3TGUD

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3tguD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3tguD02
1A56A 1NU1D 4EDFA 1H9XA 1ZZHA 2QJKB 1I6EA 2QJPB 1F1CA 3WFEC 1CRHA 5CIEB 1H31B 3A9FA 1NIRA 3TDKA 1U74B 3VRDA 5DJQB 4Q5PA 2B11B 4H0KA 3VYMA 3L4MA 2CE0A 4AX3A 4WQ8A 1L9JC 1CSWA 2B4ZA 2B0ZB 1C52A 4YE1A 1HRCA 1N50A 3H1ID 3ZIYA 1PPJD 1W2LA 2JQRA 4PJ0V 1QN2A 4V2KA 1KX7A 1FOCA 3H1JD 1FI7A 2Q3EA 2CE1A 4WQDA 4EIEA 1C6SA 3L74D 2C8SA 1A2SA 1ETPA 3DP5A 1RAQA 3H1HD 2JTIB 1U75B 1YIQA 1GDVA 5E79V 4FA9A 4D6TD 3PXWA 4WQAA 1C2RA 2OZ1A 1M60A 2LIRA 1COTA 1HROA 3NBTA 3CYTI 2BCCD 2BH4X 1DIIC 1E29A 1H31A 2YIUB 2AIUA 2N9JA 2C1DB 3NBSA 1KB0A 4FA1A 3PRJA 1SQBD 2JWAA 4NFGB 3L75D 5H2FV 2FWLA 1WEJF 1CRGA 2D0SA 4L1QA 4MU8A 5B6QA 1DVVA 5KAIV 2EXVA 2N18B 1BE3D 2N3BA 1CSXA 3PLNA 1QL4A 4GYDA 1M70A 1K3HA 3O5CA 1DW2A 2ZXYA 3BCCD 1YTCA 2N9IA 2BCNB 4PD4D 3O1YA 5C0ZA 1GQ1A 3OA8B 1N9CA 2RN0A 1K3GA 4AAOA 3M97X 3H1KD 1L0ND 3WFBC 2C9XB 2V07A 1AKKA 1HJ3A 1R0QA 3RN1A 1I8OA 2ORLA 3PHLA 3CP5A 3TF5A 1BCCD 2FYUD 4WQBA 2A06D 5CYTR 1GJQA 2C1DA 2BPBB 4IL6V 2K9JB 3L73D 3DMIA 2YCCA 1GU2A 3CX5D 1CXAA 5CIGB 1RZ5A 1MG2D 2PACA 3CXHD 1CIFA 1CORA 1QKSA 1F1FA 4FAVA 1GKSA 3PXSA 5DFSA 3DR0A 3HQ6A 4AANA 1NNOA 5CIHB 2QJYB 3TYIA 3CWBD 1FJ0A 3TGUD 1YEAA 4PW9B 2L91A 1H33A 1N15A 4AAMA 1EZVD 1N90A 1C6OA 3L72D 4KMGA 4K3IA 1DW3A 1CC5A 4FA5A 5CICB 1AOFA 1CO6A 1HZVA 2BH5X 1CCRA 5KLVD 4DY9A 1KB9D 2B12B 1LS9A 5CIBB 1FI9A 1W5CT 1CYIA 3MK7C 3SJLA 1SQQD 1CHJA 2IBZD 1DVHA 3A0HV 4UB8V 5CIFB 5AURA 3VNWA 1QL3A 1YCCA 1YEBA 1CXCA 2N9YB 3KHUA 1NTMD 2FYNB 1SQPD 1CSVA 4XYDB 2GIWA 4JCGA 5KAFV 4XXLA 3WFCC 5EXQA 1C7MA 3NWVA 2D0WA 3RMZA 3VMAA 1FCDC 5IY51 5DF5A 1I6DA 1C75A 1P84D 5C9MA 4GEDB 1I5TA 3OCDB 2YK3A 2V08A 3ZBMA 1JDLA 2DGEA 2CA4B 2MHMA 3FWLA 3ITKA 1YFCA 1LFMA 3HQ9A 1BGYD 1CSUA 4EIFA 1NMIA 2QG4A 1QYZA 5CIDB 3RN0A 3PH2B 2XTSB 2LITA 1IRWA 1LC2A 4WQ9A 2DVHA 2ZONG 1VYDA 3WC8A 2AXTV 2ZBOA 1H32B 3PXTA 1NMLA 5B66V 3ORVA 2N18C 4L3GA 2GC7D 5B5EV 1I55A 3L70D 4N0KA 4U3FD 3ZOXA 2Y0EA 1ZRTD 3CX5W 3HQ7A 4FANA 3CU4A 1CTJA 3CXHW 2GB8B 3X39A 2ZZS1 3L71D 4EIDA 2VHDA 1HCMA 4FA4A 1CHIA 5KLIB 1MZ4A 1NTZD 1CRCA 1WVEC 2BLFB 1SQXD 2C2CA 5TISV 2HV4A 1OCDA 1CRYA 3O0RC 1C2NA 1YNRA 2PCCB 3WUIA 2OZ1B 1I8PA 4P4QB 1CRIA 3HQ8A 1GIWA 3MK7B 4WQCA 4O1QA 4O1WA 4FB1A 3OA8A 1DW0A 2C1UA 3PTZA 1BL9A 3SLEA 4PWAA 3C2CA 1IRVA 1CTYA 3ZOOA 1KV9A 1AYGA 1H32A 2N3YA 1EB7A 2CXBA 3WU2V 1CTZA 4QAOA 1OAEA 1HJ5A 4EICA 1RZ6A 3GG2A 3A0BV 2FRCA 5DJQC 3KZIV 1B7VA 1HJ4A 2KNCB 1CRJA 4AALA 3GW6A 3WFDC 3SWSA 1M6ZA 1S6VB 5TJHA 1H1OA 1IZL0 3RLMA 1AOQA 1E8EA 2L4DA 3H1LD 2YQBA 2BGVX 1S5LV 4J20A 4LJIA 2O3JA 1YICA 2KS1A 3SVWA 1CCHA 1PP9D 4Y5RA 1RAPA 1CIGA 2C1VA 1I54A 1FHBA 4WQ7A 1J3SA 2Y0CA 2AI5A 1CIEA 1C6RA 4RSZA 1DW1A 1H9YA 3ZCFA 1CEDA 351CA 1LC1A 1KIBA 2Y0DA 1H33B 3SXTA 1DT1A 1KYOW 1IO3A 1LMSA 1HH7A 1KYOD 1E2RA 2CA3B 2MTAC 4RJTA 1FI3A 1DIQC 4WQEA 155CA 1CHHA 3ZOWA 5GTHV 1CNOA 4A7PA 1KX2A 4UB6V 2I8FA 1CYJA 5GTIV 4L3HA 3L4OA 1CYCA 3JBTB 3OCDA 2RMZA 5KKZB 1MG3D 1HZUA 2PCBB 2GC4D 1L0LD 1CIHA 1IQCA 2B10B 1A8CA 1L9BC 3O20A 1NTKD 451CA 4H0JA 1SQVD 3ZOYA 2ZOOA
chains in the Genus database with same CATH superfamily
4OGQC 4DOJA 3HRNA 1DH3A 3WUUA 4KT0J 1F1CA 3WFEC 2M0BA 2WPSA 5AW2B 1NIRA 3TDKA 1GK6A 2B11B 4H0KA 1PIXA 4EIJA 1RF1A 1D7MA 2K1AA 1L9JC 3Q2YA 1ZXGA 4EI2A 1EDKA 2B4ZA 1N50A 1PPJD 1K04A 2QM7A 3U1CA 2QJYC 1HJ0A 1QN2A 1KX7A 3GHGA 3R4YA 3HUSB 1ZW0A 1A2SA 2PP6A 2W27A 5KLVK 3H1HD 2E74C 1Q2NA 1GDVA 4FA9A 2FBWC 3PXWA 2AXTE 3OJAB 1ZOYC 3HE5B 4TT3H 1KN7A 1BCCG 5AVZB 4U3FG 3SFDC 5B66E 3T97B 1IO4A 2CPSA 1DIIC 1H31A 4IL6X 2N9JA 2IBZI 1KB0A 1PZQA 5GTIE 1NTZG 4NFGB 2W90A 3L75D 1FOSE 2V4HA 2D0SA 4OH8B 5KAIV 2BCCJ 3M91A 4JYCA 3USSA 2N3BA 1CSXA 1SQBK 3M9QA 3CX5H 1URQA 1M70A 3L72G 3V2PA 1K3HA 3RL0D 3O5CA 3M0DA 2OYHC 2KNCA 3BCCD 2HR3A 4H44B 5AW5B 1T3JA 2RN0A 3LW5J 3MTUE 1YYCA 4JBZA 2WSSH 2IZ1A 2C9XB 2IBZG 2Q7CA 2MJZA 2QEXP 2O01J 4IFDK 4BRYA 3MD0A 1L0NK 4H0LD 1KQGB 3V4WA 1FS0E 5CYTR 1AVYA 1SQVE 2W6BA 1GJQA 2R3CA 4IL6V 2K9JB 3L73D 3DMIA 1NYHA 5APTA 2H88C 3CX5D 5CIGB 2XDJA 2FYUK 3QH9A 2WSEH 1NTKJ 1Q81Q 1KC8Q 5CIHB 3HQ6A 1NNOA 1NU1J 3CWBD 4PW9B 2AEFA 2WSFH 4KMGA 1AA0A 2MKVA 1DW3A 1PGQA 3TGUJ 2M8RA 3ZDMA 3KXDA 2KYVA 1HZVA 1RE3A 1FZBA 3F89A 3P7KA 4IOIH 3V4QA 2KZJA 1IZNB 1CI6B 1FI9A 3H1IJ 1NWQA 3SJLA 5AVQB 2HODB 1SQQD 1CHJA 3A0HV 3GMAA 3H1JJ 1RH5B 2KOGA 1X8YA 1M7LA 3HD7A 2ZFCA 5AW8B 1SQPD 5AVVB 3L70G 4XYDB 2BCCE 1YQ3C 4D6TJ 4NPEA 2HFED 1VQKP 2KIKA 2W8ZA 1JO5A 2YKPA 1FCDC 2XV5A 1W2EA 1PFIA 4UB6E 1I6DA 1C75A 2IPPA 1JB0J 1U7JA 2V08A 3ZBMA 2DGEA 5AW7B 1YFCA 2Y9YA 2W83C 1BGYD 1QLED 4PD4E 3NTNA 5AW1B 4W7ZA 1MUUA 1HTLC 3AE5C 1QYZA 1JY3N 4H44D 4EYYQ 2XTSB 3AE1C 3H1KE 1IRWA 2OGUA 4WQ9A 2DVHA 3L36A 3H6PA 2AXTV 5KAFH 2ZBOA 1EDJA 3CCJP 3PP5A 1ZMEC 5B66V 1EQ7A 1H0TA 4I6MC 2N18C 5L8RJ 2A06E 3O6QB 2FKWB 5BU5A 1OMIA 3HQ7A 2ZT9B 1YI2P 5APUA 2O01N 1ZN5A 3CU4A 3H1HG 3X39A 3AE3C 3CXHE 1OIPA 1BCCJ 4GT1A 3AE2C 2Q5UA 2J59M 3S9OA 2BLFB 3TGUE 1SQXD 5TISV 1NAFA 1CRYA 1N7SD 2VRSA 3WUIA 2B87A 1GIWA 3CCEP 4O1WA 4FB1A 1T6AA 3E1RA 1M1KQ 3SLEA 3L75G 1OW6A 3C2CA 3G3ZA 1KB9E 3L72J 3I5CA 1CTYA 3ZOOA 1JY2P 2ZVNB 3VOPA 1H32A 2CXBA 3WU2V 1CTZA 1HJBA 1HJ5A 3JCUE 5GTHH 1RZ6A 1TU3F 2GM4A 4D6TE 3U1AA 3VP9A 1SFCC 2FRCA 3D6YA 2N1TB 1KD1Q 4AALA 3GW6A 1M57D 2JJLA 4YTPC 5BVZA 1S6VB 2O1JA 1QEXA 1FJPA 2E43A 3H1LD 1Q7YQ 1P84E 3WMM0 1SS1A 2LKMA 3HUSC 3I55P 2FXPA 3KQGA 2C9NY 3OAKA 2NZ2A 3R2PA 1SQVG 1PP9D 1EDIA 1CIGA 2C1VA 4ZKPA 3HE4B 1EC5A 5AW4B 1FHBA 4GODA 1J3SA 2Y0CA 4O9BA 2AI5A 5C39A 5M1BA 3CWBG 1LT9C 3PH0A 1FZCA 3KYQA 3KZIH 4RSZA 3G4SP 4WBAA 2KZIA 2WT7A 2FFDB 1LC1A 3SXTA 1JM0A 1KYOD 1Y8AA 4BXLA 1E2RA 2CA3B 2H7HA 3FXDA 2B88A 4U3FE 2QIWA 1QL1A 1DIQC 155CA 3ZOWA 1N73A 4UB6V 1SQQG 5AVYB 2M5AA 2SPZA 3L71E 5K5GB 1FAVA 2RMZA 1NTZE 3L70J 3VMZA 1HZUA 1L0LD 1CIHA 4PD4I 1IQCA 1SQPG 3JSVC 3O20A 3MZWB 1KORA 5KAIH 2ZOOA 4AUWA 1IFMA 1KILB 2GUVA 2WPRA 1H9XA 1VPCA 4NPFX 1M1JA 1U57A 1NTKK 2QJPB 1PL5A 2KSEA 1CRHA 4YXWH 2Q1KA 1VQ4P 5DJQB 4Q5PA 2OARA 2E74D 3SWYA 3PJSK 1S5LE 1IFDA 3CCMP 1C52A 1BGYG 2I1JA 2JWDA 3CXHI 2JQRA 1VDFA 2IYOA 1FOCA 1FI7A 2KP8A 4WQDA 1C6SA 3L74D 1QGKB 3DP5A 1YJWP 1VQ7P 2N1TD 3AEGC 1LP1B 2JTIB 1U75B 2IZ0A 5E79V 3ABVC 3BATA 1VL2A 3P8CE 2C0WA 1M60A 1NH4A 2A06G 2LIRA 1KB9I 4EOTA 3NBTA 1LWUC 2BH4X 5B5EE 2WITA 2YIUB 2C1DB 4YPCA 1GMJA 3N4XA 1W2BO 1SQBD 2WSCH 2JWAA 4B86A 1MFTA 5H2FV 1WEJF 1WT6A 4L1QA 1DEEG 3BRVB 1DVVA 5CJ4A 2EXVA 1G1IA 3RK3B 1YJNP 2N18B 1BE3D 3MUDC 2HPCB 1VQMP 4GYDA 1FE6A 4DCKA 4JQ0D 1DW2A 2ZXYA 3B5NB 1YTCA 2BCNB 3A0HH 3K5BA 1GW4A 1P84I 5APXA 3CL3D 1X22A 1K3GA 4YXDC 1OZHA 3F5HA 4RKUJ 2OYOA 4HH2A 1KV4A 2GUSA 2WVRA 1L0ND 1FOSF 3CMAP 2IYPA 1AKKA 1EDLA 4ASVA 3MIWA 3HE5A 2JP3A 3Q5PA 2WQYC 1EXIA 2ORLA 3PHLA 2FYUD 4PJ0E 2BPBB 3VTPC 1ZR2A 4WB4A 3H1LG 1F1FA 2K37A 1SQVJ 1GZLA 1G2CA 1KFMA 1S72P 1SFCB 1KYOI 2L5GB 5CCHA 3AE6C 2ZT9C 2XKMA 3HTKA 1HVVA 1PP9G 1H33A 1UIXA 1N15A 1K9MQ 1EZVD 1NTZK 3CLQA 1NGMB 1C6OA 3D71A 4K3IA 2FY8A 4FA5A 1PPJE 1AVOA 1CO6A 2YKOA 5APVA 2BH5X 1JY2O 2GA1A 4DY9A 4K35A 1QX8A 1S3JA 1N86A 2R5DA 5CIBB 1JEKA 1CYIA 3H1HE 4GDOA 4BWNA 1RE4C 4OWFA 1QL3A 1YEBA 2N9YB 2C0XA 1NTMD 2K9YA 2BEZF 1SQQJ 1LT9B 4JCGA 5TISH 1DD3A 2AEJA 3S4RA 1RF0C 2YKQA 1N7SA 3EFFK 2D0WA 3VMAA 2V7QJ 3L71G 2R44A 3L4FA 5IY51 5DF5A 3L75E 1OVUA 3V2NA 3V2QA 1L0LG 2N1TC 3OCDB 3TSIA 2YK3A 5DJUB 1S9KE 2Q9IA 2W6AA 4LGDE 3AEBC 3KDPB 2MHMA 1OXZA 1SP4A 2PFXA 3RK3D 3ITKA 2E42A 2OYIB 3BCCE 3WU2H 4R4MA 4UB8H 4Y99B 1DIPA 1FDMA 2JR8A 3PH2B 1BGYJ 2LITA 3OA7A 2QSIA 3WC8A 2AEMA 2R5BA 3H1KJ 2FXMA 2YXQB 2GC7D 5B5EV 3L74G 2WWWA 3L73E 3ZOXA 1CSBA 1ZRTD 2FFDC 3CX5E 3GHGB 1YHQP 1CTJA 1AQ5A 1HCMA 4WY4A 4IFFA 2Y9ZA 1CRCA 1WVEC 3CWBE 1GL2B 2C2CA 2QVAA 1OCDA 1IFPA 1I8PA 1SFCD 1CRIA 3MK7B 4WQCA 4O1QA 3OA8A 1VQ8P 2C1UA 3TNUB 3CC4P 3H25A 1H89A 1KILC 3SWFA 1KV9A 1RQUA 2XU6A 1SQQE 2N3YA 1LWUB 2E5TA 4EICA 4XE5B 1GK4A 2QJPC 3EQ2A 2IFMA 1M90Q 3D6ZA 3RK2B 1HH0A 3A0BV 5DJQC 4KJMA 1KQSO 1HJ4A 2KNCB 1SQPE 1USDA 1CRJA 1KMIZ 1AQTA 1QVGO 3LW5H 1JMBA 1MV8A 2YXRB 1H1OA 1N7LA 1IZL0 3RLMA 4ZNCA 1AOQA 2J58A 2O01H 4WWIA 4L76A 4C7RA 1YICA 2KS1A 3VN0A 4BRYB 1CCHA 5KJ7C 3II6A 2I8DA 1BGYE 2Z4EA 1VQOP 3Q3DA 2JEEA 1PV3A 3U59A 1C6RA 3CPWO 2JDIH 1DW1A 2E75B 1EZVG 2R3SA 3CCVP 3D70A 2YIUC 1FZGA 4W80A 1YQ4C 1KIBA 1DT1A 1PPJG 1EXJA 4CPGA 1IO3A 4ASWA 1MZ9A 5E79H 1VQ5P 3RK3C 3B8EB 2WTYA 3Q5RA 4RJTA 1FI3A 3Q1MA 3MHVA 4WQEA 1E5WA 2OYHA 4A7PA 2I8FA 1FU1A 1CYJA 5GTIV 3B5NC 5AW6B 5AW3B 5KKZB 1OW8A 3CCLP 1VF5B 2PCBB 1NTMG 4U3FJ 2GC4D 1SQXE 4Y28J 2B10B 3C1LA 1OX3A 5H2FH 1NTKD 3L71J 1GL2D 1NU1D 2Z5HA 1VQ9P 1L4AC 1NTZJ 1E79H 1HBWA 1YBKA 4K3AA 1G1JA 5KAFE 1R5LA 1M56D 2D2CB 1SQVK 3G6EP 2YO2A 1U74B 4N78D 2A45H 3VYMA 5EFWB 2IX7C 1LTJC 3C8VA 3L4MA 1NVOA 3G9RA 4MN4C 3CX5I 1NAYA 3BCCG 3H1ID 3ZIYA 2NPSC 3LIEA 1W2LA 2PAJA 3H1JD 3RK2D 1FBMA 2Q3EA 2XNDH 2ZXXA 4XFJA 2KLVA 4I2LC 5CCGD 5APWA 3H1LE 5DJTB 4N6JA 3TYYA 4D6TD 3RBZA 2I1KA 1C2RA 3L74J 2OZ1A 1SQQK 1LTGC 4QMAA 3IAOA 1PP9E 1COTA 1HROA 1H0TB 3L73G 4L73A 1E29A 2WPQA 2G8YA 3NBSA 1SQPK 4FA1A 3PRJA 5GTHE 3CD6P 2FWLA 4MU8A 5B6QA 1RY3A 1IK7A 4GKGA 1IFIA 2E75D 4PV1C 1N2DC 2B87B 2LXCB 1AV1A 1KYOE 3O1YA 1GQ1A 1N9CA 1X79B 1NJIQ 5APYA 3M9BA 1PGJA 3M97X 1LTTC 3WFBC 2OYIC 1H88A 1HJ3A 2YMKA 2ZT9D 3RGUA 3RN1A 3RBXA 1L0LE 1I8OA 4Y99C 3CP5A 3L35A 3TF5A 1BCCD 1OVVA 1R5SA 1VF5D 2C1DA 3KZIE 4I1LA 2YCCA 3H32A 1GU2A 1JTHA 1RF1C 1CXAA 3I56P 1YIJP 1CIFA 1Y47A 3L37A 3PXSA 3DR0A 2K88A 3TYIA 1FJ0A 4RO0A 2N9BA 3GHGC 4DT0A 2P7JA 1N90A 4H13B 1X0TA 3L72D 1JY2N 2PRRA 1DD4A 3A2AA 5CICB 3FWNA 1OW7A 1GL2C 2BASA 1HWTC 1CCRA 5KLVD 3L74E 4GIFA 1M8OB 1J1EB 2HYNA 3MK7C 2QJKC 5KAIE 2IBZD 1T3UA 3IFMA 3EWKA 4IL6H 1DVHA 3O8ZA 5AURA 3VNWA 2YNYA 1YCCA 3KHUA 1CXCA 1VQLP 2KUBA 3AEFC 3BASA 2QA4P 4AQRD 3H1HJ 2GIWA 2KXPB 5CBOA 5KAFV 4XXLA 3NWVA 4R4LA 1URQC 1SQBE 2FXOA 3RK2C 1SFCA 3M0DC 5C9MA 2OTKE 1FZEA 1SQXG 5CCGC 1NTKG 1BE3E 4NPDA 4L74A 1FC2C 2CA4B 2W6JH 1NU1G 1HF9A 3L75J 3AEEC 1LJ2A 3GF7A 3E1IA 3HUSA 2ZYGA 1M1JB 2QG4A 5CIDB 2LXBA 1IC2A 3A0BH 3RN0A 3B4SA 4C7NB 1L0NE 1X9VA 3BCCJ 3M0AA 3P8MC 1L4AB 1Q86Q 3H1IG 1LT9A 3T97A 3S1KA 3ORVA 2FYUE 3H1JG 3L70D 2E75C 4N0KA 1NKNA 2G3AA 4M3LA 4N3YB 2POHA 2Y0EA 1OFCX 3C9IA 1LTJB 3M06A 3CCSP 3CXHW 2E76B 3CCUP 1GDTA 4H0LB 3RL0g 1KILD 2VHDA 1CHIA 1NO4A 2NPSB 3A0HE 3L73J 1RE3C 1QL2A 3O0RC 1C2NA 1YNRA 2A45G 1EZVE 1JCDA 1S5LX 1K05A 1L0LK 5KKZC 3CWBJ 1VF5C 2AXTH 4H13D 3PTZA 1JUNA 4PWAA 2FYZA 4HKZH 1IRVA 4Z1MH 5B66H 3HD7C 5AVTB 1AYGA 1EB7A 1NHLA 4QAOA 1OAEA 2D2CC 5GTIH 2NRGA 1NTME 5KJ7D 3GLMA 1KQLA 3FXEA 2M3EA 3KZIV 2K9JA 3KPEA 3JC22 2WPVB 3WFDC 3SWSA 1M6ZA 1LTSC 1LT1A 3FGAD 3BVHA 2H89C 2WSEJ 2Q6QA 1GL2A 5CHXA 1GU4A 2H43A 1SQPJ 2YQBA 4PV1B 2ZJSE 1OWAA 2BGVX 4RESB 1YTZT 1USEA 2XZRA 1S5LV 4J20A 2O3JA 5KTBA 3MP7B 2R32A 3SVWA 2WSFJ 3RK3E 2JKVA 3TNUA 4L75A 2Z5IA 3CCQP 1CW5A 5AVRB 5CJ0A 4WQ7A 1FDIA 3VMXA 3G71P 2FYNC 1AJYA 1MFZA 1CIEA 1CI6A 3B5ND 1KZUB 2HODA 2KSJA 1LWUA 1T2KD 1S9KD 1CEDA 1G2CB 5TISE 1YTZI 3HTKB 1RF1B 1H33B 1Q90D 1YITP 1KYOW 1S4XA 1JY3P 3SSUA 5CCGA 1L4AD 5KLVG 1VQNP 5AVWB 2B9BA 3MUDA 2MTAC 1ZRTE 2Q3IA 1KX2A 2O1KA 4L3HA 1WMKA 3A7OA 1CYCA 3JBTB 1MG3D 4U7JA 3WU2E 2E76D 4UB8E 1L9BC 1SLQA 1QVFO 2HG5D 3IF4A 2NPSD 4H0JA 1SQVD 1A56A 4LLHA 3MGNA 4EDFA 2P1JA 1ZZHA 2QJKB 1SQXJ 1SQBG 2QRXA 1I6EA 1N7SB 2V7QH 3CI9A 5CIEB 1H31B 3A9FA 1SVFA 3CC2P 3VRDA 1BE3G 2CE0A 4AX3A 4WQ8A 1CSWA 1LTBC 3FX0A 2B0ZB 1W5CE 4UB6H 5KLIC 4YE1A 1HRCA 1URQB 3O6QA 2KI7B 3QWOC 1DEBA 1ZP0C 2P2UA 4PJ0V 4JPZB 4ZKUA 1T8ZA 4V2KA 5AVXB 2OTJP 2YO3A 2CE1A 4EIEA 2C8SA 2KLUA 4H13C 1ETPA 1L0NG 1RAQA 4GOEA 1EZVI 2ZYDA 4I7ZB 1YIQA 4PD4H 1IJDB 4WQAA 2E5YA 3Q5SA 1J1DB 1WRGA 2FYUG 1J1EC 4PV1D 4DZOA 1FZCC 1JMMA 3H1LJ 3CYTI 1BDDA 2BCCD 5AW0B 1NTMK 1RE4A 1FZFA 2AIUA 1R8EA 2KK7A 1FDOA 3IN6A 1CRGA 1PP9J 2OTLP 5BU8B 4WY4B 1RF0A 2WZ7A 3PLNA 1QL4A 3CXHH 1UIIA 2ZAEB 1RQVA 1RHZB 1N73C 2IDBA 5CCHD 2N1TA 2N9IA 5AVUB 3A3YB 4PD4D 3W67A 5C0ZA 3NFQA 3OA8B 4JF7A 1K73Q 1J2JB 4AAOA 1YJ9P 3H1KD 2V07A 4OGQB 4WVZA 1R0QA 4HB1A 1Z56A 1T2KC 1M1JC 1XTGB 1KB9H 5APSA 3RL0C 1NTKE 4WQBA 3HE4A 2A06D 2IFNA 1NU1E 3HD7B 1OVRA 3JCUH 1RZ5A 1L0LJ 1MG2D 2PACA 3CXHD 1CORA 1QKSA 4FAVA 1GKSA 1XTCC 5DFSA 3NXSA 4AANA 2QJYB 4N78E 2RKLA 3TGUD 1YEAA 5E79E 2FFDA 2L91A 4AAMA 2E76C 1IFNA 3V5BA 2KS1B 2DW3A 4H0LC 3GF3A 4DJGA 1CC5A 1P84H 3H1IE 4AYCA 1AOFA 2J5UA 2E74B 1URQD 1PGOA 3H1JE 1BDCA 1KB9D 2B12B 5H2FE 1LS9A 1LGHB 1W5CT 2ZYAA 3AEAC 2XNXA 3NMDA 2ZVOB 3AECC 4UB8V 5CIFB 5KLVJ 2C9LY 1L2PA 2AXCA 3OW2O 2FYNB 5CMZA 1KILA 3EFGA 1FJKA 1CSVA 3V6IA 2CK3H 3WFCC 5EXQA 1C7MA 2B89A 3TK1A 3RMZA 2CPBA 2OYHB 1KYOH 1P84D 3CMEP 4JYBA 4GEDB 1I5TA 1JCCA 1N8RQ 1JDLA 4C46A 3M9HA 1SQBJ 1HUCA 1ZV8A 3FWLA 4WY4D 1LFMA 3HQ9A 1AFOA 1VQ6P 1BE3J 1CSUA 2P10A 4EIFA 1NMIA 4LC1A 5KJ7A 1LP1A 1BSNA 1LC2A 2ZONG 1VYDA 2H8PD 1IK9A 1JY3O 1PGPA 1GW3A 1H32B 3AE9C 3PXTA 4OGQD 1NMLA 1KTMA 2P58A 2HLOA 1BCCE 1L0NJ 2ITAA 4L3GA 1KQFB 3WUVA 1I55A 1HGZA 4U3FD 5CCHC 3CX5W 1S5LH 4FANA 2GB8B 3A5TA 2ZZS1 2WSCJ 1JOCA 3L71D 3HD7D 3LIDA 4EIDA 4FA4A 4H44C 2FYUJ 5KLIB 5APQA 1MZ4A 1NTZD 4OVNF 1GTWA 1IFJA 2HPCA 2UWJE 2HV4A 1KFNA 2D2CD 2YMYA 4ZMDA 1FZAA 1H8AA 2PCCB 2OZ1B 4P4QB 3B5NA 2BCCG 3VMYA 3L72E 3HQ8A 2ZXEB 3AE7C 1SQXK 1NKZB 1GD2E 1DW0A 1HGVA 2QM8A 3AE4C 1NOHA 3WUTA 1BL9A 3VP8A 5KLVE 1NU1K 2WMMA 4C7NA 4HYTB 1BSHA 1L4AA 5B5EH 2BEQD 2IBZE 3B71A 1FZCB 2OQQA 4KHXA 1A02J 3GG2A 1N7SC 5AW9B 4XA4A 2WT7B 1MKMA 1LTIC 1Y9BA 4IFMA 3SWKA 1B7VA 1LTJA 1K8AQ 3H1KG 1S1CX 1A02F 2P67A 5TJHA 1NTMJ 2NPSA 1S2EA 2QE7H 3CCRP 1ZLLA 1E8EA 2L4DA 1N73B 2M5AB 3P8CD 2PGDA 3VYIA 4LJIA 3BRTB 3D0WA 4Y5RA 1RAPA 4I7ZC 1I54A 2JO1A 4HJGH 5CBNA 4IL6E 1GU5A 3H32B 3W68A 1JTHB 1U7MA 1J1DC 4GOFA 3AE8C 3CC7P 1Q82Q 3TGUG 4TLFA 1LTAC 4PJ0H 1DX7A 3AEDC 3RL0B 1H9YA 1ZR4A 3ZCFA 1LNQA 2A45I 351CA 2Y0DA 2RH0A 1JNMA 1LMSA 1HH7A 4WY4C 3SFEC 4W7YA 3L70E 1CHHA 2M3BA 5GTHV 1CNOA 3E7KA 2K3RA 3L4OA 1VQPP 1KILE 3V2RA 2LR2A 3UIAA 3OCDA 3N7NA 4D6TG 2KB7P 3P32A 1CZQA 1A8CA 3IR9A 5AVSB 451CA 3A0BE 2OYIA 3ZOYA
chains in the Genus database with same CATH topology
1A56A 1NU1D 4EDFA 1H9XA 1ZZHA 2QJKB 1I6EA 2QJPB 1F1CA 3WFEC 1CRHA 5CIEB 1H31B 3A9FA 1NIRA 3TDKA 1U74B 3VRDA 5DJQB 4Q5PA 2B11B 4H0KA 3VYMA 3L4MA 2CE0A 4AX3A 4WQ8A 1L9JC 1CSWA 2B4ZA 2B0ZB 1C52A 4YE1A 1HRCA 1N50A 3H1ID 3ZIYA 1PPJD 1W2LA 2JQRA 4PJ0V 1QN2A 4V2KA 1KX7A 1FOCA 3H1JD 1FI7A 2Q3EA 2CE1A 4WQDA 4EIEA 1C6SA 3L74D 2C8SA 1A2SA 1ETPA 3DP5A 1RAQA 3H1HD 2JTIB 1U75B 1YIQA 1GDVA 5E79V 4FA9A 4D6TD 3PXWA 4WQAA 1C2RA 2OZ1A 1M60A 2LIRA 1COTA 1HROA 3NBTA 3CYTI 2BCCD 2BH4X 1DIIC 1E29A 1H31A 2YIUB 2AIUA 2N9JA 2C1DB 3NBSA 1KB0A 4FA1A 3PRJA 1SQBD 2JWAA 4NFGB 3L75D 5H2FV 2FWLA 1WEJF 1CRGA 2D0SA 4L1QA 4MU8A 5B6QA 1DVVA 5KAIV 2EXVA 2N18B 1BE3D 2N3BA 1CSXA 3PLNA 1QL4A 4GYDA 1M70A 1K3HA 3O5CA 1DW2A 2ZXYA 3BCCD 1YTCA 2N9IA 2BCNB 4PD4D 3O1YA 5C0ZA 1GQ1A 3OA8B 1N9CA 2RN0A 1K3GA 4AAOA 3M97X 3H1KD 1L0ND 3WFBC 2C9XB 2V07A 1AKKA 1HJ3A 1R0QA 3RN1A 1I8OA 2ORLA 3PHLA 3CP5A 3TF5A 1BCCD 2FYUD 4WQBA 2A06D 5CYTR 1GJQA 2C1DA 2BPBB 4IL6V 2K9JB 3L73D 3DMIA 2YCCA 1GU2A 3CX5D 1CXAA 5CIGB 1RZ5A 1MG2D 2PACA 3CXHD 1CIFA 1CORA 1QKSA 1F1FA 4FAVA 1GKSA 3PXSA 5DFSA 3DR0A 3HQ6A 4AANA 1NNOA 5CIHB 2QJYB 3TYIA 3CWBD 1FJ0A 3TGUD 1YEAA 4PW9B 2L91A 1H33A 1N15A 4AAMA 1EZVD 1N90A 1C6OA 3L72D 4KMGA 4K3IA 1DW3A 1CC5A 4FA5A 5CICB 1AOFA 1CO6A 1HZVA 2BH5X 1CCRA 5KLVD 4DY9A 1KB9D 2B12B 1LS9A 5CIBB 1FI9A 1W5CT 1CYIA 3MK7C 3SJLA 1SQQD 1CHJA 2IBZD 1DVHA 3A0HV 4UB8V 5CIFB 5AURA 3VNWA 1QL3A 1YCCA 1YEBA 1CXCA 2N9YB 3KHUA 1NTMD 2FYNB 1SQPD 1CSVA 4XYDB 2GIWA 4JCGA 5KAFV 4XXLA 3WFCC 5EXQA 1C7MA 3NWVA 2D0WA 3RMZA 3VMAA 1FCDC 5IY51 5DF5A 1I6DA 1C75A 1P84D 5C9MA 4GEDB 1I5TA 3OCDB 2YK3A 2V08A 3ZBMA 1JDLA 2DGEA 2CA4B 2MHMA 3FWLA 3ITKA 1YFCA 1LFMA 3HQ9A 1BGYD 1CSUA 4EIFA 1NMIA 2QG4A 1QYZA 5CIDB 3RN0A 3PH2B 2XTSB 2LITA 1IRWA 1LC2A 4WQ9A 2DVHA 2ZONG 1VYDA 3WC8A 2AXTV 2ZBOA 1H32B 3PXTA 1NMLA 5B66V 3ORVA 2N18C 4L3GA 2GC7D 5B5EV 1I55A 3L70D 4N0KA 4U3FD 3ZOXA 2Y0EA 1ZRTD 3CX5W 3HQ7A 4FANA 3CU4A 1CTJA 3CXHW 2GB8B 3X39A 2ZZS1 3L71D 4EIDA 2VHDA 1HCMA 4FA4A 1CHIA 5KLIB 1MZ4A 1NTZD 1CRCA 1WVEC 2BLFB 1SQXD 2C2CA 5TISV 2HV4A 1OCDA 1CRYA 3O0RC 1C2NA 1YNRA 2PCCB 3WUIA 2OZ1B 1I8PA 4P4QB 1CRIA 3HQ8A 1GIWA 3MK7B 4WQCA 4O1QA 4O1WA 4FB1A 3OA8A 1DW0A 2C1UA 3PTZA 1BL9A 3SLEA 4PWAA 3C2CA 1IRVA 1CTYA 3ZOOA 1KV9A 1AYGA 1H32A 2N3YA 1EB7A 2CXBA 3WU2V 1CTZA 4QAOA 1OAEA 1HJ5A 4EICA 1RZ6A 3GG2A 3A0BV 2FRCA 5DJQC 3KZIV 1B7VA 1HJ4A 2KNCB 1CRJA 4AALA 3GW6A 3WFDC 3SWSA 1M6ZA 1S6VB 5TJHA 1H1OA 1IZL0 3RLMA 1AOQA 1E8EA 2L4DA 3H1LD 2YQBA 2BGVX 1S5LV 4J20A 4LJIA 2O3JA 1YICA 2KS1A 3SVWA 1CCHA 1PP9D 4Y5RA 1RAPA 1CIGA 2C1VA 1I54A 1FHBA 4WQ7A 1J3SA 2Y0CA 2AI5A 1CIEA 1C6RA 4RSZA 1DW1A 1H9YA 3ZCFA 1CEDA 351CA 1LC1A 1KIBA 2Y0DA 1H33B 3SXTA 1DT1A 1KYOW 1IO3A 1LMSA 1HH7A 1KYOD 1E2RA 2CA3B 2MTAC 4RJTA 1FI3A 1DIQC 4WQEA 155CA 1CHHA 3ZOWA 5GTHV 1CNOA 4A7PA 1KX2A 4UB6V 2I8FA 1CYJA 5GTIV 4L3HA 3L4OA 1CYCA 3JBTB 3OCDA 2RMZA 5KKZB 1MG3D 1HZUA 2PCBB 2GC4D 1L0LD 1CIHA 1IQCA 2B10B 1A8CA 1L9BC 3O20A 1NTKD 451CA 4H0JA 1SQVD 3ZOYA 2ZOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A56 A;  1NU1 D;  4EDF A;  1H9X A;  1ZZH A;  2QJK B;  1I6E A;  2QJP B;  1F1C A;  3WFE C;  1CRH A;  5CIE B;  1H31 B;  3A9F A;  1NIR A;  3TDK A;  1U74 B;  3VRD A;  5DJQ B;  4Q5P A;  2B11 B;  4H0K A;  3VYM A;  3L4M A;  2CE0 A;  4AX3 A;  4WQ8 A;  1L9J C;  1CSW A;  2B4Z A;  2B0Z B;  1C52 A;  4YE1 A;  1HRC A;  1N50 A;  3H1I D;  3ZIY A;  1PPJ D;  1W2L A;  2JQR A;  4PJ0 V;  1QN2 A;  4V2K A;  1KX7 A;  1FOC A;  3H1J D;  1FI7 A;  2Q3E A;  2CE1 A;  4WQD A;  4EIE A;  1C6S A;  3L74 D;  2C8S A;  1A2S A;  1ETP A;  3DP5 A;  1RAQ A;  3H1H D;  2JTI B;  1U75 B;  1YIQ A;  1GDV A;  5E79 V;  4FA9 A;  4D6T D;  3PXW A;  4WQA A;  1C2R A;  2OZ1 A;  1M60 A;  2LIR A;  1COT A;  1HRO A;  3NBT A;  3CYT I;  2BCC D;  2BH4 X;  1DII C;  1E29 A;  1H31 A;  2YIU B;  2AIU A;  2N9J A;  2C1D B;  3NBS A;  1KB0 A;  4FA1 A;  3PRJ A;  1SQB D;  2JWA A;  4NFG B;  3L75 D;  5H2F V;  2FWL A;  1WEJ F;  1CRG A;  2D0S A;  4L1Q A;  4MU8 A;  5B6Q A;  1DVV A;  5KAI V;  2EXV A;  2N18 B;  1BE3 D;  2N3B A;  1CSX A;  3PLN A;  1QL4 A;  4GYD A;  1M70 A;  1K3H A;  3O5C A;  1DW2 A;  2ZXY A;  3BCC D;  1YTC A;  2N9I A;  2BCN B;  4PD4 D;  3O1Y A;  5C0Z A;  1GQ1 A;  3OA8 B;  1N9C A;  2RN0 A;  1K3G A;  4AAO A;  3M97 X;  3H1K D;  1L0N D;  3WFB C;  2C9X B;  2V07 A;  1AKK A;  1HJ3 A;  1R0Q A;  3RN1 A;  1I8O A;  2ORL A;  3PHL A;  3CP5 A;  3TF5 A;  1BCC D;  2FYU D;  4WQB A;  2A06 D;  5CYT R;  1GJQ A;  2C1D A;  2BPB B;  4IL6 V;  2K9J B;  3L73 D;  3DMI A;  2YCC A;  1GU2 A;  3CX5 D;  1CXA A;  5CIG B;  1RZ5 A;  1MG2 D;  2PAC A;  3CXH D;  1CIF A;  1COR A;  1QKS A;  1F1F A;  4FAV A;  1GKS A;  3PXS A;  5DFS A;  3DR0 A;  3HQ6 A;  4AAN A;  1NNO A;  5CIH B;  2QJY B;  3TYI A;  3CWB D;  1FJ0 A;  3TGU D;  1YEA A;  4PW9 B;  2L91 A;  1H33 A;  1N15 A;  4AAM A;  1EZV D;  1N90 A;  1C6O A;  3L72 D;  4KMG A;  4K3I A;  1DW3 A;  1CC5 A;  4FA5 A;  5CIC B;  1AOF A;  1CO6 A;  1HZV A;  2BH5 X;  1CCR A;  5KLV D;  4DY9 A;  1KB9 D;  2B12 B;  1LS9 A;  5CIB B;  1FI9 A;  1W5C T;  1CYI A;  3MK7 C;  3SJL A;  1SQQ D;  1CHJ A;  2IBZ D;  1DVH A;  3A0H V;  4UB8 V;  5CIF B;  5AUR A;  3VNW A;  1QL3 A;  1YCC A;  1YEB A;  1CXC A;  2N9Y B;  3KHU A;  1NTM D;  2FYN B;  1SQP D;  1CSV A;  4XYD B;  2GIW A;  4JCG A;  5KAF V;  4XXL A;  3WFC C;  5EXQ A;  1C7M A;  3NWV A;  2D0W A;  3RMZ A;  3VMA A;  1FCD C;  5IY5 1;  5DF5 A;  1I6D A;  1C75 A;  1P84 D;  5C9M A;  4GED B;  1I5T A;  3OCD B;  2YK3 A;  2V08 A;  3ZBM A;  1JDL A;  2DGE A;  2CA4 B;  2MHM A;  3FWL A;  3ITK A;  1YFC A;  1LFM A;  3HQ9 A;  1BGY D;  1CSU A;  4EIF A;  1NMI A;  2QG4 A;  1QYZ A;  5CID B;  3RN0 A;  3PH2 B;  2XTS B;  2LIT A;  1IRW A;  1LC2 A;  4WQ9 A;  2DVH A;  2ZON G;  1VYD A;  3WC8 A;  2AXT V;  2ZBO A;  1H32 B;  3PXT A;  1NML A;  5B66 V;  3ORV A;  2N18 C;  4L3G A;  2GC7 D;  5B5E V;  1I55 A;  3L70 D;  4N0K A;  4U3F D;  3ZOX A;  2Y0E A;  1ZRT D;  3CX5 W;  3HQ7 A;  4FAN A;  3CU4 A;  1CTJ A;  3CXH W;  2GB8 B;  3X39 A;  2ZZS 1;  3L71 D;  4EID A;  2VHD A;  1HCM A;  4FA4 A;  1CHI A;  5KLI B;  1MZ4 A;  1NTZ D;  1CRC A;  1WVE C;  2BLF B;  1SQX D;  2C2C A;  5TIS V;  2HV4 A;  1OCD A;  1CRY A;  3O0R C;  1C2N A;  1YNR A;  2PCC B;  3WUI A;  2OZ1 B;  1I8P A;  4P4Q B;  1CRI A;  3HQ8 A;  1GIW A;  3MK7 B;  4WQC A;  4O1Q A;  4O1W A;  4FB1 A;  3OA8 A;  1DW0 A;  2C1U A;  3PTZ A;  1BL9 A;  3SLE A;  4PWA A;  3C2C A;  1IRV A;  1CTY A;  3ZOO A;  1KV9 A;  1AYG A;  1H32 A;  2N3Y A;  1EB7 A;  2CXB A;  3WU2 V;  1CTZ A;  4QAO A;  1OAE A;  1HJ5 A;  4EIC A;  1RZ6 A;  3GG2 A;  3A0B V;  2FRC A;  5DJQ C;  3KZI V;  1B7V A;  1HJ4 A;  2KNC B;  1CRJ A;  4AAL A;  3GW6 A;  3WFD C;  3SWS A;  1M6Z A;  1S6V B;  5TJH A;  1H1O A;  1IZL 0;  3RLM A;  1AOQ A;  1E8E A;  2L4D A;  3H1L D;  2YQB A;  2BGV X;  1S5L V;  4J20 A;  4LJI A;  2O3J A;  1YIC A;  2KS1 A;  3SVW A;  1CCH A;  1PP9 D;  4Y5R A;  1RAP A;  1CIG A;  2C1V A;  1I54 A;  1FHB A;  4WQ7 A;  1J3S A;  2Y0C A;  2AI5 A;  1CIE A;  1C6R A;  4RSZ A;  1DW1 A;  1H9Y A;  3ZCF A;  1CED A;  351C A;  1LC1 A;  1KIB A;  2Y0D A;  1H33 B;  3SXT A;  1DT1 A;  1KYO W;  1IO3 A;  1LMS A;  1HH7 A;  1KYO D;  1E2R A;  2CA3 B;  2MTA C;  4RJT A;  1FI3 A;  1DIQ C;  4WQE A;  155C A;  1CHH A;  3ZOW A;  5GTH V;  1CNO A;  4A7P A;  1KX2 A;  4UB6 V;  2I8F A;  1CYJ A;  5GTI V;  4L3H A;  3L4O A;  1CYC A;  3JBT B;  3OCD A;  2RMZ A;  5KKZ B;  1MG3 D;  1HZU A;  2PCB B;  2GC4 D;  1L0L D;  1CIH A;  1IQC A;  2B10 B;  1A8C A;  1L9B C;  3O20 A;  1NTK D;  451C A;  4H0J A;  1SQV D;  3ZOY A;  2ZOO A; 
#chains in the Genus database with same CATH topology
 4OGQ C;  4DOJ A;  3HRN A;  1DH3 A;  3WUU A;  4KT0 J;  1F1C A;  3WFE C;  2M0B A;  2WPS A;  5AW2 B;  1NIR A;  3TDK A;  1GK6 A;  2B11 B;  4H0K A;  1PIX A;  4EIJ A;  1RF1 A;  1D7M A;  2K1A A;  1L9J C;  3Q2Y A;  1ZXG A;  4EI2 A;  1EDK A;  2B4Z A;  1N50 A;  1PPJ D;  1K04 A;  2QM7 A;  3U1C A;  2QJY C;  1HJ0 A;  1QN2 A;  1KX7 A;  3GHG A;  3R4Y A;  3HUS B;  1ZW0 A;  1A2S A;  2PP6 A;  2W27 A;  5KLV K;  3H1H D;  2E74 C;  1Q2N A;  1GDV A;  4FA9 A;  2FBW C;  3PXW A;  2AXT E;  3OJA B;  1ZOY C;  3HE5 B;  4TT3 H;  1KN7 A;  1BCC G;  5AVZ B;  4U3F G;  3SFD C;  5B66 E;  3T97 B;  1IO4 A;  2CPS A;  1DII C;  1H31 A;  4IL6 X;  2N9J A;  2IBZ I;  1KB0 A;  1PZQ A;  5GTI E;  1NTZ G;  4NFG B;  2W90 A;  3L75 D;  1FOS E;  2V4H A;  2D0S A;  4OH8 B;  5KAI V;  2BCC J;  3M91 A;  4JYC A;  3USS A;  2N3B A;  1CSX A;  1SQB K;  3M9Q A;  3CX5 H;  1URQ A;  1M70 A;  3L72 G;  3V2P A;  1K3H A;  3RL0 D;  3O5C A;  3M0D A;  2OYH C;  2KNC A;  3BCC D;  2HR3 A;  4H44 B;  5AW5 B;  1T3J A;  2RN0 A;  3LW5 J;  3MTU E;  1YYC A;  4JBZ A;  2WSS H;  2IZ1 A;  2C9X B;  2IBZ G;  2Q7C A;  2MJZ A;  2QEX P;  2O01 J;  4IFD K;  4BRY A;  3MD0 A;  1L0N K;  4H0L D;  1KQG B;  3V4W A;  1FS0 E;  5CYT R;  1AVY A;  1SQV E;  2W6B A;  1GJQ A;  2R3C A;  4IL6 V;  2K9J B;  3L73 D;  3DMI A;  1NYH A;  5APT A;  2H88 C;  3CX5 D;  5CIG B;  2XDJ A;  2FYU K;  3QH9 A;  2WSE H;  1NTK J;  1Q81 Q;  1KC8 Q;  5CIH B;  3HQ6 A;  1NNO A;  1NU1 J;  3CWB D;  4PW9 B;  2AEF A;  2WSF H;  4KMG A;  1AA0 A;  2MKV A;  1DW3 A;  1PGQ A;  3TGU J;  2M8R A;  3ZDM A;  3KXD A;  2KYV A;  1HZV A;  1RE3 A;  1FZB A;  3F89 A;  3P7K A;  4IOI H;  3V4Q A;  2KZJ A;  1IZN B;  1CI6 B;  1FI9 A;  3H1I J;  1NWQ A;  3SJL A;  5AVQ B;  2HOD B;  1SQQ D;  1CHJ A;  3A0H V;  3GMA A;  3H1J J;  1RH5 B;  2KOG A;  1X8Y A;  1M7L A;  3HD7 A;  2ZFC A;  5AW8 B;  1SQP D;  5AVV B;  3L70 G;  4XYD B;  2BCC E;  1YQ3 C;  4D6T J;  4NPE A;  2HFE D;  1VQK P;  2KIK A;  2W8Z A;  1JO5 A;  2YKP A;  1FCD C;  2XV5 A;  1W2E A;  1PFI A;  4UB6 E;  1I6D A;  1C75 A;  2IPP A;  1JB0 J;  1U7J A;  2V08 A;  3ZBM A;  2DGE A;  5AW7 B;  1YFC A;  2Y9Y A;  2W83 C;  1BGY D;  1QLE D;  4PD4 E;  3NTN A;  5AW1 B;  4W7Z A;  1MUU A;  1HTL C;  3AE5 C;  1QYZ A;  1JY3 N;  4H44 D;  4EYY Q;  2XTS B;  3AE1 C;  3H1K E;  1IRW A;  2OGU A;  4WQ9 A;  2DVH A;  3L36 A;  3H6P A;  2AXT V;  5KAF H;  2ZBO A;  1EDJ A;  3CCJ P;  3PP5 A;  1ZME C;  5B66 V;  1EQ7 A;  1H0T A;  4I6M C;  2N18 C;  5L8R J;  2A06 E;  3O6Q B;  2FKW B;  5BU5 A;  1OMI A;  3HQ7 A;  2ZT9 B;  1YI2 P;  5APU A;  2O01 N;  1ZN5 A;  3CU4 A;  3H1H G;  3X39 A;  3AE3 C;  3CXH E;  1OIP A;  1BCC J;  4GT1 A;  3AE2 C;  2Q5U A;  2J59 M;  3S9O A;  2BLF B;  3TGU E;  1SQX D;  5TIS V;  1NAF A;  1CRY A;  1N7S D;  2VRS A;  3WUI A;  2B87 A;  1GIW A;  3CCE P;  4O1W A;  4FB1 A;  1T6A A;  3E1R A;  1M1K Q;  3SLE A;  3L75 G;  1OW6 A;  3C2C A;  3G3Z A;  1KB9 E;  3L72 J;  3I5C A;  1CTY A;  3ZOO A;  1JY2 P;  2ZVN B;  3VOP A;  1H32 A;  2CXB A;  3WU2 V;  1CTZ A;  1HJB A;  1HJ5 A;  3JCU E;  5GTH H;  1RZ6 A;  1TU3 F;  2GM4 A;  4D6T E;  3U1A A;  3VP9 A;  1SFC C;  2FRC A;  3D6Y A;  2N1T B;  1KD1 Q;  4AAL A;  3GW6 A;  1M57 D;  2JJL A;  4YTP C;  5BVZ A;  1S6V B;  2O1J A;  1QEX A;  1FJP A;  2E43 A;  3H1L D;  1Q7Y Q;  1P84 E;  3WMM 0;  1SS1 A;  2LKM A;  3HUS C;  3I55 P;  2FXP A;  3KQG A;  2C9N Y;  3OAK A;  2NZ2 A;  3R2P A;  1SQV G;  1PP9 D;  1EDI A;  1CIG A;  2C1V A;  4ZKP A;  3HE4 B;  1EC5 A;  5AW4 B;  1FHB A;  4GOD A;  1J3S A;  2Y0C A;  4O9B A;  2AI5 A;  5C39 A;  5M1B A;  3CWB G;  1LT9 C;  3PH0 A;  1FZC A;  3KYQ A;  3KZI H;  4RSZ A;  3G4S P;  4WBA A;  2KZI A;  2WT7 A;  2FFD B;  1LC1 A;  3SXT A;  1JM0 A;  1KYO D;  1Y8A A;  4BXL A;  1E2R A;  2CA3 B;  2H7H A;  3FXD A;  2B88 A;  4U3F E;  2QIW A;  1QL1 A;  1DIQ C;  155C A;  3ZOW A;  1N73 A;  4UB6 V;  1SQQ G;  5AVY B;  2M5A A;  2SPZ A;  3L71 E;  5K5G B;  1FAV A;  2RMZ A;  1NTZ E;  3L70 J;  3VMZ A;  1HZU A;  1L0L D;  1CIH A;  4PD4 I;  1IQC A;  1SQP G;  3JSV C;  3O20 A;  3MZW B;  1KOR A;  5KAI H;  2ZOO A;  4AUW A;  1IFM A;  1KIL B;  2GUV A;  2WPR A;  1H9X A;  1VPC A;  4NPF X;  1M1J A;  1U57 A;  1NTK K;  2QJP B;  1PL5 A;  2KSE A;  1CRH A;  4YXW H;  2Q1K A;  1VQ4 P;  5DJQ B;  4Q5P A;  2OAR A;  2E74 D;  3SWY A;  3PJS K;  1S5L E;  1IFD A;  3CCM P;  1C52 A;  1BGY G;  2I1J A;  2JWD A;  3CXH I;  2JQR A;  1VDF A;  2IYO A;  1FOC A;  1FI7 A;  2KP8 A;  4WQD A;  1C6S A;  3L74 D;  1QGK B;  3DP5 A;  1YJW P;  1VQ7 P;  2N1T D;  3AEG C;  1LP1 B;  2JTI B;  1U75 B;  2IZ0 A;  5E79 V;  3ABV C;  3BAT A;  1VL2 A;  3P8C E;  2C0W A;  1M60 A;  1NH4 A;  2A06 G;  2LIR A;  1KB9 I;  4EOT A;  3NBT A;  1LWU C;  2BH4 X;  5B5E E;  2WIT A;  2YIU B;  2C1D B;  4YPC A;  1GMJ A;  3N4X A;  1W2B O;  1SQB D;  2WSC H;  2JWA A;  4B86 A;  1MFT A;  5H2F V;  1WEJ F;  1WT6 A;  4L1Q A;  1DEE G;  3BRV B;  1DVV A;  5CJ4 A;  2EXV A;  1G1I A;  3RK3 B;  1YJN P;  2N18 B;  1BE3 D;  3MUD C;  2HPC B;  1VQM P;  4GYD A;  1FE6 A;  4DCK A;  4JQ0 D;  1DW2 A;  2ZXY A;  3B5N B;  1YTC A;  2BCN B;  3A0H H;  3K5B A;  1GW4 A;  1P84 I;  5APX A;  3CL3 D;  1X22 A;  1K3G A;  4YXD C;  1OZH A;  3F5H A;  4RKU J;  2OYO A;  4HH2 A;  1KV4 A;  2GUS A;  2WVR A;  1L0N D;  1FOS F;  3CMA P;  2IYP A;  1AKK A;  1EDL A;  4ASV A;  3MIW A;  3HE5 A;  2JP3 A;  3Q5P A;  2WQY C;  1EXI A;  2ORL A;  3PHL A;  2FYU D;  4PJ0 E;  2BPB B;  3VTP C;  1ZR2 A;  4WB4 A;  3H1L G;  1F1F A;  2K37 A;  1SQV J;  1GZL A;  1G2C A;  1KFM A;  1S72 P;  1SFC B;  1KYO I;  2L5G B;  5CCH A;  3AE6 C;  2ZT9 C;  2XKM A;  3HTK A;  1HVV A;  1PP9 G;  1H33 A;  1UIX A;  1N15 A;  1K9M Q;  1EZV D;  1NTZ K;  3CLQ A;  1NGM B;  1C6O A;  3D71 A;  4K3I A;  2FY8 A;  4FA5 A;  1PPJ E;  1AVO A;  1CO6 A;  2YKO A;  5APV A;  2BH5 X;  1JY2 O;  2GA1 A;  4DY9 A;  4K35 A;  1QX8 A;  1S3J A;  1N86 A;  2R5D A;  5CIB B;  1JEK A;  1CYI A;  3H1H E;  4GDO A;  4BWN A;  1RE4 C;  4OWF A;  1QL3 A;  1YEB A;  2N9Y B;  2C0X A;  1NTM D;  2K9Y A;  2BEZ F;  1SQQ J;  1LT9 B;  4JCG A;  5TIS H;  1DD3 A;  2AEJ A;  3S4R A;  1RF0 C;  2YKQ A;  1N7S A;  3EFF K;  2D0W A;  3VMA A;  2V7Q J;  3L71 G;  2R44 A;  3L4F A;  5IY5 1;  5DF5 A;  3L75 E;  1OVU A;  3V2N A;  3V2Q A;  1L0L G;  2N1T C;  3OCD B;  3TSI A;  2YK3 A;  5DJU B;  1S9K E;  2Q9I A;  2W6A A;  4LGD E;  3AEB C;  3KDP B;  2MHM A;  1OXZ A;  1SP4 A;  2PFX A;  3RK3 D;  3ITK A;  2E42 A;  2OYI B;  3BCC E;  3WU2 H;  4R4M A;  4UB8 H;  4Y99 B;  1DIP A;  1FDM A;  2JR8 A;  3PH2 B;  1BGY J;  2LIT A;  3OA7 A;  2QSI A;  3WC8 A;  2AEM A;  2R5B A;  3H1K J;  2FXM A;  2YXQ B;  2GC7 D;  5B5E V;  3L74 G;  2WWW A;  3L73 E;  3ZOX A;  1CSB A;  1ZRT D;  2FFD C;  3CX5 E;  3GHG B;  1YHQ P;  1CTJ A;  1AQ5 A;  1HCM A;  4WY4 A;  4IFF A;  2Y9Z A;  1CRC A;  1WVE C;  3CWB E;  1GL2 B;  2C2C A;  2QVA A;  1OCD A;  1IFP A;  1I8P A;  1SFC D;  1CRI A;  3MK7 B;  4WQC A;  4O1Q A;  3OA8 A;  1VQ8 P;  2C1U A;  3TNU B;  3CC4 P;  3H25 A;  1H89 A;  1KIL C;  3SWF A;  1KV9 A;  1RQU A;  2XU6 A;  1SQQ E;  2N3Y A;  1LWU B;  2E5T A;  4EIC A;  4XE5 B;  1GK4 A;  2QJP C;  3EQ2 A;  2IFM A;  1M90 Q;  3D6Z A;  3RK2 B;  1HH0 A;  3A0B V;  5DJQ C;  4KJM A;  1KQS O;  1HJ4 A;  2KNC B;  1SQP E;  1USD A;  1CRJ A;  1KMI Z;  1AQT A;  1QVG O;  3LW5 H;  1JMB A;  1MV8 A;  2YXR B;  1H1O A;  1N7L A;  1IZL 0;  3RLM A;  4ZNC A;  1AOQ A;  2J58 A;  2O01 H;  4WWI A;  4L76 A;  4C7R A;  1YIC A;  2KS1 A;  3VN0 A;  4BRY B;  1CCH A;  5KJ7 C;  3II6 A;  2I8D A;  1BGY E;  2Z4E A;  1VQO P;  3Q3D A;  2JEE A;  1PV3 A;  3U59 A;  1C6R A;  3CPW O;  2JDI H;  1DW1 A;  2E75 B;  1EZV G;  2R3S A;  3CCV P;  3D70 A;  2YIU C;  1FZG A;  4W80 A;  1YQ4 C;  1KIB A;  1DT1 A;  1PPJ G;  1EXJ A;  4CPG A;  1IO3 A;  4ASW A;  1MZ9 A;  5E79 H;  1VQ5 P;  3RK3 C;  3B8E B;  2WTY A;  3Q5R A;  4RJT A;  1FI3 A;  3Q1M A;  3MHV A;  4WQE A;  1E5W A;  2OYH A;  4A7P A;  2I8F A;  1FU1 A;  1CYJ A;  5GTI V;  3B5N C;  5AW6 B;  5AW3 B;  5KKZ B;  1OW8 A;  3CCL P;  1VF5 B;  2PCB B;  1NTM G;  4U3F J;  2GC4 D;  1SQX E;  4Y28 J;  2B10 B;  3C1L A;  1OX3 A;  5H2F H;  1NTK D;  3L71 J;  1GL2 D;  1NU1 D;  2Z5H A;  1VQ9 P;  1L4A C;  1NTZ J;  1E79 H;  1HBW A;  1YBK A;  4K3A A;  1G1J A;  5KAF E;  1R5L A;  1M56 D;  2D2C B;  1SQV K;  3G6E P;  2YO2 A;  1U74 B;  4N78 D;  2A45 H;  3VYM A;  5EFW B;  2IX7 C;  1LTJ C;  3C8V A;  3L4M A;  1NVO A;  3G9R A;  4MN4 C;  3CX5 I;  1NAY A;  3BCC G;  3H1I D;  3ZIY A;  2NPS C;  3LIE A;  1W2L A;  2PAJ A;  3H1J D;  3RK2 D;  1FBM A;  2Q3E A;  2XND H;  2ZXX A;  4XFJ A;  2KLV A;  4I2L C;  5CCG D;  5APW A;  3H1L E;  5DJT B;  4N6J A;  3TYY A;  4D6T D;  3RBZ A;  2I1K A;  1C2R A;  3L74 J;  2OZ1 A;  1SQQ K;  1LTG C;  4QMA A;  3IAO A;  1PP9 E;  1COT A;  1HRO A;  1H0T B;  3L73 G;  4L73 A;  1E29 A;  2WPQ A;  2G8Y A;  3NBS A;  1SQP K;  4FA1 A;  3PRJ A;  5GTH E;  3CD6 P;  2FWL A;  4MU8 A;  5B6Q A;  1RY3 A;  1IK7 A;  4GKG A;  1IFI A;  2E75 D;  4PV1 C;  1N2D C;  2B87 B;  2LXC B;  1AV1 A;  1KYO E;  3O1Y A;  1GQ1 A;  1N9C A;  1X79 B;  1NJI Q;  5APY A;  3M9B A;  1PGJ A;  3M97 X;  1LTT C;  3WFB C;  2OYI C;  1H88 A;  1HJ3 A;  2YMK A;  2ZT9 D;  3RGU A;  3RN1 A;  3RBX A;  1L0L E;  1I8O A;  4Y99 C;  3CP5 A;  3L35 A;  3TF5 A;  1BCC D;  1OVV A;  1R5S A;  1VF5 D;  2C1D A;  3KZI E;  4I1L A;  2YCC A;  3H32 A;  1GU2 A;  1JTH A;  1RF1 C;  1CXA A;  3I56 P;  1YIJ P;  1CIF A;  1Y47 A;  3L37 A;  3PXS A;  3DR0 A;  2K88 A;  3TYI A;  1FJ0 A;  4RO0 A;  2N9B A;  3GHG C;  4DT0 A;  2P7J A;  1N90 A;  4H13 B;  1X0T A;  3L72 D;  1JY2 N;  2PRR A;  1DD4 A;  3A2A A;  5CIC B;  3FWN A;  1OW7 A;  1GL2 C;  2BAS A;  1HWT C;  1CCR A;  5KLV D;  3L74 E;  4GIF A;  1M8O B;  1J1E B;  2HYN A;  3MK7 C;  2QJK C;  5KAI E;  2IBZ D;  1T3U A;  3IFM A;  3EWK A;  4IL6 H;  1DVH A;  3O8Z A;  5AUR A;  3VNW A;  2YNY A;  1YCC A;  3KHU A;  1CXC A;  1VQL P;  2KUB A;  3AEF C;  3BAS A;  2QA4 P;  4AQR D;  3H1H J;  2GIW A;  2KXP B;  5CBO A;  5KAF V;  4XXL A;  3NWV A;  4R4L A;  1URQ C;  1SQB E;  2FXO A;  3RK2 C;  1SFC A;  3M0D C;  5C9M A;  2OTK E;  1FZE A;  1SQX G;  5CCG C;  1NTK G;  1BE3 E;  4NPD A;  4L74 A;  1FC2 C;  2CA4 B;  2W6J H;  1NU1 G;  1HF9 A;  3L75 J;  3AEE C;  1LJ2 A;  3GF7 A;  3E1I A;  3HUS A;  2ZYG A;  1M1J B;  2QG4 A;  5CID B;  2LXB A;  1IC2 A;  3A0B H;  3RN0 A;  3B4S A;  4C7N B;  1L0N E;  1X9V A;  3BCC J;  3M0A A;  3P8M C;  1L4A B;  1Q86 Q;  3H1I G;  1LT9 A;  3T97 A;  3S1K A;  3ORV A;  2FYU E;  3H1J G;  3L70 D;  2E75 C;  4N0K A;  1NKN A;  2G3A A;  4M3L A;  4N3Y B;  2POH A;  2Y0E A;  1OFC X;  3C9I A;  1LTJ B;  3M06 A;  3CCS P;  3CXH W;  2E76 B;  3CCU P;  1GDT A;  4H0L B;  3RL0 g;  1KIL D;  2VHD A;  1CHI A;  1NO4 A;  2NPS B;  3A0H E;  3L73 J;  1RE3 C;  1QL2 A;  3O0R C;  1C2N A;  1YNR A;  2A45 G;  1EZV E;  1JCD A;  1S5L X;  1K05 A;  1L0L K;  5KKZ C;  3CWB J;  1VF5 C;  2AXT H;  4H13 D;  3PTZ A;  1JUN A;  4PWA A;  2FYZ A;  4HKZ H;  1IRV A;  4Z1M H;  5B66 H;  3HD7 C;  5AVT B;  1AYG A;  1EB7 A;  1NHL A;  4QAO A;  1OAE A;  2D2C C;  5GTI H;  2NRG A;  1NTM E;  5KJ7 D;  3GLM A;  1KQL A;  3FXE A;  2M3E A;  3KZI V;  2K9J A;  3KPE A;  3JC2 2;  2WPV B;  3WFD C;  3SWS A;  1M6Z A;  1LTS C;  1LT1 A;  3FGA D;  3BVH A;  2H89 C;  2WSE J;  2Q6Q A;  1GL2 A;  5CHX A;  1GU4 A;  2H43 A;  1SQP J;  2YQB A;  4PV1 B;  2ZJS E;  1OWA A;  2BGV X;  4RES B;  1YTZ T;  1USE A;  2XZR A;  1S5L V;  4J20 A;  2O3J A;  5KTB A;  3MP7 B;  2R32 A;  3SVW A;  2WSF J;  3RK3 E;  2JKV A;  3TNU A;  4L75 A;  2Z5I A;  3CCQ P;  1CW5 A;  5AVR B;  5CJ0 A;  4WQ7 A;  1FDI A;  3VMX A;  3G71 P;  2FYN C;  1AJY A;  1MFZ A;  1CIE A;  1CI6 A;  3B5N D;  1KZU B;  2HOD A;  2KSJ A;  1LWU A;  1T2K D;  1S9K D;  1CED A;  1G2C B;  5TIS E;  1YTZ I;  3HTK B;  1RF1 B;  1H33 B;  1Q90 D;  1YIT P;  1KYO W;  1S4X A;  1JY3 P;  3SSU A;  5CCG A;  1L4A D;  5KLV G;  1VQN P;  5AVW B;  2B9B A;  3MUD A;  2MTA C;  1ZRT E;  2Q3I A;  1KX2 A;  2O1K A;  4L3H A;  1WMK A;  3A7O A;  1CYC A;  3JBT B;  1MG3 D;  4U7J A;  3WU2 E;  2E76 D;  4UB8 E;  1L9B C;  1SLQ A;  1QVF O;  2HG5 D;  3IF4 A;  2NPS D;  4H0J A;  1SQV D;  1A56 A;  4LLH A;  3MGN A;  4EDF A;  2P1J A;  1ZZH A;  2QJK B;  1SQX J;  1SQB G;  2QRX A;  1I6E A;  1N7S B;  2V7Q H;  3CI9 A;  5CIE B;  1H31 B;  3A9F A;  1SVF A;  3CC2 P;  3VRD A;  1BE3 G;  2CE0 A;  4AX3 A;  4WQ8 A;  1CSW A;  1LTB C;  3FX0 A;  2B0Z B;  1W5C E;  4UB6 H;  5KLI C;  4YE1 A;  1HRC A;  1URQ B;  3O6Q A;  2KI7 B;  3QWO C;  1DEB A;  1ZP0 C;  2P2U A;  4PJ0 V;  4JPZ B;  4ZKU A;  1T8Z A;  4V2K A;  5AVX B;  2OTJ P;  2YO3 A;  2CE1 A;  4EIE A;  2C8S A;  2KLU A;  4H13 C;  1ETP A;  1L0N G;  1RAQ A;  4GOE A;  1EZV I;  2ZYD A;  4I7Z B;  1YIQ A;  4PD4 H;  1IJD B;  4WQA A;  2E5Y A;  3Q5S A;  1J1D B;  1WRG A;  2FYU G;  1J1E C;  4PV1 D;  4DZO A;  1FZC C;  1JMM A;  3H1L J;  3CYT I;  1BDD A;  2BCC D;  5AW0 B;  1NTM K;  1RE4 A;  1FZF A;  2AIU A;  1R8E A;  2KK7 A;  1FDO A;  3IN6 A;  1CRG A;  1PP9 J;  2OTL P;  5BU8 B;  4WY4 B;  1RF0 A;  2WZ7 A;  3PLN A;  1QL4 A;  3CXH H;  1UII A;  2ZAE B;  1RQV A;  1RHZ B;  1N73 C;  2IDB A;  5CCH D;  2N1T A;  2N9I A;  5AVU B;  3A3Y B;  4PD4 D;  3W67 A;  5C0Z A;  3NFQ A;  3OA8 B;  4JF7 A;  1K73 Q;  1J2J B;  4AAO A;  1YJ9 P;  3H1K D;  2V07 A;  4OGQ B;  4WVZ A;  1R0Q A;  4HB1 A;  1Z56 A;  1T2K C;  1M1J C;  1XTG B;  1KB9 H;  5APS A;  3RL0 C;  1NTK E;  4WQB A;  3HE4 A;  2A06 D;  2IFN A;  1NU1 E;  3HD7 B;  1OVR A;  3JCU H;  1RZ5 A;  1L0L J;  1MG2 D;  2PAC A;  3CXH D;  1COR A;  1QKS A;  4FAV A;  1GKS A;  1XTC C;  5DFS A;  3NXS A;  4AAN A;  2QJY B;  4N78 E;  2RKL A;  3TGU D;  1YEA A;  5E79 E;  2FFD A;  2L91 A;  4AAM A;  2E76 C;  1IFN A;  3V5B A;  2KS1 B;  2DW3 A;  4H0L C;  3GF3 A;  4DJG A;  1CC5 A;  1P84 H;  3H1I E;  4AYC A;  1AOF A;  2J5U A;  2E74 B;  1URQ D;  1PGO A;  3H1J E;  1BDC A;  1KB9 D;  2B12 B;  5H2F E;  1LS9 A;  1LGH B;  1W5C T;  2ZYA A;  3AEA C;  2XNX A;  3NMD A;  2ZVO B;  3AEC C;  4UB8 V;  5CIF B;  5KLV J;  2C9L Y;  1L2P A;  2AXC A;  3OW2 O;  2FYN B;  5CMZ A;  1KIL A;  3EFG A;  1FJK A;  1CSV A;  3V6I A;  2CK3 H;  3WFC C;  5EXQ A;  1C7M A;  2B89 A;  3TK1 A;  3RMZ A;  2CPB A;  2OYH B;  1KYO H;  1P84 D;  3CME P;  4JYB A;  4GED B;  1I5T A;  1JCC A;  1N8R Q;  1JDL A;  4C46 A;  3M9H A;  1SQB J;  1HUC A;  1ZV8 A;  3FWL A;  4WY4 D;  1LFM A;  3HQ9 A;  1AFO A;  1VQ6 P;  1BE3 J;  1CSU A;  2P10 A;  4EIF A;  1NMI A;  4LC1 A;  5KJ7 A;  1LP1 A;  1BSN A;  1LC2 A;  2ZON G;  1VYD A;  2H8P D;  1IK9 A;  1JY3 O;  1PGP A;  1GW3 A;  1H32 B;  3AE9 C;  3PXT A;  4OGQ D;  1NML A;  1KTM A;  2P58 A;  2HLO A;  1BCC E;  1L0N J;  2ITA A;  4L3G A;  1KQF B;  3WUV A;  1I55 A;  1HGZ A;  4U3F D;  5CCH C;  3CX5 W;  1S5L H;  4FAN A;  2GB8 B;  3A5T A;  2ZZS 1;  2WSC J;  1JOC A;  3L71 D;  3HD7 D;  3LID A;  4EID A;  4FA4 A;  4H44 C;  2FYU J;  5KLI B;  5APQ A;  1MZ4 A;  1NTZ D;  4OVN F;  1GTW A;  1IFJ A;  2HPC A;  2UWJ E;  2HV4 A;  1KFN A;  2D2C D;  2YMY A;  4ZMD A;  1FZA A;  1H8A A;  2PCC B;  2OZ1 B;  4P4Q B;  3B5N A;  2BCC G;  3VMY A;  3L72 E;  3HQ8 A;  2ZXE B;  3AE7 C;  1SQX K;  1NKZ B;  1GD2 E;  1DW0 A;  1HGV A;  2QM8 A;  3AE4 C;  1NOH A;  3WUT A;  1BL9 A;  3VP8 A;  5KLV E;  1NU1 K;  2WMM A;  4C7N A;  4HYT B;  1BSH A;  1L4A A;  5B5E H;  2BEQ D;  2IBZ E;  3B71 A;  1FZC B;  2OQQ A;  4KHX A;  1A02 J;  3GG2 A;  1N7S C;  5AW9 B;  4XA4 A;  2WT7 B;  1MKM A;  1LTI C;  1Y9B A;  4IFM A;  3SWK A;  1B7V A;  1LTJ A;  1K8A Q;  3H1K G;  1S1C X;  1A02 F;  2P67 A;  5TJH A;  1NTM J;  2NPS A;  1S2E A;  2QE7 H;  3CCR P;  1ZLL A;  1E8E A;  2L4D A;  1N73 B;  2M5A B;  3P8C D;  2PGD A;  3VYI A;  4LJI A;  3BRT B;  3D0W A;  4Y5R A;  1RAP A;  4I7Z C;  1I54 A;  2JO1 A;  4HJG H;  5CBN A;  4IL6 E;  1GU5 A;  3H32 B;  3W68 A;  1JTH B;  1U7M A;  1J1D C;  4GOF A;  3AE8 C;  3CC7 P;  1Q82 Q;  3TGU G;  4TLF A;  1LTA C;  4PJ0 H;  1DX7 A;  3AED C;  3RL0 B;  1H9Y A;  1ZR4 A;  3ZCF A;  1LNQ A;  2A45 I;  351C A;  2Y0D A;  2RH0 A;  1JNM A;  1LMS A;  1HH7 A;  4WY4 C;  3SFE C;  4W7Y A;  3L70 E;  1CHH A;  2M3B A;  5GTH V;  1CNO A;  3E7K A;  2K3R A;  3L4O A;  1VQP P;  1KIL E;  3V2R A;  2LR2 A;  3UIA A;  3OCD A;  3N7N A;  4D6T G;  2KB7 P;  3P32 A;  1CZQ A;  1A8C A;  3IR9 A;  5AVS B;  451C A;  3A0B E;  2OYI A;  3ZOY A; 
#chains in the Genus database with same CATH homology
 1A56 A;  1NU1 D;  4EDF A;  1H9X A;  1ZZH A;  2QJK B;  1I6E A;  2QJP B;  1F1C A;  3WFE C;  1CRH A;  5CIE B;  1H31 B;  3A9F A;  1NIR A;  3TDK A;  1U74 B;  3VRD A;  5DJQ B;  4Q5P A;  2B11 B;  4H0K A;  3VYM A;  3L4M A;  2CE0 A;  4AX3 A;  4WQ8 A;  1L9J C;  1CSW A;  2B4Z A;  2B0Z B;  1C52 A;  4YE1 A;  1HRC A;  1N50 A;  3H1I D;  3ZIY A;  1PPJ D;  1W2L A;  2JQR A;  4PJ0 V;  1QN2 A;  4V2K A;  1KX7 A;  1FOC A;  3H1J D;  1FI7 A;  2Q3E A;  2CE1 A;  4WQD A;  4EIE A;  1C6S A;  3L74 D;  2C8S A;  1A2S A;  1ETP A;  3DP5 A;  1RAQ A;  3H1H D;  2JTI B;  1U75 B;  1YIQ A;  1GDV A;  5E79 V;  4FA9 A;  4D6T D;  3PXW A;  4WQA A;  1C2R A;  2OZ1 A;  1M60 A;  2LIR A;  1COT A;  1HRO A;  3NBT A;  3CYT I;  2BCC D;  2BH4 X;  1DII C;  1E29 A;  1H31 A;  2YIU B;  2AIU A;  2N9J A;  2C1D B;  3NBS A;  1KB0 A;  4FA1 A;  3PRJ A;  1SQB D;  2JWA A;  4NFG B;  3L75 D;  5H2F V;  2FWL A;  1WEJ F;  1CRG A;  2D0S A;  4L1Q A;  4MU8 A;  5B6Q A;  1DVV A;  5KAI V;  2EXV A;  2N18 B;  1BE3 D;  2N3B A;  1CSX A;  3PLN A;  1QL4 A;  4GYD A;  1M70 A;  1K3H A;  3O5C A;  1DW2 A;  2ZXY A;  3BCC D;  1YTC A;  2N9I A;  2BCN B;  4PD4 D;  3O1Y A;  5C0Z A;  1GQ1 A;  3OA8 B;  1N9C A;  2RN0 A;  1K3G A;  4AAO A;  3M97 X;  3H1K D;  1L0N D;  3WFB C;  2C9X B;  2V07 A;  1AKK A;  1HJ3 A;  1R0Q A;  3RN1 A;  1I8O A;  2ORL A;  3PHL A;  3CP5 A;  3TF5 A;  1BCC D;  2FYU D;  4WQB A;  2A06 D;  5CYT R;  1GJQ A;  2C1D A;  2BPB B;  4IL6 V;  2K9J B;  3L73 D;  3DMI A;  2YCC A;  1GU2 A;  3CX5 D;  1CXA A;  5CIG B;  1RZ5 A;  1MG2 D;  2PAC A;  3CXH D;  1CIF A;  1COR A;  1QKS A;  1F1F A;  4FAV A;  1GKS A;  3PXS A;  5DFS A;  3DR0 A;  3HQ6 A;  4AAN A;  1NNO A;  5CIH B;  2QJY B;  3TYI A;  3CWB D;  1FJ0 A;  3TGU D;  1YEA A;  4PW9 B;  2L91 A;  1H33 A;  1N15 A;  4AAM A;  1EZV D;  1N90 A;  1C6O A;  3L72 D;  4KMG A;  4K3I A;  1DW3 A;  1CC5 A;  4FA5 A;  5CIC B;  1AOF A;  1CO6 A;  1HZV A;  2BH5 X;  1CCR A;  5KLV D;  4DY9 A;  1KB9 D;  2B12 B;  1LS9 A;  5CIB B;  1FI9 A;  1W5C T;  1CYI A;  3MK7 C;  3SJL A;  1SQQ D;  1CHJ A;  2IBZ D;  1DVH A;  3A0H V;  4UB8 V;  5CIF B;  5AUR A;  3VNW A;  1QL3 A;  1YCC A;  1YEB A;  1CXC A;  2N9Y B;  3KHU A;  1NTM D;  2FYN B;  1SQP D;  1CSV A;  4XYD B;  2GIW A;  4JCG A;  5KAF V;  4XXL A;  3WFC C;  5EXQ A;  1C7M A;  3NWV A;  2D0W A;  3RMZ A;  3VMA A;  1FCD C;  5IY5 1;  5DF5 A;  1I6D A;  1C75 A;  1P84 D;  5C9M A;  4GED B;  1I5T A;  3OCD B;  2YK3 A;  2V08 A;  3ZBM A;  1JDL A;  2DGE A;  2CA4 B;  2MHM A;  3FWL A;  3ITK A;  1YFC A;  1LFM A;  3HQ9 A;  1BGY D;  1CSU A;  4EIF A;  1NMI A;  2QG4 A;  1QYZ A;  5CID B;  3RN0 A;  3PH2 B;  2XTS B;  2LIT A;  1IRW A;  1LC2 A;  4WQ9 A;  2DVH A;  2ZON G;  1VYD A;  3WC8 A;  2AXT V;  2ZBO A;  1H32 B;  3PXT A;  1NML A;  5B66 V;  3ORV A;  2N18 C;  4L3G A;  2GC7 D;  5B5E V;  1I55 A;  3L70 D;  4N0K A;  4U3F D;  3ZOX A;  2Y0E A;  1ZRT D;  3CX5 W;  3HQ7 A;  4FAN A;  3CU4 A;  1CTJ A;  3CXH W;  2GB8 B;  3X39 A;  2ZZS 1;  3L71 D;  4EID A;  2VHD A;  1HCM A;  4FA4 A;  1CHI A;  5KLI B;  1MZ4 A;  1NTZ D;  1CRC A;  1WVE C;  2BLF B;  1SQX D;  2C2C A;  5TIS V;  2HV4 A;  1OCD A;  1CRY A;  3O0R C;  1C2N A;  1YNR A;  2PCC B;  3WUI A;  2OZ1 B;  1I8P A;  4P4Q B;  1CRI A;  3HQ8 A;  1GIW A;  3MK7 B;  4WQC A;  4O1Q A;  4O1W A;  4FB1 A;  3OA8 A;  1DW0 A;  2C1U A;  3PTZ A;  1BL9 A;  3SLE A;  4PWA A;  3C2C A;  1IRV A;  1CTY A;  3ZOO A;  1KV9 A;  1AYG A;  1H32 A;  2N3Y A;  1EB7 A;  2CXB A;  3WU2 V;  1CTZ A;  4QAO A;  1OAE A;  1HJ5 A;  4EIC A;  1RZ6 A;  3GG2 A;  3A0B V;  2FRC A;  5DJQ C;  3KZI V;  1B7V A;  1HJ4 A;  2KNC B;  1CRJ A;  4AAL A;  3GW6 A;  3WFD C;  3SWS A;  1M6Z A;  1S6V B;  5TJH A;  1H1O A;  1IZL 0;  3RLM A;  1AOQ A;  1E8E A;  2L4D A;  3H1L D;  2YQB A;  2BGV X;  1S5L V;  4J20 A;  4LJI A;  2O3J A;  1YIC A;  2KS1 A;  3SVW A;  1CCH A;  1PP9 D;  4Y5R A;  1RAP A;  1CIG A;  2C1V A;  1I54 A;  1FHB A;  4WQ7 A;  1J3S A;  2Y0C A;  2AI5 A;  1CIE A;  1C6R A;  4RSZ A;  1DW1 A;  1H9Y A;  3ZCF A;  1CED A;  351C A;  1LC1 A;  1KIB A;  2Y0D A;  1H33 B;  3SXT A;  1DT1 A;  1KYO W;  1IO3 A;  1LMS A;  1HH7 A;  1KYO D;  1E2R A;  2CA3 B;  2MTA C;  4RJT A;  1FI3 A;  1DIQ C;  4WQE A;  155C A;  1CHH A;  3ZOW A;  5GTH V;  1CNO A;  4A7P A;  1KX2 A;  4UB6 V;  2I8F A;  1CYJ A;  5GTI V;  4L3H A;  3L4O A;  1CYC A;  3JBT B;  3OCD A;  2RMZ A;  5KKZ B;  1MG3 D;  1HZU A;  2PCB B;  2GC4 D;  1L0L D;  1CIH A;  1IQC A;  2B10 B;  1A8C A;  1L9B C;  3O20 A;  1NTK D;  451C A;  4H0J A;  1SQV D;  3ZOY A;  2ZOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...