2A06D

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2a06D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2a06D02
3L71D 1ZRTD 2GC7D 1DIIC 1NIRA 1C6SA 2YIUB 1M70A 1MG3D 1YTCA 1HJ3A 1CRCA 2FWLA 2KNCB 2YK3A 3TGUD 4NFGB 2C1VA 2ZXYA 3H1LD 1CYJA 4L3GA 2I8FA 1CORA 3PTZA 1NTMD 1LC1A 1AYGA 1CIHA 1CNOA 4WQDA 1HZUA 1QYZA 2N18B 5B5EV 2CA3B 4J20A 3KHUA 1N50A 3RLMA 1H9YA 4WQ9A 1AKKA 1SQPD 2CE1A 5CYTR 3WC8A 2RMZA 1L9BC 3NWVA 2N9JA 2QG4A 1FI3A 4JCGA 1I6EA 4L3HA 1HROA 2PCCB 2GC4D 3CYTI 1IO3A 5E79V 4FAVA 3ZOWA 3WFDC 1E8EA 1H33A 2B12B 3VMAA 3RN1A 2N9YB 351CA 2GB8B 1C2RA 2Y0DA 4EIDA 1I54A 1A2SA 1RZ5A 2QJPB 4K3IA 2PACA 3WFEC 1CXCA 1GQ1A 1CTZA 4FA9A 1QKSA 3H1ID 3BCCD 1DT1A 5CIHB 1CIFA 4WQBA 4AALA 4FA5A 4Q5PA 1SQXD 1HZVA 2C1DA 2FRCA 4WQAA 4O1WA 5KKZB 3WFBC 1M6ZA 2QJKB 1H32B 1KB9D 2B0ZB 2BGVX 4PW9B 3A9FA 1FJ0A 2K9JB 1DVVA 2N9IA 3KZIV 3L73D 5CIDB 3GG2A 3A0HV 4YE1A 2N3YA 3O1YA 3SWSA 1NMIA 451CA 3SVWA 2EXVA 4QAOA 3L72D 3PXTA 1LC2A 2JTIB 1I6DA 1QL3A 1C52A 2CA4B 3C2CA 3HQ7A 5GTHV 1W5CT 1CHHA 1CSVA 2YCCA 1S5LV 3OA8B 3ZIYA 2XTSB 1WEJF 2MTAC 1GKSA 1M60A 3OCDA 5CIFB 2RN0A 2D0SA 2N18C 4XXLA 2ZBOA 1ZZHA 2JWAA 3PH2B 3O0RC 4LJIA 3RMZA 1B7VA 1HH7A 4EDFA 1FCDC 5KLVD 4FB1A 1CO6A 1NU1D 1EB7A 1P84D 1GU2A 4PD4D 5CIBB 3VYMA 1GDVA 2LITA 3H1JD 2GIWA 2PCBB 3X39A 5DF5A 2DGEA 3HQ6A 1A56A 4N0KA 1CHJA 4RSZA 1LMSA 5CICB 4FA4A 1CEDA 2B4ZA 1SQQD 1CXAA 1NMLA 2C9XB 1DVHA 2Y0EA 1BGYD 1MG2D 4O1QA 1KV9A 3PHLA 1CYIA 4EIFA 4L1QA 5AURA 2BCCD 3WU2V 1EZVD 3PXSA 2ZOOA 1FI9A 1HCMA 1CYCA 3PRJA 2C8SA 3CXHW 1DW2A 4Y5RA 1CHIA 1VYDA 4H0KA 2ORLA 1GJQA 3CU4A 2DVHA 3MK7C 1AOQA 1IRVA 2C2CA 3CXHD 3TDKA 1C75A 1N9CA 5DFSA 3DMIA 2CE0A 4WQCA 5TISV 1K3GA 1H31B 3TF5A 4H0JA 1DW1A 3FWLA 4FA1A 3O20A 3NBTA 1QN2A 1BE3D 3L70D 1CC5A 3ZOYA 2O3JA 1YICA 3M97X 5H2FV 4KMGA 5IY51 1L9JC 1U74B 1FOCA 1A8CA 1LFMA 4A7PA 2BCNB 1DW3A 1I5TA 4WQEA 2OZ1B 1IZL0 4V2KA 2LIRA 1H9XA 2QJYB 1QL4A 3L74D 1AOFA 2Y0CA 1NTZD 1R0QA 1OAEA 3ZCFA 1DW0A 1SQBD 5CIGB 5TJHA 4AAOA 4MU8A 3L4MA 1YIQA 1L0ND 1CTYA 4U3FD 1CCHA 2YQBA 1IQCA 2N3BA 1L0LD 2BH5X 2C1UA 1GIWA 4AX3A 2CXBA 1H32A 1MZ4A 1HJ5A 2ZONG 1YCCA 1RAQA 1H31A 1F1CA 1HRCA 1CIEA 4AANA 1HJ4A 3CX5W 1KX7A 2HV4A 5DJQB 4UB6V 3L4OA 1NNOA 3SLEA 1U75B 5GTIV 1FI7A 3CX5D 2JQRA 1KIBA 3CWBD 2OZ1A 3ZBMA 4UB8V 2C1DB 1C6RA 3PLNA 1F1FA 2L4DA 4GEDB 1S6VB 3PXWA 2FYNB 2FYUD 3DP5A 3OA8A 3HQ8A 3HQ9A 5EXQA 3ZOOA 5B66V 1I8PA 3WUIA 2ZZS1 3H1KD 3JBTB 5B6QA 2VHDA 5CIEB 1CRJA 2BPBB 1PP9D 5KLIB 4GYDA 1FHBA 4EIEA 2MHMA 2L91A 1BL9A 4XYDB 3CP5A 1WVEC 2AIUA 1SQVD 1C7MA 1COTA 1N90A 5KAIV 5KAFV 1C2NA 3RN0A 2B11B 1CRYA 2KS1A 4PWAA 4WQ8A 3ZOXA 4P4QB 5C9MA 1K3HA 4IL6V 1I8OA 1J3SA 3VRDA 1NTKD 1KX2A 4EICA 1CCRA 1H1OA 3OCDB 2AI5A 1CSXA 5C0ZA 1CSWA 1LS9A 3SJLA 3DR0A 1CRGA 3SXTA 1PPJD 3O5CA 4WQ7A 1YFCA 1E2RA 1RAPA 3ORVA 155CA 3MK7B 3WFCC 1CSUA 2Q3EA 2BLFB 1W2LA 4PJ0V 1C6OA 1JDLA 4D6TD 1I55A 1CRHA 1E29A 1RZ6A 3TYIA 1DIQC 1IRWA 2V08A 1KYOW 2A06D 1CTJA 3L75D 1YEBA 5DJQC 1N15A 1KB0A 1YEAA 2D0WA 2V07A 1YNRA 4AAMA 1BCCD 3NBSA 1OCDA 3ITKA 1H33B 1ETPA 1CRIA 2IBZD 1KYOD 2BH4X 3VNWA 1CIGA 3H1HD 4FANA 2AXTV 2B10B 4DY9A 3A0BV 4RJTA 3GW6A
chains in the Genus database with same CATH superfamily
3L71D 2E74D 5AVVB 1C6SA 2YIUB 3AECC 1NH4A 1PGJA 2IBZG 2KNCB 2O01N 3SSUA 3TGUD 2OYIC 3O6QB 4ZMDA 1CORA 3Q5RA 2HPCB 1LC1A 1AYGA 2FBWC 1HZUA 2H7HA 5EFWB 3KHUA 1IK7A 1N86A 2KP8A 2CE1A 5CYTR 2YXQB 3L4FA 2ZVOB 1L9BC 4DOJA 1FI3A 4L3HA 1HROA 1SQQE 2GC4D 1IO3A 1Y8AA 2KB7P 5E79V 1ZP0C 3WFDC 2PRRA 1H33A 3VMAA 3RN1A 3H1JG 2GB8B 2G3AA 1LT1A 2N1TC 2P67A 3NFQA 3L74J 2Q3IA 3FXDA 1NKNA 3T97B 1SQBJ 3VP8A 1M1JA 3CXHI 3L37A 1RZ5A 3H1IE 3IFMA 2Q9IA 2PACA 1FS0E 3VOPA 4WWIA 5B66H 2H43A 2E5YA 1GDTA 1CTZA 1QKSA 3F89A 1DT1A 5CIHB 3W68A 3RK3B 3V2QA 2WSSH 4WQBA 4FA5A 1BGYG 4Q5PA 1IFNA 4OGQB 3CCSP 3AE5C 2C1DA 4WQAA 1OX3A 1BE3E 1SQQK 1NU1J 2OTLP 2W6AA 2BGVX 4W7ZA 4H13B 3A7OA 1T8ZA 1LTJA 2R5DA 2GUSA 1GTWA 1Q81Q 4IL6H 2N9IA 1D7MA 3R2PA 2Z5IA 3L72E 4DZOA 2Q6QA 2SPZA 4IFMA 2XNDH 1M1JC 1I6DA 2A45G 1QEXA 3HRNA 1FBMA 1LTBC 5GTHV 2N1TD 1CSVA 2E5TA 4U3FE 1E5WA 5CJ0A 2KLVA 1GKSA 1SQVJ 1LTIC 4OH8B 3OCDA 2NZ2A 5AW8B 1GMJA 5KLVE 2ZBOA 1LWUB 2POHA 3CCVP 3M9QA 3PH2B 5B66E 1Z56A 3KYQA 1B7VA 1P84E 4XFJA 4XE5B 2P58A 1CO6A 1LTJC 1PGPA 5KLIC 1NU1D 1X0TA 3G3ZA 5AW3B 1L0NG 1M8OB 2M5AB 1SVFA 3VYMA 1GDVA 1NTZK 1G2CA 1JOCA 3A2AA 2WVRA 5AVTB 3X39A 1IO4A 2DGEA 1J1EC 2JO1A 3HQ6A 3RL0g 5CICB 3BATA 1A02F 1CEDA 1BSHA 1MUUA 2B4ZA 2KK7A 4WVZA 1CXAA 1DD3A 4HJGH 1X8YA 1S3JA 4O1QA 2J58A 4NPDA 3WU2V 5KKZC 4D6TJ 1KFMA 2W90A 1LTSC 3PXSA 2QJKC 1KZUB 1FI9A 2R3CA 2WSFH 2NPSA 4H0KA 1HWTC 3CU4A 1L4AA 3Q2YA 4B86A 1RF1C 5E79H 3CX5H 2C2CA 1FAVA 3CXHD 1SS1A 3H1HJ 4WQCA 2AXCA 3BASA 4H0JA 2E75B 3S4RA 2FYUK 1KORA 3FWLA 3I5CA 3KDPB 1FJPA 1YI2P 3P7KA 3L70D 2GUVA 3HTKA 2Q5UA 1CC5A 3SWFA 1BDCA 4GKGA 3CWBJ 5H2FV 3B5NB 4ZKUA 4KMGA 1U74B 3B8EB 4R4MA 1I5TA 3OAKA 1K8AQ 3LW5J 4YXDC 2OZ1B 2WWWA 2M8RA 3RK3E 1X22A 1QL4A 2ZYDA 1M90Q 3ZCFA 2OGUA 4M3LA 1DW0A 3IN6A 2B87A 4WBAA 4BXLA 3GF3A 2NPSC 2IZ0A 3TYYA 2OYHB 1N2DC 1L0LE 1L4AC 2W27A 1YIQA 2ZAEB 5APVA 3CMEP 2XKMA 2LXBA 2HR3A 1GIWA 1H32A 1YCCA 4OVNF 3VMZA 2QE7H 1JTHA 5CCGA 3FGAD 1FE6A 1USDA 4AANA 1HJ4A 1VQ4P 2HYNA 2ZT9C 5GTHH 2IYPA 5DJQB 3IF4A 4WB4A 4ZNCA 3CX5E 3H1IJ 2WTYA 2NRGA 1NNOA 5AW7B 1OW8A 1U75B 3MHVA 1FI7A 1SQXJ 1BCCG 5K5GB 2LXCB 2WT7A 4Y99C 3CWBD 2C1DB 1GK4A 4GEDB 2YO3A 3H1KE 4JF7A 3PXWA 3AE3C 1PP9E 3HQ9A 1VF5C 2ZZS1 3HUSA 2H88C 1CRJA 3L73J 5KLIB 2L5GB 5GTIH 2NPSD 5AVRB 1NTMG 5CCGC 1COTA 1L4AD 3SFEC 1SP4A 1LT9A 1YJWP 1NTKE 1N7LA 3AEGC 3UIAA 1J3SA 4BRYA 5BU5A 5AW1B 1YTZI 3GHGB 1SQVG 3WU2H 2ZT9D 2DW3A 2BEZF 3CD6P 1VQ7P 1OMIA 1H1OA 3OCDB 1PGOA 1NAYA 3TK1A 1CSWA 5GTHE 3SJLA 2PP6A 1CRGA 5KAIH 1S1CX 1PPJD 1U7JA 3V4QA 3HUSC 1RAPA 1KFNA 3BCCG 3H1JJ 3ORVA 3HE4B 4C7NA 3WMM0 1ZOYC 1HH0A 3BRTB 1KN7A 1K04A 1S9KE 1CW5A 1JDLA 1U7MA 1ZN5A 5CCHA 1LT9C 1KYOW 1GW4A 3L75D 4H44B 2YXRB 1N15A 1KB0A 3SWKA 5CCGD 1BGYJ 3G71P 5GTIE 3NBSA 1OCDA 4YTPC 2IBZD 3NMDA 2BH4X 4FANA 1FDMA 1KB9H 3AE4C 4PD4I 3C9IA 1YBKA 3EFFK 1E79H 3H6PA 1ZRTD 1LJ2A 2GC7D 2O1KA 1DIIC 1NIRA 2FYNC 1MG3D 1YTCA 1QGKB 1HJ3A 2BASA 1NTME 4NFGB 2C1VA 1L4AB 3H1LD 2WZ7A 3PTZA 1QL2A 1SQPE 5CHXA 1CIHA 1QYZA 4YXWH 1N50A 3RLMA 1SQBK 1H9YA 4EI2A 4WQ9A 5CCHC 1T3JA 5KAIE 5KAFE 1XTCC 3WC8A 3AE8C 3NWVA 2N9JA 3HTKB 3CCEP 3U59A 4JCGA 3CYTI 2WSEH 3SFDC 1E8EA 3G4SP 1JY2N 2V7QH 4L73A 4EIDA 1FC2C 1I54A 2GA1A 1A2SA 1NU1K 5B5EH 3D6ZA 1VQOP 3ZDMA 1JCDA 3WFEC 4N3YB 3VTPC 1L0NJ 4I1LA 1WMKA 1GQ1A 1OW6A 1SQQG 1ZXGA 1L0LJ 1CIFA 2QJYC 3MZWB 5AW9B 1HZVA 1LGHB 2FRCA 4O1WA 1QVGO 1H32B 1JO5A 3L70E 1OW7A 5L8RJ 1DIPA 3H1IG 4QMAA 1N7SB 2I1KA 5CCHD 4AYCA 1HGZA 1KILA 1AVOA 2N3YA 3EWKA 2WT7B 3MP7B 1NMIA 3SVWA 1URQA 2EXVA 1BE3G 2JTIB 1QL3A 3HQ7A 1GD2E 1JMBA 1LTGC 2O01H 2M0BA 1PP9J 2AEJA 5APWA 1ZV8A 1X79B 3VYIA 1N73C 1M60A 5CIFB 3L72G 2Q7CA 2RN0A 2D0SA 5B5EE 2N18C 4XXLA 4EYYQ 3AE7C 1HH7A 1LT9B 3P32A 1EB7A 3HD7C 3B4SA 1ZR2A 4U3FG 4PD4D 1NTKJ 5AW6B 1KILC 3CCMP 1LP1A 3V2NA 3H32B 2PCBB 3RL0C 3BRVB 4NPFX 1URQC 5KLVG 1CHJA 4RSZA 2QJPC 4FA4A 1KQLA 5APXA 2BCCE 4RKUJ 1EZVE 4L1QA 3S1KA 1NAFA 1HCMA 1CYCA 2C8SA 1P84H 1DW2A 1FZCB 1FZFA 1SFCA 2IFNA 1CHIA 2FYUG 2ORLA 1GZLA 1NYHA 1BCCJ 2DVHA 4KHXA 3U1CA 2G8YA 4EIJA 1IRVA 2I1JA 1LTAC 5AVZB 1N9CA 5DFSA 3DMIA 1KB9I 3RK2B 3OA7A 1H31B 2XU6A 2YKQA 2K3RA 3KXDA 2H89C 1VQ5P 3TNUB 4C7RA 3ZOYA 1KILD 4WY4A 1PPJE 1AA0A 2O3JA 1URQD 5IY51 3C1LA 3BVHA 2BEQD 1Q7YQ 1LFMA 2BCNB 2E74B 1NTMJ 4WQEA 1RE3A 1NTZE 1W2BO 1UIIA 1H9XA 1EXJA 2JDIH 2QJYB 3M0AA 3AEEC 1EC5A 3L74D 1AOFA 1IFMA 1KYOI 1OAEA 1SQBD 2K88A 1SFCC 5TJHA 2W83C 1OIPA 2WITA 1YHQP 2IYOA 5APQA 3G6EP 2C9NY 4AX3A 1HJBA 1HJ5A 3HE5B 5BU8B 1JM0A 1F1CA 4BWNA 4YPCA 3USSA 1FOSF 5AVYB 3M0DA 3CX5W 3CC7P 1ZRTE 4RO0A 4WY4C 2W6JH 2HV4A 1RF1A 2KS1B 1HF9A 4UB6V 3BCCJ 3M9HA 3L4OA 2W8ZA 2WPRA 1CI6B 1L0LG 5GTIV 2JWDA 4EOTA 4IOIH 4JQ0D 3H1LE 1RE3C 1KIBA 1Q2NA 2KYVA 1FDOA 2FKWB 4PV1C 1C6RA 2FYUE 3E7KA 3CCJP 1GK6A 3VMYA 1VL2A 1S6VB 3V4WA 3OA8A 3ZOOA 1I8PA 2I8DA 4N78D 1KD1Q 2VHDA 5CIEB 1KTMA 1KQGB 2OYIB 1EZVI 4EIEA 1PL5A 2L91A 1BL9A 1SFCD 2AIUA 1SQVD 1KILB 5KAIV 5KAFV 3K5BA 1FJKA 3M0DC 1JY3N 3RN0A 1URQB 3H1KG 4H0LC 1PP9G 2N9BA 3FXEA 1M57D 3RBZA 1I8OA 3CMAP 3PJSK 4WY4D 2N1TB 2HODA 1HVVA 1CCRA 1CSXA 2ZJSE 4WQ7A 1E2RA 2YKPA 1NTKG 3D6YA 3WFCC 1CSUA 2RKLA 3V2PA 1HJ0A 2Q3EA 3G9RA 2BLFB 1W2LA 1LP1B 1GL2C 1C6OA 4D6TD 1I55A 2R32A 1CRHA 2K9YA 4K3AA 1RZ6A 2V08A 2KZJA 2A06D 1YEBA 1JMMA 2HG5D 1SQQJ 2QRXA 1VQLP 1H0TA 2D0WA 4L76A 1FOSE 1H33B 3CPWO 1ETPA 1CRIA 2BCCJ 1KYOD 1VQMP 3OJAB 1AV1A 4H0LD 1Y9BA 3H1HD 3L71E 1P84I 2FXMA 2B10B 1M1JB 2E76C 2YKOA 4DY9A 3AE2C 4RJTA 2FY8A 3TGUE 3D70A 1M70A 1G1JA 2O01J 1SFCB 2KUBA 3V6IA 1OZHA 2ZXYA 4L3GA 1DD4A 2WPSA 1CNOA 5B5EV 1HUCA 1EXIA 1BE3J 2FXOA 4J20A 1JCCA 1VPCA 2KI7B 1AKKA 4AUWA 2AEMA 3AEBC 2MJZA 4UB6H 1LTJB 2QG4A 5CMZA 2RH0A 2P7JA 3WUUA 4FAVA 3L72J 1NOHA 1CZQA 3SWYA 3IR9A 1C2RA 1NTZJ 1SQPG 1VQ6P 1J1EB 3GMAA 1DEEG 1OVVA 3CC4P 4U3FJ 1CXCA 1Q82Q 2C0WA 3H1ID 2IPPA 1DX7A 2E76D 2KNCA 1GU5A 2E42A 3O6QA 1SQXD 5KKZB 5KLVJ 2QM7A 2HPCA 2QJKB 5KAFH 4GDOA 1T2KC 1KILE 1PV3A 4TT3H 3CC2P 1S2EA 3MTUE 1RF1B 1DVVA 4H0LB 1G2CB 1Y47A 3L73D 1VF5D 2PFXA 2FFDA 3O1YA 2AXTE 2E43A 3SWSA 3L74E 4QAOA 3L72D 4UB6E 3A0BE 1Q90D 1SQBE 2FYUJ 3L70G 1PZQA 2B9BA 2YIUC 1OWAA 1CHHA 3OA8B 3ZIYA 3IAOA 5CBNA 2XTSB 4W7YA 2QM8A 4MN4C 1R5SA 1T6AA 3I55P 1ZZHA 3CX5I 2JWAA 3O0RC 1NU1E 1RH5B 4EDFA 1FCDC 5KLVD 2NPSB 3M91A 3AE1C 1FU1A 2Z5HA 1P84D 5CIBB 2LITA 3H1JD 1NWQA 2FFDC 2KOGA 1K9MQ 1AQTA 5DF5A 1A56A 3VMXA 4N0KA 1LMSA 2ZT9B 3PP5A 3M9BA 1FDIA 1JEKA 2YO2A 5CJ4A 1NMLA 1KV4A 2Y0EA 3RK3C 1BGYD 1MG2D 1KV9A 4Y99B 4OGQC 3PHLA 1CYIA 1QVFO 1OFCX 4EIFA 1NHLA 2WPVB 4GIFA 2ZOOA 1LWUA 3PRJA 2B87B 5M1BA 4Y5RA 4H13C 3GLMA 4JYCA 1VYDA 3CXHE 1GJQA 1VF5B 1AQ5A 2CPBA 1JNMA 1S4XA 1N73A 3LIDA 5AW2B 1H0TB 2BCCG 3KZIE 1C75A 1EZVG 1K3GA 3A0HE 1JTHB 3M06A 2JP3A 3ABVC 1DW1A 2JR8A 2WSFJ 4FA1A 3O20A 1QN2A 2JKVA 3L71J 4TLFA 2K37A 3HD7A 4LC1A 4HYTB 1YICA 3TGUJ 1SQVK 1L9JC 1S5LE 4A7PA 2D2CC 3A5TA 1A02J 4C46A 1IZL0 4KT0J 4V2KA 1J2JB 2P2UA 1JY3P 1LWUC 2ZXEB 3NTNA 2CK3H 3H1KJ 2QEXP 2K1AA 5CIGB 4OGQD 4JPZB 4MU8A 4N6JA 1PPJG 3HUSB 1L0ND 1CTYA 1MZ9A 3KQGA 3MIWA 4JBZA 2N3BA 1L0LD 4U7JA 3EFGA 2CXBA 4H13D 1NGMB 1MV8A 2ZONG 3H1HE 5APUA 1NTZG 2Z4EA 2KLUA 2Y9ZA 2WSCH 1KX7A 2K9JA 1RY3A 1U57A 2P1JA 2PGDA 3B5NA 3CWBE 4BRYB 1OXZA 1YIJP 3CX5D 3LIEA 2OZ1A 1H88A 4JYBA 3ZBMA 3WUTA 4UB8V 2L4DA 1IZNB 2D2CD 2FYNB 3DP5A 3HQ8A 5EXQA 3CCRP 1T3UA 2OYHA 1KMIZ 3H1KD 3JBTB 2ZFCA 5B6QA 4C7NB 1EQ7A 2BPBB 1PP9D 4AQRD 4GYDA 1XTGB 5TISE 3H1LG 1WVEC 1VQPP 2E75C 1C7MA 1N90A 3P8CD 1OVRA 2FFDB 1TU3F 3MUDA 2HFED 3MD0A 1EDIA 4PWAA 4WQ8A 3ZOXA 4P4QB 3B5NC 5C9MA 1K3HA 2QVAA 1SQXE 3HD7D 3VRDA 3JC22 1NTKD 3EQ2A 1ZLLA 1VDFA 2KZIA 4EICA 4OWFA 4I2LC 5AVSB 5C0ZA 3RL0D 1LS9A 2WQYC 3W67A 2MKVA 1JY2O 3B71A 5AW4B 2OYHC 3O5CA 3L36A 1IJDB 5APYA 2YMYA 1FZEA 3QH9A 3L73E 1SQPJ 1S5LX 2M3EA 2LKMA 1W2EA 4I6MC 4GT1A 3L75E 1PIXA 3MUDC 2QSIA 1HTLC 1YQ3C 1QX8A 1S9KD 4I7ZC 5DJQC 1SQXK 1WT6A 1YEAA 2IBZE 2E75D 1BCCD 3ITKA 3II6A 2KXPB 3GHGA 1CIGA 2D2CB 2AXTV 1RQVA 2WMMA 3CCQP 3NXSA 3B5ND 4DT0A 1H89A 3A0BV 2PAJA 3Q5PA 4PJ0H 3GW6A 4HH2A 2FYZA 1DEBA 2A45H 1QL1A 3VN0A 1CRCA 2FWLA 2IFMA 3S9OA 2YK3A 3A3YB 1N8RQ 3VP9A 3HE4A 3H1JE 4RESB 1N73B 1CYJA 3E1IA 2I8FA 2XNXA 1NTMD 2KSJA 4WQDA 2N18B 1NO4A 2XZRA 2CA3B 4ZKPA 3L71G 3L70J 4DJGA 1J1DC 1SQPD 3JCUH 1EDLA 2RMZA 2C0XA 1I6EA 3TGUG 1VQNP 3HD7B 2PCCB 1LTTC 4IL6E 1BGYE 3ZOWA 3AEDC 1NJIQ 2B12B 3GHGC 1YYCA 1GL2A 2N9YB 351CA 1HGVA 3RL0B 5KLVK 4L74A 4UB8H 1CSBA 2Y0DA 1MKMA 2XV5A 4Y28J 1G1IA 3R4YA 2QJPB 4K3IA 1M56D 2WSEJ 1FZGA 1IFIA 4FA9A 3BCCD 4PD4H 1NVOA 1L2PA 2V7QJ 3QWOC 3V2RA 4AALA 1NKZB 3WFBC 1M6ZA 4PJ0E 3Q3DA 1KB9D 2B0ZB 3D0WA 3CI9A 1AVYA 4PV1D 4PW9B 3A9FA 1FJ0A 2K9JB 4H44C 1KQFB 5APTA 1W5CE 1Q86Q 1IFPA 1JY2P 2KIKA 4ASWA 3KZIV 2IX7C 2C9LY 5CIDB 3GG2A 3A0HV 4YE1A 3RGUA 1YTZT 3JCUE 1DH3A 451CA 3PXTA 1LC2A 5DJUB 5KJ7A 1FZBA 1C52A 2CA4B 2CPSA 1JB0J 3C2CA 3L35A 2IBZI 1W5CT 1USEA 2YCCA 1L0NE 1S5LV 5AVUB 3F5HA 1WEJF 2MTAC 2M3BA 2OARA 4UB8E 2OTJP 2ZXXA 4LJIA 3L74G 3RMZA 4GODA 3H25A 1SQBG 4FB1A 1R5LA 4PD4E 4I7ZB 1MFZA 1GU2A 1N7SA 1EDKA 4CPGA 3FWNA 5E79E 4XA4A 1RE4A 2AEFA 2R5BA 1VQKP 2GIWA 2AXTH 4H44D 4DCKA 2WSCJ 3A0BH 1M1KQ 1L0NK 2GM4A 5KJ7C 3CL3D 4WY4B 3AEFC 1GL2D 3I56P 1NU1G 1L0LK 4GOFA 5CBOA 1SQQD 1K73Q 2IDBA 4W80A 1VQ9P 2QA4P 2C9XB 1DVHA 5AVXB 1YITP 1VQ8P 4IL6X 5AURA 2BCCD 1BSNA 1EZVD 3P8CE 2OYOA 4PV1B 4IFDK 3L75J 3CXHW 3AEAC 1J1DB 1FZAA 4L75A 5BVZA 3MK7C 2Y9YA 1N7SC 1AOQA 2IZ1A 1RE4C 5DJTB 3Q1MA 3TDKA 1IFJA 2CE0A 5TISV 1KQSO 2ZYAA 1RQUA 3TF5A 3H32A 1IC2A 2VRSA 3NBTA 2ZVNB 1BE3D 2FXPA 2A45I 3TSIA 3M97X 2R3SA 2J5UA 2H8PD 2QIWA 1JY3O 2P10A 1FOCA 1A8CA 3H1LJ 5APSA 1YJNP 2ZYGA 1DW3A 5KJ7D 3N4XA 2OTKE 2LIRA 2JJLA 1RHZB 2V4HA 3T97A 1GW3A 3OW2O 2J59M 3JSVC 1AFOA 3KPEA 2Y0CA 1NTZD 1R0QA 4LGDE 1FZCA 2W6BA 2XDJA 3CXHH 4AAOA 3RBXA 5AW0B 4KJMA 1NTKK 3L4MA 3PH0A 4U3FD 1CCHA 2YQBA 1BCCE 3KZIH 2LR2A 5H2FH 1IQCA 3FX0A 2BH5X 2C1UA 3A0HH 2YNYA 1MZ4A 1RAQA 4HKZH 1H31A 1GL2B 1N7SD 1HRCA 3V5BA 1CIEA 4D6TG 3TNUA 1YQ4C 2A06G 1H8AA 5AW5B 1LNQA 1T2KD 3SLEA 1S5LH 3GF7A 4Z1MH 3O8ZA 3CCUP 1ZR4A 2JQRA 2UWJE 1MFTA 2O1JA 3AE6C 1X9VA 1OVUA 2HODB 1BDDA 3WU2E 3H1HG 3PLNA 1F1FA 2E76B 4N78E 1AJYA 1FZCC 5C39A 3Q5SA 2FYUD 1RF0A 5B66V 3WUIA 2KSEA 4IFFA 3N7NA 2WPQA 1QLED 3CWBG 1KC8Q 1KYOH 1SQVE 2JEEA 1EDJA 1FHBA 2MHMA 4XYDB 1SLQA 3CP5A 3RK2C 2ITAA 1S72P 3HE5A 1C2NA 5AVWB 1IK9A 2B11B 1CRYA 2KS1A 2M5AA 1NTMK 5H2FE 3BCCE 4IL6V 1CI6A 3C8VA 2E74C 1SQPK 3MGNA 3LW5H 4ASVA 1KX2A 2AI5A 1KB9E 3E1RA 1YJ9P 4O9BA 2B89A 1PFIA 3DR0A 3AE9C 3SXTA 1RF0C 1IFDA 1YFCA 1HBWA 4LLHA 2OQQA 4K35A 155CA 1PGQA 2OYIA 5TISH 3MK7B 2R44A 4GOEA 4D6TE 1SQXG 2Q1KA 2HLOA 3CLQA 3RK3D 2YMKA 4PJ0V 1JUNA 2A06E 2B88A 3WUVA 1GU4A 1E29A 1ZMEC 5KTBA 1UIXA 3TYIA 1DIQC 1IRWA 4HB1A 1CTJA 3P8MC 1M7LA 1WRGA 3RK2D 4NPEA 2V07A 1YNRA 4AAMA 1KYOE 3U1AA 3D71A 1ZW0A 3VNWA 3L73G 2N1TA 5AVQB 4R4LA 3CCLP 1R8EA 1K05A 3L75G
chains in the Genus database with same CATH topology
3L71D 1ZRTD 2GC7D 1DIIC 1NIRA 1C6SA 2YIUB 1M70A 1MG3D 1YTCA 1HJ3A 1CRCA 2FWLA 2KNCB 2YK3A 3TGUD 4NFGB 2C1VA 2ZXYA 3H1LD 1CYJA 4L3GA 2I8FA 1CORA 3PTZA 1NTMD 1LC1A 1AYGA 1CIHA 1CNOA 4WQDA 1HZUA 1QYZA 2N18B 5B5EV 2CA3B 4J20A 3KHUA 1N50A 3RLMA 1H9YA 4WQ9A 1AKKA 1SQPD 2CE1A 5CYTR 3WC8A 2RMZA 1L9BC 3NWVA 2N9JA 2QG4A 1FI3A 4JCGA 1I6EA 4L3HA 1HROA 2PCCB 2GC4D 3CYTI 1IO3A 5E79V 4FAVA 3ZOWA 3WFDC 1E8EA 1H33A 2B12B 3VMAA 3RN1A 2N9YB 351CA 2GB8B 1C2RA 2Y0DA 4EIDA 1I54A 1A2SA 1RZ5A 2QJPB 4K3IA 2PACA 3WFEC 1CXCA 1GQ1A 1CTZA 4FA9A 1QKSA 3H1ID 3BCCD 1DT1A 5CIHB 1CIFA 4WQBA 4AALA 4FA5A 4Q5PA 1SQXD 1HZVA 2C1DA 2FRCA 4WQAA 4O1WA 5KKZB 3WFBC 1M6ZA 2QJKB 1H32B 1KB9D 2B0ZB 2BGVX 4PW9B 3A9FA 1FJ0A 2K9JB 1DVVA 2N9IA 3KZIV 3L73D 5CIDB 3GG2A 3A0HV 4YE1A 2N3YA 3O1YA 3SWSA 1NMIA 451CA 3SVWA 2EXVA 4QAOA 3L72D 3PXTA 1LC2A 2JTIB 1I6DA 1QL3A 1C52A 2CA4B 3C2CA 3HQ7A 5GTHV 1W5CT 1CHHA 1CSVA 2YCCA 1S5LV 3OA8B 3ZIYA 2XTSB 1WEJF 2MTAC 1GKSA 1M60A 3OCDA 5CIFB 2RN0A 2D0SA 2N18C 4XXLA 2ZBOA 1ZZHA 2JWAA 3PH2B 3O0RC 4LJIA 3RMZA 1B7VA 1HH7A 4EDFA 1FCDC 5KLVD 4FB1A 1CO6A 1NU1D 1EB7A 1P84D 1GU2A 4PD4D 5CIBB 3VYMA 1GDVA 2LITA 3H1JD 2GIWA 2PCBB 3X39A 5DF5A 2DGEA 3HQ6A 1A56A 4N0KA 1CHJA 4RSZA 1LMSA 5CICB 4FA4A 1CEDA 2B4ZA 1SQQD 1CXAA 1NMLA 2C9XB 1DVHA 2Y0EA 1BGYD 1MG2D 4O1QA 1KV9A 3PHLA 1CYIA 4EIFA 4L1QA 5AURA 2BCCD 3WU2V 1EZVD 3PXSA 2ZOOA 1FI9A 1HCMA 1CYCA 3PRJA 2C8SA 3CXHW 1DW2A 4Y5RA 1CHIA 1VYDA 4H0KA 2ORLA 1GJQA 3CU4A 2DVHA 3MK7C 1AOQA 1IRVA 2C2CA 3CXHD 3TDKA 1C75A 1N9CA 5DFSA 3DMIA 2CE0A 4WQCA 5TISV 1K3GA 1H31B 3TF5A 4H0JA 1DW1A 3FWLA 4FA1A 3O20A 3NBTA 1QN2A 1BE3D 3L70D 1CC5A 3ZOYA 2O3JA 1YICA 3M97X 5H2FV 4KMGA 5IY51 1L9JC 1U74B 1FOCA 1A8CA 1LFMA 4A7PA 2BCNB 1DW3A 1I5TA 4WQEA 2OZ1B 1IZL0 4V2KA 2LIRA 1H9XA 2QJYB 1QL4A 3L74D 1AOFA 2Y0CA 1NTZD 1R0QA 1OAEA 3ZCFA 1DW0A 1SQBD 5CIGB 5TJHA 4AAOA 4MU8A 3L4MA 1YIQA 1L0ND 1CTYA 4U3FD 1CCHA 2YQBA 1IQCA 2N3BA 1L0LD 2BH5X 2C1UA 1GIWA 4AX3A 2CXBA 1H32A 1MZ4A 1HJ5A 2ZONG 1YCCA 1RAQA 1H31A 1F1CA 1HRCA 1CIEA 4AANA 1HJ4A 3CX5W 1KX7A 2HV4A 5DJQB 4UB6V 3L4OA 1NNOA 3SLEA 1U75B 5GTIV 1FI7A 3CX5D 2JQRA 1KIBA 3CWBD 2OZ1A 3ZBMA 4UB8V 2C1DB 1C6RA 3PLNA 1F1FA 2L4DA 4GEDB 1S6VB 3PXWA 2FYNB 2FYUD 3DP5A 3OA8A 3HQ8A 3HQ9A 5EXQA 3ZOOA 5B66V 1I8PA 3WUIA 2ZZS1 3H1KD 3JBTB 5B6QA 2VHDA 5CIEB 1CRJA 2BPBB 1PP9D 5KLIB 4GYDA 1FHBA 4EIEA 2MHMA 2L91A 1BL9A 4XYDB 3CP5A 1WVEC 2AIUA 1SQVD 1C7MA 1COTA 1N90A 5KAIV 5KAFV 1C2NA 3RN0A 2B11B 1CRYA 2KS1A 4PWAA 4WQ8A 3ZOXA 4P4QB 5C9MA 1K3HA 4IL6V 1I8OA 1J3SA 3VRDA 1NTKD 1KX2A 4EICA 1CCRA 1H1OA 3OCDB 2AI5A 1CSXA 5C0ZA 1CSWA 1LS9A 3SJLA 3DR0A 1CRGA 3SXTA 1PPJD 3O5CA 4WQ7A 1YFCA 1E2RA 1RAPA 3ORVA 155CA 3MK7B 3WFCC 1CSUA 2Q3EA 2BLFB 1W2LA 4PJ0V 1C6OA 1JDLA 4D6TD 1I55A 1CRHA 1E29A 1RZ6A 3TYIA 1DIQC 1IRWA 2V08A 1KYOW 2A06D 1CTJA 3L75D 1YEBA 5DJQC 1N15A 1KB0A 1YEAA 2D0WA 2V07A 1YNRA 4AAMA 1BCCD 3NBSA 1OCDA 3ITKA 1H33B 1ETPA 1CRIA 2IBZD 1KYOD 2BH4X 3VNWA 1CIGA 3H1HD 4FANA 2AXTV 2B10B 4DY9A 3A0BV 4RJTA 3GW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 D;  1ZRT D;  2GC7 D;  1DII C;  1NIR A;  1C6S A;  2YIU B;  1M70 A;  1MG3 D;  1YTC A;  1HJ3 A;  1CRC A;  2FWL A;  2KNC B;  2YK3 A;  3TGU D;  4NFG B;  2C1V A;  2ZXY A;  3H1L D;  1CYJ A;  4L3G A;  2I8F A;  1COR A;  3PTZ A;  1NTM D;  1LC1 A;  1AYG A;  1CIH A;  1CNO A;  4WQD A;  1HZU A;  1QYZ A;  2N18 B;  5B5E V;  2CA3 B;  4J20 A;  3KHU A;  1N50 A;  3RLM A;  1H9Y A;  4WQ9 A;  1AKK A;  1SQP D;  2CE1 A;  5CYT R;  3WC8 A;  2RMZ A;  1L9B C;  3NWV A;  2N9J A;  2QG4 A;  1FI3 A;  4JCG A;  1I6E A;  4L3H A;  1HRO A;  2PCC B;  2GC4 D;  3CYT I;  1IO3 A;  5E79 V;  4FAV A;  3ZOW A;  3WFD C;  1E8E A;  1H33 A;  2B12 B;  3VMA A;  3RN1 A;  2N9Y B;  351C A;  2GB8 B;  1C2R A;  2Y0D A;  4EID A;  1I54 A;  1A2S A;  1RZ5 A;  2QJP B;  4K3I A;  2PAC A;  3WFE C;  1CXC A;  1GQ1 A;  1CTZ A;  4FA9 A;  1QKS A;  3H1I D;  3BCC D;  1DT1 A;  5CIH B;  1CIF A;  4WQB A;  4AAL A;  4FA5 A;  4Q5P A;  1SQX D;  1HZV A;  2C1D A;  2FRC A;  4WQA A;  4O1W A;  5KKZ B;  3WFB C;  1M6Z A;  2QJK B;  1H32 B;  1KB9 D;  2B0Z B;  2BGV X;  4PW9 B;  3A9F A;  1FJ0 A;  2K9J B;  1DVV A;  2N9I A;  3KZI V;  3L73 D;  5CID B;  3GG2 A;  3A0H V;  4YE1 A;  2N3Y A;  3O1Y A;  3SWS A;  1NMI A;  451C A;  3SVW A;  2EXV A;  4QAO A;  3L72 D;  3PXT A;  1LC2 A;  2JTI B;  1I6D A;  1QL3 A;  1C52 A;  2CA4 B;  3C2C A;  3HQ7 A;  5GTH V;  1W5C T;  1CHH A;  1CSV A;  2YCC A;  1S5L V;  3OA8 B;  3ZIY A;  2XTS B;  1WEJ F;  2MTA C;  1GKS A;  1M60 A;  3OCD A;  5CIF B;  2RN0 A;  2D0S A;  2N18 C;  4XXL A;  2ZBO A;  1ZZH A;  2JWA A;  3PH2 B;  3O0R C;  4LJI A;  3RMZ A;  1B7V A;  1HH7 A;  4EDF A;  1FCD C;  5KLV D;  4FB1 A;  1CO6 A;  1NU1 D;  1EB7 A;  1P84 D;  1GU2 A;  4PD4 D;  5CIB B;  3VYM A;  1GDV A;  2LIT A;  3H1J D;  2GIW A;  2PCB B;  3X39 A;  5DF5 A;  2DGE A;  3HQ6 A;  1A56 A;  4N0K A;  1CHJ A;  4RSZ A;  1LMS A;  5CIC B;  4FA4 A;  1CED A;  2B4Z A;  1SQQ D;  1CXA A;  1NML A;  2C9X B;  1DVH A;  2Y0E A;  1BGY D;  1MG2 D;  4O1Q A;  1KV9 A;  3PHL A;  1CYI A;  4EIF A;  4L1Q A;  5AUR A;  2BCC D;  3WU2 V;  1EZV D;  3PXS A;  2ZOO A;  1FI9 A;  1HCM A;  1CYC A;  3PRJ A;  2C8S A;  3CXH W;  1DW2 A;  4Y5R A;  1CHI A;  1VYD A;  4H0K A;  2ORL A;  1GJQ A;  3CU4 A;  2DVH A;  3MK7 C;  1AOQ A;  1IRV A;  2C2C A;  3CXH D;  3TDK A;  1C75 A;  1N9C A;  5DFS A;  3DMI A;  2CE0 A;  4WQC A;  5TIS V;  1K3G A;  1H31 B;  3TF5 A;  4H0J A;  1DW1 A;  3FWL A;  4FA1 A;  3O20 A;  3NBT A;  1QN2 A;  1BE3 D;  3L70 D;  1CC5 A;  3ZOY A;  2O3J A;  1YIC A;  3M97 X;  5H2F V;  4KMG A;  5IY5 1;  1L9J C;  1U74 B;  1FOC A;  1A8C A;  1LFM A;  4A7P A;  2BCN B;  1DW3 A;  1I5T A;  4WQE A;  2OZ1 B;  1IZL 0;  4V2K A;  2LIR A;  1H9X A;  2QJY B;  1QL4 A;  3L74 D;  1AOF A;  2Y0C A;  1NTZ D;  1R0Q A;  1OAE A;  3ZCF A;  1DW0 A;  1SQB D;  5CIG B;  5TJH A;  4AAO A;  4MU8 A;  3L4M A;  1YIQ A;  1L0N D;  1CTY A;  4U3F D;  1CCH A;  2YQB A;  1IQC A;  2N3B A;  1L0L D;  2BH5 X;  2C1U A;  1GIW A;  4AX3 A;  2CXB A;  1H32 A;  1MZ4 A;  1HJ5 A;  2ZON G;  1YCC A;  1RAQ A;  1H31 A;  1F1C A;  1HRC A;  1CIE A;  4AAN A;  1HJ4 A;  3CX5 W;  1KX7 A;  2HV4 A;  5DJQ B;  4UB6 V;  3L4O A;  1NNO A;  3SLE A;  1U75 B;  5GTI V;  1FI7 A;  3CX5 D;  2JQR A;  1KIB A;  3CWB D;  2OZ1 A;  3ZBM A;  4UB8 V;  2C1D B;  1C6R A;  3PLN A;  1F1F A;  2L4D A;  4GED B;  1S6V B;  3PXW A;  2FYN B;  2FYU D;  3DP5 A;  3OA8 A;  3HQ8 A;  3HQ9 A;  5EXQ A;  3ZOO A;  5B66 V;  1I8P A;  3WUI A;  2ZZS 1;  3H1K D;  3JBT B;  5B6Q A;  2VHD A;  5CIE B;  1CRJ A;  2BPB B;  1PP9 D;  5KLI B;  4GYD A;  1FHB A;  4EIE A;  2MHM A;  2L91 A;  1BL9 A;  4XYD B;  3CP5 A;  1WVE C;  2AIU A;  1SQV D;  1C7M A;  1COT A;  1N90 A;  5KAI V;  5KAF V;  1C2N A;  3RN0 A;  2B11 B;  1CRY A;  2KS1 A;  4PWA A;  4WQ8 A;  3ZOX A;  4P4Q B;  5C9M A;  1K3H A;  4IL6 V;  1I8O A;  1J3S A;  3VRD A;  1NTK D;  1KX2 A;  4EIC A;  1CCR A;  1H1O A;  3OCD B;  2AI5 A;  1CSX A;  5C0Z A;  1CSW A;  1LS9 A;  3SJL A;  3DR0 A;  1CRG A;  3SXT A;  1PPJ D;  3O5C A;  4WQ7 A;  1YFC A;  1E2R A;  1RAP A;  3ORV A;  155C A;  3MK7 B;  3WFC C;  1CSU A;  2Q3E A;  2BLF B;  1W2L A;  4PJ0 V;  1C6O A;  1JDL A;  4D6T D;  1I55 A;  1CRH A;  1E29 A;  1RZ6 A;  3TYI A;  1DIQ C;  1IRW A;  2V08 A;  1KYO W;  2A06 D;  1CTJ A;  3L75 D;  1YEB A;  5DJQ C;  1N15 A;  1KB0 A;  1YEA A;  2D0W A;  2V07 A;  1YNR A;  4AAM A;  1BCC D;  3NBS A;  1OCD A;  3ITK A;  1H33 B;  1ETP A;  1CRI A;  2IBZ D;  1KYO D;  2BH4 X;  3VNW A;  1CIG A;  3H1H D;  4FAN A;  2AXT V;  2B10 B;  4DY9 A;  3A0B V;  4RJT A;  3GW6 A; 
#chains in the Genus database with same CATH topology
 3L71 D;  2E74 D;  5AVV B;  1C6S A;  2YIU B;  3AEC C;  1NH4 A;  1PGJ A;  2IBZ G;  2KNC B;  2O01 N;  3SSU A;  3TGU D;  2OYI C;  3O6Q B;  4ZMD A;  1COR A;  3Q5R A;  2HPC B;  1LC1 A;  1AYG A;  2FBW C;  1HZU A;  2H7H A;  5EFW B;  3KHU A;  1IK7 A;  1N86 A;  2KP8 A;  2CE1 A;  5CYT R;  2YXQ B;  3L4F A;  2ZVO B;  1L9B C;  4DOJ A;  1FI3 A;  4L3H A;  1HRO A;  1SQQ E;  2GC4 D;  1IO3 A;  1Y8A A;  2KB7 P;  5E79 V;  1ZP0 C;  3WFD C;  2PRR A;  1H33 A;  3VMA A;  3RN1 A;  3H1J G;  2GB8 B;  2G3A A;  1LT1 A;  2N1T C;  2P67 A;  3NFQ A;  3L74 J;  2Q3I A;  3FXD A;  1NKN A;  3T97 B;  1SQB J;  3VP8 A;  1M1J A;  3CXH I;  3L37 A;  1RZ5 A;  3H1I E;  3IFM A;  2Q9I A;  2PAC A;  1FS0 E;  3VOP A;  4WWI A;  5B66 H;  2H43 A;  2E5Y A;  1GDT A;  1CTZ A;  1QKS A;  3F89 A;  1DT1 A;  5CIH B;  3W68 A;  3RK3 B;  3V2Q A;  2WSS H;  4WQB A;  4FA5 A;  1BGY G;  4Q5P A;  1IFN A;  4OGQ B;  3CCS P;  3AE5 C;  2C1D A;  4WQA A;  1OX3 A;  1BE3 E;  1SQQ K;  1NU1 J;  2OTL P;  2W6A A;  2BGV X;  4W7Z A;  4H13 B;  3A7O A;  1T8Z A;  1LTJ A;  2R5D A;  2GUS A;  1GTW A;  1Q81 Q;  4IL6 H;  2N9I A;  1D7M A;  3R2P A;  2Z5I A;  3L72 E;  4DZO A;  2Q6Q A;  2SPZ A;  4IFM A;  2XND H;  1M1J C;  1I6D A;  2A45 G;  1QEX A;  3HRN A;  1FBM A;  1LTB C;  5GTH V;  2N1T D;  1CSV A;  2E5T A;  4U3F E;  1E5W A;  5CJ0 A;  2KLV A;  1GKS A;  1SQV J;  1LTI C;  4OH8 B;  3OCD A;  2NZ2 A;  5AW8 B;  1GMJ A;  5KLV E;  2ZBO A;  1LWU B;  2POH A;  3CCV P;  3M9Q A;  3PH2 B;  5B66 E;  1Z56 A;  3KYQ A;  1B7V A;  1P84 E;  4XFJ A;  4XE5 B;  2P58 A;  1CO6 A;  1LTJ C;  1PGP A;  5KLI C;  1NU1 D;  1X0T A;  3G3Z A;  5AW3 B;  1L0N G;  1M8O B;  2M5A B;  1SVF A;  3VYM A;  1GDV A;  1NTZ K;  1G2C A;  1JOC A;  3A2A A;  2WVR A;  5AVT B;  3X39 A;  1IO4 A;  2DGE A;  1J1E C;  2JO1 A;  3HQ6 A;  3RL0 g;  5CIC B;  3BAT A;  1A02 F;  1CED A;  1BSH A;  1MUU A;  2B4Z A;  2KK7 A;  4WVZ A;  1CXA A;  1DD3 A;  4HJG H;  1X8Y A;  1S3J A;  4O1Q A;  2J58 A;  4NPD A;  3WU2 V;  5KKZ C;  4D6T J;  1KFM A;  2W90 A;  1LTS C;  3PXS A;  2QJK C;  1KZU B;  1FI9 A;  2R3C A;  2WSF H;  2NPS A;  4H0K A;  1HWT C;  3CU4 A;  1L4A A;  3Q2Y A;  4B86 A;  1RF1 C;  5E79 H;  3CX5 H;  2C2C A;  1FAV A;  3CXH D;  1SS1 A;  3H1H J;  4WQC A;  2AXC A;  3BAS A;  4H0J A;  2E75 B;  3S4R A;  2FYU K;  1KOR A;  3FWL A;  3I5C A;  3KDP B;  1FJP A;  1YI2 P;  3P7K A;  3L70 D;  2GUV A;  3HTK A;  2Q5U A;  1CC5 A;  3SWF A;  1BDC A;  4GKG A;  3CWB J;  5H2F V;  3B5N B;  4ZKU A;  4KMG A;  1U74 B;  3B8E B;  4R4M A;  1I5T A;  3OAK A;  1K8A Q;  3LW5 J;  4YXD C;  2OZ1 B;  2WWW A;  2M8R A;  3RK3 E;  1X22 A;  1QL4 A;  2ZYD A;  1M90 Q;  3ZCF A;  2OGU A;  4M3L A;  1DW0 A;  3IN6 A;  2B87 A;  4WBA A;  4BXL A;  3GF3 A;  2NPS C;  2IZ0 A;  3TYY A;  2OYH B;  1N2D C;  1L0L E;  1L4A C;  2W27 A;  1YIQ A;  2ZAE B;  5APV A;  3CME P;  2XKM A;  2LXB A;  2HR3 A;  1GIW A;  1H32 A;  1YCC A;  4OVN F;  3VMZ A;  2QE7 H;  1JTH A;  5CCG A;  3FGA D;  1FE6 A;  1USD A;  4AAN A;  1HJ4 A;  1VQ4 P;  2HYN A;  2ZT9 C;  5GTH H;  2IYP A;  5DJQ B;  3IF4 A;  4WB4 A;  4ZNC A;  3CX5 E;  3H1I J;  2WTY A;  2NRG A;  1NNO A;  5AW7 B;  1OW8 A;  1U75 B;  3MHV A;  1FI7 A;  1SQX J;  1BCC G;  5K5G B;  2LXC B;  2WT7 A;  4Y99 C;  3CWB D;  2C1D B;  1GK4 A;  4GED B;  2YO3 A;  3H1K E;  4JF7 A;  3PXW A;  3AE3 C;  1PP9 E;  3HQ9 A;  1VF5 C;  2ZZS 1;  3HUS A;  2H88 C;  1CRJ A;  3L73 J;  5KLI B;  2L5G B;  5GTI H;  2NPS D;  5AVR B;  1NTM G;  5CCG C;  1COT A;  1L4A D;  3SFE C;  1SP4 A;  1LT9 A;  1YJW P;  1NTK E;  1N7L A;  3AEG C;  3UIA A;  1J3S A;  4BRY A;  5BU5 A;  5AW1 B;  1YTZ I;  3GHG B;  1SQV G;  3WU2 H;  2ZT9 D;  2DW3 A;  2BEZ F;  3CD6 P;  1VQ7 P;  1OMI A;  1H1O A;  3OCD B;  1PGO A;  1NAY A;  3TK1 A;  1CSW A;  5GTH E;  3SJL A;  2PP6 A;  1CRG A;  5KAI H;  1S1C X;  1PPJ D;  1U7J A;  3V4Q A;  3HUS C;  1RAP A;  1KFN A;  3BCC G;  3H1J J;  3ORV A;  3HE4 B;  4C7N A;  3WMM 0;  1ZOY C;  1HH0 A;  3BRT B;  1KN7 A;  1K04 A;  1S9K E;  1CW5 A;  1JDL A;  1U7M A;  1ZN5 A;  5CCH A;  1LT9 C;  1KYO W;  1GW4 A;  3L75 D;  4H44 B;  2YXR B;  1N15 A;  1KB0 A;  3SWK A;  5CCG D;  1BGY J;  3G71 P;  5GTI E;  3NBS A;  1OCD A;  4YTP C;  2IBZ D;  3NMD A;  2BH4 X;  4FAN A;  1FDM A;  1KB9 H;  3AE4 C;  4PD4 I;  3C9I A;  1YBK A;  3EFF K;  1E79 H;  3H6P A;  1ZRT D;  1LJ2 A;  2GC7 D;  2O1K A;  1DII C;  1NIR A;  2FYN C;  1MG3 D;  1YTC A;  1QGK B;  1HJ3 A;  2BAS A;  1NTM E;  4NFG B;  2C1V A;  1L4A B;  3H1L D;  2WZ7 A;  3PTZ A;  1QL2 A;  1SQP E;  5CHX A;  1CIH A;  1QYZ A;  4YXW H;  1N50 A;  3RLM A;  1SQB K;  1H9Y A;  4EI2 A;  4WQ9 A;  5CCH C;  1T3J A;  5KAI E;  5KAF E;  1XTC C;  3WC8 A;  3AE8 C;  3NWV A;  2N9J A;  3HTK B;  3CCE P;  3U59 A;  4JCG A;  3CYT I;  2WSE H;  3SFD C;  1E8E A;  3G4S P;  1JY2 N;  2V7Q H;  4L73 A;  4EID A;  1FC2 C;  1I54 A;  2GA1 A;  1A2S A;  1NU1 K;  5B5E H;  3D6Z A;  1VQO P;  3ZDM A;  1JCD A;  3WFE C;  4N3Y B;  3VTP C;  1L0N J;  4I1L A;  1WMK A;  1GQ1 A;  1OW6 A;  1SQQ G;  1ZXG A;  1L0L J;  1CIF A;  2QJY C;  3MZW B;  5AW9 B;  1HZV A;  1LGH B;  2FRC A;  4O1W A;  1QVG O;  1H32 B;  1JO5 A;  3L70 E;  1OW7 A;  5L8R J;  1DIP A;  3H1I G;  4QMA A;  1N7S B;  2I1K A;  5CCH D;  4AYC A;  1HGZ A;  1KIL A;  1AVO A;  2N3Y A;  3EWK A;  2WT7 B;  3MP7 B;  1NMI A;  3SVW A;  1URQ A;  2EXV A;  1BE3 G;  2JTI B;  1QL3 A;  3HQ7 A;  1GD2 E;  1JMB A;  1LTG C;  2O01 H;  2M0B A;  1PP9 J;  2AEJ A;  5APW A;  1ZV8 A;  1X79 B;  3VYI A;  1N73 C;  1M60 A;  5CIF B;  3L72 G;  2Q7C A;  2RN0 A;  2D0S A;  5B5E E;  2N18 C;  4XXL A;  4EYY Q;  3AE7 C;  1HH7 A;  1LT9 B;  3P32 A;  1EB7 A;  3HD7 C;  3B4S A;  1ZR2 A;  4U3F G;  4PD4 D;  1NTK J;  5AW6 B;  1KIL C;  3CCM P;  1LP1 A;  3V2N A;  3H32 B;  2PCB B;  3RL0 C;  3BRV B;  4NPF X;  1URQ C;  5KLV G;  1CHJ A;  4RSZ A;  2QJP C;  4FA4 A;  1KQL A;  5APX A;  2BCC E;  4RKU J;  1EZV E;  4L1Q A;  3S1K A;  1NAF A;  1HCM A;  1CYC A;  2C8S A;  1P84 H;  1DW2 A;  1FZC B;  1FZF A;  1SFC A;  2IFN A;  1CHI A;  2FYU G;  2ORL A;  1GZL A;  1NYH A;  1BCC J;  2DVH A;  4KHX A;  3U1C A;  2G8Y A;  4EIJ A;  1IRV A;  2I1J A;  1LTA C;  5AVZ B;  1N9C A;  5DFS A;  3DMI A;  1KB9 I;  3RK2 B;  3OA7 A;  1H31 B;  2XU6 A;  2YKQ A;  2K3R A;  3KXD A;  2H89 C;  1VQ5 P;  3TNU B;  4C7R A;  3ZOY A;  1KIL D;  4WY4 A;  1PPJ E;  1AA0 A;  2O3J A;  1URQ D;  5IY5 1;  3C1L A;  3BVH A;  2BEQ D;  1Q7Y Q;  1LFM A;  2BCN B;  2E74 B;  1NTM J;  4WQE A;  1RE3 A;  1NTZ E;  1W2B O;  1UII A;  1H9X A;  1EXJ A;  2JDI H;  2QJY B;  3M0A A;  3AEE C;  1EC5 A;  3L74 D;  1AOF A;  1IFM A;  1KYO I;  1OAE A;  1SQB D;  2K88 A;  1SFC C;  5TJH A;  2W83 C;  1OIP A;  2WIT A;  1YHQ P;  2IYO A;  5APQ A;  3G6E P;  2C9N Y;  4AX3 A;  1HJB A;  1HJ5 A;  3HE5 B;  5BU8 B;  1JM0 A;  1F1C A;  4BWN A;  4YPC A;  3USS A;  1FOS F;  5AVY B;  3M0D A;  3CX5 W;  3CC7 P;  1ZRT E;  4RO0 A;  4WY4 C;  2W6J H;  2HV4 A;  1RF1 A;  2KS1 B;  1HF9 A;  4UB6 V;  3BCC J;  3M9H A;  3L4O A;  2W8Z A;  2WPR A;  1CI6 B;  1L0L G;  5GTI V;  2JWD A;  4EOT A;  4IOI H;  4JQ0 D;  3H1L E;  1RE3 C;  1KIB A;  1Q2N A;  2KYV A;  1FDO A;  2FKW B;  4PV1 C;  1C6R A;  2FYU E;  3E7K A;  3CCJ P;  1GK6 A;  3VMY A;  1VL2 A;  1S6V B;  3V4W A;  3OA8 A;  3ZOO A;  1I8P A;  2I8D A;  4N78 D;  1KD1 Q;  2VHD A;  5CIE B;  1KTM A;  1KQG B;  2OYI B;  1EZV I;  4EIE A;  1PL5 A;  2L91 A;  1BL9 A;  1SFC D;  2AIU A;  1SQV D;  1KIL B;  5KAI V;  5KAF V;  3K5B A;  1FJK A;  3M0D C;  1JY3 N;  3RN0 A;  1URQ B;  3H1K G;  4H0L C;  1PP9 G;  2N9B A;  3FXE A;  1M57 D;  3RBZ A;  1I8O A;  3CMA P;  3PJS K;  4WY4 D;  2N1T B;  2HOD A;  1HVV A;  1CCR A;  1CSX A;  2ZJS E;  4WQ7 A;  1E2R A;  2YKP A;  1NTK G;  3D6Y A;  3WFC C;  1CSU A;  2RKL A;  3V2P A;  1HJ0 A;  2Q3E A;  3G9R A;  2BLF B;  1W2L A;  1LP1 B;  1GL2 C;  1C6O A;  4D6T D;  1I55 A;  2R32 A;  1CRH A;  2K9Y A;  4K3A A;  1RZ6 A;  2V08 A;  2KZJ A;  2A06 D;  1YEB A;  1JMM A;  2HG5 D;  1SQQ J;  2QRX A;  1VQL P;  1H0T A;  2D0W A;  4L76 A;  1FOS E;  1H33 B;  3CPW O;  1ETP A;  1CRI A;  2BCC J;  1KYO D;  1VQM P;  3OJA B;  1AV1 A;  4H0L D;  1Y9B A;  3H1H D;  3L71 E;  1P84 I;  2FXM A;  2B10 B;  1M1J B;  2E76 C;  2YKO A;  4DY9 A;  3AE2 C;  4RJT A;  2FY8 A;  3TGU E;  3D70 A;  1M70 A;  1G1J A;  2O01 J;  1SFC B;  2KUB A;  3V6I A;  1OZH A;  2ZXY A;  4L3G A;  1DD4 A;  2WPS A;  1CNO A;  5B5E V;  1HUC A;  1EXI A;  1BE3 J;  2FXO A;  4J20 A;  1JCC A;  1VPC A;  2KI7 B;  1AKK A;  4AUW A;  2AEM A;  3AEB C;  2MJZ A;  4UB6 H;  1LTJ B;  2QG4 A;  5CMZ A;  2RH0 A;  2P7J A;  3WUU A;  4FAV A;  3L72 J;  1NOH A;  1CZQ A;  3SWY A;  3IR9 A;  1C2R A;  1NTZ J;  1SQP G;  1VQ6 P;  1J1E B;  3GMA A;  1DEE G;  1OVV A;  3CC4 P;  4U3F J;  1CXC A;  1Q82 Q;  2C0W A;  3H1I D;  2IPP A;  1DX7 A;  2E76 D;  2KNC A;  1GU5 A;  2E42 A;  3O6Q A;  1SQX D;  5KKZ B;  5KLV J;  2QM7 A;  2HPC A;  2QJK B;  5KAF H;  4GDO A;  1T2K C;  1KIL E;  1PV3 A;  4TT3 H;  3CC2 P;  1S2E A;  3MTU E;  1RF1 B;  1DVV A;  4H0L B;  1G2C B;  1Y47 A;  3L73 D;  1VF5 D;  2PFX A;  2FFD A;  3O1Y A;  2AXT E;  2E43 A;  3SWS A;  3L74 E;  4QAO A;  3L72 D;  4UB6 E;  3A0B E;  1Q90 D;  1SQB E;  2FYU J;  3L70 G;  1PZQ A;  2B9B A;  2YIU C;  1OWA A;  1CHH A;  3OA8 B;  3ZIY A;  3IAO A;  5CBN A;  2XTS B;  4W7Y A;  2QM8 A;  4MN4 C;  1R5S A;  1T6A A;  3I55 P;  1ZZH A;  3CX5 I;  2JWA A;  3O0R C;  1NU1 E;  1RH5 B;  4EDF A;  1FCD C;  5KLV D;  2NPS B;  3M91 A;  3AE1 C;  1FU1 A;  2Z5H A;  1P84 D;  5CIB B;  2LIT A;  3H1J D;  1NWQ A;  2FFD C;  2KOG A;  1K9M Q;  1AQT A;  5DF5 A;  1A56 A;  3VMX A;  4N0K A;  1LMS A;  2ZT9 B;  3PP5 A;  3M9B A;  1FDI A;  1JEK A;  2YO2 A;  5CJ4 A;  1NML A;  1KV4 A;  2Y0E A;  3RK3 C;  1BGY D;  1MG2 D;  1KV9 A;  4Y99 B;  4OGQ C;  3PHL A;  1CYI A;  1QVF O;  1OFC X;  4EIF A;  1NHL A;  2WPV B;  4GIF A;  2ZOO A;  1LWU A;  3PRJ A;  2B87 B;  5M1B A;  4Y5R A;  4H13 C;  3GLM A;  4JYC A;  1VYD A;  3CXH E;  1GJQ A;  1VF5 B;  1AQ5 A;  2CPB A;  1JNM A;  1S4X A;  1N73 A;  3LID A;  5AW2 B;  1H0T B;  2BCC G;  3KZI E;  1C75 A;  1EZV G;  1K3G A;  3A0H E;  1JTH B;  3M06 A;  2JP3 A;  3ABV C;  1DW1 A;  2JR8 A;  2WSF J;  4FA1 A;  3O20 A;  1QN2 A;  2JKV A;  3L71 J;  4TLF A;  2K37 A;  3HD7 A;  4LC1 A;  4HYT B;  1YIC A;  3TGU J;  1SQV K;  1L9J C;  1S5L E;  4A7P A;  2D2C C;  3A5T A;  1A02 J;  4C46 A;  1IZL 0;  4KT0 J;  4V2K A;  1J2J B;  2P2U A;  1JY3 P;  1LWU C;  2ZXE B;  3NTN A;  2CK3 H;  3H1K J;  2QEX P;  2K1A A;  5CIG B;  4OGQ D;  4JPZ B;  4MU8 A;  4N6J A;  1PPJ G;  3HUS B;  1L0N D;  1CTY A;  1MZ9 A;  3KQG A;  3MIW A;  4JBZ A;  2N3B A;  1L0L D;  4U7J A;  3EFG A;  2CXB A;  4H13 D;  1NGM B;  1MV8 A;  2ZON G;  3H1H E;  5APU A;  1NTZ G;  2Z4E A;  2KLU A;  2Y9Z A;  2WSC H;  1KX7 A;  2K9J A;  1RY3 A;  1U57 A;  2P1J A;  2PGD A;  3B5N A;  3CWB E;  4BRY B;  1OXZ A;  1YIJ P;  3CX5 D;  3LIE A;  2OZ1 A;  1H88 A;  4JYB A;  3ZBM A;  3WUT A;  4UB8 V;  2L4D A;  1IZN B;  2D2C D;  2FYN B;  3DP5 A;  3HQ8 A;  5EXQ A;  3CCR P;  1T3U A;  2OYH A;  1KMI Z;  3H1K D;  3JBT B;  2ZFC A;  5B6Q A;  4C7N B;  1EQ7 A;  2BPB B;  1PP9 D;  4AQR D;  4GYD A;  1XTG B;  5TIS E;  3H1L G;  1WVE C;  1VQP P;  2E75 C;  1C7M A;  1N90 A;  3P8C D;  1OVR A;  2FFD B;  1TU3 F;  3MUD A;  2HFE D;  3MD0 A;  1EDI A;  4PWA A;  4WQ8 A;  3ZOX A;  4P4Q B;  3B5N C;  5C9M A;  1K3H A;  2QVA A;  1SQX E;  3HD7 D;  3VRD A;  3JC2 2;  1NTK D;  3EQ2 A;  1ZLL A;  1VDF A;  2KZI A;  4EIC A;  4OWF A;  4I2L C;  5AVS B;  5C0Z A;  3RL0 D;  1LS9 A;  2WQY C;  3W67 A;  2MKV A;  1JY2 O;  3B71 A;  5AW4 B;  2OYH C;  3O5C A;  3L36 A;  1IJD B;  5APY A;  2YMY A;  1FZE A;  3QH9 A;  3L73 E;  1SQP J;  1S5L X;  2M3E A;  2LKM A;  1W2E A;  4I6M C;  4GT1 A;  3L75 E;  1PIX A;  3MUD C;  2QSI A;  1HTL C;  1YQ3 C;  1QX8 A;  1S9K D;  4I7Z C;  5DJQ C;  1SQX K;  1WT6 A;  1YEA A;  2IBZ E;  2E75 D;  1BCC D;  3ITK A;  3II6 A;  2KXP B;  3GHG A;  1CIG A;  2D2C B;  2AXT V;  1RQV A;  2WMM A;  3CCQ P;  3NXS A;  3B5N D;  4DT0 A;  1H89 A;  3A0B V;  2PAJ A;  3Q5P A;  4PJ0 H;  3GW6 A;  4HH2 A;  2FYZ A;  1DEB A;  2A45 H;  1QL1 A;  3VN0 A;  1CRC A;  2FWL A;  2IFM A;  3S9O A;  2YK3 A;  3A3Y B;  1N8R Q;  3VP9 A;  3HE4 A;  3H1J E;  4RES B;  1N73 B;  1CYJ A;  3E1I A;  2I8F A;  2XNX A;  1NTM D;  2KSJ A;  4WQD A;  2N18 B;  1NO4 A;  2XZR A;  2CA3 B;  4ZKP A;  3L71 G;  3L70 J;  4DJG A;  1J1D C;  1SQP D;  3JCU H;  1EDL A;  2RMZ A;  2C0X A;  1I6E A;  3TGU G;  1VQN P;  3HD7 B;  2PCC B;  1LTT C;  4IL6 E;  1BGY E;  3ZOW A;  3AED C;  1NJI Q;  2B12 B;  3GHG C;  1YYC A;  1GL2 A;  2N9Y B;  351C A;  1HGV A;  3RL0 B;  5KLV K;  4L74 A;  4UB8 H;  1CSB A;  2Y0D A;  1MKM A;  2XV5 A;  4Y28 J;  1G1I A;  3R4Y A;  2QJP B;  4K3I A;  1M56 D;  2WSE J;  1FZG A;  1IFI A;  4FA9 A;  3BCC D;  4PD4 H;  1NVO A;  1L2P A;  2V7Q J;  3QWO C;  3V2R A;  4AAL A;  1NKZ B;  3WFB C;  1M6Z A;  4PJ0 E;  3Q3D A;  1KB9 D;  2B0Z B;  3D0W A;  3CI9 A;  1AVY A;  4PV1 D;  4PW9 B;  3A9F A;  1FJ0 A;  2K9J B;  4H44 C;  1KQF B;  5APT A;  1W5C E;  1Q86 Q;  1IFP A;  1JY2 P;  2KIK A;  4ASW A;  3KZI V;  2IX7 C;  2C9L Y;  5CID B;  3GG2 A;  3A0H V;  4YE1 A;  3RGU A;  1YTZ T;  3JCU E;  1DH3 A;  451C A;  3PXT A;  1LC2 A;  5DJU B;  5KJ7 A;  1FZB A;  1C52 A;  2CA4 B;  2CPS A;  1JB0 J;  3C2C A;  3L35 A;  2IBZ I;  1W5C T;  1USE A;  2YCC A;  1L0N E;  1S5L V;  5AVU B;  3F5H A;  1WEJ F;  2MTA C;  2M3B A;  2OAR A;  4UB8 E;  2OTJ P;  2ZXX A;  4LJI A;  3L74 G;  3RMZ A;  4GOD A;  3H25 A;  1SQB G;  4FB1 A;  1R5L A;  4PD4 E;  4I7Z B;  1MFZ A;  1GU2 A;  1N7S A;  1EDK A;  4CPG A;  3FWN A;  5E79 E;  4XA4 A;  1RE4 A;  2AEF A;  2R5B A;  1VQK P;  2GIW A;  2AXT H;  4H44 D;  4DCK A;  2WSC J;  3A0B H;  1M1K Q;  1L0N K;  2GM4 A;  5KJ7 C;  3CL3 D;  4WY4 B;  3AEF C;  1GL2 D;  3I56 P;  1NU1 G;  1L0L K;  4GOF A;  5CBO A;  1SQQ D;  1K73 Q;  2IDB A;  4W80 A;  1VQ9 P;  2QA4 P;  2C9X B;  1DVH A;  5AVX B;  1YIT P;  1VQ8 P;  4IL6 X;  5AUR A;  2BCC D;  1BSN A;  1EZV D;  3P8C E;  2OYO A;  4PV1 B;  4IFD K;  3L75 J;  3CXH W;  3AEA C;  1J1D B;  1FZA A;  4L75 A;  5BVZ A;  3MK7 C;  2Y9Y A;  1N7S C;  1AOQ A;  2IZ1 A;  1RE4 C;  5DJT B;  3Q1M A;  3TDK A;  1IFJ A;  2CE0 A;  5TIS V;  1KQS O;  2ZYA A;  1RQU A;  3TF5 A;  3H32 A;  1IC2 A;  2VRS A;  3NBT A;  2ZVN B;  1BE3 D;  2FXP A;  2A45 I;  3TSI A;  3M97 X;  2R3S A;  2J5U A;  2H8P D;  2QIW A;  1JY3 O;  2P10 A;  1FOC A;  1A8C A;  3H1L J;  5APS A;  1YJN P;  2ZYG A;  1DW3 A;  5KJ7 D;  3N4X A;  2OTK E;  2LIR A;  2JJL A;  1RHZ B;  2V4H A;  3T97 A;  1GW3 A;  3OW2 O;  2J59 M;  3JSV C;  1AFO A;  3KPE A;  2Y0C A;  1NTZ D;  1R0Q A;  4LGD E;  1FZC A;  2W6B A;  2XDJ A;  3CXH H;  4AAO A;  3RBX A;  5AW0 B;  4KJM A;  1NTK K;  3L4M A;  3PH0 A;  4U3F D;  1CCH A;  2YQB A;  1BCC E;  3KZI H;  2LR2 A;  5H2F H;  1IQC A;  3FX0 A;  2BH5 X;  2C1U A;  3A0H H;  2YNY A;  1MZ4 A;  1RAQ A;  4HKZ H;  1H31 A;  1GL2 B;  1N7S D;  1HRC A;  3V5B A;  1CIE A;  4D6T G;  3TNU A;  1YQ4 C;  2A06 G;  1H8A A;  5AW5 B;  1LNQ A;  1T2K D;  3SLE A;  1S5L H;  3GF7 A;  4Z1M H;  3O8Z A;  3CCU P;  1ZR4 A;  2JQR A;  2UWJ E;  1MFT A;  2O1J A;  3AE6 C;  1X9V A;  1OVU A;  2HOD B;  1BDD A;  3WU2 E;  3H1H G;  3PLN A;  1F1F A;  2E76 B;  4N78 E;  1AJY A;  1FZC C;  5C39 A;  3Q5S A;  2FYU D;  1RF0 A;  5B66 V;  3WUI A;  2KSE A;  4IFF A;  3N7N A;  2WPQ A;  1QLE D;  3CWB G;  1KC8 Q;  1KYO H;  1SQV E;  2JEE A;  1EDJ A;  1FHB A;  2MHM A;  4XYD B;  1SLQ A;  3CP5 A;  3RK2 C;  2ITA A;  1S72 P;  3HE5 A;  1C2N A;  5AVW B;  1IK9 A;  2B11 B;  1CRY A;  2KS1 A;  2M5A A;  1NTM K;  5H2F E;  3BCC E;  4IL6 V;  1CI6 A;  3C8V A;  2E74 C;  1SQP K;  3MGN A;  3LW5 H;  4ASV A;  1KX2 A;  2AI5 A;  1KB9 E;  3E1R A;  1YJ9 P;  4O9B A;  2B89 A;  1PFI A;  3DR0 A;  3AE9 C;  3SXT A;  1RF0 C;  1IFD A;  1YFC A;  1HBW A;  4LLH A;  2OQQ A;  4K35 A;  155C A;  1PGQ A;  2OYI A;  5TIS H;  3MK7 B;  2R44 A;  4GOE A;  4D6T E;  1SQX G;  2Q1K A;  2HLO A;  3CLQ A;  3RK3 D;  2YMK A;  4PJ0 V;  1JUN A;  2A06 E;  2B88 A;  3WUV A;  1GU4 A;  1E29 A;  1ZME C;  5KTB A;  1UIX A;  3TYI A;  1DIQ C;  1IRW A;  4HB1 A;  1CTJ A;  3P8M C;  1M7L A;  1WRG A;  3RK2 D;  4NPE A;  2V07 A;  1YNR A;  4AAM A;  1KYO E;  3U1A A;  3D71 A;  1ZW0 A;  3VNW A;  3L73 G;  2N1T A;  5AVQ B;  4R4L A;  3CCL P;  1R8E A;  1K05 A;  3L75 G; 
#chains in the Genus database with same CATH homology
 3L71 D;  1ZRT D;  2GC7 D;  1DII C;  1NIR A;  1C6S A;  2YIU B;  1M70 A;  1MG3 D;  1YTC A;  1HJ3 A;  1CRC A;  2FWL A;  2KNC B;  2YK3 A;  3TGU D;  4NFG B;  2C1V A;  2ZXY A;  3H1L D;  1CYJ A;  4L3G A;  2I8F A;  1COR A;  3PTZ A;  1NTM D;  1LC1 A;  1AYG A;  1CIH A;  1CNO A;  4WQD A;  1HZU A;  1QYZ A;  2N18 B;  5B5E V;  2CA3 B;  4J20 A;  3KHU A;  1N50 A;  3RLM A;  1H9Y A;  4WQ9 A;  1AKK A;  1SQP D;  2CE1 A;  5CYT R;  3WC8 A;  2RMZ A;  1L9B C;  3NWV A;  2N9J A;  2QG4 A;  1FI3 A;  4JCG A;  1I6E A;  4L3H A;  1HRO A;  2PCC B;  2GC4 D;  3CYT I;  1IO3 A;  5E79 V;  4FAV A;  3ZOW A;  3WFD C;  1E8E A;  1H33 A;  2B12 B;  3VMA A;  3RN1 A;  2N9Y B;  351C A;  2GB8 B;  1C2R A;  2Y0D A;  4EID A;  1I54 A;  1A2S A;  1RZ5 A;  2QJP B;  4K3I A;  2PAC A;  3WFE C;  1CXC A;  1GQ1 A;  1CTZ A;  4FA9 A;  1QKS A;  3H1I D;  3BCC D;  1DT1 A;  5CIH B;  1CIF A;  4WQB A;  4AAL A;  4FA5 A;  4Q5P A;  1SQX D;  1HZV A;  2C1D A;  2FRC A;  4WQA A;  4O1W A;  5KKZ B;  3WFB C;  1M6Z A;  2QJK B;  1H32 B;  1KB9 D;  2B0Z B;  2BGV X;  4PW9 B;  3A9F A;  1FJ0 A;  2K9J B;  1DVV A;  2N9I A;  3KZI V;  3L73 D;  5CID B;  3GG2 A;  3A0H V;  4YE1 A;  2N3Y A;  3O1Y A;  3SWS A;  1NMI A;  451C A;  3SVW A;  2EXV A;  4QAO A;  3L72 D;  3PXT A;  1LC2 A;  2JTI B;  1I6D A;  1QL3 A;  1C52 A;  2CA4 B;  3C2C A;  3HQ7 A;  5GTH V;  1W5C T;  1CHH A;  1CSV A;  2YCC A;  1S5L V;  3OA8 B;  3ZIY A;  2XTS B;  1WEJ F;  2MTA C;  1GKS A;  1M60 A;  3OCD A;  5CIF B;  2RN0 A;  2D0S A;  2N18 C;  4XXL A;  2ZBO A;  1ZZH A;  2JWA A;  3PH2 B;  3O0R C;  4LJI A;  3RMZ A;  1B7V A;  1HH7 A;  4EDF A;  1FCD C;  5KLV D;  4FB1 A;  1CO6 A;  1NU1 D;  1EB7 A;  1P84 D;  1GU2 A;  4PD4 D;  5CIB B;  3VYM A;  1GDV A;  2LIT A;  3H1J D;  2GIW A;  2PCB B;  3X39 A;  5DF5 A;  2DGE A;  3HQ6 A;  1A56 A;  4N0K A;  1CHJ A;  4RSZ A;  1LMS A;  5CIC B;  4FA4 A;  1CED A;  2B4Z A;  1SQQ D;  1CXA A;  1NML A;  2C9X B;  1DVH A;  2Y0E A;  1BGY D;  1MG2 D;  4O1Q A;  1KV9 A;  3PHL A;  1CYI A;  4EIF A;  4L1Q A;  5AUR A;  2BCC D;  3WU2 V;  1EZV D;  3PXS A;  2ZOO A;  1FI9 A;  1HCM A;  1CYC A;  3PRJ A;  2C8S A;  3CXH W;  1DW2 A;  4Y5R A;  1CHI A;  1VYD A;  4H0K A;  2ORL A;  1GJQ A;  3CU4 A;  2DVH A;  3MK7 C;  1AOQ A;  1IRV A;  2C2C A;  3CXH D;  3TDK A;  1C75 A;  1N9C A;  5DFS A;  3DMI A;  2CE0 A;  4WQC A;  5TIS V;  1K3G A;  1H31 B;  3TF5 A;  4H0J A;  1DW1 A;  3FWL A;  4FA1 A;  3O20 A;  3NBT A;  1QN2 A;  1BE3 D;  3L70 D;  1CC5 A;  3ZOY A;  2O3J A;  1YIC A;  3M97 X;  5H2F V;  4KMG A;  5IY5 1;  1L9J C;  1U74 B;  1FOC A;  1A8C A;  1LFM A;  4A7P A;  2BCN B;  1DW3 A;  1I5T A;  4WQE A;  2OZ1 B;  1IZL 0;  4V2K A;  2LIR A;  1H9X A;  2QJY B;  1QL4 A;  3L74 D;  1AOF A;  2Y0C A;  1NTZ D;  1R0Q A;  1OAE A;  3ZCF A;  1DW0 A;  1SQB D;  5CIG B;  5TJH A;  4AAO A;  4MU8 A;  3L4M A;  1YIQ A;  1L0N D;  1CTY A;  4U3F D;  1CCH A;  2YQB A;  1IQC A;  2N3B A;  1L0L D;  2BH5 X;  2C1U A;  1GIW A;  4AX3 A;  2CXB A;  1H32 A;  1MZ4 A;  1HJ5 A;  2ZON G;  1YCC A;  1RAQ A;  1H31 A;  1F1C A;  1HRC A;  1CIE A;  4AAN A;  1HJ4 A;  3CX5 W;  1KX7 A;  2HV4 A;  5DJQ B;  4UB6 V;  3L4O A;  1NNO A;  3SLE A;  1U75 B;  5GTI V;  1FI7 A;  3CX5 D;  2JQR A;  1KIB A;  3CWB D;  2OZ1 A;  3ZBM A;  4UB8 V;  2C1D B;  1C6R A;  3PLN A;  1F1F A;  2L4D A;  4GED B;  1S6V B;  3PXW A;  2FYN B;  2FYU D;  3DP5 A;  3OA8 A;  3HQ8 A;  3HQ9 A;  5EXQ A;  3ZOO A;  5B66 V;  1I8P A;  3WUI A;  2ZZS 1;  3H1K D;  3JBT B;  5B6Q A;  2VHD A;  5CIE B;  1CRJ A;  2BPB B;  1PP9 D;  5KLI B;  4GYD A;  1FHB A;  4EIE A;  2MHM A;  2L91 A;  1BL9 A;  4XYD B;  3CP5 A;  1WVE C;  2AIU A;  1SQV D;  1C7M A;  1COT A;  1N90 A;  5KAI V;  5KAF V;  1C2N A;  3RN0 A;  2B11 B;  1CRY A;  2KS1 A;  4PWA A;  4WQ8 A;  3ZOX A;  4P4Q B;  5C9M A;  1K3H A;  4IL6 V;  1I8O A;  1J3S A;  3VRD A;  1NTK D;  1KX2 A;  4EIC A;  1CCR A;  1H1O A;  3OCD B;  2AI5 A;  1CSX A;  5C0Z A;  1CSW A;  1LS9 A;  3SJL A;  3DR0 A;  1CRG A;  3SXT A;  1PPJ D;  3O5C A;  4WQ7 A;  1YFC A;  1E2R A;  1RAP A;  3ORV A;  155C A;  3MK7 B;  3WFC C;  1CSU A;  2Q3E A;  2BLF B;  1W2L A;  4PJ0 V;  1C6O A;  1JDL A;  4D6T D;  1I55 A;  1CRH A;  1E29 A;  1RZ6 A;  3TYI A;  1DIQ C;  1IRW A;  2V08 A;  1KYO W;  2A06 D;  1CTJ A;  3L75 D;  1YEB A;  5DJQ C;  1N15 A;  1KB0 A;  1YEA A;  2D0W A;  2V07 A;  1YNR A;  4AAM A;  1BCC D;  3NBS A;  1OCD A;  3ITK A;  1H33 B;  1ETP A;  1CRI A;  2IBZ D;  1KYO D;  2BH4 X;  3VNW A;  1CIG A;  3H1H D;  4FAN A;  2AXT V;  2B10 B;  4DY9 A;  3A0B V;  4RJT A;  3GW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...