1EZVD

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ezvD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ezvD01
351CA 5KLIB 2C1DA 1U74B 1EZVD 3PXTA 1COTA 3SXTA 1SQPD 1SQQD 1FI9A 3ITKA 2B0ZB 1CHJA 2BCCD 4FA4A 3MK7B 1IRWA 1RAPA 3L4MA 1L0LD 1GDVA 4L3GA 2V08A 2AXTV 1B7VA 5CIBB 3TYIA 4NFGB 4N0KA 1SQBD 1KB0A 5E79V 2JQRA 1C6SA 4O1WA 4UB8V 1ZZHA 2C8SA 1NTKD 5C0ZA 2PCCB 3L75D 1I6EA 3OCDA 2N18B 1N15A 1AOFA 4WQ7A 2GIWA 3KZIV 1JDLA 1YFCA 3MK7C 1H32B 1I8OA 1DW3A 1YEAA 1K3HA 4J20A 1CRHA 5CIEB 3ZOYA 2BCNB 3WU2V 1CRJA 4O1QA 1QL4A 1CIEA 4EIDA 5KAIV 1CYJA 1CIGA 1MZ4A 5KKZB 1IZL0 3TDKA 1GU2A 3CX5D 2C9XB 2ZOOA 1HJ5A 1LC1A 3PHLA 2QJPB 3CP5A 1U75B 1M70A 2YCCA 4FB1A 1IQCA 3CU4A 1K3GA 3WUIA 4MU8A 2B10B 1I55A 4AANA 5DF5A 1NMLA 3NBTA 3NBSA 3PLNA 1F1FA 2D0WA 1CHIA 2FRCA 3A0BV 3WFBC 1E2RA 3H1ID 1CRCA 1H1OA 5CIFB 2DVHA 2QG4A 4L1QA 3OA8B 2BH4X 2GC4D 1I8PA 2QJKB 1MG3D 1DIQC 4H0KA 1C6RA 1N90A 3A0HV 3SLEA 5CIDB 3RMZA 1GJQA 4WQ8A 4XYDB 3HQ8A 1NNOA 3NWVA 1NMIA 1CRYA 1HZUA 4U3FD 3RN1A 1YNRA 4P4QB 1CHHA 2IBZD 1A8CA 3DMIA 1M6ZA 1I54A 1H33B 1I5TA 3SVWA 1DW0A 2C1UA 3ZBMA 2FYNB 1HJ3A 1DVVA 4KMGA 1HH7A 1RAQA 1A2SA 2CA4B 1AYGA 1DVHA 1IRVA 2B4ZA 2N3YA 1N50A 5KLVD 3PXWA 2ZXYA 2OZ1B 4UB6V 1LC2A 3WC8A 2QJYB 1DT1A 1CCHA 5CIHB 1H9XA 2JTIB 2I8FA 2ZZS1 2ZBOA 3O20A 4YE1A 1W2LA 4IL6V 4L3HA 3PH2B 3KHUA 3HQ9A 3CX5W 1KB9D 1LMSA 451CA 1SQXD 3L73D 2RMZA 2GC7D 3RN0A 1N9CA 1CYCA 4FA5A 1R0QA 3GG2A 1QYZA 4WQ9A 4WQCA 5CICB 1NTMD 1S5LV 3H1JD 1L0ND 1CYIA 1AKKA 1FHBA 1ZRTD 4WQEA 1CNOA 1CORA 2EXVA 4PW9B 1HRCA 1E29A 1C52A 2L4DA 2YK3A 2Y0EA 2C1DB 3VMAA 2CE0A 1YICA 2V07A 5H2FV 1C75A 1GQ1A 5DFSA 5C9MA 1M60A 1H31A 3L74D 1IO3A 1EB7A 4DY9A 5TISV 1MG2D 1E8EA 1CIHA 5B66V 2MHMA 1CIFA 1AOQA 1HCMA 2MTAC 1PP9D 2N18C 4EIEA 2RN0A 4AX3A 2C1VA 1NTZD 4FA9A 1S6VB 1DW2A 5EXQA 1DIIC 1CTZA 1KV9A 3C2CA 2PACA 3O5CA 4RJTA 4XXLA 3DP5A 2N3BA 2ZONG 3CXHW 3JBTB 1A56A 5GTIV 1VYDA 1W5CT 4WQAA 4QAOA 4RSZA 2B12B 2CE1A 3GW6A 4EICA 1I6DA 1QKSA 4V2KA 3OCDB 3ORVA 1FI3A 3H1HD 1GKSA 3PXSA 2N9YB 3ZCFA 4JCGA 3VYMA 2BH5X 3WFCC 2GB8B 2CA3B 2O3JA 2AIUA 5B6QA 1FJ0A 1C6OA 1C2RA 3ZOOA 4GEDB 4FANA 1BE3D 1FOCA 1LS9A 1KYOW 1H33A 1FI7A 1CXCA 2BLFB 2PCBB 2YIUB 2BGVX 2ORLA 4FA1A 4H0JA 4LJIA 1CCRA 2L91A 5TJHA 3PTZA 3O0RC 4A7PA 3ZOWA 2KS1A 3WFDC 2LITA 2YQBA 5AURA 2XTSB 4EIFA 3CWBD 1BL9A 1H32A 3SWSA 3X39A 1LFMA 4GYDA 2D0SA 3HQ6A 1WEJF 5GTHV 4FAVA 1H31B 1QN2A 2CXBA 1BGYD 1SQVD 3ZOXA 155CA 1YEBA 4AAOA 1CSWA 3DR0A 2DGEA 2FWLA 1C2NA 1KX7A 2C2CA 1L9BC 1CO6A 4PWAA 2HV4A 2JWAA 4AAMA 3L4OA 1HROA 1OAEA 1GIWA 1CXAA 3VNWA 5CYTR 1WVEC 5IY51 1NIRA 1RZ6A 3L72D 1QL3A 2Y0DA 1PPJD 5DJQC 5DJQB 1J3SA 4Q5PA 1CRGA 2Y0CA 4D6TD 1CTYA 1P84D 2B11B 2N9JA 1CSVA 1KIBA 2OZ1A 1YTCA 4K3IA 2VHDA 2BPBB 1OCDA 1L9JC 2AI5A 3HQ7A 1ETPA 2KNCB 4WQDA 1FCDC 1CSUA 3TF5A 3CXHD 3PRJA 1C7MA 3L70D 3RLMA 1F1CA 1CTJA 3O1YA 4PJ0V 2Q3EA 5CIGB 1NU1D 3FWLA 3SJLA 3ZIYA 3A9FA 3M97X 3H1KD 2A06D 1CEDA 4WQBA 3L71D 3BCCD 3WFEC 3CYTI 5KAFV 3VRDA 1HZVA 2K9JB 1HJ4A 1RZ5A 4Y5RA 4PD4D 4AALA 3TGUD 2LIRA 3OA8A 2FYUD 1BCCD 2N9IA 1YIQA 1KYOD 4EDFA 1CRIA 1CSXA 1CC5A 1H9YA 1KX2A 5B5EV 1YCCA 1DW1A 3H1LD
chains in the Genus database with same CATH superfamily
2C1DA 3L36A 3AE7C 4GDOA 3S9OA 2HODA 2LXBA 1HTLC 1FOSE 1SQXG 5KKZC 2BCCG 4PV1B 3ITKA 3EFGA 1DEEG 4B86A 1LTGC 3VMZA 2E5YA 2FYUJ 4FA4A 2CK3H 3CXHE 1IRWA 1RAPA 1BCCG 3HTKB 3L4MA 1N7SA 3CWBG 1FZCC 3VN0A 3H32B 4L74A 3H32A 4U7JA 2AXTV 3H1HJ 1EDLA 4N0KA 1HBWA 4Y99B 3MTUE 3CL3D 1ZZHA 2POHA 3L72E 1CI6B 5CCGD 1CI6A 2PCCB 2YMKA 1I6EA 1OW6A 1NAYA 3HE5A 3KZIV 1YFCA 4RKUJ 4JQ0D 3VP8A 3W68A 3MGNA 1I8OA 2ZYDA 2O1KA 2K9YA 4N78E 3H1JG 3H1KE 1N7SB 4J20A 1CRHA 3LW5J 1VQLP 3KYQA 1ZR4A 3WU2V 1AVOA 1BSHA 1QL4A 1BDDA 3CMAP 3HD7C 2ZVNB 3RBZA 2R32A 1K9MQ 2IFNA 2ITAA 1IZL0 1HF9A 1FDMA 4UB8E 3CX5D 2ZOOA 1NTKK 1HJ5A 4WY4C 3SFEC 4FB1A 1GL2A 3CU4A 4KJMA 1L0NE 1YJNP 1I55A 2AEJA 4DZOA 5DF5A 3S1KA 1YTZI 1EZVE 1CHIA 2FRCA 5AVWB 1KILB 2R3CA 1GL2D 1HJBA 1SQVE 2LXCB 3H1ID 1G2CB 1H1OA 3CXHH 2DVHA 3OA8B 1FZCA 3CD6P 4H44B 2P7JA 1H89A 1S5LX 1I8PA 1IFJA 1OXZA 1MG3D 1C6RA 1N90A 1VQMP 3RMZA 2ZYAA 3UIAA 1YBKA 3BASA 4BXLA 2LKMA 2GUSA 2V7QJ 1CRYA 4U3FD 2FYUG 4MN4C 3M9BA 3DMIA 1A8CA 2J5UA 4ASWA 1I54A 3H1LJ 4K3AA 2ZVOB 1VF5C 1DW0A 1HJ3A 1DVVA 5B5EH 2BEQD 3SFDC 4KMGA 2Z5IA 1RAQA 1SQBE 1KILE 3CC2P 2IBZE 3RK2C 4I1LA 3A0BE 2N3YA 1RH5B 2XV5A 2WITA 5M1BA 4L73A 5AW1B 2OZ1B 1LTTC 1SLQA 1S4XA 1LC2A 5AVYB 1CCHA 1H9XA 2JTIB 2ZBOA 4WY4D 3V4QA 3PH2B 3CMEP 3HQ9A 3CI9A 1KB9D 1JMBA 3L73D 2RMZA 2IPPA 1UIXA 1R0QA 2KYVA 1NTMD 1S5LV 4LC1A 2JEEA 2D2CD 1CYIA 3QH9A 3K5BA 2KLVA 4WQEA 1Q90D 1CNOA 3B5NA 2M5AA 1BGYE 2H89C 3H6PA 1JCDA 1JM0A 2OQQA 1BGYG 1LP1B 3FWNA 1L0LK 5APYA 3P32A 1NO4A 2E75B 5H2FV 1N7SC 3P8MC 1GQ1A 2FYUE 2PFXA 1M60A 1H31A 2YKQA 1H0TA 5CCHD 5TISV 4PV1D 5AW2B 1E8EA 1GW4A 2MHMA 2HYNA 2OGUA 1CIFA 3L74G 3AE9C 1L0NK 1KB9I 1N8RQ 3RK2D 1PP9D 2ZJSE 4EIEA 2RN0A 3GHGA 3CC7P 1NTZD 1R5LA 1RQUA 4BRYB 1S6VB 1DW2A 3AE4C 2Z5HA 2YNYA 2OYHA 3L71G 3IAOA 2Y9YA 2PACA 3O5CA 4XXLA 3V4WA 3M0DC 2ZT9D 1W5CT 1QX8A 4WQAA 3OA7A 2CE1A 5B66E 1N86A 2I1JA 3GF3A 3HTKA 1FI3A 1IO4A 2N9YB 1BE3E 2QM8A 3VYMA 1M57D 4N78D 4TLFA 1RF1C 1LTJC 3H1LG 2CA3B 1QL2A 2E75C 3BRVB 1C6OA 4GEDB 2VRSA 1KYOW 3A3YB 4R4LA 3TGUJ 3AECC 1SQPG 3G4SP 2JJLA 2FXMA 1ZP0C 2KS1A 1HH0A 1MV8A 1KYOE 3RK3C 2KI7B 2YQBA 3L72G 2XTSB 2OTJP 2KK7A 2G3AA 3CX5I 1BL9A 3NFQA 4WWIA 3X39A 1SS1A 1LFMA 1RF0C 2ZAEB 2O1JA 4GYDA 3B5NB 5CJ0A 4DT0A 2BCCJ 4FAVA 4W7YA 5E79H 3CCJP 1ZV8A 5GTHE 1SQVD 4OGQB 3CPWO 3O6QA 2DGEA 2KOGA 2ZXEB 1C2NA 4OVNF 3RL0C 1TU3F 1EQ7A 3L4OA 1YQ3C 2B87A 1LNQA 4WVZA 1J1DC 1FZEA 3VNWA 1FZAA 3L75J 2I1KA 1J1DB 1EDKA 2WSCJ 1NU1J 2A06G 3IF4A 2M3EA 1S9KE 1H88A 2B89A 3E7KA 1OW7A 3MUDA 4Q5PA 1CRGA 3I55P 1RE4C 1P84D 3II6A 1KIBA 2OZ1A 3WUUA 2NZ2A 3ABVC 1L9JC 4WQDA 1FCDC 1Z56A 5CHXA 1SQXJ 3L70E 1CSUA 3TF5A 1S1CX 3L70D 1YHQP 3R4YA 5APSA 1IFIA 3H1HE 2WT7A 5KJ7C 2BASA 3FX0A 3FWLA 1S5LH 1X8YA 4GKGA 1MZ9A 2M5AB 4WQBA 3L71D 5AVXB 3RL0B 3GLMA 2KNCA 3O8ZA 5KAFV 3VRDA 3NMDA 3VTPC 3PH0A 3BCCG 4AALA 5AW4B 1D7MA 1KYOD 4EDFA 1OVRA 1CRIA 1KZUB 1H9YA 3HD7D 3H1IJ 5B5EV 1BE3J 3L73E 1SQXK 1JY2P 4JF7A 3CC4P 351CA 1DX7A 5KLIB 1VQPP 3MHVA 1USDA 2XZRA 3H1KG 1SQVK 1OFCX 1JY3O 1L0LG 1Y8AA 3TGUG 2JWDA 2E74B 2XDJA 5KLVE 1GDVA 2H8PD 5CIBB 1EXIA 1SQBD 1KB0A 2JQRA 1PGJA 3M0AA 4Y99C 5KJ7A 4O1WA 4C7RA 2R3SA 3HUSB 3L75D 4I2LC 1VQNP 2MJZA 3OCDA 1N15A 2H43A 4WQ7A 1JDLA 3KXDA 5AVUB 5AW6B 1H32B 1L4AA 2HFED 2W8ZA 1YYCA 2HPCA 2FXPA 4O9BA 1HVVA 2C0XA 3N4XA 1K8AQ 4N6JA 4D6TJ 1SP4A 2YKOA 1VQ6P 1S72P 1CRJA 4O1QA 2IYOA 5KAIV 2E74C 1CIGA 5KKZB 1FE6A 2O01H 3TDKA 2FYUK 3CP5A 2BCCE 1VQ8P 1NTZK 2B10B 2J58A 5GTIH 1VQOP 1F1FA 2FBWC 3U59A 1Q7YQ 3P8CD 1BGYJ 1JEKA 1IK9A 1E2RA 3NTNA 5CIFB 1NU1G 2BEZF 1GDTA 1MUUA 1DIQC 3Q1MA 5CIDB 1WRGA 2WPVB 4XYDB 1LTAC 1RQVA 1PV3A 3NWVA 1K73Q 5B66H 1HZUA 3RN1A 1YNRA 1CHHA 3F5HA 1H33B 4IFFA 2E76B 3C1LA 3SVWA 1GZLA 1PGQA 3CXHI 1KORA 1BSNA 4H0LC 1HH7A 1A2SA 1KYOI 3S4RA 2CA4B 1IRVA 2H88C 4YTPC 1N50A 2QA4P 2QJPC 1KD1Q 2A45I 2WPRA 1L0LE 2QJYB 1GL2B 2I8FA 2ZZS1 1YQ4C 3TNUB 3O20A 1FDOA 4YE1A 1W2LA 4W7ZA 3KHUA 1SQXD 2HR3A 1CYCA 3G3ZA 1A02J 3MP7B 3A0HH 3MUDC 3H1JD 2NPSD 1PP9J 4GOEA 1AKKA 1JUNA 1L0NG 2Q5UA 2IBZI 3B8EB 1HRCA 1S3JA 2L4DA 2Y0EA 3U1CA 1SFCC 3EFFK 4ZKUA 1PP9E 4UB6E 3FXEA 5AVSB 4HH2A 2V07A 4I6MC 4NPFX 1KQFB 1C75A 5DFSA 2GUVA 1DD3A 1CIHA 4H0LB 4YXDC 5B66V 1PIXA 2YXRB 3W67A 2WVRA 2LR2A 2MTAC 2B87B 1M1KQ 2D2CC 4ZMDA 2N18C 3IN6A 2WWWA 3B5NC 3HUSA 3L74E 3P7KA 4KHXA 5EXQA 1CTZA 1PFIA 1KV9A 1EXJA 4I7ZB 2N3BA 2ZONG 1JO5A 3CXHW 1KFNA 1RE3A 1NGMB 2HPCB 3EWKA 3JBTB 5GTIV 1VYDA 4U3FG 1RY3A 3CCVP 3GW6A 2D2CB 1OIPA 4HKZH 3L74J 3U1AA 3TYYA 1QKSA 4D6TE 3ORVA 3A5TA 1NAFA 1GKSA 4GIFA 4PJ0H 1VQ9P 2KSJA 2Q1KA 3H1HG 2O3JA 2AIUA 1SFCD 3I56P 3FXDA 3ZOOA 1VF5B 5AVVB 4FANA 1H33A 2FY8A 1FBMA 2MKVA 4FA1A 1XTGB 1CCRA 5TJHA 1NKNA 2QRXA 3HD7A 1FZBA 2LITA 3AEEC 5AURA 2L5GB 1OVUA 1PPJG 2JR8A 2NPSA 4JYBA 3N7NA 2WTYA 2ZFCA 1WEJF 5AW8B 5GTHV 1QN2A 1L4AC 2C0WA 2K9JA 3ZOXA 1S2EA 3HUSC 1YEBA 4AAOA 3QWOC 1NTKG 1ZW0A 1CSWA 1N73B 5CCHA 4W80A 4LGDE 2FWLA 1R5SA 1OVVA 1NH4A 2JWAA 3A0HE 2HV4A 1ZMEC 4RO0A 1KILA 5CYTR 4C7NA 1WVEC 1PP9G 5IY51 2A45H 1YI2P 1RZ6A 1GU4A 3L72D 1QL3A 4QMAA 5DJQC 4YPCA 3BVHA 3CCSP 5DJQB 1NVOA 3WMM0 1QLED 3HE4B 3HE4A 1U57A 1E79H 1SQBK 5BU8B 1BCCJ 4K3IA 1OCDA 1ZN5A 2AI5A 3D70A 1ZR2A 1ETPA 1ZXGA 3L73J 1LT1A 1HGZA 3CXHD 4GT1A 3RLMA 1F1CA 1HWTC 4PJ0V 1T6AA 3GMAA 1GTWA 1L4AD 3A9FA 2A06D 1EDIA 4ASVA 4TT3H 3WFEC 2WSFH 5B5EE 3CCEP 2I8DA 3MD0A 3V2NA 1AV1A 2Q9IA 4UB6H 2W6JH 1ZRTE 2N1TD 2E5TA 1CSXA 3SWFA 1CC5A 1NYHA 3KZIE 2C9LY 3B71A 1OMIA 1KTMA 1YCCA 1SQXE 3L70J 1DW1A 3H1LD 4Y28J 2YO3A 5KAIH 1U74B 1KV4A 1JY3N 4H13C 3PXTA 4CPGA 1COTA 3SXTA 3GHGC 1AVYA 1SQPD 2R5BA 1SQQD 3JSVC 1LTSC 3AEGC 3CWBJ 2G8YA 1VDFA 2KB7P 2ZYGA 1AJYA 1CHJA 3MK7B 1M1JA 4RESB 1P84E 4L3GA 1NTMJ 2HODB 1YITP 1B7VA 3TYIA 5DJUB 4NFGB 1Y47A 2K37A 1IC2A 5E79V 5KTBA 1C6SA 1LWUB 4UB8V 1VL2A 2KSEA 3M9HA 2Y9ZA 1NTKD 1DIPA 2QEXP 4JPZB 2N18B 1LTJA 1FOSF 2RH0A 5KAFE 4H0LD 4H44D 1DW3A 1YEAA 3V6IA 3OW2O 5CIEB 2ZXXA 1RE3C 3D6YA 3C9IA 1Q82Q 3L35A 5CCHC 5AW9B 1JNMA 1W2EA 2YKPA 1CIEA 4EIDA 1Y9BA 3JCUE 1CYJA 1R8EA 2W83C 1X0TA 3RL0g 5KAFH 2C9XB 3MIWA 2WQYC 1LC1A 3PHLA 3CCLP 4PV1C 3EQ2A 1U75B 1M70A 1URQD 1H0TB 4M3LA 1IQCA 2CPBA 1K3GA 3WUIA 4MU8A 4AANA 3CX5E 1NMLA 3NBTA 1NTZE 3H1IG 3PLNA 1IK7A 2E74D 1M90Q 3A0BV 1SVFA 3LW5H 1CRCA 4L1QA 3H1LE 3NXSA 2V4HA 3CLQA 2QJKB 1BE3G 1HJ0A 1GJQA 1DD4A 2XU6A 1KC8Q 3G9RA 1OZHA 2E75D 2E76D 3MZWB 2FYNC 1NMIA 3H1JJ 2AEFA 1Q81Q 2IBZD 1W2BO 1JB0J 1M6ZA 5E79E 1I5TA 1JY2O 1OX3A 3ZBMA 2WSEH 4IL6E 1AQ5A 3ZDMA 4PD4E 3CCQP 1AYGA 1DVHA 2B4ZA 1KILC 3AEFC 1JOCA 1SQQJ 4NPDA 1USEA 1IFMA 4HB1A 4UB6V 1DT1A 5CIHB 3VP9A 2GM4A 5H2FE 5AW7B 4L75A 4IL6V 4L3HA 1LMSA 451CA 2K88A 1SQQG 2GC7D 4WY4B 3RN0A 3V2PA 1U7JA 5CMZA 1KN7A 4WQ9A 5CICB 2V7QH 1IJDB 1L0ND 1P84I 3TNUA 4L76A 1FHBA 2AXTH 3V2RA 1ZRTD 1KB9E 2HG5D 3USSA 4HJGH 1CORA 2P2UA 1BDCA 2EXVA 4PW9B 1RF1B 3IR9A 1E29A 1C52A 1SQBG 4NPEA 4H13D 5APVA 3VMAA 2CE0A 2E76C 1YICA 3L75G 4AUWA 3L74D 1IO3A 3A7OA 1YJWP 4DY9A 2Q6QA 2QM7A 1AOQA 1HCMA 3WUVA 1KILD 4YXWH 5GTIE 4AX3A 1FZGA 2C1VA 1G1IA 1SQPJ 2YIUC 1L0LJ 3CCMP 3C2CA 1LGHB 4OGQC 4RJTA 3DP5A 1LP1A 2N9BA 1SFCA 2UWJE 1A56A 3H1KJ 1KQLA 2PGDA 1NTME 1I6DA 1NTMK 3B5ND 4OWFA 3SWKA 1AQTA 3H1HD 2YXQB 3OJAB 1WMKA 3ZCFA 5AVRB 2FXOA 4JCGA 2BH5X 3L71E 1QVGO 1LTBC 2QSIA 1H8AA 1FJ0A 1C2RA 4C46A 1QGKB 3IFMA 1BE3D 1EZVG 1M1JC 1T3JA 1FI7A 1CXCA 2PCBB 1NTZG 3VMXA 2BGVX 2OYHC 3RK3B 3G71P 1QEXA 2ORLA 2W27A 4HYTB 3H25A 4LJIA 2OARA 3PTZA 1NJIQ 3HE5B 1X9VA 1NTMG 3WFDC 3I5CA 1T2KC 1M56D 3AE3C 3WU2E 1GMJA 3KZIH 3WUTA 2FFDC 2WSCH 1CZQA 2JO1A 1H32A 3SWSA 5AVZB 4PJ0E 2KP8A 2IX7C 3RBXA 2D0SA 1LTJB 1H31B 2CXBA 1RF1A 1KYOH 1RE4A 1BGYD 1Q2NA 2N1TC 155CA 2QVAA 4IOIH 2KXPB 5KLIC 1FU1A 5AW3B 1U7MA 4EYYQ 3L4FA 1KX7A 2C2CA 4IFMA 1N7SD 3L70G 2Q3IA 1EDJA 1YJ9P 1HROA 2R44A 3VMYA 2PAJA 3AEDC 3RK2B 2C9NY 3FGAD 3B4SA 1FDIA 5APXA 2NPSC 2WPSA 1NTKJ 1GU5A 1JCCA 2A45G 4IFDK 3M9QA 4U3FJ 1IFPA 4D6TD 2Z4EA 2B11B 2N9JA 4XE5B 3M91A 1P84H 1T2KD 2VHDA 2BPBB 2RKLA 1HGVA 3HQ7A 2Q7CA 2KNCB 2OYIB 1L4AB 3PRJA 3O1YA 2Q3EA 2KIKA 1W5CE 2KZIA 1IZNB 3M97X 3H1KD 1NWQA 3L72J 5KAIE 5CCGA 3KPEA 1CEDA 2KS1B 3E1IA 3KQGA 3SWYA 3BCCD 1LWUA 1ZLLA 1QL1A 1HZVA 2KUBA 2K9JB 2N1TA 1RZ5A 3D6ZA 1NHLA 4PD4D 2QJKC 2FYUD 2WT7B 1BCCD 2N9IA 2W6AA 5CJ4A 3Q5RA 3C8VA 3RK3D 1K04A 1VQ4P 2JKVA 1JY2N 1KFMA 1ZOYC 2YO2A 2NRGA 3PJSK 1SQVG 1EZVD 1X22A 2OTKE 2JDIH 2WSSH 1JY3P 3H1IE 1NU1K 3L73G 1FI9A 3D0WA 1KQGB 3HD7B 2B0ZB 1PGOA 2BCCD 1NTZJ 1MFTA 3A0BH 3E1RA 3P8CE 1L0LD 1FAVA 1LTIC 3BCCE 2KLUA 2V08A 1M8OB 4EOTA 1EZVI 3RL0D 1WT6A 1S9KD 2C8SA 1BCCE 3SSUA 2ZT9B 5C0ZA 2H7HA 1AOFA 3Q2YA 3R2PA 4PD4I 1G1JA 1L0NJ 2GIWA 4I7ZC 1LWUC 3MK7C 1LJ2A 2AXTE 2AXCA 1SQPK 1YIJP 1K3HA 2JP3A 3T97B 1IFNA 1SFCB 2P67A 1NU1E 1M7LA 3ZOYA 4KT0J 1UIIA 2BCNB 4H13B 1T3UA 4IL6X 2IZ0A 2P58A 1MZ4A 2WPQA 1KMIZ 3AE6C 3L37A 4D6TG 2DW3A 1PL5A 1GU2A 4JBZA 1KQSO 1FC2C 2WSFJ 4UB8H 2QJPB 1PPJE 2YCCA 3CWBE 5APWA 5AW0B 4N3YB 3NBSA 2D0WA 1SQQE 3AE8C 4EI2A 2PP6A 3WFBC 1N2DC 3M06A 5BU5A 2QG4A 1VF5D 2BH4X 2FFDA 2GC4D 2E43A 2IDBA 1URQC 4H0KA 3SLEA 3A0HV 4WQ8A 1LT9C 3HQ8A 1NNOA 3L75E 1LT9B 2IBZG 4BWNA 2IZ1A 1OWAA 3AE2C 1J2JB 4P4QB 1CW5A 2W90A 3GF7A 5CCGC 2C1UA 2FYNB 5CBOA 2QIWA 3Q5PA 2FYZA 5TISE 3VYIA 4EIJA 2N1TB 5KLVD 3PXWA 2ZXYA 4DOJA 3WC8A 2K1AA 3KDPB 1QVFO 2QE7H 3BATA 3CX5W 3AE5C 1N9CA 1KB9H 4FA5A 5APQA 3GG2A 1FZFA 1QYZA 1URQB 4WQCA 1NKZB 4LLHA 5BVZA 1N73C 1OW8A 1SQVJ 3JC22 3TSIA 4DJGA 2OYOA 2YK3A 5L8RJ 3WU2H 3TGUE 5DJTB 1GK4A 3M0DA 2C1DB 2QJYC 2GA1A 2AEMA 1MKMA 1NOHA 5C9MA 2HLOA 5AVTB 1EB7A 1GW3A 1MG2D 2WZ7A 1MFZA 1JTHB 1RF0A 2ZT9C 5H2FH 4H44C 5C39A 1XTCC 1A02F 4WB4A 4R4MA 3OAKA 4FA9A 1VQ7P 4PD4H 1DIIC 3AE1C 2WMMA 2SPZA 2FFDB 1FJKA 3RK3E 3BRTB 4JYCA 5KLVK 3T97A 1E5WA 1PGPA 4QAOA 4RSZA 2B12B 2IYPA 3CX5H 5GTHH 4EICA 3O6QB 4V2KA 1PZQA 3OCDB 2O01N 1SQBJ 3PXSA 2KZJA 3WFCC 5EFWB 2WSEJ 2GB8B 2A06E 1EC5A 4WY4A 5APUA 5B6QA 2M0BA 1JTHA 3F89A 1FOCA 1LS9A 2E42A 1YTZT 2B9BA 1J1EB 2BLFB 2YIUB 2FKWB 4OGQD 4K35A 3Q5SA 4H0JA 1K05A 2L91A 3O0RC 4A7PA 3ZOWA 1GD2E 2XNXA 5K5GB 4C7NB 5AW5B 4AYCA 1URQA 4AQRD 4EIFA 3CWBD 3Q3DA 3TK1A 1FJPA 4U3FE 3HQ6A 1VPCA 5KLVG 1IFDA 3VOPA 1SQPE 2M3BA 4XFJA 4GOFA 1AA0A 1S5LE 1SQQK 3DR0A 3CCRP 4DCKA 1L9BC 1CO6A 4PWAA 1FS0E 2OTLP 4AAMA 4ZKPA 2M8RA 2OYIA 1OAEA 1GIWA 1CXAA 2IFMA 5KJ7D 1NIRA 3V5BA 3AEBC 3D71A 4IL6H 3L71J 1GL2C 2Y0DA 3CCUP 3BCCJ 1PPJD 1GK6A 5TISH 4Z1MH 2YMYA 1J3SA 2Y0CA 1N7LA 1Q86Q 1RHZB 1CTYA 1G2CA 4XA4A 1CSVA 3LIEA 3G6EP 1N73A 1YTCA 2K3RA 2XKMA 2J59M 4WBAA 2P1JA 1LT9A 3H1JE 2R5DA 4ZNCA 5KLVJ 1C7MA 2PRRA 3LIDA 1CTJA 2B88A 2CPSA 5CIGB 4OH8B 2NPSB 1VQKP 1CSBA 1NU1D 5AVQB 3SJLA 3ZIYA 1HUCA 5APTA 2O01J 3AEAC 2P10A 1JMMA 3RGUA 3CYTI 3HRNA 1NTKE 2XNDH 1VQ5P 4BRYA 1HJ4A 5CBNA 4Y5RA 3TGUD 2LIRA 3OA8A 1FZCB 1T8ZA 1YIQA 1L2PA 1DEBA 3A2AA 3V2QA 1M1JB 3JCUH 1DH3A 2OYHB 1KX2A 2OYIC 1AFOA 1X79B 4GODA 2W6BA 1J1EC 3PP5A 3GHGB
chains in the Genus database with same CATH topology
351CA 5KLIB 2C1DA 1U74B 1EZVD 3PXTA 1COTA 3SXTA 1SQPD 1SQQD 1FI9A 3ITKA 2B0ZB 1CHJA 2BCCD 4FA4A 3MK7B 1IRWA 1RAPA 3L4MA 1L0LD 1GDVA 4L3GA 2V08A 2AXTV 1B7VA 5CIBB 3TYIA 4NFGB 4N0KA 1SQBD 1KB0A 5E79V 2JQRA 1C6SA 4O1WA 4UB8V 1ZZHA 2C8SA 1NTKD 5C0ZA 2PCCB 3L75D 1I6EA 3OCDA 2N18B 1N15A 1AOFA 4WQ7A 2GIWA 3KZIV 1JDLA 1YFCA 3MK7C 1H32B 1I8OA 1DW3A 1YEAA 1K3HA 4J20A 1CRHA 5CIEB 3ZOYA 2BCNB 3WU2V 1CRJA 4O1QA 1QL4A 1CIEA 4EIDA 5KAIV 1CYJA 1CIGA 1MZ4A 5KKZB 1IZL0 3TDKA 1GU2A 3CX5D 2C9XB 2ZOOA 1HJ5A 1LC1A 3PHLA 2QJPB 3CP5A 1U75B 1M70A 2YCCA 4FB1A 1IQCA 3CU4A 1K3GA 3WUIA 4MU8A 2B10B 1I55A 4AANA 5DF5A 1NMLA 3NBTA 3NBSA 3PLNA 1F1FA 2D0WA 1CHIA 2FRCA 3A0BV 3WFBC 1E2RA 3H1ID 1CRCA 1H1OA 5CIFB 2DVHA 2QG4A 4L1QA 3OA8B 2BH4X 2GC4D 1I8PA 2QJKB 1MG3D 1DIQC 4H0KA 1C6RA 1N90A 3A0HV 3SLEA 5CIDB 3RMZA 1GJQA 4WQ8A 4XYDB 3HQ8A 1NNOA 3NWVA 1NMIA 1CRYA 1HZUA 4U3FD 3RN1A 1YNRA 4P4QB 1CHHA 2IBZD 1A8CA 3DMIA 1M6ZA 1I54A 1H33B 1I5TA 3SVWA 1DW0A 2C1UA 3ZBMA 2FYNB 1HJ3A 1DVVA 4KMGA 1HH7A 1RAQA 1A2SA 2CA4B 1AYGA 1DVHA 1IRVA 2B4ZA 2N3YA 1N50A 5KLVD 3PXWA 2ZXYA 2OZ1B 4UB6V 1LC2A 3WC8A 2QJYB 1DT1A 1CCHA 5CIHB 1H9XA 2JTIB 2I8FA 2ZZS1 2ZBOA 3O20A 4YE1A 1W2LA 4IL6V 4L3HA 3PH2B 3KHUA 3HQ9A 3CX5W 1KB9D 1LMSA 451CA 1SQXD 3L73D 2RMZA 2GC7D 3RN0A 1N9CA 1CYCA 4FA5A 1R0QA 3GG2A 1QYZA 4WQ9A 4WQCA 5CICB 1NTMD 1S5LV 3H1JD 1L0ND 1CYIA 1AKKA 1FHBA 1ZRTD 4WQEA 1CNOA 1CORA 2EXVA 4PW9B 1HRCA 1E29A 1C52A 2L4DA 2YK3A 2Y0EA 2C1DB 3VMAA 2CE0A 1YICA 2V07A 5H2FV 1C75A 1GQ1A 5DFSA 5C9MA 1M60A 1H31A 3L74D 1IO3A 1EB7A 4DY9A 5TISV 1MG2D 1E8EA 1CIHA 5B66V 2MHMA 1CIFA 1AOQA 1HCMA 2MTAC 1PP9D 2N18C 4EIEA 2RN0A 4AX3A 2C1VA 1NTZD 4FA9A 1S6VB 1DW2A 5EXQA 1DIIC 1CTZA 1KV9A 3C2CA 2PACA 3O5CA 4RJTA 4XXLA 3DP5A 2N3BA 2ZONG 3CXHW 3JBTB 1A56A 5GTIV 1VYDA 1W5CT 4WQAA 4QAOA 4RSZA 2B12B 2CE1A 3GW6A 4EICA 1I6DA 1QKSA 4V2KA 3OCDB 3ORVA 1FI3A 3H1HD 1GKSA 3PXSA 2N9YB 3ZCFA 4JCGA 3VYMA 2BH5X 3WFCC 2GB8B 2CA3B 2O3JA 2AIUA 5B6QA 1FJ0A 1C6OA 1C2RA 3ZOOA 4GEDB 4FANA 1BE3D 1FOCA 1LS9A 1KYOW 1H33A 1FI7A 1CXCA 2BLFB 2PCBB 2YIUB 2BGVX 2ORLA 4FA1A 4H0JA 4LJIA 1CCRA 2L91A 5TJHA 3PTZA 3O0RC 4A7PA 3ZOWA 2KS1A 3WFDC 2LITA 2YQBA 5AURA 2XTSB 4EIFA 3CWBD 1BL9A 1H32A 3SWSA 3X39A 1LFMA 4GYDA 2D0SA 3HQ6A 1WEJF 5GTHV 4FAVA 1H31B 1QN2A 2CXBA 1BGYD 1SQVD 3ZOXA 155CA 1YEBA 4AAOA 1CSWA 3DR0A 2DGEA 2FWLA 1C2NA 1KX7A 2C2CA 1L9BC 1CO6A 4PWAA 2HV4A 2JWAA 4AAMA 3L4OA 1HROA 1OAEA 1GIWA 1CXAA 3VNWA 5CYTR 1WVEC 5IY51 1NIRA 1RZ6A 3L72D 1QL3A 2Y0DA 1PPJD 5DJQC 5DJQB 1J3SA 4Q5PA 1CRGA 2Y0CA 4D6TD 1CTYA 1P84D 2B11B 2N9JA 1CSVA 1KIBA 2OZ1A 1YTCA 4K3IA 2VHDA 2BPBB 1OCDA 1L9JC 2AI5A 3HQ7A 1ETPA 2KNCB 4WQDA 1FCDC 1CSUA 3TF5A 3CXHD 3PRJA 1C7MA 3L70D 3RLMA 1F1CA 1CTJA 3O1YA 4PJ0V 2Q3EA 5CIGB 1NU1D 3FWLA 3SJLA 3ZIYA 3A9FA 3M97X 3H1KD 2A06D 1CEDA 4WQBA 3L71D 3BCCD 3WFEC 3CYTI 5KAFV 3VRDA 1HZVA 2K9JB 1HJ4A 1RZ5A 4Y5RA 4PD4D 4AALA 3TGUD 2LIRA 3OA8A 2FYUD 1BCCD 2N9IA 1YIQA 1KYOD 4EDFA 1CRIA 1CSXA 1CC5A 1H9YA 1KX2A 5B5EV 1YCCA 1DW1A 3H1LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 351C A;  5KLI B;  2C1D A;  1U74 B;  1EZV D;  3PXT A;  1COT A;  3SXT A;  1SQP D;  1SQQ D;  1FI9 A;  3ITK A;  2B0Z B;  1CHJ A;  2BCC D;  4FA4 A;  3MK7 B;  1IRW A;  1RAP A;  3L4M A;  1L0L D;  1GDV A;  4L3G A;  2V08 A;  2AXT V;  1B7V A;  5CIB B;  3TYI A;  4NFG B;  4N0K A;  1SQB D;  1KB0 A;  5E79 V;  2JQR A;  1C6S A;  4O1W A;  4UB8 V;  1ZZH A;  2C8S A;  1NTK D;  5C0Z A;  2PCC B;  3L75 D;  1I6E A;  3OCD A;  2N18 B;  1N15 A;  1AOF A;  4WQ7 A;  2GIW A;  3KZI V;  1JDL A;  1YFC A;  3MK7 C;  1H32 B;  1I8O A;  1DW3 A;  1YEA A;  1K3H A;  4J20 A;  1CRH A;  5CIE B;  3ZOY A;  2BCN B;  3WU2 V;  1CRJ A;  4O1Q A;  1QL4 A;  1CIE A;  4EID A;  5KAI V;  1CYJ A;  1CIG A;  1MZ4 A;  5KKZ B;  1IZL 0;  3TDK A;  1GU2 A;  3CX5 D;  2C9X B;  2ZOO A;  1HJ5 A;  1LC1 A;  3PHL A;  2QJP B;  3CP5 A;  1U75 B;  1M70 A;  2YCC A;  4FB1 A;  1IQC A;  3CU4 A;  1K3G A;  3WUI A;  4MU8 A;  2B10 B;  1I55 A;  4AAN A;  5DF5 A;  1NML A;  3NBT A;  3NBS A;  3PLN A;  1F1F A;  2D0W A;  1CHI A;  2FRC A;  3A0B V;  3WFB C;  1E2R A;  3H1I D;  1CRC A;  1H1O A;  5CIF B;  2DVH A;  2QG4 A;  4L1Q A;  3OA8 B;  2BH4 X;  2GC4 D;  1I8P A;  2QJK B;  1MG3 D;  1DIQ C;  4H0K A;  1C6R A;  1N90 A;  3A0H V;  3SLE A;  5CID B;  3RMZ A;  1GJQ A;  4WQ8 A;  4XYD B;  3HQ8 A;  1NNO A;  3NWV A;  1NMI A;  1CRY A;  1HZU A;  4U3F D;  3RN1 A;  1YNR A;  4P4Q B;  1CHH A;  2IBZ D;  1A8C A;  3DMI A;  1M6Z A;  1I54 A;  1H33 B;  1I5T A;  3SVW A;  1DW0 A;  2C1U A;  3ZBM A;  2FYN B;  1HJ3 A;  1DVV A;  4KMG A;  1HH7 A;  1RAQ A;  1A2S A;  2CA4 B;  1AYG A;  1DVH A;  1IRV A;  2B4Z A;  2N3Y A;  1N50 A;  5KLV D;  3PXW A;  2ZXY A;  2OZ1 B;  4UB6 V;  1LC2 A;  3WC8 A;  2QJY B;  1DT1 A;  1CCH A;  5CIH B;  1H9X A;  2JTI B;  2I8F A;  2ZZS 1;  2ZBO A;  3O20 A;  4YE1 A;  1W2L A;  4IL6 V;  4L3H A;  3PH2 B;  3KHU A;  3HQ9 A;  3CX5 W;  1KB9 D;  1LMS A;  451C A;  1SQX D;  3L73 D;  2RMZ A;  2GC7 D;  3RN0 A;  1N9C A;  1CYC A;  4FA5 A;  1R0Q A;  3GG2 A;  1QYZ A;  4WQ9 A;  4WQC A;  5CIC B;  1NTM D;  1S5L V;  3H1J D;  1L0N D;  1CYI A;  1AKK A;  1FHB A;  1ZRT D;  4WQE A;  1CNO A;  1COR A;  2EXV A;  4PW9 B;  1HRC A;  1E29 A;  1C52 A;  2L4D A;  2YK3 A;  2Y0E A;  2C1D B;  3VMA A;  2CE0 A;  1YIC A;  2V07 A;  5H2F V;  1C75 A;  1GQ1 A;  5DFS A;  5C9M A;  1M60 A;  1H31 A;  3L74 D;  1IO3 A;  1EB7 A;  4DY9 A;  5TIS V;  1MG2 D;  1E8E A;  1CIH A;  5B66 V;  2MHM A;  1CIF A;  1AOQ A;  1HCM A;  2MTA C;  1PP9 D;  2N18 C;  4EIE A;  2RN0 A;  4AX3 A;  2C1V A;  1NTZ D;  4FA9 A;  1S6V B;  1DW2 A;  5EXQ A;  1DII C;  1CTZ A;  1KV9 A;  3C2C A;  2PAC A;  3O5C A;  4RJT A;  4XXL A;  3DP5 A;  2N3B A;  2ZON G;  3CXH W;  3JBT B;  1A56 A;  5GTI V;  1VYD A;  1W5C T;  4WQA A;  4QAO A;  4RSZ A;  2B12 B;  2CE1 A;  3GW6 A;  4EIC A;  1I6D A;  1QKS A;  4V2K A;  3OCD B;  3ORV A;  1FI3 A;  3H1H D;  1GKS A;  3PXS A;  2N9Y B;  3ZCF A;  4JCG A;  3VYM A;  2BH5 X;  3WFC C;  2GB8 B;  2CA3 B;  2O3J A;  2AIU A;  5B6Q A;  1FJ0 A;  1C6O A;  1C2R A;  3ZOO A;  4GED B;  4FAN A;  1BE3 D;  1FOC A;  1LS9 A;  1KYO W;  1H33 A;  1FI7 A;  1CXC A;  2BLF B;  2PCB B;  2YIU B;  2BGV X;  2ORL A;  4FA1 A;  4H0J A;  4LJI A;  1CCR A;  2L91 A;  5TJH A;  3PTZ A;  3O0R C;  4A7P A;  3ZOW A;  2KS1 A;  3WFD C;  2LIT A;  2YQB A;  5AUR A;  2XTS B;  4EIF A;  3CWB D;  1BL9 A;  1H32 A;  3SWS A;  3X39 A;  1LFM A;  4GYD A;  2D0S A;  3HQ6 A;  1WEJ F;  5GTH V;  4FAV A;  1H31 B;  1QN2 A;  2CXB A;  1BGY D;  1SQV D;  3ZOX A;  155C A;  1YEB A;  4AAO A;  1CSW A;  3DR0 A;  2DGE A;  2FWL A;  1C2N A;  1KX7 A;  2C2C A;  1L9B C;  1CO6 A;  4PWA A;  2HV4 A;  2JWA A;  4AAM A;  3L4O A;  1HRO A;  1OAE A;  1GIW A;  1CXA A;  3VNW A;  5CYT R;  1WVE C;  5IY5 1;  1NIR A;  1RZ6 A;  3L72 D;  1QL3 A;  2Y0D A;  1PPJ D;  5DJQ C;  5DJQ B;  1J3S A;  4Q5P A;  1CRG A;  2Y0C A;  4D6T D;  1CTY A;  1P84 D;  2B11 B;  2N9J A;  1CSV A;  1KIB A;  2OZ1 A;  1YTC A;  4K3I A;  2VHD A;  2BPB B;  1OCD A;  1L9J C;  2AI5 A;  3HQ7 A;  1ETP A;  2KNC B;  4WQD A;  1FCD C;  1CSU A;  3TF5 A;  3CXH D;  3PRJ A;  1C7M A;  3L70 D;  3RLM A;  1F1C A;  1CTJ A;  3O1Y A;  4PJ0 V;  2Q3E A;  5CIG B;  1NU1 D;  3FWL A;  3SJL A;  3ZIY A;  3A9F A;  3M97 X;  3H1K D;  2A06 D;  1CED A;  4WQB A;  3L71 D;  3BCC D;  3WFE C;  3CYT I;  5KAF V;  3VRD A;  1HZV A;  2K9J B;  1HJ4 A;  1RZ5 A;  4Y5R A;  4PD4 D;  4AAL A;  3TGU D;  2LIR A;  3OA8 A;  2FYU D;  1BCC D;  2N9I A;  1YIQ A;  1KYO D;  4EDF A;  1CRI A;  1CSX A;  1CC5 A;  1H9Y A;  1KX2 A;  5B5E V;  1YCC A;  1DW1 A;  3H1L D; 
#chains in the Genus database with same CATH topology
 2C1D A;  3L36 A;  3AE7 C;  4GDO A;  3S9O A;  2HOD A;  2LXB A;  1HTL C;  1FOS E;  1SQX G;  5KKZ C;  2BCC G;  4PV1 B;  3ITK A;  3EFG A;  1DEE G;  4B86 A;  1LTG C;  3VMZ A;  2E5Y A;  2FYU J;  4FA4 A;  2CK3 H;  3CXH E;  1IRW A;  1RAP A;  1BCC G;  3HTK B;  3L4M A;  1N7S A;  3CWB G;  1FZC C;  3VN0 A;  3H32 B;  4L74 A;  3H32 A;  4U7J A;  2AXT V;  3H1H J;  1EDL A;  4N0K A;  1HBW A;  4Y99 B;  3MTU E;  3CL3 D;  1ZZH A;  2POH A;  3L72 E;  1CI6 B;  5CCG D;  1CI6 A;  2PCC B;  2YMK A;  1I6E A;  1OW6 A;  1NAY A;  3HE5 A;  3KZI V;  1YFC A;  4RKU J;  4JQ0 D;  3VP8 A;  3W68 A;  3MGN A;  1I8O A;  2ZYD A;  2O1K A;  2K9Y A;  4N78 E;  3H1J G;  3H1K E;  1N7S B;  4J20 A;  1CRH A;  3LW5 J;  1VQL P;  3KYQ A;  1ZR4 A;  3WU2 V;  1AVO A;  1BSH A;  1QL4 A;  1BDD A;  3CMA P;  3HD7 C;  2ZVN B;  3RBZ A;  2R32 A;  1K9M Q;  2IFN A;  2ITA A;  1IZL 0;  1HF9 A;  1FDM A;  4UB8 E;  3CX5 D;  2ZOO A;  1NTK K;  1HJ5 A;  4WY4 C;  3SFE C;  4FB1 A;  1GL2 A;  3CU4 A;  4KJM A;  1L0N E;  1YJN P;  1I55 A;  2AEJ A;  4DZO A;  5DF5 A;  3S1K A;  1YTZ I;  1EZV E;  1CHI A;  2FRC A;  5AVW B;  1KIL B;  2R3C A;  1GL2 D;  1HJB A;  1SQV E;  2LXC B;  3H1I D;  1G2C B;  1H1O A;  3CXH H;  2DVH A;  3OA8 B;  1FZC A;  3CD6 P;  4H44 B;  2P7J A;  1H89 A;  1S5L X;  1I8P A;  1IFJ A;  1OXZ A;  1MG3 D;  1C6R A;  1N90 A;  1VQM P;  3RMZ A;  2ZYA A;  3UIA A;  1YBK A;  3BAS A;  4BXL A;  2LKM A;  2GUS A;  2V7Q J;  1CRY A;  4U3F D;  2FYU G;  4MN4 C;  3M9B A;  3DMI A;  1A8C A;  2J5U A;  4ASW A;  1I54 A;  3H1L J;  4K3A A;  2ZVO B;  1VF5 C;  1DW0 A;  1HJ3 A;  1DVV A;  5B5E H;  2BEQ D;  3SFD C;  4KMG A;  2Z5I A;  1RAQ A;  1SQB E;  1KIL E;  3CC2 P;  2IBZ E;  3RK2 C;  4I1L A;  3A0B E;  2N3Y A;  1RH5 B;  2XV5 A;  2WIT A;  5M1B A;  4L73 A;  5AW1 B;  2OZ1 B;  1LTT C;  1SLQ A;  1S4X A;  1LC2 A;  5AVY B;  1CCH A;  1H9X A;  2JTI B;  2ZBO A;  4WY4 D;  3V4Q A;  3PH2 B;  3CME P;  3HQ9 A;  3CI9 A;  1KB9 D;  1JMB A;  3L73 D;  2RMZ A;  2IPP A;  1UIX A;  1R0Q A;  2KYV A;  1NTM D;  1S5L V;  4LC1 A;  2JEE A;  2D2C D;  1CYI A;  3QH9 A;  3K5B A;  2KLV A;  4WQE A;  1Q90 D;  1CNO A;  3B5N A;  2M5A A;  1BGY E;  2H89 C;  3H6P A;  1JCD A;  1JM0 A;  2OQQ A;  1BGY G;  1LP1 B;  3FWN A;  1L0L K;  5APY A;  3P32 A;  1NO4 A;  2E75 B;  5H2F V;  1N7S C;  3P8M C;  1GQ1 A;  2FYU E;  2PFX A;  1M60 A;  1H31 A;  2YKQ A;  1H0T A;  5CCH D;  5TIS V;  4PV1 D;  5AW2 B;  1E8E A;  1GW4 A;  2MHM A;  2HYN A;  2OGU A;  1CIF A;  3L74 G;  3AE9 C;  1L0N K;  1KB9 I;  1N8R Q;  3RK2 D;  1PP9 D;  2ZJS E;  4EIE A;  2RN0 A;  3GHG A;  3CC7 P;  1NTZ D;  1R5L A;  1RQU A;  4BRY B;  1S6V B;  1DW2 A;  3AE4 C;  2Z5H A;  2YNY A;  2OYH A;  3L71 G;  3IAO A;  2Y9Y A;  2PAC A;  3O5C A;  4XXL A;  3V4W A;  3M0D C;  2ZT9 D;  1W5C T;  1QX8 A;  4WQA A;  3OA7 A;  2CE1 A;  5B66 E;  1N86 A;  2I1J A;  3GF3 A;  3HTK A;  1FI3 A;  1IO4 A;  2N9Y B;  1BE3 E;  2QM8 A;  3VYM A;  1M57 D;  4N78 D;  4TLF A;  1RF1 C;  1LTJ C;  3H1L G;  2CA3 B;  1QL2 A;  2E75 C;  3BRV B;  1C6O A;  4GED B;  2VRS A;  1KYO W;  3A3Y B;  4R4L A;  3TGU J;  3AEC C;  1SQP G;  3G4S P;  2JJL A;  2FXM A;  1ZP0 C;  2KS1 A;  1HH0 A;  1MV8 A;  1KYO E;  3RK3 C;  2KI7 B;  2YQB A;  3L72 G;  2XTS B;  2OTJ P;  2KK7 A;  2G3A A;  3CX5 I;  1BL9 A;  3NFQ A;  4WWI A;  3X39 A;  1SS1 A;  1LFM A;  1RF0 C;  2ZAE B;  2O1J A;  4GYD A;  3B5N B;  5CJ0 A;  4DT0 A;  2BCC J;  4FAV A;  4W7Y A;  5E79 H;  3CCJ P;  1ZV8 A;  5GTH E;  1SQV D;  4OGQ B;  3CPW O;  3O6Q A;  2DGE A;  2KOG A;  2ZXE B;  1C2N A;  4OVN F;  3RL0 C;  1TU3 F;  1EQ7 A;  3L4O A;  1YQ3 C;  2B87 A;  1LNQ A;  4WVZ A;  1J1D C;  1FZE A;  3VNW A;  1FZA A;  3L75 J;  2I1K A;  1J1D B;  1EDK A;  2WSC J;  1NU1 J;  2A06 G;  3IF4 A;  2M3E A;  1S9K E;  1H88 A;  2B89 A;  3E7K A;  1OW7 A;  3MUD A;  4Q5P A;  1CRG A;  3I55 P;  1RE4 C;  1P84 D;  3II6 A;  1KIB A;  2OZ1 A;  3WUU A;  2NZ2 A;  3ABV C;  1L9J C;  4WQD A;  1FCD C;  1Z56 A;  5CHX A;  1SQX J;  3L70 E;  1CSU A;  3TF5 A;  1S1C X;  3L70 D;  1YHQ P;  3R4Y A;  5APS A;  1IFI A;  3H1H E;  2WT7 A;  5KJ7 C;  2BAS A;  3FX0 A;  3FWL A;  1S5L H;  1X8Y A;  4GKG A;  1MZ9 A;  2M5A B;  4WQB A;  3L71 D;  5AVX B;  3RL0 B;  3GLM A;  2KNC A;  3O8Z A;  5KAF V;  3VRD A;  3NMD A;  3VTP C;  3PH0 A;  3BCC G;  4AAL A;  5AW4 B;  1D7M A;  1KYO D;  4EDF A;  1OVR A;  1CRI A;  1KZU B;  1H9Y A;  3HD7 D;  3H1I J;  5B5E V;  1BE3 J;  3L73 E;  1SQX K;  1JY2 P;  4JF7 A;  3CC4 P;  351C A;  1DX7 A;  5KLI B;  1VQP P;  3MHV A;  1USD A;  2XZR A;  3H1K G;  1SQV K;  1OFC X;  1JY3 O;  1L0L G;  1Y8A A;  3TGU G;  2JWD A;  2E74 B;  2XDJ A;  5KLV E;  1GDV A;  2H8P D;  5CIB B;  1EXI A;  1SQB D;  1KB0 A;  2JQR A;  1PGJ A;  3M0A A;  4Y99 C;  5KJ7 A;  4O1W A;  4C7R A;  2R3S A;  3HUS B;  3L75 D;  4I2L C;  1VQN P;  2MJZ A;  3OCD A;  1N15 A;  2H43 A;  4WQ7 A;  1JDL A;  3KXD A;  5AVU B;  5AW6 B;  1H32 B;  1L4A A;  2HFE D;  2W8Z A;  1YYC A;  2HPC A;  2FXP A;  4O9B A;  1HVV A;  2C0X A;  3N4X A;  1K8A Q;  4N6J A;  4D6T J;  1SP4 A;  2YKO A;  1VQ6 P;  1S72 P;  1CRJ A;  4O1Q A;  2IYO A;  5KAI V;  2E74 C;  1CIG A;  5KKZ B;  1FE6 A;  2O01 H;  3TDK A;  2FYU K;  3CP5 A;  2BCC E;  1VQ8 P;  1NTZ K;  2B10 B;  2J58 A;  5GTI H;  1VQO P;  1F1F A;  2FBW C;  3U59 A;  1Q7Y Q;  3P8C D;  1BGY J;  1JEK A;  1IK9 A;  1E2R A;  3NTN A;  5CIF B;  1NU1 G;  2BEZ F;  1GDT A;  1MUU A;  1DIQ C;  3Q1M A;  5CID B;  1WRG A;  2WPV B;  4XYD B;  1LTA C;  1RQV A;  1PV3 A;  3NWV A;  1K73 Q;  5B66 H;  1HZU A;  3RN1 A;  1YNR A;  1CHH A;  3F5H A;  1H33 B;  4IFF A;  2E76 B;  3C1L A;  3SVW A;  1GZL A;  1PGQ A;  3CXH I;  1KOR A;  1BSN A;  4H0L C;  1HH7 A;  1A2S A;  1KYO I;  3S4R A;  2CA4 B;  1IRV A;  2H88 C;  4YTP C;  1N50 A;  2QA4 P;  2QJP C;  1KD1 Q;  2A45 I;  2WPR A;  1L0L E;  2QJY B;  1GL2 B;  2I8F A;  2ZZS 1;  1YQ4 C;  3TNU B;  3O20 A;  1FDO A;  4YE1 A;  1W2L A;  4W7Z A;  3KHU A;  1SQX D;  2HR3 A;  1CYC A;  3G3Z A;  1A02 J;  3MP7 B;  3A0H H;  3MUD C;  3H1J D;  2NPS D;  1PP9 J;  4GOE A;  1AKK A;  1JUN A;  1L0N G;  2Q5U A;  2IBZ I;  3B8E B;  1HRC A;  1S3J A;  2L4D A;  2Y0E A;  3U1C A;  1SFC C;  3EFF K;  4ZKU A;  1PP9 E;  4UB6 E;  3FXE A;  5AVS B;  4HH2 A;  2V07 A;  4I6M C;  4NPF X;  1KQF B;  1C75 A;  5DFS A;  2GUV A;  1DD3 A;  1CIH A;  4H0L B;  4YXD C;  5B66 V;  1PIX A;  2YXR B;  3W67 A;  2WVR A;  2LR2 A;  2MTA C;  2B87 B;  1M1K Q;  2D2C C;  4ZMD A;  2N18 C;  3IN6 A;  2WWW A;  3B5N C;  3HUS A;  3L74 E;  3P7K A;  4KHX A;  5EXQ A;  1CTZ A;  1PFI A;  1KV9 A;  1EXJ A;  4I7Z B;  2N3B A;  2ZON G;  1JO5 A;  3CXH W;  1KFN A;  1RE3 A;  1NGM B;  2HPC B;  3EWK A;  3JBT B;  5GTI V;  1VYD A;  4U3F G;  1RY3 A;  3CCV P;  3GW6 A;  2D2C B;  1OIP A;  4HKZ H;  3L74 J;  3U1A A;  3TYY A;  1QKS A;  4D6T E;  3ORV A;  3A5T A;  1NAF A;  1GKS A;  4GIF A;  4PJ0 H;  1VQ9 P;  2KSJ A;  2Q1K A;  3H1H G;  2O3J A;  2AIU A;  1SFC D;  3I56 P;  3FXD A;  3ZOO A;  1VF5 B;  5AVV B;  4FAN A;  1H33 A;  2FY8 A;  1FBM A;  2MKV A;  4FA1 A;  1XTG B;  1CCR A;  5TJH A;  1NKN A;  2QRX A;  3HD7 A;  1FZB A;  2LIT A;  3AEE C;  5AUR A;  2L5G B;  1OVU A;  1PPJ G;  2JR8 A;  2NPS A;  4JYB A;  3N7N A;  2WTY A;  2ZFC A;  1WEJ F;  5AW8 B;  5GTH V;  1QN2 A;  1L4A C;  2C0W A;  2K9J A;  3ZOX A;  1S2E A;  3HUS C;  1YEB A;  4AAO A;  3QWO C;  1NTK G;  1ZW0 A;  1CSW A;  1N73 B;  5CCH A;  4W80 A;  4LGD E;  2FWL A;  1R5S A;  1OVV A;  1NH4 A;  2JWA A;  3A0H E;  2HV4 A;  1ZME C;  4RO0 A;  1KIL A;  5CYT R;  4C7N A;  1WVE C;  1PP9 G;  5IY5 1;  2A45 H;  1YI2 P;  1RZ6 A;  1GU4 A;  3L72 D;  1QL3 A;  4QMA A;  5DJQ C;  4YPC A;  3BVH A;  3CCS P;  5DJQ B;  1NVO A;  3WMM 0;  1QLE D;  3HE4 B;  3HE4 A;  1U57 A;  1E79 H;  1SQB K;  5BU8 B;  1BCC J;  4K3I A;  1OCD A;  1ZN5 A;  2AI5 A;  3D70 A;  1ZR2 A;  1ETP A;  1ZXG A;  3L73 J;  1LT1 A;  1HGZ A;  3CXH D;  4GT1 A;  3RLM A;  1F1C A;  1HWT C;  4PJ0 V;  1T6A A;  3GMA A;  1GTW A;  1L4A D;  3A9F A;  2A06 D;  1EDI A;  4ASV A;  4TT3 H;  3WFE C;  2WSF H;  5B5E E;  3CCE P;  2I8D A;  3MD0 A;  3V2N A;  1AV1 A;  2Q9I A;  4UB6 H;  2W6J H;  1ZRT E;  2N1T D;  2E5T A;  1CSX A;  3SWF A;  1CC5 A;  1NYH A;  3KZI E;  2C9L Y;  3B71 A;  1OMI A;  1KTM A;  1YCC A;  1SQX E;  3L70 J;  1DW1 A;  3H1L D;  4Y28 J;  2YO3 A;  5KAI H;  1U74 B;  1KV4 A;  1JY3 N;  4H13 C;  3PXT A;  4CPG A;  1COT A;  3SXT A;  3GHG C;  1AVY A;  1SQP D;  2R5B A;  1SQQ D;  3JSV C;  1LTS C;  3AEG C;  3CWB J;  2G8Y A;  1VDF A;  2KB7 P;  2ZYG A;  1AJY A;  1CHJ A;  3MK7 B;  1M1J A;  4RES B;  1P84 E;  4L3G A;  1NTM J;  2HOD B;  1YIT P;  1B7V A;  3TYI A;  5DJU B;  4NFG B;  1Y47 A;  2K37 A;  1IC2 A;  5E79 V;  5KTB A;  1C6S A;  1LWU B;  4UB8 V;  1VL2 A;  2KSE A;  3M9H A;  2Y9Z A;  1NTK D;  1DIP A;  2QEX P;  4JPZ B;  2N18 B;  1LTJ A;  1FOS F;  2RH0 A;  5KAF E;  4H0L D;  4H44 D;  1DW3 A;  1YEA A;  3V6I A;  3OW2 O;  5CIE B;  2ZXX A;  1RE3 C;  3D6Y A;  3C9I A;  1Q82 Q;  3L35 A;  5CCH C;  5AW9 B;  1JNM A;  1W2E A;  2YKP A;  1CIE A;  4EID A;  1Y9B A;  3JCU E;  1CYJ A;  1R8E A;  2W83 C;  1X0T A;  3RL0 g;  5KAF H;  2C9X B;  3MIW A;  2WQY C;  1LC1 A;  3PHL A;  3CCL P;  4PV1 C;  3EQ2 A;  1U75 B;  1M70 A;  1URQ D;  1H0T B;  4M3L A;  1IQC A;  2CPB A;  1K3G A;  3WUI A;  4MU8 A;  4AAN A;  3CX5 E;  1NML A;  3NBT A;  1NTZ E;  3H1I G;  3PLN A;  1IK7 A;  2E74 D;  1M90 Q;  3A0B V;  1SVF A;  3LW5 H;  1CRC A;  4L1Q A;  3H1L E;  3NXS A;  2V4H A;  3CLQ A;  2QJK B;  1BE3 G;  1HJ0 A;  1GJQ A;  1DD4 A;  2XU6 A;  1KC8 Q;  3G9R A;  1OZH A;  2E75 D;  2E76 D;  3MZW B;  2FYN C;  1NMI A;  3H1J J;  2AEF A;  1Q81 Q;  2IBZ D;  1W2B O;  1JB0 J;  1M6Z A;  5E79 E;  1I5T A;  1JY2 O;  1OX3 A;  3ZBM A;  2WSE H;  4IL6 E;  1AQ5 A;  3ZDM A;  4PD4 E;  3CCQ P;  1AYG A;  1DVH A;  2B4Z A;  1KIL C;  3AEF C;  1JOC A;  1SQQ J;  4NPD A;  1USE A;  1IFM A;  4HB1 A;  4UB6 V;  1DT1 A;  5CIH B;  3VP9 A;  2GM4 A;  5H2F E;  5AW7 B;  4L75 A;  4IL6 V;  4L3H A;  1LMS A;  451C A;  2K88 A;  1SQQ G;  2GC7 D;  4WY4 B;  3RN0 A;  3V2P A;  1U7J A;  5CMZ A;  1KN7 A;  4WQ9 A;  5CIC B;  2V7Q H;  1IJD B;  1L0N D;  1P84 I;  3TNU A;  4L76 A;  1FHB A;  2AXT H;  3V2R A;  1ZRT D;  1KB9 E;  2HG5 D;  3USS A;  4HJG H;  1COR A;  2P2U A;  1BDC A;  2EXV A;  4PW9 B;  1RF1 B;  3IR9 A;  1E29 A;  1C52 A;  1SQB G;  4NPE A;  4H13 D;  5APV A;  3VMA A;  2CE0 A;  2E76 C;  1YIC A;  3L75 G;  4AUW A;  3L74 D;  1IO3 A;  3A7O A;  1YJW P;  4DY9 A;  2Q6Q A;  2QM7 A;  1AOQ A;  1HCM A;  3WUV A;  1KIL D;  4YXW H;  5GTI E;  4AX3 A;  1FZG A;  2C1V A;  1G1I A;  1SQP J;  2YIU C;  1L0L J;  3CCM P;  3C2C A;  1LGH B;  4OGQ C;  4RJT A;  3DP5 A;  1LP1 A;  2N9B A;  1SFC A;  2UWJ E;  1A56 A;  3H1K J;  1KQL A;  2PGD A;  1NTM E;  1I6D A;  1NTM K;  3B5N D;  4OWF A;  3SWK A;  1AQT A;  3H1H D;  2YXQ B;  3OJA B;  1WMK A;  3ZCF A;  5AVR B;  2FXO A;  4JCG A;  2BH5 X;  3L71 E;  1QVG O;  1LTB C;  2QSI A;  1H8A A;  1FJ0 A;  1C2R A;  4C46 A;  1QGK B;  3IFM A;  1BE3 D;  1EZV G;  1M1J C;  1T3J A;  1FI7 A;  1CXC A;  2PCB B;  1NTZ G;  3VMX A;  2BGV X;  2OYH C;  3RK3 B;  3G71 P;  1QEX A;  2ORL A;  2W27 A;  4HYT B;  3H25 A;  4LJI A;  2OAR A;  3PTZ A;  1NJI Q;  3HE5 B;  1X9V A;  1NTM G;  3WFD C;  3I5C A;  1T2K C;  1M56 D;  3AE3 C;  3WU2 E;  1GMJ A;  3KZI H;  3WUT A;  2FFD C;  2WSC H;  1CZQ A;  2JO1 A;  1H32 A;  3SWS A;  5AVZ B;  4PJ0 E;  2KP8 A;  2IX7 C;  3RBX A;  2D0S A;  1LTJ B;  1H31 B;  2CXB A;  1RF1 A;  1KYO H;  1RE4 A;  1BGY D;  1Q2N A;  2N1T C;  155C A;  2QVA A;  4IOI H;  2KXP B;  5KLI C;  1FU1 A;  5AW3 B;  1U7M A;  4EYY Q;  3L4F A;  1KX7 A;  2C2C A;  4IFM A;  1N7S D;  3L70 G;  2Q3I A;  1EDJ A;  1YJ9 P;  1HRO A;  2R44 A;  3VMY A;  2PAJ A;  3AED C;  3RK2 B;  2C9N Y;  3FGA D;  3B4S A;  1FDI A;  5APX A;  2NPS C;  2WPS A;  1NTK J;  1GU5 A;  1JCC A;  2A45 G;  4IFD K;  3M9Q A;  4U3F J;  1IFP A;  4D6T D;  2Z4E A;  2B11 B;  2N9J A;  4XE5 B;  3M91 A;  1P84 H;  1T2K D;  2VHD A;  2BPB B;  2RKL A;  1HGV A;  3HQ7 A;  2Q7C A;  2KNC B;  2OYI B;  1L4A B;  3PRJ A;  3O1Y A;  2Q3E A;  2KIK A;  1W5C E;  2KZI A;  1IZN B;  3M97 X;  3H1K D;  1NWQ A;  3L72 J;  5KAI E;  5CCG A;  3KPE A;  1CED A;  2KS1 B;  3E1I A;  3KQG A;  3SWY A;  3BCC D;  1LWU A;  1ZLL A;  1QL1 A;  1HZV A;  2KUB A;  2K9J B;  2N1T A;  1RZ5 A;  3D6Z A;  1NHL A;  4PD4 D;  2QJK C;  2FYU D;  2WT7 B;  1BCC D;  2N9I A;  2W6A A;  5CJ4 A;  3Q5R A;  3C8V A;  3RK3 D;  1K04 A;  1VQ4 P;  2JKV A;  1JY2 N;  1KFM A;  1ZOY C;  2YO2 A;  2NRG A;  3PJS K;  1SQV G;  1EZV D;  1X22 A;  2OTK E;  2JDI H;  2WSS H;  1JY3 P;  3H1I E;  1NU1 K;  3L73 G;  1FI9 A;  3D0W A;  1KQG B;  3HD7 B;  2B0Z B;  1PGO A;  2BCC D;  1NTZ J;  1MFT A;  3A0B H;  3E1R A;  3P8C E;  1L0L D;  1FAV A;  1LTI C;  3BCC E;  2KLU A;  2V08 A;  1M8O B;  4EOT A;  1EZV I;  3RL0 D;  1WT6 A;  1S9K D;  2C8S A;  1BCC E;  3SSU A;  2ZT9 B;  5C0Z A;  2H7H A;  1AOF A;  3Q2Y A;  3R2P A;  4PD4 I;  1G1J A;  1L0N J;  2GIW A;  4I7Z C;  1LWU C;  3MK7 C;  1LJ2 A;  2AXT E;  2AXC A;  1SQP K;  1YIJ P;  1K3H A;  2JP3 A;  3T97 B;  1IFN A;  1SFC B;  2P67 A;  1NU1 E;  1M7L A;  3ZOY A;  4KT0 J;  1UII A;  2BCN B;  4H13 B;  1T3U A;  4IL6 X;  2IZ0 A;  2P58 A;  1MZ4 A;  2WPQ A;  1KMI Z;  3AE6 C;  3L37 A;  4D6T G;  2DW3 A;  1PL5 A;  1GU2 A;  4JBZ A;  1KQS O;  1FC2 C;  2WSF J;  4UB8 H;  2QJP B;  1PPJ E;  2YCC A;  3CWB E;  5APW A;  5AW0 B;  4N3Y B;  3NBS A;  2D0W A;  1SQQ E;  3AE8 C;  4EI2 A;  2PP6 A;  3WFB C;  1N2D C;  3M06 A;  5BU5 A;  2QG4 A;  1VF5 D;  2BH4 X;  2FFD A;  2GC4 D;  2E43 A;  2IDB A;  1URQ C;  4H0K A;  3SLE A;  3A0H V;  4WQ8 A;  1LT9 C;  3HQ8 A;  1NNO A;  3L75 E;  1LT9 B;  2IBZ G;  4BWN A;  2IZ1 A;  1OWA A;  3AE2 C;  1J2J B;  4P4Q B;  1CW5 A;  2W90 A;  3GF7 A;  5CCG C;  2C1U A;  2FYN B;  5CBO A;  2QIW A;  3Q5P A;  2FYZ A;  5TIS E;  3VYI A;  4EIJ A;  2N1T B;  5KLV D;  3PXW A;  2ZXY A;  4DOJ A;  3WC8 A;  2K1A A;  3KDP B;  1QVF O;  2QE7 H;  3BAT A;  3CX5 W;  3AE5 C;  1N9C A;  1KB9 H;  4FA5 A;  5APQ A;  3GG2 A;  1FZF A;  1QYZ A;  1URQ B;  4WQC A;  1NKZ B;  4LLH A;  5BVZ A;  1N73 C;  1OW8 A;  1SQV J;  3JC2 2;  3TSI A;  4DJG A;  2OYO A;  2YK3 A;  5L8R J;  3WU2 H;  3TGU E;  5DJT B;  1GK4 A;  3M0D A;  2C1D B;  2QJY C;  2GA1 A;  2AEM A;  1MKM A;  1NOH A;  5C9M A;  2HLO A;  5AVT B;  1EB7 A;  1GW3 A;  1MG2 D;  2WZ7 A;  1MFZ A;  1JTH B;  1RF0 A;  2ZT9 C;  5H2F H;  4H44 C;  5C39 A;  1XTC C;  1A02 F;  4WB4 A;  4R4M A;  3OAK A;  4FA9 A;  1VQ7 P;  4PD4 H;  1DII C;  3AE1 C;  2WMM A;  2SPZ A;  2FFD B;  1FJK A;  3RK3 E;  3BRT B;  4JYC A;  5KLV K;  3T97 A;  1E5W A;  1PGP A;  4QAO A;  4RSZ A;  2B12 B;  2IYP A;  3CX5 H;  5GTH H;  4EIC A;  3O6Q B;  4V2K A;  1PZQ A;  3OCD B;  2O01 N;  1SQB J;  3PXS A;  2KZJ A;  3WFC C;  5EFW B;  2WSE J;  2GB8 B;  2A06 E;  1EC5 A;  4WY4 A;  5APU A;  5B6Q A;  2M0B A;  1JTH A;  3F89 A;  1FOC A;  1LS9 A;  2E42 A;  1YTZ T;  2B9B A;  1J1E B;  2BLF B;  2YIU B;  2FKW B;  4OGQ D;  4K35 A;  3Q5S A;  4H0J A;  1K05 A;  2L91 A;  3O0R C;  4A7P A;  3ZOW A;  1GD2 E;  2XNX A;  5K5G B;  4C7N B;  5AW5 B;  4AYC A;  1URQ A;  4AQR D;  4EIF A;  3CWB D;  3Q3D A;  3TK1 A;  1FJP A;  4U3F E;  3HQ6 A;  1VPC A;  5KLV G;  1IFD A;  3VOP A;  1SQP E;  2M3B A;  4XFJ A;  4GOF A;  1AA0 A;  1S5L E;  1SQQ K;  3DR0 A;  3CCR P;  4DCK A;  1L9B C;  1CO6 A;  4PWA A;  1FS0 E;  2OTL P;  4AAM A;  4ZKP A;  2M8R A;  2OYI A;  1OAE A;  1GIW A;  1CXA A;  2IFM A;  5KJ7 D;  1NIR A;  3V5B A;  3AEB C;  3D71 A;  4IL6 H;  3L71 J;  1GL2 C;  2Y0D A;  3CCU P;  3BCC J;  1PPJ D;  1GK6 A;  5TIS H;  4Z1M H;  2YMY A;  1J3S A;  2Y0C A;  1N7L A;  1Q86 Q;  1RHZ B;  1CTY A;  1G2C A;  4XA4 A;  1CSV A;  3LIE A;  3G6E P;  1N73 A;  1YTC A;  2K3R A;  2XKM A;  2J59 M;  4WBA A;  2P1J A;  1LT9 A;  3H1J E;  2R5D A;  4ZNC A;  5KLV J;  1C7M A;  2PRR A;  3LID A;  1CTJ A;  2B88 A;  2CPS A;  5CIG B;  4OH8 B;  2NPS B;  1VQK P;  1CSB A;  1NU1 D;  5AVQ B;  3SJL A;  3ZIY A;  1HUC A;  5APT A;  2O01 J;  3AEA C;  2P10 A;  1JMM A;  3RGU A;  3CYT I;  3HRN A;  1NTK E;  2XND H;  1VQ5 P;  4BRY A;  1HJ4 A;  5CBN A;  4Y5R A;  3TGU D;  2LIR A;  3OA8 A;  1FZC B;  1T8Z A;  1YIQ A;  1L2P A;  1DEB A;  3A2A A;  3V2Q A;  1M1J B;  3JCU H;  1DH3 A;  2OYH B;  1KX2 A;  2OYI C;  1AFO A;  1X79 B;  4GOD A;  2W6B A;  1J1E C;  3PP5 A;  3GHG B; 
#chains in the Genus database with same CATH homology
 351C A;  5KLI B;  2C1D A;  1U74 B;  1EZV D;  3PXT A;  1COT A;  3SXT A;  1SQP D;  1SQQ D;  1FI9 A;  3ITK A;  2B0Z B;  1CHJ A;  2BCC D;  4FA4 A;  3MK7 B;  1IRW A;  1RAP A;  3L4M A;  1L0L D;  1GDV A;  4L3G A;  2V08 A;  2AXT V;  1B7V A;  5CIB B;  3TYI A;  4NFG B;  4N0K A;  1SQB D;  1KB0 A;  5E79 V;  2JQR A;  1C6S A;  4O1W A;  4UB8 V;  1ZZH A;  2C8S A;  1NTK D;  5C0Z A;  2PCC B;  3L75 D;  1I6E A;  3OCD A;  2N18 B;  1N15 A;  1AOF A;  4WQ7 A;  2GIW A;  3KZI V;  1JDL A;  1YFC A;  3MK7 C;  1H32 B;  1I8O A;  1DW3 A;  1YEA A;  1K3H A;  4J20 A;  1CRH A;  5CIE B;  3ZOY A;  2BCN B;  3WU2 V;  1CRJ A;  4O1Q A;  1QL4 A;  1CIE A;  4EID A;  5KAI V;  1CYJ A;  1CIG A;  1MZ4 A;  5KKZ B;  1IZL 0;  3TDK A;  1GU2 A;  3CX5 D;  2C9X B;  2ZOO A;  1HJ5 A;  1LC1 A;  3PHL A;  2QJP B;  3CP5 A;  1U75 B;  1M70 A;  2YCC A;  4FB1 A;  1IQC A;  3CU4 A;  1K3G A;  3WUI A;  4MU8 A;  2B10 B;  1I55 A;  4AAN A;  5DF5 A;  1NML A;  3NBT A;  3NBS A;  3PLN A;  1F1F A;  2D0W A;  1CHI A;  2FRC A;  3A0B V;  3WFB C;  1E2R A;  3H1I D;  1CRC A;  1H1O A;  5CIF B;  2DVH A;  2QG4 A;  4L1Q A;  3OA8 B;  2BH4 X;  2GC4 D;  1I8P A;  2QJK B;  1MG3 D;  1DIQ C;  4H0K A;  1C6R A;  1N90 A;  3A0H V;  3SLE A;  5CID B;  3RMZ A;  1GJQ A;  4WQ8 A;  4XYD B;  3HQ8 A;  1NNO A;  3NWV A;  1NMI A;  1CRY A;  1HZU A;  4U3F D;  3RN1 A;  1YNR A;  4P4Q B;  1CHH A;  2IBZ D;  1A8C A;  3DMI A;  1M6Z A;  1I54 A;  1H33 B;  1I5T A;  3SVW A;  1DW0 A;  2C1U A;  3ZBM A;  2FYN B;  1HJ3 A;  1DVV A;  4KMG A;  1HH7 A;  1RAQ A;  1A2S A;  2CA4 B;  1AYG A;  1DVH A;  1IRV A;  2B4Z A;  2N3Y A;  1N50 A;  5KLV D;  3PXW A;  2ZXY A;  2OZ1 B;  4UB6 V;  1LC2 A;  3WC8 A;  2QJY B;  1DT1 A;  1CCH A;  5CIH B;  1H9X A;  2JTI B;  2I8F A;  2ZZS 1;  2ZBO A;  3O20 A;  4YE1 A;  1W2L A;  4IL6 V;  4L3H A;  3PH2 B;  3KHU A;  3HQ9 A;  3CX5 W;  1KB9 D;  1LMS A;  451C A;  1SQX D;  3L73 D;  2RMZ A;  2GC7 D;  3RN0 A;  1N9C A;  1CYC A;  4FA5 A;  1R0Q A;  3GG2 A;  1QYZ A;  4WQ9 A;  4WQC A;  5CIC B;  1NTM D;  1S5L V;  3H1J D;  1L0N D;  1CYI A;  1AKK A;  1FHB A;  1ZRT D;  4WQE A;  1CNO A;  1COR A;  2EXV A;  4PW9 B;  1HRC A;  1E29 A;  1C52 A;  2L4D A;  2YK3 A;  2Y0E A;  2C1D B;  3VMA A;  2CE0 A;  1YIC A;  2V07 A;  5H2F V;  1C75 A;  1GQ1 A;  5DFS A;  5C9M A;  1M60 A;  1H31 A;  3L74 D;  1IO3 A;  1EB7 A;  4DY9 A;  5TIS V;  1MG2 D;  1E8E A;  1CIH A;  5B66 V;  2MHM A;  1CIF A;  1AOQ A;  1HCM A;  2MTA C;  1PP9 D;  2N18 C;  4EIE A;  2RN0 A;  4AX3 A;  2C1V A;  1NTZ D;  4FA9 A;  1S6V B;  1DW2 A;  5EXQ A;  1DII C;  1CTZ A;  1KV9 A;  3C2C A;  2PAC A;  3O5C A;  4RJT A;  4XXL A;  3DP5 A;  2N3B A;  2ZON G;  3CXH W;  3JBT B;  1A56 A;  5GTI V;  1VYD A;  1W5C T;  4WQA A;  4QAO A;  4RSZ A;  2B12 B;  2CE1 A;  3GW6 A;  4EIC A;  1I6D A;  1QKS A;  4V2K A;  3OCD B;  3ORV A;  1FI3 A;  3H1H D;  1GKS A;  3PXS A;  2N9Y B;  3ZCF A;  4JCG A;  3VYM A;  2BH5 X;  3WFC C;  2GB8 B;  2CA3 B;  2O3J A;  2AIU A;  5B6Q A;  1FJ0 A;  1C6O A;  1C2R A;  3ZOO A;  4GED B;  4FAN A;  1BE3 D;  1FOC A;  1LS9 A;  1KYO W;  1H33 A;  1FI7 A;  1CXC A;  2BLF B;  2PCB B;  2YIU B;  2BGV X;  2ORL A;  4FA1 A;  4H0J A;  4LJI A;  1CCR A;  2L91 A;  5TJH A;  3PTZ A;  3O0R C;  4A7P A;  3ZOW A;  2KS1 A;  3WFD C;  2LIT A;  2YQB A;  5AUR A;  2XTS B;  4EIF A;  3CWB D;  1BL9 A;  1H32 A;  3SWS A;  3X39 A;  1LFM A;  4GYD A;  2D0S A;  3HQ6 A;  1WEJ F;  5GTH V;  4FAV A;  1H31 B;  1QN2 A;  2CXB A;  1BGY D;  1SQV D;  3ZOX A;  155C A;  1YEB A;  4AAO A;  1CSW A;  3DR0 A;  2DGE A;  2FWL A;  1C2N A;  1KX7 A;  2C2C A;  1L9B C;  1CO6 A;  4PWA A;  2HV4 A;  2JWA A;  4AAM A;  3L4O A;  1HRO A;  1OAE A;  1GIW A;  1CXA A;  3VNW A;  5CYT R;  1WVE C;  5IY5 1;  1NIR A;  1RZ6 A;  3L72 D;  1QL3 A;  2Y0D A;  1PPJ D;  5DJQ C;  5DJQ B;  1J3S A;  4Q5P A;  1CRG A;  2Y0C A;  4D6T D;  1CTY A;  1P84 D;  2B11 B;  2N9J A;  1CSV A;  1KIB A;  2OZ1 A;  1YTC A;  4K3I A;  2VHD A;  2BPB B;  1OCD A;  1L9J C;  2AI5 A;  3HQ7 A;  1ETP A;  2KNC B;  4WQD A;  1FCD C;  1CSU A;  3TF5 A;  3CXH D;  3PRJ A;  1C7M A;  3L70 D;  3RLM A;  1F1C A;  1CTJ A;  3O1Y A;  4PJ0 V;  2Q3E A;  5CIG B;  1NU1 D;  3FWL A;  3SJL A;  3ZIY A;  3A9F A;  3M97 X;  3H1K D;  2A06 D;  1CED A;  4WQB A;  3L71 D;  3BCC D;  3WFE C;  3CYT I;  5KAF V;  3VRD A;  1HZV A;  2K9J B;  1HJ4 A;  1RZ5 A;  4Y5R A;  4PD4 D;  4AAL A;  3TGU D;  2LIR A;  3OA8 A;  2FYU D;  1BCC D;  2N9I A;  1YIQ A;  1KYO D;  4EDF A;  1CRI A;  1CSX A;  1CC5 A;  1H9Y A;  1KX2 A;  5B5E V;  1YCC A;  1DW1 A;  3H1L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...