3TGUD

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3tguD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3tguD02
3ITKA 1C52A 5KLVD 1JDLA 2KS1A 5EXQA 1PP9D 1KB0A 4U3FD 3L70D 3ZCFA 2Y0EA 1KV9A 2BLFB 2A06D 3O20A 1WVEC 1NNOA 1CSVA 3NWVA 1CRGA 3VNWA 4EDFA 1KB9D 1BE3D 2N9IA 1EZVD 2EXVA 4FA9A 1CTJA 1GDVA 1ETPA 2BCCD 4IL6V 1RZ6A 1DW3A 4H0KA 2YK3A 2CA4B 5B5EV 1CRJA 1GIWA 3SVWA 2MHMA 4QAOA 2LIRA 1H32B 3SJLA 1CHJA 5CIDB 1BL9A 3HQ7A 2Y0CA 4PW9B 4N0KA 4AALA 2C1DB 1H32A 2GB8B 4WQAA 3A0BV 4FA5A 2YQBA 2BH4X 3L71D 1IO3A 1DT1A 3L72D 1CSUA 1KX7A 2QG4A 1DVVA 3H1LD 2C1DA 2V08A 3L74D 2FRCA 4PWAA 1GU2A 4PJ0V 1YFCA 2CE0A 3ZIYA 4AAOA 5GTIV 2LITA 4O1WA 4K3IA 2K9JB 5C0ZA 1ZRTD 1I55A 1L9BC 5KKZB 1DIQC 1CO6A 451CA 3WUIA 5TISV 1CYIA 2HV4A 1EB7A 3ZOWA 1S6VB 2QJYB 1C7MA 2BH5X 3DMIA 1OCDA 2N18B 4O1QA 1U75B 2AIUA 3WFDC 4EIDA 1NU1D 1AOFA 2I8FA 4GEDB 1CC5A 1CXCA 3L75D 1F1CA 1N50A 1NTKD 2ZOOA 2L4DA 5GTHV 1HRCA 5DFSA 4RSZA 3VYMA 1E29A 2ZBOA 1RAQA 3SLEA 1I54A 1A8CA 1H33B 3ZBMA 1CCHA 2B4ZA 3TF5A 5CIEB 1NTMD 2BCNB 4WQCA 4H0JA 1AOQA 4XXLA 2ORLA 2YCCA 1R0QA 1YEBA 5KLIB 1FJ0A 1SQXD 1C6SA 3VRDA 1SQBD 1CHHA 1C75A 1H33A 2N9YB 2N9JA 1I5TA 4LJIA 2KNCB 1CYJA 5CICB 4NFGB 3CYTI 4UB8V 2C8SA 1YEAA 3GW6A 5CIFB 3PXWA 3PXSA 1B7VA 2Q3EA 3A0HV 2AI5A 4L3GA 4KMGA 1DVHA 1MG2D 2MTAC 4L1QA 1H9XA 1IRWA 1U74B 2C2CA 3MK7C 3PXTA 2V07A 1CRIA 1MG3D 3NBTA 4D6TD 2PCBB 3PTZA 1H9YA 1YCCA 3L73D 3CU4A 1CEDA 2N3BA 4WQEA 1CIEA 2DVHA 1CCRA 5H2FV 3CX5W 1CHIA 1NMLA 1CSWA 3H1HD 1CIGA 1CIHA 1YNRA 1W2LA 1KIBA 3RN1A 3SXTA 4AAMA 4V2KA 2FWLA 5AURA 2C1UA 2C1VA 1H31B 5DJQC 3HQ6A 5DF5A 2XTSB 5CIHB 1CIFA 2GC7D 3OA8B 1CYCA 1H31A 1IQCA 3RMZA 4WQ7A 3OA8A 1AYGA 1QN2A 1HJ4A 1C2NA 3KZIV 1KYOW 3VMAA 1YTCA 1SQVD 3HQ8A 1P84D 5KAFV 3M97X 3ORVA 5B66V 4RJTA 1SQQD 2C9XB 1PPJD 1GQ1A 3WU2V 1CSXA 1GJQA 4XYDB 5CIBB 1N90A 1FHBA 1FCDC 3C2CA 1I8PA 3OCDA 1HJ5A 1RAPA 1N15A 2QJPB 3CX5D 1I6DA 2ZONG 1I8OA 3HQ9A 1CTZA 4FANA 2PCCB 1QKSA 2N3YA 1E8EA 1HCMA 3L4MA 1DW2A 2CXBA 3TGUD 4FB1A 1HZUA 1IZL0 4WQ9A 3GG2A 4UB6V 1FI3A 4EICA 2IBZD 3L4OA 3WFEC 1NIRA 1HZVA 1L0ND 3BCCD 1IRVA 3CXHW 1CXAA 2AXTV 2B11B 4FAVA 1YIQA 3CWBD 1KYOD 3WFCC 1M70A 2Y0DA 1M60A 2VHDA 2DGEA 2CA3B 1J3SA 3RN0A 2BGVX 2JQRA 3X39A 1COTA 2ZXYA 2D0SA 3DP5A 3NBSA 2B12B 4A7PA 1CTYA 2ZZS1 1LFMA 1C6OA 1QL4A 4Y5RA 3TDKA 1DW1A 3ZOXA 2FYUD 3O1YA 1LC2A 1ZZHA 1CNOA 1KX2A 1HROA 1FI7A 4L3HA 2FYNB 4PD4D 3PLNA 4DY9A 1RZ5A 1CRHA 3PH2B 1L9JC 1DW0A 3PHLA 1AKKA 351CA 5C9MA 2JWAA 2RN0A 5TJHA 1GKSA 3A9FA 4AANA 4EIEA 4WQBA 1H1OA 1M6ZA 4FA4A 3SWSA 1K3GA 4FA1A 3H1JD 1OAEA 3KHUA 2RMZA 1QYZA 3CXHD 4AX3A 1QL3A 1W5CT 1F1FA 3JBTB 1CRCA 4J20A 3RLMA 1LC1A 2PACA 2OZ1B 1BCCD 3FWLA 1I6EA 2B10B 5IY51 1HJ3A 1LS9A 3TYIA 3PRJA 4WQ8A 1CRYA 1L0LD 2N18C 3O0RC 3MK7B 2OZ1A 2GC4D 1C2RA 3DR0A 5CIGB 2JTIB 1E2RA 3OCDB 2O3JA 1MZ4A 1CORA 1A2SA 1K3HA 4P4QB 2L91A 3H1ID 4WQDA 5KAIV 3O5CA 3ZOOA 4JCGA 2BPBB 5DJQB 1NTZD 4EIFA 2B0ZB 3H1KD 1A56A 3WC8A 3ZOYA 3WFBC 1BGYD 2CE1A 4Q5PA 5B6QA 1DIIC 5CYTR 5E79V 2QJKB 2YIUB 3CP5A 1YICA 1FOCA 2D0WA 1C6RA 1LMSA 4GYDA 1HH7A 1VYDA 1NMIA 1S5LV 2GIWA 155CA 4MU8A 1N9CA 4YE1A 1FI9A 1SQPD 1WEJF
chains in the Genus database with same CATH superfamily
2ZT9B 5KLVD 2R32A 5CCGD 1EZVI 3GMAA 3Q5SA 1U7MA 2FXPA 3ABVC 3L70G 4U3FG 1KB0A 1NJIQ 4D6TE 2JKVA 4U3FJ 2BLFB 2A06D 3L73E 1QGKB 4GOFA 1CSVA 1VF5B 3VNWA 4H0LB 2QEXP 1LWUB 3BVHA 1SFCD 2FYUJ 1BE3D 4FA9A 1KFNA 1U57A 2DW3A 1GDVA 1FU1A 1ETPA 1GK4A 2YNYA 5GTIE 1KD1Q 1S9KE 5B5EV 1SQPK 3B5NC 4Y99B 4DOJA 2LIRA 1G2CB 1H32B 2OGUA 2WSCJ 1SQQE 2QJPC 4N0KA 1L0LJ 2C1DB 2JP3A 2LR2A 2R5DA 4FA5A 5AVQB 5AVTB 3GF7A 2O1JA 3H1LG 5CCHA 1IO3A 3IAOA 2FFDB 4ZMDA 1KX7A 4TT3H 3H1LJ 1GD2E 2FRCA 2NRGA 1Q2NA 1S2EA 1GU2A 3AEEC 3E7KA 2IZ1A 2CE0A 2VRSA 1OW8A 2WSSH 4IFFA 1Q82Q 1IZNB 4GDOA 1NYHA 4C7NB 3SFDC 2QE7H 4K3IA 1JMBA 1FJKA 2KYVA 2OTLP 2GM4A 2A45H 1UIXA 1L9BC 4YXDC 1RF1C 1NWQA 1CO6A 2IBZE 1A02F 1PZQA 2HV4A 3ZOWA 4ZKUA 1S6VB 2JO1A 1JCDA 1NU1G 3DMIA 2N18B 2W83C 1NHLA 1AOFA 1KYOE 1NU1J 2PRRA 2I8FA 3L75G 4WY4D 4GEDB 1CC5A 4KJMA 1F1CA 2L4DA 1OWAA 2JWDA 2OYHC 1KN7A 4EI2A 2E74C 1VQ4P 3CMEP 3SLEA 4OH8B 2FYNC 2WPRA 1IK7A 1A8CA 1NTMG 4H13B 3Q5RA 4DT0A 5CIEB 3VTPC 2QM8A 4H44B 1NTMJ 2ORLA 1R0QA 1JEKA 1FJ0A 1CHHA 2OQQA 2FBWC 1SQQK 1I5TA 1RY3A 3V4WA 3T97A 2XKMA 4NFGB 2C8SA 1YEAA 5CIFB 1FOSF 3H1HE 4H0LD 2ZXEB 1WMKA 1EC5A 1IFMA 1B7VA 1NKNA 1K9MQ 3A7OA 3HE4A 2GA1A 2W27A 4M3LA 1JY2P 3CMAP 1CRIA 1L4AD 5AW1B 3H1JE 5CHXA 3NBTA 4D6TD 1H9YA 2KP8A 3L73D 2E74B 3M9HA 1N7SC 1URQC 5H2FV 1CHIA 2WZ7A 2E75B 1VQ9P 2Z5HA 3TNUA 2BEQD 1FDMA 1FDOA 3AEFC 5M1BA 5TISE 1NOHA 1P84I 3H32B 1VPCA 1SQBK 2O01H 2JJLA 1X0TA 1LTBC 1CIFA 3EQ2A 2C9NY 3L71J 4OVNF 4HB1A 1S9KD 3D6YA 3RMZA 3HTKA 3Q5PA 3CCRP 3L74J 3OA8A 1HJ4A 3CL3D 1C2NA 3L4FA 1SQVD 3QWOC 2WWWA 4GT1A 2E43A 5B5EH 1SQQD 2M0BA 2WSEJ 1N7SB 1CW5A 3SWYA 3CPWO 1NAFA 3CCSP 1I8PA 3B5ND 4DCKA 2R3SA 2NZ2A 1IO4A 3SFEC 2Q1KA 1YJ9P 4TLFA 1I6DA 1N73C 1JUNA 2ZONG 1I8OA 4EOTA 3HQ9A 4FANA 4I6MC 1GW4A 2N3YA 3V4QA 2BEZF 1HCMA 1PGOA 2CXBA 4FB1A 1RF0C 3B8EB 1A02J 1LJ2A 4DJGA 3RK2C 2IBZD 1YHQP 3WFEC 3R4YA 1MFTA 3BCCG 3JCUH 3T97B 1LTSC 1IRVA 3BCCJ 2AXTV 1JY2O 1SQXJ 2GUVA 1YIQA 2FKWB 1KYOD 3HE4B 1M70A 3MTUE 1H8AA 1M1JC 5CCGA 2JQRA 2A45I 5APVA 2WPQA 2P67A 3NBSA 3VP9A 3VMZA 3V6IA 1FZCC 3D70A 1FZEA 1BDDA 2FYUD 1ZZHA 2E74D 2FY8A 4WBAA 5KAFE 3TNUB 4L3HA 4DY9A 3MIWA 1L9JC 1SFCA 3PHLA 1HJ0A 1YJNP 351CA 2V4HA 1LT9A 4LC1A 3C9IA 3A9FA 4AANA 4EIEA 3SWSA 3HTKB 4FA1A 3WMM0 2E42A 3H1JD 1OAEA 3O6QA 1KC8Q 1HJBA 4J20A 1CRCA 1LC1A 2PACA 2OZ1B 3P32A 1I6EA 2B10B 3PRJA 3TYIA 2QJYC 3HUSC 3UIAA 1L0LD 2B9BA 2FXOA 1C2RA 4CPGA 5CIGB 1BGYE 2IYOA 4XA4A 1QL1A 1URQD 1A2SA 1K3HA 2L91A 4WQDA 4PD4H 2H7HA 1GTWA 1NTKE 3ZOOA 4K35A 2BPBB 1NTZJ 4EIFA 1CSBA 2KLVA 2Z4EA 2WT7B 5KLVE 2CE1A 1LT9C 3TGUJ 3W67A 1SQXE 1YICA 3CXHH 2A06E 2YMYA 1VYDA 3NMDA 3OAKA 2FXMA 1S3JA 1NMIA 1IFJA 5AVRB 1VQPP 155CA 1AVYA 1SQPG 2N1TC 4WY4A 1BE3E 1SQPJ 3U59A 5AVZB 1JDLA 1PP9G 2YMKA 3GF3A 3ZCFA 2Y0EA 1HGZA 3O20A 3RBXA 1WVEC 1FS0E 2Q6QA 3NXSA 1SP4A 4R4MA 5KJ7C 1CRGA 2HLOA 1K73Q 1SFCB 1EZVG 5AVYB 2KNCA 4I7ZB 1LT9B 3I55P 3KYQA 1GK6A 1IFPA 1LWUA 3RK2D 3A3YB 1K05A 2AXTH 2BCCJ 5KAIE 4H0KA 3O6QB 3N4XA 3TK1A 1MKMA 2CA4B 1L4AA 1RHZB 1GIWA 1T2KC 4LLHA 3VMYA 4JPZB 1RQUA 2MHMA 1ZR4A 5KLVK 1DEEG 2KIKA 4OGQC 2WTYA 1KQFB 1BCCJ 1BL9A 1PGQA 3HQ7A 4B86A 1PPJE 3BATA 5E79E 1VQ6P 4AALA 5AW6B 1H32A 2OTKE 3L72G 3ZDMA 3L71D 1FBMA 4O9BA 3L72J 2C1DA 1ZP0C 3L74D 4QMAA 1ZXGA 3AE1C 1M7LA 1M57D 1KB9H 1GU4A 1VQOP 1KORA 3HE5A 3PH0A 2NPSC 2LITA 1QVFO 1KV4A 3M91A 3PJSK 4C7NA 1IFNA 3O8ZA 4HH2A 3NFQA 2OYOA 1L0NE 1C7MA 2OTJP 3AEDC 3B5NA 4AUWA 1OCDA 3WFDC 1FZAA 3CWBE 4WY4B 1NTKD 4IL6E 2K88A 1HRCA 4Z1MH 4N78D 1MZ9A 1I54A 3ZBMA 2QRXA 2NPSB 1SQBG 3L36A 5AVVB 1C6SA 1YEBA 3L70J 1SQXD 3P7KA 1C75A 2N9YB 1SQBJ 3II6A 2WMMA 3L35A 4LJIA 1D7MA 2KNCB 3CYTI 1XTCC 4UB8V 2H88C 3V2RA 3A0BE 3V2NA 3PXSA 2IYPA 1MFZA 2AI5A 1RF1A 3M0DA 3A2AA 1DVHA 4BWNA 2Q7CA 1J1EC 1HUCA 3VYIA 1L4AB 1MG3D 1BSNA 1HF9A 3CXHE 3PTZA 3AEGC 2XZRA 2N1TD 2ZFCA 1M1KQ 2M5AB 3H1HG 3LIEA 5CJ4A 2OYHA 1RE3C 1NMLA 1EDKA 3NTNA 1SQVE 4PV1C 3PP5A 1KIBA 1S5LX 3SXTA 4AAMA 5DJQC 3HQ6A 1LP1A 5KJ7D 2XTSB 5CIHB 1OZHA 2ZYAA 3H32A 1IQCA 4C46A 5GTHE 2KLUA 4WQ7A 3HE5B 1QN2A 2B88A 1GDTA 1J1EB 1KYOW 2L5GB 1LTGC 1USEA 3V2PA 5B66V 2AEFA 1ZOYC 4C7RA 1PPJD 1KFMA 1T6AA 3VN0A 1VQKP 3WU2V 2AXTE 1GJQA 1T2KD 4XYDB 1Q81Q 4WVZA 1FCDC 3M0DC 3B5NB 1PFIA 3OCDA 1N7SA 2KZJA 3KDPB 1HJ5A 1RAPA 1JY2N 1URQA 2IBZI 2AEMA 2BASA 4OGQD 1L2PA 4YPCA 1SS1A 2QJPB 3A0HE 3K5BA 2ZVOB 3M0AA 1KILD 1CTZA 1VQ5P 1VQNP 1KYOI 3L75J 1YQ4C 3TGUD 2YKPA 4WQ9A 4U3FE 1AFOA 4UB6V 3G71P 5CJ0A 1IJDB 1SQVK 1L0ND 2NPSD 4GODA 3AE4C 2FYUE 2B11B 4EYYQ 3CWBD 1YTZT 3WFCC 3U1CA 1RF1B 2WSEH 3L37A 2KK7A 1LTJC 2J58A 1EDLA 3MUDC 3RN0A 4I2LC 1N7LA 3X39A 1COTA 2ZXYA 2D0SA 3DP5A 1J2JB 2J59M 1FE6A 1UIIA 1X8YA 1C6OA 1QL4A 3CX5H 4Y5RA 1N73A 2OYHB 3ZOXA 1LC2A 3C1LA 1KX2A 3BASA 1FI7A 4PD4D 2FYNB 1K04A 2YXRB 4AQRD 1USDA 1PIXA 1CRHA 5AVUB 1DD3A 1L0LE 1DW0A 1NO4A 4JYCA 4ZKPA 1RF0A 1YJWP 3D6ZA 5C9MA 1LP1B 1ZMEC 2D2CC 1OMIA 4WQBA 3H1LE 4UB8H 1VQLP 1M6ZA 4FA4A 1K3GA 1EQ7A 1OVRA 4GKGA 5KKZC 1QYZA 3CXHD 1T8ZA 1QL3A 1W5CT 2AEJA 1JB0J 2R3CA 1LTJB 2B87A 1BCCD 5CBNA 2QJKC 5BU8B 1CRYA 4XE5B 3VP8A 1S72P 3O0RC 1HGVA 2KSJA 1M1JA 2OZ1A 1AJYA 2JTIB 1M56D 1VDFA 2KOGA 3OCDB 2O3JA 2FYUK 1FZCA 5AW4B 1URQB 2LKMA 4P4QB 3H1IG 3FXEA 1NU1E 3I5CA 3Q1MA 3H1IJ 4PV1D 1JM0A 3CCVP 2HPCA 3USSA 2D2CB 3LIDA 1GL2C 1DEBA 4WWIA 1Q7YQ 3H1KG 3RGUA 3M9QA 1A56A 1BGYG 3H1KJ 2ZVNB 2IFMA 1K8AQ 1DIIC 5BU5A 2M3EA 1NTME 2WT7A 2ZXXA 2QJKB 3CP5A 1FOCA 4GYDA 2I1KA 3OA7A 3SSUA 1L0LK 3VMXA 3WU2H 3HUSA 2JDIH 1BDCA 1N9CA 2PFXA 5KLVG 3GHGC 1CI6A 3ITKA 4YTPC 1C52A 2YKOA 1SVFA 1WT6A 2WSFJ 2HG5D 4U3FD 3L70D 1GL2B 2A06G 5APUA 3AE6C 1N73B 1ZV8A 3OJAB 3E1RA 3NWVA 2UWJE 2PGDA 4I1LA 1BE3G 2I8DA 5C39A 4EDFA 4UB6H 1KB9D 3KPEA 2N9IA 4IOIH 1RQVA 1RH5B 2G8YA 3RK2B 1ZLLA 1CTJA 4JQ0D 1NH4A 3WUTA 1NU1K 1RZ6A 3D0WA 3L71E 1LTIC 1Q86Q 2YK3A 1YITP 4AYCA 1CRJA 3L74E 3GHGB 2B87B 2CPBA 1U7JA 2N1TA 4QAOA 3CC4P 2HYNA 1M1JB 3AE2C 2J5UA 3LW5H 1CHJA 5CIDB 1OVUA 2Y0CA 1J1DC 3IR9A 3WUUA 1OW7A 5AW3B 1H88A 1FZCB 1YTZI 2GB8B 2K37A 3FWNA 1R8EA 3P8MC 1VQMP 1CSUA 2QG4A 3F5HA 1VL2A 5AVSB 3H1LD 5H2FH 5KJ7A 3MZWB 4PWAA 2HPCB 4PJ0V 5AW5B 2M8RA 4HKZH 3ZIYA 3V5BA 4AAOA 3RK3D 2D2CD 3CLQA 1IK9A 5BVZA 4N78E 4N3YB 2V7QH 5C0ZA 1ZRTD 3CCQP 2OYIC 3OW2O 2IFNA 1QX8A 1Q90D 4JF7A 451CA 3WUIA 1AQ5A 4BXLA 5TISV 4ZNCA 2R44A 1AV1A 1R5SA 3BCCE 3H25A 2QJYB 1N2DC 3HUSB 1J1DB 2LXBA 2BH5X 4O1QA 1U75B 4EIDA 4IFDK 1NU1D 1W5CE 2E76C 3L75D 1CI6B 2ZOOA 3CD6P 1KILA 4RSZA 3CCLP 1E29A 1RAQA 3LW5J 5B5EE 5KTBA 1H33B 1CCHA 2B4ZA 3TF5A 1NTMD 4WQCA 4H0JA 1AOQA 2G3AA 3B4SA 3HD7C 1KQLA 1PP9J 2P58A 1GL2D 3VRDA 1FOSE 3MGNA 2N9JA 3TSIA 1CYJA 2NPSA 2POHA 3GW6A 2P7JA 3PXWA 3C8VA 3FXDA 1GMJA 4L3GA 1KQSO 3G4SP 4KMGA 1GU5A 4L1QA 4HJGH 1H9XA 1IRWA 2V7QJ 2C2CA 3MK7C 2V07A 4D6TG 4BRYA 1ZR2A 3L73G 2PCBB 4YXWH 5AW2B 1NTKK 2N1TB 4D6TJ 1YCCA 3L73J 2W6JH 3JCUE 2N3BA 4WQEA 4KHXA 3WU2E 4JYBA 2WQYC 1W2BO 2WPSA 2YKQA 1T3UA 1YNRA 1OIPA 2M5AA 2OARA 3RN1A 3M9BA 2YO3A 2KB7P 4V2KA 5AURA 2C1UA 1H31B 1SQXK 2O1KA 1KILC 5DF5A 2GC7D 1CYCA 2Q5UA 1AYGA 2YIUC 1NTZE 1SQVG 4IFMA 3KZIV 1KILE 2K9YA 3VMAA 4RESB 1YTCA 3HQ8A 1SQQG 3CCUP 1IFDA 5KAFV 3M97X 3ORVA 2C9XB 1SQQJ 1RE4C 3TGUE 2H43A 5CIBB 1N90A 1VQ8P 5L8RJ 2ZT9C 4OGQB 1KQGB 1RE3A 3CX5D 1CZQA 1HWTC 3CC7P 1KILB 2PP6A 3G3ZA 1SQPE 3FGAD 2XV5A 3D71A 1DD4A 1VF5C 1NVOA 3L4MA 4PJ0H 2IBZG 1FI3A 2JR8A 4ASVA 1S4XA 2KI7B 5H2FE 3L4OA 1H0TA 2Q3IA 4KT0J 3BCCD 4WB4A 3CXHW 1CXAA 5APSA 4PD4E 1P84H 1EZVE 2IPPA 2Y0DA 3F89A 5TISH 1M60A 4PD4I 2CA3B 2BCCE 3AE7C 1J3SA 1JY3P 4Y99C 4LGDE 4BRYB 5AW9B 1X79B 3RL0D 3H6PA 3IF4A 2Y9YA 3EWKA 1NTZK 1CTYA 2E76D 1LFMA 1WRGA 1N8RQ 3S1KA 2FYUG 3TDKA 1DW1A 3O1YA 2FFDC 2AXCA 1CNOA 3CXHI 1BCCE 3PLNA 1IC2A 1RZ5A 3AE8C 2C0WA 2CK3H 4W7YA 3AE3C 3H1HJ 3HRNA 5APQA 1AKKA 2JWAA 5APYA 3HD7D 2RN0A 4Y28J 5TJHA 1L0NK 3L72E 1AVOA 3H1JG 3P8CD 1HBWA 4NPFX 3H1JJ 3JBTB 1F1FA 2QA4P 1PL5A 4GOEA 2XU6A 5IY51 1HJ3A 1LS9A 1L0LG 4WQ8A 2N18C 1LTJA 3AE9C 3MUDA 2IZ0A 2ZYDA 3DR0A 3E1IA 1FDIA 2M3BA 3S9OA 2I1JA 3BRVB 1T3JA 2O01N 1PGJA 2RH0A 1TU3F 4PV1B 5KAIV 4H13C 4IL6X 1YYCA 4H44C 4JCGA 5DJQB 1NTZD 2FYZA 2B0ZB 1HVVA 1MUUA 3WC8A 3ZOYA 3WFBC 4ASWA 5B6QA 2K9JA 1LNQA 5CYTR 2P1JA 1H0TB 5E79V 3L70E 3KZIH 1FAVA 4K3AA 2D0WA 1SQBE 1C6RA 3Q2YA 1E5WA 1JY3O 5KAFH 1S5LV 1DX7A 3AEAC 1YIJP 3MD0A 2E5TA 4MU8A 2QVAA 2KUBA 2YXQB 1MV8A 1KB9E 1FI9A 4HYTB 1SQPD 1DIPA 1WEJF 1KZUB 1KB9I 2ZT9D 1M8OB 2E75C 2KS1A 3G9RA 5EXQA 1PP9D 1KV9A 5CCHC 1NKZB 1NNOA 4NPDA 3AECC 1GL2A 1VF5D 5AW8B 1EXIA 2K1AA 1EZVD 3TYYA 2EXVA 1FZGA 5AVWB 2C9LY 2A45G 2BCCD 1LT1A 4PJ0E 4IL6V 3AE5C 3IN6A 1DW3A 3RK3C 4NPEA 4L75A 3IFMA 2WPVB 3SVWA 1GW3A 3GHGA 1P84E 1FZBA 2H89C 5DJTB 3SJLA 3RK3E 2B89A 2XNDH 4PW9B 1DH3A 1E79H 2WSFH 1ZRTE 3L71G 4WQAA 3A0BV 2YQBA 1NAYA 2BH4X 3U1AA 1FZFA 1YI2P 1DT1A 3L72D 1DVVA 3L74G 2V08A 1X22A 5APWA 1Y8AA 1OW6A 1ZN5A 1IFIA 1YFCA 5GTIV 3L75E 1YQ3C 3RK3B 2ZAEB 3CI9A 5KLIC 4O1WA 3R2PA 2K9JB 2XNXA 3GLMA 1I55A 5KKZB 2IX7C 1Y47A 1DIQC 1BGYJ 1X9VA 1AQTA 1CYIA 1EB7A 2W8ZA 1LTTC 5APTA 1QL2A 2AIUA 2P10A 5B66H 3CCJP 1NTKG 1CXCA 1EDIA 1JMMA 1N50A 5GTHV 1NTKJ 3S4RA 5DFSA 3WUVA 4N6JA 5AVXB 3VYMA 2KS1B 2ZBOA 5KAIH 5KLVJ 2C0XA 1FC2C 2HR3A 2K3RA 4H13D 1OX3A 2O01J 3CCMP 2BCNB 3JC22 2PAJA 1SQXG 4XXLA 4H44D 2YCCA 5KLIB 4U7JA 5AW0B 5APXA 1SQBD 1JNMA 1H33A 2P2UA 2W6BA 5CICB 2E5YA 1SLQA 1JCCA 3CC2P 5E79H 5EFWB 2Q3EA 3A0HV 2OYIA 1BSHA 1BE3J 1HH0A 3MHVA 1MG2D 2MTAC 1S5LH 2CPSA 1U74B 1YBKA 3PXTA 1QVGO 3KZIE 2N9BA 3Q3DA 1N86A 4XFJA 3CU4A 1CEDA 1CIEA 2DVHA 1CCRA 3CX5W 2H8PD 1CSWA 3H1HD 1CIGA 3AEBC 2E75D 1CIHA 1W2LA 1NTMK 2FWLA 1G1JA 5CCHD 2C1VA 1W2EA 3HD7A 2QSIA 3I56P 4W80A 3OA8B 2QM7A 3H1IE 1XTGB 1H31A 1ZW0A 2Y9ZA 3CX5E 4IL6H 1JTHA 2GUSA 5AW7B 3CX5I 1PGPA 1P84D 2W90A 3H1KE 2IDBA 1PPJG 4RJTA 1GQ1A 2MKVA 1N7SD 1CSXA 3CCEP 2ITAA 3A5TA 1FHBA 3C2CA 5CCGC 4UB8E 2JEEA 4RKUJ 2W6AA 1N15A 1R5LA 1NTZG 3QH9A 3SWFA 3RL0C 3A0BH 2XDJA 2PCCB 1QKSA 1E8EA 1JOCA 2WITA 3FX0A 4OWFA 1SFCC 3TGUG 1DW2A 1OFCX 1HZUA 4I7ZC 1IZL0 3GG2A 4EICA 1LTAC 3KXDA 5GTIH 2Q9IA 1PV3A 3EFFK 1L0NG 2YO2A 1NIRA 1HZVA 1L0NJ 2HODA 3CWBG 4FAVA 1Z56A 1QEXA 3MP7B 1S1CX 1KMIZ 2OYIB 3CWBJ 2VHDA 1RE4A 2DGEA 3RBZA 1M90Q 1FJPA 1AA0A 2ZYGA 2BGVX 2KXPB 3RL0B 3EFGA 2B12B 4A7PA 2E76B 5GTHH 2ZZS1 3P8CE 3N7NA 5CBOA 2QIWA 1OVVA 5B66E 3G6EP 2LXCB 1HROA 3KQGA 1EXJA 3SWKA 4DZOA 5DJUB 3PH2B 1NGMB 2BCCG 2WVRA 2R5BA 3HD7B 4RO0A 1G1IA 5K5GB 1GKSA 2Z5IA 1H1OA 5CMZA 1KTMA 1H89A 3KHUA 2RMZA 3A0HH 4AX3A 3RLMA 4EIJA 1JTHB 1EDJA 1KYOH 1BCCG 3FWLA 1LGHB 3B71A 3M06A 3W68A 4UB6E 1GZLA 3MK7B 1G2CA 4WY4C 2GC4D 1SQVJ 1HTLC 1QLED 2KSEA 1S5LE 1E2RA 1MZ4A 1CORA 3V2QA 1JY3N 3BRTB 3RL0g 2SPZA 2FFDA 3H1ID 3JSVC 1Y9BA 3O5CA 2MJZA 4R4LA 2RKLA 1OXZA 4GIFA 4W7ZA 3H1KD 4L76A 4JBZA 4H0LC 1BGYD 4L74A 4Q5PA 1LWUC 1PP9E 1JO5A 2YIUB 4L73A 1LMSA 2HODB 1HH7A 2ZJSE 4MN4C 1VQ7P 3VOPA 1L4AC 2WSCH 2GIWA 4YE1A 2KZIA 2HFED
chains in the Genus database with same CATH topology
3ITKA 1C52A 5KLVD 1JDLA 2KS1A 5EXQA 1PP9D 1KB0A 4U3FD 3L70D 3ZCFA 2Y0EA 1KV9A 2BLFB 2A06D 3O20A 1WVEC 1NNOA 1CSVA 3NWVA 1CRGA 3VNWA 4EDFA 1KB9D 1BE3D 2N9IA 1EZVD 2EXVA 4FA9A 1CTJA 1GDVA 1ETPA 2BCCD 4IL6V 1RZ6A 1DW3A 4H0KA 2YK3A 2CA4B 5B5EV 1CRJA 1GIWA 3SVWA 2MHMA 4QAOA 2LIRA 1H32B 3SJLA 1CHJA 5CIDB 1BL9A 3HQ7A 2Y0CA 4PW9B 4N0KA 4AALA 2C1DB 1H32A 2GB8B 4WQAA 3A0BV 4FA5A 2YQBA 2BH4X 3L71D 1IO3A 1DT1A 3L72D 1CSUA 1KX7A 2QG4A 1DVVA 3H1LD 2C1DA 2V08A 3L74D 2FRCA 4PWAA 1GU2A 4PJ0V 1YFCA 2CE0A 3ZIYA 4AAOA 5GTIV 2LITA 4O1WA 4K3IA 2K9JB 5C0ZA 1ZRTD 1I55A 1L9BC 5KKZB 1DIQC 1CO6A 451CA 3WUIA 5TISV 1CYIA 2HV4A 1EB7A 3ZOWA 1S6VB 2QJYB 1C7MA 2BH5X 3DMIA 1OCDA 2N18B 4O1QA 1U75B 2AIUA 3WFDC 4EIDA 1NU1D 1AOFA 2I8FA 4GEDB 1CC5A 1CXCA 3L75D 1F1CA 1N50A 1NTKD 2ZOOA 2L4DA 5GTHV 1HRCA 5DFSA 4RSZA 3VYMA 1E29A 2ZBOA 1RAQA 3SLEA 1I54A 1A8CA 1H33B 3ZBMA 1CCHA 2B4ZA 3TF5A 5CIEB 1NTMD 2BCNB 4WQCA 4H0JA 1AOQA 4XXLA 2ORLA 2YCCA 1R0QA 1YEBA 5KLIB 1FJ0A 1SQXD 1C6SA 3VRDA 1SQBD 1CHHA 1C75A 1H33A 2N9YB 2N9JA 1I5TA 4LJIA 2KNCB 1CYJA 5CICB 4NFGB 3CYTI 4UB8V 2C8SA 1YEAA 3GW6A 5CIFB 3PXWA 3PXSA 1B7VA 2Q3EA 3A0HV 2AI5A 4L3GA 4KMGA 1DVHA 1MG2D 2MTAC 4L1QA 1H9XA 1IRWA 1U74B 2C2CA 3MK7C 3PXTA 2V07A 1CRIA 1MG3D 3NBTA 4D6TD 2PCBB 3PTZA 1H9YA 1YCCA 3L73D 3CU4A 1CEDA 2N3BA 4WQEA 1CIEA 2DVHA 1CCRA 5H2FV 3CX5W 1CHIA 1NMLA 1CSWA 3H1HD 1CIGA 1CIHA 1YNRA 1W2LA 1KIBA 3RN1A 3SXTA 4AAMA 4V2KA 2FWLA 5AURA 2C1UA 2C1VA 1H31B 5DJQC 3HQ6A 5DF5A 2XTSB 5CIHB 1CIFA 2GC7D 3OA8B 1CYCA 1H31A 1IQCA 3RMZA 4WQ7A 3OA8A 1AYGA 1QN2A 1HJ4A 1C2NA 3KZIV 1KYOW 3VMAA 1YTCA 1SQVD 3HQ8A 1P84D 5KAFV 3M97X 3ORVA 5B66V 4RJTA 1SQQD 2C9XB 1PPJD 1GQ1A 3WU2V 1CSXA 1GJQA 4XYDB 5CIBB 1N90A 1FHBA 1FCDC 3C2CA 1I8PA 3OCDA 1HJ5A 1RAPA 1N15A 2QJPB 3CX5D 1I6DA 2ZONG 1I8OA 3HQ9A 1CTZA 4FANA 2PCCB 1QKSA 2N3YA 1E8EA 1HCMA 3L4MA 1DW2A 2CXBA 3TGUD 4FB1A 1HZUA 1IZL0 4WQ9A 3GG2A 4UB6V 1FI3A 4EICA 2IBZD 3L4OA 3WFEC 1NIRA 1HZVA 1L0ND 3BCCD 1IRVA 3CXHW 1CXAA 2AXTV 2B11B 4FAVA 1YIQA 3CWBD 1KYOD 3WFCC 1M70A 2Y0DA 1M60A 2VHDA 2DGEA 2CA3B 1J3SA 3RN0A 2BGVX 2JQRA 3X39A 1COTA 2ZXYA 2D0SA 3DP5A 3NBSA 2B12B 4A7PA 1CTYA 2ZZS1 1LFMA 1C6OA 1QL4A 4Y5RA 3TDKA 1DW1A 3ZOXA 2FYUD 3O1YA 1LC2A 1ZZHA 1CNOA 1KX2A 1HROA 1FI7A 4L3HA 2FYNB 4PD4D 3PLNA 4DY9A 1RZ5A 1CRHA 3PH2B 1L9JC 1DW0A 3PHLA 1AKKA 351CA 5C9MA 2JWAA 2RN0A 5TJHA 1GKSA 3A9FA 4AANA 4EIEA 4WQBA 1H1OA 1M6ZA 4FA4A 3SWSA 1K3GA 4FA1A 3H1JD 1OAEA 3KHUA 2RMZA 1QYZA 3CXHD 4AX3A 1QL3A 1W5CT 1F1FA 3JBTB 1CRCA 4J20A 3RLMA 1LC1A 2PACA 2OZ1B 1BCCD 3FWLA 1I6EA 2B10B 5IY51 1HJ3A 1LS9A 3TYIA 3PRJA 4WQ8A 1CRYA 1L0LD 2N18C 3O0RC 3MK7B 2OZ1A 2GC4D 1C2RA 3DR0A 5CIGB 2JTIB 1E2RA 3OCDB 2O3JA 1MZ4A 1CORA 1A2SA 1K3HA 4P4QB 2L91A 3H1ID 4WQDA 5KAIV 3O5CA 3ZOOA 4JCGA 2BPBB 5DJQB 1NTZD 4EIFA 2B0ZB 3H1KD 1A56A 3WC8A 3ZOYA 3WFBC 1BGYD 2CE1A 4Q5PA 5B6QA 1DIIC 5CYTR 5E79V 2QJKB 2YIUB 3CP5A 1YICA 1FOCA 2D0WA 1C6RA 1LMSA 4GYDA 1HH7A 1VYDA 1NMIA 1S5LV 2GIWA 155CA 4MU8A 1N9CA 4YE1A 1FI9A 1SQPD 1WEJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ITK A;  1C52 A;  5KLV D;  1JDL A;  2KS1 A;  5EXQ A;  1PP9 D;  1KB0 A;  4U3F D;  3L70 D;  3ZCF A;  2Y0E A;  1KV9 A;  2BLF B;  2A06 D;  3O20 A;  1WVE C;  1NNO A;  1CSV A;  3NWV A;  1CRG A;  3VNW A;  4EDF A;  1KB9 D;  1BE3 D;  2N9I A;  1EZV D;  2EXV A;  4FA9 A;  1CTJ A;  1GDV A;  1ETP A;  2BCC D;  4IL6 V;  1RZ6 A;  1DW3 A;  4H0K A;  2YK3 A;  2CA4 B;  5B5E V;  1CRJ A;  1GIW A;  3SVW A;  2MHM A;  4QAO A;  2LIR A;  1H32 B;  3SJL A;  1CHJ A;  5CID B;  1BL9 A;  3HQ7 A;  2Y0C A;  4PW9 B;  4N0K A;  4AAL A;  2C1D B;  1H32 A;  2GB8 B;  4WQA A;  3A0B V;  4FA5 A;  2YQB A;  2BH4 X;  3L71 D;  1IO3 A;  1DT1 A;  3L72 D;  1CSU A;  1KX7 A;  2QG4 A;  1DVV A;  3H1L D;  2C1D A;  2V08 A;  3L74 D;  2FRC A;  4PWA A;  1GU2 A;  4PJ0 V;  1YFC A;  2CE0 A;  3ZIY A;  4AAO A;  5GTI V;  2LIT A;  4O1W A;  4K3I A;  2K9J B;  5C0Z A;  1ZRT D;  1I55 A;  1L9B C;  5KKZ B;  1DIQ C;  1CO6 A;  451C A;  3WUI A;  5TIS V;  1CYI A;  2HV4 A;  1EB7 A;  3ZOW A;  1S6V B;  2QJY B;  1C7M A;  2BH5 X;  3DMI A;  1OCD A;  2N18 B;  4O1Q A;  1U75 B;  2AIU A;  3WFD C;  4EID A;  1NU1 D;  1AOF A;  2I8F A;  4GED B;  1CC5 A;  1CXC A;  3L75 D;  1F1C A;  1N50 A;  1NTK D;  2ZOO A;  2L4D A;  5GTH V;  1HRC A;  5DFS A;  4RSZ A;  3VYM A;  1E29 A;  2ZBO A;  1RAQ A;  3SLE A;  1I54 A;  1A8C A;  1H33 B;  3ZBM A;  1CCH A;  2B4Z A;  3TF5 A;  5CIE B;  1NTM D;  2BCN B;  4WQC A;  4H0J A;  1AOQ A;  4XXL A;  2ORL A;  2YCC A;  1R0Q A;  1YEB A;  5KLI B;  1FJ0 A;  1SQX D;  1C6S A;  3VRD A;  1SQB D;  1CHH A;  1C75 A;  1H33 A;  2N9Y B;  2N9J A;  1I5T A;  4LJI A;  2KNC B;  1CYJ A;  5CIC B;  4NFG B;  3CYT I;  4UB8 V;  2C8S A;  1YEA A;  3GW6 A;  5CIF B;  3PXW A;  3PXS A;  1B7V A;  2Q3E A;  3A0H V;  2AI5 A;  4L3G A;  4KMG A;  1DVH A;  1MG2 D;  2MTA C;  4L1Q A;  1H9X A;  1IRW A;  1U74 B;  2C2C A;  3MK7 C;  3PXT A;  2V07 A;  1CRI A;  1MG3 D;  3NBT A;  4D6T D;  2PCB B;  3PTZ A;  1H9Y A;  1YCC A;  3L73 D;  3CU4 A;  1CED A;  2N3B A;  4WQE A;  1CIE A;  2DVH A;  1CCR A;  5H2F V;  3CX5 W;  1CHI A;  1NML A;  1CSW A;  3H1H D;  1CIG A;  1CIH A;  1YNR A;  1W2L A;  1KIB A;  3RN1 A;  3SXT A;  4AAM A;  4V2K A;  2FWL A;  5AUR A;  2C1U A;  2C1V A;  1H31 B;  5DJQ C;  3HQ6 A;  5DF5 A;  2XTS B;  5CIH B;  1CIF A;  2GC7 D;  3OA8 B;  1CYC A;  1H31 A;  1IQC A;  3RMZ A;  4WQ7 A;  3OA8 A;  1AYG A;  1QN2 A;  1HJ4 A;  1C2N A;  3KZI V;  1KYO W;  3VMA A;  1YTC A;  1SQV D;  3HQ8 A;  1P84 D;  5KAF V;  3M97 X;  3ORV A;  5B66 V;  4RJT A;  1SQQ D;  2C9X B;  1PPJ D;  1GQ1 A;  3WU2 V;  1CSX A;  1GJQ A;  4XYD B;  5CIB B;  1N90 A;  1FHB A;  1FCD C;  3C2C A;  1I8P A;  3OCD A;  1HJ5 A;  1RAP A;  1N15 A;  2QJP B;  3CX5 D;  1I6D A;  2ZON G;  1I8O A;  3HQ9 A;  1CTZ A;  4FAN A;  2PCC B;  1QKS A;  2N3Y A;  1E8E A;  1HCM A;  3L4M A;  1DW2 A;  2CXB A;  3TGU D;  4FB1 A;  1HZU A;  1IZL 0;  4WQ9 A;  3GG2 A;  4UB6 V;  1FI3 A;  4EIC A;  2IBZ D;  3L4O A;  3WFE C;  1NIR A;  1HZV A;  1L0N D;  3BCC D;  1IRV A;  3CXH W;  1CXA A;  2AXT V;  2B11 B;  4FAV A;  1YIQ A;  3CWB D;  1KYO D;  3WFC C;  1M70 A;  2Y0D A;  1M60 A;  2VHD A;  2DGE A;  2CA3 B;  1J3S A;  3RN0 A;  2BGV X;  2JQR A;  3X39 A;  1COT A;  2ZXY A;  2D0S A;  3DP5 A;  3NBS A;  2B12 B;  4A7P A;  1CTY A;  2ZZS 1;  1LFM A;  1C6O A;  1QL4 A;  4Y5R A;  3TDK A;  1DW1 A;  3ZOX A;  2FYU D;  3O1Y A;  1LC2 A;  1ZZH A;  1CNO A;  1KX2 A;  1HRO A;  1FI7 A;  4L3H A;  2FYN B;  4PD4 D;  3PLN A;  4DY9 A;  1RZ5 A;  1CRH A;  3PH2 B;  1L9J C;  1DW0 A;  3PHL A;  1AKK A;  351C A;  5C9M A;  2JWA A;  2RN0 A;  5TJH A;  1GKS A;  3A9F A;  4AAN A;  4EIE A;  4WQB A;  1H1O A;  1M6Z A;  4FA4 A;  3SWS A;  1K3G A;  4FA1 A;  3H1J D;  1OAE A;  3KHU A;  2RMZ A;  1QYZ A;  3CXH D;  4AX3 A;  1QL3 A;  1W5C T;  1F1F A;  3JBT B;  1CRC A;  4J20 A;  3RLM A;  1LC1 A;  2PAC A;  2OZ1 B;  1BCC D;  3FWL A;  1I6E A;  2B10 B;  5IY5 1;  1HJ3 A;  1LS9 A;  3TYI A;  3PRJ A;  4WQ8 A;  1CRY A;  1L0L D;  2N18 C;  3O0R C;  3MK7 B;  2OZ1 A;  2GC4 D;  1C2R A;  3DR0 A;  5CIG B;  2JTI B;  1E2R A;  3OCD B;  2O3J A;  1MZ4 A;  1COR A;  1A2S A;  1K3H A;  4P4Q B;  2L91 A;  3H1I D;  4WQD A;  5KAI V;  3O5C A;  3ZOO A;  4JCG A;  2BPB B;  5DJQ B;  1NTZ D;  4EIF A;  2B0Z B;  3H1K D;  1A56 A;  3WC8 A;  3ZOY A;  3WFB C;  1BGY D;  2CE1 A;  4Q5P A;  5B6Q A;  1DII C;  5CYT R;  5E79 V;  2QJK B;  2YIU B;  3CP5 A;  1YIC A;  1FOC A;  2D0W A;  1C6R A;  1LMS A;  4GYD A;  1HH7 A;  1VYD A;  1NMI A;  1S5L V;  2GIW A;  155C A;  4MU8 A;  1N9C A;  4YE1 A;  1FI9 A;  1SQP D;  1WEJ F; 
#chains in the Genus database with same CATH topology
 2ZT9 B;  5KLV D;  2R32 A;  5CCG D;  1EZV I;  3GMA A;  3Q5S A;  1U7M A;  2FXP A;  3ABV C;  3L70 G;  4U3F G;  1KB0 A;  1NJI Q;  4D6T E;  2JKV A;  4U3F J;  2BLF B;  2A06 D;  3L73 E;  1QGK B;  4GOF A;  1CSV A;  1VF5 B;  3VNW A;  4H0L B;  2QEX P;  1LWU B;  3BVH A;  1SFC D;  2FYU J;  1BE3 D;  4FA9 A;  1KFN A;  1U57 A;  2DW3 A;  1GDV A;  1FU1 A;  1ETP A;  1GK4 A;  2YNY A;  5GTI E;  1KD1 Q;  1S9K E;  5B5E V;  1SQP K;  3B5N C;  4Y99 B;  4DOJ A;  2LIR A;  1G2C B;  1H32 B;  2OGU A;  2WSC J;  1SQQ E;  2QJP C;  4N0K A;  1L0L J;  2C1D B;  2JP3 A;  2LR2 A;  2R5D A;  4FA5 A;  5AVQ B;  5AVT B;  3GF7 A;  2O1J A;  3H1L G;  5CCH A;  1IO3 A;  3IAO A;  2FFD B;  4ZMD A;  1KX7 A;  4TT3 H;  3H1L J;  1GD2 E;  2FRC A;  2NRG A;  1Q2N A;  1S2E A;  1GU2 A;  3AEE C;  3E7K A;  2IZ1 A;  2CE0 A;  2VRS A;  1OW8 A;  2WSS H;  4IFF A;  1Q82 Q;  1IZN B;  4GDO A;  1NYH A;  4C7N B;  3SFD C;  2QE7 H;  4K3I A;  1JMB A;  1FJK A;  2KYV A;  2OTL P;  2GM4 A;  2A45 H;  1UIX A;  1L9B C;  4YXD C;  1RF1 C;  1NWQ A;  1CO6 A;  2IBZ E;  1A02 F;  1PZQ A;  2HV4 A;  3ZOW A;  4ZKU A;  1S6V B;  2JO1 A;  1JCD A;  1NU1 G;  3DMI A;  2N18 B;  2W83 C;  1NHL A;  1AOF A;  1KYO E;  1NU1 J;  2PRR A;  2I8F A;  3L75 G;  4WY4 D;  4GED B;  1CC5 A;  4KJM A;  1F1C A;  2L4D A;  1OWA A;  2JWD A;  2OYH C;  1KN7 A;  4EI2 A;  2E74 C;  1VQ4 P;  3CME P;  3SLE A;  4OH8 B;  2FYN C;  2WPR A;  1IK7 A;  1A8C A;  1NTM G;  4H13 B;  3Q5R A;  4DT0 A;  5CIE B;  3VTP C;  2QM8 A;  4H44 B;  1NTM J;  2ORL A;  1R0Q A;  1JEK A;  1FJ0 A;  1CHH A;  2OQQ A;  2FBW C;  1SQQ K;  1I5T A;  1RY3 A;  3V4W A;  3T97 A;  2XKM A;  4NFG B;  2C8S A;  1YEA A;  5CIF B;  1FOS F;  3H1H E;  4H0L D;  2ZXE B;  1WMK A;  1EC5 A;  1IFM A;  1B7V A;  1NKN A;  1K9M Q;  3A7O A;  3HE4 A;  2GA1 A;  2W27 A;  4M3L A;  1JY2 P;  3CMA P;  1CRI A;  1L4A D;  5AW1 B;  3H1J E;  5CHX A;  3NBT A;  4D6T D;  1H9Y A;  2KP8 A;  3L73 D;  2E74 B;  3M9H A;  1N7S C;  1URQ C;  5H2F V;  1CHI A;  2WZ7 A;  2E75 B;  1VQ9 P;  2Z5H A;  3TNU A;  2BEQ D;  1FDM A;  1FDO A;  3AEF C;  5M1B A;  5TIS E;  1NOH A;  1P84 I;  3H32 B;  1VPC A;  1SQB K;  2O01 H;  2JJL A;  1X0T A;  1LTB C;  1CIF A;  3EQ2 A;  2C9N Y;  3L71 J;  4OVN F;  4HB1 A;  1S9K D;  3D6Y A;  3RMZ A;  3HTK A;  3Q5P A;  3CCR P;  3L74 J;  3OA8 A;  1HJ4 A;  3CL3 D;  1C2N A;  3L4F A;  1SQV D;  3QWO C;  2WWW A;  4GT1 A;  2E43 A;  5B5E H;  1SQQ D;  2M0B A;  2WSE J;  1N7S B;  1CW5 A;  3SWY A;  3CPW O;  1NAF A;  3CCS P;  1I8P A;  3B5N D;  4DCK A;  2R3S A;  2NZ2 A;  1IO4 A;  3SFE C;  2Q1K A;  1YJ9 P;  4TLF A;  1I6D A;  1N73 C;  1JUN A;  2ZON G;  1I8O A;  4EOT A;  3HQ9 A;  4FAN A;  4I6M C;  1GW4 A;  2N3Y A;  3V4Q A;  2BEZ F;  1HCM A;  1PGO A;  2CXB A;  4FB1 A;  1RF0 C;  3B8E B;  1A02 J;  1LJ2 A;  4DJG A;  3RK2 C;  2IBZ D;  1YHQ P;  3WFE C;  3R4Y A;  1MFT A;  3BCC G;  3JCU H;  3T97 B;  1LTS C;  1IRV A;  3BCC J;  2AXT V;  1JY2 O;  1SQX J;  2GUV A;  1YIQ A;  2FKW B;  1KYO D;  3HE4 B;  1M70 A;  3MTU E;  1H8A A;  1M1J C;  5CCG A;  2JQR A;  2A45 I;  5APV A;  2WPQ A;  2P67 A;  3NBS A;  3VP9 A;  3VMZ A;  3V6I A;  1FZC C;  3D70 A;  1FZE A;  1BDD A;  2FYU D;  1ZZH A;  2E74 D;  2FY8 A;  4WBA A;  5KAF E;  3TNU B;  4L3H A;  4DY9 A;  3MIW A;  1L9J C;  1SFC A;  3PHL A;  1HJ0 A;  1YJN P;  351C A;  2V4H A;  1LT9 A;  4LC1 A;  3C9I A;  3A9F A;  4AAN A;  4EIE A;  3SWS A;  3HTK B;  4FA1 A;  3WMM 0;  2E42 A;  3H1J D;  1OAE A;  3O6Q A;  1KC8 Q;  1HJB A;  4J20 A;  1CRC A;  1LC1 A;  2PAC A;  2OZ1 B;  3P32 A;  1I6E A;  2B10 B;  3PRJ A;  3TYI A;  2QJY C;  3HUS C;  3UIA A;  1L0L D;  2B9B A;  2FXO A;  1C2R A;  4CPG A;  5CIG B;  1BGY E;  2IYO A;  4XA4 A;  1QL1 A;  1URQ D;  1A2S A;  1K3H A;  2L91 A;  4WQD A;  4PD4 H;  2H7H A;  1GTW A;  1NTK E;  3ZOO A;  4K35 A;  2BPB B;  1NTZ J;  4EIF A;  1CSB A;  2KLV A;  2Z4E A;  2WT7 B;  5KLV E;  2CE1 A;  1LT9 C;  3TGU J;  3W67 A;  1SQX E;  1YIC A;  3CXH H;  2A06 E;  2YMY A;  1VYD A;  3NMD A;  3OAK A;  2FXM A;  1S3J A;  1NMI A;  1IFJ A;  5AVR B;  1VQP P;  155C A;  1AVY A;  1SQP G;  2N1T C;  4WY4 A;  1BE3 E;  1SQP J;  3U59 A;  5AVZ B;  1JDL A;  1PP9 G;  2YMK A;  3GF3 A;  3ZCF A;  2Y0E A;  1HGZ A;  3O20 A;  3RBX A;  1WVE C;  1FS0 E;  2Q6Q A;  3NXS A;  1SP4 A;  4R4M A;  5KJ7 C;  1CRG A;  2HLO A;  1K73 Q;  1SFC B;  1EZV G;  5AVY B;  2KNC A;  4I7Z B;  1LT9 B;  3I55 P;  3KYQ A;  1GK6 A;  1IFP A;  1LWU A;  3RK2 D;  3A3Y B;  1K05 A;  2AXT H;  2BCC J;  5KAI E;  4H0K A;  3O6Q B;  3N4X A;  3TK1 A;  1MKM A;  2CA4 B;  1L4A A;  1RHZ B;  1GIW A;  1T2K C;  4LLH A;  3VMY A;  4JPZ B;  1RQU A;  2MHM A;  1ZR4 A;  5KLV K;  1DEE G;  2KIK A;  4OGQ C;  2WTY A;  1KQF B;  1BCC J;  1BL9 A;  1PGQ A;  3HQ7 A;  4B86 A;  1PPJ E;  3BAT A;  5E79 E;  1VQ6 P;  4AAL A;  5AW6 B;  1H32 A;  2OTK E;  3L72 G;  3ZDM A;  3L71 D;  1FBM A;  4O9B A;  3L72 J;  2C1D A;  1ZP0 C;  3L74 D;  4QMA A;  1ZXG A;  3AE1 C;  1M7L A;  1M57 D;  1KB9 H;  1GU4 A;  1VQO P;  1KOR A;  3HE5 A;  3PH0 A;  2NPS C;  2LIT A;  1QVF O;  1KV4 A;  3M91 A;  3PJS K;  4C7N A;  1IFN A;  3O8Z A;  4HH2 A;  3NFQ A;  2OYO A;  1L0N E;  1C7M A;  2OTJ P;  3AED C;  3B5N A;  4AUW A;  1OCD A;  3WFD C;  1FZA A;  3CWB E;  4WY4 B;  1NTK D;  4IL6 E;  2K88 A;  1HRC A;  4Z1M H;  4N78 D;  1MZ9 A;  1I54 A;  3ZBM A;  2QRX A;  2NPS B;  1SQB G;  3L36 A;  5AVV B;  1C6S A;  1YEB A;  3L70 J;  1SQX D;  3P7K A;  1C75 A;  2N9Y B;  1SQB J;  3II6 A;  2WMM A;  3L35 A;  4LJI A;  1D7M A;  2KNC B;  3CYT I;  1XTC C;  4UB8 V;  2H88 C;  3V2R A;  3A0B E;  3V2N A;  3PXS A;  2IYP A;  1MFZ A;  2AI5 A;  1RF1 A;  3M0D A;  3A2A A;  1DVH A;  4BWN A;  2Q7C A;  1J1E C;  1HUC A;  3VYI A;  1L4A B;  1MG3 D;  1BSN A;  1HF9 A;  3CXH E;  3PTZ A;  3AEG C;  2XZR A;  2N1T D;  2ZFC A;  1M1K Q;  2M5A B;  3H1H G;  3LIE A;  5CJ4 A;  2OYH A;  1RE3 C;  1NML A;  1EDK A;  3NTN A;  1SQV E;  4PV1 C;  3PP5 A;  1KIB A;  1S5L X;  3SXT A;  4AAM A;  5DJQ C;  3HQ6 A;  1LP1 A;  5KJ7 D;  2XTS B;  5CIH B;  1OZH A;  2ZYA A;  3H32 A;  1IQC A;  4C46 A;  5GTH E;  2KLU A;  4WQ7 A;  3HE5 B;  1QN2 A;  2B88 A;  1GDT A;  1J1E B;  1KYO W;  2L5G B;  1LTG C;  1USE A;  3V2P A;  5B66 V;  2AEF A;  1ZOY C;  4C7R A;  1PPJ D;  1KFM A;  1T6A A;  3VN0 A;  1VQK P;  3WU2 V;  2AXT E;  1GJQ A;  1T2K D;  4XYD B;  1Q81 Q;  4WVZ A;  1FCD C;  3M0D C;  3B5N B;  1PFI A;  3OCD A;  1N7S A;  2KZJ A;  3KDP B;  1HJ5 A;  1RAP A;  1JY2 N;  1URQ A;  2IBZ I;  2AEM A;  2BAS A;  4OGQ D;  1L2P A;  4YPC A;  1SS1 A;  2QJP B;  3A0H E;  3K5B A;  2ZVO B;  3M0A A;  1KIL D;  1CTZ A;  1VQ5 P;  1VQN P;  1KYO I;  3L75 J;  1YQ4 C;  3TGU D;  2YKP A;  4WQ9 A;  4U3F E;  1AFO A;  4UB6 V;  3G71 P;  5CJ0 A;  1IJD B;  1SQV K;  1L0N D;  2NPS D;  4GOD A;  3AE4 C;  2FYU E;  2B11 B;  4EYY Q;  3CWB D;  1YTZ T;  3WFC C;  3U1C A;  1RF1 B;  2WSE H;  3L37 A;  2KK7 A;  1LTJ C;  2J58 A;  1EDL A;  3MUD C;  3RN0 A;  4I2L C;  1N7L A;  3X39 A;  1COT A;  2ZXY A;  2D0S A;  3DP5 A;  1J2J B;  2J59 M;  1FE6 A;  1UII A;  1X8Y A;  1C6O A;  1QL4 A;  3CX5 H;  4Y5R A;  1N73 A;  2OYH B;  3ZOX A;  1LC2 A;  3C1L A;  1KX2 A;  3BAS A;  1FI7 A;  4PD4 D;  2FYN B;  1K04 A;  2YXR B;  4AQR D;  1USD A;  1PIX A;  1CRH A;  5AVU B;  1DD3 A;  1L0L E;  1DW0 A;  1NO4 A;  4JYC A;  4ZKP A;  1RF0 A;  1YJW P;  3D6Z A;  5C9M A;  1LP1 B;  1ZME C;  2D2C C;  1OMI A;  4WQB A;  3H1L E;  4UB8 H;  1VQL P;  1M6Z A;  4FA4 A;  1K3G A;  1EQ7 A;  1OVR A;  4GKG A;  5KKZ C;  1QYZ A;  3CXH D;  1T8Z A;  1QL3 A;  1W5C T;  2AEJ A;  1JB0 J;  2R3C A;  1LTJ B;  2B87 A;  1BCC D;  5CBN A;  2QJK C;  5BU8 B;  1CRY A;  4XE5 B;  3VP8 A;  1S72 P;  3O0R C;  1HGV A;  2KSJ A;  1M1J A;  2OZ1 A;  1AJY A;  2JTI B;  1M56 D;  1VDF A;  2KOG A;  3OCD B;  2O3J A;  2FYU K;  1FZC A;  5AW4 B;  1URQ B;  2LKM A;  4P4Q B;  3H1I G;  3FXE A;  1NU1 E;  3I5C A;  3Q1M A;  3H1I J;  4PV1 D;  1JM0 A;  3CCV P;  2HPC A;  3USS A;  2D2C B;  3LID A;  1GL2 C;  1DEB A;  4WWI A;  1Q7Y Q;  3H1K G;  3RGU A;  3M9Q A;  1A56 A;  1BGY G;  3H1K J;  2ZVN B;  2IFM A;  1K8A Q;  1DII C;  5BU5 A;  2M3E A;  1NTM E;  2WT7 A;  2ZXX A;  2QJK B;  3CP5 A;  1FOC A;  4GYD A;  2I1K A;  3OA7 A;  3SSU A;  1L0L K;  3VMX A;  3WU2 H;  3HUS A;  2JDI H;  1BDC A;  1N9C A;  2PFX A;  5KLV G;  3GHG C;  1CI6 A;  3ITK A;  4YTP C;  1C52 A;  2YKO A;  1SVF A;  1WT6 A;  2WSF J;  2HG5 D;  4U3F D;  3L70 D;  1GL2 B;  2A06 G;  5APU A;  3AE6 C;  1N73 B;  1ZV8 A;  3OJA B;  3E1R A;  3NWV A;  2UWJ E;  2PGD A;  4I1L A;  1BE3 G;  2I8D A;  5C39 A;  4EDF A;  4UB6 H;  1KB9 D;  3KPE A;  2N9I A;  4IOI H;  1RQV A;  1RH5 B;  2G8Y A;  3RK2 B;  1ZLL A;  1CTJ A;  4JQ0 D;  1NH4 A;  3WUT A;  1NU1 K;  1RZ6 A;  3D0W A;  3L71 E;  1LTI C;  1Q86 Q;  2YK3 A;  1YIT P;  4AYC A;  1CRJ A;  3L74 E;  3GHG B;  2B87 B;  2CPB A;  1U7J A;  2N1T A;  4QAO A;  3CC4 P;  2HYN A;  1M1J B;  3AE2 C;  2J5U A;  3LW5 H;  1CHJ A;  5CID B;  1OVU A;  2Y0C A;  1J1D C;  3IR9 A;  3WUU A;  1OW7 A;  5AW3 B;  1H88 A;  1FZC B;  1YTZ I;  2GB8 B;  2K37 A;  3FWN A;  1R8E A;  3P8M C;  1VQM P;  1CSU A;  2QG4 A;  3F5H A;  1VL2 A;  5AVS B;  3H1L D;  5H2F H;  5KJ7 A;  3MZW B;  4PWA A;  2HPC B;  4PJ0 V;  5AW5 B;  2M8R A;  4HKZ H;  3ZIY A;  3V5B A;  4AAO A;  3RK3 D;  2D2C D;  3CLQ A;  1IK9 A;  5BVZ A;  4N78 E;  4N3Y B;  2V7Q H;  5C0Z A;  1ZRT D;  3CCQ P;  2OYI C;  3OW2 O;  2IFN A;  1QX8 A;  1Q90 D;  4JF7 A;  451C A;  3WUI A;  1AQ5 A;  4BXL A;  5TIS V;  4ZNC A;  2R44 A;  1AV1 A;  1R5S A;  3BCC E;  3H25 A;  2QJY B;  1N2D C;  3HUS B;  1J1D B;  2LXB A;  2BH5 X;  4O1Q A;  1U75 B;  4EID A;  4IFD K;  1NU1 D;  1W5C E;  2E76 C;  3L75 D;  1CI6 B;  2ZOO A;  3CD6 P;  1KIL A;  4RSZ A;  3CCL P;  1E29 A;  1RAQ A;  3LW5 J;  5B5E E;  5KTB A;  1H33 B;  1CCH A;  2B4Z A;  3TF5 A;  1NTM D;  4WQC A;  4H0J A;  1AOQ A;  2G3A A;  3B4S A;  3HD7 C;  1KQL A;  1PP9 J;  2P58 A;  1GL2 D;  3VRD A;  1FOS E;  3MGN A;  2N9J A;  3TSI A;  1CYJ A;  2NPS A;  2POH A;  3GW6 A;  2P7J A;  3PXW A;  3C8V A;  3FXD A;  1GMJ A;  4L3G A;  1KQS O;  3G4S P;  4KMG A;  1GU5 A;  4L1Q A;  4HJG H;  1H9X A;  1IRW A;  2V7Q J;  2C2C A;  3MK7 C;  2V07 A;  4D6T G;  4BRY A;  1ZR2 A;  3L73 G;  2PCB B;  4YXW H;  5AW2 B;  1NTK K;  2N1T B;  4D6T J;  1YCC A;  3L73 J;  2W6J H;  3JCU E;  2N3B A;  4WQE A;  4KHX A;  3WU2 E;  4JYB A;  2WQY C;  1W2B O;  2WPS A;  2YKQ A;  1T3U A;  1YNR A;  1OIP A;  2M5A A;  2OAR A;  3RN1 A;  3M9B A;  2YO3 A;  2KB7 P;  4V2K A;  5AUR A;  2C1U A;  1H31 B;  1SQX K;  2O1K A;  1KIL C;  5DF5 A;  2GC7 D;  1CYC A;  2Q5U A;  1AYG A;  2YIU C;  1NTZ E;  1SQV G;  4IFM A;  3KZI V;  1KIL E;  2K9Y A;  3VMA A;  4RES B;  1YTC A;  3HQ8 A;  1SQQ G;  3CCU P;  1IFD A;  5KAF V;  3M97 X;  3ORV A;  2C9X B;  1SQQ J;  1RE4 C;  3TGU E;  2H43 A;  5CIB B;  1N90 A;  1VQ8 P;  5L8R J;  2ZT9 C;  4OGQ B;  1KQG B;  1RE3 A;  3CX5 D;  1CZQ A;  1HWT C;  3CC7 P;  1KIL B;  2PP6 A;  3G3Z A;  1SQP E;  3FGA D;  2XV5 A;  3D71 A;  1DD4 A;  1VF5 C;  1NVO A;  3L4M A;  4PJ0 H;  2IBZ G;  1FI3 A;  2JR8 A;  4ASV A;  1S4X A;  2KI7 B;  5H2F E;  3L4O A;  1H0T A;  2Q3I A;  4KT0 J;  3BCC D;  4WB4 A;  3CXH W;  1CXA A;  5APS A;  4PD4 E;  1P84 H;  1EZV E;  2IPP A;  2Y0D A;  3F89 A;  5TIS H;  1M60 A;  4PD4 I;  2CA3 B;  2BCC E;  3AE7 C;  1J3S A;  1JY3 P;  4Y99 C;  4LGD E;  4BRY B;  5AW9 B;  1X79 B;  3RL0 D;  3H6P A;  3IF4 A;  2Y9Y A;  3EWK A;  1NTZ K;  1CTY A;  2E76 D;  1LFM A;  1WRG A;  1N8R Q;  3S1K A;  2FYU G;  3TDK A;  1DW1 A;  3O1Y A;  2FFD C;  2AXC A;  1CNO A;  3CXH I;  1BCC E;  3PLN A;  1IC2 A;  1RZ5 A;  3AE8 C;  2C0W A;  2CK3 H;  4W7Y A;  3AE3 C;  3H1H J;  3HRN A;  5APQ A;  1AKK A;  2JWA A;  5APY A;  3HD7 D;  2RN0 A;  4Y28 J;  5TJH A;  1L0N K;  3L72 E;  1AVO A;  3H1J G;  3P8C D;  1HBW A;  4NPF X;  3H1J J;  3JBT B;  1F1F A;  2QA4 P;  1PL5 A;  4GOE A;  2XU6 A;  5IY5 1;  1HJ3 A;  1LS9 A;  1L0L G;  4WQ8 A;  2N18 C;  1LTJ A;  3AE9 C;  3MUD A;  2IZ0 A;  2ZYD A;  3DR0 A;  3E1I A;  1FDI A;  2M3B A;  3S9O A;  2I1J A;  3BRV B;  1T3J A;  2O01 N;  1PGJ A;  2RH0 A;  1TU3 F;  4PV1 B;  5KAI V;  4H13 C;  4IL6 X;  1YYC A;  4H44 C;  4JCG A;  5DJQ B;  1NTZ D;  2FYZ A;  2B0Z B;  1HVV A;  1MUU A;  3WC8 A;  3ZOY A;  3WFB C;  4ASW A;  5B6Q A;  2K9J A;  1LNQ A;  5CYT R;  2P1J A;  1H0T B;  5E79 V;  3L70 E;  3KZI H;  1FAV A;  4K3A A;  2D0W A;  1SQB E;  1C6R A;  3Q2Y A;  1E5W A;  1JY3 O;  5KAF H;  1S5L V;  1DX7 A;  3AEA C;  1YIJ P;  3MD0 A;  2E5T A;  4MU8 A;  2QVA A;  2KUB A;  2YXQ B;  1MV8 A;  1KB9 E;  1FI9 A;  4HYT B;  1SQP D;  1DIP A;  1WEJ F;  1KZU B;  1KB9 I;  2ZT9 D;  1M8O B;  2E75 C;  2KS1 A;  3G9R A;  5EXQ A;  1PP9 D;  1KV9 A;  5CCH C;  1NKZ B;  1NNO A;  4NPD A;  3AEC C;  1GL2 A;  1VF5 D;  5AW8 B;  1EXI A;  2K1A A;  1EZV D;  3TYY A;  2EXV A;  1FZG A;  5AVW B;  2C9L Y;  2A45 G;  2BCC D;  1LT1 A;  4PJ0 E;  4IL6 V;  3AE5 C;  3IN6 A;  1DW3 A;  3RK3 C;  4NPE A;  4L75 A;  3IFM A;  2WPV B;  3SVW A;  1GW3 A;  3GHG A;  1P84 E;  1FZB A;  2H89 C;  5DJT B;  3SJL A;  3RK3 E;  2B89 A;  2XND H;  4PW9 B;  1DH3 A;  1E79 H;  2WSF H;  1ZRT E;  3L71 G;  4WQA A;  3A0B V;  2YQB A;  1NAY A;  2BH4 X;  3U1A A;  1FZF A;  1YI2 P;  1DT1 A;  3L72 D;  1DVV A;  3L74 G;  2V08 A;  1X22 A;  5APW A;  1Y8A A;  1OW6 A;  1ZN5 A;  1IFI A;  1YFC A;  5GTI V;  3L75 E;  1YQ3 C;  3RK3 B;  2ZAE B;  3CI9 A;  5KLI C;  4O1W A;  3R2P A;  2K9J B;  2XNX A;  3GLM A;  1I55 A;  5KKZ B;  2IX7 C;  1Y47 A;  1DIQ C;  1BGY J;  1X9V A;  1AQT A;  1CYI A;  1EB7 A;  2W8Z A;  1LTT C;  5APT A;  1QL2 A;  2AIU A;  2P10 A;  5B66 H;  3CCJ P;  1NTK G;  1CXC A;  1EDI A;  1JMM A;  1N50 A;  5GTH V;  1NTK J;  3S4R A;  5DFS A;  3WUV A;  4N6J A;  5AVX B;  3VYM A;  2KS1 B;  2ZBO A;  5KAI H;  5KLV J;  2C0X A;  1FC2 C;  2HR3 A;  2K3R A;  4H13 D;  1OX3 A;  2O01 J;  3CCM P;  2BCN B;  3JC2 2;  2PAJ A;  1SQX G;  4XXL A;  4H44 D;  2YCC A;  5KLI B;  4U7J A;  5AW0 B;  5APX A;  1SQB D;  1JNM A;  1H33 A;  2P2U A;  2W6B A;  5CIC B;  2E5Y A;  1SLQ A;  1JCC A;  3CC2 P;  5E79 H;  5EFW B;  2Q3E A;  3A0H V;  2OYI A;  1BSH A;  1BE3 J;  1HH0 A;  3MHV A;  1MG2 D;  2MTA C;  1S5L H;  2CPS A;  1U74 B;  1YBK A;  3PXT A;  1QVG O;  3KZI E;  2N9B A;  3Q3D A;  1N86 A;  4XFJ A;  3CU4 A;  1CED A;  1CIE A;  2DVH A;  1CCR A;  3CX5 W;  2H8P D;  1CSW A;  3H1H D;  1CIG A;  3AEB C;  2E75 D;  1CIH A;  1W2L A;  1NTM K;  2FWL A;  1G1J A;  5CCH D;  2C1V A;  1W2E A;  3HD7 A;  2QSI A;  3I56 P;  4W80 A;  3OA8 B;  2QM7 A;  3H1I E;  1XTG B;  1H31 A;  1ZW0 A;  2Y9Z A;  3CX5 E;  4IL6 H;  1JTH A;  2GUS A;  5AW7 B;  3CX5 I;  1PGP A;  1P84 D;  2W90 A;  3H1K E;  2IDB A;  1PPJ G;  4RJT A;  1GQ1 A;  2MKV A;  1N7S D;  1CSX A;  3CCE P;  2ITA A;  3A5T A;  1FHB A;  3C2C A;  5CCG C;  4UB8 E;  2JEE A;  4RKU J;  2W6A A;  1N15 A;  1R5L A;  1NTZ G;  3QH9 A;  3SWF A;  3RL0 C;  3A0B H;  2XDJ A;  2PCC B;  1QKS A;  1E8E A;  1JOC A;  2WIT A;  3FX0 A;  4OWF A;  1SFC C;  3TGU G;  1DW2 A;  1OFC X;  1HZU A;  4I7Z C;  1IZL 0;  3GG2 A;  4EIC A;  1LTA C;  3KXD A;  5GTI H;  2Q9I A;  1PV3 A;  3EFF K;  1L0N G;  2YO2 A;  1NIR A;  1HZV A;  1L0N J;  2HOD A;  3CWB G;  4FAV A;  1Z56 A;  1QEX A;  3MP7 B;  1S1C X;  1KMI Z;  2OYI B;  3CWB J;  2VHD A;  1RE4 A;  2DGE A;  3RBZ A;  1M90 Q;  1FJP A;  1AA0 A;  2ZYG A;  2BGV X;  2KXP B;  3RL0 B;  3EFG A;  2B12 B;  4A7P A;  2E76 B;  5GTH H;  2ZZS 1;  3P8C E;  3N7N A;  5CBO A;  2QIW A;  1OVV A;  5B66 E;  3G6E P;  2LXC B;  1HRO A;  3KQG A;  1EXJ A;  3SWK A;  4DZO A;  5DJU B;  3PH2 B;  1NGM B;  2BCC G;  2WVR A;  2R5B A;  3HD7 B;  4RO0 A;  1G1I A;  5K5G B;  1GKS A;  2Z5I A;  1H1O A;  5CMZ A;  1KTM A;  1H89 A;  3KHU A;  2RMZ A;  3A0H H;  4AX3 A;  3RLM A;  4EIJ A;  1JTH B;  1EDJ A;  1KYO H;  1BCC G;  3FWL A;  1LGH B;  3B71 A;  3M06 A;  3W68 A;  4UB6 E;  1GZL A;  3MK7 B;  1G2C A;  4WY4 C;  2GC4 D;  1SQV J;  1HTL C;  1QLE D;  2KSE A;  1S5L E;  1E2R A;  1MZ4 A;  1COR A;  3V2Q A;  1JY3 N;  3BRT B;  3RL0 g;  2SPZ A;  2FFD A;  3H1I D;  3JSV C;  1Y9B A;  3O5C A;  2MJZ A;  4R4L A;  2RKL A;  1OXZ A;  4GIF A;  4W7Z A;  3H1K D;  4L76 A;  4JBZ A;  4H0L C;  1BGY D;  4L74 A;  4Q5P A;  1LWU C;  1PP9 E;  1JO5 A;  2YIU B;  4L73 A;  1LMS A;  2HOD B;  1HH7 A;  2ZJS E;  4MN4 C;  1VQ7 P;  3VOP A;  1L4A C;  2WSC H;  2GIW A;  4YE1 A;  2KZI A;  2HFE D; 
#chains in the Genus database with same CATH homology
 3ITK A;  1C52 A;  5KLV D;  1JDL A;  2KS1 A;  5EXQ A;  1PP9 D;  1KB0 A;  4U3F D;  3L70 D;  3ZCF A;  2Y0E A;  1KV9 A;  2BLF B;  2A06 D;  3O20 A;  1WVE C;  1NNO A;  1CSV A;  3NWV A;  1CRG A;  3VNW A;  4EDF A;  1KB9 D;  1BE3 D;  2N9I A;  1EZV D;  2EXV A;  4FA9 A;  1CTJ A;  1GDV A;  1ETP A;  2BCC D;  4IL6 V;  1RZ6 A;  1DW3 A;  4H0K A;  2YK3 A;  2CA4 B;  5B5E V;  1CRJ A;  1GIW A;  3SVW A;  2MHM A;  4QAO A;  2LIR A;  1H32 B;  3SJL A;  1CHJ A;  5CID B;  1BL9 A;  3HQ7 A;  2Y0C A;  4PW9 B;  4N0K A;  4AAL A;  2C1D B;  1H32 A;  2GB8 B;  4WQA A;  3A0B V;  4FA5 A;  2YQB A;  2BH4 X;  3L71 D;  1IO3 A;  1DT1 A;  3L72 D;  1CSU A;  1KX7 A;  2QG4 A;  1DVV A;  3H1L D;  2C1D A;  2V08 A;  3L74 D;  2FRC A;  4PWA A;  1GU2 A;  4PJ0 V;  1YFC A;  2CE0 A;  3ZIY A;  4AAO A;  5GTI V;  2LIT A;  4O1W A;  4K3I A;  2K9J B;  5C0Z A;  1ZRT D;  1I55 A;  1L9B C;  5KKZ B;  1DIQ C;  1CO6 A;  451C A;  3WUI A;  5TIS V;  1CYI A;  2HV4 A;  1EB7 A;  3ZOW A;  1S6V B;  2QJY B;  1C7M A;  2BH5 X;  3DMI A;  1OCD A;  2N18 B;  4O1Q A;  1U75 B;  2AIU A;  3WFD C;  4EID A;  1NU1 D;  1AOF A;  2I8F A;  4GED B;  1CC5 A;  1CXC A;  3L75 D;  1F1C A;  1N50 A;  1NTK D;  2ZOO A;  2L4D A;  5GTH V;  1HRC A;  5DFS A;  4RSZ A;  3VYM A;  1E29 A;  2ZBO A;  1RAQ A;  3SLE A;  1I54 A;  1A8C A;  1H33 B;  3ZBM A;  1CCH A;  2B4Z A;  3TF5 A;  5CIE B;  1NTM D;  2BCN B;  4WQC A;  4H0J A;  1AOQ A;  4XXL A;  2ORL A;  2YCC A;  1R0Q A;  1YEB A;  5KLI B;  1FJ0 A;  1SQX D;  1C6S A;  3VRD A;  1SQB D;  1CHH A;  1C75 A;  1H33 A;  2N9Y B;  2N9J A;  1I5T A;  4LJI A;  2KNC B;  1CYJ A;  5CIC B;  4NFG B;  3CYT I;  4UB8 V;  2C8S A;  1YEA A;  3GW6 A;  5CIF B;  3PXW A;  3PXS A;  1B7V A;  2Q3E A;  3A0H V;  2AI5 A;  4L3G A;  4KMG A;  1DVH A;  1MG2 D;  2MTA C;  4L1Q A;  1H9X A;  1IRW A;  1U74 B;  2C2C A;  3MK7 C;  3PXT A;  2V07 A;  1CRI A;  1MG3 D;  3NBT A;  4D6T D;  2PCB B;  3PTZ A;  1H9Y A;  1YCC A;  3L73 D;  3CU4 A;  1CED A;  2N3B A;  4WQE A;  1CIE A;  2DVH A;  1CCR A;  5H2F V;  3CX5 W;  1CHI A;  1NML A;  1CSW A;  3H1H D;  1CIG A;  1CIH A;  1YNR A;  1W2L A;  1KIB A;  3RN1 A;  3SXT A;  4AAM A;  4V2K A;  2FWL A;  5AUR A;  2C1U A;  2C1V A;  1H31 B;  5DJQ C;  3HQ6 A;  5DF5 A;  2XTS B;  5CIH B;  1CIF A;  2GC7 D;  3OA8 B;  1CYC A;  1H31 A;  1IQC A;  3RMZ A;  4WQ7 A;  3OA8 A;  1AYG A;  1QN2 A;  1HJ4 A;  1C2N A;  3KZI V;  1KYO W;  3VMA A;  1YTC A;  1SQV D;  3HQ8 A;  1P84 D;  5KAF V;  3M97 X;  3ORV A;  5B66 V;  4RJT A;  1SQQ D;  2C9X B;  1PPJ D;  1GQ1 A;  3WU2 V;  1CSX A;  1GJQ A;  4XYD B;  5CIB B;  1N90 A;  1FHB A;  1FCD C;  3C2C A;  1I8P A;  3OCD A;  1HJ5 A;  1RAP A;  1N15 A;  2QJP B;  3CX5 D;  1I6D A;  2ZON G;  1I8O A;  3HQ9 A;  1CTZ A;  4FAN A;  2PCC B;  1QKS A;  2N3Y A;  1E8E A;  1HCM A;  3L4M A;  1DW2 A;  2CXB A;  3TGU D;  4FB1 A;  1HZU A;  1IZL 0;  4WQ9 A;  3GG2 A;  4UB6 V;  1FI3 A;  4EIC A;  2IBZ D;  3L4O A;  3WFE C;  1NIR A;  1HZV A;  1L0N D;  3BCC D;  1IRV A;  3CXH W;  1CXA A;  2AXT V;  2B11 B;  4FAV A;  1YIQ A;  3CWB D;  1KYO D;  3WFC C;  1M70 A;  2Y0D A;  1M60 A;  2VHD A;  2DGE A;  2CA3 B;  1J3S A;  3RN0 A;  2BGV X;  2JQR A;  3X39 A;  1COT A;  2ZXY A;  2D0S A;  3DP5 A;  3NBS A;  2B12 B;  4A7P A;  1CTY A;  2ZZS 1;  1LFM A;  1C6O A;  1QL4 A;  4Y5R A;  3TDK A;  1DW1 A;  3ZOX A;  2FYU D;  3O1Y A;  1LC2 A;  1ZZH A;  1CNO A;  1KX2 A;  1HRO A;  1FI7 A;  4L3H A;  2FYN B;  4PD4 D;  3PLN A;  4DY9 A;  1RZ5 A;  1CRH A;  3PH2 B;  1L9J C;  1DW0 A;  3PHL A;  1AKK A;  351C A;  5C9M A;  2JWA A;  2RN0 A;  5TJH A;  1GKS A;  3A9F A;  4AAN A;  4EIE A;  4WQB A;  1H1O A;  1M6Z A;  4FA4 A;  3SWS A;  1K3G A;  4FA1 A;  3H1J D;  1OAE A;  3KHU A;  2RMZ A;  1QYZ A;  3CXH D;  4AX3 A;  1QL3 A;  1W5C T;  1F1F A;  3JBT B;  1CRC A;  4J20 A;  3RLM A;  1LC1 A;  2PAC A;  2OZ1 B;  1BCC D;  3FWL A;  1I6E A;  2B10 B;  5IY5 1;  1HJ3 A;  1LS9 A;  3TYI A;  3PRJ A;  4WQ8 A;  1CRY A;  1L0L D;  2N18 C;  3O0R C;  3MK7 B;  2OZ1 A;  2GC4 D;  1C2R A;  3DR0 A;  5CIG B;  2JTI B;  1E2R A;  3OCD B;  2O3J A;  1MZ4 A;  1COR A;  1A2S A;  1K3H A;  4P4Q B;  2L91 A;  3H1I D;  4WQD A;  5KAI V;  3O5C A;  3ZOO A;  4JCG A;  2BPB B;  5DJQ B;  1NTZ D;  4EIF A;  2B0Z B;  3H1K D;  1A56 A;  3WC8 A;  3ZOY A;  3WFB C;  1BGY D;  2CE1 A;  4Q5P A;  5B6Q A;  1DII C;  5CYT R;  5E79 V;  2QJK B;  2YIU B;  3CP5 A;  1YIC A;  1FOC A;  2D0W A;  1C6R A;  1LMS A;  4GYD A;  1HH7 A;  1VYD A;  1NMI A;  1S5L V;  2GIW A;  155C A;  4MU8 A;  1N9C A;  4YE1 A;  1FI9 A;  1SQP D;  1WEJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...