1EZVD

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ezvD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ezvD01
1HH7A 3NWVA 1RZ5A 1M60A 3X39A 1I8PA 1U75B 5KAIV 1RAPA 5TISV 3O20A 2QJKB 2HV4A 1M6ZA 3A0HV 1CRYA 1K3HA 1LC2A 1C6OA 3PHLA 3ITKA 1AOQA 2PACA 4O1WA 5TJHA 4AAMA 1H1OA 3PRJA 1QL3A 1CTYA 2N18C 3ZIYA 5DJQC 2VHDA 2YQBA 1CIEA 1YIQA 1FOCA 4MU8A 1HRCA 2FYNB 2KNCB 1ZRTD 5CYTR 2MHMA 1QYZA 3HQ7A 1FI3A 1H31A 2FRCA 2N9JA 2OZ1B 1R0QA 1OCDA 4NFGB 3SXTA 4FB1A 2N18B 4WQ8A 3TF5A 4EIDA 4PW9B 1F1CA 1P84D 1IZL0 1DVVA 2BCNB 1AKKA 1C6SA 1LFMA 1DIIC 2GIWA 3L70D 1C6RA 1CXAA 5CIBB 1YCCA 1COTA 3RN0A 3TGUD 1HZVA 4EIFA 1HCMA 2LITA 4H0KA 3A9FA 1SQVD 2CA3B 1IO3A 1SQXD 4J20A 4Y5RA 2N3YA 3CP5A 5KLVD 1HJ5A 1GDVA 3PXWA 1CYIA 5EXQA 1DVHA 1GJQA 2RN0A 351CA 3BCCD 5CIFB 4L3HA 1I6EA 2Y0DA 2ZBOA 1SQBD 2ZONG 1DW3A 3H1HD 4PWAA 2V07A 2JWAA 3ZBMA 1A56A 3WUIA 1DW1A 2AIUA 4A7PA 1MG2D 1A8CA 2LIRA 5B6QA 2ZZS1 3VNWA 1NNOA 1EB7A 4WQ7A 1YTCA 1C7MA 1PPJD 1CRIA 2BGVX 4EICA 1GU2A 3H1JD 1CIHA 3PH2B 2OZ1A 3TYIA 1HJ3A 2CE1A 1W2LA 1OAEA 2C1DB 2YCCA 1KV9A 2DVHA 4GYDA 451CA 1KB0A 2V08A 4EIEA 1CHJA 4IL6V 4Q5PA 4JCGA 2B12B 2AI5A 2N9YB 1M70A 1FJ0A 3CYTI 3JBTB 3WU2V 2DGEA 3CU4A 1WVEC 4L1QA 1N9CA 2K9JB 3H1LD 3NBSA 1CEDA 3ZOXA 1AOFA 3O0RC 1KX7A 4FA4A 2C8SA 4GEDB 1H33B 2B4ZA 1C2RA 1ZZHA 1A2SA 1CRCA 1VYDA 4LJIA 4AALA 1MZ4A 2QJPB 5KLIB 2IBZD 1HROA 1CSXA 3TDKA 2D0SA 4FA1A 1AYGA 3A0BV 4RJTA 1FI9A 3CXHD 1H9XA 2PCCB 1CTZA 2BPBB 5DJQB 5H2FV 1MG3D 3M97X 4WQEA 2BH5X 5CIEB 2C1DA 2C1UA 3CX5D 1YFCA 1DIQC 4WQCA 4N0KA 5E79V 4QAOA 1DW0A 2GB8B 1QKSA 1CO6A 3VYMA 4FA5A 2QJYB 3GG2A 1L9BC 2BCCD 2GC7D 1NMIA 4H0JA 1YEAA 4O1QA 1KX2A 1I54A 1LC1A 2C1VA 1CTJA 1WEJF 2CE0A 1GKSA 1EZVD 1CCHA 1CHIA 1CIFA 1KYOW 1H33A 1U74B 2AXTV 1IRVA 3OA8B 4D6TD 3CXHW 3PTZA 1BE3D 1FCDC 3HQ9A 5DF5A 3KHUA 2BH4X 1CNOA 4FAVA 3L72D 1CRHA 3ZOOA 1LMSA 4FA9A 1CIGA 3H1KD 5AURA 2CA4B 1B7VA 2BLFB 1BGYD 3O5CA 3WFDC 5KAFV 1CSVA 3CX5W 1S5LV 4WQBA 1N90A 1S6VB 3DR0A 1I5TA 3L4OA 5C9MA 1NU1D 1L0ND 2XTSB 1I55A 2A06D 1PP9D 1KIBA 3L4MA 1I6DA 2RMZA 1HJ4A 1CYCA 5C0ZA 3RN1A 3WFCC 3HQ8A 2ORLA 5B5EV 4V2KA 1J3SA 1NMLA 2QG4A 2I8FA 4FANA 3GW6A 5B66V 1CSUA 2ZOOA 2CXBA 1CXCA 4XXLA 5KKZB 1HZUA 1SQQD 3NBTA 2Y0CA 2L4DA 3WFBC 3OCDB 1KYOD 1SQPD 2YIUB 1GIWA 4P4QB 3KZIV 4K3IA 3MK7C 2MTAC 3PXSA 1NIRA 3OA8A 1JDLA 1QL4A 3H1ID 2B11B 3HQ6A 1CRGA 2Y0EA 1NTZD 1CYJA 155CA 3ZOWA 3ZCFA 2B10B 2FWLA 3DP5A 1L9JC 3MK7B 3SJLA 1K3GA 3SLEA 1N50A 1H32B 1CC5A 1I8OA 4L3GA 4UB8V 1C2NA 1W5CT 1H9YA 1E8EA 3ORVA 2Q3EA 4AX3A 2O3JA 2N9IA 1YNRA 4XYDB 1LS9A 4EDFA 2D0WA 1RAQA 3PXTA 1C52A 4U3FD 3VRDA 1CSWA 3L71D 1F1FA 3ZOYA 4UB6V 3CWBD 3FWLA 5GTIV 1NTMD 1QN2A 3L75D 1FI7A 2L91A 3VMAA 1CHHA 3RMZA 2JQRA 5CIHB 2C9XB 1RZ6A 5CIDB 3RLMA 3OCDA 1L0LD 5CICB 3SVWA 1CCRA 2PCBB 1CRJA 1E2RA 3WFEC 4WQ9A 1IRWA 1BL9A 3PLNA 2FYUD 2GC4D 2YK3A 1YEBA 2C2CA 1H31B 2N3BA 2JTIB 5GTHV 1YICA 5CIGB 1H32A 3O1YA 3SWSA 2KS1A 1E29A 2B0ZB 4WQDA 2EXVA 1ETPA 4RSZA 1NTKD 2ZXYA 4PJ0V 4AANA 3DMIA 4PD4D 1IQCA 1N15A 1BCCD 1C75A 3WC8A 1CORA 4AAOA 4KMGA 1DT1A 4WQAA 1GQ1A 4YE1A 3L74D 3L73D 1FHBA 5DFSA 4DY9A 1DW2A 3C2CA 5IY51 1KB9D
chains in the Genus database with same CATH superfamily
1VQKP 3NWVA 1M60A 4QMAA 1I8PA 1RAPA 3O20A 1LWUC 3H32A 1M57D 5TJHA 2OYHB 1H1OA 3ZIYA 1CW5A 2OTJP 2VHDA 2YQBA 4DJGA 2R32A 2FYNB 2Z5IA 2KNCB 5CYTR 2MHMA 2R5DA 1K73Q 2FRCA 2N9JA 2WZ7A 1R0QA 3IR9A 4NFGB 1FDIA 1PGOA 3T97A 1M56D 2N1TB 4Y99B 1P84D 1A02F 1IZL0 2W27A 3Q1MA 4TT3H 1LFMA 3CWBG 5KAIH 1C6RA 1FZEA 1HZVA 4EIFA 1NTMG 2LITA 3FXEA 2O01H 2Q9IA 3A9FA 3P8CE 5AVYB 2OYIA 3C8VA 4J20A 3L70E 1MZ9A 5KLVD 1JY2O 1KQGB 1KB9I 1DVHA 1NAFA 2D2CC 3QH9A 351CA 1SQXE 2ZVNB 3H32B 5CIFB 5EFWB 2O1JA 2Y0DA 2ZBOA 1KB9H 3OA7A 1KILB 2Y9YA 3H1HD 1S3JA 1A56A 2WPRA 4A7PA 2FYZA 1H8AA 2LIRA 2ZZS1 1KILE 1DEBA 2WMMA 1PGPA 4H44B 4KT0J 3A7OA 4Y28J 1Q81Q 3R4YA 3KXDA 1SQQJ 3H1JD 4K35A 3AEAC 2OZ1A 1PPJE 2CE1A 4WY4B 3B5NA 2OGUA 5APTA 2DVHA 1P84I 451CA 2Z4EA 3WUTA 3F89A 2BASA 1NHLA 1P84H 1RF1A 2N9YB 1FJ0A 5AW6B 3P32A 1SFCD 3JBTB 1N73B 1TU3F 3C1LA 1QGKB 2QJPC 3CU4A 5KLIC 2XU6A 3PJSK 1CEDA 1NTZG 3ZOXA 1DD4A 1YQ4C 4R4MA 4GT1A 2B4ZA 1C2RA 1ZZHA 1JB0J 3H1LE 1Z56A 1MZ4A 2YXRB 1G2CA 4H13B 1S72P 5BU5A 4YXWH 1HROA 3AE8C 3TDKA 1AYGA 1JTHA 2K37A 1PV3A 2PCCB 3TNUB 2BPBB 1PL5A 2ZXEB 1ZMEC 2Q6QA 2ZYDA 1Q86Q 2B88A 3TGUG 3CC4P 3P8CD 2C0WA 1LT9C 1IC2A 1IO4A 3USSA 3CX5D 4WQCA 5E79V 2ZYAA 2R5BA 2GB8B 1QKSA 1CO6A 3M9HA 3VYMA 1HUCA 3VN0A 2ZYGA 4YXDC 1NU1J 1K9MQ 4H0JA 3EQ2A 1KILD 2C1VA 1WEJF 1CHIA 1CIFA 1J1EC 5H2FH 1IRVA 2JP3A 1QL1A 1NTME 3CXHW 3PTZA 3CCQP 3HQ9A 1FCDC 4FAVA 4H44D 1CRHA 4D6TE 2WT7A 1N8RQ 1BE3E 5AURA 1BCCG 1HH0A 1DX7A 4RKUJ 2LKMA 3II6A 1BGYD 4EI2A 3L73G 2FY8A 4L73A 1UIXA 3H1KE 1S6VB 1IFDA 1GL2A 1NU1D 1OW7A 3CX5I 2KB7P 1PP9D 2I1KA 4U7JA 5CMZA 1QVFO 2K1AA 3V5BA 5C0ZA 3CX5H 1L0NE 3RN1A 3WFCC 2ORLA 4V2KA 2A06E 3HE4A 2I8FA 3KZIE 4PV1B 1NKNA 1KFNA 1CSUA 2ZOOA 2HFED 2IBZG 5KKZB 1HZUA 1YIJP 4L75A 3NBTA 2L4DA 3OCDB 1KYOD 1SQPD 2YIUB 2E76B 3Q5SA 4H13D 3D6ZA 3GF3A 1SQVJ 3MK7C 5KAFH 2H43A 3OA8A 4IFDK 1KV4A 2NZ2A 1GTWA 1CYJA 2GUSA 4HYTB 3BCCJ 2FWLA 3H1IE 3H6PA 1K8AQ 3R2PA 1SQBJ 1W2BO 3CLQA 1NTZE 3SLEA 2QM7A 4L3GA 4UB8V 1Y47A 3P8MC 5CCGA 5AVUB 1CI6A 1N7SB 1VQ9P 1LP1B 1H89A 2N9IA 1M1JB 1ZOYC 5K5GB 3D71A 2HYNA 4C7RA 1AA0A 3O6QB 2FYUK 3HUSC 2PAJA 5KJ7A 1FDMA 3ZOYA 1LTJC 3SWFA 2GM4A 3LW5J 1PZQA 3CWBD 1VQNP 1NTMD 1QN2A 1AVOA 2L91A 3KYQA 3WUVA 3RL0B 1KYOI 3L72G 2XKMA 1ZR4A 2E43A 2PCBB 1KYOH 1IFJA 3RK3C 3LIEA 1EDJA 2WITA 3HD7B 3PLNA 3VTPC 3AE5C 2GA1A 5CJ4A 2R3CA 4I6MC 1H32A 3SWSA 4WQDA 4UB6H 3U59A 2ZXYA 3CCVP 1HTLC 3FXDA 3Q5RA 4PD4D 5KAIE 3AE4C 1URQB 4YE1A 1SQQG 1EDIA 4I2LC 4AQRD 4PV1D 5KTBA 4JF7A 1BCCE 5IY51 3W68A 2FXOA 1SP4A 1RF0C 1HH7A 1RZ5A 1N86A 1NWQA 3X39A 2JEEA 3AECC 3L74E 3L73E 4BRYB 2NPSC 5TISV 2ZAEB 2QJKB 3TGUJ 4K3AA 1LGHB 2R44A 1M6ZA 1KB9E 3GHGA 3MP7B 5BVZA 2E76D 2RKLA 1CRYA 1MFZA 3WUUA 1VDFA 3AEEC 1AOQA 4IOIH 2PACA 4O1WA 3TK1A 2QM8A 2YO2A 5DJQC 5KLVK 1LWUB 2BCCJ 1FOCA 1VQMP 4PJ0H 2SPZA 3IN6A 4JYBA 1ZRTD 1FZCC 1QYZA 1FI3A 1H31A 1T6AA 1OCDA 1IZNB 1NYHA 5GTIE 1N7SD 2C0XA 2L5GB 1JY3P 2B87B 1DVVA 1AKKA 1DIIC 1FOSF 4NPDA 1EXJA 1N7LA 3LW5H 4PD4I 1COTA 3AE7C 3TGUD 1HCMA 1P84E 1EQ7A 1S9KD 3EFGA 3EFFK 4PD4H 1SFCA 2Q7CA 1GJQA 1BSHA 4R4LA 3M0DC 3RL0D 1NKZB 5KLVE 2IZ0A 5CCHC 3CCMP 4PWAA 4XFJA 3WUIA 2D2CB 1A8CA 5B6QA 3H1HE 1NU1G 3MUDC 1VF5D 2KIKA 2W83C 2OYHA 1JCCA 1GK6A 1EB7A 1YTCA 2FXPA 1WMKA 1CRIA 1KB9D 3D70A 2QIWA 2KNCA 2H8PD 2AEJA 1KC8Q 3M0AA 1CIHA 3TYIA 1W2LA 1OAEA 1Q90D 2C1DB 2YCCA 2N1TA 3CMEP 4GYDA 1OXZA 2BEZF 2KUBA 3A0HE 1CHJA 4IL6V 4DOJA 1URQD 2B12B 2AI5A 5APSA 2I8DA 1X0TA 3WU2V 2P58A 5APWA 1WVEC 3S1KA 3NBSA 5AW0B 4IFMA 3E1RA 1CZQA 1AOFA 2C8SA 1RE4A 3MHVA 1KILA 1Q82Q 1VYDA 2HG5D 1SQXK 4I1LA 4U3FJ 5H2FE 2QJPB 5KLIB 3L71J 2IBZD 4Z1MH 1CSXA 1GK4A 1RQUA 1QVGO 4FA1A 3A0BV 1FI9A 1H9XA 3L75J 1CTZA 1MG3D 1YITP 1L4AC 1FJPA 1L0LJ 1S1CX 1SQVG 4WY4A 2HR3A 2QJYC 3L72J 2J5UA 2FFDC 4N0KA 4NPFX 1GW3A 3BCCG 1AVYA 4C7NB 3CX5E 3MIWA 3Q5PA 3AE1C 1SQBG 1HJ0A 3GG2A 1YBKA 1N73A 1NMIA 1YEAA 1OW8A 4O1QA 1LC1A 4BWNA 4EIJA 1NTKJ 2CE0A 1JY2N 1CCHA 1KYOW 2Q5UA 4B86A 3SSUA 2AXTV 2D2CD 2IBZI 3NFQA 5KAFE 3HE5B 3L72D 4OH8B 3ZOOA 2LXCB 5E79H 5AVSB 1J1EB 1CIGA 1FOSE 2CA4B 3TNUA 4I7ZC 1RE3C 1MV8A 1SQPK 1S5LV 3D0WA 3DR0A 1I5TA 3V6IA 1BGYE 1KIBA 3L4MA 3BATA 1NVOA 1NU1E 1W5CE 5B5EV 2AEMA 2VRSA 2WQYC 1PP9E 2QG4A 2ZXXA 4FANA 3CC7P 1R5LA 5B66V 2KI7B 1H88A 2YKQA 2V4HA 1NAYA 2WWWA 1U57A 2CXBA 1KORA 1HF9A 2J58A 1SQQD 2Y0CA 3WFBC 3CD6P 3L70J 1GIWA 1Q7YQ 1VQ8P 3HTKA 1KZUB 1KYOE 1SQPE 1JDLA 2Y0EA 1VQLP 2M5AB 1H0TB 3ZCFA 1R5SA 1NTMK 2YMYA 3VYIA 3MK7B 2KS1B 1Y8AA 3RK2C 2HLOA 1W5CT 2P67A 1H9YA 3M06A 2Q3EA 4UB6E 3B8EB 2HODB 4H0LC 1FZBA 1YNRA 3AEFC 3SFEC 2BCCG 3P7KA 1BDDA 1C52A 1X8YA 3VRDA 4N78E 2QSIA 4GOEA 2Z5HA 1EZVG 3L35A 2W8ZA 2XNXA 2O1KA 2KP8A 2IZ1A 1L0NK 3FWLA 5GTIV 4WWIA 4GDOA 3VP8A 1S5LX 4CPGA 1YJWP 1KFMA 3HUSB 1CHHA 3CWBE 2ZJSE 3SWYA 2C9XB 3HTKB 1FE6A 1RZ6A 1X79B 1LTJB 4ASVA 3OCDA 3AEDC 1OW6A 1JY2P 3BCCE 4UB8H 1CRJA 3WFEC 3L36A 4EOTA 4WQ9A 1RY3A 1BL9A 1OVVA 3V2PA 2PP6A 1W2EA 4WY4C 4PJ0E 1T3JA 1KD1Q 4JPZB 2P10A 5GTHV 1FZAA 2OYIC 1GD2E 2WVRA 1E29A 2LXBA 1NTZK 1N7SA 4KJMA 3CL3D 1N73C 1LP1A 1BSNA 1M1JA 2WTYA 3GMAA 1C75A 1OVRA 1GU5A 3CCRP 4WQAA 3O6QA 4PD4E 1YJNP 2Q3IA 3M91A 5APVA 1GU4A 5AW4B 1QEXA 2OQQA 5APXA 2RH0A 3A0HV 1LC2A 1C6OA 3PHLA 1IFMA 2B89A 3V2NA 3LIDA 2P1JA 4AAMA 2NPSB 3B5NC 1QL3A 3FWNA 1FJKA 4N3YB 2N18C 1U7JA 2IPPA 1FZGA 1FBMA 1USDA 3G3ZA 1YIQA 1JMBA 4MU8A 3HD7A 5CBOA 1HRCA 2YMKA 2KK7A 1JY3O 2AEFA 1RF1C 3AE9C 1AFOA 3SXTA 2YNYA 1GW4A 2ZVOB 4U3FG 4N78D 1ZRTE 4RESB 2WPVB 3L71G 4D6TJ 1AV1A 1BE3J 5DJTB 1FZCB 1FAVA 2GIWA 5TISH 1PFIA 5CIBB 1CXAA 4L76A 3L75G 4H0KA 2W90A 3H1KJ 1SQVD 1URQA 2CA3B 4LC1A 2N3YA 2R3SA 1GDVA 3TGUE 2BEQD 1GZLA 4MN4C 1L0LG 1S9KE 1MFTA 2E75C 3BCCD 2JKVA 1BDCA 1SVFA 4L3HA 1I6EA 4BRYA 1SQBD 1DW3A 3O8ZA 2JWAA 2FXMA 1PGJA 2BCCE 1LTGC 2P7JA 1DW1A 2WSEJ 3SFDC 1VF5B 3VNWA 3NMDA 4HJGH 1NNOA 1M7LA 1C7MA 3CI9A 1LWUA 2NRGA 5DJUB 1E79H 4WVZA 4KHXA 1NTKG 5APQA 3RK3D 3AE3C 3F5HA 1HJ3A 5AVVB 3PP5A 1T2KC 1IFNA 1KV9A 3IF4A 1KB0A 2B87A 1PIXA 2V08A 4EIEA 4O9BA 2OYOA 2A45H 1OZHA 3CYTI 2P2UA 1XTGB 3A5TA 1VQPP 1OIPA 4TLFA 2DGEA 2K9JB 2IYOA 2QVAA 3CCUP 3O0RC 4GEDB 1H33B 1LJ2A 1YHQP 1KTMA 1YTZT 4LJIA 4AALA 2NPSD 3JSVC 1JUNA 1DIPA 4ZKPA 3ABVC 2D0SA 4ZNCA 1GL2C 3CXHD 2IBZE 3N4XA 2ZT9C 1DD3A 1J2JB 4IL6H 1NH4A 1QLED 3BRTB 3L70G 1IJDB 4GKGA 3WU2H 4DT0A 4OGQC 3RL0g 2XDJA 4WQEA 2C1DA 2C1UA 1YFCA 4QAOA 1VQ5P 2PGDA 1Q2NA 1L4AB 2WSFJ 2FYUJ 1HWTC 2DW3A 4L74A 2QJYB 1RH5B 4HH2A 2FFDB 4C46A 2BCCD 2QRXA 4W7ZA 1YQ3C 1RQVA 3A3YB 2Y9ZA 1RHZB 3A0BH 1KX2A 2KSEA 3VOPA 2WSEH 4AUWA 1GKSA 3L71E 1EZVD 3N7NA 2KYVA 1U7MA 4M3LA 1PPJG 2KLUA 1U74B 3MGNA 3HD7C 2V7QJ 1JO5A 1J1DC 3L74J 2I1JA 4DCKA 5DF5A 3KHUA 5CCGC 1CNOA 5CCHD 3SWKA 3CXHI 1IFIA 2UWJE 2YKOA 4FA9A 1L0LE 3A2AA 1JEKA 3VMYA 3CXHH 3L72E 2M8RA 1SQQK 2E74C 3O5CA 5KJ7C 1VPCA 3CX5W 1SS1A 3L4OA 3UIAA 1KQSO 1JOCA 5C9MA 2YO3A 2XTSB 2HPCB 4WB4A 1I6DA 4I7ZB 2C9NY 4ASWA 3H1LG 1CYCA 3S9OA 3HQ8A 1M90Q 2E74D 3CMAP 4C7NA 1ZR2A 5C39A 2AXTH 1UIIA 3GW6A 3CCLP 2G8YA 2B9BA 1YTZI 1HVVA 3AEGC 3BVHA 1EZVI 3L4FA 1VL2A 4P4QB 3KZIV 1SQQE 1NGMB 2MTAC 1S5LH 3E1IA 3PXSA 1NIRA 1EC5A 2WSCJ 1K05A 4GODA 1DH3A 4UB8E 5KLVJ 1QL2A 4HKZH 2B11B 2G3AA 4LLHA 3HQ6A 2A45G 3G71P 3HE5A 2B10B 3DP5A 1ZV8A 1L9JC 5B5EH 3SJLA 1N50A 3H1HJ 1CC5A 2WSFH 1I8OA 3BASA 1E8EA 3MD0A 3ORVA 1G1JA 5B66H 2O3JA 2YKPA 4XYDB 1L4AD 3FX0A 1LS9A 4EDFA 1LT9B 5BU8B 1WT6A 1RAQA 3PXTA 3GHGC 4U3FD 1SLQA 4NPEA 3RK2B 3L71D 1F1FA 1NO4A 3H1JJ 1WRGA 4H0LB 1NU1K 4ZMDA 1EXIA 4D6TG 2V7QH 3L75D 3Q2YA 3VMAA 1BE3G 4IL6X 3AE2C 5CIDB 2N9BA 4GIFA 1L0LD 5CICB 3H1KG 1CCRA 2PRRA 1X22A 5AVTB 1M8OB 3G9RA 3PH0A 1IRWA 1KMIZ 3L37A 5AW8B 2GC4D 1GDTA 2YK3A 1YEBA 1L0NG 2M5AA 1H0TA 2QE7H 2A06G 2N3BA 3JCUH 3T97B 4JYCA 3CCJP 1YICA 2IX7C 2KS1A 2CPSA 2E5TA 1YI2P 2B0ZB 1KN7A 1SFCC 2XV5A 1ETPA 5GTIH 1NTKD 2E42A 3DMIA 2HODA 5TISE 1IQCA 1N15A 1VQ7P 3ZDMA 3WC8A 4AAOA 2OYIB 1DT1A 1IK9A 3V4WA 1GQ1A 1FHBA 1DW2A 3C2CA 3V4QA 2OYHC 2CK3H 1U75B 5KAIV 3IAOA 3H1IG 2WSCH 2HV4A 2M3EA 3HUSA 3K5BA 2CPBA 1T8ZA 2FYNC 1SQXJ 1K3HA 3CPWO 1LTJA 3ITKA 1M1KQ 5GTHH 4N6JA 1MKMA 1SQVK 4LGDE 3PRJA 2JDIH 1CTYA 2N1TC 3I5CA 4Y99C 1CIEA 3S4RA 4W80A 3H25A 2W6AA 3OJAB 3HQ7A 2OZ1B 4ZKUA 1MUUA 1SQBK 3G4SP 3W67A 4FB1A 1OMIA 3B5NB 2N18B 4WQ8A 5AVXB 3TF5A 4EIDA 4PW9B 2N1TD 1F1CA 3CC2P 2BCNB 1C6SA 2C9LY 1RF1B 3L70D 1YCCA 1ZP0C 2ZFCA 3RN0A 1LTTC 1EDLA 3A0HH 3RK2D 1RE4C 1KILC 5CJ0A 4Y5RA 1IO3A 1SQXD 1K04A 4W7YA 2WPSA 3CP5A 4H0LD 1HJ5A 1BGYJ 2POHA 3PXWA 1CYIA 5EXQA 1XTCC 1OFCX 1SQVE 2KSJA 2RN0A 3KPEA 1AJYA 1PP9J 2ZONG 2W6JH 4H44C 3I55P 3JC22 2FYUG 1YYCA 1VQ4P 1G2CB 2V07A 3ZBMA 1KQFB 5APUA 2AIUA 1MG2D 1SQBE 1RF0A 2E75B 2JO1A 1JTHB 3AEBC 3H1LJ 3MTUE 3VP9A 2NPSA 5AVZB 4WQ7A 3M9QA 2H88C 1ZXGA 1PPJD 3KQGA 4XE5B 3RK3B 1HBWA 1LNQA 4IL6E 2FBWC 2BGVX 4EICA 1GU2A 1SQPJ 3PH2B 2K9YA 3EWKA 3WU2E 4WBAA 3RK3E 3V2QA 3L74G 4WY4D 1S4XA 2MKVA 1NOHA 5APYA 2KOGA 1FZCA 4Q5PA 4JCGA 1M70A 1G1IA 1EDKA 1AQTA 2AXCA 5AW2B 5CBNA 2M0BA 1FC2C 1OWAA 1T3UA 4L1QA 4H13C 1N9CA 4OVNF 3H1LD 1OX3A 2KZJA 3A0BE 1KX7A 4FA4A 2OTKE 1A2SA 2OTLP 1CRCA 2QA4P 2XZRA 4JBZA 1NJIQ 4OWFA 1X9VA 5L8RJ 5AW9B 3M0DA 2WT7B 3CWBJ 4RJTA 3RBZA 1NTMJ 2YXQB 5CCHA 1IFPA 5DJQB 1LTBC 5H2FV 2KXPB 3M97X 3B5ND 3CXHE 1A02J 1GL2B 4XA4A 3MUDA 1JY3N 2PFXA 3I56P 3GLMA 2BH5X 5CIEB 2ZT9B 1DIQC 4DZOA 5KLVG 1DW0A 1HJBA 2MJZA 4FA5A 4OGQB 2KLVA 4EYYQ 3HE4B 2AXTE 1R8EA 3H1HG 3V2RA 1L0NJ 3CCSP 1JM0A 1L9BC 2E5YA 2GC7D 2IYPA 5AW1B 2K9JA 3U1CA 1I54A 3NXSA 2K3RA 1CTJA 1FZFA 2ITAA 3CCEP 1H33A 2Q1KA 2WPQA 1Y9BA 1D7MA 3OA8B 1YJ9P 2E75D 4D6TD 1EZVE 5AW3B 3H1JG 1BE3D 1S5LE 1JCDA 2BH4X 1HGVA 3C9IA 3RBXA 1N2DC 1DEEG 4YTPC 1LMSA 5AW7B 3B71A 3H1KD 1B7VA 2BLFB 1J1DB 3GF7A 5B5EE 1VQOP 3WFDC 5KAFV 2A45I 1CSVA 3E7KA 4WQBA 1N90A 3H1IJ 1CI6B 3RGUA 2FYUE 1QX8A 1ZN5A 1L0ND 1NTZJ 1I55A 1ZW0A 3NTNA 3FGAD 4PV1C 2A06D 5B66E 1CSBA 2WSSH 3HRNA 2RMZA 1HJ4A 2E74B 1E5WA 5KKZC 1L4AA 4YPCA 1J3SA 1T2KD 1NMLA 2YIUC 5M1BA 2E76C 1FU1A 3VMXA 1LTSC 3KDPB 2FFDA 1KQLA 3OAKA 2H7HA 1OVUA 1CXCA 3MZWB 4XXLA 1ZLLA 1USEA 3D6YA 4K3IA 1FDOA 3B4SA 1QL4A 3H1ID 5E79E 3G6EP 1CRGA 2IDBA 1NTZD 1AQ5A 155CA 3ZOWA 1N7SC 1PGQA 5AW5B 1VQ6P 2LR2A 4JQ0D 1M1JC 1K3GA 3BRVB 1SQXG 2IFNA 1GL2D 1H32B 3JCUE 1C2NA 1LT1A 3U1AA 1L0LK 2ZT9D 4AX3A 2J59M 4GOFA 2QEXP 2HPCA 1JNMA 2D0WA 4OGQD 1RE3A 2GUVA 3RL0C 1CSWA 2FKWB 3KZIH 2H89C 4RO0A 4IFFA 1LTAC 4UB6V 4U3FE 3OW2O 2O01J 2K88A 1JMMA 1FI7A 3GHGB 3RMZA 2JQRA 1BCCJ 5AVQB 5CIHB 1VF5C 2O01N 1NTKK 3RLMA 3L73J 3L75E 3WMM0 3SVWA 3M9BA 3AE6C 1L2PA 1IK7A 5GTHE 1FS0E 1E2RA 1BGYG 2FYUD 2JWDA 1HGZA 3QWOC 2C2CA 3HD7D 1H31B 4AYCA 1PP9G 3IFMA 3VMZA 2JTIB 5AVRB 5CCGD 1URQC 4HB1A 5CIGB 4BXLA 3O1YA 2OARA 3TYYA 2EXVA 1GMJA 3TSIA 4RSZA 5CHXA 2KZIA 4PJ0V 4AANA 5AVWB 3H1JE 5KJ7D 1BCCD 1CORA 4KMGA 2QJKC 1LT9A 1LTIC 1NTKE 3Q3DA 2W6BA 2XNDH 2JJLA 3L74D 3L73D 1S2EA 5DFSA 4DY9A 1SFCB 2IFMA 1SQPG 2JR8A 2M3BA
chains in the Genus database with same CATH topology
1HH7A 3NWVA 1RZ5A 1M60A 3X39A 1I8PA 1U75B 5KAIV 1RAPA 5TISV 3O20A 2QJKB 2HV4A 1M6ZA 3A0HV 1CRYA 1K3HA 1LC2A 1C6OA 3PHLA 3ITKA 1AOQA 2PACA 4O1WA 5TJHA 4AAMA 1H1OA 3PRJA 1QL3A 1CTYA 2N18C 3ZIYA 5DJQC 2VHDA 2YQBA 1CIEA 1YIQA 1FOCA 4MU8A 1HRCA 2FYNB 2KNCB 1ZRTD 5CYTR 2MHMA 1QYZA 3HQ7A 1FI3A 1H31A 2FRCA 2N9JA 2OZ1B 1R0QA 1OCDA 4NFGB 3SXTA 4FB1A 2N18B 4WQ8A 3TF5A 4EIDA 4PW9B 1F1CA 1P84D 1IZL0 1DVVA 2BCNB 1AKKA 1C6SA 1LFMA 1DIIC 2GIWA 3L70D 1C6RA 1CXAA 5CIBB 1YCCA 1COTA 3RN0A 3TGUD 1HZVA 4EIFA 1HCMA 2LITA 4H0KA 3A9FA 1SQVD 2CA3B 1IO3A 1SQXD 4J20A 4Y5RA 2N3YA 3CP5A 5KLVD 1HJ5A 1GDVA 3PXWA 1CYIA 5EXQA 1DVHA 1GJQA 2RN0A 351CA 3BCCD 5CIFB 4L3HA 1I6EA 2Y0DA 2ZBOA 1SQBD 2ZONG 1DW3A 3H1HD 4PWAA 2V07A 2JWAA 3ZBMA 1A56A 3WUIA 1DW1A 2AIUA 4A7PA 1MG2D 1A8CA 2LIRA 5B6QA 2ZZS1 3VNWA 1NNOA 1EB7A 4WQ7A 1YTCA 1C7MA 1PPJD 1CRIA 2BGVX 4EICA 1GU2A 3H1JD 1CIHA 3PH2B 2OZ1A 3TYIA 1HJ3A 2CE1A 1W2LA 1OAEA 2C1DB 2YCCA 1KV9A 2DVHA 4GYDA 451CA 1KB0A 2V08A 4EIEA 1CHJA 4IL6V 4Q5PA 4JCGA 2B12B 2AI5A 2N9YB 1M70A 1FJ0A 3CYTI 3JBTB 3WU2V 2DGEA 3CU4A 1WVEC 4L1QA 1N9CA 2K9JB 3H1LD 3NBSA 1CEDA 3ZOXA 1AOFA 3O0RC 1KX7A 4FA4A 2C8SA 4GEDB 1H33B 2B4ZA 1C2RA 1ZZHA 1A2SA 1CRCA 1VYDA 4LJIA 4AALA 1MZ4A 2QJPB 5KLIB 2IBZD 1HROA 1CSXA 3TDKA 2D0SA 4FA1A 1AYGA 3A0BV 4RJTA 1FI9A 3CXHD 1H9XA 2PCCB 1CTZA 2BPBB 5DJQB 5H2FV 1MG3D 3M97X 4WQEA 2BH5X 5CIEB 2C1DA 2C1UA 3CX5D 1YFCA 1DIQC 4WQCA 4N0KA 5E79V 4QAOA 1DW0A 2GB8B 1QKSA 1CO6A 3VYMA 4FA5A 2QJYB 3GG2A 1L9BC 2BCCD 2GC7D 1NMIA 4H0JA 1YEAA 4O1QA 1KX2A 1I54A 1LC1A 2C1VA 1CTJA 1WEJF 2CE0A 1GKSA 1EZVD 1CCHA 1CHIA 1CIFA 1KYOW 1H33A 1U74B 2AXTV 1IRVA 3OA8B 4D6TD 3CXHW 3PTZA 1BE3D 1FCDC 3HQ9A 5DF5A 3KHUA 2BH4X 1CNOA 4FAVA 3L72D 1CRHA 3ZOOA 1LMSA 4FA9A 1CIGA 3H1KD 5AURA 2CA4B 1B7VA 2BLFB 1BGYD 3O5CA 3WFDC 5KAFV 1CSVA 3CX5W 1S5LV 4WQBA 1N90A 1S6VB 3DR0A 1I5TA 3L4OA 5C9MA 1NU1D 1L0ND 2XTSB 1I55A 2A06D 1PP9D 1KIBA 3L4MA 1I6DA 2RMZA 1HJ4A 1CYCA 5C0ZA 3RN1A 3WFCC 3HQ8A 2ORLA 5B5EV 4V2KA 1J3SA 1NMLA 2QG4A 2I8FA 4FANA 3GW6A 5B66V 1CSUA 2ZOOA 2CXBA 1CXCA 4XXLA 5KKZB 1HZUA 1SQQD 3NBTA 2Y0CA 2L4DA 3WFBC 3OCDB 1KYOD 1SQPD 2YIUB 1GIWA 4P4QB 3KZIV 4K3IA 3MK7C 2MTAC 3PXSA 1NIRA 3OA8A 1JDLA 1QL4A 3H1ID 2B11B 3HQ6A 1CRGA 2Y0EA 1NTZD 1CYJA 155CA 3ZOWA 3ZCFA 2B10B 2FWLA 3DP5A 1L9JC 3MK7B 3SJLA 1K3GA 3SLEA 1N50A 1H32B 1CC5A 1I8OA 4L3GA 4UB8V 1C2NA 1W5CT 1H9YA 1E8EA 3ORVA 2Q3EA 4AX3A 2O3JA 2N9IA 1YNRA 4XYDB 1LS9A 4EDFA 2D0WA 1RAQA 3PXTA 1C52A 4U3FD 3VRDA 1CSWA 3L71D 1F1FA 3ZOYA 4UB6V 3CWBD 3FWLA 5GTIV 1NTMD 1QN2A 3L75D 1FI7A 2L91A 3VMAA 1CHHA 3RMZA 2JQRA 5CIHB 2C9XB 1RZ6A 5CIDB 3RLMA 3OCDA 1L0LD 5CICB 3SVWA 1CCRA 2PCBB 1CRJA 1E2RA 3WFEC 4WQ9A 1IRWA 1BL9A 3PLNA 2FYUD 2GC4D 2YK3A 1YEBA 2C2CA 1H31B 2N3BA 2JTIB 5GTHV 1YICA 5CIGB 1H32A 3O1YA 3SWSA 2KS1A 1E29A 2B0ZB 4WQDA 2EXVA 1ETPA 4RSZA 1NTKD 2ZXYA 4PJ0V 4AANA 3DMIA 4PD4D 1IQCA 1N15A 1BCCD 1C75A 3WC8A 1CORA 4AAOA 4KMGA 1DT1A 4WQAA 1GQ1A 4YE1A 3L74D 3L73D 1FHBA 5DFSA 4DY9A 1DW2A 3C2CA 5IY51 1KB9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HH7 A;  3NWV A;  1RZ5 A;  1M60 A;  3X39 A;  1I8P A;  1U75 B;  5KAI V;  1RAP A;  5TIS V;  3O20 A;  2QJK B;  2HV4 A;  1M6Z A;  3A0H V;  1CRY A;  1K3H A;  1LC2 A;  1C6O A;  3PHL A;  3ITK A;  1AOQ A;  2PAC A;  4O1W A;  5TJH A;  4AAM A;  1H1O A;  3PRJ A;  1QL3 A;  1CTY A;  2N18 C;  3ZIY A;  5DJQ C;  2VHD A;  2YQB A;  1CIE A;  1YIQ A;  1FOC A;  4MU8 A;  1HRC A;  2FYN B;  2KNC B;  1ZRT D;  5CYT R;  2MHM A;  1QYZ A;  3HQ7 A;  1FI3 A;  1H31 A;  2FRC A;  2N9J A;  2OZ1 B;  1R0Q A;  1OCD A;  4NFG B;  3SXT A;  4FB1 A;  2N18 B;  4WQ8 A;  3TF5 A;  4EID A;  4PW9 B;  1F1C A;  1P84 D;  1IZL 0;  1DVV A;  2BCN B;  1AKK A;  1C6S A;  1LFM A;  1DII C;  2GIW A;  3L70 D;  1C6R A;  1CXA A;  5CIB B;  1YCC A;  1COT A;  3RN0 A;  3TGU D;  1HZV A;  4EIF A;  1HCM A;  2LIT A;  4H0K A;  3A9F A;  1SQV D;  2CA3 B;  1IO3 A;  1SQX D;  4J20 A;  4Y5R A;  2N3Y A;  3CP5 A;  5KLV D;  1HJ5 A;  1GDV A;  3PXW A;  1CYI A;  5EXQ A;  1DVH A;  1GJQ A;  2RN0 A;  351C A;  3BCC D;  5CIF B;  4L3H A;  1I6E A;  2Y0D A;  2ZBO A;  1SQB D;  2ZON G;  1DW3 A;  3H1H D;  4PWA A;  2V07 A;  2JWA A;  3ZBM A;  1A56 A;  3WUI A;  1DW1 A;  2AIU A;  4A7P A;  1MG2 D;  1A8C A;  2LIR A;  5B6Q A;  2ZZS 1;  3VNW A;  1NNO A;  1EB7 A;  4WQ7 A;  1YTC A;  1C7M A;  1PPJ D;  1CRI A;  2BGV X;  4EIC A;  1GU2 A;  3H1J D;  1CIH A;  3PH2 B;  2OZ1 A;  3TYI A;  1HJ3 A;  2CE1 A;  1W2L A;  1OAE A;  2C1D B;  2YCC A;  1KV9 A;  2DVH A;  4GYD A;  451C A;  1KB0 A;  2V08 A;  4EIE A;  1CHJ A;  4IL6 V;  4Q5P A;  4JCG A;  2B12 B;  2AI5 A;  2N9Y B;  1M70 A;  1FJ0 A;  3CYT I;  3JBT B;  3WU2 V;  2DGE A;  3CU4 A;  1WVE C;  4L1Q A;  1N9C A;  2K9J B;  3H1L D;  3NBS A;  1CED A;  3ZOX A;  1AOF A;  3O0R C;  1KX7 A;  4FA4 A;  2C8S A;  4GED B;  1H33 B;  2B4Z A;  1C2R A;  1ZZH A;  1A2S A;  1CRC A;  1VYD A;  4LJI A;  4AAL A;  1MZ4 A;  2QJP B;  5KLI B;  2IBZ D;  1HRO A;  1CSX A;  3TDK A;  2D0S A;  4FA1 A;  1AYG A;  3A0B V;  4RJT A;  1FI9 A;  3CXH D;  1H9X A;  2PCC B;  1CTZ A;  2BPB B;  5DJQ B;  5H2F V;  1MG3 D;  3M97 X;  4WQE A;  2BH5 X;  5CIE B;  2C1D A;  2C1U A;  3CX5 D;  1YFC A;  1DIQ C;  4WQC A;  4N0K A;  5E79 V;  4QAO A;  1DW0 A;  2GB8 B;  1QKS A;  1CO6 A;  3VYM A;  4FA5 A;  2QJY B;  3GG2 A;  1L9B C;  2BCC D;  2GC7 D;  1NMI A;  4H0J A;  1YEA A;  4O1Q A;  1KX2 A;  1I54 A;  1LC1 A;  2C1V A;  1CTJ A;  1WEJ F;  2CE0 A;  1GKS A;  1EZV D;  1CCH A;  1CHI A;  1CIF A;  1KYO W;  1H33 A;  1U74 B;  2AXT V;  1IRV A;  3OA8 B;  4D6T D;  3CXH W;  3PTZ A;  1BE3 D;  1FCD C;  3HQ9 A;  5DF5 A;  3KHU A;  2BH4 X;  1CNO A;  4FAV A;  3L72 D;  1CRH A;  3ZOO A;  1LMS A;  4FA9 A;  1CIG A;  3H1K D;  5AUR A;  2CA4 B;  1B7V A;  2BLF B;  1BGY D;  3O5C A;  3WFD C;  5KAF V;  1CSV A;  3CX5 W;  1S5L V;  4WQB A;  1N90 A;  1S6V B;  3DR0 A;  1I5T A;  3L4O A;  5C9M A;  1NU1 D;  1L0N D;  2XTS B;  1I55 A;  2A06 D;  1PP9 D;  1KIB A;  3L4M A;  1I6D A;  2RMZ A;  1HJ4 A;  1CYC A;  5C0Z A;  3RN1 A;  3WFC C;  3HQ8 A;  2ORL A;  5B5E V;  4V2K A;  1J3S A;  1NML A;  2QG4 A;  2I8F A;  4FAN A;  3GW6 A;  5B66 V;  1CSU A;  2ZOO A;  2CXB A;  1CXC A;  4XXL A;  5KKZ B;  1HZU A;  1SQQ D;  3NBT A;  2Y0C A;  2L4D A;  3WFB C;  3OCD B;  1KYO D;  1SQP D;  2YIU B;  1GIW A;  4P4Q B;  3KZI V;  4K3I A;  3MK7 C;  2MTA C;  3PXS A;  1NIR A;  3OA8 A;  1JDL A;  1QL4 A;  3H1I D;  2B11 B;  3HQ6 A;  1CRG A;  2Y0E A;  1NTZ D;  1CYJ A;  155C A;  3ZOW A;  3ZCF A;  2B10 B;  2FWL A;  3DP5 A;  1L9J C;  3MK7 B;  3SJL A;  1K3G A;  3SLE A;  1N50 A;  1H32 B;  1CC5 A;  1I8O A;  4L3G A;  4UB8 V;  1C2N A;  1W5C T;  1H9Y A;  1E8E A;  3ORV A;  2Q3E A;  4AX3 A;  2O3J A;  2N9I A;  1YNR A;  4XYD B;  1LS9 A;  4EDF A;  2D0W A;  1RAQ A;  3PXT A;  1C52 A;  4U3F D;  3VRD A;  1CSW A;  3L71 D;  1F1F A;  3ZOY A;  4UB6 V;  3CWB D;  3FWL A;  5GTI V;  1NTM D;  1QN2 A;  3L75 D;  1FI7 A;  2L91 A;  3VMA A;  1CHH A;  3RMZ A;  2JQR A;  5CIH B;  2C9X B;  1RZ6 A;  5CID B;  3RLM A;  3OCD A;  1L0L D;  5CIC B;  3SVW A;  1CCR A;  2PCB B;  1CRJ A;  1E2R A;  3WFE C;  4WQ9 A;  1IRW A;  1BL9 A;  3PLN A;  2FYU D;  2GC4 D;  2YK3 A;  1YEB A;  2C2C A;  1H31 B;  2N3B A;  2JTI B;  5GTH V;  1YIC A;  5CIG B;  1H32 A;  3O1Y A;  3SWS A;  2KS1 A;  1E29 A;  2B0Z B;  4WQD A;  2EXV A;  1ETP A;  4RSZ A;  1NTK D;  2ZXY A;  4PJ0 V;  4AAN A;  3DMI A;  4PD4 D;  1IQC A;  1N15 A;  1BCC D;  1C75 A;  3WC8 A;  1COR A;  4AAO A;  4KMG A;  1DT1 A;  4WQA A;  1GQ1 A;  4YE1 A;  3L74 D;  3L73 D;  1FHB A;  5DFS A;  4DY9 A;  1DW2 A;  3C2C A;  5IY5 1;  1KB9 D; 
#chains in the Genus database with same CATH topology
 1VQK P;  3NWV A;  1M60 A;  4QMA A;  1I8P A;  1RAP A;  3O20 A;  1LWU C;  3H32 A;  1M57 D;  5TJH A;  2OYH B;  1H1O A;  3ZIY A;  1CW5 A;  2OTJ P;  2VHD A;  2YQB A;  4DJG A;  2R32 A;  2FYN B;  2Z5I A;  2KNC B;  5CYT R;  2MHM A;  2R5D A;  1K73 Q;  2FRC A;  2N9J A;  2WZ7 A;  1R0Q A;  3IR9 A;  4NFG B;  1FDI A;  1PGO A;  3T97 A;  1M56 D;  2N1T B;  4Y99 B;  1P84 D;  1A02 F;  1IZL 0;  2W27 A;  3Q1M A;  4TT3 H;  1LFM A;  3CWB G;  5KAI H;  1C6R A;  1FZE A;  1HZV A;  4EIF A;  1NTM G;  2LIT A;  3FXE A;  2O01 H;  2Q9I A;  3A9F A;  3P8C E;  5AVY B;  2OYI A;  3C8V A;  4J20 A;  3L70 E;  1MZ9 A;  5KLV D;  1JY2 O;  1KQG B;  1KB9 I;  1DVH A;  1NAF A;  2D2C C;  3QH9 A;  351C A;  1SQX E;  2ZVN B;  3H32 B;  5CIF B;  5EFW B;  2O1J A;  2Y0D A;  2ZBO A;  1KB9 H;  3OA7 A;  1KIL B;  2Y9Y A;  3H1H D;  1S3J A;  1A56 A;  2WPR A;  4A7P A;  2FYZ A;  1H8A A;  2LIR A;  2ZZS 1;  1KIL E;  1DEB A;  2WMM A;  1PGP A;  4H44 B;  4KT0 J;  3A7O A;  4Y28 J;  1Q81 Q;  3R4Y A;  3KXD A;  1SQQ J;  3H1J D;  4K35 A;  3AEA C;  2OZ1 A;  1PPJ E;  2CE1 A;  4WY4 B;  3B5N A;  2OGU A;  5APT A;  2DVH A;  1P84 I;  451C A;  2Z4E A;  3WUT A;  3F89 A;  2BAS A;  1NHL A;  1P84 H;  1RF1 A;  2N9Y B;  1FJ0 A;  5AW6 B;  3P32 A;  1SFC D;  3JBT B;  1N73 B;  1TU3 F;  3C1L A;  1QGK B;  2QJP C;  3CU4 A;  5KLI C;  2XU6 A;  3PJS K;  1CED A;  1NTZ G;  3ZOX A;  1DD4 A;  1YQ4 C;  4R4M A;  4GT1 A;  2B4Z A;  1C2R A;  1ZZH A;  1JB0 J;  3H1L E;  1Z56 A;  1MZ4 A;  2YXR B;  1G2C A;  4H13 B;  1S72 P;  5BU5 A;  4YXW H;  1HRO A;  3AE8 C;  3TDK A;  1AYG A;  1JTH A;  2K37 A;  1PV3 A;  2PCC B;  3TNU B;  2BPB B;  1PL5 A;  2ZXE B;  1ZME C;  2Q6Q A;  2ZYD A;  1Q86 Q;  2B88 A;  3TGU G;  3CC4 P;  3P8C D;  2C0W A;  1LT9 C;  1IC2 A;  1IO4 A;  3USS A;  3CX5 D;  4WQC A;  5E79 V;  2ZYA A;  2R5B A;  2GB8 B;  1QKS A;  1CO6 A;  3M9H A;  3VYM A;  1HUC A;  3VN0 A;  2ZYG A;  4YXD C;  1NU1 J;  1K9M Q;  4H0J A;  3EQ2 A;  1KIL D;  2C1V A;  1WEJ F;  1CHI A;  1CIF A;  1J1E C;  5H2F H;  1IRV A;  2JP3 A;  1QL1 A;  1NTM E;  3CXH W;  3PTZ A;  3CCQ P;  3HQ9 A;  1FCD C;  4FAV A;  4H44 D;  1CRH A;  4D6T E;  2WT7 A;  1N8R Q;  1BE3 E;  5AUR A;  1BCC G;  1HH0 A;  1DX7 A;  4RKU J;  2LKM A;  3II6 A;  1BGY D;  4EI2 A;  3L73 G;  2FY8 A;  4L73 A;  1UIX A;  3H1K E;  1S6V B;  1IFD A;  1GL2 A;  1NU1 D;  1OW7 A;  3CX5 I;  2KB7 P;  1PP9 D;  2I1K A;  4U7J A;  5CMZ A;  1QVF O;  2K1A A;  3V5B A;  5C0Z A;  3CX5 H;  1L0N E;  3RN1 A;  3WFC C;  2ORL A;  4V2K A;  2A06 E;  3HE4 A;  2I8F A;  3KZI E;  4PV1 B;  1NKN A;  1KFN A;  1CSU A;  2ZOO A;  2HFE D;  2IBZ G;  5KKZ B;  1HZU A;  1YIJ P;  4L75 A;  3NBT A;  2L4D A;  3OCD B;  1KYO D;  1SQP D;  2YIU B;  2E76 B;  3Q5S A;  4H13 D;  3D6Z A;  3GF3 A;  1SQV J;  3MK7 C;  5KAF H;  2H43 A;  3OA8 A;  4IFD K;  1KV4 A;  2NZ2 A;  1GTW A;  1CYJ A;  2GUS A;  4HYT B;  3BCC J;  2FWL A;  3H1I E;  3H6P A;  1K8A Q;  3R2P A;  1SQB J;  1W2B O;  3CLQ A;  1NTZ E;  3SLE A;  2QM7 A;  4L3G A;  4UB8 V;  1Y47 A;  3P8M C;  5CCG A;  5AVU B;  1CI6 A;  1N7S B;  1VQ9 P;  1LP1 B;  1H89 A;  2N9I A;  1M1J B;  1ZOY C;  5K5G B;  3D71 A;  2HYN A;  4C7R A;  1AA0 A;  3O6Q B;  2FYU K;  3HUS C;  2PAJ A;  5KJ7 A;  1FDM A;  3ZOY A;  1LTJ C;  3SWF A;  2GM4 A;  3LW5 J;  1PZQ A;  3CWB D;  1VQN P;  1NTM D;  1QN2 A;  1AVO A;  2L91 A;  3KYQ A;  3WUV A;  3RL0 B;  1KYO I;  3L72 G;  2XKM A;  1ZR4 A;  2E43 A;  2PCB B;  1KYO H;  1IFJ A;  3RK3 C;  3LIE A;  1EDJ A;  2WIT A;  3HD7 B;  3PLN A;  3VTP C;  3AE5 C;  2GA1 A;  5CJ4 A;  2R3C A;  4I6M C;  1H32 A;  3SWS A;  4WQD A;  4UB6 H;  3U59 A;  2ZXY A;  3CCV P;  1HTL C;  3FXD A;  3Q5R A;  4PD4 D;  5KAI E;  3AE4 C;  1URQ B;  4YE1 A;  1SQQ G;  1EDI A;  4I2L C;  4AQR D;  4PV1 D;  5KTB A;  4JF7 A;  1BCC E;  5IY5 1;  3W68 A;  2FXO A;  1SP4 A;  1RF0 C;  1HH7 A;  1RZ5 A;  1N86 A;  1NWQ A;  3X39 A;  2JEE A;  3AEC C;  3L74 E;  3L73 E;  4BRY B;  2NPS C;  5TIS V;  2ZAE B;  2QJK B;  3TGU J;  4K3A A;  1LGH B;  2R44 A;  1M6Z A;  1KB9 E;  3GHG A;  3MP7 B;  5BVZ A;  2E76 D;  2RKL A;  1CRY A;  1MFZ A;  3WUU A;  1VDF A;  3AEE C;  1AOQ A;  4IOI H;  2PAC A;  4O1W A;  3TK1 A;  2QM8 A;  2YO2 A;  5DJQ C;  5KLV K;  1LWU B;  2BCC J;  1FOC A;  1VQM P;  4PJ0 H;  2SPZ A;  3IN6 A;  4JYB A;  1ZRT D;  1FZC C;  1QYZ A;  1FI3 A;  1H31 A;  1T6A A;  1OCD A;  1IZN B;  1NYH A;  5GTI E;  1N7S D;  2C0X A;  2L5G B;  1JY3 P;  2B87 B;  1DVV A;  1AKK A;  1DII C;  1FOS F;  4NPD A;  1EXJ A;  1N7L A;  3LW5 H;  4PD4 I;  1COT A;  3AE7 C;  3TGU D;  1HCM A;  1P84 E;  1EQ7 A;  1S9K D;  3EFG A;  3EFF K;  4PD4 H;  1SFC A;  2Q7C A;  1GJQ A;  1BSH A;  4R4L A;  3M0D C;  3RL0 D;  1NKZ B;  5KLV E;  2IZ0 A;  5CCH C;  3CCM P;  4PWA A;  4XFJ A;  3WUI A;  2D2C B;  1A8C A;  5B6Q A;  3H1H E;  1NU1 G;  3MUD C;  1VF5 D;  2KIK A;  2W83 C;  2OYH A;  1JCC A;  1GK6 A;  1EB7 A;  1YTC A;  2FXP A;  1WMK A;  1CRI A;  1KB9 D;  3D70 A;  2QIW A;  2KNC A;  2H8P D;  2AEJ A;  1KC8 Q;  3M0A A;  1CIH A;  3TYI A;  1W2L A;  1OAE A;  1Q90 D;  2C1D B;  2YCC A;  2N1T A;  3CME P;  4GYD A;  1OXZ A;  2BEZ F;  2KUB A;  3A0H E;  1CHJ A;  4IL6 V;  4DOJ A;  1URQ D;  2B12 B;  2AI5 A;  5APS A;  2I8D A;  1X0T A;  3WU2 V;  2P58 A;  5APW A;  1WVE C;  3S1K A;  3NBS A;  5AW0 B;  4IFM A;  3E1R A;  1CZQ A;  1AOF A;  2C8S A;  1RE4 A;  3MHV A;  1KIL A;  1Q82 Q;  1VYD A;  2HG5 D;  1SQX K;  4I1L A;  4U3F J;  5H2F E;  2QJP B;  5KLI B;  3L71 J;  2IBZ D;  4Z1M H;  1CSX A;  1GK4 A;  1RQU A;  1QVG O;  4FA1 A;  3A0B V;  1FI9 A;  1H9X A;  3L75 J;  1CTZ A;  1MG3 D;  1YIT P;  1L4A C;  1FJP A;  1L0L J;  1S1C X;  1SQV G;  4WY4 A;  2HR3 A;  2QJY C;  3L72 J;  2J5U A;  2FFD C;  4N0K A;  4NPF X;  1GW3 A;  3BCC G;  1AVY A;  4C7N B;  3CX5 E;  3MIW A;  3Q5P A;  3AE1 C;  1SQB G;  1HJ0 A;  3GG2 A;  1YBK A;  1N73 A;  1NMI A;  1YEA A;  1OW8 A;  4O1Q A;  1LC1 A;  4BWN A;  4EIJ A;  1NTK J;  2CE0 A;  1JY2 N;  1CCH A;  1KYO W;  2Q5U A;  4B86 A;  3SSU A;  2AXT V;  2D2C D;  2IBZ I;  3NFQ A;  5KAF E;  3HE5 B;  3L72 D;  4OH8 B;  3ZOO A;  2LXC B;  5E79 H;  5AVS B;  1J1E B;  1CIG A;  1FOS E;  2CA4 B;  3TNU A;  4I7Z C;  1RE3 C;  1MV8 A;  1SQP K;  1S5L V;  3D0W A;  3DR0 A;  1I5T A;  3V6I A;  1BGY E;  1KIB A;  3L4M A;  3BAT A;  1NVO A;  1NU1 E;  1W5C E;  5B5E V;  2AEM A;  2VRS A;  2WQY C;  1PP9 E;  2QG4 A;  2ZXX A;  4FAN A;  3CC7 P;  1R5L A;  5B66 V;  2KI7 B;  1H88 A;  2YKQ A;  2V4H A;  1NAY A;  2WWW A;  1U57 A;  2CXB A;  1KOR A;  1HF9 A;  2J58 A;  1SQQ D;  2Y0C A;  3WFB C;  3CD6 P;  3L70 J;  1GIW A;  1Q7Y Q;  1VQ8 P;  3HTK A;  1KZU B;  1KYO E;  1SQP E;  1JDL A;  2Y0E A;  1VQL P;  2M5A B;  1H0T B;  3ZCF A;  1R5S A;  1NTM K;  2YMY A;  3VYI A;  3MK7 B;  2KS1 B;  1Y8A A;  3RK2 C;  2HLO A;  1W5C T;  2P67 A;  1H9Y A;  3M06 A;  2Q3E A;  4UB6 E;  3B8E B;  2HOD B;  4H0L C;  1FZB A;  1YNR A;  3AEF C;  3SFE C;  2BCC G;  3P7K A;  1BDD A;  1C52 A;  1X8Y A;  3VRD A;  4N78 E;  2QSI A;  4GOE A;  2Z5H A;  1EZV G;  3L35 A;  2W8Z A;  2XNX A;  2O1K A;  2KP8 A;  2IZ1 A;  1L0N K;  3FWL A;  5GTI V;  4WWI A;  4GDO A;  3VP8 A;  1S5L X;  4CPG A;  1YJW P;  1KFM A;  3HUS B;  1CHH A;  3CWB E;  2ZJS E;  3SWY A;  2C9X B;  3HTK B;  1FE6 A;  1RZ6 A;  1X79 B;  1LTJ B;  4ASV A;  3OCD A;  3AED C;  1OW6 A;  1JY2 P;  3BCC E;  4UB8 H;  1CRJ A;  3WFE C;  3L36 A;  4EOT A;  4WQ9 A;  1RY3 A;  1BL9 A;  1OVV A;  3V2P A;  2PP6 A;  1W2E A;  4WY4 C;  4PJ0 E;  1T3J A;  1KD1 Q;  4JPZ B;  2P10 A;  5GTH V;  1FZA A;  2OYI C;  1GD2 E;  2WVR A;  1E29 A;  2LXB A;  1NTZ K;  1N7S A;  4KJM A;  3CL3 D;  1N73 C;  1LP1 A;  1BSN A;  1M1J A;  2WTY A;  3GMA A;  1C75 A;  1OVR A;  1GU5 A;  3CCR P;  4WQA A;  3O6Q A;  4PD4 E;  1YJN P;  2Q3I A;  3M91 A;  5APV A;  1GU4 A;  5AW4 B;  1QEX A;  2OQQ A;  5APX A;  2RH0 A;  3A0H V;  1LC2 A;  1C6O A;  3PHL A;  1IFM A;  2B89 A;  3V2N A;  3LID A;  2P1J A;  4AAM A;  2NPS B;  3B5N C;  1QL3 A;  3FWN A;  1FJK A;  4N3Y B;  2N18 C;  1U7J A;  2IPP A;  1FZG A;  1FBM A;  1USD A;  3G3Z A;  1YIQ A;  1JMB A;  4MU8 A;  3HD7 A;  5CBO A;  1HRC A;  2YMK A;  2KK7 A;  1JY3 O;  2AEF A;  1RF1 C;  3AE9 C;  1AFO A;  3SXT A;  2YNY A;  1GW4 A;  2ZVO B;  4U3F G;  4N78 D;  1ZRT E;  4RES B;  2WPV B;  3L71 G;  4D6T J;  1AV1 A;  1BE3 J;  5DJT B;  1FZC B;  1FAV A;  2GIW A;  5TIS H;  1PFI A;  5CIB B;  1CXA A;  4L76 A;  3L75 G;  4H0K A;  2W90 A;  3H1K J;  1SQV D;  1URQ A;  2CA3 B;  4LC1 A;  2N3Y A;  2R3S A;  1GDV A;  3TGU E;  2BEQ D;  1GZL A;  4MN4 C;  1L0L G;  1S9K E;  1MFT A;  2E75 C;  3BCC D;  2JKV A;  1BDC A;  1SVF A;  4L3H A;  1I6E A;  4BRY A;  1SQB D;  1DW3 A;  3O8Z A;  2JWA A;  2FXM A;  1PGJ A;  2BCC E;  1LTG C;  2P7J A;  1DW1 A;  2WSE J;  3SFD C;  1VF5 B;  3VNW A;  3NMD A;  4HJG H;  1NNO A;  1M7L A;  1C7M A;  3CI9 A;  1LWU A;  2NRG A;  5DJU B;  1E79 H;  4WVZ A;  4KHX A;  1NTK G;  5APQ A;  3RK3 D;  3AE3 C;  3F5H A;  1HJ3 A;  5AVV B;  3PP5 A;  1T2K C;  1IFN A;  1KV9 A;  3IF4 A;  1KB0 A;  2B87 A;  1PIX A;  2V08 A;  4EIE A;  4O9B A;  2OYO A;  2A45 H;  1OZH A;  3CYT I;  2P2U A;  1XTG B;  3A5T A;  1VQP P;  1OIP A;  4TLF A;  2DGE A;  2K9J B;  2IYO A;  2QVA A;  3CCU P;  3O0R C;  4GED B;  1H33 B;  1LJ2 A;  1YHQ P;  1KTM A;  1YTZ T;  4LJI A;  4AAL A;  2NPS D;  3JSV C;  1JUN A;  1DIP A;  4ZKP A;  3ABV C;  2D0S A;  4ZNC A;  1GL2 C;  3CXH D;  2IBZ E;  3N4X A;  2ZT9 C;  1DD3 A;  1J2J B;  4IL6 H;  1NH4 A;  1QLE D;  3BRT B;  3L70 G;  1IJD B;  4GKG A;  3WU2 H;  4DT0 A;  4OGQ C;  3RL0 g;  2XDJ A;  4WQE A;  2C1D A;  2C1U A;  1YFC A;  4QAO A;  1VQ5 P;  2PGD A;  1Q2N A;  1L4A B;  2WSF J;  2FYU J;  1HWT C;  2DW3 A;  4L74 A;  2QJY B;  1RH5 B;  4HH2 A;  2FFD B;  4C46 A;  2BCC D;  2QRX A;  4W7Z A;  1YQ3 C;  1RQV A;  3A3Y B;  2Y9Z A;  1RHZ B;  3A0B H;  1KX2 A;  2KSE A;  3VOP A;  2WSE H;  4AUW A;  1GKS A;  3L71 E;  1EZV D;  3N7N A;  2KYV A;  1U7M A;  4M3L A;  1PPJ G;  2KLU A;  1U74 B;  3MGN A;  3HD7 C;  2V7Q J;  1JO5 A;  1J1D C;  3L74 J;  2I1J A;  4DCK A;  5DF5 A;  3KHU A;  5CCG C;  1CNO A;  5CCH D;  3SWK A;  3CXH I;  1IFI A;  2UWJ E;  2YKO A;  4FA9 A;  1L0L E;  3A2A A;  1JEK A;  3VMY A;  3CXH H;  3L72 E;  2M8R A;  1SQQ K;  2E74 C;  3O5C A;  5KJ7 C;  1VPC A;  3CX5 W;  1SS1 A;  3L4O A;  3UIA A;  1KQS O;  1JOC A;  5C9M A;  2YO3 A;  2XTS B;  2HPC B;  4WB4 A;  1I6D A;  4I7Z B;  2C9N Y;  4ASW A;  3H1L G;  1CYC A;  3S9O A;  3HQ8 A;  1M90 Q;  2E74 D;  3CMA P;  4C7N A;  1ZR2 A;  5C39 A;  2AXT H;  1UII A;  3GW6 A;  3CCL P;  2G8Y A;  2B9B A;  1YTZ I;  1HVV A;  3AEG C;  3BVH A;  1EZV I;  3L4F A;  1VL2 A;  4P4Q B;  3KZI V;  1SQQ E;  1NGM B;  2MTA C;  1S5L H;  3E1I A;  3PXS A;  1NIR A;  1EC5 A;  2WSC J;  1K05 A;  4GOD A;  1DH3 A;  4UB8 E;  5KLV J;  1QL2 A;  4HKZ H;  2B11 B;  2G3A A;  4LLH A;  3HQ6 A;  2A45 G;  3G71 P;  3HE5 A;  2B10 B;  3DP5 A;  1ZV8 A;  1L9J C;  5B5E H;  3SJL A;  1N50 A;  3H1H J;  1CC5 A;  2WSF H;  1I8O A;  3BAS A;  1E8E A;  3MD0 A;  3ORV A;  1G1J A;  5B66 H;  2O3J A;  2YKP A;  4XYD B;  1L4A D;  3FX0 A;  1LS9 A;  4EDF A;  1LT9 B;  5BU8 B;  1WT6 A;  1RAQ A;  3PXT A;  3GHG C;  4U3F D;  1SLQ A;  4NPE A;  3RK2 B;  3L71 D;  1F1F A;  1NO4 A;  3H1J J;  1WRG A;  4H0L B;  1NU1 K;  4ZMD A;  1EXI A;  4D6T G;  2V7Q H;  3L75 D;  3Q2Y A;  3VMA A;  1BE3 G;  4IL6 X;  3AE2 C;  5CID B;  2N9B A;  4GIF A;  1L0L D;  5CIC B;  3H1K G;  1CCR A;  2PRR A;  1X22 A;  5AVT B;  1M8O B;  3G9R A;  3PH0 A;  1IRW A;  1KMI Z;  3L37 A;  5AW8 B;  2GC4 D;  1GDT A;  2YK3 A;  1YEB A;  1L0N G;  2M5A A;  1H0T A;  2QE7 H;  2A06 G;  2N3B A;  3JCU H;  3T97 B;  4JYC A;  3CCJ P;  1YIC A;  2IX7 C;  2KS1 A;  2CPS A;  2E5T A;  1YI2 P;  2B0Z B;  1KN7 A;  1SFC C;  2XV5 A;  1ETP A;  5GTI H;  1NTK D;  2E42 A;  3DMI A;  2HOD A;  5TIS E;  1IQC A;  1N15 A;  1VQ7 P;  3ZDM A;  3WC8 A;  4AAO A;  2OYI B;  1DT1 A;  1IK9 A;  3V4W A;  1GQ1 A;  1FHB A;  1DW2 A;  3C2C A;  3V4Q A;  2OYH C;  2CK3 H;  1U75 B;  5KAI V;  3IAO A;  3H1I G;  2WSC H;  2HV4 A;  2M3E A;  3HUS A;  3K5B A;  2CPB A;  1T8Z A;  2FYN C;  1SQX J;  1K3H A;  3CPW O;  1LTJ A;  3ITK A;  1M1K Q;  5GTH H;  4N6J A;  1MKM A;  1SQV K;  4LGD E;  3PRJ A;  2JDI H;  1CTY A;  2N1T C;  3I5C A;  4Y99 C;  1CIE A;  3S4R A;  4W80 A;  3H25 A;  2W6A A;  3OJA B;  3HQ7 A;  2OZ1 B;  4ZKU A;  1MUU A;  1SQB K;  3G4S P;  3W67 A;  4FB1 A;  1OMI A;  3B5N B;  2N18 B;  4WQ8 A;  5AVX B;  3TF5 A;  4EID A;  4PW9 B;  2N1T D;  1F1C A;  3CC2 P;  2BCN B;  1C6S A;  2C9L Y;  1RF1 B;  3L70 D;  1YCC A;  1ZP0 C;  2ZFC A;  3RN0 A;  1LTT C;  1EDL A;  3A0H H;  3RK2 D;  1RE4 C;  1KIL C;  5CJ0 A;  4Y5R A;  1IO3 A;  1SQX D;  1K04 A;  4W7Y A;  2WPS A;  3CP5 A;  4H0L D;  1HJ5 A;  1BGY J;  2POH A;  3PXW A;  1CYI A;  5EXQ A;  1XTC C;  1OFC X;  1SQV E;  2KSJ A;  2RN0 A;  3KPE A;  1AJY A;  1PP9 J;  2ZON G;  2W6J H;  4H44 C;  3I55 P;  3JC2 2;  2FYU G;  1YYC A;  1VQ4 P;  1G2C B;  2V07 A;  3ZBM A;  1KQF B;  5APU A;  2AIU A;  1MG2 D;  1SQB E;  1RF0 A;  2E75 B;  2JO1 A;  1JTH B;  3AEB C;  3H1L J;  3MTU E;  3VP9 A;  2NPS A;  5AVZ B;  4WQ7 A;  3M9Q A;  2H88 C;  1ZXG A;  1PPJ D;  3KQG A;  4XE5 B;  3RK3 B;  1HBW A;  1LNQ A;  4IL6 E;  2FBW C;  2BGV X;  4EIC A;  1GU2 A;  1SQP J;  3PH2 B;  2K9Y A;  3EWK A;  3WU2 E;  4WBA A;  3RK3 E;  3V2Q A;  3L74 G;  4WY4 D;  1S4X A;  2MKV A;  1NOH A;  5APY A;  2KOG A;  1FZC A;  4Q5P A;  4JCG A;  1M70 A;  1G1I A;  1EDK A;  1AQT A;  2AXC A;  5AW2 B;  5CBN A;  2M0B A;  1FC2 C;  1OWA A;  1T3U A;  4L1Q A;  4H13 C;  1N9C A;  4OVN F;  3H1L D;  1OX3 A;  2KZJ A;  3A0B E;  1KX7 A;  4FA4 A;  2OTK E;  1A2S A;  2OTL P;  1CRC A;  2QA4 P;  2XZR A;  4JBZ A;  1NJI Q;  4OWF A;  1X9V A;  5L8R J;  5AW9 B;  3M0D A;  2WT7 B;  3CWB J;  4RJT A;  3RBZ A;  1NTM J;  2YXQ B;  5CCH A;  1IFP A;  5DJQ B;  1LTB C;  5H2F V;  2KXP B;  3M97 X;  3B5N D;  3CXH E;  1A02 J;  1GL2 B;  4XA4 A;  3MUD A;  1JY3 N;  2PFX A;  3I56 P;  3GLM A;  2BH5 X;  5CIE B;  2ZT9 B;  1DIQ C;  4DZO A;  5KLV G;  1DW0 A;  1HJB A;  2MJZ A;  4FA5 A;  4OGQ B;  2KLV A;  4EYY Q;  3HE4 B;  2AXT E;  1R8E A;  3H1H G;  3V2R A;  1L0N J;  3CCS P;  1JM0 A;  1L9B C;  2E5Y A;  2GC7 D;  2IYP A;  5AW1 B;  2K9J A;  3U1C A;  1I54 A;  3NXS A;  2K3R A;  1CTJ A;  1FZF A;  2ITA A;  3CCE P;  1H33 A;  2Q1K A;  2WPQ A;  1Y9B A;  1D7M A;  3OA8 B;  1YJ9 P;  2E75 D;  4D6T D;  1EZV E;  5AW3 B;  3H1J G;  1BE3 D;  1S5L E;  1JCD A;  2BH4 X;  1HGV A;  3C9I A;  3RBX A;  1N2D C;  1DEE G;  4YTP C;  1LMS A;  5AW7 B;  3B71 A;  3H1K D;  1B7V A;  2BLF B;  1J1D B;  3GF7 A;  5B5E E;  1VQO P;  3WFD C;  5KAF V;  2A45 I;  1CSV A;  3E7K A;  4WQB A;  1N90 A;  3H1I J;  1CI6 B;  3RGU A;  2FYU E;  1QX8 A;  1ZN5 A;  1L0N D;  1NTZ J;  1I55 A;  1ZW0 A;  3NTN A;  3FGA D;  4PV1 C;  2A06 D;  5B66 E;  1CSB A;  2WSS H;  3HRN A;  2RMZ A;  1HJ4 A;  2E74 B;  1E5W A;  5KKZ C;  1L4A A;  4YPC A;  1J3S A;  1T2K D;  1NML A;  2YIU C;  5M1B A;  2E76 C;  1FU1 A;  3VMX A;  1LTS C;  3KDP B;  2FFD A;  1KQL A;  3OAK A;  2H7H A;  1OVU A;  1CXC A;  3MZW B;  4XXL A;  1ZLL A;  1USE A;  3D6Y A;  4K3I A;  1FDO A;  3B4S A;  1QL4 A;  3H1I D;  5E79 E;  3G6E P;  1CRG A;  2IDB A;  1NTZ D;  1AQ5 A;  155C A;  3ZOW A;  1N7S C;  1PGQ A;  5AW5 B;  1VQ6 P;  2LR2 A;  4JQ0 D;  1M1J C;  1K3G A;  3BRV B;  1SQX G;  2IFN A;  1GL2 D;  1H32 B;  3JCU E;  1C2N A;  1LT1 A;  3U1A A;  1L0L K;  2ZT9 D;  4AX3 A;  2J59 M;  4GOF A;  2QEX P;  2HPC A;  1JNM A;  2D0W A;  4OGQ D;  1RE3 A;  2GUV A;  3RL0 C;  1CSW A;  2FKW B;  3KZI H;  2H89 C;  4RO0 A;  4IFF A;  1LTA C;  4UB6 V;  4U3F E;  3OW2 O;  2O01 J;  2K88 A;  1JMM A;  1FI7 A;  3GHG B;  3RMZ A;  2JQR A;  1BCC J;  5AVQ B;  5CIH B;  1VF5 C;  2O01 N;  1NTK K;  3RLM A;  3L73 J;  3L75 E;  3WMM 0;  3SVW A;  3M9B A;  3AE6 C;  1L2P A;  1IK7 A;  5GTH E;  1FS0 E;  1E2R A;  1BGY G;  2FYU D;  2JWD A;  1HGZ A;  3QWO C;  2C2C A;  3HD7 D;  1H31 B;  4AYC A;  1PP9 G;  3IFM A;  3VMZ A;  2JTI B;  5AVR B;  5CCG D;  1URQ C;  4HB1 A;  5CIG B;  4BXL A;  3O1Y A;  2OAR A;  3TYY A;  2EXV A;  1GMJ A;  3TSI A;  4RSZ A;  5CHX A;  2KZI A;  4PJ0 V;  4AAN A;  5AVW B;  3H1J E;  5KJ7 D;  1BCC D;  1COR A;  4KMG A;  2QJK C;  1LT9 A;  1LTI C;  1NTK E;  3Q3D A;  2W6B A;  2XND H;  2JJL A;  3L74 D;  3L73 D;  1S2E A;  5DFS A;  4DY9 A;  1SFC B;  2IFM A;  1SQP G;  2JR8 A;  2M3B A; 
#chains in the Genus database with same CATH homology
 1HH7 A;  3NWV A;  1RZ5 A;  1M60 A;  3X39 A;  1I8P A;  1U75 B;  5KAI V;  1RAP A;  5TIS V;  3O20 A;  2QJK B;  2HV4 A;  1M6Z A;  3A0H V;  1CRY A;  1K3H A;  1LC2 A;  1C6O A;  3PHL A;  3ITK A;  1AOQ A;  2PAC A;  4O1W A;  5TJH A;  4AAM A;  1H1O A;  3PRJ A;  1QL3 A;  1CTY A;  2N18 C;  3ZIY A;  5DJQ C;  2VHD A;  2YQB A;  1CIE A;  1YIQ A;  1FOC A;  4MU8 A;  1HRC A;  2FYN B;  2KNC B;  1ZRT D;  5CYT R;  2MHM A;  1QYZ A;  3HQ7 A;  1FI3 A;  1H31 A;  2FRC A;  2N9J A;  2OZ1 B;  1R0Q A;  1OCD A;  4NFG B;  3SXT A;  4FB1 A;  2N18 B;  4WQ8 A;  3TF5 A;  4EID A;  4PW9 B;  1F1C A;  1P84 D;  1IZL 0;  1DVV A;  2BCN B;  1AKK A;  1C6S A;  1LFM A;  1DII C;  2GIW A;  3L70 D;  1C6R A;  1CXA A;  5CIB B;  1YCC A;  1COT A;  3RN0 A;  3TGU D;  1HZV A;  4EIF A;  1HCM A;  2LIT A;  4H0K A;  3A9F A;  1SQV D;  2CA3 B;  1IO3 A;  1SQX D;  4J20 A;  4Y5R A;  2N3Y A;  3CP5 A;  5KLV D;  1HJ5 A;  1GDV A;  3PXW A;  1CYI A;  5EXQ A;  1DVH A;  1GJQ A;  2RN0 A;  351C A;  3BCC D;  5CIF B;  4L3H A;  1I6E A;  2Y0D A;  2ZBO A;  1SQB D;  2ZON G;  1DW3 A;  3H1H D;  4PWA A;  2V07 A;  2JWA A;  3ZBM A;  1A56 A;  3WUI A;  1DW1 A;  2AIU A;  4A7P A;  1MG2 D;  1A8C A;  2LIR A;  5B6Q A;  2ZZS 1;  3VNW A;  1NNO A;  1EB7 A;  4WQ7 A;  1YTC A;  1C7M A;  1PPJ D;  1CRI A;  2BGV X;  4EIC A;  1GU2 A;  3H1J D;  1CIH A;  3PH2 B;  2OZ1 A;  3TYI A;  1HJ3 A;  2CE1 A;  1W2L A;  1OAE A;  2C1D B;  2YCC A;  1KV9 A;  2DVH A;  4GYD A;  451C A;  1KB0 A;  2V08 A;  4EIE A;  1CHJ A;  4IL6 V;  4Q5P A;  4JCG A;  2B12 B;  2AI5 A;  2N9Y B;  1M70 A;  1FJ0 A;  3CYT I;  3JBT B;  3WU2 V;  2DGE A;  3CU4 A;  1WVE C;  4L1Q A;  1N9C A;  2K9J B;  3H1L D;  3NBS A;  1CED A;  3ZOX A;  1AOF A;  3O0R C;  1KX7 A;  4FA4 A;  2C8S A;  4GED B;  1H33 B;  2B4Z A;  1C2R A;  1ZZH A;  1A2S A;  1CRC A;  1VYD A;  4LJI A;  4AAL A;  1MZ4 A;  2QJP B;  5KLI B;  2IBZ D;  1HRO A;  1CSX A;  3TDK A;  2D0S A;  4FA1 A;  1AYG A;  3A0B V;  4RJT A;  1FI9 A;  3CXH D;  1H9X A;  2PCC B;  1CTZ A;  2BPB B;  5DJQ B;  5H2F V;  1MG3 D;  3M97 X;  4WQE A;  2BH5 X;  5CIE B;  2C1D A;  2C1U A;  3CX5 D;  1YFC A;  1DIQ C;  4WQC A;  4N0K A;  5E79 V;  4QAO A;  1DW0 A;  2GB8 B;  1QKS A;  1CO6 A;  3VYM A;  4FA5 A;  2QJY B;  3GG2 A;  1L9B C;  2BCC D;  2GC7 D;  1NMI A;  4H0J A;  1YEA A;  4O1Q A;  1KX2 A;  1I54 A;  1LC1 A;  2C1V A;  1CTJ A;  1WEJ F;  2CE0 A;  1GKS A;  1EZV D;  1CCH A;  1CHI A;  1CIF A;  1KYO W;  1H33 A;  1U74 B;  2AXT V;  1IRV A;  3OA8 B;  4D6T D;  3CXH W;  3PTZ A;  1BE3 D;  1FCD C;  3HQ9 A;  5DF5 A;  3KHU A;  2BH4 X;  1CNO A;  4FAV A;  3L72 D;  1CRH A;  3ZOO A;  1LMS A;  4FA9 A;  1CIG A;  3H1K D;  5AUR A;  2CA4 B;  1B7V A;  2BLF B;  1BGY D;  3O5C A;  3WFD C;  5KAF V;  1CSV A;  3CX5 W;  1S5L V;  4WQB A;  1N90 A;  1S6V B;  3DR0 A;  1I5T A;  3L4O A;  5C9M A;  1NU1 D;  1L0N D;  2XTS B;  1I55 A;  2A06 D;  1PP9 D;  1KIB A;  3L4M A;  1I6D A;  2RMZ A;  1HJ4 A;  1CYC A;  5C0Z A;  3RN1 A;  3WFC C;  3HQ8 A;  2ORL A;  5B5E V;  4V2K A;  1J3S A;  1NML A;  2QG4 A;  2I8F A;  4FAN A;  3GW6 A;  5B66 V;  1CSU A;  2ZOO A;  2CXB A;  1CXC A;  4XXL A;  5KKZ B;  1HZU A;  1SQQ D;  3NBT A;  2Y0C A;  2L4D A;  3WFB C;  3OCD B;  1KYO D;  1SQP D;  2YIU B;  1GIW A;  4P4Q B;  3KZI V;  4K3I A;  3MK7 C;  2MTA C;  3PXS A;  1NIR A;  3OA8 A;  1JDL A;  1QL4 A;  3H1I D;  2B11 B;  3HQ6 A;  1CRG A;  2Y0E A;  1NTZ D;  1CYJ A;  155C A;  3ZOW A;  3ZCF A;  2B10 B;  2FWL A;  3DP5 A;  1L9J C;  3MK7 B;  3SJL A;  1K3G A;  3SLE A;  1N50 A;  1H32 B;  1CC5 A;  1I8O A;  4L3G A;  4UB8 V;  1C2N A;  1W5C T;  1H9Y A;  1E8E A;  3ORV A;  2Q3E A;  4AX3 A;  2O3J A;  2N9I A;  1YNR A;  4XYD B;  1LS9 A;  4EDF A;  2D0W A;  1RAQ A;  3PXT A;  1C52 A;  4U3F D;  3VRD A;  1CSW A;  3L71 D;  1F1F A;  3ZOY A;  4UB6 V;  3CWB D;  3FWL A;  5GTI V;  1NTM D;  1QN2 A;  3L75 D;  1FI7 A;  2L91 A;  3VMA A;  1CHH A;  3RMZ A;  2JQR A;  5CIH B;  2C9X B;  1RZ6 A;  5CID B;  3RLM A;  3OCD A;  1L0L D;  5CIC B;  3SVW A;  1CCR A;  2PCB B;  1CRJ A;  1E2R A;  3WFE C;  4WQ9 A;  1IRW A;  1BL9 A;  3PLN A;  2FYU D;  2GC4 D;  2YK3 A;  1YEB A;  2C2C A;  1H31 B;  2N3B A;  2JTI B;  5GTH V;  1YIC A;  5CIG B;  1H32 A;  3O1Y A;  3SWS A;  2KS1 A;  1E29 A;  2B0Z B;  4WQD A;  2EXV A;  1ETP A;  4RSZ A;  1NTK D;  2ZXY A;  4PJ0 V;  4AAN A;  3DMI A;  4PD4 D;  1IQC A;  1N15 A;  1BCC D;  1C75 A;  3WC8 A;  1COR A;  4AAO A;  4KMG A;  1DT1 A;  4WQA A;  1GQ1 A;  4YE1 A;  3L74 D;  3L73 D;  1FHB A;  5DFS A;  4DY9 A;  1DW2 A;  3C2C A;  5IY5 1;  1KB9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...