3TGUD

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3tguD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3tguD02
1ZRTD 1H31A 1M6ZA 2KS1A 3HQ7A 1FI3A 2QJYB 4PJ0V 1JDLA 1F1CA 2CE0A 5CYTR 1DT1A 3HQ9A 2CXBA 1L9JC 1QN2A 3CYTI 1DW1A 4GYDA 5KAFV 2DGEA 1OAEA 2Y0EA 1OCDA 3L72D 1CTYA 2HV4A 1I8PA 3M97X 1BE3D 4UB8V 4EIEA 1FI9A 2FYUD 4P4QB 1CORA 3HQ8A 3ZOWA 3VRDA 1H9YA 2N3BA 5DF5A 2C8SA 1YFCA 3A9FA 1GQ1A 3NBTA 1DW0A 3JBTB 4H0KA 1KIBA 1KYOW 3O5CA 5GTHV 1U75B 1CRHA 5CICB 1EB7A 2PCBB 1LS9A 3OCDB 3X39A 4AAOA 4WQ9A 1KB0A 1ZZHA 1RAPA 4PW9B 2CE1A 2BH5X 4FA5A 1FI7A 1AOQA 1YEBA 1HRCA 4WQBA 1HJ3A 1IQCA 2B4ZA 1GKSA 1DW3A 2QG4A 2ZBOA 1BCCD 1CSUA 4EIFA 1IO3A 1CTZA 3WFBC 5CIGB 1P84D 4AAMA 5DFSA 3WFDC 3WU2V 3ZOYA 1KYOD 1DVHA 3A0BV 1EZVD 5CIDB 1SQQD 2B10B 1CC5A 1QKSA 1KV9A 2AIUA 2N9JA 4RJTA 2OZ1A 2Y0DA 1FHBA 1AOFA 2DVHA 1QYZA 2YCCA 2CA3B 1AKKA 1RZ5A 1E2RA 3NWVA 2FWLA 1QL3A 3BCCD 1CSVA 1COTA 1HJ4A 2QJKB 1LC1A 4FAVA 4EDFA 4IL6V 1H31B 2VHDA 4U3FD 1J3SA 2KNCB 3FWLA 5H2FV 3PXTA 4MU8A 4WQEA 1RZ6A 1L0ND 1SQXD 5C0ZA 3PHLA 4FA1A 1NU1D 2K9JB 2ZONG 2AXTV 5KLVD 4FA4A 1C6OA 1CIGA 3H1JD 3ORVA 1N90A 3ZCFA 5KLIB 2A06D 1KX2A 3PXWA 1I8OA 1CYIA 1F1FA 2LITA 2N18B 1I6DA 1C2RA 1HROA 3RN0A 1CHHA 3GG2A 1C6SA 1A56A 1S6VB 1L0LD 1MG3D 1H1OA 1SQVD 1GIWA 2C1UA 2N18C 3RN1A 1C2NA 1PP9D 1M70A 351CA 1LFMA 3H1KD 1RAQA 2N9IA 2D0WA 4FB1A 3CU4A 1H32A 2XTSB 1KB9D 4RSZA 1SQPD 3CXHD 4UB6V 1CSXA 3L71D 1NMIA 4AALA 5TJHA 155CA 4Q5PA 4WQAA 2MTAC 2C9XB 3ZOXA 1YICA 2ORLA 2C1VA 2B11B 1FJ0A 5EXQA 1HZVA 5CIEB 1I5TA 3O20A 2GB8B 3L4OA 4PD4D 2CA4B 1PPJD 2OZ1B 4WQDA 2GIWA 2BCCD 4XYDB 3CP5A 1QL4A 3RLMA 3TF5A 1YTCA 1DIQC 2ZXYA 1VYDA 4FA9A 1IRVA 4H0JA 5CIBB 1IZL0 1BL9A 1K3HA 1GU2A 1CIFA 3DMIA 1CO6A 5B6QA 5DJQB 1CRYA 4DY9A 3TGUD 3C2CA 3L4MA 3ZBMA 1KX7A 4O1QA 3O0RC 2BCNB 2RMZA 4EIDA 1H33A 4PWAA 5DJQC 3L75D 4GEDB 2BH4X 2C1DA 1CXCA 3ITKA 3OA8A 3A0HV 1C6RA 4K3IA 1HH7A 3TDKA 1NNOA 2ZOOA 3H1HD 2GC4D 2C2CA 1ETPA 3SLEA 5CIFB 1DVVA 4L3GA 3H1ID 3SWSA 1H32B 2Q3EA 4JCGA 2V08A 3SVWA 3O1YA 4AX3A 4XXLA 1IRWA 2B12B 1MZ4A 1CYCA 3SJLA 1W2LA 2FYNB 1NTMD 1CXAA 1E8EA 3PTZA 1I55A 3VYMA 1DW2A 1AYGA 2MHMA 1FOCA 1CYJA 1CRJA 4QAOA 1N15A 1B7VA 1S5LV 4Y5RA 4YE1A 5E79V 3KZIV 2RN0A 1LC2A 2EXVA 3PXSA 4FANA 3H1LD 1N50A 3KHUA 3ZOOA 5KKZB 3GW6A 1WVEC 1NIRA 4V2KA 4A7PA 2LIRA 2AI5A 5TISV 1CEDA 1NTZD 2IBZD 3DP5A 1CRCA 1YNRA 2L91A 1W5CT 5B5EV 3VMAA 4EICA 4J20A 1CHIA 2D0SA 1C7MA 3CX5W 1A8CA 1L9BC 1CNOA 1CCRA 3L73D 3SXTA 2JQRA 3TYIA 3WC8A 1YCCA 2YK3A 4O1WA 1NMLA 1C52A 1HJ5A 1HCMA 4N0KA 1BGYD 2BPBB 3HQ6A 1CRIA 4WQCA 1CRGA 5GTIV 3PRJA 1K3GA 5IY51 1H33B 3PLNA 3NBSA 4L1QA 3PH2B 1NTKD 2C1DB 1GDVA 3OA8B 2YIUB 5AURA 3L70D 2YQBA 3WFEC 1MG2D 1CSWA 2GC7D 2N3YA 1CIEA 2BLFB 1CTJA 5CIHB 2V07A 4WQ8A 3CX5D 5KAIV 2L4DA 2BGVX 4LJIA 2O3JA 1CCHA 3OCDA 3DR0A 4L3HA 4KMGA 1R0QA 2PACA 1FCDC 1YEAA 5B66V 2FRCA 1N9CA 4WQ7A 2B0ZB 3VNWA 2JTIB 2N9YB 1YIQA 1CIHA 2QJPB 1U74B 3MK7B 3ZIYA 2ZZS1 1A2SA 3CWBD 2I8FA 3L74D 3RMZA 4NFGB 1CHJA 5C9MA 3WFCC 1H9XA 2PCCB 3WUIA 1GJQA 2Y0CA 1DIIC 1I6EA 451CA 1E29A 3MK7C 1HZUA 2JWAA 1I54A 1M60A 1C75A 1SQBD 1WEJF 1LMSA 3CXHW 4AANA 4D6TD
chains in the Genus database with same CATH superfamily
3TGUG 3HQ7A 1N7SC 1Q2NA 1LT1A 1EZVI 2KSEA 3H32A 1L9JC 1QN2A 1OVUA 3D6YA 4GYDA 2FYUJ 3L75G 1OCDA 3PJSK 2KB7P 1FAVA 1A02F 1GTWA 5KAIE 1SQXG 2Y9ZA 3BRVB 4UB8V 1FI9A 1CORA 3ZOWA 3VRDA 1H9YA 4GDOA 4WWIA 3JBTB 3A9FA 2ZYAA 1DW0A 2P7JA 4N78E 5AW5B 4OH8B 2KOGA 5GTHV 1Q82Q 2KSJA 1CRHA 1J1EC 1LTBC 5CICB 2YMYA 1EB7A 2E5TA 1NTMG 3AE6C 3VMZA 1BCCJ 2POHA 4R4MA 4AAOA 1HJ3A 1SQQJ 1YHQP 2R5DA 2B87A 1GK4A 2ZBOA 4WY4D 1IO3A 1RH5B 3L75E 1FZCB 2KLUA 3O6QB 1SQXK 1KFNA 3WFDC 3WU2V 3CC4P 1DIPA 2WVRA 2B10B 2WSFH 1AA0A 2PGDA 1FZCC 3CMEP 4RJTA 1PV3A 3R4YA 4PJ0E 2OZ1A 2DVHA 2AEMA 2CA3B 1AKKA 1RZ5A 4KHXA 3BCCD 3USSA 2HODA 1L0NJ 1CSVA 1NU1J 1LC1A 4FAVA 4IL6V 3NFQA 3H1JJ 1NTME 1D7MA 3FWLA 5H2FV 1K04A 1N73C 2QJPC 1SFCA 5C0ZA 2ZT9C 4PD4I 2ZONG 4HH2A 2AXTV 4D6TJ 3A7OA 1X79B 1CIGA 3ORVA 1N90A 1EXIA 1X8YA 1AQTA 2YXQB 5KLIB 1L0LJ 2A06D 1SQVJ 2CPBA 4WY4B 5APWA 1F1FA 1T3UA 2N18B 3CLQA 3AE5C 3L72E 1HROA 1PP9J 1MFTA 1HWTC 1MKMA 1NTZE 2ZAEB 3NMDA 3GG2A 1N86A 1S9KD 1L4AC 2Z4EA 2N18C 2MJZA 1KTMA 4BRYA 1ZV8A 1H0TA 2YNYA 3V2PA 2ZVOB 3CU4A 2WPQA 4NPEA 1PIXA 2XTSB 1SQPD 4BXLA 2HYNA 3CXHD 1BGYE 4AALA 1A02J 3OAKA 1KC8Q 3BRTB 2K37A 2XKMA 1VQNP 2MTAC 1N7SA 5AW3B 2C9XB 3KPEA 4Y99C 2FY8A 3PH0A 3CCMP 5EXQA 2M5AB 1I5TA 1W2BO 3O20A 1Y8AA 1BDDA 3T97B 2LXCB 3CX5E 1KQLA 4DCKA 1FZAA 3CC7P 4XYDB 1S1CX 4I2LC 1YQ3C 1M8OB 3F89A 1YJ9P 1ZOYC 2N1TD 3MHVA 1RF1B 4N78D 1YTCA 2NPSA 1VQOP 1DIQC 2Z5HA 1IZL0 3BCCJ 1BL9A 3RK3C 2J5UA 1CIFA 4W7ZA 3CWBE 5DJQB 1CRYA 3TGUD 4L74A 2C9NY 3C2CA 3L4MA 1H89A 4OGQC 4EIDA 2OYIB 1H33A 5DJQC 3L75D 5KJ7C 1CXCA 1C6RA 5EFWB 1JY3O 1PGPA 3TNUB 1HGVA 2QJKC 1S5LH 2IZ1A 2K1AA 5E79H 2C2CA 1VPCA 3SLEA 1RF0C 4L3GA 2FXMA 1BDCA 2A45H 4JCGA 5B5EE 2N1TB 1MZ9A 1CYCA 3SJLA 2E74D 1W2LA 1NTMD 1SQQG 1PFIA 2W6AA 1I55A 1N73A 1DW2A 3H1LJ 2FYUE 1IK9A 2CPSA 1URQD 3HE5B 2RN0A 5GTIE 1CI6A 5AVQB 3S1KA 3CCRP 1T3JA 4W7YA 1PGQA 1JY2N 3ZOOA 1GU4A 3CXHH 1NIRA 4V2KA 3CMAP 2JR8A 1NTKK 5TISV 1PGOA 1NTZD 3DP5A 4PD4E 4Z1MH 1NU1G 3NXSA 3GMAA 1L4AA 3VMAA 4EICA 4J20A 4I6MC 1BCCE 2D0SA 4JYBA 3CX5W 3CD6P 1R8EA 5KAIH 3UIAA 1KQSO 2Q6QA 3JSVC 2JQRA 4D6TG 3WC8A 4YXWH 1YCCA 2PAJA 4O1WA 2QRXA 2E74B 1BGYD 3RL0g 2IFMA 5AVUB 1CRIA 1LP1B 1RHZB 3HD7D 2XU6A 1CRGA 1K3GA 3I56P 3PLNA 1M90Q 1UIXA 2C1DB 1WRGA 5CJ0A 1DH3A 3V2NA 1URQB 2N3YA 1CSWA 2GC7D 1HVVA 1JCCA 1CTJA 2V4HA 2BEZF 3CX5D 2L4DA 5AW2B 3TSIA 2W27A 2BGVX 3AE3C 3G3ZA 1L0NE 2O3JA 1K9MQ 1LT9B 1HJ0A 1NU1E 1YTZI 5KLVE 3H1JE 3MUDC 2WPRA 3AE9C 4EOTA 2PACA 1GU5A 2KYVA 2NZ2A 1FCDC 1GL2D 2H89C 3L74J 4JBZA 1YEAA 2KZIA 4YTPC 1PGJA 1PPJG 4OWFA 2FFDB 2Q1KA 2ZZS1 3CWBD 4PJ0H 4H44D 1L0LE 1GK6A 1SQVE 5DJTB 1SQBJ 2PCCB 3RL0C 3HD7B 2Y0CA 3AE2C 1LWUB 1PP9E 1HZUA 2ZXEB 2M3EA 5KJ7A 1AQ5A 5GTHE 1M60A 3HTKA 1CSBA 1WEJF 1MV8A 3G9RA 1IJDB 3E1IA 1KZUB 3D71A 1H31A 2WSEH 2KNCA 3L72J 4K3AA 2KS1A 2QJYB 1KYOI 1RF0A 3BCCG 5CYTR 3HQ9A 1EQ7A 1DW1A 5CHXA 3M06A 2QJYC 3QWOC 1I8PA 1GL2B 3MTUE 3V4QA 3M97X 1PPJE 3L73E 3AEDC 3L36A 4EIEA 2HPCB 2FYUD 5DF5A 4H44B 2C8SA 4R4LA 1GQ1A 4H0KA 1GZLA 1KIBA 2A06G 3GLMA 2A45G 5CCHC 3O5CA 1OW7A 1U75B 2KLVA 5B66E 1USDA 4CPGA 4GODA 5AW1B 2E75D 3OCDB 1ZW0A 2XNXA 4L75A 1ZZHA 5H2FE 1HRCA 4LLHA 1OVRA 1JMMA 1DW3A 1BCCD 4EIFA 2AXTE 5CBNA 1CTZA 1NAYA 3MIWA 3RBXA 1KILC 3CI9A 1K73Q 1SQPG 3CX5H 4AAMA 3C9IA 1EDLA 1SQQD 3EWKA 1KV9A 3SWYA 2IBZG 4K35A 1VQ9P 1Y47A 4JQ0D 3CWBJ 1FHBA 3VMXA 1KB9I 3MGNA 1QYZA 4U3FJ 1DX7A 3NWVA 1E2RA 4HKZH 5KAFE 1M1JA 3E1RA 1U57A 1AV1A 3NTNA 2KK7A 3A2AA 4WQEA 1OWAA 1L0ND 1FU1A 1CW5A 1NU1D 2K9JB 2WT7B 1JTHB 5KLVD 4FA4A 3A5TA 3H1JD 3EQ2A 2YKOA 3MUDA 1SQPK 3PP5A 3AEBC 2V7QJ 3LW5J 1G2CB 3H1LE 3V6IA 2SPZA 3B71A 2KUBA 2HG5D 3PXWA 1CYIA 4I7ZC 2C0WA 2E76C 1NKNA 1AVOA 2IBZE 2QM8A 1FE6A 2RKLA 3H1KJ 1C6SA 3K5BA 1L0LD 3ABVC 1SQVD 2WSCH 4ASWA 2C1UA 5B5EH 1QGKB 1RE3C 1M57D 1PP9D 2IPPA 2FBWC 1LFMA 1RAQA 3L71J 1OVVA 3B5NB 3A0BE 1AFOA 2YMKA 2YKPA 2K9YA 3FWNA 1J1DB 3I5CA 1N2DC 4WBAA 155CA 4Q5PA 1FDMA 3B5NC 1QVFO 1T2KD 2KI7B 1YICA 3WUUA 2C1VA 2B11B 4AYCA 4GOEA 2KXPB 4U7JA 2GB8B 1SQBG 1PPJD 2GIWA 5CCGC 4OVNF 4GIFA 3MZWB 3CP5A 3SSUA 2CK3H 3A0HH 5CCHA 2ZXYA 3A3YB 3L72G 1IRVA 5CIBB 1RE4C 1NTZG 5AW6B 2WWWA 3BVHA 1NYHA 1EXJA 1CO6A 1KD1Q 4DY9A 3L74E 2E5YA 5K5GB 2PP6A 2QVAA 3ZBMA 1KX7A 1NTMK 2OTLP 1AVYA 1HUCA 5KLVJ 3IFMA 4GEDB 1KILA 5AVXB 3OA8A 3P32A 1SQBE 2OYHB 1BGYG 1JEKA 1Y9BA 1R5LA 1HH7A 4UB6E 4C7NB 3H1IJ 4N6JA 3U1CA 3BATA 5TISE 3GHGB 1DVVA 1IFIA 2R44A 1H32B 1NTZK 1IRWA 5AW0B 5KLIC 2FYNB 1BE3E 1BSNA 4WY4C 1E8EA 3PTZA 3VYMA 4MN4C 1AYGA 2XNDH 4L73A 4ZNCA 1HH0A 1QL2A 1S5LV 1DD3A 1LTJB 3B4SA 4Y5RA 1YI2P 4ZKPA 5E79V 5L8RJ 2EXVA 3H1LD 1J2JB 3KHUA 1HTLC 1WVEC 1EDJA 3CWBG 2QIWA 1OZHA 2IBZD 1S4XA 1QEXA 1KORA 1FBMA 1YNRA 3OJAB 4DOJA 3L73J 3HE4A 1W5CT 1JY3N 1IFPA 1RE3A 1LJ2A 1C7MA 1L9BC 2H7HA 1P84E 2WITA 1EDKA 4RESB 4JPZB 1YJNP 1EZVE 3HUSB 1NAFA 3L70J 1C52A 1IFMA 5AVTB 2OQQA 1YBKA 2P10A 3HQ6A 2QM7A 5APXA 2JP3A 3NBSA 4L1QA 3PH2B 2ZYGA 4C7RA 2D2CD 1IFNA 5B66H 4EI2A 3HUSC 2YIUB 3WFEC 1MG2D 3FX0A 3W67A 1KFMA 2BLFB 1RF1C 4B86A 4WB4A 2V07A 1R5SA 2YXRB 4WQ8A 1DD4A 1PL5A 5KAIV 2FYUG 4U3FE 2Q3IA 2YIUC 2AEFA 1OW8A 3KZIE 1YJWP 2AXCA 2M0BA 4HYTB 1VQMP 4ZMDA 3AEGC 1N9CA 4WQ7A 3TK1A 2B0ZB 1WMKA 2OYIC 2JTIB 1JM0A 1RE4A 1U74B 2ZJSE 1FZCA 5AW7B 3O6QA 3ZIYA 2I8FA 3L74D 4QMAA 4NFGB 3WFCC 1NVOA 1H9XA 5KAFH 1BCCG 1JY2P 3WUIA 1GJQA 2W6BA 451CA 1E29A 2JWAA 2OYOA 4ZKUA 1N8RQ 3H1KE 2D2CB 2OARA 2FYUK 1SQBD 4IOIH 2N1TC 1LMSA 1KQFB 2O1JA 2J59M 1XTCC 2LXBA 2D2CC 3L71E 1M56D 1M6ZA 1FI3A 4PJ0V 1F1CA 2G8YA 3VTPC 1DT1A 3CYTI 1K05A 2I1JA 2WPVB 1NWQA 2DGEA 5CBOA 3L72D 1CTYA 2HV4A 1LTIC 1L0NG 1BE3D 1YQ4C 1LTAC 4WY4A 3JCUE 5KLVG 3AE4C 1FJKA 2BCCE 3H1JG 5BU8B 5CMZA 2N3BA 1HBWA 4YXDC 1SQQK 2HLOA 3A0BH 5AVZB 1NKZB 1JB0J 4NPDA 3Q5PA 3LIDA 2IYPA 2R32A 2JDIH 1L0LG 1VQ7P 1SQVG 2Y9YA 1KQGB 1KV4A 4WQ9A 1NH4A 2A45I 1RAPA 4FA5A 2W6JH 2LR2A 1YEBA 1PP9G 2E74C 4WQBA 4M3LA 3M0DC 2FYZA 3S9OA 5AVWB 1VQPP 5CIGB 1P84D 2ITAA 1L0NK 3WUTA 1URQC 5APVA 5AW4B 2IDBA 2WMMA 1NU1K 3IR9A 1EZVD 1IZNB 5CIDB 5KLVK 2M5AA 1U7JA 1QKSA 4XFJA 4N3YB 1S72P 3O8ZA 3CCVP 3T97A 3TYYA 3C1LA 3CXHI 1UIIA 2YCCA 3P8MC 1LT9C 5AVYB 1YYCA 2FWLA 1CZQA 3H1IE 3OW2O 2VRSA 3Q5SA 1COTA 1L0LK 1RF1A 3L73G 1SQVK 4EDFA 2VHDA 4U3FD 1J3SA 4UB8E 1RQVA 2QSIA 3IN6A 3H32B 1FJPA 2WTYA 2FFDC 4FA1A 2XDJA 1JUNA 1C6OA 2C9LY 2UWJE 3SFDC 2R3CA 1YIJP 3L70G 3HD7C 1LWUC 4UB6H 1I8OA 4JF7A 2OYIA 2JWDA 1I6DA 1C2RA 1NGMB 1VQLP 3RN0A 1CHHA 1G1IA 1A56A 5DJUB 1BE3J 2O01J 1H1OA 1T8ZA 1Q7YQ 5M1BA 3TNUA 2YKQA 1GIWA 3M91A 5APTA 3RN1A 1C2NA 2P1JA 2B88A 3M9QA 4IL6X 1X9VA 3GF3A 3H6PA 3H1KD 1SFCD 2D0WA 4FB1A 2O01H 3WU2E 2I1KA 1MUUA 4RSZA 2N1TA 4IFMA 1GL2C 1CSXA 3L71D 2B87B 5TJHA 3LIEA 2Q5UA 3WUVA 3G71P 1ZR4A 2E42A 3ZOXA 1SLQA 2ZXXA 3SWKA 4C46A 3L70E 4H44C 3HE5A 1FJ0A 3H25A 1HZVA 5CIEB 1SP4A 4RKUJ 3AEAC 3L4OA 4IL6E 4PD4D 3FXEA 1JOCA 1VF5D 2BASA 2OZ1B 3VP9A 4WQDA 2OGUA 4BWNA 2BCCD 2QEXP 3CPWO 1PZQA 1S5LX 2HODB 3RK2D 1QL4A 3H1LG 1NHLA 1P84H 1HF9A 4XA4A 2O01N 1VYDA 1N7SD 3D0WA 1SFCB 4H0LD 1GU2A 3DMIA 3AECC 5B6QA 1KN7A 3U1AA 1JMBA 4I1LA 4O1QA 1LP1A 1X22A 3M0DA 2BCNB 3H1HJ 4WVZA 4EYYQ 5BU5A 2C1DA 3GF7A 1LTTC 3A0HV 1URQA 1X0TA 4K3IA 2E75B 1DEEG 3D70A 1OXZA 2NPSD 2GC4D 1VF5B 3KZIH 1ZRTE 1E79H 4BRYB 1H0TB 2E75C 3RK3E 3H1ID 1LT9A 2JO1A 2Q3EA 3RGUA 2V08A 2IYOA 3SVWA 3RK2B 5APSA 2B12B 2GUSA 2N9BA 2V7QH 3LW5H 3Q1MA 2P2UA 1GMJA 3KXDA 1N7SB 4H0LB 2MHMA 1FOCA 2R3SA 1CYJA 2R5BA 1CRJA 1N15A 2FFDA 3CXHE 5AVVB 3CX5I 4IFDK 3RBZA 2YO3A 3AEFC 3PXSA 4FANA 3MP7B 4H0LC 3HD7A 5KKZB 3GW6A 1LWUA 1QLED 3L74G 4A7PA 4AUWA 2LKMA 5GTIH 1CEDA 2ZYDA 1CRCA 5KKZC 2K88A 1J1DC 2NPSB 2H8PD 1IFDA 2BCCJ 1M1KQ 1J1EB 1A8CA 1LTGC 1CNOA 4PD4H 1CCRA 2Q7CA 3L73D 1VQ8P 2W8ZA 2ZT9D 2NPSC 1NTKJ 1KYOE 3TYIA 3JCUH 3V5BA 2YK3A 1NMLA 4N0KA 1HCMA 1GL2A 2BPBB 4WQCA 1ZN5A 4RO0A 3PRJA 5IY51 1H33B 3AE1C 1FZGA 4DT0A 2HPCA 3TGUE 2W90A 3L70D 2IX7C 2YQBA 1CIEA 1L2PA 5CIHB 2WSFJ 1JNMA 1BE3G 1L4AD 4H13D 4LJIA 1SQXE 1E5WA 3OCDA 1SQBK 4L3HA 1Z56A 1OFCX 5AW9B 4L76A 5B66V 3VNWA 2N9YB 3M9HA 1N73B 1CIHA 2QJPB 1T2KC 3CCUP 1NJIQ 2ZT9B 2J58A 3MK7B 1A2SA 2OYHC 1VL2A 3Q3DA 2C0XA 1CI6B 3KQGA 1RY3A 1HJBA 3L4FA 1ZLLA 3VYIA 3B8EB 3GHGC 1I6EA 3MK7C 1N7LA 1EZVG 1I54A 2PFXA 3V2QA 4PV1D 4UB8H 1C75A 1KB9E 1JY3P 3CXHW 1K8AQ 4AANA 2FYNC 1L4AB 4H13B 1ZRTD 4GT1A 3SFEC 5GTHH 1JDLA 1EC5A 2CE0A 2NRGA 3RK3D 1H8AA 4AQRD 2CXBA 2FXOA 5KAFV 2K9JA 1LTJC 2WT7A 1IO4A 1JTHA 1OAEA 4H13C 1Q86Q 2Y0EA 1QX8A 4U3FG 4DZOA 3P8CE 2Q9IA 1G2CA 4OGQD 3H1HG 4Y28J 1MFZA 3E7KA 4P4QB 5KJ7D 3HQ8A 4Y99B 1GW3A 2M8RA 1YFCA 3NBTA 3WMM0 3U59A 2G3AA 1KYOW 3AEEC 3WU2H 3CCLP 3KDPB 2PCBB 4PV1B 1LS9A 3B5NA 3X39A 1KB0A 4PW9B 2CE1A 2BH5X 1FI7A 1AOQA 3EFGA 4LC1A 3H1KG 1IQCA 2B4ZA 4HJGH 1GKSA 4PV1C 2QG4A 1CSUA 1NO4A 3WFBC 3CCSP 4IL6H 4IFFA 3RK3B 2E43A 5H2FH 1TU3F 5DFSA 4NPFX 3ZOYA 1KYOD 1DVHA 3A0BV 3L71G 2W83C 5CCGA 2Z5IA 1CC5A 3H1HE 2AXTH 1FZEA 1YITP 4OGQB 2MKVA 2AIUA 1ZMEC 2N9JA 1DEBA 1LNQA 2Y0DA 1W5CE 1AOFA 1SS1A 1FDOA 5KTBA 1QL3A 3HTKB 1Q81Q 1FDIA 4JYCA 1HJ4A 2QJKB 5AW8B 3V4WA 1H31B 2BCCG 2KNCB 1VDFA 2ZFCA 2KS1B 2OTKE 1FOSE 2B89A 1T6AA 3PXTA 2L5GB 4MU8A 1W2EA 1RZ6A 4ASVA 1SQXD 3PHLA 3G4SP 1KILE 1GD2E 1NTKG 3ZCFA 1FZFA 2XZRA 1FC2C 1KX2A 1S3JA 5AVSB 2LITA 1LTSC 4GOFA 2DW3A 1BSHA 2GA1A 2OYHA 1S6VB 4KJMA 1MG3D 5AVRB 4C7NA 4W80A 3AE8C 2XV5A 4YPCA 1SQPJ 1M70A 3FXDA 351CA 3GHGA 3P7KA 2N9IA 1RQUA 3R2PA 1H32A 1S2EA 1KB9D 2WZ7A 3VP8A 4UB6V 1GDTA 1ZR2A 1NMIA 2IZ0A 4WQAA 3H1IG 1NTKE 2IFNA 3FGAD 3VN0A 2ORLA 1LTJA 4TT3H 3P8CD 3JC22 5APQA 3D6ZA 3RL0D 2CA4B 3A0HE 4LGDE 1AJYA 2JEEA 3IF4A 1SQQE 3IAOA 1M1JB 3ZDMA 1SVFA 3RLMA 1NOHA 2JKVA 3TF5A 1ZP0C 1FS0E 1KYOH 3TGUJ 3KYQA 2YO2A 4FA9A 4H0JA 1M1JC 5C39A 1JO5A 1OX3A 1K3HA 5CJ4A 2M3BA 1QL1A 3QH9A 2HR3A 3S4RA 3L75J 1VQ5P 3CC2P 3BASA 3F5HA 3HUSA 1JY2O 1SQXJ 3CCJP 3O0RC 2IBZI 2RMZA 4PWAA 1OMIA 1VQ6P 3EFFK 2BH4X 3ITKA 3N7NA 1FOSF 1WT6A 2HFED 3TDKA 1NNOA 2QA4P 2ZOOA 3H1HD 5CCHD 1EDIA 3W68A 4D6TE 3RL0B 2H88C 1JCDA 1ETPA 5CIFB 1NTMJ 3MD0A 2RH0A 3SWSA 3V2RA 1GW4A 3O1YA 4AX3A 4XXLA 2P67A 1MZ4A 5TISH 2FXPA 3VOPA 3AE7C 2KIKA 2WSEJ 3C8VA 3VMYA 2ZVNB 1CXAA 2GM4A 1KILD 3L35A 4QAOA 2GUVA 1B7VA 4YE1A 3KZIV 1LC2A 5APYA 4EIJA 1NTZJ 3II6A 2B9BA 4HB1A 1N50A 4XE5B 4DJGA 1KB9H 2JJLA 5APUA 1OIPA 3CCQP 2QE7H 3OA7A 2LIRA 2AI5A 1FZBA 3Q5RA 2KP8A 2OTJP 2L91A 3M0AA 1XTGB 5B5EV 1CHIA 1BGYJ 3M9BA 3SXTA 1VQ4P 1IFJA 1QVGO 2K3RA 1HJ5A 1HGZA 2KZJA 3G6EP 5GTIV 1NTKD 1GDVA 2E76D 1KILB 3OA8B 5AURA 2O1KA 1ZXGA 3BCCE 2H43A 1IK7A 2FKWB 3N4XA 2PRRA 3Q2YA 1YTZT 1SFCC 3SWFA 2WPSA 1CCHA 1S5LE 1G1JA 2AEJA 5E79E 3DR0A 4KMGA 2WSSH 1R0QA 2BEQD 2WQYC 3HRNA 2FRCA 1IC2A 2A06E 4GKGA 2I8DA 2P58A 1YIQA 3B5ND 1M7LA 1U7MA 3CCEP 4O9BA 1KMIZ 3RMZA 1OW6A 1CHJA 5BVZA 5C9MA 3L37A 1USEA 1S9KE 1VF5C 1DIIC 1Q90D 1H88A 4I7ZB 2E76B 5CCGD 4KT0J 3I55P 3RK2C 1VQKP 3CL3D 1LGHB 2WSCJ 1SQPE 3HE4B 4TLFA 4D6TD 1P84I
chains in the Genus database with same CATH topology
1ZRTD 1H31A 1M6ZA 2KS1A 3HQ7A 1FI3A 2QJYB 4PJ0V 1JDLA 1F1CA 2CE0A 5CYTR 1DT1A 3HQ9A 2CXBA 1L9JC 1QN2A 3CYTI 1DW1A 4GYDA 5KAFV 2DGEA 1OAEA 2Y0EA 1OCDA 3L72D 1CTYA 2HV4A 1I8PA 3M97X 1BE3D 4UB8V 4EIEA 1FI9A 2FYUD 4P4QB 1CORA 3HQ8A 3ZOWA 3VRDA 1H9YA 2N3BA 5DF5A 2C8SA 1YFCA 3A9FA 1GQ1A 3NBTA 1DW0A 3JBTB 4H0KA 1KIBA 1KYOW 3O5CA 5GTHV 1U75B 1CRHA 5CICB 1EB7A 2PCBB 1LS9A 3OCDB 3X39A 4AAOA 4WQ9A 1KB0A 1ZZHA 1RAPA 4PW9B 2CE1A 2BH5X 4FA5A 1FI7A 1AOQA 1YEBA 1HRCA 4WQBA 1HJ3A 1IQCA 2B4ZA 1GKSA 1DW3A 2QG4A 2ZBOA 1BCCD 1CSUA 4EIFA 1IO3A 1CTZA 3WFBC 5CIGB 1P84D 4AAMA 5DFSA 3WFDC 3WU2V 3ZOYA 1KYOD 1DVHA 3A0BV 1EZVD 5CIDB 1SQQD 2B10B 1CC5A 1QKSA 1KV9A 2AIUA 2N9JA 4RJTA 2OZ1A 2Y0DA 1FHBA 1AOFA 2DVHA 1QYZA 2YCCA 2CA3B 1AKKA 1RZ5A 1E2RA 3NWVA 2FWLA 1QL3A 3BCCD 1CSVA 1COTA 1HJ4A 2QJKB 1LC1A 4FAVA 4EDFA 4IL6V 1H31B 2VHDA 4U3FD 1J3SA 2KNCB 3FWLA 5H2FV 3PXTA 4MU8A 4WQEA 1RZ6A 1L0ND 1SQXD 5C0ZA 3PHLA 4FA1A 1NU1D 2K9JB 2ZONG 2AXTV 5KLVD 4FA4A 1C6OA 1CIGA 3H1JD 3ORVA 1N90A 3ZCFA 5KLIB 2A06D 1KX2A 3PXWA 1I8OA 1CYIA 1F1FA 2LITA 2N18B 1I6DA 1C2RA 1HROA 3RN0A 1CHHA 3GG2A 1C6SA 1A56A 1S6VB 1L0LD 1MG3D 1H1OA 1SQVD 1GIWA 2C1UA 2N18C 3RN1A 1C2NA 1PP9D 1M70A 351CA 1LFMA 3H1KD 1RAQA 2N9IA 2D0WA 4FB1A 3CU4A 1H32A 2XTSB 1KB9D 4RSZA 1SQPD 3CXHD 4UB6V 1CSXA 3L71D 1NMIA 4AALA 5TJHA 155CA 4Q5PA 4WQAA 2MTAC 2C9XB 3ZOXA 1YICA 2ORLA 2C1VA 2B11B 1FJ0A 5EXQA 1HZVA 5CIEB 1I5TA 3O20A 2GB8B 3L4OA 4PD4D 2CA4B 1PPJD 2OZ1B 4WQDA 2GIWA 2BCCD 4XYDB 3CP5A 1QL4A 3RLMA 3TF5A 1YTCA 1DIQC 2ZXYA 1VYDA 4FA9A 1IRVA 4H0JA 5CIBB 1IZL0 1BL9A 1K3HA 1GU2A 1CIFA 3DMIA 1CO6A 5B6QA 5DJQB 1CRYA 4DY9A 3TGUD 3C2CA 3L4MA 3ZBMA 1KX7A 4O1QA 3O0RC 2BCNB 2RMZA 4EIDA 1H33A 4PWAA 5DJQC 3L75D 4GEDB 2BH4X 2C1DA 1CXCA 3ITKA 3OA8A 3A0HV 1C6RA 4K3IA 1HH7A 3TDKA 1NNOA 2ZOOA 3H1HD 2GC4D 2C2CA 1ETPA 3SLEA 5CIFB 1DVVA 4L3GA 3H1ID 3SWSA 1H32B 2Q3EA 4JCGA 2V08A 3SVWA 3O1YA 4AX3A 4XXLA 1IRWA 2B12B 1MZ4A 1CYCA 3SJLA 1W2LA 2FYNB 1NTMD 1CXAA 1E8EA 3PTZA 1I55A 3VYMA 1DW2A 1AYGA 2MHMA 1FOCA 1CYJA 1CRJA 4QAOA 1N15A 1B7VA 1S5LV 4Y5RA 4YE1A 5E79V 3KZIV 2RN0A 1LC2A 2EXVA 3PXSA 4FANA 3H1LD 1N50A 3KHUA 3ZOOA 5KKZB 3GW6A 1WVEC 1NIRA 4V2KA 4A7PA 2LIRA 2AI5A 5TISV 1CEDA 1NTZD 2IBZD 3DP5A 1CRCA 1YNRA 2L91A 1W5CT 5B5EV 3VMAA 4EICA 4J20A 1CHIA 2D0SA 1C7MA 3CX5W 1A8CA 1L9BC 1CNOA 1CCRA 3L73D 3SXTA 2JQRA 3TYIA 3WC8A 1YCCA 2YK3A 4O1WA 1NMLA 1C52A 1HJ5A 1HCMA 4N0KA 1BGYD 2BPBB 3HQ6A 1CRIA 4WQCA 1CRGA 5GTIV 3PRJA 1K3GA 5IY51 1H33B 3PLNA 3NBSA 4L1QA 3PH2B 1NTKD 2C1DB 1GDVA 3OA8B 2YIUB 5AURA 3L70D 2YQBA 3WFEC 1MG2D 1CSWA 2GC7D 2N3YA 1CIEA 2BLFB 1CTJA 5CIHB 2V07A 4WQ8A 3CX5D 5KAIV 2L4DA 2BGVX 4LJIA 2O3JA 1CCHA 3OCDA 3DR0A 4L3HA 4KMGA 1R0QA 2PACA 1FCDC 1YEAA 5B66V 2FRCA 1N9CA 4WQ7A 2B0ZB 3VNWA 2JTIB 2N9YB 1YIQA 1CIHA 2QJPB 1U74B 3MK7B 3ZIYA 2ZZS1 1A2SA 3CWBD 2I8FA 3L74D 3RMZA 4NFGB 1CHJA 5C9MA 3WFCC 1H9XA 2PCCB 3WUIA 1GJQA 2Y0CA 1DIIC 1I6EA 451CA 1E29A 3MK7C 1HZUA 2JWAA 1I54A 1M60A 1C75A 1SQBD 1WEJF 1LMSA 3CXHW 4AANA 4D6TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRT D;  1H31 A;  1M6Z A;  2KS1 A;  3HQ7 A;  1FI3 A;  2QJY B;  4PJ0 V;  1JDL A;  1F1C A;  2CE0 A;  5CYT R;  1DT1 A;  3HQ9 A;  2CXB A;  1L9J C;  1QN2 A;  3CYT I;  1DW1 A;  4GYD A;  5KAF V;  2DGE A;  1OAE A;  2Y0E A;  1OCD A;  3L72 D;  1CTY A;  2HV4 A;  1I8P A;  3M97 X;  1BE3 D;  4UB8 V;  4EIE A;  1FI9 A;  2FYU D;  4P4Q B;  1COR A;  3HQ8 A;  3ZOW A;  3VRD A;  1H9Y A;  2N3B A;  5DF5 A;  2C8S A;  1YFC A;  3A9F A;  1GQ1 A;  3NBT A;  1DW0 A;  3JBT B;  4H0K A;  1KIB A;  1KYO W;  3O5C A;  5GTH V;  1U75 B;  1CRH A;  5CIC B;  1EB7 A;  2PCB B;  1LS9 A;  3OCD B;  3X39 A;  4AAO A;  4WQ9 A;  1KB0 A;  1ZZH A;  1RAP A;  4PW9 B;  2CE1 A;  2BH5 X;  4FA5 A;  1FI7 A;  1AOQ A;  1YEB A;  1HRC A;  4WQB A;  1HJ3 A;  1IQC A;  2B4Z A;  1GKS A;  1DW3 A;  2QG4 A;  2ZBO A;  1BCC D;  1CSU A;  4EIF A;  1IO3 A;  1CTZ A;  3WFB C;  5CIG B;  1P84 D;  4AAM A;  5DFS A;  3WFD C;  3WU2 V;  3ZOY A;  1KYO D;  1DVH A;  3A0B V;  1EZV D;  5CID B;  1SQQ D;  2B10 B;  1CC5 A;  1QKS A;  1KV9 A;  2AIU A;  2N9J A;  4RJT A;  2OZ1 A;  2Y0D A;  1FHB A;  1AOF A;  2DVH A;  1QYZ A;  2YCC A;  2CA3 B;  1AKK A;  1RZ5 A;  1E2R A;  3NWV A;  2FWL A;  1QL3 A;  3BCC D;  1CSV A;  1COT A;  1HJ4 A;  2QJK B;  1LC1 A;  4FAV A;  4EDF A;  4IL6 V;  1H31 B;  2VHD A;  4U3F D;  1J3S A;  2KNC B;  3FWL A;  5H2F V;  3PXT A;  4MU8 A;  4WQE A;  1RZ6 A;  1L0N D;  1SQX D;  5C0Z A;  3PHL A;  4FA1 A;  1NU1 D;  2K9J B;  2ZON G;  2AXT V;  5KLV D;  4FA4 A;  1C6O A;  1CIG A;  3H1J D;  3ORV A;  1N90 A;  3ZCF A;  5KLI B;  2A06 D;  1KX2 A;  3PXW A;  1I8O A;  1CYI A;  1F1F A;  2LIT A;  2N18 B;  1I6D A;  1C2R A;  1HRO A;  3RN0 A;  1CHH A;  3GG2 A;  1C6S A;  1A56 A;  1S6V B;  1L0L D;  1MG3 D;  1H1O A;  1SQV D;  1GIW A;  2C1U A;  2N18 C;  3RN1 A;  1C2N A;  1PP9 D;  1M70 A;  351C A;  1LFM A;  3H1K D;  1RAQ A;  2N9I A;  2D0W A;  4FB1 A;  3CU4 A;  1H32 A;  2XTS B;  1KB9 D;  4RSZ A;  1SQP D;  3CXH D;  4UB6 V;  1CSX A;  3L71 D;  1NMI A;  4AAL A;  5TJH A;  155C A;  4Q5P A;  4WQA A;  2MTA C;  2C9X B;  3ZOX A;  1YIC A;  2ORL A;  2C1V A;  2B11 B;  1FJ0 A;  5EXQ A;  1HZV A;  5CIE B;  1I5T A;  3O20 A;  2GB8 B;  3L4O A;  4PD4 D;  2CA4 B;  1PPJ D;  2OZ1 B;  4WQD A;  2GIW A;  2BCC D;  4XYD B;  3CP5 A;  1QL4 A;  3RLM A;  3TF5 A;  1YTC A;  1DIQ C;  2ZXY A;  1VYD A;  4FA9 A;  1IRV A;  4H0J A;  5CIB B;  1IZL 0;  1BL9 A;  1K3H A;  1GU2 A;  1CIF A;  3DMI A;  1CO6 A;  5B6Q A;  5DJQ B;  1CRY A;  4DY9 A;  3TGU D;  3C2C A;  3L4M A;  3ZBM A;  1KX7 A;  4O1Q A;  3O0R C;  2BCN B;  2RMZ A;  4EID A;  1H33 A;  4PWA A;  5DJQ C;  3L75 D;  4GED B;  2BH4 X;  2C1D A;  1CXC A;  3ITK A;  3OA8 A;  3A0H V;  1C6R A;  4K3I A;  1HH7 A;  3TDK A;  1NNO A;  2ZOO A;  3H1H D;  2GC4 D;  2C2C A;  1ETP A;  3SLE A;  5CIF B;  1DVV A;  4L3G A;  3H1I D;  3SWS A;  1H32 B;  2Q3E A;  4JCG A;  2V08 A;  3SVW A;  3O1Y A;  4AX3 A;  4XXL A;  1IRW A;  2B12 B;  1MZ4 A;  1CYC A;  3SJL A;  1W2L A;  2FYN B;  1NTM D;  1CXA A;  1E8E A;  3PTZ A;  1I55 A;  3VYM A;  1DW2 A;  1AYG A;  2MHM A;  1FOC A;  1CYJ A;  1CRJ A;  4QAO A;  1N15 A;  1B7V A;  1S5L V;  4Y5R A;  4YE1 A;  5E79 V;  3KZI V;  2RN0 A;  1LC2 A;  2EXV A;  3PXS A;  4FAN A;  3H1L D;  1N50 A;  3KHU A;  3ZOO A;  5KKZ B;  3GW6 A;  1WVE C;  1NIR A;  4V2K A;  4A7P A;  2LIR A;  2AI5 A;  5TIS V;  1CED A;  1NTZ D;  2IBZ D;  3DP5 A;  1CRC A;  1YNR A;  2L91 A;  1W5C T;  5B5E V;  3VMA A;  4EIC A;  4J20 A;  1CHI A;  2D0S A;  1C7M A;  3CX5 W;  1A8C A;  1L9B C;  1CNO A;  1CCR A;  3L73 D;  3SXT A;  2JQR A;  3TYI A;  3WC8 A;  1YCC A;  2YK3 A;  4O1W A;  1NML A;  1C52 A;  1HJ5 A;  1HCM A;  4N0K A;  1BGY D;  2BPB B;  3HQ6 A;  1CRI A;  4WQC A;  1CRG A;  5GTI V;  3PRJ A;  1K3G A;  5IY5 1;  1H33 B;  3PLN A;  3NBS A;  4L1Q A;  3PH2 B;  1NTK D;  2C1D B;  1GDV A;  3OA8 B;  2YIU B;  5AUR A;  3L70 D;  2YQB A;  3WFE C;  1MG2 D;  1CSW A;  2GC7 D;  2N3Y A;  1CIE A;  2BLF B;  1CTJ A;  5CIH B;  2V07 A;  4WQ8 A;  3CX5 D;  5KAI V;  2L4D A;  2BGV X;  4LJI A;  2O3J A;  1CCH A;  3OCD A;  3DR0 A;  4L3H A;  4KMG A;  1R0Q A;  2PAC A;  1FCD C;  1YEA A;  5B66 V;  2FRC A;  1N9C A;  4WQ7 A;  2B0Z B;  3VNW A;  2JTI B;  2N9Y B;  1YIQ A;  1CIH A;  2QJP B;  1U74 B;  3MK7 B;  3ZIY A;  2ZZS 1;  1A2S A;  3CWB D;  2I8F A;  3L74 D;  3RMZ A;  4NFG B;  1CHJ A;  5C9M A;  3WFC C;  1H9X A;  2PCC B;  3WUI A;  1GJQ A;  2Y0C A;  1DII C;  1I6E A;  451C A;  1E29 A;  3MK7 C;  1HZU A;  2JWA A;  1I54 A;  1M60 A;  1C75 A;  1SQB D;  1WEJ F;  1LMS A;  3CXH W;  4AAN A;  4D6T D; 
#chains in the Genus database with same CATH topology
 3TGU G;  3HQ7 A;  1N7S C;  1Q2N A;  1LT1 A;  1EZV I;  2KSE A;  3H32 A;  1L9J C;  1QN2 A;  1OVU A;  3D6Y A;  4GYD A;  2FYU J;  3L75 G;  1OCD A;  3PJS K;  2KB7 P;  1FAV A;  1A02 F;  1GTW A;  5KAI E;  1SQX G;  2Y9Z A;  3BRV B;  4UB8 V;  1FI9 A;  1COR A;  3ZOW A;  3VRD A;  1H9Y A;  4GDO A;  4WWI A;  3JBT B;  3A9F A;  2ZYA A;  1DW0 A;  2P7J A;  4N78 E;  5AW5 B;  4OH8 B;  2KOG A;  5GTH V;  1Q82 Q;  2KSJ A;  1CRH A;  1J1E C;  1LTB C;  5CIC B;  2YMY A;  1EB7 A;  2E5T A;  1NTM G;  3AE6 C;  3VMZ A;  1BCC J;  2POH A;  4R4M A;  4AAO A;  1HJ3 A;  1SQQ J;  1YHQ P;  2R5D A;  2B87 A;  1GK4 A;  2ZBO A;  4WY4 D;  1IO3 A;  1RH5 B;  3L75 E;  1FZC B;  2KLU A;  3O6Q B;  1SQX K;  1KFN A;  3WFD C;  3WU2 V;  3CC4 P;  1DIP A;  2WVR A;  2B10 B;  2WSF H;  1AA0 A;  2PGD A;  1FZC C;  3CME P;  4RJT A;  1PV3 A;  3R4Y A;  4PJ0 E;  2OZ1 A;  2DVH A;  2AEM A;  2CA3 B;  1AKK A;  1RZ5 A;  4KHX A;  3BCC D;  3USS A;  2HOD A;  1L0N J;  1CSV A;  1NU1 J;  1LC1 A;  4FAV A;  4IL6 V;  3NFQ A;  3H1J J;  1NTM E;  1D7M A;  3FWL A;  5H2F V;  1K04 A;  1N73 C;  2QJP C;  1SFC A;  5C0Z A;  2ZT9 C;  4PD4 I;  2ZON G;  4HH2 A;  2AXT V;  4D6T J;  3A7O A;  1X79 B;  1CIG A;  3ORV A;  1N90 A;  1EXI A;  1X8Y A;  1AQT A;  2YXQ B;  5KLI B;  1L0L J;  2A06 D;  1SQV J;  2CPB A;  4WY4 B;  5APW A;  1F1F A;  1T3U A;  2N18 B;  3CLQ A;  3AE5 C;  3L72 E;  1HRO A;  1PP9 J;  1MFT A;  1HWT C;  1MKM A;  1NTZ E;  2ZAE B;  3NMD A;  3GG2 A;  1N86 A;  1S9K D;  1L4A C;  2Z4E A;  2N18 C;  2MJZ A;  1KTM A;  4BRY A;  1ZV8 A;  1H0T A;  2YNY A;  3V2P A;  2ZVO B;  3CU4 A;  2WPQ A;  4NPE A;  1PIX A;  2XTS B;  1SQP D;  4BXL A;  2HYN A;  3CXH D;  1BGY E;  4AAL A;  1A02 J;  3OAK A;  1KC8 Q;  3BRT B;  2K37 A;  2XKM A;  1VQN P;  2MTA C;  1N7S A;  5AW3 B;  2C9X B;  3KPE A;  4Y99 C;  2FY8 A;  3PH0 A;  3CCM P;  5EXQ A;  2M5A B;  1I5T A;  1W2B O;  3O20 A;  1Y8A A;  1BDD A;  3T97 B;  2LXC B;  3CX5 E;  1KQL A;  4DCK A;  1FZA A;  3CC7 P;  4XYD B;  1S1C X;  4I2L C;  1YQ3 C;  1M8O B;  3F89 A;  1YJ9 P;  1ZOY C;  2N1T D;  3MHV A;  1RF1 B;  4N78 D;  1YTC A;  2NPS A;  1VQO P;  1DIQ C;  2Z5H A;  1IZL 0;  3BCC J;  1BL9 A;  3RK3 C;  2J5U A;  1CIF A;  4W7Z A;  3CWB E;  5DJQ B;  1CRY A;  3TGU D;  4L74 A;  2C9N Y;  3C2C A;  3L4M A;  1H89 A;  4OGQ C;  4EID A;  2OYI B;  1H33 A;  5DJQ C;  3L75 D;  5KJ7 C;  1CXC A;  1C6R A;  5EFW B;  1JY3 O;  1PGP A;  3TNU B;  1HGV A;  2QJK C;  1S5L H;  2IZ1 A;  2K1A A;  5E79 H;  2C2C A;  1VPC A;  3SLE A;  1RF0 C;  4L3G A;  2FXM A;  1BDC A;  2A45 H;  4JCG A;  5B5E E;  2N1T B;  1MZ9 A;  1CYC A;  3SJL A;  2E74 D;  1W2L A;  1NTM D;  1SQQ G;  1PFI A;  2W6A A;  1I55 A;  1N73 A;  1DW2 A;  3H1L J;  2FYU E;  1IK9 A;  2CPS A;  1URQ D;  3HE5 B;  2RN0 A;  5GTI E;  1CI6 A;  5AVQ B;  3S1K A;  3CCR P;  1T3J A;  4W7Y A;  1PGQ A;  1JY2 N;  3ZOO A;  1GU4 A;  3CXH H;  1NIR A;  4V2K A;  3CMA P;  2JR8 A;  1NTK K;  5TIS V;  1PGO A;  1NTZ D;  3DP5 A;  4PD4 E;  4Z1M H;  1NU1 G;  3NXS A;  3GMA A;  1L4A A;  3VMA A;  4EIC A;  4J20 A;  4I6M C;  1BCC E;  2D0S A;  4JYB A;  3CX5 W;  3CD6 P;  1R8E A;  5KAI H;  3UIA A;  1KQS O;  2Q6Q A;  3JSV C;  2JQR A;  4D6T G;  3WC8 A;  4YXW H;  1YCC A;  2PAJ A;  4O1W A;  2QRX A;  2E74 B;  1BGY D;  3RL0 g;  2IFM A;  5AVU B;  1CRI A;  1LP1 B;  1RHZ B;  3HD7 D;  2XU6 A;  1CRG A;  1K3G A;  3I56 P;  3PLN A;  1M90 Q;  1UIX A;  2C1D B;  1WRG A;  5CJ0 A;  1DH3 A;  3V2N A;  1URQ B;  2N3Y A;  1CSW A;  2GC7 D;  1HVV A;  1JCC A;  1CTJ A;  2V4H A;  2BEZ F;  3CX5 D;  2L4D A;  5AW2 B;  3TSI A;  2W27 A;  2BGV X;  3AE3 C;  3G3Z A;  1L0N E;  2O3J A;  1K9M Q;  1LT9 B;  1HJ0 A;  1NU1 E;  1YTZ I;  5KLV E;  3H1J E;  3MUD C;  2WPR A;  3AE9 C;  4EOT A;  2PAC A;  1GU5 A;  2KYV A;  2NZ2 A;  1FCD C;  1GL2 D;  2H89 C;  3L74 J;  4JBZ A;  1YEA A;  2KZI A;  4YTP C;  1PGJ A;  1PPJ G;  4OWF A;  2FFD B;  2Q1K A;  2ZZS 1;  3CWB D;  4PJ0 H;  4H44 D;  1L0L E;  1GK6 A;  1SQV E;  5DJT B;  1SQB J;  2PCC B;  3RL0 C;  3HD7 B;  2Y0C A;  3AE2 C;  1LWU B;  1PP9 E;  1HZU A;  2ZXE B;  2M3E A;  5KJ7 A;  1AQ5 A;  5GTH E;  1M60 A;  3HTK A;  1CSB A;  1WEJ F;  1MV8 A;  3G9R A;  1IJD B;  3E1I A;  1KZU B;  3D71 A;  1H31 A;  2WSE H;  2KNC A;  3L72 J;  4K3A A;  2KS1 A;  2QJY B;  1KYO I;  1RF0 A;  3BCC G;  5CYT R;  3HQ9 A;  1EQ7 A;  1DW1 A;  5CHX A;  3M06 A;  2QJY C;  3QWO C;  1I8P A;  1GL2 B;  3MTU E;  3V4Q A;  3M97 X;  1PPJ E;  3L73 E;  3AED C;  3L36 A;  4EIE A;  2HPC B;  2FYU D;  5DF5 A;  4H44 B;  2C8S A;  4R4L A;  1GQ1 A;  4H0K A;  1GZL A;  1KIB A;  2A06 G;  3GLM A;  2A45 G;  5CCH C;  3O5C A;  1OW7 A;  1U75 B;  2KLV A;  5B66 E;  1USD A;  4CPG A;  4GOD A;  5AW1 B;  2E75 D;  3OCD B;  1ZW0 A;  2XNX A;  4L75 A;  1ZZH A;  5H2F E;  1HRC A;  4LLH A;  1OVR A;  1JMM A;  1DW3 A;  1BCC D;  4EIF A;  2AXT E;  5CBN A;  1CTZ A;  1NAY A;  3MIW A;  3RBX A;  1KIL C;  3CI9 A;  1K73 Q;  1SQP G;  3CX5 H;  4AAM A;  3C9I A;  1EDL A;  1SQQ D;  3EWK A;  1KV9 A;  3SWY A;  2IBZ G;  4K35 A;  1VQ9 P;  1Y47 A;  4JQ0 D;  3CWB J;  1FHB A;  3VMX A;  1KB9 I;  3MGN A;  1QYZ A;  4U3F J;  1DX7 A;  3NWV A;  1E2R A;  4HKZ H;  5KAF E;  1M1J A;  3E1R A;  1U57 A;  1AV1 A;  3NTN A;  2KK7 A;  3A2A A;  4WQE A;  1OWA A;  1L0N D;  1FU1 A;  1CW5 A;  1NU1 D;  2K9J B;  2WT7 B;  1JTH B;  5KLV D;  4FA4 A;  3A5T A;  3H1J D;  3EQ2 A;  2YKO A;  3MUD A;  1SQP K;  3PP5 A;  3AEB C;  2V7Q J;  3LW5 J;  1G2C B;  3H1L E;  3V6I A;  2SPZ A;  3B71 A;  2KUB A;  2HG5 D;  3PXW A;  1CYI A;  4I7Z C;  2C0W A;  2E76 C;  1NKN A;  1AVO A;  2IBZ E;  2QM8 A;  1FE6 A;  2RKL A;  3H1K J;  1C6S A;  3K5B A;  1L0L D;  3ABV C;  1SQV D;  2WSC H;  4ASW A;  2C1U A;  5B5E H;  1QGK B;  1RE3 C;  1M57 D;  1PP9 D;  2IPP A;  2FBW C;  1LFM A;  1RAQ A;  3L71 J;  1OVV A;  3B5N B;  3A0B E;  1AFO A;  2YMK A;  2YKP A;  2K9Y A;  3FWN A;  1J1D B;  3I5C A;  1N2D C;  4WBA A;  155C A;  4Q5P A;  1FDM A;  3B5N C;  1QVF O;  1T2K D;  2KI7 B;  1YIC A;  3WUU A;  2C1V A;  2B11 B;  4AYC A;  4GOE A;  2KXP B;  4U7J A;  2GB8 B;  1SQB G;  1PPJ D;  2GIW A;  5CCG C;  4OVN F;  4GIF A;  3MZW B;  3CP5 A;  3SSU A;  2CK3 H;  3A0H H;  5CCH A;  2ZXY A;  3A3Y B;  3L72 G;  1IRV A;  5CIB B;  1RE4 C;  1NTZ G;  5AW6 B;  2WWW A;  3BVH A;  1NYH A;  1EXJ A;  1CO6 A;  1KD1 Q;  4DY9 A;  3L74 E;  2E5Y A;  5K5G B;  2PP6 A;  2QVA A;  3ZBM A;  1KX7 A;  1NTM K;  2OTL P;  1AVY A;  1HUC A;  5KLV J;  3IFM A;  4GED B;  1KIL A;  5AVX B;  3OA8 A;  3P32 A;  1SQB E;  2OYH B;  1BGY G;  1JEK A;  1Y9B A;  1R5L A;  1HH7 A;  4UB6 E;  4C7N B;  3H1I J;  4N6J A;  3U1C A;  3BAT A;  5TIS E;  3GHG B;  1DVV A;  1IFI A;  2R44 A;  1H32 B;  1NTZ K;  1IRW A;  5AW0 B;  5KLI C;  2FYN B;  1BE3 E;  1BSN A;  4WY4 C;  1E8E A;  3PTZ A;  3VYM A;  4MN4 C;  1AYG A;  2XND H;  4L73 A;  4ZNC A;  1HH0 A;  1QL2 A;  1S5L V;  1DD3 A;  1LTJ B;  3B4S A;  4Y5R A;  1YI2 P;  4ZKP A;  5E79 V;  5L8R J;  2EXV A;  3H1L D;  1J2J B;  3KHU A;  1HTL C;  1WVE C;  1EDJ A;  3CWB G;  2QIW A;  1OZH A;  2IBZ D;  1S4X A;  1QEX A;  1KOR A;  1FBM A;  1YNR A;  3OJA B;  4DOJ A;  3L73 J;  3HE4 A;  1W5C T;  1JY3 N;  1IFP A;  1RE3 A;  1LJ2 A;  1C7M A;  1L9B C;  2H7H A;  1P84 E;  2WIT A;  1EDK A;  4RES B;  4JPZ B;  1YJN P;  1EZV E;  3HUS B;  1NAF A;  3L70 J;  1C52 A;  1IFM A;  5AVT B;  2OQQ A;  1YBK A;  2P10 A;  3HQ6 A;  2QM7 A;  5APX A;  2JP3 A;  3NBS A;  4L1Q A;  3PH2 B;  2ZYG A;  4C7R A;  2D2C D;  1IFN A;  5B66 H;  4EI2 A;  3HUS C;  2YIU B;  3WFE C;  1MG2 D;  3FX0 A;  3W67 A;  1KFM A;  2BLF B;  1RF1 C;  4B86 A;  4WB4 A;  2V07 A;  1R5S A;  2YXR B;  4WQ8 A;  1DD4 A;  1PL5 A;  5KAI V;  2FYU G;  4U3F E;  2Q3I A;  2YIU C;  2AEF A;  1OW8 A;  3KZI E;  1YJW P;  2AXC A;  2M0B A;  4HYT B;  1VQM P;  4ZMD A;  3AEG C;  1N9C A;  4WQ7 A;  3TK1 A;  2B0Z B;  1WMK A;  2OYI C;  2JTI B;  1JM0 A;  1RE4 A;  1U74 B;  2ZJS E;  1FZC A;  5AW7 B;  3O6Q A;  3ZIY A;  2I8F A;  3L74 D;  4QMA A;  4NFG B;  3WFC C;  1NVO A;  1H9X A;  5KAF H;  1BCC G;  1JY2 P;  3WUI A;  1GJQ A;  2W6B A;  451C A;  1E29 A;  2JWA A;  2OYO A;  4ZKU A;  1N8R Q;  3H1K E;  2D2C B;  2OAR A;  2FYU K;  1SQB D;  4IOI H;  2N1T C;  1LMS A;  1KQF B;  2O1J A;  2J59 M;  1XTC C;  2LXB A;  2D2C C;  3L71 E;  1M56 D;  1M6Z A;  1FI3 A;  4PJ0 V;  1F1C A;  2G8Y A;  3VTP C;  1DT1 A;  3CYT I;  1K05 A;  2I1J A;  2WPV B;  1NWQ A;  2DGE A;  5CBO A;  3L72 D;  1CTY A;  2HV4 A;  1LTI C;  1L0N G;  1BE3 D;  1YQ4 C;  1LTA C;  4WY4 A;  3JCU E;  5KLV G;  3AE4 C;  1FJK A;  2BCC E;  3H1J G;  5BU8 B;  5CMZ A;  2N3B A;  1HBW A;  4YXD C;  1SQQ K;  2HLO A;  3A0B H;  5AVZ B;  1NKZ B;  1JB0 J;  4NPD A;  3Q5P A;  3LID A;  2IYP A;  2R32 A;  2JDI H;  1L0L G;  1VQ7 P;  1SQV G;  2Y9Y A;  1KQG B;  1KV4 A;  4WQ9 A;  1NH4 A;  2A45 I;  1RAP A;  4FA5 A;  2W6J H;  2LR2 A;  1YEB A;  1PP9 G;  2E74 C;  4WQB A;  4M3L A;  3M0D C;  2FYZ A;  3S9O A;  5AVW B;  1VQP P;  5CIG B;  1P84 D;  2ITA A;  1L0N K;  3WUT A;  1URQ C;  5APV A;  5AW4 B;  2IDB A;  2WMM A;  1NU1 K;  3IR9 A;  1EZV D;  1IZN B;  5CID B;  5KLV K;  2M5A A;  1U7J A;  1QKS A;  4XFJ A;  4N3Y B;  1S72 P;  3O8Z A;  3CCV P;  3T97 A;  3TYY A;  3C1L A;  3CXH I;  1UII A;  2YCC A;  3P8M C;  1LT9 C;  5AVY B;  1YYC A;  2FWL A;  1CZQ A;  3H1I E;  3OW2 O;  2VRS A;  3Q5S A;  1COT A;  1L0L K;  1RF1 A;  3L73 G;  1SQV K;  4EDF A;  2VHD A;  4U3F D;  1J3S A;  4UB8 E;  1RQV A;  2QSI A;  3IN6 A;  3H32 B;  1FJP A;  2WTY A;  2FFD C;  4FA1 A;  2XDJ A;  1JUN A;  1C6O A;  2C9L Y;  2UWJ E;  3SFD C;  2R3C A;  1YIJ P;  3L70 G;  3HD7 C;  1LWU C;  4UB6 H;  1I8O A;  4JF7 A;  2OYI A;  2JWD A;  1I6D A;  1C2R A;  1NGM B;  1VQL P;  3RN0 A;  1CHH A;  1G1I A;  1A56 A;  5DJU B;  1BE3 J;  2O01 J;  1H1O A;  1T8Z A;  1Q7Y Q;  5M1B A;  3TNU A;  2YKQ A;  1GIW A;  3M91 A;  5APT A;  3RN1 A;  1C2N A;  2P1J A;  2B88 A;  3M9Q A;  4IL6 X;  1X9V A;  3GF3 A;  3H6P A;  3H1K D;  1SFC D;  2D0W A;  4FB1 A;  2O01 H;  3WU2 E;  2I1K A;  1MUU A;  4RSZ A;  2N1T A;  4IFM A;  1GL2 C;  1CSX A;  3L71 D;  2B87 B;  5TJH A;  3LIE A;  2Q5U A;  3WUV A;  3G71 P;  1ZR4 A;  2E42 A;  3ZOX A;  1SLQ A;  2ZXX A;  3SWK A;  4C46 A;  3L70 E;  4H44 C;  3HE5 A;  1FJ0 A;  3H25 A;  1HZV A;  5CIE B;  1SP4 A;  4RKU J;  3AEA C;  3L4O A;  4IL6 E;  4PD4 D;  3FXE A;  1JOC A;  1VF5 D;  2BAS A;  2OZ1 B;  3VP9 A;  4WQD A;  2OGU A;  4BWN A;  2BCC D;  2QEX P;  3CPW O;  1PZQ A;  1S5L X;  2HOD B;  3RK2 D;  1QL4 A;  3H1L G;  1NHL A;  1P84 H;  1HF9 A;  4XA4 A;  2O01 N;  1VYD A;  1N7S D;  3D0W A;  1SFC B;  4H0L D;  1GU2 A;  3DMI A;  3AEC C;  5B6Q A;  1KN7 A;  3U1A A;  1JMB A;  4I1L A;  4O1Q A;  1LP1 A;  1X22 A;  3M0D A;  2BCN B;  3H1H J;  4WVZ A;  4EYY Q;  5BU5 A;  2C1D A;  3GF7 A;  1LTT C;  3A0H V;  1URQ A;  1X0T A;  4K3I A;  2E75 B;  1DEE G;  3D70 A;  1OXZ A;  2NPS D;  2GC4 D;  1VF5 B;  3KZI H;  1ZRT E;  1E79 H;  4BRY B;  1H0T B;  2E75 C;  3RK3 E;  3H1I D;  1LT9 A;  2JO1 A;  2Q3E A;  3RGU A;  2V08 A;  2IYO A;  3SVW A;  3RK2 B;  5APS A;  2B12 B;  2GUS A;  2N9B A;  2V7Q H;  3LW5 H;  3Q1M A;  2P2U A;  1GMJ A;  3KXD A;  1N7S B;  4H0L B;  2MHM A;  1FOC A;  2R3S A;  1CYJ A;  2R5B A;  1CRJ A;  1N15 A;  2FFD A;  3CXH E;  5AVV B;  3CX5 I;  4IFD K;  3RBZ A;  2YO3 A;  3AEF C;  3PXS A;  4FAN A;  3MP7 B;  4H0L C;  3HD7 A;  5KKZ B;  3GW6 A;  1LWU A;  1QLE D;  3L74 G;  4A7P A;  4AUW A;  2LKM A;  5GTI H;  1CED A;  2ZYD A;  1CRC A;  5KKZ C;  2K88 A;  1J1D C;  2NPS B;  2H8P D;  1IFD A;  2BCC J;  1M1K Q;  1J1E B;  1A8C A;  1LTG C;  1CNO A;  4PD4 H;  1CCR A;  2Q7C A;  3L73 D;  1VQ8 P;  2W8Z A;  2ZT9 D;  2NPS C;  1NTK J;  1KYO E;  3TYI A;  3JCU H;  3V5B A;  2YK3 A;  1NML A;  4N0K A;  1HCM A;  1GL2 A;  2BPB B;  4WQC A;  1ZN5 A;  4RO0 A;  3PRJ A;  5IY5 1;  1H33 B;  3AE1 C;  1FZG A;  4DT0 A;  2HPC A;  3TGU E;  2W90 A;  3L70 D;  2IX7 C;  2YQB A;  1CIE A;  1L2P A;  5CIH B;  2WSF J;  1JNM A;  1BE3 G;  1L4A D;  4H13 D;  4LJI A;  1SQX E;  1E5W A;  3OCD A;  1SQB K;  4L3H A;  1Z56 A;  1OFC X;  5AW9 B;  4L76 A;  5B66 V;  3VNW A;  2N9Y B;  3M9H A;  1N73 B;  1CIH A;  2QJP B;  1T2K C;  3CCU P;  1NJI Q;  2ZT9 B;  2J58 A;  3MK7 B;  1A2S A;  2OYH C;  1VL2 A;  3Q3D A;  2C0X A;  1CI6 B;  3KQG A;  1RY3 A;  1HJB A;  3L4F A;  1ZLL A;  3VYI A;  3B8E B;  3GHG C;  1I6E A;  3MK7 C;  1N7L A;  1EZV G;  1I54 A;  2PFX A;  3V2Q A;  4PV1 D;  4UB8 H;  1C75 A;  1KB9 E;  1JY3 P;  3CXH W;  1K8A Q;  4AAN A;  2FYN C;  1L4A B;  4H13 B;  1ZRT D;  4GT1 A;  3SFE C;  5GTH H;  1JDL A;  1EC5 A;  2CE0 A;  2NRG A;  3RK3 D;  1H8A A;  4AQR D;  2CXB A;  2FXO A;  5KAF V;  2K9J A;  1LTJ C;  2WT7 A;  1IO4 A;  1JTH A;  1OAE A;  4H13 C;  1Q86 Q;  2Y0E A;  1QX8 A;  4U3F G;  4DZO A;  3P8C E;  2Q9I A;  1G2C A;  4OGQ D;  3H1H G;  4Y28 J;  1MFZ A;  3E7K A;  4P4Q B;  5KJ7 D;  3HQ8 A;  4Y99 B;  1GW3 A;  2M8R A;  1YFC A;  3NBT A;  3WMM 0;  3U59 A;  2G3A A;  1KYO W;  3AEE C;  3WU2 H;  3CCL P;  3KDP B;  2PCB B;  4PV1 B;  1LS9 A;  3B5N A;  3X39 A;  1KB0 A;  4PW9 B;  2CE1 A;  2BH5 X;  1FI7 A;  1AOQ A;  3EFG A;  4LC1 A;  3H1K G;  1IQC A;  2B4Z A;  4HJG H;  1GKS A;  4PV1 C;  2QG4 A;  1CSU A;  1NO4 A;  3WFB C;  3CCS P;  4IL6 H;  4IFF A;  3RK3 B;  2E43 A;  5H2F H;  1TU3 F;  5DFS A;  4NPF X;  3ZOY A;  1KYO D;  1DVH A;  3A0B V;  3L71 G;  2W83 C;  5CCG A;  2Z5I A;  1CC5 A;  3H1H E;  2AXT H;  1FZE A;  1YIT P;  4OGQ B;  2MKV A;  2AIU A;  1ZME C;  2N9J A;  1DEB A;  1LNQ A;  2Y0D A;  1W5C E;  1AOF A;  1SS1 A;  1FDO A;  5KTB A;  1QL3 A;  3HTK B;  1Q81 Q;  1FDI A;  4JYC A;  1HJ4 A;  2QJK B;  5AW8 B;  3V4W A;  1H31 B;  2BCC G;  2KNC B;  1VDF A;  2ZFC A;  2KS1 B;  2OTK E;  1FOS E;  2B89 A;  1T6A A;  3PXT A;  2L5G B;  4MU8 A;  1W2E A;  1RZ6 A;  4ASV A;  1SQX D;  3PHL A;  3G4S P;  1KIL E;  1GD2 E;  1NTK G;  3ZCF A;  1FZF A;  2XZR A;  1FC2 C;  1KX2 A;  1S3J A;  5AVS B;  2LIT A;  1LTS C;  4GOF A;  2DW3 A;  1BSH A;  2GA1 A;  2OYH A;  1S6V B;  4KJM A;  1MG3 D;  5AVR B;  4C7N A;  4W80 A;  3AE8 C;  2XV5 A;  4YPC A;  1SQP J;  1M70 A;  3FXD A;  351C A;  3GHG A;  3P7K A;  2N9I A;  1RQU A;  3R2P A;  1H32 A;  1S2E A;  1KB9 D;  2WZ7 A;  3VP8 A;  4UB6 V;  1GDT A;  1ZR2 A;  1NMI A;  2IZ0 A;  4WQA A;  3H1I G;  1NTK E;  2IFN A;  3FGA D;  3VN0 A;  2ORL A;  1LTJ A;  4TT3 H;  3P8C D;  3JC2 2;  5APQ A;  3D6Z A;  3RL0 D;  2CA4 B;  3A0H E;  4LGD E;  1AJY A;  2JEE A;  3IF4 A;  1SQQ E;  3IAO A;  1M1J B;  3ZDM A;  1SVF A;  3RLM A;  1NOH A;  2JKV A;  3TF5 A;  1ZP0 C;  1FS0 E;  1KYO H;  3TGU J;  3KYQ A;  2YO2 A;  4FA9 A;  4H0J A;  1M1J C;  5C39 A;  1JO5 A;  1OX3 A;  1K3H A;  5CJ4 A;  2M3B A;  1QL1 A;  3QH9 A;  2HR3 A;  3S4R A;  3L75 J;  1VQ5 P;  3CC2 P;  3BAS A;  3F5H A;  3HUS A;  1JY2 O;  1SQX J;  3CCJ P;  3O0R C;  2IBZ I;  2RMZ A;  4PWA A;  1OMI A;  1VQ6 P;  3EFF K;  2BH4 X;  3ITK A;  3N7N A;  1FOS F;  1WT6 A;  2HFE D;  3TDK A;  1NNO A;  2QA4 P;  2ZOO A;  3H1H D;  5CCH D;  1EDI A;  3W68 A;  4D6T E;  3RL0 B;  2H88 C;  1JCD A;  1ETP A;  5CIF B;  1NTM J;  3MD0 A;  2RH0 A;  3SWS A;  3V2R A;  1GW4 A;  3O1Y A;  4AX3 A;  4XXL A;  2P67 A;  1MZ4 A;  5TIS H;  2FXP A;  3VOP A;  3AE7 C;  2KIK A;  2WSE J;  3C8V A;  3VMY A;  2ZVN B;  1CXA A;  2GM4 A;  1KIL D;  3L35 A;  4QAO A;  2GUV A;  1B7V A;  4YE1 A;  3KZI V;  1LC2 A;  5APY A;  4EIJ A;  1NTZ J;  3II6 A;  2B9B A;  4HB1 A;  1N50 A;  4XE5 B;  4DJG A;  1KB9 H;  2JJL A;  5APU A;  1OIP A;  3CCQ P;  2QE7 H;  3OA7 A;  2LIR A;  2AI5 A;  1FZB A;  3Q5R A;  2KP8 A;  2OTJ P;  2L91 A;  3M0A A;  1XTG B;  5B5E V;  1CHI A;  1BGY J;  3M9B A;  3SXT A;  1VQ4 P;  1IFJ A;  1QVG O;  2K3R A;  1HJ5 A;  1HGZ A;  2KZJ A;  3G6E P;  5GTI V;  1NTK D;  1GDV A;  2E76 D;  1KIL B;  3OA8 B;  5AUR A;  2O1K A;  1ZXG A;  3BCC E;  2H43 A;  1IK7 A;  2FKW B;  3N4X A;  2PRR A;  3Q2Y A;  1YTZ T;  1SFC C;  3SWF A;  2WPS A;  1CCH A;  1S5L E;  1G1J A;  2AEJ A;  5E79 E;  3DR0 A;  4KMG A;  2WSS H;  1R0Q A;  2BEQ D;  2WQY C;  3HRN A;  2FRC A;  1IC2 A;  2A06 E;  4GKG A;  2I8D A;  2P58 A;  1YIQ A;  3B5N D;  1M7L A;  1U7M A;  3CCE P;  4O9B A;  1KMI Z;  3RMZ A;  1OW6 A;  1CHJ A;  5BVZ A;  5C9M A;  3L37 A;  1USE A;  1S9K E;  1VF5 C;  1DII C;  1Q90 D;  1H88 A;  4I7Z B;  2E76 B;  5CCG D;  4KT0 J;  3I55 P;  3RK2 C;  1VQK P;  3CL3 D;  1LGH B;  2WSC J;  1SQP E;  3HE4 B;  4TLF A;  4D6T D;  1P84 I; 
#chains in the Genus database with same CATH homology
 1ZRT D;  1H31 A;  1M6Z A;  2KS1 A;  3HQ7 A;  1FI3 A;  2QJY B;  4PJ0 V;  1JDL A;  1F1C A;  2CE0 A;  5CYT R;  1DT1 A;  3HQ9 A;  2CXB A;  1L9J C;  1QN2 A;  3CYT I;  1DW1 A;  4GYD A;  5KAF V;  2DGE A;  1OAE A;  2Y0E A;  1OCD A;  3L72 D;  1CTY A;  2HV4 A;  1I8P A;  3M97 X;  1BE3 D;  4UB8 V;  4EIE A;  1FI9 A;  2FYU D;  4P4Q B;  1COR A;  3HQ8 A;  3ZOW A;  3VRD A;  1H9Y A;  2N3B A;  5DF5 A;  2C8S A;  1YFC A;  3A9F A;  1GQ1 A;  3NBT A;  1DW0 A;  3JBT B;  4H0K A;  1KIB A;  1KYO W;  3O5C A;  5GTH V;  1U75 B;  1CRH A;  5CIC B;  1EB7 A;  2PCB B;  1LS9 A;  3OCD B;  3X39 A;  4AAO A;  4WQ9 A;  1KB0 A;  1ZZH A;  1RAP A;  4PW9 B;  2CE1 A;  2BH5 X;  4FA5 A;  1FI7 A;  1AOQ A;  1YEB A;  1HRC A;  4WQB A;  1HJ3 A;  1IQC A;  2B4Z A;  1GKS A;  1DW3 A;  2QG4 A;  2ZBO A;  1BCC D;  1CSU A;  4EIF A;  1IO3 A;  1CTZ A;  3WFB C;  5CIG B;  1P84 D;  4AAM A;  5DFS A;  3WFD C;  3WU2 V;  3ZOY A;  1KYO D;  1DVH A;  3A0B V;  1EZV D;  5CID B;  1SQQ D;  2B10 B;  1CC5 A;  1QKS A;  1KV9 A;  2AIU A;  2N9J A;  4RJT A;  2OZ1 A;  2Y0D A;  1FHB A;  1AOF A;  2DVH A;  1QYZ A;  2YCC A;  2CA3 B;  1AKK A;  1RZ5 A;  1E2R A;  3NWV A;  2FWL A;  1QL3 A;  3BCC D;  1CSV A;  1COT A;  1HJ4 A;  2QJK B;  1LC1 A;  4FAV A;  4EDF A;  4IL6 V;  1H31 B;  2VHD A;  4U3F D;  1J3S A;  2KNC B;  3FWL A;  5H2F V;  3PXT A;  4MU8 A;  4WQE A;  1RZ6 A;  1L0N D;  1SQX D;  5C0Z A;  3PHL A;  4FA1 A;  1NU1 D;  2K9J B;  2ZON G;  2AXT V;  5KLV D;  4FA4 A;  1C6O A;  1CIG A;  3H1J D;  3ORV A;  1N90 A;  3ZCF A;  5KLI B;  2A06 D;  1KX2 A;  3PXW A;  1I8O A;  1CYI A;  1F1F A;  2LIT A;  2N18 B;  1I6D A;  1C2R A;  1HRO A;  3RN0 A;  1CHH A;  3GG2 A;  1C6S A;  1A56 A;  1S6V B;  1L0L D;  1MG3 D;  1H1O A;  1SQV D;  1GIW A;  2C1U A;  2N18 C;  3RN1 A;  1C2N A;  1PP9 D;  1M70 A;  351C A;  1LFM A;  3H1K D;  1RAQ A;  2N9I A;  2D0W A;  4FB1 A;  3CU4 A;  1H32 A;  2XTS B;  1KB9 D;  4RSZ A;  1SQP D;  3CXH D;  4UB6 V;  1CSX A;  3L71 D;  1NMI A;  4AAL A;  5TJH A;  155C A;  4Q5P A;  4WQA A;  2MTA C;  2C9X B;  3ZOX A;  1YIC A;  2ORL A;  2C1V A;  2B11 B;  1FJ0 A;  5EXQ A;  1HZV A;  5CIE B;  1I5T A;  3O20 A;  2GB8 B;  3L4O A;  4PD4 D;  2CA4 B;  1PPJ D;  2OZ1 B;  4WQD A;  2GIW A;  2BCC D;  4XYD B;  3CP5 A;  1QL4 A;  3RLM A;  3TF5 A;  1YTC A;  1DIQ C;  2ZXY A;  1VYD A;  4FA9 A;  1IRV A;  4H0J A;  5CIB B;  1IZL 0;  1BL9 A;  1K3H A;  1GU2 A;  1CIF A;  3DMI A;  1CO6 A;  5B6Q A;  5DJQ B;  1CRY A;  4DY9 A;  3TGU D;  3C2C A;  3L4M A;  3ZBM A;  1KX7 A;  4O1Q A;  3O0R C;  2BCN B;  2RMZ A;  4EID A;  1H33 A;  4PWA A;  5DJQ C;  3L75 D;  4GED B;  2BH4 X;  2C1D A;  1CXC A;  3ITK A;  3OA8 A;  3A0H V;  1C6R A;  4K3I A;  1HH7 A;  3TDK A;  1NNO A;  2ZOO A;  3H1H D;  2GC4 D;  2C2C A;  1ETP A;  3SLE A;  5CIF B;  1DVV A;  4L3G A;  3H1I D;  3SWS A;  1H32 B;  2Q3E A;  4JCG A;  2V08 A;  3SVW A;  3O1Y A;  4AX3 A;  4XXL A;  1IRW A;  2B12 B;  1MZ4 A;  1CYC A;  3SJL A;  1W2L A;  2FYN B;  1NTM D;  1CXA A;  1E8E A;  3PTZ A;  1I55 A;  3VYM A;  1DW2 A;  1AYG A;  2MHM A;  1FOC A;  1CYJ A;  1CRJ A;  4QAO A;  1N15 A;  1B7V A;  1S5L V;  4Y5R A;  4YE1 A;  5E79 V;  3KZI V;  2RN0 A;  1LC2 A;  2EXV A;  3PXS A;  4FAN A;  3H1L D;  1N50 A;  3KHU A;  3ZOO A;  5KKZ B;  3GW6 A;  1WVE C;  1NIR A;  4V2K A;  4A7P A;  2LIR A;  2AI5 A;  5TIS V;  1CED A;  1NTZ D;  2IBZ D;  3DP5 A;  1CRC A;  1YNR A;  2L91 A;  1W5C T;  5B5E V;  3VMA A;  4EIC A;  4J20 A;  1CHI A;  2D0S A;  1C7M A;  3CX5 W;  1A8C A;  1L9B C;  1CNO A;  1CCR A;  3L73 D;  3SXT A;  2JQR A;  3TYI A;  3WC8 A;  1YCC A;  2YK3 A;  4O1W A;  1NML A;  1C52 A;  1HJ5 A;  1HCM A;  4N0K A;  1BGY D;  2BPB B;  3HQ6 A;  1CRI A;  4WQC A;  1CRG A;  5GTI V;  3PRJ A;  1K3G A;  5IY5 1;  1H33 B;  3PLN A;  3NBS A;  4L1Q A;  3PH2 B;  1NTK D;  2C1D B;  1GDV A;  3OA8 B;  2YIU B;  5AUR A;  3L70 D;  2YQB A;  3WFE C;  1MG2 D;  1CSW A;  2GC7 D;  2N3Y A;  1CIE A;  2BLF B;  1CTJ A;  5CIH B;  2V07 A;  4WQ8 A;  3CX5 D;  5KAI V;  2L4D A;  2BGV X;  4LJI A;  2O3J A;  1CCH A;  3OCD A;  3DR0 A;  4L3H A;  4KMG A;  1R0Q A;  2PAC A;  1FCD C;  1YEA A;  5B66 V;  2FRC A;  1N9C A;  4WQ7 A;  2B0Z B;  3VNW A;  2JTI B;  2N9Y B;  1YIQ A;  1CIH A;  2QJP B;  1U74 B;  3MK7 B;  3ZIY A;  2ZZS 1;  1A2S A;  3CWB D;  2I8F A;  3L74 D;  3RMZ A;  4NFG B;  1CHJ A;  5C9M A;  3WFC C;  1H9X A;  2PCC B;  3WUI A;  1GJQ A;  2Y0C A;  1DII C;  1I6E A;  451C A;  1E29 A;  3MK7 C;  1HZU A;  2JWA A;  1I54 A;  1M60 A;  1C75 A;  1SQB D;  1WEJ F;  1LMS A;  3CXH W;  4AAN A;  4D6T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...