3TGUD

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3tguD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3tguD02
1HZUA 1H33A 1KYOW 1CSWA 1GIWA 1M60A 2Q3EA 4PJ0V 3L4MA 5E79V 3PTZA 4GEDB 1LMSA 1NIRA 2QJKB 5B6QA 1H9YA 4WQAA 1M70A 1IZL0 1DVHA 1CTJA 2BH5X 1CO6A 1MG3D 3CXHD 1I6EA 2KNCB 3WC8A 3ZOYA 4O1QA 1CSVA 1FCDC 1MG2D 2A06D 1CNOA 1LFMA 4AALA 2JTIB 1HJ5A 3CXHW 2FRCA 1AYGA 2PCBB 3HQ9A 1F1CA 2N9JA 3HQ6A 1I54A 1QL3A 1LC1A 4XYDB 4IL6V 1QYZA 4EDFA 1SQVD 1C7MA 2V07A 5DJQB 3L4OA 1YCCA 1SQPD 4FA1A 3TDKA 4PD4D 1CXAA 2ZBOA 5KLIB 2EXVA 3O0RC 1A8CA 4WQCA 1KYOD 1IO3A 1OAEA 4YE1A 3VRDA 3L75D 1H32B 5TJHA 1HJ3A 3GW6A 1NNOA 2N18B 1R0QA 4PW9B 1C6RA 1RAQA 1CHIA 2YIUB 1AOQA 4FANA 2B12B 1ZRTD 3A0BV 3H1ID 5CIEB 4EIFA 3CWBD 3ORVA 5TISV 1BE3D 3WFBC 1A56A 1CC5A 1FJ0A 4U3FD 1E29A 4WQ8A 5CYTR 5DFSA 2YQBA 1CCRA 1CIEA 3O1YA 3CYTI 3RLMA 2L91A 4WQ7A 3PH2B 1YNRA 1DW1A 4PWAA 3L73D 4FA9A 5C0ZA 1K3HA 1K3GA 1I6DA 1SQQD 4L3HA 351CA 1YEAA 3OA8B 1CXCA 1C6OA 2B0ZB 1DW3A 2JQRA 2C1DA 3A0HV 3TYIA 1IRVA 4Q5PA 2BH4X 1C6SA 1M6ZA 2OZ1A 4N0KA 5DJQC 3NWVA 3JBTB 1KB9D 4EICA 3HQ8A 4GYDA 1I5TA 4J20A 5CIFB 2CA3B 1FOCA 3PXSA 1COTA 1N90A 1DW2A 1PP9D 3SVWA 4FA5A 4MU8A 3RN1A 3O20A 1L0LD 2AIUA 2ZXYA 4KMGA 1CYIA 1L9JC 1CRIA 2MHMA 1HZVA 5GTHV 1CRGA 1RZ6A 1U74B 1QKSA 1FI7A 1DIQC 3H1LD 2BPBB 2YCCA 1H9XA 2I8FA 3KZIV 2DGEA 2C2CA 3WFDC 1W2LA 4K3IA 5KAFV 2LITA 1AKKA 2GB8B 2IBZD 1ETPA 2PACA 2Y0DA 2MTAC 1CIGA 2C1VA 3H1KD 3DMIA 1CRJA 1YICA 4UB6V 3RMZA 3RN0A 2O3JA 2BCNB 2V08A 2AI5A 2ORLA 3L74D 1CHJA 2B4ZA 3WUIA 3SLEA 5H2FV 1KX2A 2Y0CA 4D6TD 1AOFA 4AANA 2CE1A 3PRJA 5GTIV 2DVHA 1S5LV 4V2KA 1J3SA 4WQBA 2D0SA 1YIQA 3SJLA 5CIHB 1WVEC 1VYDA 1S6VB 3GG2A 1ZZHA 3OCDB 3A9FA 1CRCA 3ZOWA 5B5EV 1LC2A 3NBSA 1QN2A 3WFCC 5EXQA 1HROA 3NBTA 1GJQA 4XXLA 1BGYD 1HJ4A 2PCCB 2ZZS1 3O5CA 5CIGB 2N3YA 1L0ND 4A7PA 1H32A 3PHLA 1NTZD 4RJTA 2N9YB 1YEBA 3VMAA 3CP5A 5KLVD 2L4DA 4L1QA 2GIWA 1SQBD 1I8PA 2ZOOA 1YFCA 2K9JB 2Y0EA 2KS1A 2VHDA 1KV9A 3PXTA 2C9XB 4H0JA 2N9IA 1NTKD 1C52A 1FI3A 4QAOA 5IY51 1FI9A 2GC7D 4H0KA 3ITKA 2LIRA 1GKSA 1KB0A 2CA4B 1C2NA 2YK3A 1NTMD 3L71D 1PPJD 5AURA 1I55A 1EZVD 1E8EA 2FWLA 2XTSB 2GC4D 4FB1A 451CA 5CIDB 1CHHA 3H1HD 1CCHA 4FAVA 3L70D 2D0WA 2CE0A 1BL9A 2C8SA 2FYNB 2N18C 4UB8V 3H1JD 3OCDA 1CEDA 1IRWA 1HRCA 3C2CA 2AXTV 1CTYA 1W5CT 1N9CA 3TF5A 1KIBA 4NFGB 4WQ9A 3VNWA 4EIDA 1B7VA 1BCCD 2BGVX 1DW0A 1FHBA 3ZBMA 2RN0A 2QJPB 2HV4A 3HQ7A 2ZONG 3WFEC 3X39A 1H33B 4L3GA 5KKZB 2QG4A 2BCCD 1CYJA 1H1OA 1KX7A 5C9MA 1RAPA 1H31B 1I8OA 2RMZA 1YTCA 1H31A 2C1DB 4AAMA 5CICB 3M97X 1CSUA 155CA 3OA8A 2JWAA 4FA4A 4AX3A 1NMIA 1A2SA 4WQEA 3ZIYA 4RSZA 3CU4A 1RZ5A 3TGUD 1MZ4A 1NU1D 5B66V 2QJYB 1CRYA 1DIIC 4P4QB 1HCMA 1GDVA 4DY9A 3L72D 3KHUA 3MK7B 1NMLA 1OCDA 3DP5A 1N50A 1IQCA 1GU2A 1QL4A 3ZOOA 1CRHA 1CSXA 1CIHA 3FWLA 3CX5D 3VYMA 1L9BC 3WU2V 5KAIV 3PLNA 2CXBA 4LJIA 1P84D 1LS9A 1HH7A 1WEJF 3ZOXA 1EB7A 3SWSA 3MK7C 5DF5A 1CORA 5CIBB 2B11B 3CX5W 1CIFA 1U75B 4AAOA 3BCCD 1DVVA 1DT1A 1C2RA 3PXWA 1F1FA 1CYCA 2C1UA 1N15A 2N3BA 2FYUD 4WQDA 4Y5RA 1GQ1A 1JDLA 4O1WA 3ZCFA 2OZ1B 3DR0A 2BLFB 1C75A 4EIEA 3SXTA 1E2RA 2B10B 4JCGA 1CTZA 1SQXD
chains in the Genus database with same CATH superfamily
2W6AA 3V4QA 1CSWA 4PJ0H 4ASWA 1M60A 1L0LK 1NVOA 5E79V 3PTZA 4C7NA 1CI6A 1PPJE 4GODA 4HB1A 3RL0B 1S4XA 3GF7A 1KILB 1LT9B 1NIRA 2QJKB 3GLMA 3HUSC 5CCHA 3PJSK 1CO6A 1KYOE 1NH4A 1NWQA 1PP9G 1JY2O 3WC8A 4O1QA 4H0LB 4W7ZA 4TLFA 4PD4E 4AALA 3CMAP 2JTIB 5KLVJ 1AYGA 1LTTC 1RF0C 1FZAA 4IL6V 1QYZA 3JCUH 4EDFA 1AQ5A 3Q5SA 2V07A 4IL6H 3O8ZA 4Z1MH 4FA1A 3TDKA 4PD4D 2M0BA 5KLIB 1FDIA 3ABVC 1GW3A 1KYOD 1BCCG 2B88A 5TJHA 1J1DB 1HJ3A 1EDKA 4PV1D 2N18B 1URQC 2FYNC 2PP6A 3CC7P 1DD3A 3H1ID 4EIFA 3WFBC 1CC5A 1E29A 1S2EA 4PJ0E 1CIEA 1Q82Q 3ZDMA 3RLMA 2KI7B 2A45I 3PH2B 1RY3A 2KZJA 4PWAA 1KC8Q 1X79B 1YEAA 3OA8B 1PZQA 1IK7A 4IL6E 5KLIC 3TYIA 4Q5PA 1AVYA 3RK3D 3H1HE 2OYOA 1EDLA 4N0KA 2CK3H 2Q6QA 3JBTB 3HE5A 1KTMA 1KB9D 3PP5A 1U7MA 3TNUB 1T2KC 3CCLP 1N73B 1IFMA 1J1EB 3MUDA 3N7NA 2K88A 1VQMP 1HBWA 1FDMA 4PD4H 5AW8B 1L0NG 5GTIH 1BGYG 3PXSA 1COTA 2AEJA 1PP9D 2H8PD 3GHGA 2I8DA 2PGDA 3LW5H 1KILD 1KQGB 1GK4A 3I5CA 4PV1B 4KMGA 1HF9A 1L9JC 5E79E 2MHMA 5GTHV 3HUSA 3P7KA 2ITAA 1FZCB 2FFDB 1RZ6A 3VMXA 4BRYA 1QKSA 3E1IA 1FI7A 2E74B 1DX7A 1J1DC 5CCGD 1Y9BA 2YXQB 1P84H 2C2CA 1RF0A 3IR9A 3WFDC 1OW8A 1W2LA 5KTBA 3M0DA 2PACA 2D2CC 2Q3IA 3A0HH 5CCHD 2MTAC 2WPRA 3FXEA 1YI2P 1X8YA 4NPEA 4UB6V 1L4AA 3RN0A 1PGQA 2BCNB 2V08A 2ORLA 2IBZI 3VP9A 2E5TA 1SQPJ 3H1KE 1CHJA 2B4ZA 1NKNA 4UB6H 3WUIA 2Y9ZA 3SLEA 5H2FV 1YJNP 5C39A 5GTIV 3G71P 1NTZE 3BCCJ 4H0LD 2YKOA 1L0LE 2D0SA 4I7ZC 3AE5C 2LR2A 2WWWA 1WVEC 1VYDA 4XE5B 1FU1A 3LW5J 3OCDB 1NTKK 5AW9B 2NPSA 2WSSH 1JY3N 1N7SA 2BASA 3WFCC 1D7MA 5EXQA 3NBTA 5KJ7A 4ZNCA 5CIGB 2E74D 1L0ND 3L73J 4A7PA 3PHLA 4RJTA 1USEA 3WUTA 1U57A 1L4AB 3CP5A 4L1QA 2JEEA 3M9BA 2GIWA 3V2QA 2ZYAA 1W2EA 2ZOOA 1YFCA 2Y0EA 2KS1A 1ZR4A 1KV9A 3PXTA 2C9XB 2N9IA 3EFGA 1NTKD 1C52A 1FI3A 1QLED 4YTPC 2E43A 2O1JA 3ITKA 4YPCA 1PPJD 2QM7A 3V6IA 3GHGC 2GC4D 1LWUB 2IZ1A 2GA1A 1FZCA 1SQBK 2WSFJ 3RGUA 1YQ4C 3H1HD 3HRNA 1FDOA 4M3LA 1CCHA 3H1JG 1N7SB 2CE0A 2MJZA 1KN7A 3CWBG 2FYNB 2N18C 4UB8V 3OCDA 3G9RA 3LIEA 2AXTV 3H6PA 1FZEA 3QWOC 5B5EH 1SQBE 5APSA 3TF5A 1YJWP 4WQ9A 1B7VA 1EDIA 2P67A 1DW0A 1FHBA 3ZBMA 1VQ5P 1Q90D 2QJPB 2QSIA 5KKZB 1NTMG 4L3GA 1YJ9P 3CCJP 1NU1E 2QG4A 3E1RA 3M0DC 1SQPG 2ZVOB 2JP3A 2YNYA 2I1KA 3CXHE 1YTCA 1H31A 3U1AA 3M97X 2H88C 2W27A 1P84E 3AE7C 3II6A 4IL6X 4EI2A 2SPZA 2WTYA 3RK2D 3OA8A 2JWAA 1OW6A 3H1HJ 2L5GB 5B66H 2HODB 5CJ4A 4RSZA 3A7OA 2W6JH 3CU4A 1MZ4A 1GDVA 1JCDA 3KHUA 1NMLA 2KSEA 5M1BA 1JO5A 4OGQD 1GU4A 2WT7B 2W90A 3OA7A 3KQGA 3ZOOA 1CRHA 1IJDB 3M9HA 1HGVA 3FXDA 2IFMA 2FFDA 1JMMA 1L9BC 1K05A 5KAIV 1N7SC 4R4MA 4LJIA 1DIPA 2JR8A 1S5LE 5AW4B 2AXTH 1HH7A 3MHVA 1SQQK 5CIBB 1JY2N 3TGUE 1HGZA 2AXCA 1RF1A 1M1JA 3U59A 1FOSF 3L35A 4AAOA 4WY4B 4D6TG 1DT1A 2WPSA 1F1FA 1AV1A 4IFMA 4RESB 4Y5RA 5KAFE 4L73A 3ZCFA 4JYCA 3P32A 1KZUB 4DZOA 3SSUA 3HD7A 1SQXD 1GL2B 1HZUA 1VQOP 3TYYA 1GIWA 2FBWC 3H1LG 3SFEC 1HWTC 2IZ0A 1LT9A 3A5TA 2YMYA 2R5BA 4LLHA 3AE4C 1CTJA 3CXHD 3KYQA 1MG3D 1OIPA 1Z56A 3D0WA 3ZOYA 1MG2D 2E75D 1KILE 1SS1A 3C9IA 2I1JA 3CMEP 2WQYC 4L74A 3M91A 4OVNF 3HQ9A 2J5UA 2KUBA 1T2KD 3IAOA 3RBXA 3SWFA 2ZT9C 1C7MA 3CCQP 4LGDE 3CC4P 1FJKA 3OJAB 3L4OA 1YCCA 1J2JB 2KS1B 2QJPC 2YO2A 2FYUE 1H0TA 3FX0A 3SWKA 2ZBOA 1BDCA 2VRSA 1KYOH 4H13B 3VMYA 2EXVA 3NFQA 3O0RC 2IDBA 4H44C 4OGQB 3L75D 1MZ9A 2ZT9D 4K3AA 4PW9B 1JY3O 2E42A 4FANA 2OARA 5DJTB 1ZRTD 5CIEB 4U3FG 5KAIE 2BEZF 1S9KE 4D6TJ 3ORVA 1VQ7P 2FXPA 1WT6A 3B71A 2HFED 1A56A 4U3FD 3L70G 1W2BO 2YQBA 3JSVC 1IFPA 1FE6A 4BXLA 4C7RA 3TK1A 2KP8A 3RK2B 3CX5I 1RE3A 1EZVG 1I6DA 1SQQD 3L72J 2W6BA 1ZLLA 1C6OA 1DW3A 2Z4EA 4H13C 3RL0g 1FJPA 2C1DA 1IRVA 1HTLC 2WITA 1L4AC 2BEQD 5DJQC 3AE1C 3Q5RA 3IN6A 5KLVG 4EICA 4J20A 2WSCJ 3S9OA 2OYIA 1VPCA 2WSCH 1N7LA 1DW2A 4AQRD 2M5AA 3SVWA 4FA5A 1T3JA 5DJUB 1S3JA 5APXA 1IFIA 1L0NE 1AVOA 3WU2E 1BGYE 3WMM0 1L0LD 4GT1A 1NKZB 2XV5A 1RE4A 1NOHA 2QJKC 1YITP 1IO4A 1FAVA 3Q2YA 1GMJA 1JM0A 3H1LD 3AECC 1JB0J 2I8FA 1SQXG 2BCCJ 4K35A 1YYCA 3L74G 1GL2C 3KZIH 1PGPA 2GB8B 2IBZD 1ETPA 2Y0DA 2OYHB 1HUCA 2K9JA 1CIGA 4NPFX 3H1KD 3LIDA 2WSEJ 2HLOA 5AVWB 1N86A 2O3JA 3KDPB 2IBZG 2AI5A 3G6EP 1OVUA 4I2LC 2YO3A 3L70E 1KX2A 4D6TD 2IPPA 2CE1A 3CCEP 1CW5A 1WMKA 1JMBA 1PIXA 1Y47A 3FWNA 5AW0B 1JOCA 3FGAD 1J3SA 4WQBA 4YXDC 1YTZT 1S5LH 1OX3A 1TU3F 3SJLA 2E76C 1HJ0A 5CIHB 4B86A 3EFFK 1S6VB 4W80A 1L0LG 1JTHA 3A9FA 4L75A 3ZOWA 1NHLA 3L75E 3SWYA 1S72P 1QL1A 5APYA 3BRTB 4XXLA 3RK3C 1HJ4A 5CHXA 3O5CA 5GTIE 5H2FE 1PFIA 1X22A 3E7KA 5KLVD 2L4DA 1ZP0C 3H1IJ 2ZT9B 4UB6E 2Q1KA 1OZHA 3OAKA 4EIJA 4H0JA 4QAOA 1VQ9P 1N7SD 2KZIA 3C8VA 2E75B 4N3YB 2P2UA 2LIRA 2CA4B 2XU6A 1VF5B 4I1LA 4NPDA 5AURA 3HE4A 3USSA 3BRVB 2AEFA 1SP4A 451CA 1CZQA 1VQLP 1G2CA 1CHHA 2K37A 4Y28J 2Q9IA 4FAVA 1LTGC 2C8SA 5KAIH 5GTHE 3H1JD 5APTA 2QE7H 3CCVP 3H1HG 3H1JE 3SFDC 1CTYA 3VMZA 2D2CD 1CI6B 2AEMA 5CJ0A 1SQXK 1SQXJ 3T97B 2IBZE 2ZVNB 5CBNA 3WFEC 4ASVA 1GL2A 3H32A 2BCCD 3WUVA 2Z5HA 2QVAA 1KV4A 1NTKG 1SQVJ 1LTIC 1SQVG 4AAMA 4XFJA 5AVSB 1LTSC 1NMIA 3ZIYA 4WQEA 2C0WA 3TGUD 5B66V 1NU1D 2ZJSE 1CRYA 1HCMA 1JEKA 2FYZA 3AEAC 4DY9A 3L72D 4WY4A 1NO4A 2FKWB 3RL0C 3CXHI 1KQLA 1BGYJ 2KXPB 2R5DA 4Y99C 3IF4A 4JQ0D 5AW6B 3WU2V 1G2CB 5AVRB 2HYNA 2H43A 3B5NB 1P84D 2O01N 3SWSA 4MN4C 1CORA 3TSIA 2A06E 2WT7A 1M7LA 3CX5W 3IFMA 1YQ3C 3N4XA 3BCCD 1DVVA 1BE3E 3L71E 2CPBA 2C1UA 1N15A 2N3BA 2FYUD 1QVFO 4I6MC 1EDJA 1VQPP 1GQ1A 1SQQJ 2KYVA 2OZ1B 4AYCA 2LXBA 3KZIE 4EIEA 3P8MC 1E2RA 1GU5A 4N78D 4DOJA 3JCUE 2B10B 2JWDA 2QIWA 4QMAA 1BCCE 2RKLA 1L0NK 3EWKA 3V5BA 1KYOW 1SFCD 2GUVA 5APVA 1HJBA 2RH0A 3V2RA 4GEDB 3H1LE 4EYYQ 1LMSA 1N2DC 3L75J 1FZGA 3A3YB 3PH0A 2KIKA 1M70A 1QGKB 2BH5X 2KNCB 2M3BA 4GIFA 1HH0A 1M1JC 1VQ4P 2B9BA 3CWBJ 2ZYGA 2R3CA 3HQ6A 2KSJA 2GM4A 1LP1B 3L70J 1I54A 2JO1A 1LC1A 4XYDB 1JNMA 1GZLA 1IFJA 1M90Q 3G4SP 2IX7C 5KKZC 3CWBE 3AE3C 1SVFA 3MGNA 1SQPD 3HD7C 2B87B 2YKQA 3VRDA 1IO3A 1OAEA 4YE1A 3AEFC 1NNOA 2KK7A 2V7QJ 1NTME 2E5YA 2C9NY 1RAQA 1AOQA 2B12B 3A0BV 1BE3G 3CWBD 5TISV 1BE3D 1FJ0A 1LWUC 5CYTR 1CCRA 2N9BA 1LTJA 5CMZA 4U3FE 5TISH 3CYTI 2L91A 2OYIB 1YNRA 1DW1A 3D70A 4FA9A 1K3HA 1N73A 1K3GA 1URQB 1E79H 351CA 1MFZA 2HG5D 1CXCA 1G1IA 2JDIH 1C6SA 3O6QA 1M6ZA 1RQUA 2OZ1A 2D2CB 3VYIA 2LXCB 3JC22 3B5ND 4GYDA 3CXHH 3EQ2A 1I5TA 1NTZG 1GD2E 2W83C 1FOCA 3T97A 3Q5PA 2M3EA 3WUUA 3HTKB 1X9VA 1U7JA 2N1TA 3O20A 3AE6C 1IFNA 2AIUA 2ZXYA 1CRIA 2QM8A 2QRXA 5CCHC 3AE2C 1CRGA 4L76A 5AVXB 3HUSB 1K9MQ 1DIQC 2G3AA 5APUA 2BPBB 3KZIV 1BDDA 2DGEA 1URQD 3CD6P 1AKKA 3V4WA 1DEEG 1VL2A 3CCUP 4HJGH 2QA4P 4R4LA 5AVUB 3I56P 3HE5B 1SFCB 5KAFH 5AW3B 4KT0J 3DMIA 1CRJA 1OFCX 2OQQA 3W68A 2N1TD 4HKZH 1S1CX 1OXZA 1KYOI 1ZOYC 2Y0CA 1NAFA 1OVRA 3PRJA 3S1KA 3BASA 1IK9A 4V2KA 4IFFA 2AXTE 1DEBA 3M9QA 1YIQA 1PGOA 1UIXA 3CCSP 1IFDA 1ZZHA 1LTJC 1K73Q 1KFNA 4YXWH 1GTWA 5KJ7D 1PGJA 3NBSA 4OGQC 3G3ZA 1J1EC 1N73C 1BGYD 3U1CA 1BSNA 1NU1G 1NTZD 3HD7B 1OWAA 3VMAA 1BCCJ 5EFWB 2YMKA 3Q1MA 3BVHA 1MKMA 2VHDA 4WBAA 2PAJA 3CPWO 3B8EB 1LJ2A 1SQQE 2P7JA 1PP9E 2P58A 3L73E 2Q5UA 2GC7D 4H0KA 3C1LA 1KQFB 1GKSA 2BCCG 1KB0A 3MUDC 1K8AQ 2YK3A 3L71D 1M1JB 1ZV8A 2XTSB 1AFOA 1T6AA 4FB1A 2N1TC 1ZW0A 1OVVA 2WSFH 2WPQA 3H1LJ 1LT9C 2YIUC 3B5NC 1KILC 1KQSO 2D0WA 1BL9A 1JTHB 1AJYA 3M06A 3H1IG 3HTKA 1Q7YQ 3BCCE 1HRCA 2ZAEB 3MIWA 1DH3A 4XA4A 2YKPA 4GKGA 1OW7A 1N9CA 3A0BE 4HH2A 4NFGB 5AVVB 1BCCD 2BGVX 2OTJP 2FXMA 2O1KA 3CX5H 2HV4A 5AVQB 3X39A 1CYJA 1KX7A 5C9MA 1NGMB 3NTNA 3OW2O 1RQVA 1RAPA 1H31B 1YBKA 1I8OA 2C1DB 5CICB 1BE3J 155CA 1NTKE 1SFCA 1H8AA 1GW4A 4HYTB 4H0LC 4AX3A 2OYHA 1SQVE 4RKUJ 1FS0E 1M1KQ 2KB7P 1KMIZ 1RZ5A 4H44D 1DD4A 2QJYB 4P4QB 3MK7B 1OCDA 4WWIA 4DCKA 3H25A 5AVTB 1N50A 3I55P 1R5SA 1GU2A 4Y99B 1SQBJ 3CX5D 2OGUA 2NPSC 2XZRA 3QH9A 1A02F 3PLNA 2CXBA 4IFDK 1LS9A 1WEJF 1M8OB 3ZOXA 5DF5A 2E76B 3VN0A 2B11B 2N1TB 3HD7D 5APQA 3B4SA 1BSHA 1RE3C 2XNDH 1H0TB 3CCRP 1LTAC 2P10A 1CYCA 4C46A 2ZXEB 2OTKE 1JY3P 1LP1A 2J58A 1OMIA 3KXDA 1JDLA 1CSBA 1ZMEC 2FYUG 2BLFB 2CPSA 5BVZA 4GOFA 2PFXA 1MV8A 1WRGA 1YTZI 4JCGA 4WY4D 3H1IE 3BCCG 1XTGB 3CCMP 3H1JJ 1H33A 1QVGO 2M8RA 1W5CE 1IZNB 5L8RJ 2GUSA 1PL5A 1URQA 2Q3EA 2P1JA 1T8ZA 2NPSB 4PJ0V 3L4MA 2IYOA 1S9KD 1YHQP 3AE8C 1LTJB 2Z5IA 2A45G 5B6QA 3K5BA 1H9YA 4WQAA 4DJGA 1IZL0 3D71A 1DVHA 1R5LA 1I6EA 3CI9A 3KPEA 2JKVA 2HPCA 1EZVE 4PV1C 2XNXA 3L72G 3P8CE 1CSVA 1FCDC 1L0LJ 2A06D 3NMDA 1CNOA 3TGUG 2G8YA 1LFMA 2XDJA 3CL3D 1HJ5A 3CXHW 2FRCA 1KB9I 2E75C 2ZYDA 2PCBB 2B87A 2HR3A 4GOEA 5B66E 1NJIQ 1F1CA 2N9JA 1USDA 1QL3A 2WVRA 1SQVD 2IYPA 5DJQB 1H89A 1HVVA 1SFCC 4WVZA 5KLVE 2OYHC 2WSEH 1CXAA 3AE9C 1N8RQ 1JCCA 4OH8B 3L71J 1A8CA 3MD0A 4WQCA 1EC5A 1H32B 3GW6A 1R0QA 4OWFA 2E74C 1FZFA 2MKVA 1C6RA 2O01H 2W8ZA 1CHIA 2YIUB 2KNCA 3RK3E 3RK2C 4N6JA 2FFDC 1FOSE 1FBMA 1NU1K 4WQ8A 3GHGB 5DFSA 1P84I 1JY2P 4GDOA 1Q2NA 2UWJE 4JF7A 1SQPK 4WQ7A 1RF1C 1ZR2A 4CPGA 3L73D 5C0ZA 1L0NJ 2ZXXA 4L3HA 3TNUA 1AQTA 2HODA 3S4RA 1SLQA 4H44B 4RO0A 3L36A 2B0ZB 2JQRA 1L4AD 3A0HV 3RBZA 2Q7CA 2BH4X 5BU8B 1EXJA 1VQKP 1VQ6P 1NTKJ 1EXIA 1MUUA 1NYHA 2K9YA 1SQBG 3NWVA 3L4FA 4KJMA 3CC2P 1LNQA 1AA0A 3HQ8A 4PD4I 5H2FH 5CIFB 2CA3B 1PV3A 2A06G 5CCGA 5K5GB 1VDFA 2XKMA 1N90A 3L72E 2QEXP 1RF1B 4MU8A 3RN1A 4W7YA 1NAYA 3F5HA 1CYIA 1QEXA 3A0BH 1HZVA 1LWUA 1U74B 5GTHH 1KB9H 3AEEC 2JJLA 2R32A 5KJ7C 2FYUK 1EQ7A 2YCCA 1H9XA 3M0AA 3F89A 4K3IA 3VP8A 5KAFV 1LTBC 4WB4A 2LITA 1H88A 2WZ7A 2Y9YA 3BATA 3CLQA 5KLVK 2C1VA 2FYUJ 2FXOA 3H1KG 1Q86Q 1RHZB 1PP9J 1YICA 3RL0D 4JBZA 3RMZA 3CX5E 3O6QB 1VQNP 3MTUE 1ZN5A 3L74D 3NXSA 1T3UA 1M57D 1M56D 1AOFA 4AANA 2KOGA 2YXRB 4U3FJ 2DVHA 1S5LV 5BU5A 1FZCC 4WY4C 5AW2B 2LKMA 1KILA 3Q3DA 1NTMJ 4C7NB 3GG2A 4ZMDA 4UB8H 1CRCA 5B5EV 1LC2A 1QN2A 1HROA 1GJQA 2FY8A 2PCCB 2ZZS1 2N3YA 1H32A 2KLVA 2N9YB 1YEBA 1VQ8P 2C0XA 3HE4B 4DT0A 3GF3A 1SQBD 1L2PA 3L74E 1I8PA 3L74J 1Q81Q 1KD1Q 2K9JB 2H7HA 3MP7B 4LC1A 5IY51 1E5WA 1G1JA 1FI9A 2K3RA 3V2NA 1C2NA 4BWNA 1QX8A 1NTMD 1Y8AA 1I55A 5CCGC 1R8EA 1QL2A 2OYIC 1SQQG 1EZVD 3L73G 1E8EA 1NTZK 2FWLA 2BCCE 1K04A 2WMMA 2DW3A 1GL2D 5B5EE 4UB8E 5CIDB 5AW1B 2V7QH 2O01J 3L37A 3AEDC 2HPCB 3TGUJ 2IFNA 3L70D 3A2AA 1S5LX 1YIJP 1RE4C 2B89A 4IOIH 1CEDA 1IRWA 3C2CA 1NTZJ 1VF5D 1W5CT 3AEGC 1KIBA 3VNWA 4EIDA 3L75G 4ZKUA 1SQPE 3H1KJ 3UIAA 2RN0A 2A45H 2ZFCA 4TT3H 2C9LY 3HQ7A 2ZONG 1PPJG 3L71G 2OTLP 1H33B 1H1OA 3D6ZA 1IC2A 4U7JA 2WPVB 1A02J 2RMZA 2KLUA 5AVZB 2PRRA 1X0TA 3D6YA 1CSUA 1EZVI 3W67A 4FA4A 2NZ2A 2K1AA 5CBOA 3V2PA 1A2SA 3VTPC 5APWA 3R2PA 1KB9E 4ZKPA 1DIIC 2E76D 2J59M 1MFTA 3GMAA 4H13D 1LT1A 3DP5A 1NTMK 5E79H 1ZXGA 2R44A 3RK3B 2NRGA 4JPZB 1IQCA 1XTCC 1QL4A 3WU2H 1GDTA 1CSXA 1RH5B 1CIHA 3FWLA 5AVYB 3VOPA 4BRYB 3B5NA 3VYMA 1KORA 5TISE 1JUNA 4AUWA 4EOTA 2H89C 4D6TE 1FC2C 1EB7A 3MK7C 4I7ZB 3R4YA 2QJYC 1CIFA 1U75B 3P8CD 5AW7B 2M5AB 3AEBC 1SQVK 1KFMA 1VF5C 1C2RA 3PXWA 4O9BA 4KHXA 5AW5B 2R3SA 1LGHB 1FZBA 2NPSD 1GK6A 4WQDA 4N78E 3MZWB 3A0HE 4O1WA 1NU1J 3DR0A 4JYBA 1UIIA 1C75A 3SXTA 2POHA 2V4HA 1ZRTE 1CTZA 1SQXE 3O1YA 3H32B
chains in the Genus database with same CATH topology
1HZUA 1H33A 1KYOW 1CSWA 1GIWA 1M60A 2Q3EA 4PJ0V 3L4MA 5E79V 3PTZA 4GEDB 1LMSA 1NIRA 2QJKB 5B6QA 1H9YA 4WQAA 1M70A 1IZL0 1DVHA 1CTJA 2BH5X 1CO6A 1MG3D 3CXHD 1I6EA 2KNCB 3WC8A 3ZOYA 4O1QA 1CSVA 1FCDC 1MG2D 2A06D 1CNOA 1LFMA 4AALA 2JTIB 1HJ5A 3CXHW 2FRCA 1AYGA 2PCBB 3HQ9A 1F1CA 2N9JA 3HQ6A 1I54A 1QL3A 1LC1A 4XYDB 4IL6V 1QYZA 4EDFA 1SQVD 1C7MA 2V07A 5DJQB 3L4OA 1YCCA 1SQPD 4FA1A 3TDKA 4PD4D 1CXAA 2ZBOA 5KLIB 2EXVA 3O0RC 1A8CA 4WQCA 1KYOD 1IO3A 1OAEA 4YE1A 3VRDA 3L75D 1H32B 5TJHA 1HJ3A 3GW6A 1NNOA 2N18B 1R0QA 4PW9B 1C6RA 1RAQA 1CHIA 2YIUB 1AOQA 4FANA 2B12B 1ZRTD 3A0BV 3H1ID 5CIEB 4EIFA 3CWBD 3ORVA 5TISV 1BE3D 3WFBC 1A56A 1CC5A 1FJ0A 4U3FD 1E29A 4WQ8A 5CYTR 5DFSA 2YQBA 1CCRA 1CIEA 3O1YA 3CYTI 3RLMA 2L91A 4WQ7A 3PH2B 1YNRA 1DW1A 4PWAA 3L73D 4FA9A 5C0ZA 1K3HA 1K3GA 1I6DA 1SQQD 4L3HA 351CA 1YEAA 3OA8B 1CXCA 1C6OA 2B0ZB 1DW3A 2JQRA 2C1DA 3A0HV 3TYIA 1IRVA 4Q5PA 2BH4X 1C6SA 1M6ZA 2OZ1A 4N0KA 5DJQC 3NWVA 3JBTB 1KB9D 4EICA 3HQ8A 4GYDA 1I5TA 4J20A 5CIFB 2CA3B 1FOCA 3PXSA 1COTA 1N90A 1DW2A 1PP9D 3SVWA 4FA5A 4MU8A 3RN1A 3O20A 1L0LD 2AIUA 2ZXYA 4KMGA 1CYIA 1L9JC 1CRIA 2MHMA 1HZVA 5GTHV 1CRGA 1RZ6A 1U74B 1QKSA 1FI7A 1DIQC 3H1LD 2BPBB 2YCCA 1H9XA 2I8FA 3KZIV 2DGEA 2C2CA 3WFDC 1W2LA 4K3IA 5KAFV 2LITA 1AKKA 2GB8B 2IBZD 1ETPA 2PACA 2Y0DA 2MTAC 1CIGA 2C1VA 3H1KD 3DMIA 1CRJA 1YICA 4UB6V 3RMZA 3RN0A 2O3JA 2BCNB 2V08A 2AI5A 2ORLA 3L74D 1CHJA 2B4ZA 3WUIA 3SLEA 5H2FV 1KX2A 2Y0CA 4D6TD 1AOFA 4AANA 2CE1A 3PRJA 5GTIV 2DVHA 1S5LV 4V2KA 1J3SA 4WQBA 2D0SA 1YIQA 3SJLA 5CIHB 1WVEC 1VYDA 1S6VB 3GG2A 1ZZHA 3OCDB 3A9FA 1CRCA 3ZOWA 5B5EV 1LC2A 3NBSA 1QN2A 3WFCC 5EXQA 1HROA 3NBTA 1GJQA 4XXLA 1BGYD 1HJ4A 2PCCB 2ZZS1 3O5CA 5CIGB 2N3YA 1L0ND 4A7PA 1H32A 3PHLA 1NTZD 4RJTA 2N9YB 1YEBA 3VMAA 3CP5A 5KLVD 2L4DA 4L1QA 2GIWA 1SQBD 1I8PA 2ZOOA 1YFCA 2K9JB 2Y0EA 2KS1A 2VHDA 1KV9A 3PXTA 2C9XB 4H0JA 2N9IA 1NTKD 1C52A 1FI3A 4QAOA 5IY51 1FI9A 2GC7D 4H0KA 3ITKA 2LIRA 1GKSA 1KB0A 2CA4B 1C2NA 2YK3A 1NTMD 3L71D 1PPJD 5AURA 1I55A 1EZVD 1E8EA 2FWLA 2XTSB 2GC4D 4FB1A 451CA 5CIDB 1CHHA 3H1HD 1CCHA 4FAVA 3L70D 2D0WA 2CE0A 1BL9A 2C8SA 2FYNB 2N18C 4UB8V 3H1JD 3OCDA 1CEDA 1IRWA 1HRCA 3C2CA 2AXTV 1CTYA 1W5CT 1N9CA 3TF5A 1KIBA 4NFGB 4WQ9A 3VNWA 4EIDA 1B7VA 1BCCD 2BGVX 1DW0A 1FHBA 3ZBMA 2RN0A 2QJPB 2HV4A 3HQ7A 2ZONG 3WFEC 3X39A 1H33B 4L3GA 5KKZB 2QG4A 2BCCD 1CYJA 1H1OA 1KX7A 5C9MA 1RAPA 1H31B 1I8OA 2RMZA 1YTCA 1H31A 2C1DB 4AAMA 5CICB 3M97X 1CSUA 155CA 3OA8A 2JWAA 4FA4A 4AX3A 1NMIA 1A2SA 4WQEA 3ZIYA 4RSZA 3CU4A 1RZ5A 3TGUD 1MZ4A 1NU1D 5B66V 2QJYB 1CRYA 1DIIC 4P4QB 1HCMA 1GDVA 4DY9A 3L72D 3KHUA 3MK7B 1NMLA 1OCDA 3DP5A 1N50A 1IQCA 1GU2A 1QL4A 3ZOOA 1CRHA 1CSXA 1CIHA 3FWLA 3CX5D 3VYMA 1L9BC 3WU2V 5KAIV 3PLNA 2CXBA 4LJIA 1P84D 1LS9A 1HH7A 1WEJF 3ZOXA 1EB7A 3SWSA 3MK7C 5DF5A 1CORA 5CIBB 2B11B 3CX5W 1CIFA 1U75B 4AAOA 3BCCD 1DVVA 1DT1A 1C2RA 3PXWA 1F1FA 1CYCA 2C1UA 1N15A 2N3BA 2FYUD 4WQDA 4Y5RA 1GQ1A 1JDLA 4O1WA 3ZCFA 2OZ1B 3DR0A 2BLFB 1C75A 4EIEA 3SXTA 1E2RA 2B10B 4JCGA 1CTZA 1SQXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZU A;  1H33 A;  1KYO W;  1CSW A;  1GIW A;  1M60 A;  2Q3E A;  4PJ0 V;  3L4M A;  5E79 V;  3PTZ A;  4GED B;  1LMS A;  1NIR A;  2QJK B;  5B6Q A;  1H9Y A;  4WQA A;  1M70 A;  1IZL 0;  1DVH A;  1CTJ A;  2BH5 X;  1CO6 A;  1MG3 D;  3CXH D;  1I6E A;  2KNC B;  3WC8 A;  3ZOY A;  4O1Q A;  1CSV A;  1FCD C;  1MG2 D;  2A06 D;  1CNO A;  1LFM A;  4AAL A;  2JTI B;  1HJ5 A;  3CXH W;  2FRC A;  1AYG A;  2PCB B;  3HQ9 A;  1F1C A;  2N9J A;  3HQ6 A;  1I54 A;  1QL3 A;  1LC1 A;  4XYD B;  4IL6 V;  1QYZ A;  4EDF A;  1SQV D;  1C7M A;  2V07 A;  5DJQ B;  3L4O A;  1YCC A;  1SQP D;  4FA1 A;  3TDK A;  4PD4 D;  1CXA A;  2ZBO A;  5KLI B;  2EXV A;  3O0R C;  1A8C A;  4WQC A;  1KYO D;  1IO3 A;  1OAE A;  4YE1 A;  3VRD A;  3L75 D;  1H32 B;  5TJH A;  1HJ3 A;  3GW6 A;  1NNO A;  2N18 B;  1R0Q A;  4PW9 B;  1C6R A;  1RAQ A;  1CHI A;  2YIU B;  1AOQ A;  4FAN A;  2B12 B;  1ZRT D;  3A0B V;  3H1I D;  5CIE B;  4EIF A;  3CWB D;  3ORV A;  5TIS V;  1BE3 D;  3WFB C;  1A56 A;  1CC5 A;  1FJ0 A;  4U3F D;  1E29 A;  4WQ8 A;  5CYT R;  5DFS A;  2YQB A;  1CCR A;  1CIE A;  3O1Y A;  3CYT I;  3RLM A;  2L91 A;  4WQ7 A;  3PH2 B;  1YNR A;  1DW1 A;  4PWA A;  3L73 D;  4FA9 A;  5C0Z A;  1K3H A;  1K3G A;  1I6D A;  1SQQ D;  4L3H A;  351C A;  1YEA A;  3OA8 B;  1CXC A;  1C6O A;  2B0Z B;  1DW3 A;  2JQR A;  2C1D A;  3A0H V;  3TYI A;  1IRV A;  4Q5P A;  2BH4 X;  1C6S A;  1M6Z A;  2OZ1 A;  4N0K A;  5DJQ C;  3NWV A;  3JBT B;  1KB9 D;  4EIC A;  3HQ8 A;  4GYD A;  1I5T A;  4J20 A;  5CIF B;  2CA3 B;  1FOC A;  3PXS A;  1COT A;  1N90 A;  1DW2 A;  1PP9 D;  3SVW A;  4FA5 A;  4MU8 A;  3RN1 A;  3O20 A;  1L0L D;  2AIU A;  2ZXY A;  4KMG A;  1CYI A;  1L9J C;  1CRI A;  2MHM A;  1HZV A;  5GTH V;  1CRG A;  1RZ6 A;  1U74 B;  1QKS A;  1FI7 A;  1DIQ C;  3H1L D;  2BPB B;  2YCC A;  1H9X A;  2I8F A;  3KZI V;  2DGE A;  2C2C A;  3WFD C;  1W2L A;  4K3I A;  5KAF V;  2LIT A;  1AKK A;  2GB8 B;  2IBZ D;  1ETP A;  2PAC A;  2Y0D A;  2MTA C;  1CIG A;  2C1V A;  3H1K D;  3DMI A;  1CRJ A;  1YIC A;  4UB6 V;  3RMZ A;  3RN0 A;  2O3J A;  2BCN B;  2V08 A;  2AI5 A;  2ORL A;  3L74 D;  1CHJ A;  2B4Z A;  3WUI A;  3SLE A;  5H2F V;  1KX2 A;  2Y0C A;  4D6T D;  1AOF A;  4AAN A;  2CE1 A;  3PRJ A;  5GTI V;  2DVH A;  1S5L V;  4V2K A;  1J3S A;  4WQB A;  2D0S A;  1YIQ A;  3SJL A;  5CIH B;  1WVE C;  1VYD A;  1S6V B;  3GG2 A;  1ZZH A;  3OCD B;  3A9F A;  1CRC A;  3ZOW A;  5B5E V;  1LC2 A;  3NBS A;  1QN2 A;  3WFC C;  5EXQ A;  1HRO A;  3NBT A;  1GJQ A;  4XXL A;  1BGY D;  1HJ4 A;  2PCC B;  2ZZS 1;  3O5C A;  5CIG B;  2N3Y A;  1L0N D;  4A7P A;  1H32 A;  3PHL A;  1NTZ D;  4RJT A;  2N9Y B;  1YEB A;  3VMA A;  3CP5 A;  5KLV D;  2L4D A;  4L1Q A;  2GIW A;  1SQB D;  1I8P A;  2ZOO A;  1YFC A;  2K9J B;  2Y0E A;  2KS1 A;  2VHD A;  1KV9 A;  3PXT A;  2C9X B;  4H0J A;  2N9I A;  1NTK D;  1C52 A;  1FI3 A;  4QAO A;  5IY5 1;  1FI9 A;  2GC7 D;  4H0K A;  3ITK A;  2LIR A;  1GKS A;  1KB0 A;  2CA4 B;  1C2N A;  2YK3 A;  1NTM D;  3L71 D;  1PPJ D;  5AUR A;  1I55 A;  1EZV D;  1E8E A;  2FWL A;  2XTS B;  2GC4 D;  4FB1 A;  451C A;  5CID B;  1CHH A;  3H1H D;  1CCH A;  4FAV A;  3L70 D;  2D0W A;  2CE0 A;  1BL9 A;  2C8S A;  2FYN B;  2N18 C;  4UB8 V;  3H1J D;  3OCD A;  1CED A;  1IRW A;  1HRC A;  3C2C A;  2AXT V;  1CTY A;  1W5C T;  1N9C A;  3TF5 A;  1KIB A;  4NFG B;  4WQ9 A;  3VNW A;  4EID A;  1B7V A;  1BCC D;  2BGV X;  1DW0 A;  1FHB A;  3ZBM A;  2RN0 A;  2QJP B;  2HV4 A;  3HQ7 A;  2ZON G;  3WFE C;  3X39 A;  1H33 B;  4L3G A;  5KKZ B;  2QG4 A;  2BCC D;  1CYJ A;  1H1O A;  1KX7 A;  5C9M A;  1RAP A;  1H31 B;  1I8O A;  2RMZ A;  1YTC A;  1H31 A;  2C1D B;  4AAM A;  5CIC B;  3M97 X;  1CSU A;  155C A;  3OA8 A;  2JWA A;  4FA4 A;  4AX3 A;  1NMI A;  1A2S A;  4WQE A;  3ZIY A;  4RSZ A;  3CU4 A;  1RZ5 A;  3TGU D;  1MZ4 A;  1NU1 D;  5B66 V;  2QJY B;  1CRY A;  1DII C;  4P4Q B;  1HCM A;  1GDV A;  4DY9 A;  3L72 D;  3KHU A;  3MK7 B;  1NML A;  1OCD A;  3DP5 A;  1N50 A;  1IQC A;  1GU2 A;  1QL4 A;  3ZOO A;  1CRH A;  1CSX A;  1CIH A;  3FWL A;  3CX5 D;  3VYM A;  1L9B C;  3WU2 V;  5KAI V;  3PLN A;  2CXB A;  4LJI A;  1P84 D;  1LS9 A;  1HH7 A;  1WEJ F;  3ZOX A;  1EB7 A;  3SWS A;  3MK7 C;  5DF5 A;  1COR A;  5CIB B;  2B11 B;  3CX5 W;  1CIF A;  1U75 B;  4AAO A;  3BCC D;  1DVV A;  1DT1 A;  1C2R A;  3PXW A;  1F1F A;  1CYC A;  2C1U A;  1N15 A;  2N3B A;  2FYU D;  4WQD A;  4Y5R A;  1GQ1 A;  1JDL A;  4O1W A;  3ZCF A;  2OZ1 B;  3DR0 A;  2BLF B;  1C75 A;  4EIE A;  3SXT A;  1E2R A;  2B10 B;  4JCG A;  1CTZ A;  1SQX D; 
#chains in the Genus database with same CATH topology
 2W6A A;  3V4Q A;  1CSW A;  4PJ0 H;  4ASW A;  1M60 A;  1L0L K;  1NVO A;  5E79 V;  3PTZ A;  4C7N A;  1CI6 A;  1PPJ E;  4GOD A;  4HB1 A;  3RL0 B;  1S4X A;  3GF7 A;  1KIL B;  1LT9 B;  1NIR A;  2QJK B;  3GLM A;  3HUS C;  5CCH A;  3PJS K;  1CO6 A;  1KYO E;  1NH4 A;  1NWQ A;  1PP9 G;  1JY2 O;  3WC8 A;  4O1Q A;  4H0L B;  4W7Z A;  4TLF A;  4PD4 E;  4AAL A;  3CMA P;  2JTI B;  5KLV J;  1AYG A;  1LTT C;  1RF0 C;  1FZA A;  4IL6 V;  1QYZ A;  3JCU H;  4EDF A;  1AQ5 A;  3Q5S A;  2V07 A;  4IL6 H;  3O8Z A;  4Z1M H;  4FA1 A;  3TDK A;  4PD4 D;  2M0B A;  5KLI B;  1FDI A;  3ABV C;  1GW3 A;  1KYO D;  1BCC G;  2B88 A;  5TJH A;  1J1D B;  1HJ3 A;  1EDK A;  4PV1 D;  2N18 B;  1URQ C;  2FYN C;  2PP6 A;  3CC7 P;  1DD3 A;  3H1I D;  4EIF A;  3WFB C;  1CC5 A;  1E29 A;  1S2E A;  4PJ0 E;  1CIE A;  1Q82 Q;  3ZDM A;  3RLM A;  2KI7 B;  2A45 I;  3PH2 B;  1RY3 A;  2KZJ A;  4PWA A;  1KC8 Q;  1X79 B;  1YEA A;  3OA8 B;  1PZQ A;  1IK7 A;  4IL6 E;  5KLI C;  3TYI A;  4Q5P A;  1AVY A;  3RK3 D;  3H1H E;  2OYO A;  1EDL A;  4N0K A;  2CK3 H;  2Q6Q A;  3JBT B;  3HE5 A;  1KTM A;  1KB9 D;  3PP5 A;  1U7M A;  3TNU B;  1T2K C;  3CCL P;  1N73 B;  1IFM A;  1J1E B;  3MUD A;  3N7N A;  2K88 A;  1VQM P;  1HBW A;  1FDM A;  4PD4 H;  5AW8 B;  1L0N G;  5GTI H;  1BGY G;  3PXS A;  1COT A;  2AEJ A;  1PP9 D;  2H8P D;  3GHG A;  2I8D A;  2PGD A;  3LW5 H;  1KIL D;  1KQG B;  1GK4 A;  3I5C A;  4PV1 B;  4KMG A;  1HF9 A;  1L9J C;  5E79 E;  2MHM A;  5GTH V;  3HUS A;  3P7K A;  2ITA A;  1FZC B;  2FFD B;  1RZ6 A;  3VMX A;  4BRY A;  1QKS A;  3E1I A;  1FI7 A;  2E74 B;  1DX7 A;  1J1D C;  5CCG D;  1Y9B A;  2YXQ B;  1P84 H;  2C2C A;  1RF0 A;  3IR9 A;  3WFD C;  1OW8 A;  1W2L A;  5KTB A;  3M0D A;  2PAC A;  2D2C C;  2Q3I A;  3A0H H;  5CCH D;  2MTA C;  2WPR A;  3FXE A;  1YI2 P;  1X8Y A;  4NPE A;  4UB6 V;  1L4A A;  3RN0 A;  1PGQ A;  2BCN B;  2V08 A;  2ORL A;  2IBZ I;  3VP9 A;  2E5T A;  1SQP J;  3H1K E;  1CHJ A;  2B4Z A;  1NKN A;  4UB6 H;  3WUI A;  2Y9Z A;  3SLE A;  5H2F V;  1YJN P;  5C39 A;  5GTI V;  3G71 P;  1NTZ E;  3BCC J;  4H0L D;  2YKO A;  1L0L E;  2D0S A;  4I7Z C;  3AE5 C;  2LR2 A;  2WWW A;  1WVE C;  1VYD A;  4XE5 B;  1FU1 A;  3LW5 J;  3OCD B;  1NTK K;  5AW9 B;  2NPS A;  2WSS H;  1JY3 N;  1N7S A;  2BAS A;  3WFC C;  1D7M A;  5EXQ A;  3NBT A;  5KJ7 A;  4ZNC A;  5CIG B;  2E74 D;  1L0N D;  3L73 J;  4A7P A;  3PHL A;  4RJT A;  1USE A;  3WUT A;  1U57 A;  1L4A B;  3CP5 A;  4L1Q A;  2JEE A;  3M9B A;  2GIW A;  3V2Q A;  2ZYA A;  1W2E A;  2ZOO A;  1YFC A;  2Y0E A;  2KS1 A;  1ZR4 A;  1KV9 A;  3PXT A;  2C9X B;  2N9I A;  3EFG A;  1NTK D;  1C52 A;  1FI3 A;  1QLE D;  4YTP C;  2E43 A;  2O1J A;  3ITK A;  4YPC A;  1PPJ D;  2QM7 A;  3V6I A;  3GHG C;  2GC4 D;  1LWU B;  2IZ1 A;  2GA1 A;  1FZC A;  1SQB K;  2WSF J;  3RGU A;  1YQ4 C;  3H1H D;  3HRN A;  1FDO A;  4M3L A;  1CCH A;  3H1J G;  1N7S B;  2CE0 A;  2MJZ A;  1KN7 A;  3CWB G;  2FYN B;  2N18 C;  4UB8 V;  3OCD A;  3G9R A;  3LIE A;  2AXT V;  3H6P A;  1FZE A;  3QWO C;  5B5E H;  1SQB E;  5APS A;  3TF5 A;  1YJW P;  4WQ9 A;  1B7V A;  1EDI A;  2P67 A;  1DW0 A;  1FHB A;  3ZBM A;  1VQ5 P;  1Q90 D;  2QJP B;  2QSI A;  5KKZ B;  1NTM G;  4L3G A;  1YJ9 P;  3CCJ P;  1NU1 E;  2QG4 A;  3E1R A;  3M0D C;  1SQP G;  2ZVO B;  2JP3 A;  2YNY A;  2I1K A;  3CXH E;  1YTC A;  1H31 A;  3U1A A;  3M97 X;  2H88 C;  2W27 A;  1P84 E;  3AE7 C;  3II6 A;  4IL6 X;  4EI2 A;  2SPZ A;  2WTY A;  3RK2 D;  3OA8 A;  2JWA A;  1OW6 A;  3H1H J;  2L5G B;  5B66 H;  2HOD B;  5CJ4 A;  4RSZ A;  3A7O A;  2W6J H;  3CU4 A;  1MZ4 A;  1GDV A;  1JCD A;  3KHU A;  1NML A;  2KSE A;  5M1B A;  1JO5 A;  4OGQ D;  1GU4 A;  2WT7 B;  2W90 A;  3OA7 A;  3KQG A;  3ZOO A;  1CRH A;  1IJD B;  3M9H A;  1HGV A;  3FXD A;  2IFM A;  2FFD A;  1JMM A;  1L9B C;  1K05 A;  5KAI V;  1N7S C;  4R4M A;  4LJI A;  1DIP A;  2JR8 A;  1S5L E;  5AW4 B;  2AXT H;  1HH7 A;  3MHV A;  1SQQ K;  5CIB B;  1JY2 N;  3TGU E;  1HGZ A;  2AXC A;  1RF1 A;  1M1J A;  3U59 A;  1FOS F;  3L35 A;  4AAO A;  4WY4 B;  4D6T G;  1DT1 A;  2WPS A;  1F1F A;  1AV1 A;  4IFM A;  4RES B;  4Y5R A;  5KAF E;  4L73 A;  3ZCF A;  4JYC A;  3P32 A;  1KZU B;  4DZO A;  3SSU A;  3HD7 A;  1SQX D;  1GL2 B;  1HZU A;  1VQO P;  3TYY A;  1GIW A;  2FBW C;  3H1L G;  3SFE C;  1HWT C;  2IZ0 A;  1LT9 A;  3A5T A;  2YMY A;  2R5B A;  4LLH A;  3AE4 C;  1CTJ A;  3CXH D;  3KYQ A;  1MG3 D;  1OIP A;  1Z56 A;  3D0W A;  3ZOY A;  1MG2 D;  2E75 D;  1KIL E;  1SS1 A;  3C9I A;  2I1J A;  3CME P;  2WQY C;  4L74 A;  3M91 A;  4OVN F;  3HQ9 A;  2J5U A;  2KUB A;  1T2K D;  3IAO A;  3RBX A;  3SWF A;  2ZT9 C;  1C7M A;  3CCQ P;  4LGD E;  3CC4 P;  1FJK A;  3OJA B;  3L4O A;  1YCC A;  1J2J B;  2KS1 B;  2QJP C;  2YO2 A;  2FYU E;  1H0T A;  3FX0 A;  3SWK A;  2ZBO A;  1BDC A;  2VRS A;  1KYO H;  4H13 B;  3VMY A;  2EXV A;  3NFQ A;  3O0R C;  2IDB A;  4H44 C;  4OGQ B;  3L75 D;  1MZ9 A;  2ZT9 D;  4K3A A;  4PW9 B;  1JY3 O;  2E42 A;  4FAN A;  2OAR A;  5DJT B;  1ZRT D;  5CIE B;  4U3F G;  5KAI E;  2BEZ F;  1S9K E;  4D6T J;  3ORV A;  1VQ7 P;  2FXP A;  1WT6 A;  3B71 A;  2HFE D;  1A56 A;  4U3F D;  3L70 G;  1W2B O;  2YQB A;  3JSV C;  1IFP A;  1FE6 A;  4BXL A;  4C7R A;  3TK1 A;  2KP8 A;  3RK2 B;  3CX5 I;  1RE3 A;  1EZV G;  1I6D A;  1SQQ D;  3L72 J;  2W6B A;  1ZLL A;  1C6O A;  1DW3 A;  2Z4E A;  4H13 C;  3RL0 g;  1FJP A;  2C1D A;  1IRV A;  1HTL C;  2WIT A;  1L4A C;  2BEQ D;  5DJQ C;  3AE1 C;  3Q5R A;  3IN6 A;  5KLV G;  4EIC A;  4J20 A;  2WSC J;  3S9O A;  2OYI A;  1VPC A;  2WSC H;  1N7L A;  1DW2 A;  4AQR D;  2M5A A;  3SVW A;  4FA5 A;  1T3J A;  5DJU B;  1S3J A;  5APX A;  1IFI A;  1L0N E;  1AVO A;  3WU2 E;  1BGY E;  3WMM 0;  1L0L D;  4GT1 A;  1NKZ B;  2XV5 A;  1RE4 A;  1NOH A;  2QJK C;  1YIT P;  1IO4 A;  1FAV A;  3Q2Y A;  1GMJ A;  1JM0 A;  3H1L D;  3AEC C;  1JB0 J;  2I8F A;  1SQX G;  2BCC J;  4K35 A;  1YYC A;  3L74 G;  1GL2 C;  3KZI H;  1PGP A;  2GB8 B;  2IBZ D;  1ETP A;  2Y0D A;  2OYH B;  1HUC A;  2K9J A;  1CIG A;  4NPF X;  3H1K D;  3LID A;  2WSE J;  2HLO A;  5AVW B;  1N86 A;  2O3J A;  3KDP B;  2IBZ G;  2AI5 A;  3G6E P;  1OVU A;  4I2L C;  2YO3 A;  3L70 E;  1KX2 A;  4D6T D;  2IPP A;  2CE1 A;  3CCE P;  1CW5 A;  1WMK A;  1JMB A;  1PIX A;  1Y47 A;  3FWN A;  5AW0 B;  1JOC A;  3FGA D;  1J3S A;  4WQB A;  4YXD C;  1YTZ T;  1S5L H;  1OX3 A;  1TU3 F;  3SJL A;  2E76 C;  1HJ0 A;  5CIH B;  4B86 A;  3EFF K;  1S6V B;  4W80 A;  1L0L G;  1JTH A;  3A9F A;  4L75 A;  3ZOW A;  1NHL A;  3L75 E;  3SWY A;  1S72 P;  1QL1 A;  5APY A;  3BRT B;  4XXL A;  3RK3 C;  1HJ4 A;  5CHX A;  3O5C A;  5GTI E;  5H2F E;  1PFI A;  1X22 A;  3E7K A;  5KLV D;  2L4D A;  1ZP0 C;  3H1I J;  2ZT9 B;  4UB6 E;  2Q1K A;  1OZH A;  3OAK A;  4EIJ A;  4H0J A;  4QAO A;  1VQ9 P;  1N7S D;  2KZI A;  3C8V A;  2E75 B;  4N3Y B;  2P2U A;  2LIR A;  2CA4 B;  2XU6 A;  1VF5 B;  4I1L A;  4NPD A;  5AUR A;  3HE4 A;  3USS A;  3BRV B;  2AEF A;  1SP4 A;  451C A;  1CZQ A;  1VQL P;  1G2C A;  1CHH A;  2K37 A;  4Y28 J;  2Q9I A;  4FAV A;  1LTG C;  2C8S A;  5KAI H;  5GTH E;  3H1J D;  5APT A;  2QE7 H;  3CCV P;  3H1H G;  3H1J E;  3SFD C;  1CTY A;  3VMZ A;  2D2C D;  1CI6 B;  2AEM A;  5CJ0 A;  1SQX K;  1SQX J;  3T97 B;  2IBZ E;  2ZVN B;  5CBN A;  3WFE C;  4ASV A;  1GL2 A;  3H32 A;  2BCC D;  3WUV A;  2Z5H A;  2QVA A;  1KV4 A;  1NTK G;  1SQV J;  1LTI C;  1SQV G;  4AAM A;  4XFJ A;  5AVS B;  1LTS C;  1NMI A;  3ZIY A;  4WQE A;  2C0W A;  3TGU D;  5B66 V;  1NU1 D;  2ZJS E;  1CRY A;  1HCM A;  1JEK A;  2FYZ A;  3AEA C;  4DY9 A;  3L72 D;  4WY4 A;  1NO4 A;  2FKW B;  3RL0 C;  3CXH I;  1KQL A;  1BGY J;  2KXP B;  2R5D A;  4Y99 C;  3IF4 A;  4JQ0 D;  5AW6 B;  3WU2 V;  1G2C B;  5AVR B;  2HYN A;  2H43 A;  3B5N B;  1P84 D;  2O01 N;  3SWS A;  4MN4 C;  1COR A;  3TSI A;  2A06 E;  2WT7 A;  1M7L A;  3CX5 W;  3IFM A;  1YQ3 C;  3N4X A;  3BCC D;  1DVV A;  1BE3 E;  3L71 E;  2CPB A;  2C1U A;  1N15 A;  2N3B A;  2FYU D;  1QVF O;  4I6M C;  1EDJ A;  1VQP P;  1GQ1 A;  1SQQ J;  2KYV A;  2OZ1 B;  4AYC A;  2LXB A;  3KZI E;  4EIE A;  3P8M C;  1E2R A;  1GU5 A;  4N78 D;  4DOJ A;  3JCU E;  2B10 B;  2JWD A;  2QIW A;  4QMA A;  1BCC E;  2RKL A;  1L0N K;  3EWK A;  3V5B A;  1KYO W;  1SFC D;  2GUV A;  5APV A;  1HJB A;  2RH0 A;  3V2R A;  4GED B;  3H1L E;  4EYY Q;  1LMS A;  1N2D C;  3L75 J;  1FZG A;  3A3Y B;  3PH0 A;  2KIK A;  1M70 A;  1QGK B;  2BH5 X;  2KNC B;  2M3B A;  4GIF A;  1HH0 A;  1M1J C;  1VQ4 P;  2B9B A;  3CWB J;  2ZYG A;  2R3C A;  3HQ6 A;  2KSJ A;  2GM4 A;  1LP1 B;  3L70 J;  1I54 A;  2JO1 A;  1LC1 A;  4XYD B;  1JNM A;  1GZL A;  1IFJ A;  1M90 Q;  3G4S P;  2IX7 C;  5KKZ C;  3CWB E;  3AE3 C;  1SVF A;  3MGN A;  1SQP D;  3HD7 C;  2B87 B;  2YKQ A;  3VRD A;  1IO3 A;  1OAE A;  4YE1 A;  3AEF C;  1NNO A;  2KK7 A;  2V7Q J;  1NTM E;  2E5Y A;  2C9N Y;  1RAQ A;  1AOQ A;  2B12 B;  3A0B V;  1BE3 G;  3CWB D;  5TIS V;  1BE3 D;  1FJ0 A;  1LWU C;  5CYT R;  1CCR A;  2N9B A;  1LTJ A;  5CMZ A;  4U3F E;  5TIS H;  3CYT I;  2L91 A;  2OYI B;  1YNR A;  1DW1 A;  3D70 A;  4FA9 A;  1K3H A;  1N73 A;  1K3G A;  1URQ B;  1E79 H;  351C A;  1MFZ A;  2HG5 D;  1CXC A;  1G1I A;  2JDI H;  1C6S A;  3O6Q A;  1M6Z A;  1RQU A;  2OZ1 A;  2D2C B;  3VYI A;  2LXC B;  3JC2 2;  3B5N D;  4GYD A;  3CXH H;  3EQ2 A;  1I5T A;  1NTZ G;  1GD2 E;  2W83 C;  1FOC A;  3T97 A;  3Q5P A;  2M3E A;  3WUU A;  3HTK B;  1X9V A;  1U7J A;  2N1T A;  3O20 A;  3AE6 C;  1IFN A;  2AIU A;  2ZXY A;  1CRI A;  2QM8 A;  2QRX A;  5CCH C;  3AE2 C;  1CRG A;  4L76 A;  5AVX B;  3HUS B;  1K9M Q;  1DIQ C;  2G3A A;  5APU A;  2BPB B;  3KZI V;  1BDD A;  2DGE A;  1URQ D;  3CD6 P;  1AKK A;  3V4W A;  1DEE G;  1VL2 A;  3CCU P;  4HJG H;  2QA4 P;  4R4L A;  5AVU B;  3I56 P;  3HE5 B;  1SFC B;  5KAF H;  5AW3 B;  4KT0 J;  3DMI A;  1CRJ A;  1OFC X;  2OQQ A;  3W68 A;  2N1T D;  4HKZ H;  1S1C X;  1OXZ A;  1KYO I;  1ZOY C;  2Y0C A;  1NAF A;  1OVR A;  3PRJ A;  3S1K A;  3BAS A;  1IK9 A;  4V2K A;  4IFF A;  2AXT E;  1DEB A;  3M9Q A;  1YIQ A;  1PGO A;  1UIX A;  3CCS P;  1IFD A;  1ZZH A;  1LTJ C;  1K73 Q;  1KFN A;  4YXW H;  1GTW A;  5KJ7 D;  1PGJ A;  3NBS A;  4OGQ C;  3G3Z A;  1J1E C;  1N73 C;  1BGY D;  3U1C A;  1BSN A;  1NU1 G;  1NTZ D;  3HD7 B;  1OWA A;  3VMA A;  1BCC J;  5EFW B;  2YMK A;  3Q1M A;  3BVH A;  1MKM A;  2VHD A;  4WBA A;  2PAJ A;  3CPW O;  3B8E B;  1LJ2 A;  1SQQ E;  2P7J A;  1PP9 E;  2P58 A;  3L73 E;  2Q5U A;  2GC7 D;  4H0K A;  3C1L A;  1KQF B;  1GKS A;  2BCC G;  1KB0 A;  3MUD C;  1K8A Q;  2YK3 A;  3L71 D;  1M1J B;  1ZV8 A;  2XTS B;  1AFO A;  1T6A A;  4FB1 A;  2N1T C;  1ZW0 A;  1OVV A;  2WSF H;  2WPQ A;  3H1L J;  1LT9 C;  2YIU C;  3B5N C;  1KIL C;  1KQS O;  2D0W A;  1BL9 A;  1JTH B;  1AJY A;  3M06 A;  3H1I G;  3HTK A;  1Q7Y Q;  3BCC E;  1HRC A;  2ZAE B;  3MIW A;  1DH3 A;  4XA4 A;  2YKP A;  4GKG A;  1OW7 A;  1N9C A;  3A0B E;  4HH2 A;  4NFG B;  5AVV B;  1BCC D;  2BGV X;  2OTJ P;  2FXM A;  2O1K A;  3CX5 H;  2HV4 A;  5AVQ B;  3X39 A;  1CYJ A;  1KX7 A;  5C9M A;  1NGM B;  3NTN A;  3OW2 O;  1RQV A;  1RAP A;  1H31 B;  1YBK A;  1I8O A;  2C1D B;  5CIC B;  1BE3 J;  155C A;  1NTK E;  1SFC A;  1H8A A;  1GW4 A;  4HYT B;  4H0L C;  4AX3 A;  2OYH A;  1SQV E;  4RKU J;  1FS0 E;  1M1K Q;  2KB7 P;  1KMI Z;  1RZ5 A;  4H44 D;  1DD4 A;  2QJY B;  4P4Q B;  3MK7 B;  1OCD A;  4WWI A;  4DCK A;  3H25 A;  5AVT B;  1N50 A;  3I55 P;  1R5S A;  1GU2 A;  4Y99 B;  1SQB J;  3CX5 D;  2OGU A;  2NPS C;  2XZR A;  3QH9 A;  1A02 F;  3PLN A;  2CXB A;  4IFD K;  1LS9 A;  1WEJ F;  1M8O B;  3ZOX A;  5DF5 A;  2E76 B;  3VN0 A;  2B11 B;  2N1T B;  3HD7 D;  5APQ A;  3B4S A;  1BSH A;  1RE3 C;  2XND H;  1H0T B;  3CCR P;  1LTA C;  2P10 A;  1CYC A;  4C46 A;  2ZXE B;  2OTK E;  1JY3 P;  1LP1 A;  2J58 A;  1OMI A;  3KXD A;  1JDL A;  1CSB A;  1ZME C;  2FYU G;  2BLF B;  2CPS A;  5BVZ A;  4GOF A;  2PFX A;  1MV8 A;  1WRG A;  1YTZ I;  4JCG A;  4WY4 D;  3H1I E;  3BCC G;  1XTG B;  3CCM P;  3H1J J;  1H33 A;  1QVG O;  2M8R A;  1W5C E;  1IZN B;  5L8R J;  2GUS A;  1PL5 A;  1URQ A;  2Q3E A;  2P1J A;  1T8Z A;  2NPS B;  4PJ0 V;  3L4M A;  2IYO A;  1S9K D;  1YHQ P;  3AE8 C;  1LTJ B;  2Z5I A;  2A45 G;  5B6Q A;  3K5B A;  1H9Y A;  4WQA A;  4DJG A;  1IZL 0;  3D71 A;  1DVH A;  1R5L A;  1I6E A;  3CI9 A;  3KPE A;  2JKV A;  2HPC A;  1EZV E;  4PV1 C;  2XNX A;  3L72 G;  3P8C E;  1CSV A;  1FCD C;  1L0L J;  2A06 D;  3NMD A;  1CNO A;  3TGU G;  2G8Y A;  1LFM A;  2XDJ A;  3CL3 D;  1HJ5 A;  3CXH W;  2FRC A;  1KB9 I;  2E75 C;  2ZYD A;  2PCB B;  2B87 A;  2HR3 A;  4GOE A;  5B66 E;  1NJI Q;  1F1C A;  2N9J A;  1USD A;  1QL3 A;  2WVR A;  1SQV D;  2IYP A;  5DJQ B;  1H89 A;  1HVV A;  1SFC C;  4WVZ A;  5KLV E;  2OYH C;  2WSE H;  1CXA A;  3AE9 C;  1N8R Q;  1JCC A;  4OH8 B;  3L71 J;  1A8C A;  3MD0 A;  4WQC A;  1EC5 A;  1H32 B;  3GW6 A;  1R0Q A;  4OWF A;  2E74 C;  1FZF A;  2MKV A;  1C6R A;  2O01 H;  2W8Z A;  1CHI A;  2YIU B;  2KNC A;  3RK3 E;  3RK2 C;  4N6J A;  2FFD C;  1FOS E;  1FBM A;  1NU1 K;  4WQ8 A;  3GHG B;  5DFS A;  1P84 I;  1JY2 P;  4GDO A;  1Q2N A;  2UWJ E;  4JF7 A;  1SQP K;  4WQ7 A;  1RF1 C;  1ZR2 A;  4CPG A;  3L73 D;  5C0Z A;  1L0N J;  2ZXX A;  4L3H A;  3TNU A;  1AQT A;  2HOD A;  3S4R A;  1SLQ A;  4H44 B;  4RO0 A;  3L36 A;  2B0Z B;  2JQR A;  1L4A D;  3A0H V;  3RBZ A;  2Q7C A;  2BH4 X;  5BU8 B;  1EXJ A;  1VQK P;  1VQ6 P;  1NTK J;  1EXI A;  1MUU A;  1NYH A;  2K9Y A;  1SQB G;  3NWV A;  3L4F A;  4KJM A;  3CC2 P;  1LNQ A;  1AA0 A;  3HQ8 A;  4PD4 I;  5H2F H;  5CIF B;  2CA3 B;  1PV3 A;  2A06 G;  5CCG A;  5K5G B;  1VDF A;  2XKM A;  1N90 A;  3L72 E;  2QEX P;  1RF1 B;  4MU8 A;  3RN1 A;  4W7Y A;  1NAY A;  3F5H A;  1CYI A;  1QEX A;  3A0B H;  1HZV A;  1LWU A;  1U74 B;  5GTH H;  1KB9 H;  3AEE C;  2JJL A;  2R32 A;  5KJ7 C;  2FYU K;  1EQ7 A;  2YCC A;  1H9X A;  3M0A A;  3F89 A;  4K3I A;  3VP8 A;  5KAF V;  1LTB C;  4WB4 A;  2LIT A;  1H88 A;  2WZ7 A;  2Y9Y A;  3BAT A;  3CLQ A;  5KLV K;  2C1V A;  2FYU J;  2FXO A;  3H1K G;  1Q86 Q;  1RHZ B;  1PP9 J;  1YIC A;  3RL0 D;  4JBZ A;  3RMZ A;  3CX5 E;  3O6Q B;  1VQN P;  3MTU E;  1ZN5 A;  3L74 D;  3NXS A;  1T3U A;  1M57 D;  1M56 D;  1AOF A;  4AAN A;  2KOG A;  2YXR B;  4U3F J;  2DVH A;  1S5L V;  5BU5 A;  1FZC C;  4WY4 C;  5AW2 B;  2LKM A;  1KIL A;  3Q3D A;  1NTM J;  4C7N B;  3GG2 A;  4ZMD A;  4UB8 H;  1CRC A;  5B5E V;  1LC2 A;  1QN2 A;  1HRO A;  1GJQ A;  2FY8 A;  2PCC B;  2ZZS 1;  2N3Y A;  1H32 A;  2KLV A;  2N9Y B;  1YEB A;  1VQ8 P;  2C0X A;  3HE4 B;  4DT0 A;  3GF3 A;  1SQB D;  1L2P A;  3L74 E;  1I8P A;  3L74 J;  1Q81 Q;  1KD1 Q;  2K9J B;  2H7H A;  3MP7 B;  4LC1 A;  5IY5 1;  1E5W A;  1G1J A;  1FI9 A;  2K3R A;  3V2N A;  1C2N A;  4BWN A;  1QX8 A;  1NTM D;  1Y8A A;  1I55 A;  5CCG C;  1R8E A;  1QL2 A;  2OYI C;  1SQQ G;  1EZV D;  3L73 G;  1E8E A;  1NTZ K;  2FWL A;  2BCC E;  1K04 A;  2WMM A;  2DW3 A;  1GL2 D;  5B5E E;  4UB8 E;  5CID B;  5AW1 B;  2V7Q H;  2O01 J;  3L37 A;  3AED C;  2HPC B;  3TGU J;  2IFN A;  3L70 D;  3A2A A;  1S5L X;  1YIJ P;  1RE4 C;  2B89 A;  4IOI H;  1CED A;  1IRW A;  3C2C A;  1NTZ J;  1VF5 D;  1W5C T;  3AEG C;  1KIB A;  3VNW A;  4EID A;  3L75 G;  4ZKU A;  1SQP E;  3H1K J;  3UIA A;  2RN0 A;  2A45 H;  2ZFC A;  4TT3 H;  2C9L Y;  3HQ7 A;  2ZON G;  1PPJ G;  3L71 G;  2OTL P;  1H33 B;  1H1O A;  3D6Z A;  1IC2 A;  4U7J A;  2WPV B;  1A02 J;  2RMZ A;  2KLU A;  5AVZ B;  2PRR A;  1X0T A;  3D6Y A;  1CSU A;  1EZV I;  3W67 A;  4FA4 A;  2NZ2 A;  2K1A A;  5CBO A;  3V2P A;  1A2S A;  3VTP C;  5APW A;  3R2P A;  1KB9 E;  4ZKP A;  1DII C;  2E76 D;  2J59 M;  1MFT A;  3GMA A;  4H13 D;  1LT1 A;  3DP5 A;  1NTM K;  5E79 H;  1ZXG A;  2R44 A;  3RK3 B;  2NRG A;  4JPZ B;  1IQC A;  1XTC C;  1QL4 A;  3WU2 H;  1GDT A;  1CSX A;  1RH5 B;  1CIH A;  3FWL A;  5AVY B;  3VOP A;  4BRY B;  3B5N A;  3VYM A;  1KOR A;  5TIS E;  1JUN A;  4AUW A;  4EOT A;  2H89 C;  4D6T E;  1FC2 C;  1EB7 A;  3MK7 C;  4I7Z B;  3R4Y A;  2QJY C;  1CIF A;  1U75 B;  3P8C D;  5AW7 B;  2M5A B;  3AEB C;  1SQV K;  1KFM A;  1VF5 C;  1C2R A;  3PXW A;  4O9B A;  4KHX A;  5AW5 B;  2R3S A;  1LGH B;  1FZB A;  2NPS D;  1GK6 A;  4WQD A;  4N78 E;  3MZW B;  3A0H E;  4O1W A;  1NU1 J;  3DR0 A;  4JYB A;  1UII A;  1C75 A;  3SXT A;  2POH A;  2V4H A;  1ZRT E;  1CTZ A;  1SQX E;  3O1Y A;  3H32 B; 
#chains in the Genus database with same CATH homology
 1HZU A;  1H33 A;  1KYO W;  1CSW A;  1GIW A;  1M60 A;  2Q3E A;  4PJ0 V;  3L4M A;  5E79 V;  3PTZ A;  4GED B;  1LMS A;  1NIR A;  2QJK B;  5B6Q A;  1H9Y A;  4WQA A;  1M70 A;  1IZL 0;  1DVH A;  1CTJ A;  2BH5 X;  1CO6 A;  1MG3 D;  3CXH D;  1I6E A;  2KNC B;  3WC8 A;  3ZOY A;  4O1Q A;  1CSV A;  1FCD C;  1MG2 D;  2A06 D;  1CNO A;  1LFM A;  4AAL A;  2JTI B;  1HJ5 A;  3CXH W;  2FRC A;  1AYG A;  2PCB B;  3HQ9 A;  1F1C A;  2N9J A;  3HQ6 A;  1I54 A;  1QL3 A;  1LC1 A;  4XYD B;  4IL6 V;  1QYZ A;  4EDF A;  1SQV D;  1C7M A;  2V07 A;  5DJQ B;  3L4O A;  1YCC A;  1SQP D;  4FA1 A;  3TDK A;  4PD4 D;  1CXA A;  2ZBO A;  5KLI B;  2EXV A;  3O0R C;  1A8C A;  4WQC A;  1KYO D;  1IO3 A;  1OAE A;  4YE1 A;  3VRD A;  3L75 D;  1H32 B;  5TJH A;  1HJ3 A;  3GW6 A;  1NNO A;  2N18 B;  1R0Q A;  4PW9 B;  1C6R A;  1RAQ A;  1CHI A;  2YIU B;  1AOQ A;  4FAN A;  2B12 B;  1ZRT D;  3A0B V;  3H1I D;  5CIE B;  4EIF A;  3CWB D;  3ORV A;  5TIS V;  1BE3 D;  3WFB C;  1A56 A;  1CC5 A;  1FJ0 A;  4U3F D;  1E29 A;  4WQ8 A;  5CYT R;  5DFS A;  2YQB A;  1CCR A;  1CIE A;  3O1Y A;  3CYT I;  3RLM A;  2L91 A;  4WQ7 A;  3PH2 B;  1YNR A;  1DW1 A;  4PWA A;  3L73 D;  4FA9 A;  5C0Z A;  1K3H A;  1K3G A;  1I6D A;  1SQQ D;  4L3H A;  351C A;  1YEA A;  3OA8 B;  1CXC A;  1C6O A;  2B0Z B;  1DW3 A;  2JQR A;  2C1D A;  3A0H V;  3TYI A;  1IRV A;  4Q5P A;  2BH4 X;  1C6S A;  1M6Z A;  2OZ1 A;  4N0K A;  5DJQ C;  3NWV A;  3JBT B;  1KB9 D;  4EIC A;  3HQ8 A;  4GYD A;  1I5T A;  4J20 A;  5CIF B;  2CA3 B;  1FOC A;  3PXS A;  1COT A;  1N90 A;  1DW2 A;  1PP9 D;  3SVW A;  4FA5 A;  4MU8 A;  3RN1 A;  3O20 A;  1L0L D;  2AIU A;  2ZXY A;  4KMG A;  1CYI A;  1L9J C;  1CRI A;  2MHM A;  1HZV A;  5GTH V;  1CRG A;  1RZ6 A;  1U74 B;  1QKS A;  1FI7 A;  1DIQ C;  3H1L D;  2BPB B;  2YCC A;  1H9X A;  2I8F A;  3KZI V;  2DGE A;  2C2C A;  3WFD C;  1W2L A;  4K3I A;  5KAF V;  2LIT A;  1AKK A;  2GB8 B;  2IBZ D;  1ETP A;  2PAC A;  2Y0D A;  2MTA C;  1CIG A;  2C1V A;  3H1K D;  3DMI A;  1CRJ A;  1YIC A;  4UB6 V;  3RMZ A;  3RN0 A;  2O3J A;  2BCN B;  2V08 A;  2AI5 A;  2ORL A;  3L74 D;  1CHJ A;  2B4Z A;  3WUI A;  3SLE A;  5H2F V;  1KX2 A;  2Y0C A;  4D6T D;  1AOF A;  4AAN A;  2CE1 A;  3PRJ A;  5GTI V;  2DVH A;  1S5L V;  4V2K A;  1J3S A;  4WQB A;  2D0S A;  1YIQ A;  3SJL A;  5CIH B;  1WVE C;  1VYD A;  1S6V B;  3GG2 A;  1ZZH A;  3OCD B;  3A9F A;  1CRC A;  3ZOW A;  5B5E V;  1LC2 A;  3NBS A;  1QN2 A;  3WFC C;  5EXQ A;  1HRO A;  3NBT A;  1GJQ A;  4XXL A;  1BGY D;  1HJ4 A;  2PCC B;  2ZZS 1;  3O5C A;  5CIG B;  2N3Y A;  1L0N D;  4A7P A;  1H32 A;  3PHL A;  1NTZ D;  4RJT A;  2N9Y B;  1YEB A;  3VMA A;  3CP5 A;  5KLV D;  2L4D A;  4L1Q A;  2GIW A;  1SQB D;  1I8P A;  2ZOO A;  1YFC A;  2K9J B;  2Y0E A;  2KS1 A;  2VHD A;  1KV9 A;  3PXT A;  2C9X B;  4H0J A;  2N9I A;  1NTK D;  1C52 A;  1FI3 A;  4QAO A;  5IY5 1;  1FI9 A;  2GC7 D;  4H0K A;  3ITK A;  2LIR A;  1GKS A;  1KB0 A;  2CA4 B;  1C2N A;  2YK3 A;  1NTM D;  3L71 D;  1PPJ D;  5AUR A;  1I55 A;  1EZV D;  1E8E A;  2FWL A;  2XTS B;  2GC4 D;  4FB1 A;  451C A;  5CID B;  1CHH A;  3H1H D;  1CCH A;  4FAV A;  3L70 D;  2D0W A;  2CE0 A;  1BL9 A;  2C8S A;  2FYN B;  2N18 C;  4UB8 V;  3H1J D;  3OCD A;  1CED A;  1IRW A;  1HRC A;  3C2C A;  2AXT V;  1CTY A;  1W5C T;  1N9C A;  3TF5 A;  1KIB A;  4NFG B;  4WQ9 A;  3VNW A;  4EID A;  1B7V A;  1BCC D;  2BGV X;  1DW0 A;  1FHB A;  3ZBM A;  2RN0 A;  2QJP B;  2HV4 A;  3HQ7 A;  2ZON G;  3WFE C;  3X39 A;  1H33 B;  4L3G A;  5KKZ B;  2QG4 A;  2BCC D;  1CYJ A;  1H1O A;  1KX7 A;  5C9M A;  1RAP A;  1H31 B;  1I8O A;  2RMZ A;  1YTC A;  1H31 A;  2C1D B;  4AAM A;  5CIC B;  3M97 X;  1CSU A;  155C A;  3OA8 A;  2JWA A;  4FA4 A;  4AX3 A;  1NMI A;  1A2S A;  4WQE A;  3ZIY A;  4RSZ A;  3CU4 A;  1RZ5 A;  3TGU D;  1MZ4 A;  1NU1 D;  5B66 V;  2QJY B;  1CRY A;  1DII C;  4P4Q B;  1HCM A;  1GDV A;  4DY9 A;  3L72 D;  3KHU A;  3MK7 B;  1NML A;  1OCD A;  3DP5 A;  1N50 A;  1IQC A;  1GU2 A;  1QL4 A;  3ZOO A;  1CRH A;  1CSX A;  1CIH A;  3FWL A;  3CX5 D;  3VYM A;  1L9B C;  3WU2 V;  5KAI V;  3PLN A;  2CXB A;  4LJI A;  1P84 D;  1LS9 A;  1HH7 A;  1WEJ F;  3ZOX A;  1EB7 A;  3SWS A;  3MK7 C;  5DF5 A;  1COR A;  5CIB B;  2B11 B;  3CX5 W;  1CIF A;  1U75 B;  4AAO A;  3BCC D;  1DVV A;  1DT1 A;  1C2R A;  3PXW A;  1F1F A;  1CYC A;  2C1U A;  1N15 A;  2N3B A;  2FYU D;  4WQD A;  4Y5R A;  1GQ1 A;  1JDL A;  4O1W A;  3ZCF A;  2OZ1 B;  3DR0 A;  2BLF B;  1C75 A;  4EIE A;  3SXT A;  1E2R A;  2B10 B;  4JCG A;  1CTZ A;  1SQX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...