2A06D

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2a06D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2a06D02
1I8PA 3PTZA 3PXTA 4EIFA 1QL4A 3WC8A 1HJ3A 3L75D 3VYMA 1I6DA 1ETPA 1GQ1A 1DIIC 2ZONG 2FYNB 2AIUA 1KX2A 2BCCD 3OA8B 1L0ND 3TF5A 1RZ6A 1A8CA 2PACA 4KMGA 4WQBA 1I5TA 1FI7A 2JTIB 1H1OA 1N9CA 3H1JD 2Y0EA 1QKSA 1NMLA 2V08A 2Y0CA 1C52A 4AAMA 4XYDB 4RSZA 1YCCA 2GC7D 1YFCA 1H32B 5CIHB 3O0RC 2OZ1A 2L4DA 1CRCA 1W2LA 1COTA 1BCCD 1DW2A 2D0SA 2ZOOA 1SQBD 1U74B 1LS9A 3WFCC 2FRCA 3A0BV 4FA9A 4A7PA 1C7MA 2CE1A 2QJPB 5CYTR 1BL9A 2BLFB 3WFEC 4JCGA 2D0WA 4WQDA 3GG2A 3KZIV 1RAQA 1M6ZA 3PHLA 4K3IA 5KLVD 1IRVA 5DF5A 4DY9A 3SLEA 1KB9D 5KKZB 1E2RA 3WFBC 1HZVA 3VNWA 4H0KA 2C1DB 1CHIA 1YIQA 5AURA 3GW6A 1L9JC 1NTZD 1YTCA 1FCDC 3O1YA 451CA 5C9MA 1CRGA 2Q3EA 1KYOW 1LC1A 1OAEA 3KHUA 3HQ8A 2O3JA 1M70A 1K3HA 2N18B 2B11B 4MU8A 4PJ0V 1C6OA 1IZL0 1A56A 2C1DA 1CIFA 3PLNA 2HV4A 3VRDA 4EIDA 5TISV 2B0ZB 1SQVD 1NTKD 3O5CA 1LFMA 5TJHA 1CYCA 3C2CA 1CNOA 1CYJA 2C1UA 1H9XA 2GC4D 4L3HA 1ZZHA 1CRHA 4GEDB 4LJIA 2KNCB 1CO6A 2GB8B 3ORVA 3ZBMA 1YEBA 4N0KA 3TDKA 1DIQC 3A9FA 5B6QA 2B4ZA 1B7VA 5DJQC 1CSWA 3CX5D 3PRJA 2N9YB 2BH5X 2OZ1B 3L70D 5KAIV 1BE3D 4V2KA 1YEAA 1NIRA 2RN0A 1LMSA 1ZRTD 3L73D 4O1WA 1A2SA 3VMAA 1E29A 1HROA 2BH4X 4WQ7A 4FA4A 4H0JA 1K3GA 2B10B 2N18C 3MK7B 4EICA 1CC5A 1C6RA 5CIGB 3CXHW 1WVEC 4WQCA 4FB1A 1HRCA 2IBZD 1CCHA 1HH7A 1I54A 1H33A 4RJTA 5DFSA 2BCNB 4NFGB 1M60A 1F1CA 4EDFA 5DJQB 1C75A 2LITA 1H9YA 1GIWA 2CA3B 3L4MA 3ITKA 3X39A 4L3GA 1CSVA 2N3BA 2QJYB 2Y0DA 2CA4B 1CRIA 3L72D 4U3FD 2LIRA 1CXAA 1U75B 1WEJF 5CIFB 4UB8V 1IRWA 2DVHA 3HQ7A 2N9JA 2YQBA 1N50A 3SXTA 3WU2V 3ZCFA 1KX7A 1GDVA 3TGUD 3RMZA 1DW0A 1BGYD 4WQAA 3NWVA 3PH2B 3WFDC 1SQQD 1HJ5A 2YCCA 2JWAA 1MZ4A 1JDLA 5EXQA 2BGVX 4Y5RA 3H1LD 1CHJA 1J3SA 3MK7C 1NMIA 4P4QB 1R0QA 1CCRA 4FAVA 3H1KD 2N9IA 1NTMD 4WQ8A 2EXVA 1W5CT 3CU4A 1CRYA 1S5LV 5H2FV 2K9JB 5CICB 4AAOA 3PXWA 2KS1A 4XXLA 4O1QA 3PXSA 1S6VB 1VYDA 1CIGA 4AANA 3OCDB 1H31B 3DP5A 3WUIA 2MHMA 1DW1A 1EZVD 3H1ID 2ZBOA 1KIBA 2YK3A 5IY51 2V07A 5GTIV 1OCDA 1P84D 1CSXA 1MG3D 2QG4A 1SQPD 3NBTA 1C6SA 1RZ5A 1HJ4A 3ZOOA 2CXBA 1CRJA 1I6EA 1KB0A 1DT1A 2B12B 4WQ9A 1F1FA 3DR0A 1PP9D 3OCDA 1H33B 1H31A 4J20A 4PWAA 3O20A 3DMIA 4AX3A 3L71D 3TYIA 1LC2A 1CXCA 1CSUA 2C8SA 3H1HD 4FA5A 1NNOA 1CIHA 2N3YA 2AI5A 1CORA 3ZIYA 5CIBB 1AOQA 1HZUA 1MG2D 1FOCA 1CTZA 351CA 2PCCB 2ZZS1 2CE0A 2FWLA 5GTHV 1GJQA 1PPJD 3CP5A 1IO3A 4GYDA 4Q5PA 3ZOXA 1KYOD 1C2NA 3CX5W 3ZOWA 1I55A 1RAPA 1N90A 3HQ6A 3OA8A 3HQ9A 1CYIA 2C1VA 4L1QA 1CHHA 3SWSA 1KV9A 2BPBB 2ORLA 1GU2A 2DGEA 4EIEA 4YE1A 4AALA 1HCMA 1N15A 1FI3A 2AXTV 1H32A 2I8FA 3SJLA 1DVVA 1L9BC 2A06D 5C0ZA 4QAOA 3NBSA 1NU1D 1E8EA 4PW9B 1L0LD 1SQXD 2PCBB 1CTJA 1QN2A 2C9XB 3L74D 5E79V 5KAFV 3RLMA 1FI9A 2VHDA 2YIUB 5CIDB 3RN0A 1QL3A 3CWBD 1FJ0A 1YNRA 2GIWA 3ZOYA 1IQCA 3FWLA 2XTSB 3L4OA 1CTYA 1YICA 2C2CA 2FYUD 4IL6V 3RN1A 5B5EV 4UB6V 3BCCD 2RMZA 2MTAC 1CEDA 2JQRA 3A0HV 1FHBA 4D6TD 4WQEA 3M97X 4PD4D 1I8OA 4FANA 1GKSA 1DVHA 155CA 1AKKA 1EB7A 3CYTI 4FA1A 2L91A 5CIEB 2QJKB 1C2RA 5KLIB 1DW3A 3JBTB 1CIEA 2ZXYA 1AYGA 3CXHD 1QYZA 5B66V 1AOFA 3SVWA
chains in the Genus database with same CATH superfamily
1PGOA 4WWIA 3CX5I 1CI6B 4EIFA 4U7JA 3ABVC 5KJ7C 3L75D 3TGUJ 1JNMA 1ETPA 1SFCA 1Z56A 1GQ1A 2XV5A 2OYOA 2AIUA 2K3RA 4WQBA 1FI7A 2JTIB 2Y0EA 1CI6A 2XDJA 3MHVA 1Q82Q 1GZLA 3FWNA 3B71A 4LLHA 2OTLP 1GL2B 1T8ZA 3H1KJ 3VOPA 5CIHB 1NTMJ 1KILB 1EQ7A 3TK1A 1CRCA 3A3YB 1W2LA 1NOHA 5E79E 5KAFE 4IFDK 2ZOOA 1J1DC 1S9KD 3RK2C 2A06G 2FRCA 3GF7A 4A7PA 3H1IJ 2CE1A 5CYTR 1K05A 3WFEC 1OW8A 3CCUP 3LW5H 1BSHA 3M9QA 2YKOA 3GG2A 3PHLA 3G71P 3CWBG 2AEFA 1JB0J 3LIDA 2E74D 3RL0C 1VQ8P 2KYVA 1FJPA 5APUA 1A02J 1NJIQ 1L4AD 2KIKA 2VRSA 3GMAA 4RO0A 3VNWA 1YQ3C 3L71J 3H1HJ 3HD7C 3KYQA 4R4MA 2WSSH 2JKVA 2Y9YA 451CA 1KYOW 5B5EH 1LTBC 1JCDA 5B66E 1KMIZ 2V7QH 3CL3D 1J1DB 4MU8A 1VQ6P 3IAOA 2QA4P 1A56A 3V2NA 1CIFA 1M1JA 3VRDA 1DD4A 4EIDA 5GTIH 2OGUA 4EI2A 2KLVA 2E76C 3PP5A 1NGMB 1NTKD 1IJDB 1CYCA 2HFED 3O6QA 1CYJA 1FAVA 2GC4D 3RL0B 1CRHA 2WSCJ 5APTA 3H6PA 2QM7A 2OTJP 1GW4A 4KJMA 3M0AA 4WB4A 1DEBA 1SVFA 3L74J 3D70A 1XTGB 3M91A 3JCUH 5CCGA 1S3JA 3L70D 1PPJG 1Y8AA 3CCEP 1HUCA 3TSIA 1FC2C 3H1LE 3GHGC 2OYIC 2K1AA 1AA0A 2FKWB 1VQNP 4GDOA 1A2SA 3VMAA 1HROA 4K35A 3B5ND 3AEBC 4JPZB 2B10B 2N18C 4GT1A 1C6RA 4PD4H 4IOIH 2NPSC 2Y9ZA 3CXHW 2YO3A 2Q1KA 2FXPA 3R4YA 1NU1G 1PGPA 2P7JA 1HRCA 1LGHB 5AVRB 1I54A 1H33A 2H7HA 5DFSA 3C1LA 3WMM0 2IFNA 2YO2A 1H9YA 1YQ4C 3ITKA 3AEFC 1RF0A 1M57D 4L74A 1FDIA 1JUNA 4I2LC 2Q6QA 3GHGB 2OYIB 2FYUG 1GL2D 2BCCJ 1CXAA 1JCCA 1MV8A 1KILD 2O1JA 1U75B 3BCCG 1M56D 2KI7B 1IRWA 3CMAP 1SP4A 3HQ7A 4D6TG 3D0WA 1KX7A 5APXA 3T97A 2BEZF 1JM0A 1IFMA 2R5DA 2JWAA 2ZYDA 2JO1A 3GHGA 2WSFJ 5KJ7D 4IFMA 4Y5RA 1FZAA 4H0LC 1VQ9P 2B88A 5K5GB 3MK7C 1NMIA 3L72E 2N9IA 4PD4I 1RH5B 3L75G 4WQ8A 3CU4A 2O01H 2K9JB 3PXWA 2M8RA 3OCDB 5KLVJ 1EDLA 1SQXE 3WUIA 3S1KA 5AVUB 1KIBA 1IC2A 3L73G 1OCDA 4ZNCA 4M3LA 3RL0g 3RK2D 3KDPB 2FBWC 2W90A 3OCDA 3O20A 1MKMA 3VP8A 1AVYA 4AX3A 3H1KE 4H0LB 2C8SA 1KQLA 2FYZA 3RL0D 3U59A 3MUDA 1CIHA 2N3YA 3NXSA 1GMJA 3RGUA 2WPVB 1YJNP 1OIPA 1U7MA 1SQVJ 1HWTC 1HBWA 1EZVE 3H1IE 3HD7D 2FWLA 3FX0A 3CP5A 1IO3A 1Q81Q 2CPSA 1VQ4P 1S72P 3CXHE 3CX5W 1PGQA 4DZOA 1HJBA 3HQ6A 2KSEA 1JEKA 2MJZA 2C1VA 1CHHA 1GD2E 2AEMA 1SLQA 4L76A 1P84H 3L71E 3TGUG 2IDBA 1GU5A 3MZWB 1H32A 2E76D 2I8FA 1DVVA 2Q7CA 2QJKC 2A06D 4N78E 5KLIC 4IL6E 2PP6A 3V2RA 2YKPA 1NVOA 3RK3E 3H1JE 3P7KA 4JF7A 3W67A 5H2FE 1FI9A 5CIDB 2KS1B 3CWBD 3D6ZA 2GIWA 3C8VA 1NTMG 1T3JA 4GOEA 4WY4C 1N73A 1A02F 1SQBE 1NAYA 1NH4A 3L4OA 1OVUA 1G2CA 1WMKA 4NPEA 4TLFA 2C2CA 5CBNA 4NPDA 1S5LH 4IL6V 5H2FH 2B87B 3G9RA 3D71A 3FXEA 4W80A 2E5YA 4WQEA 3WUTA 1RY3A 3L70G 1YHQP 4OGQC 2ZVOB 2LXCB 4Y99B 3L74E 5KAIH 2QJKB 2N9BA 2H88C 5KLIB 1NTMK 2KZIA 4WVZA 1VQPP 3JBTB 2PFXA 2ZXYA 2NPSD 3PTZA 3AEAC 1NTZE 1I8PA 2QJPC 2O01N 5GTHE 3PXTA 3H32A 4BXLA 4CPGA 1I6DA 3Q2YA 5AVSB 1S4XA 4QMAA 1YBKA 4WY4B 1N86A 2ZONG 1EDIA 1KX2A 1SQQJ 5C39A 4YPCA 1MFZA 1JO5A 2KNCA 4OWFA 3S9OA 3CCLP 1ZOYC 3H1LJ 1NMLA 3M0DA 2AXTE 2I1KA 3KZIE 3I55P 1N7SA 2GC7D 3V5BA 5DJUB 2P58A 3A7OA 1N2DC 1ZR2A 2L4DA 4PV1D 3P32A 1LS9A 3WFCC 3F89A 3U1CA 3I5CA 2QJPB 1FS0E 1KZUB 2BCCE 4H0LD 1E79H 4WQDA 1SQPJ 1YTZT 3KZIV 3WU2H 1IRVA 5DF5A 4UB6E 4DY9A 1DH3A 5KKZB 1PP9J 2FXOA 3G3ZA 3N7NA 1FZEA 3RK3C 3AE1C 3GLMA 3CD6P 3HE4A 5AURA 4Z1MH 1ZMEC 1YTCA 1N8RQ 4L73A 1CRGA 1OAEA 2W6JH 2O3JA 4UB6H 1YYCA 1K3HA 2IBZE 1W2EA 2N1TB 4PJ0V 1NKZB 1C6OA 2ZXEB 2H43A 1RHZB 3PLNA 2B0ZB 5APSA 5KLVE 4C7RA 2QSIA 2R44A 2NZ2A 3RBZA 3L37A 1LFMA 1H0TA 2P10A 4JYBA 2C1UA 4GODA 1H9XA 3AECC 1QLED 1LT9B 1CO6A 2N1TA 3ORVA 3ZBMA 2FXMA 4H13C 3K5BA 4K3AA 4B86A 5CHXA 3RK3B 3BASA 1L0LJ 5DJQC 1PL5A 1SQXJ 4RKUJ 1BGYE 2V4HA 1LT9A 2ZYGA 1NIRA 2RN0A 1Q86Q 1SQVE 2YNYA 1LTJC 3L73D 1R8EA 4DT0A 1M1JC 2WZ7A 1NHLA 1GK6A 1RF1B 5BVZA 1K3GA 1R5LA 2ZXXA 1RE4C 4EICA 2R3SA 1CC5A 3SFEC 1S5LX 4H13B 4ASVA 4RJTA 4WY4D 4UB8E 4NFGB 1M60A 4EDFA 5DJQB 1RF1A 1FE6A 3C9IA 1BE3E 2R32A 5CCGC 1GIWA 2KXPB 2ZVNB 5E79H 5KAFH 3FXDA 4L3GA 1CSVA 1DX7A 3L72D 1LTJB 4U3FD 4OGQD 1M1JB 4BRYA 1L0NJ 2M5AA 3EWKA 5KLVK 4UB8V 3AE5C 3H1JJ 3O6QB 3TGUD 3RMZA 3NWVA 3PH2B 2HR3A 1FZFA 2KSJA 1PIXA 2Q5UA 4RESB 1LTJA 1MZ4A 1JY3O 1BCCJ 3V6IA 1PFIA 1SQBJ 1URQC 2HODB 1CHJA 2E42A 1OW7A 1FU1A 1IFIA 3R2PA 5B66H 1RE4A 5AW9B 1CCRA 1RF0C 2OQQA 3H1KD 1OWAA 4C46A 1NTMD 1HVVA 1CRYA 3E1RA 3AEEC 1Q90D 1K8AQ 1SQVK 4XXLA 3B8EB 3EFGA 1Q7YQ 3CMEP 3DP5A 4R4LA 2OYHA 1EZVD 3H1ID 2ZBOA 3VP9A 3M9BA 2V07A 5GTIV 2HODA 3AE7C 1P84D 1CSXA 1USEA 2QG4A 1SQQE 3OJAB 3NBTA 1IFDA 3S4RA 3ZOOA 1NTZJ 1CRJA 1I6EA 2E5TA 1DT1A 3P8CD 2LR2A 1R5SA 1T2KD 1H33B 1Q2NA 1SFCD 4PWAA 3DMIA 2XZRA 1LTIC 2IX7C 1BSNA 3L71D 5AW6B 3TYIA 3CCRP 1CXCA 1URQB 3H1HD 1KD1Q 1NNOA 1JMBA 1NO4A 1CSBA 3IR9A 3MD0A 3ZIYA 2RH0A 2KZJA 3RK3D 3CCMP 2YIUC 4Y28J 3WUUA 1JY3N 3AE9C 2PCCB 1GJQA 4GYDA 1ZV8A 1SQPE 2Z5HA 1RAPA 1N90A 1OFCX 1URQA 3OA8A 3HQ9A 1CYIA 1D7MA 3T97B 1PP9E 1LJ2A 1KV9A 1AFOA 2BASA 2ORLA 4EIEA 4HKZH 1HCMA 5KTBA 3SJLA 2YKQA 5C0ZA 4QAOA 3NBSA 4ZKUA 4PW9B 1YJWP 3AE8C 1L2PA 3MUDC 5CMZA 4H44C 1CTJA 1QN2A 3L74D 1NAFA 3A0HE 1LTGC 3H1LG 3RLMA 4H13D 1MZ9A 1MUUA 2VHDA 3VMZA 2YIUB 1KYOE 1VQMP 1QL3A 2GM4A 1FJ0A 1YNRA 2WVRA 2L5GB 3D6YA 2R3CA 1S9KE 1CTYA 1KFMA 1T6AA 1SQQK 3RN1A 2ZAEB 2MTAC 1CEDA 1KYOH 4YTPC 3BATA 3A0HV 1M1KQ 1I8OA 2FFDA 4L75A 4FANA 1GKSA 1L0LE 2E43A 3CCSP 3RBXA 3BVHA 3KQGA 4ZMDA 1KV4A 2ZT9C 1K73Q 1CIEA 4H44B 3PJSK 5AVYB 3HTKA 1LP1B 3W68A 2IYPA 3CCQP 3V4QA 2Z4EA 2C0WA 2I8DA 1AQTA 3WC8A 4O9BA 1N73C 3CPWO 5CCGD 1BGYJ 2OARA 1DIIC 1SQPK 2M0BA 2AXCA 5AW0B 2BCCD 2YXRB 3TF5A 1A8CA 2WT7A 3L35A 2KUBA 1QEXA 3NMDA 1LP1A 3MP7B 4GIFA 1IFJA 3TYYA 1NTKE 2Y0CA 1C52A 1IFNA 4XYDB 4RSZA 5CCHA 1YCCA 1H32B 2OTKE 2RKLA 4YXDC 2XNXA 5AW1B 2OZ1A 3Q5SA 3L72G 2ZT9B 4U3FG 1COTA 1DW2A 2D0SA 1U74B 3A0BV 5L8RJ 3SWYA 1SQXG 2BLFB 1GTWA 4JCGA 3LW5J 4EIJA 2D0WA 1L0NE 3CXHH 1N73B 4Y99C 1RAQA 1BE3J 4K3IA 1G2CB 3M06A 5KLVD 1E2RA 2QM8A 3AE6C 1HZVA 1ZLLA 1RQVA 3M0DC 5TISE 2HPCB 3U1AA 3GW6A 4HYTB 1N7SC 1L9JC 1HJ0A 3H1KG 2ZYAA 1L0LK 4KHXA 1BCCE 5C9MA 1SQXK 1JY2O 2Q3EA 3KHUA 4IL6H 1HF9A 3HQ8A 3L4FA 1VQ7P 3VMYA 1J1EC 2B11B 2QIWA 4HJGH 4XFJA 1EZVG 3H1IG 5EFWB 1IZL0 1LTTC 2HPCA 3H32B 5TISV 1SQVD 1LWUA 4I1LA 1KB9E 2IYOA 1FZCA 5TJHA 2W8ZA 1CNOA 4L3HA 2WQYC 2WSCH 2KNCB 2GB8B 5AW7B 3L71G 4N0KA 1EZVI 3TDKA 3H1HG 1DIQC 2QE7H 1NU1J 3A9FA 5B6QA 1IZNB 3Q3DA 2B4ZA 1B7VA 1P84I 3SSUA 1RQUA 3Q1MA 1N7SB 2KOGA 3CXHI 3PRJA 3SWKA 1OZHA 2N9YB 5KAIV 3NTNA 5KKZC 2QJYC 1BE3D 4W7YA 1J1EB 1VDFA 4V2KA 3VTPC 3ZDMA 1JTHB 1YEAA 1FJKA 1Y9BA 1X0TA 2E75C 1LMSA 2XKMA 5GTHH 4O1WA 1EXIA 3VMXA 1E29A 1SQBG 2BH4X 1JY2N 2Q3IA 2FYUJ 4WQ7A 4TT3H 4FA4A 3LIEA 1L0NK 2W6BA 1H89A 2BEQD 2ZFCA 4H44D 4D6TJ 3FGAD 1RE3A 2N1TC 2E74B 1JTHA 1TU3F 1AV1A 1U7JA 4FB1A 3CX5E 2CK3H 2AXTH 4ASWA 1CCHA 1T3UA 1G1JA 3HE4B 3KZIH 3L74G 1FBMA 1F1CA 1C75A 2LITA 1J2JB 3VN0A 4C7NB 1SQBK 2CA3B 3L4MA 3TNUB 3CC7P 3X39A 1DEEG 1JOCA 1NTZG 1ZRTE 1LT9C 1LTAC 2QJYB 4PJ0E 3CX5H 2Y0DA 1L4AA 2E75B 3IF4A 1CRIA 5BU5A 5AW3B 5AVTB 1BDCA 1VQKP 5CBOA 3V2QA 3B5NC 5CIFB 2NRGA 2ZT9D 1N7LA 5M1BA 1VQ5P 1OVVA 4C7NA 2YQBA 2WMMA 3TNUA 1H0TB 3WU2V 3ZCFA 1GDVA 4PJ0H 1Y47A 1KQSO 3HUSC 4I7ZC 1SQQD 1HJ5A 2YCCA 1NTZK 2WSFH 2JR8A 1RF1C 1FDMA 5EXQA 1NYHA 3H1LD 1IO4A 2PGDA 1BDDA 3L36A 4FAVA 4ZKPA 1OVRA 4OH8B 2EXVA 2O01J 1EXJA 4DCKA 2A06E 4O1QA 2BCCG 3PXSA 1S6VB 1X79B 1VYDA 1CIGA 2YXQB 4AANA 1H31B 2MHMA 1DW1A 3B5NB 3CCVP 2YK3A 2M3EA 1PGJA 3O8ZA 3HE5B 1SQPD 3CWBE 1C6SA 1RZ5A 1IFPA 1EDJA 1HJ4A 3Q5RA 2HG5D 3HUSB 1KB0A 2PAJA 4I7ZB 2B12B 1VQLP 3A2AA 4EYYQ 3DR0A 1PP9D 1H31A 4J20A 2WWWA 1H88A 4BWNA 3B5NA 2IBZG 3HE5A 1VQOP 1S2EA 1YITP 4IL6X 1CORA 1VF5C 3B4SA 1MG2D 2IZ0A 3HUSA 1AJYA 1CTZA 1NTKJ 5KLVG 1N7SD 2ZZS1 2WPRA 4BRYB 4W7ZA 2OYHC 3ZOXA 1KYOD 2M5AB 2R5BA 5APYA 4XA4A 4XE5B 1LT1A 2IBZI 4L1QA 2BPBB 4HH2A 2KB7P 4YE1A 4WBAA 4UB8H 4AALA 1BGYG 1FI3A 3L70J 4AYCA 1GL2A 3QH9A 1L9BC 1KILA 1NKNA 1E8EA 1VL2A 1W5CE 1L0LD 5B5EE 1SQXD 1QX8A 1SQVG 3H25A 2W6AA 3N4XA 5E79V 5KAFV 2KP8A 1VF5B 4AQRD 1PPJE 3II6A 3RN0A 3Q5PA 3ZOYA 3M9HA 1IQCA 1IK7A 1W2BO 4OVNF 1GK4A 5KJ7A 1XTCC 5GTIE 2OYHB 2FYNC 1YICA 5CJ4A 5B5EV 2WSEJ 2E75D 3RK2B 5BU8B 1NU1E 1KC8Q 3AE3C 1BE3G 4EOTA 1DVHA 2PRRA 1QL2A 155CA 1EB7A 5CIEB 1KN7A 2D2CC 2C0XA 3QWOC 1C2RA 3JCUE 1DW3A 1GU4A 2N1TD 5AVVB 3CXHD 1QYZA 5B66V 5AVQB 2P2UA 4NPFX 3CCJP 4KT0J 1CW5A 4YXWH 1QL4A 3HD7B 1QGKB 2Q9IA 1HJ3A 3VYMA 2FYUE 2FY8A 2FYNB 3BCCE 3OA8B 2B89A 1L0ND 1X9VA 4D6TE 2YMYA 1RZ6A 2PACA 4N78D 4PD4E 4KMGA 1I5TA 1H1OA 1N9CA 3H1JD 1GW3A 3WUVA 1QKSA 2AEJA 1U57A 2V08A 1HH0A 2FFDC 4AAMA 5AVXB 2B9BA 3HD7A 4LGDE 1YFCA 2E76B 3O0RC 2JEEA 1M8OB 2D2CB 2DW3A 4LC1A 1BCCD 1SQBD 1OX3A 4FA9A 4HB1A 3L75E 1C7MA 3GF3A 1BL9A 1YIJP 1VPCA 2WPSA 1M6ZA 1SQQG 1UIXA 3AE4C 3JC22 3SLEA 3L73E 1KB9D 5DJTB 3WFBC 2O1KA 2HYNA 3A5TA 4H0KA 2C1DB 1CHIA 1FZGA 1YIQA 5CCHC 1YJ9P 1NU1K 2FFDB 1NTZD 2W83C 1FCDC 3O1YA 3SWFA 1LC1A 3I56P 3P8MC 1M70A 2N18B 1IK9A 2JJLA 2JDIH 3A0HH 4GOFA 4PV1C 2J58A 2NPSB 3HTKB 1YTZI 2OYIA 2C1DA 2GA1A 2HV4A 5APVA 1SQPG 1OXZA 2FYUK 2WPQA 3O5CA 1KFNA 5AVWB 3C2CA 1HTLC 1PP9G 1VF5D 3MGNA 4U3FE 1ZZHA 4GEDB 4LJIA 2WT7B 1M90Q 2NPSA 1YEBA 1SS1A 2I1JA 3VYIA 1ZR4A 1CSWA 2KLUA 2GUSA 3KXDA 2KK7A 3TGUE 3CX5D 3E1IA 2ZJSE 1K04A 2BH5X 1HGZA 3EQ2A 1KQFB 1JY3P 2OZ1B 3PH0A 1H8AA 3CWBJ 3A0BE 5AW2B 4PV1B 4IFFA 2K9JA 1WRGA 1ZRTD 1HGVA 1LWUC 2IZ1A 1AVOA 2Z5IA 4H0JA 1FZCC 1NTME 3V4WA 3V2PA 1GDTA 3MK7B 3A0BH 1YI2P 5CIGB 3CC4P 1WVEC 4WQCA 1KYOI 2IBZD 1L0LG 4DOJA 1M7LA 1ZW0A 1HH7A 1K9MQ 1P84E 2BCNB 5APQA 2QRXA 3L70E 2G3AA 1URQD 2HLOA 3G4SP 2JP3A 3P8CE 2QEXP 2N3BA 2YMKA 2LXBA 2QVAA 3SFDC 2CA4B 2POHA 5AW5B 2LIRA 3H1HE 1DD3A 1WEJF 1LWUB 2D2CD 2DVHA 1FZCB 2N9JA 1ZP0C 1N50A 3SXTA 2H89C 2K9YA 1RE3C 1S5LE 1DW0A 1BGYD 4WQAA 3WFDC 2V7QJ 1NTKG 5TISH 2P67A 3AEDC 3MIWA 1JDLA 1PZQA 2BGVX 2XNDH 1NWQA 2UWJE 1CZQA 5KAIE 1J3SA 4P4QB 2C9LY 1R0QA 2WSEH 2E74C 1W5CT 4AUWA 1S5LV 5H2FV 1L4AC 5CICB 1KILE 4AAOA 2KS1A 1UIIA 1L0NG 1WT6A 2GUVA 1NTKK 1FOSE 1KB9H 2J59M 1QVGO 5IY51 3H1JG 1MG3D 1KTMA 2B87A 2LKMA 2CXBA 4N3YB 2A45H 1MFTA 4WQ9A 1BCCG 1F1FA 1X22A 1ZN5A 2P1JA 1JMMA 3BCCJ 1LC2A 3CLQA 1CSUA 4FA5A 3EFFK 2W27A 3BRTB 2AI5A 3OAKA 1FOSF 1G1IA 4N6JA 5CIBB 1AOQA 1DIPA 1HZUA 1FOCA 1USDA 1L4AB 4MN4C 351CA 4JBZA 5CCHD 2CE0A 5GTHV 3USSA 4OGQB 1PPJD 4Q5PA 3UIAA 4WY4A 1C2NA 3ZOWA 5AW4B 3WU2E 1I55A 2WTYA 3BRVB 1E5WA 2H8PD 3MTUE 3AEGC 1FZBA 1QVFO 2JWDA 3SWSA 2A45G 3L75J 2M3BA 5AVZB 4JYCA 1OW6A 1GU2A 2DGEA 4JQ0D 3OA7A 1T2KC 2CPBA 3IFMA 1FDOA 1N15A 2AXTV 1SFCC 1KORA 1KB9I 2K37A 1NU1D 1S1CX 2J5UA 2PCBB 3L73J 2ITAA 3HRNA 2C9XB 3AE2C 1X8YA 5AW8B 3KPEA 4DJGA 2XU6A 4I6MC 2A45I 1LNQA 1PV3A 3OW2O 3G6EP 3IN6A 2MKVA 2WITA 1QL1A 3FWLA 2C9NY 2IPPA 1KQGB 2XTSB 3CC2P 1EC5A 4GKGA 5CJ0A 2FYUD 4UB6V 3BCCD 2RMZA 3JSVC 5APWA 2JQRA 2K88A 1FHBA 3F5HA 4D6TD 3NFQA 2G8YA 3M97X 4PD4D 1ZXGA 1EDKA 1OMIA 1GL2C 2IFMA 1SFCB 1KILC 1AKKA 3CYTI 2L91A 4FA1A 1AQ5A 3E7KA 2SPZA 3L72J 3CI9A 1JY2P 4U3FJ 1AYGA 1AOFA 1LTSC 3SVWA
chains in the Genus database with same CATH topology
1I8PA 3PTZA 3PXTA 4EIFA 1QL4A 3WC8A 1HJ3A 3L75D 3VYMA 1I6DA 1ETPA 1GQ1A 1DIIC 2ZONG 2FYNB 2AIUA 1KX2A 2BCCD 3OA8B 1L0ND 3TF5A 1RZ6A 1A8CA 2PACA 4KMGA 4WQBA 1I5TA 1FI7A 2JTIB 1H1OA 1N9CA 3H1JD 2Y0EA 1QKSA 1NMLA 2V08A 2Y0CA 1C52A 4AAMA 4XYDB 4RSZA 1YCCA 2GC7D 1YFCA 1H32B 5CIHB 3O0RC 2OZ1A 2L4DA 1CRCA 1W2LA 1COTA 1BCCD 1DW2A 2D0SA 2ZOOA 1SQBD 1U74B 1LS9A 3WFCC 2FRCA 3A0BV 4FA9A 4A7PA 1C7MA 2CE1A 2QJPB 5CYTR 1BL9A 2BLFB 3WFEC 4JCGA 2D0WA 4WQDA 3GG2A 3KZIV 1RAQA 1M6ZA 3PHLA 4K3IA 5KLVD 1IRVA 5DF5A 4DY9A 3SLEA 1KB9D 5KKZB 1E2RA 3WFBC 1HZVA 3VNWA 4H0KA 2C1DB 1CHIA 1YIQA 5AURA 3GW6A 1L9JC 1NTZD 1YTCA 1FCDC 3O1YA 451CA 5C9MA 1CRGA 2Q3EA 1KYOW 1LC1A 1OAEA 3KHUA 3HQ8A 2O3JA 1M70A 1K3HA 2N18B 2B11B 4MU8A 4PJ0V 1C6OA 1IZL0 1A56A 2C1DA 1CIFA 3PLNA 2HV4A 3VRDA 4EIDA 5TISV 2B0ZB 1SQVD 1NTKD 3O5CA 1LFMA 5TJHA 1CYCA 3C2CA 1CNOA 1CYJA 2C1UA 1H9XA 2GC4D 4L3HA 1ZZHA 1CRHA 4GEDB 4LJIA 2KNCB 1CO6A 2GB8B 3ORVA 3ZBMA 1YEBA 4N0KA 3TDKA 1DIQC 3A9FA 5B6QA 2B4ZA 1B7VA 5DJQC 1CSWA 3CX5D 3PRJA 2N9YB 2BH5X 2OZ1B 3L70D 5KAIV 1BE3D 4V2KA 1YEAA 1NIRA 2RN0A 1LMSA 1ZRTD 3L73D 4O1WA 1A2SA 3VMAA 1E29A 1HROA 2BH4X 4WQ7A 4FA4A 4H0JA 1K3GA 2B10B 2N18C 3MK7B 4EICA 1CC5A 1C6RA 5CIGB 3CXHW 1WVEC 4WQCA 4FB1A 1HRCA 2IBZD 1CCHA 1HH7A 1I54A 1H33A 4RJTA 5DFSA 2BCNB 4NFGB 1M60A 1F1CA 4EDFA 5DJQB 1C75A 2LITA 1H9YA 1GIWA 2CA3B 3L4MA 3ITKA 3X39A 4L3GA 1CSVA 2N3BA 2QJYB 2Y0DA 2CA4B 1CRIA 3L72D 4U3FD 2LIRA 1CXAA 1U75B 1WEJF 5CIFB 4UB8V 1IRWA 2DVHA 3HQ7A 2N9JA 2YQBA 1N50A 3SXTA 3WU2V 3ZCFA 1KX7A 1GDVA 3TGUD 3RMZA 1DW0A 1BGYD 4WQAA 3NWVA 3PH2B 3WFDC 1SQQD 1HJ5A 2YCCA 2JWAA 1MZ4A 1JDLA 5EXQA 2BGVX 4Y5RA 3H1LD 1CHJA 1J3SA 3MK7C 1NMIA 4P4QB 1R0QA 1CCRA 4FAVA 3H1KD 2N9IA 1NTMD 4WQ8A 2EXVA 1W5CT 3CU4A 1CRYA 1S5LV 5H2FV 2K9JB 5CICB 4AAOA 3PXWA 2KS1A 4XXLA 4O1QA 3PXSA 1S6VB 1VYDA 1CIGA 4AANA 3OCDB 1H31B 3DP5A 3WUIA 2MHMA 1DW1A 1EZVD 3H1ID 2ZBOA 1KIBA 2YK3A 5IY51 2V07A 5GTIV 1OCDA 1P84D 1CSXA 1MG3D 2QG4A 1SQPD 3NBTA 1C6SA 1RZ5A 1HJ4A 3ZOOA 2CXBA 1CRJA 1I6EA 1KB0A 1DT1A 2B12B 4WQ9A 1F1FA 3DR0A 1PP9D 3OCDA 1H33B 1H31A 4J20A 4PWAA 3O20A 3DMIA 4AX3A 3L71D 3TYIA 1LC2A 1CXCA 1CSUA 2C8SA 3H1HD 4FA5A 1NNOA 1CIHA 2N3YA 2AI5A 1CORA 3ZIYA 5CIBB 1AOQA 1HZUA 1MG2D 1FOCA 1CTZA 351CA 2PCCB 2ZZS1 2CE0A 2FWLA 5GTHV 1GJQA 1PPJD 3CP5A 1IO3A 4GYDA 4Q5PA 3ZOXA 1KYOD 1C2NA 3CX5W 3ZOWA 1I55A 1RAPA 1N90A 3HQ6A 3OA8A 3HQ9A 1CYIA 2C1VA 4L1QA 1CHHA 3SWSA 1KV9A 2BPBB 2ORLA 1GU2A 2DGEA 4EIEA 4YE1A 4AALA 1HCMA 1N15A 1FI3A 2AXTV 1H32A 2I8FA 3SJLA 1DVVA 1L9BC 2A06D 5C0ZA 4QAOA 3NBSA 1NU1D 1E8EA 4PW9B 1L0LD 1SQXD 2PCBB 1CTJA 1QN2A 2C9XB 3L74D 5E79V 5KAFV 3RLMA 1FI9A 2VHDA 2YIUB 5CIDB 3RN0A 1QL3A 3CWBD 1FJ0A 1YNRA 2GIWA 3ZOYA 1IQCA 3FWLA 2XTSB 3L4OA 1CTYA 1YICA 2C2CA 2FYUD 4IL6V 3RN1A 5B5EV 4UB6V 3BCCD 2RMZA 2MTAC 1CEDA 2JQRA 3A0HV 1FHBA 4D6TD 4WQEA 3M97X 4PD4D 1I8OA 4FANA 1GKSA 1DVHA 155CA 1AKKA 1EB7A 3CYTI 4FA1A 2L91A 5CIEB 2QJKB 1C2RA 5KLIB 1DW3A 3JBTB 1CIEA 2ZXYA 1AYGA 3CXHD 1QYZA 5B66V 1AOFA 3SVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8P A;  3PTZ A;  3PXT A;  4EIF A;  1QL4 A;  3WC8 A;  1HJ3 A;  3L75 D;  3VYM A;  1I6D A;  1ETP A;  1GQ1 A;  1DII C;  2ZON G;  2FYN B;  2AIU A;  1KX2 A;  2BCC D;  3OA8 B;  1L0N D;  3TF5 A;  1RZ6 A;  1A8C A;  2PAC A;  4KMG A;  4WQB A;  1I5T A;  1FI7 A;  2JTI B;  1H1O A;  1N9C A;  3H1J D;  2Y0E A;  1QKS A;  1NML A;  2V08 A;  2Y0C A;  1C52 A;  4AAM A;  4XYD B;  4RSZ A;  1YCC A;  2GC7 D;  1YFC A;  1H32 B;  5CIH B;  3O0R C;  2OZ1 A;  2L4D A;  1CRC A;  1W2L A;  1COT A;  1BCC D;  1DW2 A;  2D0S A;  2ZOO A;  1SQB D;  1U74 B;  1LS9 A;  3WFC C;  2FRC A;  3A0B V;  4FA9 A;  4A7P A;  1C7M A;  2CE1 A;  2QJP B;  5CYT R;  1BL9 A;  2BLF B;  3WFE C;  4JCG A;  2D0W A;  4WQD A;  3GG2 A;  3KZI V;  1RAQ A;  1M6Z A;  3PHL A;  4K3I A;  5KLV D;  1IRV A;  5DF5 A;  4DY9 A;  3SLE A;  1KB9 D;  5KKZ B;  1E2R A;  3WFB C;  1HZV A;  3VNW A;  4H0K A;  2C1D B;  1CHI A;  1YIQ A;  5AUR A;  3GW6 A;  1L9J C;  1NTZ D;  1YTC A;  1FCD C;  3O1Y A;  451C A;  5C9M A;  1CRG A;  2Q3E A;  1KYO W;  1LC1 A;  1OAE A;  3KHU A;  3HQ8 A;  2O3J A;  1M70 A;  1K3H A;  2N18 B;  2B11 B;  4MU8 A;  4PJ0 V;  1C6O A;  1IZL 0;  1A56 A;  2C1D A;  1CIF A;  3PLN A;  2HV4 A;  3VRD A;  4EID A;  5TIS V;  2B0Z B;  1SQV D;  1NTK D;  3O5C A;  1LFM A;  5TJH A;  1CYC A;  3C2C A;  1CNO A;  1CYJ A;  2C1U A;  1H9X A;  2GC4 D;  4L3H A;  1ZZH A;  1CRH A;  4GED B;  4LJI A;  2KNC B;  1CO6 A;  2GB8 B;  3ORV A;  3ZBM A;  1YEB A;  4N0K A;  3TDK A;  1DIQ C;  3A9F A;  5B6Q A;  2B4Z A;  1B7V A;  5DJQ C;  1CSW A;  3CX5 D;  3PRJ A;  2N9Y B;  2BH5 X;  2OZ1 B;  3L70 D;  5KAI V;  1BE3 D;  4V2K A;  1YEA A;  1NIR A;  2RN0 A;  1LMS A;  1ZRT D;  3L73 D;  4O1W A;  1A2S A;  3VMA A;  1E29 A;  1HRO A;  2BH4 X;  4WQ7 A;  4FA4 A;  4H0J A;  1K3G A;  2B10 B;  2N18 C;  3MK7 B;  4EIC A;  1CC5 A;  1C6R A;  5CIG B;  3CXH W;  1WVE C;  4WQC A;  4FB1 A;  1HRC A;  2IBZ D;  1CCH A;  1HH7 A;  1I54 A;  1H33 A;  4RJT A;  5DFS A;  2BCN B;  4NFG B;  1M60 A;  1F1C A;  4EDF A;  5DJQ B;  1C75 A;  2LIT A;  1H9Y A;  1GIW A;  2CA3 B;  3L4M A;  3ITK A;  3X39 A;  4L3G A;  1CSV A;  2N3B A;  2QJY B;  2Y0D A;  2CA4 B;  1CRI A;  3L72 D;  4U3F D;  2LIR A;  1CXA A;  1U75 B;  1WEJ F;  5CIF B;  4UB8 V;  1IRW A;  2DVH A;  3HQ7 A;  2N9J A;  2YQB A;  1N50 A;  3SXT A;  3WU2 V;  3ZCF A;  1KX7 A;  1GDV A;  3TGU D;  3RMZ A;  1DW0 A;  1BGY D;  4WQA A;  3NWV A;  3PH2 B;  3WFD C;  1SQQ D;  1HJ5 A;  2YCC A;  2JWA A;  1MZ4 A;  1JDL A;  5EXQ A;  2BGV X;  4Y5R A;  3H1L D;  1CHJ A;  1J3S A;  3MK7 C;  1NMI A;  4P4Q B;  1R0Q A;  1CCR A;  4FAV A;  3H1K D;  2N9I A;  1NTM D;  4WQ8 A;  2EXV A;  1W5C T;  3CU4 A;  1CRY A;  1S5L V;  5H2F V;  2K9J B;  5CIC B;  4AAO A;  3PXW A;  2KS1 A;  4XXL A;  4O1Q A;  3PXS A;  1S6V B;  1VYD A;  1CIG A;  4AAN A;  3OCD B;  1H31 B;  3DP5 A;  3WUI A;  2MHM A;  1DW1 A;  1EZV D;  3H1I D;  2ZBO A;  1KIB A;  2YK3 A;  5IY5 1;  2V07 A;  5GTI V;  1OCD A;  1P84 D;  1CSX A;  1MG3 D;  2QG4 A;  1SQP D;  3NBT A;  1C6S A;  1RZ5 A;  1HJ4 A;  3ZOO A;  2CXB A;  1CRJ A;  1I6E A;  1KB0 A;  1DT1 A;  2B12 B;  4WQ9 A;  1F1F A;  3DR0 A;  1PP9 D;  3OCD A;  1H33 B;  1H31 A;  4J20 A;  4PWA A;  3O20 A;  3DMI A;  4AX3 A;  3L71 D;  3TYI A;  1LC2 A;  1CXC A;  1CSU A;  2C8S A;  3H1H D;  4FA5 A;  1NNO A;  1CIH A;  2N3Y A;  2AI5 A;  1COR A;  3ZIY A;  5CIB B;  1AOQ A;  1HZU A;  1MG2 D;  1FOC A;  1CTZ A;  351C A;  2PCC B;  2ZZS 1;  2CE0 A;  2FWL A;  5GTH V;  1GJQ A;  1PPJ D;  3CP5 A;  1IO3 A;  4GYD A;  4Q5P A;  3ZOX A;  1KYO D;  1C2N A;  3CX5 W;  3ZOW A;  1I55 A;  1RAP A;  1N90 A;  3HQ6 A;  3OA8 A;  3HQ9 A;  1CYI A;  2C1V A;  4L1Q A;  1CHH A;  3SWS A;  1KV9 A;  2BPB B;  2ORL A;  1GU2 A;  2DGE A;  4EIE A;  4YE1 A;  4AAL A;  1HCM A;  1N15 A;  1FI3 A;  2AXT V;  1H32 A;  2I8F A;  3SJL A;  1DVV A;  1L9B C;  2A06 D;  5C0Z A;  4QAO A;  3NBS A;  1NU1 D;  1E8E A;  4PW9 B;  1L0L D;  1SQX D;  2PCB B;  1CTJ A;  1QN2 A;  2C9X B;  3L74 D;  5E79 V;  5KAF V;  3RLM A;  1FI9 A;  2VHD A;  2YIU B;  5CID B;  3RN0 A;  1QL3 A;  3CWB D;  1FJ0 A;  1YNR A;  2GIW A;  3ZOY A;  1IQC A;  3FWL A;  2XTS B;  3L4O A;  1CTY A;  1YIC A;  2C2C A;  2FYU D;  4IL6 V;  3RN1 A;  5B5E V;  4UB6 V;  3BCC D;  2RMZ A;  2MTA C;  1CED A;  2JQR A;  3A0H V;  1FHB A;  4D6T D;  4WQE A;  3M97 X;  4PD4 D;  1I8O A;  4FAN A;  1GKS A;  1DVH A;  155C A;  1AKK A;  1EB7 A;  3CYT I;  4FA1 A;  2L91 A;  5CIE B;  2QJK B;  1C2R A;  5KLI B;  1DW3 A;  3JBT B;  1CIE A;  2ZXY A;  1AYG A;  3CXH D;  1QYZ A;  5B66 V;  1AOF A;  3SVW A; 
#chains in the Genus database with same CATH topology
 1PGO A;  4WWI A;  3CX5 I;  1CI6 B;  4EIF A;  4U7J A;  3ABV C;  5KJ7 C;  3L75 D;  3TGU J;  1JNM A;  1ETP A;  1SFC A;  1Z56 A;  1GQ1 A;  2XV5 A;  2OYO A;  2AIU A;  2K3R A;  4WQB A;  1FI7 A;  2JTI B;  2Y0E A;  1CI6 A;  2XDJ A;  3MHV A;  1Q82 Q;  1GZL A;  3FWN A;  3B71 A;  4LLH A;  2OTL P;  1GL2 B;  1T8Z A;  3H1K J;  3VOP A;  5CIH B;  1NTM J;  1KIL B;  1EQ7 A;  3TK1 A;  1CRC A;  3A3Y B;  1W2L A;  1NOH A;  5E79 E;  5KAF E;  4IFD K;  2ZOO A;  1J1D C;  1S9K D;  3RK2 C;  2A06 G;  2FRC A;  3GF7 A;  4A7P A;  3H1I J;  2CE1 A;  5CYT R;  1K05 A;  3WFE C;  1OW8 A;  3CCU P;  3LW5 H;  1BSH A;  3M9Q A;  2YKO A;  3GG2 A;  3PHL A;  3G71 P;  3CWB G;  2AEF A;  1JB0 J;  3LID A;  2E74 D;  3RL0 C;  1VQ8 P;  2KYV A;  1FJP A;  5APU A;  1A02 J;  1NJI Q;  1L4A D;  2KIK A;  2VRS A;  3GMA A;  4RO0 A;  3VNW A;  1YQ3 C;  3L71 J;  3H1H J;  3HD7 C;  3KYQ A;  4R4M A;  2WSS H;  2JKV A;  2Y9Y A;  451C A;  1KYO W;  5B5E H;  1LTB C;  1JCD A;  5B66 E;  1KMI Z;  2V7Q H;  3CL3 D;  1J1D B;  4MU8 A;  1VQ6 P;  3IAO A;  2QA4 P;  1A56 A;  3V2N A;  1CIF A;  1M1J A;  3VRD A;  1DD4 A;  4EID A;  5GTI H;  2OGU A;  4EI2 A;  2KLV A;  2E76 C;  3PP5 A;  1NGM B;  1NTK D;  1IJD B;  1CYC A;  2HFE D;  3O6Q A;  1CYJ A;  1FAV A;  2GC4 D;  3RL0 B;  1CRH A;  2WSC J;  5APT A;  3H6P A;  2QM7 A;  2OTJ P;  1GW4 A;  4KJM A;  3M0A A;  4WB4 A;  1DEB A;  1SVF A;  3L74 J;  3D70 A;  1XTG B;  3M91 A;  3JCU H;  5CCG A;  1S3J A;  3L70 D;  1PPJ G;  1Y8A A;  3CCE P;  1HUC A;  3TSI A;  1FC2 C;  3H1L E;  3GHG C;  2OYI C;  2K1A A;  1AA0 A;  2FKW B;  1VQN P;  4GDO A;  1A2S A;  3VMA A;  1HRO A;  4K35 A;  3B5N D;  3AEB C;  4JPZ B;  2B10 B;  2N18 C;  4GT1 A;  1C6R A;  4PD4 H;  4IOI H;  2NPS C;  2Y9Z A;  3CXH W;  2YO3 A;  2Q1K A;  2FXP A;  3R4Y A;  1NU1 G;  1PGP A;  2P7J A;  1HRC A;  1LGH B;  5AVR B;  1I54 A;  1H33 A;  2H7H A;  5DFS A;  3C1L A;  3WMM 0;  2IFN A;  2YO2 A;  1H9Y A;  1YQ4 C;  3ITK A;  3AEF C;  1RF0 A;  1M57 D;  4L74 A;  1FDI A;  1JUN A;  4I2L C;  2Q6Q A;  3GHG B;  2OYI B;  2FYU G;  1GL2 D;  2BCC J;  1CXA A;  1JCC A;  1MV8 A;  1KIL D;  2O1J A;  1U75 B;  3BCC G;  1M56 D;  2KI7 B;  1IRW A;  3CMA P;  1SP4 A;  3HQ7 A;  4D6T G;  3D0W A;  1KX7 A;  5APX A;  3T97 A;  2BEZ F;  1JM0 A;  1IFM A;  2R5D A;  2JWA A;  2ZYD A;  2JO1 A;  3GHG A;  2WSF J;  5KJ7 D;  4IFM A;  4Y5R A;  1FZA A;  4H0L C;  1VQ9 P;  2B88 A;  5K5G B;  3MK7 C;  1NMI A;  3L72 E;  2N9I A;  4PD4 I;  1RH5 B;  3L75 G;  4WQ8 A;  3CU4 A;  2O01 H;  2K9J B;  3PXW A;  2M8R A;  3OCD B;  5KLV J;  1EDL A;  1SQX E;  3WUI A;  3S1K A;  5AVU B;  1KIB A;  1IC2 A;  3L73 G;  1OCD A;  4ZNC A;  4M3L A;  3RL0 g;  3RK2 D;  3KDP B;  2FBW C;  2W90 A;  3OCD A;  3O20 A;  1MKM A;  3VP8 A;  1AVY A;  4AX3 A;  3H1K E;  4H0L B;  2C8S A;  1KQL A;  2FYZ A;  3RL0 D;  3U59 A;  3MUD A;  1CIH A;  2N3Y A;  3NXS A;  1GMJ A;  3RGU A;  2WPV B;  1YJN P;  1OIP A;  1U7M A;  1SQV J;  1HWT C;  1HBW A;  1EZV E;  3H1I E;  3HD7 D;  2FWL A;  3FX0 A;  3CP5 A;  1IO3 A;  1Q81 Q;  2CPS A;  1VQ4 P;  1S72 P;  3CXH E;  3CX5 W;  1PGQ A;  4DZO A;  1HJB A;  3HQ6 A;  2KSE A;  1JEK A;  2MJZ A;  2C1V A;  1CHH A;  1GD2 E;  2AEM A;  1SLQ A;  4L76 A;  1P84 H;  3L71 E;  3TGU G;  2IDB A;  1GU5 A;  3MZW B;  1H32 A;  2E76 D;  2I8F A;  1DVV A;  2Q7C A;  2QJK C;  2A06 D;  4N78 E;  5KLI C;  4IL6 E;  2PP6 A;  3V2R A;  2YKP A;  1NVO A;  3RK3 E;  3H1J E;  3P7K A;  4JF7 A;  3W67 A;  5H2F E;  1FI9 A;  5CID B;  2KS1 B;  3CWB D;  3D6Z A;  2GIW A;  3C8V A;  1NTM G;  1T3J A;  4GOE A;  4WY4 C;  1N73 A;  1A02 F;  1SQB E;  1NAY A;  1NH4 A;  3L4O A;  1OVU A;  1G2C A;  1WMK A;  4NPE A;  4TLF A;  2C2C A;  5CBN A;  4NPD A;  1S5L H;  4IL6 V;  5H2F H;  2B87 B;  3G9R A;  3D71 A;  3FXE A;  4W80 A;  2E5Y A;  4WQE A;  3WUT A;  1RY3 A;  3L70 G;  1YHQ P;  4OGQ C;  2ZVO B;  2LXC B;  4Y99 B;  3L74 E;  5KAI H;  2QJK B;  2N9B A;  2H88 C;  5KLI B;  1NTM K;  2KZI A;  4WVZ A;  1VQP P;  3JBT B;  2PFX A;  2ZXY A;  2NPS D;  3PTZ A;  3AEA C;  1NTZ E;  1I8P A;  2QJP C;  2O01 N;  5GTH E;  3PXT A;  3H32 A;  4BXL A;  4CPG A;  1I6D A;  3Q2Y A;  5AVS B;  1S4X A;  4QMA A;  1YBK A;  4WY4 B;  1N86 A;  2ZON G;  1EDI A;  1KX2 A;  1SQQ J;  5C39 A;  4YPC A;  1MFZ A;  1JO5 A;  2KNC A;  4OWF A;  3S9O A;  3CCL P;  1ZOY C;  3H1L J;  1NML A;  3M0D A;  2AXT E;  2I1K A;  3KZI E;  3I55 P;  1N7S A;  2GC7 D;  3V5B A;  5DJU B;  2P58 A;  3A7O A;  1N2D C;  1ZR2 A;  2L4D A;  4PV1 D;  3P32 A;  1LS9 A;  3WFC C;  3F89 A;  3U1C A;  3I5C A;  2QJP B;  1FS0 E;  1KZU B;  2BCC E;  4H0L D;  1E79 H;  4WQD A;  1SQP J;  1YTZ T;  3KZI V;  3WU2 H;  1IRV A;  5DF5 A;  4UB6 E;  4DY9 A;  1DH3 A;  5KKZ B;  1PP9 J;  2FXO A;  3G3Z A;  3N7N A;  1FZE A;  3RK3 C;  3AE1 C;  3GLM A;  3CD6 P;  3HE4 A;  5AUR A;  4Z1M H;  1ZME C;  1YTC A;  1N8R Q;  4L73 A;  1CRG A;  1OAE A;  2W6J H;  2O3J A;  4UB6 H;  1YYC A;  1K3H A;  2IBZ E;  1W2E A;  2N1T B;  4PJ0 V;  1NKZ B;  1C6O A;  2ZXE B;  2H43 A;  1RHZ B;  3PLN A;  2B0Z B;  5APS A;  5KLV E;  4C7R A;  2QSI A;  2R44 A;  2NZ2 A;  3RBZ A;  3L37 A;  1LFM A;  1H0T A;  2P10 A;  4JYB A;  2C1U A;  4GOD A;  1H9X A;  3AEC C;  1QLE D;  1LT9 B;  1CO6 A;  2N1T A;  3ORV A;  3ZBM A;  2FXM A;  4H13 C;  3K5B A;  4K3A A;  4B86 A;  5CHX A;  3RK3 B;  3BAS A;  1L0L J;  5DJQ C;  1PL5 A;  1SQX J;  4RKU J;  1BGY E;  2V4H A;  1LT9 A;  2ZYG A;  1NIR A;  2RN0 A;  1Q86 Q;  1SQV E;  2YNY A;  1LTJ C;  3L73 D;  1R8E A;  4DT0 A;  1M1J C;  2WZ7 A;  1NHL A;  1GK6 A;  1RF1 B;  5BVZ A;  1K3G A;  1R5L A;  2ZXX A;  1RE4 C;  4EIC A;  2R3S A;  1CC5 A;  3SFE C;  1S5L X;  4H13 B;  4ASV A;  4RJT A;  4WY4 D;  4UB8 E;  4NFG B;  1M60 A;  4EDF A;  5DJQ B;  1RF1 A;  1FE6 A;  3C9I A;  1BE3 E;  2R32 A;  5CCG C;  1GIW A;  2KXP B;  2ZVN B;  5E79 H;  5KAF H;  3FXD A;  4L3G A;  1CSV A;  1DX7 A;  3L72 D;  1LTJ B;  4U3F D;  4OGQ D;  1M1J B;  4BRY A;  1L0N J;  2M5A A;  3EWK A;  5KLV K;  4UB8 V;  3AE5 C;  3H1J J;  3O6Q B;  3TGU D;  3RMZ A;  3NWV A;  3PH2 B;  2HR3 A;  1FZF A;  2KSJ A;  1PIX A;  2Q5U A;  4RES B;  1LTJ A;  1MZ4 A;  1JY3 O;  1BCC J;  3V6I A;  1PFI A;  1SQB J;  1URQ C;  2HOD B;  1CHJ A;  2E42 A;  1OW7 A;  1FU1 A;  1IFI A;  3R2P A;  5B66 H;  1RE4 A;  5AW9 B;  1CCR A;  1RF0 C;  2OQQ A;  3H1K D;  1OWA A;  4C46 A;  1NTM D;  1HVV A;  1CRY A;  3E1R A;  3AEE C;  1Q90 D;  1K8A Q;  1SQV K;  4XXL A;  3B8E B;  3EFG A;  1Q7Y Q;  3CME P;  3DP5 A;  4R4L A;  2OYH A;  1EZV D;  3H1I D;  2ZBO A;  3VP9 A;  3M9B A;  2V07 A;  5GTI V;  2HOD A;  3AE7 C;  1P84 D;  1CSX A;  1USE A;  2QG4 A;  1SQQ E;  3OJA B;  3NBT A;  1IFD A;  3S4R A;  3ZOO A;  1NTZ J;  1CRJ A;  1I6E A;  2E5T A;  1DT1 A;  3P8C D;  2LR2 A;  1R5S A;  1T2K D;  1H33 B;  1Q2N A;  1SFC D;  4PWA A;  3DMI A;  2XZR A;  1LTI C;  2IX7 C;  1BSN A;  3L71 D;  5AW6 B;  3TYI A;  3CCR P;  1CXC A;  1URQ B;  3H1H D;  1KD1 Q;  1NNO A;  1JMB A;  1NO4 A;  1CSB A;  3IR9 A;  3MD0 A;  3ZIY A;  2RH0 A;  2KZJ A;  3RK3 D;  3CCM P;  2YIU C;  4Y28 J;  3WUU A;  1JY3 N;  3AE9 C;  2PCC B;  1GJQ A;  4GYD A;  1ZV8 A;  1SQP E;  2Z5H A;  1RAP A;  1N90 A;  1OFC X;  1URQ A;  3OA8 A;  3HQ9 A;  1CYI A;  1D7M A;  3T97 B;  1PP9 E;  1LJ2 A;  1KV9 A;  1AFO A;  2BAS A;  2ORL A;  4EIE A;  4HKZ H;  1HCM A;  5KTB A;  3SJL A;  2YKQ A;  5C0Z A;  4QAO A;  3NBS A;  4ZKU A;  4PW9 B;  1YJW P;  3AE8 C;  1L2P A;  3MUD C;  5CMZ A;  4H44 C;  1CTJ A;  1QN2 A;  3L74 D;  1NAF A;  3A0H E;  1LTG C;  3H1L G;  3RLM A;  4H13 D;  1MZ9 A;  1MUU A;  2VHD A;  3VMZ A;  2YIU B;  1KYO E;  1VQM P;  1QL3 A;  2GM4 A;  1FJ0 A;  1YNR A;  2WVR A;  2L5G B;  3D6Y A;  2R3C A;  1S9K E;  1CTY A;  1KFM A;  1T6A A;  1SQQ K;  3RN1 A;  2ZAE B;  2MTA C;  1CED A;  1KYO H;  4YTP C;  3BAT A;  3A0H V;  1M1K Q;  1I8O A;  2FFD A;  4L75 A;  4FAN A;  1GKS A;  1L0L E;  2E43 A;  3CCS P;  3RBX A;  3BVH A;  3KQG A;  4ZMD A;  1KV4 A;  2ZT9 C;  1K73 Q;  1CIE A;  4H44 B;  3PJS K;  5AVY B;  3HTK A;  1LP1 B;  3W68 A;  2IYP A;  3CCQ P;  3V4Q A;  2Z4E A;  2C0W A;  2I8D A;  1AQT A;  3WC8 A;  4O9B A;  1N73 C;  3CPW O;  5CCG D;  1BGY J;  2OAR A;  1DII C;  1SQP K;  2M0B A;  2AXC A;  5AW0 B;  2BCC D;  2YXR B;  3TF5 A;  1A8C A;  2WT7 A;  3L35 A;  2KUB A;  1QEX A;  3NMD A;  1LP1 A;  3MP7 B;  4GIF A;  1IFJ A;  3TYY A;  1NTK E;  2Y0C A;  1C52 A;  1IFN A;  4XYD B;  4RSZ A;  5CCH A;  1YCC A;  1H32 B;  2OTK E;  2RKL A;  4YXD C;  2XNX A;  5AW1 B;  2OZ1 A;  3Q5S A;  3L72 G;  2ZT9 B;  4U3F G;  1COT A;  1DW2 A;  2D0S A;  1U74 B;  3A0B V;  5L8R J;  3SWY A;  1SQX G;  2BLF B;  1GTW A;  4JCG A;  3LW5 J;  4EIJ A;  2D0W A;  1L0N E;  3CXH H;  1N73 B;  4Y99 C;  1RAQ A;  1BE3 J;  4K3I A;  1G2C B;  3M06 A;  5KLV D;  1E2R A;  2QM8 A;  3AE6 C;  1HZV A;  1ZLL A;  1RQV A;  3M0D C;  5TIS E;  2HPC B;  3U1A A;  3GW6 A;  4HYT B;  1N7S C;  1L9J C;  1HJ0 A;  3H1K G;  2ZYA A;  1L0L K;  4KHX A;  1BCC E;  5C9M A;  1SQX K;  1JY2 O;  2Q3E A;  3KHU A;  4IL6 H;  1HF9 A;  3HQ8 A;  3L4F A;  1VQ7 P;  3VMY A;  1J1E C;  2B11 B;  2QIW A;  4HJG H;  4XFJ A;  1EZV G;  3H1I G;  5EFW B;  1IZL 0;  1LTT C;  2HPC A;  3H32 B;  5TIS V;  1SQV D;  1LWU A;  4I1L A;  1KB9 E;  2IYO A;  1FZC A;  5TJH A;  2W8Z A;  1CNO A;  4L3H A;  2WQY C;  2WSC H;  2KNC B;  2GB8 B;  5AW7 B;  3L71 G;  4N0K A;  1EZV I;  3TDK A;  3H1H G;  1DIQ C;  2QE7 H;  1NU1 J;  3A9F A;  5B6Q A;  1IZN B;  3Q3D A;  2B4Z A;  1B7V A;  1P84 I;  3SSU A;  1RQU A;  3Q1M A;  1N7S B;  2KOG A;  3CXH I;  3PRJ A;  3SWK A;  1OZH A;  2N9Y B;  5KAI V;  3NTN A;  5KKZ C;  2QJY C;  1BE3 D;  4W7Y A;  1J1E B;  1VDF A;  4V2K A;  3VTP C;  3ZDM A;  1JTH B;  1YEA A;  1FJK A;  1Y9B A;  1X0T A;  2E75 C;  1LMS A;  2XKM A;  5GTH H;  4O1W A;  1EXI A;  3VMX A;  1E29 A;  1SQB G;  2BH4 X;  1JY2 N;  2Q3I A;  2FYU J;  4WQ7 A;  4TT3 H;  4FA4 A;  3LIE A;  1L0N K;  2W6B A;  1H89 A;  2BEQ D;  2ZFC A;  4H44 D;  4D6T J;  3FGA D;  1RE3 A;  2N1T C;  2E74 B;  1JTH A;  1TU3 F;  1AV1 A;  1U7J A;  4FB1 A;  3CX5 E;  2CK3 H;  2AXT H;  4ASW A;  1CCH A;  1T3U A;  1G1J A;  3HE4 B;  3KZI H;  3L74 G;  1FBM A;  1F1C A;  1C75 A;  2LIT A;  1J2J B;  3VN0 A;  4C7N B;  1SQB K;  2CA3 B;  3L4M A;  3TNU B;  3CC7 P;  3X39 A;  1DEE G;  1JOC A;  1NTZ G;  1ZRT E;  1LT9 C;  1LTA C;  2QJY B;  4PJ0 E;  3CX5 H;  2Y0D A;  1L4A A;  2E75 B;  3IF4 A;  1CRI A;  5BU5 A;  5AW3 B;  5AVT B;  1BDC A;  1VQK P;  5CBO A;  3V2Q A;  3B5N C;  5CIF B;  2NRG A;  2ZT9 D;  1N7L A;  5M1B A;  1VQ5 P;  1OVV A;  4C7N A;  2YQB A;  2WMM A;  3TNU A;  1H0T B;  3WU2 V;  3ZCF A;  1GDV A;  4PJ0 H;  1Y47 A;  1KQS O;  3HUS C;  4I7Z C;  1SQQ D;  1HJ5 A;  2YCC A;  1NTZ K;  2WSF H;  2JR8 A;  1RF1 C;  1FDM A;  5EXQ A;  1NYH A;  3H1L D;  1IO4 A;  2PGD A;  1BDD A;  3L36 A;  4FAV A;  4ZKP A;  1OVR A;  4OH8 B;  2EXV A;  2O01 J;  1EXJ A;  4DCK A;  2A06 E;  4O1Q A;  2BCC G;  3PXS A;  1S6V B;  1X79 B;  1VYD A;  1CIG A;  2YXQ B;  4AAN A;  1H31 B;  2MHM A;  1DW1 A;  3B5N B;  3CCV P;  2YK3 A;  2M3E A;  1PGJ A;  3O8Z A;  3HE5 B;  1SQP D;  3CWB E;  1C6S A;  1RZ5 A;  1IFP A;  1EDJ A;  1HJ4 A;  3Q5R A;  2HG5 D;  3HUS B;  1KB0 A;  2PAJ A;  4I7Z B;  2B12 B;  1VQL P;  3A2A A;  4EYY Q;  3DR0 A;  1PP9 D;  1H31 A;  4J20 A;  2WWW A;  1H88 A;  4BWN A;  3B5N A;  2IBZ G;  3HE5 A;  1VQO P;  1S2E A;  1YIT P;  4IL6 X;  1COR A;  1VF5 C;  3B4S A;  1MG2 D;  2IZ0 A;  3HUS A;  1AJY A;  1CTZ A;  1NTK J;  5KLV G;  1N7S D;  2ZZS 1;  2WPR A;  4BRY B;  4W7Z A;  2OYH C;  3ZOX A;  1KYO D;  2M5A B;  2R5B A;  5APY A;  4XA4 A;  4XE5 B;  1LT1 A;  2IBZ I;  4L1Q A;  2BPB B;  4HH2 A;  2KB7 P;  4YE1 A;  4WBA A;  4UB8 H;  4AAL A;  1BGY G;  1FI3 A;  3L70 J;  4AYC A;  1GL2 A;  3QH9 A;  1L9B C;  1KIL A;  1NKN A;  1E8E A;  1VL2 A;  1W5C E;  1L0L D;  5B5E E;  1SQX D;  1QX8 A;  1SQV G;  3H25 A;  2W6A A;  3N4X A;  5E79 V;  5KAF V;  2KP8 A;  1VF5 B;  4AQR D;  1PPJ E;  3II6 A;  3RN0 A;  3Q5P A;  3ZOY A;  3M9H A;  1IQC A;  1IK7 A;  1W2B O;  4OVN F;  1GK4 A;  5KJ7 A;  1XTC C;  5GTI E;  2OYH B;  2FYN C;  1YIC A;  5CJ4 A;  5B5E V;  2WSE J;  2E75 D;  3RK2 B;  5BU8 B;  1NU1 E;  1KC8 Q;  3AE3 C;  1BE3 G;  4EOT A;  1DVH A;  2PRR A;  1QL2 A;  155C A;  1EB7 A;  5CIE B;  1KN7 A;  2D2C C;  2C0X A;  3QWO C;  1C2R A;  3JCU E;  1DW3 A;  1GU4 A;  2N1T D;  5AVV B;  3CXH D;  1QYZ A;  5B66 V;  5AVQ B;  2P2U A;  4NPF X;  3CCJ P;  4KT0 J;  1CW5 A;  4YXW H;  1QL4 A;  3HD7 B;  1QGK B;  2Q9I A;  1HJ3 A;  3VYM A;  2FYU E;  2FY8 A;  2FYN B;  3BCC E;  3OA8 B;  2B89 A;  1L0N D;  1X9V A;  4D6T E;  2YMY A;  1RZ6 A;  2PAC A;  4N78 D;  4PD4 E;  4KMG A;  1I5T A;  1H1O A;  1N9C A;  3H1J D;  1GW3 A;  3WUV A;  1QKS A;  2AEJ A;  1U57 A;  2V08 A;  1HH0 A;  2FFD C;  4AAM A;  5AVX B;  2B9B A;  3HD7 A;  4LGD E;  1YFC A;  2E76 B;  3O0R C;  2JEE A;  1M8O B;  2D2C B;  2DW3 A;  4LC1 A;  1BCC D;  1SQB D;  1OX3 A;  4FA9 A;  4HB1 A;  3L75 E;  1C7M A;  3GF3 A;  1BL9 A;  1YIJ P;  1VPC A;  2WPS A;  1M6Z A;  1SQQ G;  1UIX A;  3AE4 C;  3JC2 2;  3SLE A;  3L73 E;  1KB9 D;  5DJT B;  3WFB C;  2O1K A;  2HYN A;  3A5T A;  4H0K A;  2C1D B;  1CHI A;  1FZG A;  1YIQ A;  5CCH C;  1YJ9 P;  1NU1 K;  2FFD B;  1NTZ D;  2W83 C;  1FCD C;  3O1Y A;  3SWF A;  1LC1 A;  3I56 P;  3P8M C;  1M70 A;  2N18 B;  1IK9 A;  2JJL A;  2JDI H;  3A0H H;  4GOF A;  4PV1 C;  2J58 A;  2NPS B;  3HTK B;  1YTZ I;  2OYI A;  2C1D A;  2GA1 A;  2HV4 A;  5APV A;  1SQP G;  1OXZ A;  2FYU K;  2WPQ A;  3O5C A;  1KFN A;  5AVW B;  3C2C A;  1HTL C;  1PP9 G;  1VF5 D;  3MGN A;  4U3F E;  1ZZH A;  4GED B;  4LJI A;  2WT7 B;  1M90 Q;  2NPS A;  1YEB A;  1SS1 A;  2I1J A;  3VYI A;  1ZR4 A;  1CSW A;  2KLU A;  2GUS A;  3KXD A;  2KK7 A;  3TGU E;  3CX5 D;  3E1I A;  2ZJS E;  1K04 A;  2BH5 X;  1HGZ A;  3EQ2 A;  1KQF B;  1JY3 P;  2OZ1 B;  3PH0 A;  1H8A A;  3CWB J;  3A0B E;  5AW2 B;  4PV1 B;  4IFF A;  2K9J A;  1WRG A;  1ZRT D;  1HGV A;  1LWU C;  2IZ1 A;  1AVO A;  2Z5I A;  4H0J A;  1FZC C;  1NTM E;  3V4W A;  3V2P A;  1GDT A;  3MK7 B;  3A0B H;  1YI2 P;  5CIG B;  3CC4 P;  1WVE C;  4WQC A;  1KYO I;  2IBZ D;  1L0L G;  4DOJ A;  1M7L A;  1ZW0 A;  1HH7 A;  1K9M Q;  1P84 E;  2BCN B;  5APQ A;  2QRX A;  3L70 E;  2G3A A;  1URQ D;  2HLO A;  3G4S P;  2JP3 A;  3P8C E;  2QEX P;  2N3B A;  2YMK A;  2LXB A;  2QVA A;  3SFD C;  2CA4 B;  2POH A;  5AW5 B;  2LIR A;  3H1H E;  1DD3 A;  1WEJ F;  1LWU B;  2D2C D;  2DVH A;  1FZC B;  2N9J A;  1ZP0 C;  1N50 A;  3SXT A;  2H89 C;  2K9Y A;  1RE3 C;  1S5L E;  1DW0 A;  1BGY D;  4WQA A;  3WFD C;  2V7Q J;  1NTK G;  5TIS H;  2P67 A;  3AED C;  3MIW A;  1JDL A;  1PZQ A;  2BGV X;  2XND H;  1NWQ A;  2UWJ E;  1CZQ A;  5KAI E;  1J3S A;  4P4Q B;  2C9L Y;  1R0Q A;  2WSE H;  2E74 C;  1W5C T;  4AUW A;  1S5L V;  5H2F V;  1L4A C;  5CIC B;  1KIL E;  4AAO A;  2KS1 A;  1UII A;  1L0N G;  1WT6 A;  2GUV A;  1NTK K;  1FOS E;  1KB9 H;  2J59 M;  1QVG O;  5IY5 1;  3H1J G;  1MG3 D;  1KTM A;  2B87 A;  2LKM A;  2CXB A;  4N3Y B;  2A45 H;  1MFT A;  4WQ9 A;  1BCC G;  1F1F A;  1X22 A;  1ZN5 A;  2P1J A;  1JMM A;  3BCC J;  1LC2 A;  3CLQ A;  1CSU A;  4FA5 A;  3EFF K;  2W27 A;  3BRT B;  2AI5 A;  3OAK A;  1FOS F;  1G1I A;  4N6J A;  5CIB B;  1AOQ A;  1DIP A;  1HZU A;  1FOC A;  1USD A;  1L4A B;  4MN4 C;  351C A;  4JBZ A;  5CCH D;  2CE0 A;  5GTH V;  3USS A;  4OGQ B;  1PPJ D;  4Q5P A;  3UIA A;  4WY4 A;  1C2N A;  3ZOW A;  5AW4 B;  3WU2 E;  1I55 A;  2WTY A;  3BRV B;  1E5W A;  2H8P D;  3MTU E;  3AEG C;  1FZB A;  1QVF O;  2JWD A;  3SWS A;  2A45 G;  3L75 J;  2M3B A;  5AVZ B;  4JYC A;  1OW6 A;  1GU2 A;  2DGE A;  4JQ0 D;  3OA7 A;  1T2K C;  2CPB A;  3IFM A;  1FDO A;  1N15 A;  2AXT V;  1SFC C;  1KOR A;  1KB9 I;  2K37 A;  1NU1 D;  1S1C X;  2J5U A;  2PCB B;  3L73 J;  2ITA A;  3HRN A;  2C9X B;  3AE2 C;  1X8Y A;  5AW8 B;  3KPE A;  4DJG A;  2XU6 A;  4I6M C;  2A45 I;  1LNQ A;  1PV3 A;  3OW2 O;  3G6E P;  3IN6 A;  2MKV A;  2WIT A;  1QL1 A;  3FWL A;  2C9N Y;  2IPP A;  1KQG B;  2XTS B;  3CC2 P;  1EC5 A;  4GKG A;  5CJ0 A;  2FYU D;  4UB6 V;  3BCC D;  2RMZ A;  3JSV C;  5APW A;  2JQR A;  2K88 A;  1FHB A;  3F5H A;  4D6T D;  3NFQ A;  2G8Y A;  3M97 X;  4PD4 D;  1ZXG A;  1EDK A;  1OMI A;  1GL2 C;  2IFM A;  1SFC B;  1KIL C;  1AKK A;  3CYT I;  2L91 A;  4FA1 A;  1AQ5 A;  3E7K A;  2SPZ A;  3L72 J;  3CI9 A;  1JY2 P;  4U3F J;  1AYG A;  1AOF A;  1LTS C;  3SVW A; 
#chains in the Genus database with same CATH homology
 1I8P A;  3PTZ A;  3PXT A;  4EIF A;  1QL4 A;  3WC8 A;  1HJ3 A;  3L75 D;  3VYM A;  1I6D A;  1ETP A;  1GQ1 A;  1DII C;  2ZON G;  2FYN B;  2AIU A;  1KX2 A;  2BCC D;  3OA8 B;  1L0N D;  3TF5 A;  1RZ6 A;  1A8C A;  2PAC A;  4KMG A;  4WQB A;  1I5T A;  1FI7 A;  2JTI B;  1H1O A;  1N9C A;  3H1J D;  2Y0E A;  1QKS A;  1NML A;  2V08 A;  2Y0C A;  1C52 A;  4AAM A;  4XYD B;  4RSZ A;  1YCC A;  2GC7 D;  1YFC A;  1H32 B;  5CIH B;  3O0R C;  2OZ1 A;  2L4D A;  1CRC A;  1W2L A;  1COT A;  1BCC D;  1DW2 A;  2D0S A;  2ZOO A;  1SQB D;  1U74 B;  1LS9 A;  3WFC C;  2FRC A;  3A0B V;  4FA9 A;  4A7P A;  1C7M A;  2CE1 A;  2QJP B;  5CYT R;  1BL9 A;  2BLF B;  3WFE C;  4JCG A;  2D0W A;  4WQD A;  3GG2 A;  3KZI V;  1RAQ A;  1M6Z A;  3PHL A;  4K3I A;  5KLV D;  1IRV A;  5DF5 A;  4DY9 A;  3SLE A;  1KB9 D;  5KKZ B;  1E2R A;  3WFB C;  1HZV A;  3VNW A;  4H0K A;  2C1D B;  1CHI A;  1YIQ A;  5AUR A;  3GW6 A;  1L9J C;  1NTZ D;  1YTC A;  1FCD C;  3O1Y A;  451C A;  5C9M A;  1CRG A;  2Q3E A;  1KYO W;  1LC1 A;  1OAE A;  3KHU A;  3HQ8 A;  2O3J A;  1M70 A;  1K3H A;  2N18 B;  2B11 B;  4MU8 A;  4PJ0 V;  1C6O A;  1IZL 0;  1A56 A;  2C1D A;  1CIF A;  3PLN A;  2HV4 A;  3VRD A;  4EID A;  5TIS V;  2B0Z B;  1SQV D;  1NTK D;  3O5C A;  1LFM A;  5TJH A;  1CYC A;  3C2C A;  1CNO A;  1CYJ A;  2C1U A;  1H9X A;  2GC4 D;  4L3H A;  1ZZH A;  1CRH A;  4GED B;  4LJI A;  2KNC B;  1CO6 A;  2GB8 B;  3ORV A;  3ZBM A;  1YEB A;  4N0K A;  3TDK A;  1DIQ C;  3A9F A;  5B6Q A;  2B4Z A;  1B7V A;  5DJQ C;  1CSW A;  3CX5 D;  3PRJ A;  2N9Y B;  2BH5 X;  2OZ1 B;  3L70 D;  5KAI V;  1BE3 D;  4V2K A;  1YEA A;  1NIR A;  2RN0 A;  1LMS A;  1ZRT D;  3L73 D;  4O1W A;  1A2S A;  3VMA A;  1E29 A;  1HRO A;  2BH4 X;  4WQ7 A;  4FA4 A;  4H0J A;  1K3G A;  2B10 B;  2N18 C;  3MK7 B;  4EIC A;  1CC5 A;  1C6R A;  5CIG B;  3CXH W;  1WVE C;  4WQC A;  4FB1 A;  1HRC A;  2IBZ D;  1CCH A;  1HH7 A;  1I54 A;  1H33 A;  4RJT A;  5DFS A;  2BCN B;  4NFG B;  1M60 A;  1F1C A;  4EDF A;  5DJQ B;  1C75 A;  2LIT A;  1H9Y A;  1GIW A;  2CA3 B;  3L4M A;  3ITK A;  3X39 A;  4L3G A;  1CSV A;  2N3B A;  2QJY B;  2Y0D A;  2CA4 B;  1CRI A;  3L72 D;  4U3F D;  2LIR A;  1CXA A;  1U75 B;  1WEJ F;  5CIF B;  4UB8 V;  1IRW A;  2DVH A;  3HQ7 A;  2N9J A;  2YQB A;  1N50 A;  3SXT A;  3WU2 V;  3ZCF A;  1KX7 A;  1GDV A;  3TGU D;  3RMZ A;  1DW0 A;  1BGY D;  4WQA A;  3NWV A;  3PH2 B;  3WFD C;  1SQQ D;  1HJ5 A;  2YCC A;  2JWA A;  1MZ4 A;  1JDL A;  5EXQ A;  2BGV X;  4Y5R A;  3H1L D;  1CHJ A;  1J3S A;  3MK7 C;  1NMI A;  4P4Q B;  1R0Q A;  1CCR A;  4FAV A;  3H1K D;  2N9I A;  1NTM D;  4WQ8 A;  2EXV A;  1W5C T;  3CU4 A;  1CRY A;  1S5L V;  5H2F V;  2K9J B;  5CIC B;  4AAO A;  3PXW A;  2KS1 A;  4XXL A;  4O1Q A;  3PXS A;  1S6V B;  1VYD A;  1CIG A;  4AAN A;  3OCD B;  1H31 B;  3DP5 A;  3WUI A;  2MHM A;  1DW1 A;  1EZV D;  3H1I D;  2ZBO A;  1KIB A;  2YK3 A;  5IY5 1;  2V07 A;  5GTI V;  1OCD A;  1P84 D;  1CSX A;  1MG3 D;  2QG4 A;  1SQP D;  3NBT A;  1C6S A;  1RZ5 A;  1HJ4 A;  3ZOO A;  2CXB A;  1CRJ A;  1I6E A;  1KB0 A;  1DT1 A;  2B12 B;  4WQ9 A;  1F1F A;  3DR0 A;  1PP9 D;  3OCD A;  1H33 B;  1H31 A;  4J20 A;  4PWA A;  3O20 A;  3DMI A;  4AX3 A;  3L71 D;  3TYI A;  1LC2 A;  1CXC A;  1CSU A;  2C8S A;  3H1H D;  4FA5 A;  1NNO A;  1CIH A;  2N3Y A;  2AI5 A;  1COR A;  3ZIY A;  5CIB B;  1AOQ A;  1HZU A;  1MG2 D;  1FOC A;  1CTZ A;  351C A;  2PCC B;  2ZZS 1;  2CE0 A;  2FWL A;  5GTH V;  1GJQ A;  1PPJ D;  3CP5 A;  1IO3 A;  4GYD A;  4Q5P A;  3ZOX A;  1KYO D;  1C2N A;  3CX5 W;  3ZOW A;  1I55 A;  1RAP A;  1N90 A;  3HQ6 A;  3OA8 A;  3HQ9 A;  1CYI A;  2C1V A;  4L1Q A;  1CHH A;  3SWS A;  1KV9 A;  2BPB B;  2ORL A;  1GU2 A;  2DGE A;  4EIE A;  4YE1 A;  4AAL A;  1HCM A;  1N15 A;  1FI3 A;  2AXT V;  1H32 A;  2I8F A;  3SJL A;  1DVV A;  1L9B C;  2A06 D;  5C0Z A;  4QAO A;  3NBS A;  1NU1 D;  1E8E A;  4PW9 B;  1L0L D;  1SQX D;  2PCB B;  1CTJ A;  1QN2 A;  2C9X B;  3L74 D;  5E79 V;  5KAF V;  3RLM A;  1FI9 A;  2VHD A;  2YIU B;  5CID B;  3RN0 A;  1QL3 A;  3CWB D;  1FJ0 A;  1YNR A;  2GIW A;  3ZOY A;  1IQC A;  3FWL A;  2XTS B;  3L4O A;  1CTY A;  1YIC A;  2C2C A;  2FYU D;  4IL6 V;  3RN1 A;  5B5E V;  4UB6 V;  3BCC D;  2RMZ A;  2MTA C;  1CED A;  2JQR A;  3A0H V;  1FHB A;  4D6T D;  4WQE A;  3M97 X;  4PD4 D;  1I8O A;  4FAN A;  1GKS A;  1DVH A;  155C A;  1AKK A;  1EB7 A;  3CYT I;  4FA1 A;  2L91 A;  5CIE B;  2QJK B;  1C2R A;  5KLI B;  1DW3 A;  3JBT B;  1CIE A;  2ZXY A;  1AYG A;  3CXH D;  1QYZ A;  5B66 V;  1AOF A;  3SVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...