JM0 A;  3L70 G;  1HH0 A;  2KXP B;  2FY8 A;  3BAS A;  1OVR A;  2N1T B;  1BSN A;  1Q86 Q;  4I2L C;  5TJH A;  3MUD A;  4U7J A;  1GKS A;  1VQ9 P;  2Y9Y A;  5GTH V;  1CSB A;  2GM4 A;  3L70 J;  5CIF B;  2OYI C;  1W5C T;  4I7Z C;  2H43 A;  1X0T A;  4GOD A;  2H8P D;  3M0D A;  5AW4 B;  2LR2 A;  4QMA A;  3AEE C;  4FB1 A;  5APU A;  1HJ0 A;  5KLV J;  4NFG B;  1EB7 A;  2N3B A;  1LTG C;  4TT3 H;  3RL0 g;  1NTZ D;  1JY2 N;  1QL3 A;  2B4Z A;  3OCD B;  1FC2 C;  1LMS A;  3V2Q A;  4IL6 V;  1OAE A;  2IBZ G;  2WPQ A;  2KSJ A;  1H33 A;  3WC8 A;  3PH2 B;  2OGU A;  1EQ7 A;  1SQP K;  1VQN P;  1NNO A;  5TIS V;  3OAK A;  1A02 F;  4MN4 C;  2OZ1 B;  3B5N A;  1COR A;  3H1L D;  2FYZ A;  1QL1 A;  1KB9 H;  2KSE A;  2YXR B;  1HGV A;  3VTP C;  5CIH B;  2QA4 P;  1PZQ A;  1NU1 D;  3BCC E;  1KTM A;  5CIE B;  3ZBM A;  1CRI A;  1OMI A;  3HUS A;  1U75 B;  5KAI V;  5KAF E;  1GQ1 A;  2H88 C;  3TSI A;  2W83 C;  4IFM A;  4XFJ A;  1KC8 Q;  1KIB A;  4H0K A;  2B10 B;  4GED B;  1VQL P;  2G8Y A;  5B5E E;  2GC7 D;  1M90 Q;  2Q9I A;  3EQ2 A;  4MU8 A;  1MV8 A;  1EXI A;  3AEC C;  2W6B A;  1ZLL A;  1HZU A;  2VHD A;  1YYC A;  2C1V A;  4PV1 C;  5C39 A;  1S9K D;  5BU8 B;  4K3I A;  3SVW A;  1YBK A;  1G2C A;  4WQA A;  3V6I A;  1N7L A;  2XDJ A;  5CCH A;  3FX0 A;  5APX A;  2R3C A;  4N78 D;  5KLV E;  1DVV A;  1MG3 D;  2N1T A;  3H1H G;  3CCM P;  4NPD A;  5AVX B;  1BE3 G;  1Q82 Q;  3A0H H;  2KP8 A;  2AXT H;  1U7M A;  1T2K C;  1C6O A;  3WFB C;  1FZE A;  3WUT A;  2K1A A;  1EXJ A;  1YJW P;  1OVU A;  1LTA C;  1GL2 C;  2I8D A;  2R3S A;  2B89 A;  3HQ7 A;  1MZ9 A;  3SWY A;  3VMZ A;  1DII C;  2OTK E;  1BE3 J;  1KIL E;  2FFD B;  2Q7C A;  2OTL P;  1NGM B;  1GDV A;  1H9Y A;  1ZME C;  1E8E A;  1MFT A;  1KIL A;  2ZYA A;  4LC1 A;  3ZOW A;  1NTK G;  5L8R J;  1PFI A;  1PGJ A;  3PXS A;  3HD7 D;  3NFQ A;  5KJ7 D;  2ZT9 C;  1SQP J;  3H1I G;  3MZW B;  4U3F G;  3SLE A;  1KQL A;  1PGO A;  1NYH A;  1EDI A;  1FZC A;  4H44 D;  5AW9 B;  2C8S A;  1LTT C;  1GW4 A;  2E76 D;  3FXE A;  1OW8 A;  2Y0C A;  2N18 C;  2WQY C;  2OZ1 A;  2BAS A;  5CBO A;  2IYO A;  4FAV A;  1DW1 A;  1OIP A;  4HB1 A;  4U3F J;  5APW A;  5BU5 A;  3L4O A;  4W7Z A;  1XTC C;  3E1I A;  1N7S C;  1CRC A;  1L0N D;  5DFS A;  1ETP A;  3O6Q A;  3CCS P;  3A0H V;  2PAC A;  2AXT V;  2M5A B;  5E79 E;  1N73 C;  1M60 A;  2D0W A;  1QEX A;  2WTY A;  2DGE A;  5DF5 A;  1RAQ A;  3G3Z A;  1J1D B;  1P84 D;  1URQ A;  1FJ0 A;  1SQB D;  4EI2 A;  1FI9 A;  3TYI A;  1IRV A;  1H8A A;  2YO3 A;  4Y99 C;  2J59 M;  3CCJ P;  5KAF H;  1S3J A;  3CCQ P;  3I5C A;  2B0Z B;  2CPB A;  4H13 C;  1YEB A;  4Z1M H;  1VQM P;  1LTB C;  5B5E H;  3RN0 A;  1AVO A;  4PV1 B;  2OYH A;  1HUC A;  1S72 P;  2WPS A;  3MUD C;  1SQP E;  1S5L E;  3L72 D;  3L37 A;  2N9I A;  1CRY A;  2NPS C;  1YNR A;  3L4F A;  2QJK C;  3L74 E;  3U1C A;  1H32 B;  2K3R A;  5CJ0 A;  1LTS C;  5K5G B;  3VP8 A;  3WU2 E;  4GT1 A;  2Z5H A;  3H1K J;  2FFD A;  1JMB A;  3M0D C;  1CCR A;  2IFM A;  1PGQ A;  4D6T J;  3SXT A;  3L75 D;  4DZO A;  1RE4 C;  2IFN A;  3A2A A;  1BGY G;  1HJ3 A;  3TNU B;  3KZI H;  3G71 P;  2C1D B;  1VYD A;  2QE7 H;  1M7L A;  5AW0 B;  4C46 A;  1CI6 B;  2ZBO A;  1PIX A;  4O1W A;  2ZT9 B;  1H31 B;  4KJM A; 
#chains in the Genus database with same CATH homology
 1EZV D;  3ORV A;  4Q5P A;  1CTJ A;  3WUI A;  5CYT R;  451C A;  1H33 B;  2DVH A;  2RN0 A;  2PCB B;  3PLN A;  1CYJ A;  1FI3 A;  3H1J D;  3CP5 A;  1FOC A;  1HRO A;  2BCN B;  2L91 A;  3SJL A;  1L0L D;  1DW3 A;  2ZON G;  2MHM A;  3ZOO A;  2N9J A;  1WVE C;  4WQ7 A;  3O1Y A;  4FA9 A;  3ZCF A;  4L3G A;  1YIQ A;  1DVH A;  1CYC A;  1K3H A;  2CE0 A;  2IBZ D;  1GU2 A;  3MK7 C;  1ZRT D;  3SWS A;  2B11 B;  5IY5 1;  2K9J B;  1B7V A;  1W2L A;  4QAO A;  2I8F A;  4KMG A;  4WQD A;  2KS1 A;  1BL9 A;  2Y0E A;  1N90 A;  4FA5 A;  1KYO W;  1IRW A;  3ZOX A;  4GYD A;  1HRC A;  4AAL A;  1N9C A;  1C2N A;  4YE1 A;  3MK7 B;  1L9B C;  3TDK A;  2LIT A;  4EIC A;  1CNO A;  1OCD A;  1CCH A;  3L4M A;  1M70 A;  2C1U A;  3KHU A;  1FHB A;  3KZI V;  1QKS A;  1DIQ C;  1F1C A;  1QL4 A;  2FRC A;  2BGV X;  3GW6 A;  1HCM A;  3CU4 A;  1GJQ A;  1C6R A;  5CIC B;  5TJH A;  5B6Q A;  3O0R C;  3BCC D;  1A8C A;  1GKS A;  2JQR A;  4A7P A;  155C A;  2BH4 X;  1CSV A;  5GTH V;  1E29 A;  3RN1 A;  1HH7 A;  2AI5 A;  3WFC C;  2PCC B;  1CYI A;  4XYD B;  2FWL A;  5CIF B;  1KV9 A;  1W5C T;  1L9J C;  2BH5 X;  2N3Y A;  1CSW A;  5DJQ C;  3FWL A;  2CXB A;  1E2R A;  4PD4 D;  1FI7 A;  4L3H A;  3H1H D;  2JWA A;  1H9X A;  4UB8 V;  3PHL A;  1MG2 D;  2C1D A;  1BE3 D;  5C0Z A;  3VMA A;  4FB1 A;  4NFG B;  5DJQ B;  1EB7 A;  2N3B A;  3HQ8 A;  4RJT A;  1CTZ A;  1J3S A;  1NTZ D;  1H31 A;  1RAP A;  1I6D A;  1C52 A;  1QL3 A;  5KLV D;  2B4Z A;  3OCD B;  1LMS A;  3OCD A;  5KAF V;  1LC1 A;  3OA8 B;  4IL6 V;  4FAN A;  1OAE A;  2N9Y B;  1H33 A;  3WC8 A;  1CHH A;  2ZXY A;  5E79 V;  4WQC A;  3PH2 B;  1PP9 D;  2FYN B;  2D0S A;  3A9F A;  5B5E V;  2QG4 A;  1NNO A;  5TIS V;  3PXW A;  5H2F V;  2B12 B;  3WFE C;  1YIC A;  1A2S A;  2ZOO A;  2OZ1 B;  1DW2 A;  5CID B;  1NTK D;  2EXV A;  1COR A;  4FA4 A;  3H1L D;  3NBT A;  1COT A;  3WFD C;  2LIR A;  3VYM A;  3X39 A;  1CC5 A;  5CIH B;  1HZV A;  4PW9 B;  2QJY B;  4LJI A;  3PTZ A;  3TGU D;  1NU1 D;  1I8P A;  3H1I D;  5CIE B;  3ZBM A;  1CRI A;  1U75 B;  4U3F D;  5KAI V;  3ZOY A;  1GQ1 A;  1CXA A;  4H0J A;  3GG2 A;  1KIB A;  4H0K A;  2B10 B;  4GED B;  1CIF A;  2GC7 D;  1QYZ A;  1KX7 A;  4WQ9 A;  3HQ6 A;  4MU8 A;  1LFM A;  1N50 A;  4V2K A;  3CWB D;  3NWV A;  3TF5 A;  2C2C A;  4J20 A;  1LC2 A;  3C2C A;  2ORL A;  3HQ9 A;  1ZZH A;  1KX2 A;  1HZU A;  2VHD A;  4Y5R A;  2MTA C;  2C1V A;  1KB9 D;  3A0B V;  4UB6 V;  4K3I A;  3SVW A;  351C A;  2RMZ A;  4WQA A;  1AYG A;  1CIH A;  3DR0 A;  1AOF A;  1DVV A;  1I5T A;  1MG3 D;  3VRD A;  4AX3 A;  4EIE A;  3CX5 D;  5B66 V;  2V08 A;  2YCC A;  2L4D A;  1C6O A;  3RLM A;  3WFB C;  3DP5 A;  1PPJ D;  3DMI A;  3L71 D;  3HQ7 A;  4O1Q A;  1CSX A;  1CHI A;  1I8O A;  1DII C;  1I55 A;  2AIU A;  1CRH A;  2CE1 A;  3CXH D;  3O5C A;  1GDV A;  1H9Y A;  1E8E A;  1IO3 A;  1CED A;  1KB0 A;  1SQV D;  3ZOW A;  1I6E A;  3JBT B;  1NTM D;  1U74 B;  3CYT I;  3CXH W;  3PXS A;  2KNC B;  4L1Q A;  5EXQ A;  4WQE A;  2BCC D;  1CIE A;  3OA8 A;  4AAN A;  3M97 X;  1SQP D;  3SLE A;  1F1F A;  3RMZ A;  1FCD C;  2C8S A;  1QN2 A;  2ZZS 1;  3L74 D;  1A56 A;  2Y0C A;  2C9X B;  2N18 C;  1AOQ A;  2OZ1 A;  1IZL 0;  4WQ8 A;  4FAV A;  1DW1 A;  2HV4 A;  1BGY D;  5C9M A;  3NBS A;  1NMI A;  3L4O A;  2N18 B;  1R0Q A;  1DW0 A;  2BPB B;  2GB8 B;  3PXT A;  1I54 A;  1CRC A;  1L0N D;  4PWA A;  5DFS A;  1ETP A;  3A0H V;  2PAC A;  1MZ4 A;  2AXT V;  5AUR A;  4AAO A;  4FA1 A;  2CA4 B;  1M60 A;  1YCC A;  2D0W A;  4JCG A;  4EDF A;  2Y0D A;  1AKK A;  3ITK A;  2DGE A;  5DF5 A;  1RAQ A;  1S5L V;  2V07 A;  1C6S A;  1C75 A;  1CHJ A;  5KKZ B;  1M6Z A;  1P84 D;  4EID A;  1CRJ A;  1C7M A;  1KYO D;  1FJ0 A;  1SQB D;  1CRG A;  1FI9 A;  1CSU A;  3TYI A;  1YTC A;  1IRV A;  2A06 D;  2YQB A;  3VNW A;  1NIR A;  2FYU D;  1YEA A;  3O20 A;  2B0Z B;  3WU2 V;  4WQB A;  1NML A;  1YEB A;  1JDL A;  3ZIY A;  3RN0 A;  5CIB B;  1C2R A;  3PRJ A;  2GIW A;  2XTS B;  3L72 D;  5GTI V;  4XXL A;  2N9I A;  5KLI B;  1CRY A;  1IQC A;  2Q3E A;  2JTI B;  1YNR A;  1CXC A;  1HJ5 A;  3CX5 W;  1H32 B;  1H32 A;  1CIG A;  4AAM A;  1RZ5 A;  1CO6 A;  4DY9 A;  3L73 D;  1LS9 A;  1K3G A;  1SQQ D;  4EIF A;  2QJK B;  1BCC D;  1RZ6 A;  1CCR A;  4RSZ A;  1SQX D;  2O3J A;  3H1K D;  4PJ0 V;  1YFC A;  3SXT A;  2GC4 D;  3L75 D;  4P4Q B;  3L70 D;  4D6T D;  4N0K A;  1HJ3 A;  1S6V B;  2CA3 B;  1WEJ F;  1N15 A;  2YK3 A;  2C1D B;  1VYD A;  1HJ4 A;  1CTY A;  5CIG B;  1GIW A;  2QJP B;  2ZBO A;  1H1O A;  2BLF B;  4O1W A;  2YIU B;  1DT1 A;  1H31 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...