1I6DA

Solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the reduced state
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
MADPAAGEKVFGKCKACHKLDGNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTPEALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLEGQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C552
publication title Solution structure and dynamics of the functional domain of Paracoccus denitrificans cytochrome c(552) in both redox states.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 23
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1i6dA00
1I8OA 1FI9A 1H31A 1DW3A 4AAOA 2QJKB 1C2NA 4U3FD 1JDLA 4FA1A 2DGEA 1YCCA 3OCDA 1EB7A 2D0WA 1CCHA 2IBZD 1YNRA 3X39A 1YEAA 4IL6V 1HH7A 2ZOOA 2LIRA 2C1DB 1DIQC 4FANA 1MZ4A 1BE3D 3L75D 1FI7A 1CO6A 5KAFV 1C7MA 3H1KD 1GKSA 4FA9A 2YQBA 3C2CA 2FWLA 3ORVA 2YCCA 1DIIC 1L0ND 3CYTI 1SQPD 5B66V 2ZONG 1SQBD 4WQ9A 5B6QA 4DY9A 2CE1A 3SLEA 2JTIB 3BCCD 2CXBA 2B10B 1FI3A 2AIUA 1W5CT 2L4DA 2JQRA 1CSVA 3JBTB 3OA8B 1I54A 5DJQB 3RMZA 3PXTA 4XYDB 1CIFA 1L0LD 1LS9A 1IRVA 1CYIA 3O0RC 1CNOA 3CXHD 4L3HA 1J3SA 1FJ0A 1KX2A 3WFDC 3A9FA 3L73D 2ZXYA 3DR0A 2B0ZB 5EXQA 5CICB 1SQQD 1C75A 2CA4B 1DW2A 3PXSA 3MK7C 1CRCA 1C6RA 4AX3A 1QKSA 3H1HD 1KB0A 1IO3A 3L70D 1NTMD 1YTCA 1S5LV 1DT1A 5KAIV 1CXCA 1PP9D 1C6OA 3O1YA 3RLMA 1K3HA 4PW9B 2B12B 4AANA 3WFCC 3NWVA 5KKZB 2MTAC 1CRHA 4PWAA 4WQBA 5AURA 1MG3D 3HQ7A 1AKKA 1CRGA 1SQXD 3ZOYA 1CRJA 4EIEA 3TYIA 1H32B 2ZZS1 4YE1A 1IRWA 3CU4A 2FYUD 1U75B 2BH5X 5CIHB 4V2KA 1I5TA 1ZRTD 1L9BC 1BGYD 1AYGA 1RAPA 5CIDB 1C6SA 1NTKD 2V07A 1CHHA 5CIGB 1C2RA 3WFBC 3A0BV 1HZUA 3WC8A 1KYOD 4AAMA 1ZZHA 1KV9A 2I8FA 1NIRA 1H32A 1GDVA 2CE0A 351CA 3L71D 1HROA 1AOFA 1F1CA 3CXHW 1NMLA 3PH2B 2C8SA 2N18C 1H1OA 2QJYB 2GIWA 2LITA 1PPJD 1C52A 1E29A 1EZVD 1CORA 1IZL0 1CIEA 1CTJA 1DVHA 1HZVA 3HQ8A 5H2FV 1HJ3A 4UB6V 1YEBA 1WVEC 2BGVX 1CXAA 2ZBOA 2AI5A 1I6DA 2PCBB 5DF5A 1QN2A 2GB8B 1SQVD 1WEJF 1CSWA 3ZIYA 1R0QA 1CSUA 3M97X 1QYZA 1GQ1A 5DFSA 2C1DA 2PCCB 1CTYA 1YICA 4JCGA 2BCCD 3PXWA 1ETPA 2V08A 1LMSA 1H9XA 3CX5D 4O1WA 3RN1A 4FA5A 1CIGA 1AOQA 5C0ZA 1CYCA 4GYDA 4UB8V 2C1UA 1DVVA 5GTIV 1DW0A 2QJPB 3ZOWA 1CYJA 1NU1D 2AXTV 3OA8A 4H0KA 1CTZA 3CWBD 1CIHA 3KZIV 1A56A 4K3IA 1KYOW 1CSXA 3L74D 1CRYA 3WUIA 1N9CA 3H1LD 3NBSA 1E2RA 3MK7B 3VRDA 2B4ZA 1GJQA 4L1QA 1HRCA 1CRIA 4PJ0V 4H0JA 1YFCA 2C1VA 4EIDA 1M60A 1NTZD 1M70A 2BCNB 1IQCA 4WQDA 1H31B 1KB9D 3ZCFA 4Y5RA 1HJ5A 5CIEB 1LFMA 3O20A 4FA4A 3H1JD 3A0HV 2PACA 4J20A 155CA 2N9IA 1B7VA 4O1QA 2XTSB 1W2LA 1DW1A 1FHBA 1A2SA 1H9YA 3RN0A 4AALA 2FRCA 2OZ1B 3VYMA 2B11B 1H33B 1CEDA 4WQ8A 2N3BA 3CX5W 1RZ5A 3ZOOA 3VNWA 1GIWA 5IY51 1KX7A 3HQ9A 1NMIA 4PD4D 2ORLA 4WQ7A 1MG2D 4XXLA 1E8EA 4N0KA 4Q5PA 1CC5A 1S6VB 4EICA 4FB1A 1HJ4A 1FCDC 4P4QB 3SWSA 2N18B 5KLIB 1F1FA 1QL4A 1K3GA 2OZ1A 3SJLA 1H33A 4LJIA 3DMIA 1KIBA 3WFEC 1HCMA 4MU8A 2VHDA 2YK3A 3CP5A 5DJQC 4QAOA 4D6TD 1U74B 1P84D 3HQ6A 1LC1A 2HV4A 2A06D 1I8PA 1RAQA 4WQAA 4L3GA 2D0SA 1FOCA 1N90A 3DP5A 4RSZA 5KLVD 4EIFA 1OAEA 2GC4D 2BH4X 2N9JA 2N3YA 2EXVA 4WQCA 1M6ZA 1N15A 1BCCD 4GEDB 3L4OA 5CYTR 2YIUB 2BLFB 1CHJA 5E79V 1QL3A 2C9XB 4KMGA 1GU2A 1COTA 3O5CA 3SXTA 1N50A 4WQEA 3ZOXA 1A8CA 5TISV 1CHIA 2BPBB 2C2CA 3TGUD 1YIQA 1LC2A 5B5EV 2MHMA 1VYDA 2CA3B 3ZBMA 5C9MA 3WU2V 1NNOA 3H1ID 1I55A 1CCRA 1L9JC 3OCDB 1OCDA 1RZ6A 2FYNB 5GTHV 5CIFB 1BL9A 5CIBB 3SVWA 1I6EA 451CA 2GC7D 2DVHA 3NBTA 3L72D 4FAVA 4NFGB 3L4MA
chains in the Genus database with same CATH superfamily
1I8OA 1FI9A 1H31A 1DW3A 4AAOA 2QJKB 1C2NA 4U3FD 1JDLA 4FA1A 2DGEA 1YCCA 3OCDA 1EB7A 2D0WA 1CCHA 2IBZD 1YNRA 3X39A 1YEAA 4IL6V 1HH7A 2ZOOA 2LIRA 2C1DB 1DIQC 4FANA 1MZ4A 1BE3D 3L75D 1FI7A 1CO6A 5KAFV 1C7MA 3H1KD 1GKSA 4FA9A 2YQBA 3C2CA 2FWLA 3ORVA 2YCCA 1DIIC 1L0ND 3CYTI 1SQPD 5B66V 2ZONG 1SQBD 4WQ9A 5B6QA 4DY9A 2CE1A 3SLEA 2JTIB 3BCCD 2CXBA 2B10B 1FI3A 2AIUA 1W5CT 2L4DA 2JQRA 1CSVA 3JBTB 3OA8B 1I54A 5DJQB 3RMZA 3PXTA 4XYDB 1CIFA 1L0LD 1LS9A 1IRVA 1CYIA 3O0RC 1CNOA 3CXHD 4L3HA 1J3SA 1FJ0A 1KX2A 3WFDC 3A9FA 3L73D 2ZXYA 3DR0A 2B0ZB 5EXQA 5CICB 1SQQD 1C75A 2CA4B 1DW2A 3D0WA 3PXSA 3MK7C 1CRCA 1C6RA 4AX3A 1QKSA 3H1HD 1KB0A 1IO3A 3L70D 1NTMD 1YTCA 1S5LV 1DT1A 5KAIV 1CXCA 1PP9D 1C6OA 3O1YA 3RLMA 1K3HA 4PW9B 2B12B 4AANA 3WFCC 3NWVA 5KKZB 2MTAC 1CRHA 4PWAA 4WQBA 5AURA 1MG3D 3HQ7A 1AKKA 1CRGA 1SQXD 3ZOYA 1CRJA 4EIEA 3TYIA 1H32B 2ZZS1 4YE1A 1IRWA 3CU4A 2FYUD 1U75B 2BH5X 5CIHB 4V2KA 1I5TA 1ZRTD 1L9BC 1BGYD 1AYGA 1RAPA 5CIDB 1C6SA 1NTKD 2V07A 1CHHA 5CIGB 1C2RA 3WFBC 3A0BV 1HZUA 3WC8A 1KYOD 4AAMA 1ZZHA 1KV9A 2I8FA 1NIRA 1H32A 1GDVA 2CE0A 351CA 3L71D 1HROA 1AOFA 1F1CA 3CXHW 1NMLA 3PH2B 2C8SA 2N18C 1H1OA 2QJYB 2GIWA 2LITA 1PPJD 1C52A 1E29A 1EZVD 1CORA 1IZL0 1CIEA 1CTJA 1DVHA 1HZVA 3HQ8A 5H2FV 1HJ3A 4UB6V 1YEBA 1WVEC 2BGVX 1CXAA 2ZBOA 2AI5A 1I6DA 2PCBB 5DF5A 1QN2A 2GB8B 1SQVD 1WEJF 1CSWA 3ZIYA 1R0QA 1CSUA 3M97X 1QYZA 1GQ1A 5DFSA 2C1DA 2PCCB 1CTYA 1YICA 4JCGA 2BCCD 3PXWA 1ETPA 2V08A 1LMSA 1H9XA 3CX5D 4O1WA 3RN1A 4FA5A 1CIGA 1AOQA 5C0ZA 1CYCA 4GYDA 4UB8V 2C1UA 1DVVA 5GTIV 1DW0A 2QJPB 3ZOWA 1CYJA 1NU1D 2AXTV 3OA8A 4H0KA 1CTZA 3CWBD 1CIHA 3KZIV 1A56A 4K3IA 1KYOW 1CSXA 3L74D 1CRYA 3WUIA 1N9CA 3H1LD 3NBSA 1E2RA 3MK7B 3VRDA 2B4ZA 1GJQA 4L1QA 1HRCA 1CRIA 4PJ0V 4H0JA 1YFCA 2C1VA 4EIDA 1M60A 1NTZD 1M70A 2BCNB 1IQCA 4WQDA 1H31B 1KB9D 3ZCFA 4Y5RA 1HJ5A 5CIEB 1LFMA 3O20A 4FA4A 3H1JD 3A0HV 2PACA 4J20A 155CA 2N9IA 1B7VA 4O1QA 2XTSB 1W2LA 1DW1A 1FHBA 1A2SA 1H9YA 3RN0A 4AALA 2FRCA 2OZ1B 3VYMA 2B11B 1H33B 1CEDA 4WQ8A 2N3BA 3CX5W 1RZ5A 3ZOOA 3VNWA 1GIWA 5IY51 1KX7A 3HQ9A 1NMIA 4PD4D 2ORLA 4WQ7A 1MG2D 4XXLA 1E8EA 4N0KA 4Q5PA 1CC5A 1S6VB 4EICA 4FB1A 1HJ4A 1FCDC 4P4QB 3SWSA 2N18B 5KLIB 1F1FA 1QL4A 1K3GA 2OZ1A 3SJLA 1H33A 4LJIA 3DMIA 1KIBA 3WFEC 1HCMA 4MU8A 2VHDA 2YK3A 3CP5A 5DJQC 4QAOA 4D6TD 1U74B 1P84D 3HQ6A 1LC1A 2HV4A 2A06D 1I8PA 1RAQA 4WQAA 4L3GA 2D0SA 1FOCA 1N90A 3DP5A 4RSZA 5KLVD 4EIFA 1OAEA 2GC4D 2BH4X 2N9JA 2N3YA 2EXVA 4WQCA 1M6ZA 1N15A 1BCCD 4GEDB 3L4OA 5CYTR 2YIUB 2BLFB 1CHJA 5E79V 1QL3A 2C9XB 4KMGA 1GU2A 1COTA 3O5CA 3SXTA 1N50A 4WQEA 3ZOXA 1A8CA 5TISV 1CHIA 2BPBB 2C2CA 3TGUD 1YIQA 1LC2A 5B5EV 2MHMA 1VYDA 2CA3B 3ZBMA 5C9MA 3WU2V 1NNOA 3H1ID 1I55A 1CCRA 1L9JC 3OCDB 1OCDA 1RZ6A 2FYNB 5GTHV 5CIFB 1BL9A 5CIBB 3SVWA 1I6EA 451CA 2GC7D 2DVHA 3NBTA 3L72D 4FAVA 4NFGB 3L4MA
chains in the Genus database with same CATH topology
1I8OA 1FI9A 1H31A 1DW3A 4AAOA 2QJKB 1C2NA 4U3FD 1JDLA 4FA1A 2DGEA 1YCCA 3OCDA 1EB7A 2D0WA 1CCHA 2IBZD 1YNRA 3X39A 1YEAA 4IL6V 1HH7A 2ZOOA 2LIRA 2C1DB 1DIQC 4FANA 1MZ4A 1BE3D 3L75D 1FI7A 1CO6A 5KAFV 1C7MA 3H1KD 1GKSA 4FA9A 2YQBA 3C2CA 2FWLA 3ORVA 2YCCA 1DIIC 1L0ND 3CYTI 1SQPD 5B66V 2ZONG 1SQBD 4WQ9A 5B6QA 4DY9A 2CE1A 3SLEA 2JTIB 3BCCD 2CXBA 2B10B 1FI3A 2AIUA 1W5CT 2L4DA 2JQRA 1CSVA 3JBTB 3OA8B 1I54A 5DJQB 3RMZA 3PXTA 4XYDB 1CIFA 1L0LD 1LS9A 1IRVA 1CYIA 3O0RC 1CNOA 3CXHD 4L3HA 1J3SA 1FJ0A 1KX2A 3WFDC 3A9FA 3L73D 2ZXYA 3DR0A 2B0ZB 5EXQA 5CICB 1SQQD 1C75A 2CA4B 1DW2A 3PXSA 3MK7C 1CRCA 1C6RA 4AX3A 1QKSA 3H1HD 1KB0A 1IO3A 3L70D 1NTMD 1YTCA 1S5LV 1DT1A 5KAIV 1CXCA 1PP9D 1C6OA 3O1YA 3RLMA 1K3HA 4PW9B 2B12B 4AANA 3WFCC 3NWVA 5KKZB 2MTAC 1CRHA 4PWAA 4WQBA 5AURA 1MG3D 3HQ7A 1AKKA 1CRGA 1SQXD 3ZOYA 1CRJA 4EIEA 3TYIA 1H32B 2ZZS1 4YE1A 1IRWA 3CU4A 2FYUD 1U75B 2BH5X 5CIHB 4V2KA 1I5TA 1ZRTD 1L9BC 1BGYD 1AYGA 1RAPA 5CIDB 1C6SA 1NTKD 2V07A 1CHHA 5CIGB 1C2RA 3WFBC 3A0BV 1HZUA 3WC8A 1KYOD 4AAMA 1ZZHA 1KV9A 2I8FA 1NIRA 1H32A 1GDVA 2CE0A 351CA 3L71D 1HROA 1AOFA 1F1CA 3CXHW 1NMLA 3PH2B 2C8SA 2N18C 1H1OA 2QJYB 2GIWA 2LITA 1PPJD 1C52A 1E29A 1EZVD 1CORA 1IZL0 1CIEA 1CTJA 1DVHA 1HZVA 3HQ8A 5H2FV 1HJ3A 4UB6V 1YEBA 1WVEC 2BGVX 1CXAA 2ZBOA 2AI5A 1I6DA 2PCBB 5DF5A 1QN2A 2GB8B 1SQVD 1WEJF 1CSWA 3ZIYA 1R0QA 1CSUA 3M97X 1QYZA 1GQ1A 5DFSA 2C1DA 2PCCB 1CTYA 1YICA 4JCGA 2BCCD 3PXWA 1ETPA 2V08A 1LMSA 1H9XA 3CX5D 4O1WA 3RN1A 4FA5A 1CIGA 1AOQA 5C0ZA 1CYCA 4GYDA 4UB8V 2C1UA 1DVVA 5GTIV 1DW0A 2QJPB 3ZOWA 1CYJA 1NU1D 2AXTV 3OA8A 4H0KA 1CTZA 3CWBD 1CIHA 3KZIV 1A56A 4K3IA 1KYOW 1CSXA 3L74D 1CRYA 3WUIA 1N9CA 3H1LD 3NBSA 1E2RA 3MK7B 3VRDA 2B4ZA 1GJQA 4L1QA 1HRCA 1CRIA 4PJ0V 4H0JA 1YFCA 2C1VA 4EIDA 1M60A 1NTZD 1M70A 2BCNB 1IQCA 4WQDA 1H31B 1KB9D 3ZCFA 4Y5RA 1HJ5A 5CIEB 1LFMA 3O20A 4FA4A 3H1JD 3A0HV 2PACA 4J20A 155CA 2N9IA 1B7VA 4O1QA 2XTSB 1W2LA 1DW1A 1FHBA 1A2SA 1H9YA 3RN0A 4AALA 2FRCA 2OZ1B 3VYMA 2B11B 1H33B 1CEDA 4WQ8A 2N3BA 3CX5W 1RZ5A 3ZOOA 3VNWA 1GIWA 5IY51 1KX7A 3HQ9A 1NMIA 4PD4D 2ORLA 4WQ7A 1MG2D 4XXLA 1E8EA 4N0KA 4Q5PA 1CC5A 1S6VB 4EICA 4FB1A 1HJ4A 1FCDC 4P4QB 3SWSA 2N18B 5KLIB 1F1FA 1QL4A 1K3GA 2OZ1A 3SJLA 1H33A 4LJIA 3DMIA 1KIBA 3WFEC 1HCMA 4MU8A 2VHDA 2YK3A 3CP5A 5DJQC 4QAOA 4D6TD 1U74B 1P84D 3HQ6A 1LC1A 2HV4A 2A06D 1I8PA 1RAQA 4WQAA 4L3GA 2D0SA 1FOCA 1N90A 3DP5A 4RSZA 5KLVD 4EIFA 1OAEA 2GC4D 2BH4X 2N9JA 2N3YA 2EXVA 4WQCA 1M6ZA 1N15A 1BCCD 4GEDB 3L4OA 5CYTR 2YIUB 2BLFB 1CHJA 5E79V 1QL3A 2C9XB 4KMGA 1GU2A 1COTA 3O5CA 3SXTA 1N50A 4WQEA 3ZOXA 1A8CA 5TISV 1CHIA 2BPBB 2C2CA 3TGUD 1YIQA 1LC2A 5B5EV 2MHMA 1VYDA 2CA3B 3ZBMA 5C9MA 3WU2V 1NNOA 3H1ID 1I55A 1CCRA 1L9JC 3OCDB 1OCDA 1RZ6A 2FYNB 5GTHV 5CIFB 1BL9A 5CIBB 3SVWA 1I6EA 451CA 2GC7D 2DVHA 3NBTA 3L72D 4FAVA 4NFGB 3L4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8O A;  1FI9 A;  1H31 A;  1DW3 A;  4AAO A;  2QJK B;  1C2N A;  4U3F D;  1JDL A;  4FA1 A;  2DGE A;  1YCC A;  3OCD A;  1EB7 A;  2D0W A;  1CCH A;  2IBZ D;  1YNR A;  3X39 A;  1YEA A;  4IL6 V;  1HH7 A;  2ZOO A;  2LIR A;  2C1D B;  1DIQ C;  4FAN A;  1MZ4 A;  1BE3 D;  3L75 D;  1FI7 A;  1CO6 A;  5KAF V;  1C7M A;  3H1K D;  1GKS A;  4FA9 A;  2YQB A;  3C2C A;  2FWL A;  3ORV A;  2YCC A;  1DII C;  1L0N D;  3CYT I;  1SQP D;  5B66 V;  2ZON G;  1SQB D;  4WQ9 A;  5B6Q A;  4DY9 A;  2CE1 A;  3SLE A;  2JTI B;  3BCC D;  2CXB A;  2B10 B;  1FI3 A;  2AIU A;  1W5C T;  2L4D A;  2JQR A;  1CSV A;  3JBT B;  3OA8 B;  1I54 A;  5DJQ B;  3RMZ A;  3PXT A;  4XYD B;  1CIF A;  1L0L D;  1LS9 A;  1IRV A;  1CYI A;  3O0R C;  1CNO A;  3CXH D;  4L3H A;  1J3S A;  1FJ0 A;  1KX2 A;  3WFD C;  3A9F A;  3L73 D;  2ZXY A;  3DR0 A;  2B0Z B;  5EXQ A;  5CIC B;  1SQQ D;  1C75 A;  2CA4 B;  1DW2 A;  3PXS A;  3MK7 C;  1CRC A;  1C6R A;  4AX3 A;  1QKS A;  3H1H D;  1KB0 A;  1IO3 A;  3L70 D;  1NTM D;  1YTC A;  1S5L V;  1DT1 A;  5KAI V;  1CXC A;  1PP9 D;  1C6O A;  3O1Y A;  3RLM A;  1K3H A;  4PW9 B;  2B12 B;  4AAN A;  3WFC C;  3NWV A;  5KKZ B;  2MTA C;  1CRH A;  4PWA A;  4WQB A;  5AUR A;  1MG3 D;  3HQ7 A;  1AKK A;  1CRG A;  1SQX D;  3ZOY A;  1CRJ A;  4EIE A;  3TYI A;  1H32 B;  2ZZS 1;  4YE1 A;  1IRW A;  3CU4 A;  2FYU D;  1U75 B;  2BH5 X;  5CIH B;  4V2K A;  1I5T A;  1ZRT D;  1L9B C;  1BGY D;  1AYG A;  1RAP A;  5CID B;  1C6S A;  1NTK D;  2V07 A;  1CHH A;  5CIG B;  1C2R A;  3WFB C;  3A0B V;  1HZU A;  3WC8 A;  1KYO D;  4AAM A;  1ZZH A;  1KV9 A;  2I8F A;  1NIR A;  1H32 A;  1GDV A;  2CE0 A;  351C A;  3L71 D;  1HRO A;  1AOF A;  1F1C A;  3CXH W;  1NML A;  3PH2 B;  2C8S A;  2N18 C;  1H1O A;  2QJY B;  2GIW A;  2LIT A;  1PPJ D;  1C52 A;  1E29 A;  1EZV D;  1COR A;  1IZL 0;  1CIE A;  1CTJ A;  1DVH A;  1HZV A;  3HQ8 A;  5H2F V;  1HJ3 A;  4UB6 V;  1YEB A;  1WVE C;  2BGV X;  1CXA A;  2ZBO A;  2AI5 A;  1I6D A;  2PCB B;  5DF5 A;  1QN2 A;  2GB8 B;  1SQV D;  1WEJ F;  1CSW A;  3ZIY A;  1R0Q A;  1CSU A;  3M97 X;  1QYZ A;  1GQ1 A;  5DFS A;  2C1D A;  2PCC B;  1CTY A;  1YIC A;  4JCG A;  2BCC D;  3PXW A;  1ETP A;  2V08 A;  1LMS A;  1H9X A;  3CX5 D;  4O1W A;  3RN1 A;  4FA5 A;  1CIG A;  1AOQ A;  5C0Z A;  1CYC A;  4GYD A;  4UB8 V;  2C1U A;  1DVV A;  5GTI V;  1DW0 A;  2QJP B;  3ZOW A;  1CYJ A;  1NU1 D;  2AXT V;  3OA8 A;  4H0K A;  1CTZ A;  3CWB D;  1CIH A;  3KZI V;  1A56 A;  4K3I A;  1KYO W;  1CSX A;  3L74 D;  1CRY A;  3WUI A;  1N9C A;  3H1L D;  3NBS A;  1E2R A;  3MK7 B;  3VRD A;  2B4Z A;  1GJQ A;  4L1Q A;  1HRC A;  1CRI A;  4PJ0 V;  4H0J A;  1YFC A;  2C1V A;  4EID A;  1M60 A;  1NTZ D;  1M70 A;  2BCN B;  1IQC A;  4WQD A;  1H31 B;  1KB9 D;  3ZCF A;  4Y5R A;  1HJ5 A;  5CIE B;  1LFM A;  3O20 A;  4FA4 A;  3H1J D;  3A0H V;  2PAC A;  4J20 A;  155C A;  2N9I A;  1B7V A;  4O1Q A;  2XTS B;  1W2L A;  1DW1 A;  1FHB A;  1A2S A;  1H9Y A;  3RN0 A;  4AAL A;  2FRC A;  2OZ1 B;  3VYM A;  2B11 B;  1H33 B;  1CED A;  4WQ8 A;  2N3B A;  3CX5 W;  1RZ5 A;  3ZOO A;  3VNW A;  1GIW A;  5IY5 1;  1KX7 A;  3HQ9 A;  1NMI A;  4PD4 D;  2ORL A;  4WQ7 A;  1MG2 D;  4XXL A;  1E8E A;  4N0K A;  4Q5P A;  1CC5 A;  1S6V B;  4EIC A;  4FB1 A;  1HJ4 A;  1FCD C;  4P4Q B;  3SWS A;  2N18 B;  5KLI B;  1F1F A;  1QL4 A;  1K3G A;  2OZ1 A;  3SJL A;  1H33 A;  4LJI A;  3DMI A;  1KIB A;  3WFE C;  1HCM A;  4MU8 A;  2VHD A;  2YK3 A;  3CP5 A;  5DJQ C;  4QAO A;  4D6T D;  1U74 B;  1P84 D;  3HQ6 A;  1LC1 A;  2HV4 A;  2A06 D;  1I8P A;  1RAQ A;  4WQA A;  4L3G A;  2D0S A;  1FOC A;  1N90 A;  3DP5 A;  4RSZ A;  5KLV D;  4EIF A;  1OAE A;  2GC4 D;  2BH4 X;  2N9J A;  2N3Y A;  2EXV A;  4WQC A;  1M6Z A;  1N15 A;  1BCC D;  4GED B;  3L4O A;  5CYT R;  2YIU B;  2BLF B;  1CHJ A;  5E79 V;  1QL3 A;  2C9X B;  4KMG A;  1GU2 A;  1COT A;  3O5C A;  3SXT A;  1N50 A;  4WQE A;  3ZOX A;  1A8C A;  5TIS V;  1CHI A;  2BPB B;  2C2C A;  3TGU D;  1YIQ A;  1LC2 A;  5B5E V;  2MHM A;  1VYD A;  2CA3 B;  3ZBM A;  5C9M A;  3WU2 V;  1NNO A;  3H1I D;  1I55 A;  1CCR A;  1L9J C;  3OCD B;  1OCD A;  1RZ6 A;  2FYN B;  5GTH V;  5CIF B;  1BL9 A;  5CIB B;  3SVW A;  1I6E A;  451C A;  2GC7 D;  2DVH A;  3NBT A;  3L72 D;  4FAV A;  4NFG B;  3L4M A; 
#chains in the Genus database with same CATH topology
 1I8O A;  1FI9 A;  1H31 A;  1DW3 A;  4AAO A;  2QJK B;  1C2N A;  4U3F D;  1JDL A;  4FA1 A;  2DGE A;  1YCC A;  3OCD A;  1EB7 A;  2D0W A;  1CCH A;  2IBZ D;  1YNR A;  3X39 A;  1YEA A;  4IL6 V;  1HH7 A;  2ZOO A;  2LIR A;  2C1D B;  1DIQ C;  4FAN A;  1MZ4 A;  1BE3 D;  3L75 D;  1FI7 A;  1CO6 A;  5KAF V;  1C7M A;  3H1K D;  1GKS A;  4FA9 A;  2YQB A;  3C2C A;  2FWL A;  3ORV A;  2YCC A;  1DII C;  1L0N D;  3CYT I;  1SQP D;  5B66 V;  2ZON G;  1SQB D;  4WQ9 A;  5B6Q A;  4DY9 A;  2CE1 A;  3SLE A;  2JTI B;  3BCC D;  2CXB A;  2B10 B;  1FI3 A;  2AIU A;  1W5C T;  2L4D A;  2JQR A;  1CSV A;  3JBT B;  3OA8 B;  1I54 A;  5DJQ B;  3RMZ A;  3PXT A;  4XYD B;  1CIF A;  1L0L D;  1LS9 A;  1IRV A;  1CYI A;  3O0R C;  1CNO A;  3CXH D;  4L3H A;  1J3S A;  1FJ0 A;  1KX2 A;  3WFD C;  3A9F A;  3L73 D;  2ZXY A;  3DR0 A;  2B0Z B;  5EXQ A;  5CIC B;  1SQQ D;  1C75 A;  2CA4 B;  1DW2 A;  3D0W A;  3PXS A;  3MK7 C;  1CRC A;  1C6R A;  4AX3 A;  1QKS A;  3H1H D;  1KB0 A;  1IO3 A;  3L70 D;  1NTM D;  1YTC A;  1S5L V;  1DT1 A;  5KAI V;  1CXC A;  1PP9 D;  1C6O A;  3O1Y A;  3RLM A;  1K3H A;  4PW9 B;  2B12 B;  4AAN A;  3WFC C;  3NWV A;  5KKZ B;  2MTA C;  1CRH A;  4PWA A;  4WQB A;  5AUR A;  1MG3 D;  3HQ7 A;  1AKK A;  1CRG A;  1SQX D;  3ZOY A;  1CRJ A;  4EIE A;  3TYI A;  1H32 B;  2ZZS 1;  4YE1 A;  1IRW A;  3CU4 A;  2FYU D;  1U75 B;  2BH5 X;  5CIH B;  4V2K A;  1I5T A;  1ZRT D;  1L9B C;  1BGY D;  1AYG A;  1RAP A;  5CID B;  1C6S A;  1NTK D;  2V07 A;  1CHH A;  5CIG B;  1C2R A;  3WFB C;  3A0B V;  1HZU A;  3WC8 A;  1KYO D;  4AAM A;  1ZZH A;  1KV9 A;  2I8F A;  1NIR A;  1H32 A;  1GDV A;  2CE0 A;  351C A;  3L71 D;  1HRO A;  1AOF A;  1F1C A;  3CXH W;  1NML A;  3PH2 B;  2C8S A;  2N18 C;  1H1O A;  2QJY B;  2GIW A;  2LIT A;  1PPJ D;  1C52 A;  1E29 A;  1EZV D;  1COR A;  1IZL 0;  1CIE A;  1CTJ A;  1DVH A;  1HZV A;  3HQ8 A;  5H2F V;  1HJ3 A;  4UB6 V;  1YEB A;  1WVE C;  2BGV X;  1CXA A;  2ZBO A;  2AI5 A;  1I6D A;  2PCB B;  5DF5 A;  1QN2 A;  2GB8 B;  1SQV D;  1WEJ F;  1CSW A;  3ZIY A;  1R0Q A;  1CSU A;  3M97 X;  1QYZ A;  1GQ1 A;  5DFS A;  2C1D A;  2PCC B;  1CTY A;  1YIC A;  4JCG A;  2BCC D;  3PXW A;  1ETP A;  2V08 A;  1LMS A;  1H9X A;  3CX5 D;  4O1W A;  3RN1 A;  4FA5 A;  1CIG A;  1AOQ A;  5C0Z A;  1CYC A;  4GYD A;  4UB8 V;  2C1U A;  1DVV A;  5GTI V;  1DW0 A;  2QJP B;  3ZOW A;  1CYJ A;  1NU1 D;  2AXT V;  3OA8 A;  4H0K A;  1CTZ A;  3CWB D;  1CIH A;  3KZI V;  1A56 A;  4K3I A;  1KYO W;  1CSX A;  3L74 D;  1CRY A;  3WUI A;  1N9C A;  3H1L D;  3NBS A;  1E2R A;  3MK7 B;  3VRD A;  2B4Z A;  1GJQ A;  4L1Q A;  1HRC A;  1CRI A;  4PJ0 V;  4H0J A;  1YFC A;  2C1V A;  4EID A;  1M60 A;  1NTZ D;  1M70 A;  2BCN B;  1IQC A;  4WQD A;  1H31 B;  1KB9 D;  3ZCF A;  4Y5R A;  1HJ5 A;  5CIE B;  1LFM A;  3O20 A;  4FA4 A;  3H1J D;  3A0H V;  2PAC A;  4J20 A;  155C A;  2N9I A;  1B7V A;  4O1Q A;  2XTS B;  1W2L A;  1DW1 A;  1FHB A;  1A2S A;  1H9Y A;  3RN0 A;  4AAL A;  2FRC A;  2OZ1 B;  3VYM A;  2B11 B;  1H33 B;  1CED A;  4WQ8 A;  2N3B A;  3CX5 W;  1RZ5 A;  3ZOO A;  3VNW A;  1GIW A;  5IY5 1;  1KX7 A;  3HQ9 A;  1NMI A;  4PD4 D;  2ORL A;  4WQ7 A;  1MG2 D;  4XXL A;  1E8E A;  4N0K A;  4Q5P A;  1CC5 A;  1S6V B;  4EIC A;  4FB1 A;  1HJ4 A;  1FCD C;  4P4Q B;  3SWS A;  2N18 B;  5KLI B;  1F1F A;  1QL4 A;  1K3G A;  2OZ1 A;  3SJL A;  1H33 A;  4LJI A;  3DMI A;  1KIB A;  3WFE C;  1HCM A;  4MU8 A;  2VHD A;  2YK3 A;  3CP5 A;  5DJQ C;  4QAO A;  4D6T D;  1U74 B;  1P84 D;  3HQ6 A;  1LC1 A;  2HV4 A;  2A06 D;  1I8P A;  1RAQ A;  4WQA A;  4L3G A;  2D0S A;  1FOC A;  1N90 A;  3DP5 A;  4RSZ A;  5KLV D;  4EIF A;  1OAE A;  2GC4 D;  2BH4 X;  2N9J A;  2N3Y A;  2EXV A;  4WQC A;  1M6Z A;  1N15 A;  1BCC D;  4GED B;  3L4O A;  5CYT R;  2YIU B;  2BLF B;  1CHJ A;  5E79 V;  1QL3 A;  2C9X B;  4KMG A;  1GU2 A;  1COT A;  3O5C A;  3SXT A;  1N50 A;  4WQE A;  3ZOX A;  1A8C A;  5TIS V;  1CHI A;  2BPB B;  2C2C A;  3TGU D;  1YIQ A;  1LC2 A;  5B5E V;  2MHM A;  1VYD A;  2CA3 B;  3ZBM A;  5C9M A;  3WU2 V;  1NNO A;  3H1I D;  1I55 A;  1CCR A;  1L9J C;  3OCD B;  1OCD A;  1RZ6 A;  2FYN B;  5GTH V;  5CIF B;  1BL9 A;  5CIB B;  3SVW A;  1I6E A;  451C A;  2GC7 D;  2DVH A;  3NBT A;  3L72 D;  4FAV A;  4NFG B;  3L4M A; 
#chains in the Genus database with same CATH homology
 1I8O A;  1FI9 A;  1H31 A;  1DW3 A;  4AAO A;  2QJK B;  1C2N A;  4U3F D;  1JDL A;  4FA1 A;  2DGE A;  1YCC A;  3OCD A;  1EB7 A;  2D0W A;  1CCH A;  2IBZ D;  1YNR A;  3X39 A;  1YEA A;  4IL6 V;  1HH7 A;  2ZOO A;  2LIR A;  2C1D B;  1DIQ C;  4FAN A;  1MZ4 A;  1BE3 D;  3L75 D;  1FI7 A;  1CO6 A;  5KAF V;  1C7M A;  3H1K D;  1GKS A;  4FA9 A;  2YQB A;  3C2C A;  2FWL A;  3ORV A;  2YCC A;  1DII C;  1L0N D;  3CYT I;  1SQP D;  5B66 V;  2ZON G;  1SQB D;  4WQ9 A;  5B6Q A;  4DY9 A;  2CE1 A;  3SLE A;  2JTI B;  3BCC D;  2CXB A;  2B10 B;  1FI3 A;  2AIU A;  1W5C T;  2L4D A;  2JQR A;  1CSV A;  3JBT B;  3OA8 B;  1I54 A;  5DJQ B;  3RMZ A;  3PXT A;  4XYD B;  1CIF A;  1L0L D;  1LS9 A;  1IRV A;  1CYI A;  3O0R C;  1CNO A;  3CXH D;  4L3H A;  1J3S A;  1FJ0 A;  1KX2 A;  3WFD C;  3A9F A;  3L73 D;  2ZXY A;  3DR0 A;  2B0Z B;  5EXQ A;  5CIC B;  1SQQ D;  1C75 A;  2CA4 B;  1DW2 A;  3PXS A;  3MK7 C;  1CRC A;  1C6R A;  4AX3 A;  1QKS A;  3H1H D;  1KB0 A;  1IO3 A;  3L70 D;  1NTM D;  1YTC A;  1S5L V;  1DT1 A;  5KAI V;  1CXC A;  1PP9 D;  1C6O A;  3O1Y A;  3RLM A;  1K3H A;  4PW9 B;  2B12 B;  4AAN A;  3WFC C;  3NWV A;  5KKZ B;  2MTA C;  1CRH A;  4PWA A;  4WQB A;  5AUR A;  1MG3 D;  3HQ7 A;  1AKK A;  1CRG A;  1SQX D;  3ZOY A;  1CRJ A;  4EIE A;  3TYI A;  1H32 B;  2ZZS 1;  4YE1 A;  1IRW A;  3CU4 A;  2FYU D;  1U75 B;  2BH5 X;  5CIH B;  4V2K A;  1I5T A;  1ZRT D;  1L9B C;  1BGY D;  1AYG A;  1RAP A;  5CID B;  1C6S A;  1NTK D;  2V07 A;  1CHH A;  5CIG B;  1C2R A;  3WFB C;  3A0B V;  1HZU A;  3WC8 A;  1KYO D;  4AAM A;  1ZZH A;  1KV9 A;  2I8F A;  1NIR A;  1H32 A;  1GDV A;  2CE0 A;  351C A;  3L71 D;  1HRO A;  1AOF A;  1F1C A;  3CXH W;  1NML A;  3PH2 B;  2C8S A;  2N18 C;  1H1O A;  2QJY B;  2GIW A;  2LIT A;  1PPJ D;  1C52 A;  1E29 A;  1EZV D;  1COR A;  1IZL 0;  1CIE A;  1CTJ A;  1DVH A;  1HZV A;  3HQ8 A;  5H2F V;  1HJ3 A;  4UB6 V;  1YEB A;  1WVE C;  2BGV X;  1CXA A;  2ZBO A;  2AI5 A;  1I6D A;  2PCB B;  5DF5 A;  1QN2 A;  2GB8 B;  1SQV D;  1WEJ F;  1CSW A;  3ZIY A;  1R0Q A;  1CSU A;  3M97 X;  1QYZ A;  1GQ1 A;  5DFS A;  2C1D A;  2PCC B;  1CTY A;  1YIC A;  4JCG A;  2BCC D;  3PXW A;  1ETP A;  2V08 A;  1LMS A;  1H9X A;  3CX5 D;  4O1W A;  3RN1 A;  4FA5 A;  1CIG A;  1AOQ A;  5C0Z A;  1CYC A;  4GYD A;  4UB8 V;  2C1U A;  1DVV A;  5GTI V;  1DW0 A;  2QJP B;  3ZOW A;  1CYJ A;  1NU1 D;  2AXT V;  3OA8 A;  4H0K A;  1CTZ A;  3CWB D;  1CIH A;  3KZI V;  1A56 A;  4K3I A;  1KYO W;  1CSX A;  3L74 D;  1CRY A;  3WUI A;  1N9C A;  3H1L D;  3NBS A;  1E2R A;  3MK7 B;  3VRD A;  2B4Z A;  1GJQ A;  4L1Q A;  1HRC A;  1CRI A;  4PJ0 V;  4H0J A;  1YFC A;  2C1V A;  4EID A;  1M60 A;  1NTZ D;  1M70 A;  2BCN B;  1IQC A;  4WQD A;  1H31 B;  1KB9 D;  3ZCF A;  4Y5R A;  1HJ5 A;  5CIE B;  1LFM A;  3O20 A;  4FA4 A;  3H1J D;  3A0H V;  2PAC A;  4J20 A;  155C A;  2N9I A;  1B7V A;  4O1Q A;  2XTS B;  1W2L A;  1DW1 A;  1FHB A;  1A2S A;  1H9Y A;  3RN0 A;  4AAL A;  2FRC A;  2OZ1 B;  3VYM A;  2B11 B;  1H33 B;  1CED A;  4WQ8 A;  2N3B A;  3CX5 W;  1RZ5 A;  3ZOO A;  3VNW A;  1GIW A;  5IY5 1;  1KX7 A;  3HQ9 A;  1NMI A;  4PD4 D;  2ORL A;  4WQ7 A;  1MG2 D;  4XXL A;  1E8E A;  4N0K A;  4Q5P A;  1CC5 A;  1S6V B;  4EIC A;  4FB1 A;  1HJ4 A;  1FCD C;  4P4Q B;  3SWS A;  2N18 B;  5KLI B;  1F1F A;  1QL4 A;  1K3G A;  2OZ1 A;  3SJL A;  1H33 A;  4LJI A;  3DMI A;  1KIB A;  3WFE C;  1HCM A;  4MU8 A;  2VHD A;  2YK3 A;  3CP5 A;  5DJQ C;  4QAO A;  4D6T D;  1U74 B;  1P84 D;  3HQ6 A;  1LC1 A;  2HV4 A;  2A06 D;  1I8P A;  1RAQ A;  4WQA A;  4L3G A;  2D0S A;  1FOC A;  1N90 A;  3DP5 A;  4RSZ A;  5KLV D;  4EIF A;  1OAE A;  2GC4 D;  2BH4 X;  2N9J A;  2N3Y A;  2EXV A;  4WQC A;  1M6Z A;  1N15 A;  1BCC D;  4GED B;  3L4O A;  5CYT R;  2YIU B;  2BLF B;  1CHJ A;  5E79 V;  1QL3 A;  2C9X B;  4KMG A;  1GU2 A;  1COT A;  3O5C A;  3SXT A;  1N50 A;  4WQE A;  3ZOX A;  1A8C A;  5TIS V;  1CHI A;  2BPB B;  2C2C A;  3TGU D;  1YIQ A;  1LC2 A;  5B5E V;  2MHM A;  1VYD A;  2CA3 B;  3ZBM A;  5C9M A;  3WU2 V;  1NNO A;  3H1I D;  1I55 A;  1CCR A;  1L9J C;  3OCD B;  1OCD A;  1RZ6 A;  2FYN B;  5GTH V;  5CIF B;  1BL9 A;  5CIB B;  3SVW A;  1I6E A;  451C A;  2GC7 D;  2DVH A;  3NBT A;  3L72 D;  4FAV A;  4NFG B;  3L4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...