2A06D

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2a06D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2a06D02
1KB9D 2N3YA 1QL3A 1AKKA 1H32B 1DVVA 4GEDB 2L91A 1K3GA 1NNOA 3H1JD 2N9YB 1KV9A 3HQ9A 4FA9A 4UB6V 1DVHA 2BCNB 4FB1A 2CA3B 3H1KD 1LMSA 1GJQA 4Q5PA 1KIBA 3WFEC 1FI3A 2QJPB 1HZUA 4PW9B 1CCRA 1YFCA 2D0SA 2BCCD 1F1CA 4LJIA 4O1QA 1A8CA 1L0ND 1U75B 1FI7A 3SLEA 2L4DA 1I6DA 1GU2A 3DMIA 1J3SA 1CXCA 5EXQA 5DF5A 1DW1A 5KAFV 3PLNA 2D0WA 5CIHB 1N90A 2GB8B 2I8FA 2LIRA 3BCCD 1AYGA 3CXHD 3VRDA 2FYNB 1C6RA 1YNRA 2IBZD 5GTHV 4PJ0V 2O3JA 3RN1A 4KMGA 5CIEB 3WFCC 5B6QA 4WQAA 2JWAA 2ORLA 3WU2V 1I5TA 1SQVD 3PXTA 1FJ0A 1RZ5A 5CIGB 4EICA 1DW3A 2B10B 2ZZS1 1CRYA 1N15A 3PH2B 4AAOA 1ZRTD 1NTKD 3ITKA 3KHUA 3ZCFA 1HRCA 4RJTA 1H33A 2B11B 1CYJA 5B5EV 1W5CT 3PTZA 4L3GA 2V08A 1CIHA 1CHIA 2C9XB 3ZBMA 1CTJA 1I55A 4WQBA 1NMLA 1HJ3A 5TJHA 1N9CA 4WQCA 3VNWA 3GG2A 2C1VA 5DFSA 1EZVD 5KKZB 1DT1A 3OA8A 3WFDC 3TDKA 4GYDA 3WUIA 4L3HA 4XXLA 3CX5D 1MG3D 2JTIB 3L72D 3H1ID 1FI9A 1I8OA 3MK7B 3C2CA 2N9IA 3A0HV 1BGYD 1CC5A 5AURA 1CTZA 5C0ZA 1DIQC 2YIUB 2Y0DA 1BE3D 1PPJD 5TISV 3RMZA 1KYOW 3VYMA 2ZBOA 3FWLA 1H33B 3A9FA 1IRVA 2N18B 4UB8V 2KS1A 4Y5RA 2FYUD 1FHBA 4O1WA 1ZZHA 3TYIA 2GIWA 1E2RA 3H1LD 4V2KA 3CYTI 2GC4D 1LFMA 1FOCA 2FRCA 1IRWA 1H1OA 1S5LV 4XYDB 2A06D 3ORVA 3CX5W 3O20A 3CXHW 2C8SA 3SWSA 4FAVA 2VHDA 2B0ZB 1RZ6A 4DY9A 5H2FV 1NU1D 3CU4A 2CE1A 5CICB 2N18C 1RAQA 1QKSA 1MZ4A 2QG4A 1C52A 1EB7A 1I54A 1C6SA 1NTMD 4WQ8A 3SXTA 1IZL0 5DJQB 1HH7A 2C1DA 1L9BC 1HJ5A 4FA1A 4N0KA 1L9JC 1SQPD 2EXVA 5KAIV 4WQ9A 2B4ZA 1CIGA 2AXTV 3X39A 1CSUA 1YEBA 1LC2A 1K3HA 1KB0A 3CWBD 5C9MA 2MTAC 1YTCA 1H32A 2PACA 1OCDA 1AOQA 1LS9A 1GKSA 5GTIV 1WVEC 1CRGA 1L0LD 1JDLA 3L4OA 2ZONG 1DIIC 3ZOXA 1C7MA 4PWAA 1BL9A 1CRJA 3OA8B 1ETPA 1DW2A 1F1FA 3WFBC 2ZXYA 4QAOA 3H1HD 4IL6V 4MU8A 2N9JA 4JCGA 351CA 3RLMA 4AX3A 4WQEA 3ZOYA 1C2NA 4P4QB 1HROA 1AOFA 3L71D 1CRCA 1B7VA 1FCDC 2XTSB 1CIEA 2C1UA 2BH5X 1M6ZA 1CYCA 1CXAA 3SVWA 5CIBB 4WQ7A 3DP5A 1N50A 2AI5A 2RN0A 1WEJF 1COTA 1S6VB 4NFGB 155CA 1CO6A 2MHMA 4EDFA 3O5CA 3JBTB 4EIDA 1KX7A 3NWVA 1H31B 1QL4A 5CYTR 2N3BA 3L75D 1M70A 4H0JA 2RMZA 4A7PA 2PCBB 4J20A 2HV4A 3PXWA 4YE1A 1CORA 1E29A 1YCCA 4AALA 3HQ7A 2K9JB 2LITA 2YK3A 2CA4B 4L1QA 2Q3EA 1LC1A 2BGVX 1I8PA 3O0RC 4EIFA 1H9XA 3SJLA 1YEAA 3CP5A 3KZIV 1CTYA 3GW6A 1QN2A 1GIWA 5E79V 5KLIB 2V07A 4PD4D 3NBTA 2B12B 2GC7D 1CRHA 2CXBA 2DVHA 1C75A 1CSWA 3WC8A 1NTZD 4EIEA 4D6TD 1CHHA 4FA4A 2FWLA 1SQQD 1OAEA 3L73D 4FA5A 1VYDA 2Y0CA 3PRJA 1YICA 1M60A 3RN0A 1I6EA 3TF5A 3OCDA 2BPBB 2C1DB 1BCCD 1HCMA 2DGEA 1NIRA 1SQXD 2PCCB 1CHJA 3L70D 2KNCB 3NBSA 2QJKB 1SQBD 2C2CA 3L74D 1YIQA 1A56A 3A0BV 1P84D 5CIDB 1W2LA 3ZOWA 1RAPA 1HJ4A 3ZIYA 3HQ8A 1U74B 1CIFA 5KLVD 1CSXA 3DR0A 3VMAA 2BLFB 2YQBA 5DJQC 1CRIA 1C6OA 1MG2D 4AAMA 2CE0A 5IY51 5CIFB 2YCCA 1E8EA 1A2SA 2OZ1B 3M97X 2QJYB 4WQDA 1R0QA 1QYZA 1NMIA 1KX2A 4AANA 2JQRA 1DW0A 1IO3A 4H0KA 451CA 3L4MA 3OCDB 2ZOOA 4FANA 1CSVA 1CCHA 4U3FD 4K3IA 3ZOOA 4RSZA 1C2RA 1CEDA 1IQCA 1H9YA 2AIUA 1GQ1A 1CNOA 2BH4X 1H31A 1PP9D 1CYIA 1GDVA 3PXSA 2Y0EA 3TGUD 3HQ6A 1KYOD 1HZVA 5B66V 2OZ1A 3O1YA 3PHLA 3MK7C
chains in the Genus database with same CATH superfamily
3W67A 1LWUB 2KB7P 3AEFC 4WB4A 1DVVA 4GEDB 1J1EB 1GK4A 3L71J 2K9JA 2R3SA 2WMMA 1GJQA 1Y47A 3CWBE 2IPPA 1VQ4P 1SQQK 1HZUA 4PW9B 1NVOA 3RK2C 1YFCA 1F1CA 2I1KA 3WUUA 1U57A 5APYA 1A8CA 1PZQA 3Q5SA 2FBWC 1J3SA 1EDLA 2KK7A 1DW1A 3NTNA 2D0WA 4HKZH 2LIRA 2GB8B 2BEZF 3OA7A 1X8YA 1NTKK 2OYIB 3H1LE 5CCGC 3BCCG 2OTLP 1VQ5P 1S5LH 1SS1A 2H8PD 2O01N 3L75G 2P67A 5B6QA 2JWAA 2ORLA 1N86A 1GTWA 1PGOA 1SQVD 3PXTA 1Q86Q 4EICA 1GU5A 2ZZS1 4U3FE 2QRXA 1N15A 1DEBA 4AAOA 1JOCA 1ZRTD 1PP9E 2OTKE 2B11B 3HTKB 3SWFA 5B5EV 3L35A 1W5CT 3HUSB 1PFIA 4HB1A 2ZXXA 5AVUB 2C9XB 1XTGB 3HE4B 3KPEA 1KFMA 5KJ7C 1CTJA 4D6TG 1BE3G 1PPJE 5AW5B 1NKZB 1URQC 2M8RA 2N9BA 5AVRB 5KJ7A 2Z5IA 1OMIA 5KLVJ 3WFDC 1NTMK 4GYDA 1KMIZ 1IK7A 2OYHB 3CXHE 4Y28J 1LWUA 3TGUE 2Z5HA 1FI9A 4ZNCA 2Y9YA 1BGYD 2M0BA 3D6ZA 5AURA 1E5WA 1YJWP 2HPCB 3F5HA 3HRNA 1E79H 3FWLA 3JC22 1EZVG 1JUNA 1LTAC 1U7MA 4H0LB 1SQQG 1IRVA 4UB8V 3RBZA 3AECC 1MKMA 1W2BO 3U1CA 1OVVA 4EIJA 1E2RA 2GC4D 3KDPB 1R5SA 2A45I 5APVA 1BE3E 1PPJG 2N1TD 1JCDA 3CXHW 3BCCJ 3GHGB 3B5NB 1VPCA 1OWAA 1YI2P 1QLED 3CMEP 2E43A 2NPSC 2ZYAA 1ZLLA 3M9BA 3CCLP 1RH5B 3AE6C 1TU3F 5CICB 1RAQA 1MZ4A 2QG4A 5AW2B 4D6TE 4C46A 1JY2N 3SXTA 1FDOA 2C1DA 1L9JC 3CLQA 3G9RA 1SFCB 4BWNA 1SQPD 2EXVA 3V4QA 2B4ZA 1MFTA 3X39A 1DIPA 5APSA 4U3FG 5C9MA 2NRGA 4PV1C 3L72E 3P8CE 1VQ8P 1AOQA 3S1KA 1M90Q 1GKSA 1KC8Q 5GTIV 1WVEC 2IZ0A 1L0LD 2KSEA 1QGKB 1OW7A 2ZONG 5KLVE 2ZXEB 1FDIA 1KB9H 3B5NC 4YPCA 1G2CA 5AVVB 1CRJA 3OA8B 2FFDC 3HD7C 2PFXA 4H44D 3T97B 2FYUE 1SQQJ 5M1BA 4MU8A 2LR2A 2KLUA 4JCGA 3RLMA 2AEJA 4NPFX 3SFEC 2QJPC 3EFGA 2Q1KA 3IR9A 3H1HG 1HROA 1AOFA 3L71D 1NU1J 1X0TA 1FCDC 1BGYE 2XTSB 2C1UA 4B86A 3M0DC 2QJKC 1SQXK 2BH5X 1PL5A 1IJDB 2FYZA 4GT1A 4KJMA 3RK2D 1OW8A 2MHMA 4K3AA 3NWVA 4RESB 1WMKA 1QL4A 2OYHC 4EI2A 1P84I 4ZKPA 1M70A 2XNDH 4J20A 1KILB 4YE1A 2C9NY 1NU1K 1YCCA 5CCGA 3HQ7A 1Y9BA 1ZXGA 2YK3A 2MJZA 1USDA 5H2FH 2I8DA 4WY4D 4DCKA 1Q7YQ 1H9XA 2E42A 3BCCE 2WWWA 3IF4A 1CTYA 2RH0A 4GDOA 1NYHA 1GIWA 5E79V 5KLIB 1GL2A 4PD4D 2FY8A 1FAVA 3NBTA 2E5TA 3CD6P 2B12B 2GC7D 1OZHA 3AE7C 1CRHA 1PP9J 1CSWA 2KUBA 1KYOI 1NAFA 4EIEA 2P10A 1SQQD 2WQYC 3M0DA 3HD7D 3L73D 3PJSK 2Y0CA 4XFJA 4AUWA 3O8ZA 1S5LE 1YICA 3RN0A 1PIXA 3CXHH 5E79H 2DGEA 2XV5A 1G1IA 2PCCB 2YKPA 1HWTC 1H0TB 1HGZA 1YJNP 1HGVA 1YQ3C 2DW3A 1GL2B 1P84D 1W2LA 3L71E 5AVWB 2XU6A 1OW6A 3HQ8A 3GLMA 1UIXA 3L70J 3CCJP 1S9KE 3T97A 2O01J 3VMAA 2G3AA 2FYUG 3NFQA 2P58A 2GM4A 3V2NA 5CIFB 2KIKA 3M9HA 5KAFE 3EFFK 3A0HH 4IFFA 1H89A 1HUCA 5TISE 451CA 3B5NA 1FZFA 3L4MA 2B87B 1CCHA 4U3FD 2N1TB 4K3IA 3ZOOA 1CEDA 1PV3A 3GHGC 3MP7B 1AFOA 1PP9D 2OYOA 1CYIA 1JY3P 1MV8A 1EC5A 2HYNA 2Z4EA 2Y0EA 1LT9B 3TGUD 2JEEA 5B66V 3N7NA 2BCCG 4ASVA 3BVHA 1AKKA 4WY4A 1L0LG 2M5AA 2L91A 1DH3A 2N9YB 5BU8B 1KV9A 4FA9A 4UB6V 1DVHA 1K9MQ 1IFDA 2BCNB 1OX3A 1ZP0C 5AW3B 3H1KD 3L71G 3WFEC 3H1JG 5K5GB 2KS1B 4I6MC 2NPSA 1LT9A 4OH8B 3H32A 2D0SA 4LJIA 4O1QA 1L2PA 3SFDC 1N7LA 3AE9C 4KHXA 1SVFA 2OYIC 3H1HJ 3VP8A 1RF1B 1FI7A 3SLEA 1W5CE 1I6DA 4UB6H 5EXQA 5DF5A 5KAFV 3HUSC 3D0WA 1GMJA 5CIHB 3CXHD 3VRDA 3AEBC 4WWIA 2IBZE 1ZMEC 1SQBE 1ZOYC 3RN1A 4KMGA 1T2KD 2XKMA 3A2AA 2H89C 4WQAA 3H6PA 3WU2V 1KV4A 1M7LA 3KYQA 5CIGB 1RF0C 2KOGA 2LXBA 5GTIE 4H13C 3U59A 1GL2C 1Q2NA 4NPEA 1HRCA 3L73G 3LIDA 2QM8A 1SQPK 2PRRA 2YKOA 2UWJE 1JMMA 5H2FE 1JNMA 2ZJSE 4WQBA 1NMLA 2V7QJ 2NZ2A 1KILD 3VNWA 4AYCA 1HJBA 1NTKE 1NKNA 3OA8A 3KXDA 3CC4P 3GF7A 1D7MA 3WUIA 4L3HA 3H1HE 2YMYA 3USSA 2KXPB 3F89A 1JB0J 3L72D 3P8CD 1S3JA 3MK7B 2LXCB 5APWA 3C2CA 1M56D 1KILC 2BEQD 3H1JJ 5C0ZA 1IFMA 2Y0DA 1BE3D 3H1IJ 1EZVI 3P32A 1NAYA 4I2LC 1PGQA 2ZBOA 1IFJA 5KJ7D 1H33B 2KS1A 4Y5RA 1SQXG 2FYUD 1NGMB 1FHBA 3TYIA 1SQXE 4MN4C 2GIWA 3CYTI 1PGJA 1VQ7P 2SPZA 1LFMA 4PD4I 1FOCA 2FRCA 3AE8C 5KTBA 1VDFA 2JR8A 1K05A 3TGUG 4DY9A 5H2FV 1NU1D 1SQPE 1KQSO 2QA4P 1DD3A 1G1JA 3FWNA 1PP9G 5CJ0A 2E76C 4TT3H 5CJ4A 5B5EH 2R32A 3MIWA 3CCUP 2D2CD 1JY2O 3WU2E 3GF3A 1EB7A 1OVUA 1ZR4A 1NTMD 3M0AA 4WQ8A 3JSVC 3H1KG 4PV1B 4GOFA 3VYIA 5BVZA 1L9BC 1U7JA 2HODA 1N7SD 2JO1A 5KAIV 2WSEJ 1L0NJ 1CIGA 1N73C 2V7QH 4YXWH 3FXEA 5KAIE 2D2CC 3W68A 1YEBA 1LC2A 2FXOA 4PD4E 1KB0A 3CWBD 1YTCA 2K37A 2PACA 2NPSD 3CCMP 1FJKA 2W27A 1LS9A 2GUVA 1OIPA 1AVOA 1M1JA 3M9QA 1J1DC 2IDBA 2QSIA 4CPGA 2O01H 1BL9A 1P84H 5B5EE 3SWKA 2W90A 3WFBC 2ZXYA 1KYOH 2RKLA 3JCUH 1ZN5A 351CA 5AW0B 4AX3A 4WQEA 3BRTB 4P4QB 4JPZB 3SSUA 2LKMA 3AE2C 1CSBA 1BDDA 3OJAB 3Q1MA 3RL0C 3Q5RA 4DT0A 2W6AA 1CYCA 1EQ7A 3MHVA 4WQ7A 1N73B 2RN0A 3H1JE 1COTA 1YTZT 1Z56A 3EQ2A 3HE5B 2E75C 1CW5A 4EIDA 3WUTA 3Q5PA 5CYTR 2N3BA 2OGUA 1RE3C 2WSFJ 4H0JA 4A7PA 4H0LC 3IAOA 2HV4A 1J1DB 1CORA 4AALA 2WT7A 3AEEC 4OGQC 2LITA 1YBKA 2XDJA 3II6A 1FZGA 2ZAEB 3BATA 2BGVX 3HUSA 1ZRTE 5KAIH 1L0LK 1I8PA 3O0RC 3AEAC 3I56P 3KZIV 3GW6A 3A5TA 1KORA 1VL2A 5GTHH 3L70G 4OGQD 4FA4A 1RF0A 1VYDA 4LGDE 1LTTC 3BRVB 1IC2A 3LIEA 1IK9A 3I5CA 2WPVB 4TLFA 1SQXJ 1NOHA 1FOSE 1N7SB 3OCDA 2XNXA 2OYHA 1WRGA 2CPSA 3L4FA 1NIRA 1SQXD 2KYVA 3HD7A 1NTZK 2KNCB 1QL1A 1JY2P 4Y99C 1SQBD 2C2CA 3A0BV 4U3FJ 4K35A 2J59M 3ZIYA 1EDJA 1DX7A 1OFCX 4DOJA 5KLVD 2ZFCA 3DR0A 2K88A 1ZR2A 2B9BA 5KKZC 1CRIA 2R5BA 1H8AA 5IY51 3GHGA 1LTJC 1A2SA 3M97X 5CBOA 1NMIA 2JQRA 1Q90D 3GMAA 1T3JA 1KQGB 4WY4B 4H0KA 1L0NE 4PJ0E 1LTSC 1IZNB 3ZDMA 2JP3A 4U7JA 4RSZA 1IQCA 1H9YA 1L0LJ 1GD2E 3I55P 1GDVA 2W6BA 4Z1MH 4BRYB 5L8RJ 2NPSB 3H1KE 3H1IE 3O6QB 3H32B 3HQ6A 1NO4A 3AE1C 1JMBA 3LW5J 1RF1A 1QL3A 2HODB 1H32B 2QIWA 2KP8A 3IN6A 1EDKA 1SQBK 1K3GA 3RL0B 1GZLA 1NNOA 3G3ZA 2W6JH 1FZEA 5C39A 4Q5PA 1KIBA 1EXJA 4LLHA 2QEXP 1CCRA 1QX8A 2BCCD 2HG5D 1VF5D 1AQ5A 1L0ND 1U75B 2L4DA 1N7SA 3A0BE 3A0HE 2JDIH 1GU2A 5AW4B 5CCHC 2P1JA 1CXCA 1LWUC 4W80A 2QJYC 1T2KC 2YIUC 3BCCD 3HD7B 2K9YA 1C6RA 3L70E 2ZYDA 1L4AC 2IBZD 2WSFH 3KZIE 3UIAA 5GTHV 3CMAP 2WSCH 2O3JA 3AE5C 5B66H 5CCHD 5AVYB 5CIEB 1NTME 1S5LX 1S9KD 2ZVNB 3V6IA 3D70A 2OQQA 2YXQB 4HH2A 1RZ5A 1DW3A 2B10B 3FXDA 4N3YB 3L72J 3PH2B 1NTKD 3KHUA 3ZCFA 2JKVA 2FKWB 5E79E 1CYJA 3VMYA 4L3GA 5APTA 1JM0A 1SQVK 1CHIA 2KSJA 1HTLC 3ZBMA 2FYUJ 1I55A 5TJHA 1YHQP 1YYCA 5B66E 2WSEH 3L36A 3GG2A 1EDIA 1GW4A 2Q7CA 1RY3A 2C1VA 5KKZB 1DT1A 1X79B 3VOPA 3CX5D 2I1JA 2JTIB 2L5GB 1JY3O 3H1ID 2KI7B 4DZOA 1A02J 3D6YA 1M1JC 1NTZE 2J58A 3VP9A 3H1LG 3RK3C 1SQBG 3R4YA 4R4MA 2YIUB 1A02F 1BCCJ 2VRSA 3RMZA 2A06G 1KYOW 1LT9C 3VYMA 3CWBJ 5KLVG 1NTZG 1AA0A 3SWYA 3VMZA 1N73A 1QVFO 2OARA 4O1WA 2M3BA 1ZZHA 4C7NA 3L72G 2WTYA 3HE4A 3L74E 1MFZA 1H1OA 2MKVA 1FZAA 5APQA 3O20A 1QL2A 3WMM0 4FAVA 2VHDA 2B0ZB 1RZ6A 4WBAA 1YJ9P 3CU4A 1GK6A 1IFIA 2CE1A 1KYOE 2N18C 1M1JB 3RGUA 5KLIC 1GDTA 2B88A 3B71A 2E75B 1SQPG 1C6SA 5TISH 2WPSA 4WY4C 2XZRA 1HJ5A 2BASA 3H1LJ 1NU1G 2J5UA 4JBZA 2FXPA 3AE4C 1S4XA 4WQ9A 4IFMA 1BCCE 1CSUA 2V4HA 1L0NG 3A0BH 1OCDA 3C1LA 4H13D 1Y8AA 2W83C 1WT6A 2C0XA 3H1KJ 3Q3DA 1NTMG 1CRGA 1Q82Q 1JDLA 3L4OA 1FZBA 1URQB 1DIIC 3RL0g 3TNUA 2A06E 4PWAA 4GOEA 2IBZG 2IX7C 5AW1B 1MZ9A 2FYNC 3H1HD 2E76B 2N9JA 3CWBG 1FZCA 2AEFA 1C2NA 4RKUJ 1RE4A 3P7KA 2H7HA 1CIEA 1NTKG 3MZWB 1CXAA 3E1RA 5CIBB 3E7KA 3S4RA 1N50A 4D6TJ 2AI5A 3CPWO 5GTHE 3MD0A 2IZ1A 2D2CB 2O1JA 1LTBC 4EDFA 1CO6A 1AVYA 4R4LA 3O5CA 2C0WA 1N2DC 2ITAA 1KX7A 1JEKA 3K5BA 1H31B 3L73E 5BU5A 1GL2D 3CXHI 2RMZA 2Q9IA 1FDMA 2YO3A 1SP4A 1E29A 4KT0J 1JCCA 3VMXA 3PH0A 2CA4B 4IFDK 1X22A 3H1IG 1J1EC 1J2JB 1LC1A 1BE3J 4RO0A 2H88C 3SJLA 1YEAA 3CP5A 1QN2A 4GKGA 2V07A 1SQVJ 1IO4A 1LTIC 2CXBA 2R44A 2QVAA 2DVHA 1C75A 2C9LY 1NTZD 1CHHA 1HJ0A 4QMAA 1H88A 1RE4C 2CK3H 3WU2H 4PV1D 1ZW0A 1LJ2A 2ZT9D 2GA1A 2Q6QA 1FJPA 1M60A 2PGDA 2YNYA 5KLVK 3CCSP 3TF5A 1T3UA 2BPBB 2WITA 3FX0A 1KQLA 1HCMA 3CCRP 4DJGA 3L70D 5AVQB 3NBSA 2FFDA 1XTCC 2JWDA 4WVZA 3L74D 2ZT9C 1YIQA 2WSCJ 1A56A 2E74C 3ZOWA 1RAPA 4NPDA 3MTUE 3BASA 5CHXA 2OYIA 5EFWB 1U74B 4I7ZC 1CSXA 1SQBJ 4I1LA 4UB8H 2IFMA 2WPRA 2H43A 2BLFB 2YQBA 5DJQC 4EYYQ 1QEXA 4N6JA 4W7YA 3VN0A 3TNUB 4AAMA 1Q81Q 2YCCA 3RK3D 1FZCC 1T6AA 1URQD 2QJYB 1QYZA 1YQ4C 4AANA 1DW0A 3H25A 2M5AB 3ABVC 3M91A 3V2PA 3Q2YA 2E76D 3OCDB 2ZOOA 4FANA 1CSVA 1VQ9P 2KZIA 1YITP 1LTJA 1LGHB 2HFED 1KFNA 1CNOA 1USEA 1NU1E 1R5LA 1SFCA 3P8MC 4IL6X 4YXDC 4Y99B 4AQRD 2ZT9B 5AVTB 1SQPJ 1HZVA 3OAKA 2HLOA 4PJ0H 2WT7B 3MK7C 1KB9D 1GW3A 2N3YA 3AEGC 3TGUJ 1MUUA 1CZQA 3V2QA 2WSSH 1VQOP 2R3CA 3H1JD 2YXRB 3HQ9A 2QE7H 5CCGD 3TK1A 4FB1A 2CA3B 1LMSA 2N1TA 1FI3A 5DJUB 2QJPB 1VQLP 1LT1A 3A3YB 2Q5UA 2P2UA 1KZUB 3NMDA 2OTJP 4ZKUA 2O1KA 4L76A 2P7JA 4N78D 2K1AA 1FC2C 3DMIA 3PLNA 1EZVE 2A45H 1YTZI 1DEEG 1N90A 2I8FA 1AYGA 3RK3E 1LTGC 3RL0D 2FYNB 1KB9I 1YNRA 2K3RA 3QH9A 4LC1A 4L73A 1RHZB 4PJ0V 4UB6E 1KTMA 2ZYGA 3WFCC 1RQVA 1I5TA 4C7RA 1FJ0A 2PP6A 3NXSA 3AE3C 3TSIA 1CRYA 1KILA 4H0LD 4ZMDA 2E74B 3ITKA 4RJTA 1H33A 2R5DA 3L37A 3PTZA 4JF7A 3CCQP 2AEMA 2V08A 2POHA 3AEDC 1JY3N 1LNQA 1CIHA 2IBZI 3N4XA 1OXZA 3V2RA 1HJ3A 1N9CA 4WQCA 1LTJB 4I7ZB 3CC7P 1JO5A 1VQPP 1BSNA 5DFSA 3L74G 1EZVD 3PP5A 1L0NK 3TDKA 1BGYJ 4YTPC 4XXLA 1L4AB 1FBMA 5APXA 1MG3D 3CX5E 3D71A 1S1CX 3L75E 1VQMP 2A45G 1NHLA 1M1KQ 1I8OA 1SQQE 1K8AQ 2N9IA 3A0HV 1KN7A 2KZJA 1CC5A 1CTZA 1DIQC 1PPJD 3A7OA 5TISV 5APUA 4OVNF 3A9FA 3CCVP 2N18B 3M06A 4IL6H 1IFNA 1HF9A 3CI9A 2AXTH 2HR3A 1YIJP 1P84E 1KQFB 1FS0E 1LP1B 1JTHB 3H1LD 4V2KA 4H44B 2GUSA 1BCCG 1HH0A 2CPBA 1IRWA 1RF1C 1S5LV 1SLQA 4XYDB 1VQ6P 2A06D 3ORVA 3CX5W 4XE5B 5DJTB 2FYUK 2C8SA 3SWSA 1M57D 2E75D 3E1IA 4XA4A 2YO2A 1NH4A 2Q3IA 5AW7B 1NTMJ 1QKSA 2BCCE 4HYTB 3RK3B 3RK2B 1EXIA 1C52A 3O6QA 1I54A 2YKQA 1IZL0 5DJQB 4N78E 1HH7A 3L75J 3R2PA 4BRYA 4FA1A 4N0KA 1IFPA 3RBXA 2FXMA 2M3EA 2Y9ZA 2IYPA 2AXTV 1FZCB 1OVRA 3LW5H 4GODA 3QWOC 3VTPC 1K3HA 2MTAC 1S72P 4BXLA 1H32A 3HE5A 4GIFA 4UB8E 3ZOXA 1C7MA 2W8ZA 3CC2P 3CCEP 1ETPA 1DW2A 1VF5C 1F1FA 3C9IA 4QAOA 4JYCA 4IL6V 2B89A 3U1AA 4OWFA 1AQTA 2E5YA 1NJIQ 1VQKP 1RQUA 3EWKA 1R8EA 3ZOYA 1NTKJ 1L0LE 3FGAD 1CRCA 1B7VA 5AW8B 1BDCA 3MUDA 1ZV8A 2QM7A 1M6ZA 1L4AD 1DD4A 2ZVOB 3SVWA 2HPCA 3DP5A 1G2CB 3G4SP 1WEJF 3CX5H 1S6VB 4NFGB 2B87A 4JQ0D 1K04A 2G8YA 3KQGA 155CA 3JBTB 3B4SA 2IYOA 1LP1A 1JTHA 1CI6A 2JJLA 3HTKA 3L75D 4JYBA 4HJGH 1KD1Q 1URQA 1SQVG 3CX5I 2PCBB 4W7ZA 2KLVA 1W2EA 3PXWA 1RE3A 2K9JB 3L74J 4ASWA 4L1QA 5KAFH 2Q3EA 2AXCA 3C8VA 1T8ZA 1NTZJ 2WVRA 4M3LA 2AXTE 5CMZA 4EIFA 1UIIA 4L75A 5CCHA 2WZ7A 3TYYA 3G71P 1N7SC 4L74A 5GTIH 1FE6A 3WC8A 1CI6B 2WPQA 4D6TD 1KB9E 2FWLA 1NWQA 1OAEA 3G6EP 4FA5A 3PRJA 2BCCJ 5CBNA 2E74D 1QVGO 1I6EA 3MGNA 5AVSB 5AW9B 2N1TC 1HVVA 4PD4H 1L4AA 2C1DB 1BCCD 4OGQB 1FOSF 1S2EA 3JCUE 1CHJA 2QJKB 1BGYG 3B8EB 5CIDB 1FU1A 3WUVA 4C7NB 1HJ4A 1X9VA 1AJYA 3S9OA 4EOTA 3V4WA 1CIFA 3CL3D 1AV1A 3MUDC 3V5BA 1VQNP 1BSHA 1KILE 3L73J 4O9BA 1PGPA 1M8OB 1SFCC 4H13B 1C6OA 1MG2D 2CE0A 1E8EA 2OZ1B 3OW2O 4WQDA 1R0QA 1H0TA 5AVZB 1KX2A 1GU4A 1IO3A 1VF5B 1K73Q 2IFNA 1SFCD 1HBWA 1SQVE 1C2RA 2AIUA 5AW6B 2YMKA 1GQ1A 5AVXB 3KZIH 2BH4X 1H31A 2KNCA 3B5ND 2FFDB 3PXSA 4IL6E 1N8RQ 2PAJA 4H44C 1KYOD 3IFMA 2OZ1A 4IOIH 3O1YA 3PHLA
chains in the Genus database with same CATH topology
1KB9D 2N3YA 1QL3A 1AKKA 1H32B 1DVVA 4GEDB 2L91A 1K3GA 1NNOA 3H1JD 2N9YB 1KV9A 3HQ9A 4FA9A 4UB6V 1DVHA 2BCNB 4FB1A 2CA3B 3H1KD 1LMSA 1GJQA 4Q5PA 1KIBA 3WFEC 1FI3A 2QJPB 1HZUA 4PW9B 1CCRA 1YFCA 2D0SA 2BCCD 1F1CA 4LJIA 4O1QA 1A8CA 1L0ND 1U75B 1FI7A 3SLEA 2L4DA 1I6DA 1GU2A 3DMIA 1J3SA 1CXCA 5EXQA 5DF5A 1DW1A 5KAFV 3PLNA 2D0WA 5CIHB 1N90A 2GB8B 2I8FA 2LIRA 3BCCD 1AYGA 3CXHD 3VRDA 2FYNB 1C6RA 1YNRA 2IBZD 5GTHV 4PJ0V 2O3JA 3RN1A 4KMGA 5CIEB 3WFCC 5B6QA 4WQAA 2JWAA 2ORLA 3WU2V 1I5TA 1SQVD 3PXTA 1FJ0A 1RZ5A 5CIGB 4EICA 1DW3A 2B10B 2ZZS1 1CRYA 1N15A 3PH2B 4AAOA 1ZRTD 1NTKD 3ITKA 3KHUA 3ZCFA 1HRCA 4RJTA 1H33A 2B11B 1CYJA 5B5EV 1W5CT 3PTZA 4L3GA 2V08A 1CIHA 1CHIA 2C9XB 3ZBMA 1CTJA 1I55A 4WQBA 1NMLA 1HJ3A 5TJHA 1N9CA 4WQCA 3VNWA 3GG2A 2C1VA 5DFSA 1EZVD 5KKZB 1DT1A 3OA8A 3WFDC 3TDKA 4GYDA 3WUIA 4L3HA 4XXLA 3CX5D 1MG3D 2JTIB 3L72D 3H1ID 1FI9A 1I8OA 3MK7B 3C2CA 2N9IA 3A0HV 1BGYD 1CC5A 5AURA 1CTZA 5C0ZA 1DIQC 2YIUB 2Y0DA 1BE3D 1PPJD 5TISV 3RMZA 1KYOW 3VYMA 2ZBOA 3FWLA 1H33B 3A9FA 1IRVA 2N18B 4UB8V 2KS1A 4Y5RA 2FYUD 1FHBA 4O1WA 1ZZHA 3TYIA 2GIWA 1E2RA 3H1LD 4V2KA 3CYTI 2GC4D 1LFMA 1FOCA 2FRCA 1IRWA 1H1OA 1S5LV 4XYDB 2A06D 3ORVA 3CX5W 3O20A 3CXHW 2C8SA 3SWSA 4FAVA 2VHDA 2B0ZB 1RZ6A 4DY9A 5H2FV 1NU1D 3CU4A 2CE1A 5CICB 2N18C 1RAQA 1QKSA 1MZ4A 2QG4A 1C52A 1EB7A 1I54A 1C6SA 1NTMD 4WQ8A 3SXTA 1IZL0 5DJQB 1HH7A 2C1DA 1L9BC 1HJ5A 4FA1A 4N0KA 1L9JC 1SQPD 2EXVA 5KAIV 4WQ9A 2B4ZA 1CIGA 2AXTV 3X39A 1CSUA 1YEBA 1LC2A 1K3HA 1KB0A 3CWBD 5C9MA 2MTAC 1YTCA 1H32A 2PACA 1OCDA 1AOQA 1LS9A 1GKSA 5GTIV 1WVEC 1CRGA 1L0LD 1JDLA 3L4OA 2ZONG 1DIIC 3ZOXA 1C7MA 4PWAA 1BL9A 1CRJA 3OA8B 1ETPA 1DW2A 1F1FA 3WFBC 2ZXYA 4QAOA 3H1HD 4IL6V 4MU8A 2N9JA 4JCGA 351CA 3RLMA 4AX3A 4WQEA 3ZOYA 1C2NA 4P4QB 1HROA 1AOFA 3L71D 1CRCA 1B7VA 1FCDC 2XTSB 1CIEA 2C1UA 2BH5X 1M6ZA 1CYCA 1CXAA 3SVWA 5CIBB 4WQ7A 3DP5A 1N50A 2AI5A 2RN0A 1WEJF 1COTA 1S6VB 4NFGB 155CA 1CO6A 2MHMA 4EDFA 3O5CA 3JBTB 4EIDA 1KX7A 3NWVA 1H31B 1QL4A 5CYTR 2N3BA 3L75D 1M70A 4H0JA 2RMZA 4A7PA 2PCBB 4J20A 2HV4A 3PXWA 4YE1A 1CORA 1E29A 1YCCA 4AALA 3HQ7A 2K9JB 2LITA 2YK3A 2CA4B 4L1QA 2Q3EA 1LC1A 2BGVX 1I8PA 3O0RC 4EIFA 1H9XA 3SJLA 1YEAA 3CP5A 3KZIV 1CTYA 3GW6A 1QN2A 1GIWA 5E79V 5KLIB 2V07A 4PD4D 3NBTA 2B12B 2GC7D 1CRHA 2CXBA 2DVHA 1C75A 1CSWA 3WC8A 1NTZD 4EIEA 4D6TD 1CHHA 4FA4A 2FWLA 1SQQD 1OAEA 3L73D 4FA5A 1VYDA 2Y0CA 3PRJA 1YICA 1M60A 3RN0A 1I6EA 3TF5A 3OCDA 2BPBB 2C1DB 1BCCD 1HCMA 2DGEA 1NIRA 1SQXD 2PCCB 1CHJA 3L70D 2KNCB 3NBSA 2QJKB 1SQBD 2C2CA 3L74D 1YIQA 1A56A 3A0BV 1P84D 5CIDB 1W2LA 3ZOWA 1RAPA 1HJ4A 3ZIYA 3HQ8A 1U74B 1CIFA 5KLVD 1CSXA 3DR0A 3VMAA 2BLFB 2YQBA 5DJQC 1CRIA 1C6OA 1MG2D 4AAMA 2CE0A 5IY51 5CIFB 2YCCA 1E8EA 1A2SA 2OZ1B 3M97X 2QJYB 4WQDA 1R0QA 1QYZA 1NMIA 1KX2A 4AANA 2JQRA 1DW0A 1IO3A 4H0KA 451CA 3L4MA 3OCDB 2ZOOA 4FANA 1CSVA 1CCHA 4U3FD 4K3IA 3ZOOA 4RSZA 1C2RA 1CEDA 1IQCA 1H9YA 2AIUA 1GQ1A 1CNOA 2BH4X 1H31A 1PP9D 1CYIA 1GDVA 3PXSA 2Y0EA 3TGUD 3HQ6A 1KYOD 1HZVA 5B66V 2OZ1A 3O1YA 3PHLA 3MK7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 D;  2N3Y A;  1QL3 A;  1AKK A;  1H32 B;  1DVV A;  4GED B;  2L91 A;  1K3G A;  1NNO A;  3H1J D;  2N9Y B;  1KV9 A;  3HQ9 A;  4FA9 A;  4UB6 V;  1DVH A;  2BCN B;  4FB1 A;  2CA3 B;  3H1K D;  1LMS A;  1GJQ A;  4Q5P A;  1KIB A;  3WFE C;  1FI3 A;  2QJP B;  1HZU A;  4PW9 B;  1CCR A;  1YFC A;  2D0S A;  2BCC D;  1F1C A;  4LJI A;  4O1Q A;  1A8C A;  1L0N D;  1U75 B;  1FI7 A;  3SLE A;  2L4D A;  1I6D A;  1GU2 A;  3DMI A;  1J3S A;  1CXC A;  5EXQ A;  5DF5 A;  1DW1 A;  5KAF V;  3PLN A;  2D0W A;  5CIH B;  1N90 A;  2GB8 B;  2I8F A;  2LIR A;  3BCC D;  1AYG A;  3CXH D;  3VRD A;  2FYN B;  1C6R A;  1YNR A;  2IBZ D;  5GTH V;  4PJ0 V;  2O3J A;  3RN1 A;  4KMG A;  5CIE B;  3WFC C;  5B6Q A;  4WQA A;  2JWA A;  2ORL A;  3WU2 V;  1I5T A;  1SQV D;  3PXT A;  1FJ0 A;  1RZ5 A;  5CIG B;  4EIC A;  1DW3 A;  2B10 B;  2ZZS 1;  1CRY A;  1N15 A;  3PH2 B;  4AAO A;  1ZRT D;  1NTK D;  3ITK A;  3KHU A;  3ZCF A;  1HRC A;  4RJT A;  1H33 A;  2B11 B;  1CYJ A;  5B5E V;  1W5C T;  3PTZ A;  4L3G A;  2V08 A;  1CIH A;  1CHI A;  2C9X B;  3ZBM A;  1CTJ A;  1I55 A;  4WQB A;  1NML A;  1HJ3 A;  5TJH A;  1N9C A;  4WQC A;  3VNW A;  3GG2 A;  2C1V A;  5DFS A;  1EZV D;  5KKZ B;  1DT1 A;  3OA8 A;  3WFD C;  3TDK A;  4GYD A;  3WUI A;  4L3H A;  4XXL A;  3CX5 D;  1MG3 D;  2JTI B;  3L72 D;  3H1I D;  1FI9 A;  1I8O A;  3MK7 B;  3C2C A;  2N9I A;  3A0H V;  1BGY D;  1CC5 A;  5AUR A;  1CTZ A;  5C0Z A;  1DIQ C;  2YIU B;  2Y0D A;  1BE3 D;  1PPJ D;  5TIS V;  3RMZ A;  1KYO W;  3VYM A;  2ZBO A;  3FWL A;  1H33 B;  3A9F A;  1IRV A;  2N18 B;  4UB8 V;  2KS1 A;  4Y5R A;  2FYU D;  1FHB A;  4O1W A;  1ZZH A;  3TYI A;  2GIW A;  1E2R A;  3H1L D;  4V2K A;  3CYT I;  2GC4 D;  1LFM A;  1FOC A;  2FRC A;  1IRW A;  1H1O A;  1S5L V;  4XYD B;  2A06 D;  3ORV A;  3CX5 W;  3O20 A;  3CXH W;  2C8S A;  3SWS A;  4FAV A;  2VHD A;  2B0Z B;  1RZ6 A;  4DY9 A;  5H2F V;  1NU1 D;  3CU4 A;  2CE1 A;  5CIC B;  2N18 C;  1RAQ A;  1QKS A;  1MZ4 A;  2QG4 A;  1C52 A;  1EB7 A;  1I54 A;  1C6S A;  1NTM D;  4WQ8 A;  3SXT A;  1IZL 0;  5DJQ B;  1HH7 A;  2C1D A;  1L9B C;  1HJ5 A;  4FA1 A;  4N0K A;  1L9J C;  1SQP D;  2EXV A;  5KAI V;  4WQ9 A;  2B4Z A;  1CIG A;  2AXT V;  3X39 A;  1CSU A;  1YEB A;  1LC2 A;  1K3H A;  1KB0 A;  3CWB D;  5C9M A;  2MTA C;  1YTC A;  1H32 A;  2PAC A;  1OCD A;  1AOQ A;  1LS9 A;  1GKS A;  5GTI V;  1WVE C;  1CRG A;  1L0L D;  1JDL A;  3L4O A;  2ZON G;  1DII C;  3ZOX A;  1C7M A;  4PWA A;  1BL9 A;  1CRJ A;  3OA8 B;  1ETP A;  1DW2 A;  1F1F A;  3WFB C;  2ZXY A;  4QAO A;  3H1H D;  4IL6 V;  4MU8 A;  2N9J A;  4JCG A;  351C A;  3RLM A;  4AX3 A;  4WQE A;  3ZOY A;  1C2N A;  4P4Q B;  1HRO A;  1AOF A;  3L71 D;  1CRC A;  1B7V A;  1FCD C;  2XTS B;  1CIE A;  2C1U A;  2BH5 X;  1M6Z A;  1CYC A;  1CXA A;  3SVW A;  5CIB B;  4WQ7 A;  3DP5 A;  1N50 A;  2AI5 A;  2RN0 A;  1WEJ F;  1COT A;  1S6V B;  4NFG B;  155C A;  1CO6 A;  2MHM A;  4EDF A;  3O5C A;  3JBT B;  4EID A;  1KX7 A;  3NWV A;  1H31 B;  1QL4 A;  5CYT R;  2N3B A;  3L75 D;  1M70 A;  4H0J A;  2RMZ A;  4A7P A;  2PCB B;  4J20 A;  2HV4 A;  3PXW A;  4YE1 A;  1COR A;  1E29 A;  1YCC A;  4AAL A;  3HQ7 A;  2K9J B;  2LIT A;  2YK3 A;  2CA4 B;  4L1Q A;  2Q3E A;  1LC1 A;  2BGV X;  1I8P A;  3O0R C;  4EIF A;  1H9X A;  3SJL A;  1YEA A;  3CP5 A;  3KZI V;  1CTY A;  3GW6 A;  1QN2 A;  1GIW A;  5E79 V;  5KLI B;  2V07 A;  4PD4 D;  3NBT A;  2B12 B;  2GC7 D;  1CRH A;  2CXB A;  2DVH A;  1C75 A;  1CSW A;  3WC8 A;  1NTZ D;  4EIE A;  4D6T D;  1CHH A;  4FA4 A;  2FWL A;  1SQQ D;  1OAE A;  3L73 D;  4FA5 A;  1VYD A;  2Y0C A;  3PRJ A;  1YIC A;  1M60 A;  3RN0 A;  1I6E A;  3TF5 A;  3OCD A;  2BPB B;  2C1D B;  1BCC D;  1HCM A;  2DGE A;  1NIR A;  1SQX D;  2PCC B;  1CHJ A;  3L70 D;  2KNC B;  3NBS A;  2QJK B;  1SQB D;  2C2C A;  3L74 D;  1YIQ A;  1A56 A;  3A0B V;  1P84 D;  5CID B;  1W2L A;  3ZOW A;  1RAP A;  1HJ4 A;  3ZIY A;  3HQ8 A;  1U74 B;  1CIF A;  5KLV D;  1CSX A;  3DR0 A;  3VMA A;  2BLF B;  2YQB A;  5DJQ C;  1CRI A;  1C6O A;  1MG2 D;  4AAM A;  2CE0 A;  5IY5 1;  5CIF B;  2YCC A;  1E8E A;  1A2S A;  2OZ1 B;  3M97 X;  2QJY B;  4WQD A;  1R0Q A;  1QYZ A;  1NMI A;  1KX2 A;  4AAN A;  2JQR A;  1DW0 A;  1IO3 A;  4H0K A;  451C A;  3L4M A;  3OCD B;  2ZOO A;  4FAN A;  1CSV A;  1CCH A;  4U3F D;  4K3I A;  3ZOO A;  4RSZ A;  1C2R A;  1CED A;  1IQC A;  1H9Y A;  2AIU A;  1GQ1 A;  1CNO A;  2BH4 X;  1H31 A;  1PP9 D;  1CYI A;  1GDV A;  3PXS A;  2Y0E A;  3TGU D;  3HQ6 A;  1KYO D;  1HZV A;  5B66 V;  2OZ1 A;  3O1Y A;  3PHL A;  3MK7 C; 
#chains in the Genus database with same CATH topology
 3W67 A;  1LWU B;  2KB7 P;  3AEF C;  4WB4 A;  1DVV A;  4GED B;  1J1E B;  1GK4 A;  3L71 J;  2K9J A;  2R3S A;  2WMM A;  1GJQ A;  1Y47 A;  3CWB E;  2IPP A;  1VQ4 P;  1SQQ K;  1HZU A;  4PW9 B;  1NVO A;  3RK2 C;  1YFC A;  1F1C A;  2I1K A;  3WUU A;  1U57 A;  5APY A;  1A8C A;  1PZQ A;  3Q5S A;  2FBW C;  1J3S A;  1EDL A;  2KK7 A;  1DW1 A;  3NTN A;  2D0W A;  4HKZ H;  2LIR A;  2GB8 B;  2BEZ F;  3OA7 A;  1X8Y A;  1NTK K;  2OYI B;  3H1L E;  5CCG C;  3BCC G;  2OTL P;  1VQ5 P;  1S5L H;  1SS1 A;  2H8P D;  2O01 N;  3L75 G;  2P67 A;  5B6Q A;  2JWA A;  2ORL A;  1N86 A;  1GTW A;  1PGO A;  1SQV D;  3PXT A;  1Q86 Q;  4EIC A;  1GU5 A;  2ZZS 1;  4U3F E;  2QRX A;  1N15 A;  1DEB A;  4AAO A;  1JOC A;  1ZRT D;  1PP9 E;  2OTK E;  2B11 B;  3HTK B;  3SWF A;  5B5E V;  3L35 A;  1W5C T;  3HUS B;  1PFI A;  4HB1 A;  2ZXX A;  5AVU B;  2C9X B;  1XTG B;  3HE4 B;  3KPE A;  1KFM A;  5KJ7 C;  1CTJ A;  4D6T G;  1BE3 G;  1PPJ E;  5AW5 B;  1NKZ B;  1URQ C;  2M8R A;  2N9B A;  5AVR B;  5KJ7 A;  2Z5I A;  1OMI A;  5KLV J;  3WFD C;  1NTM K;  4GYD A;  1KMI Z;  1IK7 A;  2OYH B;  3CXH E;  4Y28 J;  1LWU A;  3TGU E;  2Z5H A;  1FI9 A;  4ZNC A;  2Y9Y A;  1BGY D;  2M0B A;  3D6Z A;  5AUR A;  1E5W A;  1YJW P;  2HPC B;  3F5H A;  3HRN A;  1E79 H;  3FWL A;  3JC2 2;  1EZV G;  1JUN A;  1LTA C;  1U7M A;  4H0L B;  1SQQ G;  1IRV A;  4UB8 V;  3RBZ A;  3AEC C;  1MKM A;  1W2B O;  3U1C A;  1OVV A;  4EIJ A;  1E2R A;  2GC4 D;  3KDP B;  1R5S A;  2A45 I;  5APV A;  1BE3 E;  1PPJ G;  2N1T D;  1JCD A;  3CXH W;  3BCC J;  3GHG B;  3B5N B;  1VPC A;  1OWA A;  1YI2 P;  1QLE D;  3CME P;  2E43 A;  2NPS C;  2ZYA A;  1ZLL A;  3M9B A;  3CCL P;  1RH5 B;  3AE6 C;  1TU3 F;  5CIC B;  1RAQ A;  1MZ4 A;  2QG4 A;  5AW2 B;  4D6T E;  4C46 A;  1JY2 N;  3SXT A;  1FDO A;  2C1D A;  1L9J C;  3CLQ A;  3G9R A;  1SFC B;  4BWN A;  1SQP D;  2EXV A;  3V4Q A;  2B4Z A;  1MFT A;  3X39 A;  1DIP A;  5APS A;  4U3F G;  5C9M A;  2NRG A;  4PV1 C;  3L72 E;  3P8C E;  1VQ8 P;  1AOQ A;  3S1K A;  1M90 Q;  1GKS A;  1KC8 Q;  5GTI V;  1WVE C;  2IZ0 A;  1L0L D;  2KSE A;  1QGK B;  1OW7 A;  2ZON G;  5KLV E;  2ZXE B;  1FDI A;  1KB9 H;  3B5N C;  4YPC A;  1G2C A;  5AVV B;  1CRJ A;  3OA8 B;  2FFD C;  3HD7 C;  2PFX A;  4H44 D;  3T97 B;  2FYU E;  1SQQ J;  5M1B A;  4MU8 A;  2LR2 A;  2KLU A;  4JCG A;  3RLM A;  2AEJ A;  4NPF X;  3SFE C;  2QJP C;  3EFG A;  2Q1K A;  3IR9 A;  3H1H G;  1HRO A;  1AOF A;  3L71 D;  1NU1 J;  1X0T A;  1FCD C;  1BGY E;  2XTS B;  2C1U A;  4B86 A;  3M0D C;  2QJK C;  1SQX K;  2BH5 X;  1PL5 A;  1IJD B;  2FYZ A;  4GT1 A;  4KJM A;  3RK2 D;  1OW8 A;  2MHM A;  4K3A A;  3NWV A;  4RES B;  1WMK A;  1QL4 A;  2OYH C;  4EI2 A;  1P84 I;  4ZKP A;  1M70 A;  2XND H;  4J20 A;  1KIL B;  4YE1 A;  2C9N Y;  1NU1 K;  1YCC A;  5CCG A;  3HQ7 A;  1Y9B A;  1ZXG A;  2YK3 A;  2MJZ A;  1USD A;  5H2F H;  2I8D A;  4WY4 D;  4DCK A;  1Q7Y Q;  1H9X A;  2E42 A;  3BCC E;  2WWW A;  3IF4 A;  1CTY A;  2RH0 A;  4GDO A;  1NYH A;  1GIW A;  5E79 V;  5KLI B;  1GL2 A;  4PD4 D;  2FY8 A;  1FAV A;  3NBT A;  2E5T A;  3CD6 P;  2B12 B;  2GC7 D;  1OZH A;  3AE7 C;  1CRH A;  1PP9 J;  1CSW A;  2KUB A;  1KYO I;  1NAF A;  4EIE A;  2P10 A;  1SQQ D;  2WQY C;  3M0D A;  3HD7 D;  3L73 D;  3PJS K;  2Y0C A;  4XFJ A;  4AUW A;  3O8Z A;  1S5L E;  1YIC A;  3RN0 A;  1PIX A;  3CXH H;  5E79 H;  2DGE A;  2XV5 A;  1G1I A;  2PCC B;  2YKP A;  1HWT C;  1H0T B;  1HGZ A;  1YJN P;  1HGV A;  1YQ3 C;  2DW3 A;  1GL2 B;  1P84 D;  1W2L A;  3L71 E;  5AVW B;  2XU6 A;  1OW6 A;  3HQ8 A;  3GLM A;  1UIX A;  3L70 J;  3CCJ P;  1S9K E;  3T97 A;  2O01 J;  3VMA A;  2G3A A;  2FYU G;  3NFQ A;  2P58 A;  2GM4 A;  3V2N A;  5CIF B;  2KIK A;  3M9H A;  5KAF E;  3EFF K;  3A0H H;  4IFF A;  1H89 A;  1HUC A;  5TIS E;  451C A;  3B5N A;  1FZF A;  3L4M A;  2B87 B;  1CCH A;  4U3F D;  2N1T B;  4K3I A;  3ZOO A;  1CED A;  1PV3 A;  3GHG C;  3MP7 B;  1AFO A;  1PP9 D;  2OYO A;  1CYI A;  1JY3 P;  1MV8 A;  1EC5 A;  2HYN A;  2Z4E A;  2Y0E A;  1LT9 B;  3TGU D;  2JEE A;  5B66 V;  3N7N A;  2BCC G;  4ASV A;  3BVH A;  1AKK A;  4WY4 A;  1L0L G;  2M5A A;  2L91 A;  1DH3 A;  2N9Y B;  5BU8 B;  1KV9 A;  4FA9 A;  4UB6 V;  1DVH A;  1K9M Q;  1IFD A;  2BCN B;  1OX3 A;  1ZP0 C;  5AW3 B;  3H1K D;  3L71 G;  3WFE C;  3H1J G;  5K5G B;  2KS1 B;  4I6M C;  2NPS A;  1LT9 A;  4OH8 B;  3H32 A;  2D0S A;  4LJI A;  4O1Q A;  1L2P A;  3SFD C;  1N7L A;  3AE9 C;  4KHX A;  1SVF A;  2OYI C;  3H1H J;  3VP8 A;  1RF1 B;  1FI7 A;  3SLE A;  1W5C E;  1I6D A;  4UB6 H;  5EXQ A;  5DF5 A;  5KAF V;  3HUS C;  3D0W A;  1GMJ A;  5CIH B;  3CXH D;  3VRD A;  3AEB C;  4WWI A;  2IBZ E;  1ZME C;  1SQB E;  1ZOY C;  3RN1 A;  4KMG A;  1T2K D;  2XKM A;  3A2A A;  2H89 C;  4WQA A;  3H6P A;  3WU2 V;  1KV4 A;  1M7L A;  3KYQ A;  5CIG B;  1RF0 C;  2KOG A;  2LXB A;  5GTI E;  4H13 C;  3U59 A;  1GL2 C;  1Q2N A;  4NPE A;  1HRC A;  3L73 G;  3LID A;  2QM8 A;  1SQP K;  2PRR A;  2YKO A;  2UWJ E;  1JMM A;  5H2F E;  1JNM A;  2ZJS E;  4WQB A;  1NML A;  2V7Q J;  2NZ2 A;  1KIL D;  3VNW A;  4AYC A;  1HJB A;  1NTK E;  1NKN A;  3OA8 A;  3KXD A;  3CC4 P;  3GF7 A;  1D7M A;  3WUI A;  4L3H A;  3H1H E;  2YMY A;  3USS A;  2KXP B;  3F89 A;  1JB0 J;  3L72 D;  3P8C D;  1S3J A;  3MK7 B;  2LXC B;  5APW A;  3C2C A;  1M56 D;  1KIL C;  2BEQ D;  3H1J J;  5C0Z A;  1IFM A;  2Y0D A;  1BE3 D;  3H1I J;  1EZV I;  3P32 A;  1NAY A;  4I2L C;  1PGQ A;  2ZBO A;  1IFJ A;  5KJ7 D;  1H33 B;  2KS1 A;  4Y5R A;  1SQX G;  2FYU D;  1NGM B;  1FHB A;  3TYI A;  1SQX E;  4MN4 C;  2GIW A;  3CYT I;  1PGJ A;  1VQ7 P;  2SPZ A;  1LFM A;  4PD4 I;  1FOC A;  2FRC A;  3AE8 C;  5KTB A;  1VDF A;  2JR8 A;  1K05 A;  3TGU G;  4DY9 A;  5H2F V;  1NU1 D;  1SQP E;  1KQS O;  2QA4 P;  1DD3 A;  1G1J A;  3FWN A;  1PP9 G;  5CJ0 A;  2E76 C;  4TT3 H;  5CJ4 A;  5B5E H;  2R32 A;  3MIW A;  3CCU P;  2D2C D;  1JY2 O;  3WU2 E;  3GF3 A;  1EB7 A;  1OVU A;  1ZR4 A;  1NTM D;  3M0A A;  4WQ8 A;  3JSV C;  3H1K G;  4PV1 B;  4GOF A;  3VYI A;  5BVZ A;  1L9B C;  1U7J A;  2HOD A;  1N7S D;  2JO1 A;  5KAI V;  2WSE J;  1L0N J;  1CIG A;  1N73 C;  2V7Q H;  4YXW H;  3FXE A;  5KAI E;  2D2C C;  3W68 A;  1YEB A;  1LC2 A;  2FXO A;  4PD4 E;  1KB0 A;  3CWB D;  1YTC A;  2K37 A;  2PAC A;  2NPS D;  3CCM P;  1FJK A;  2W27 A;  1LS9 A;  2GUV A;  1OIP A;  1AVO A;  1M1J A;  3M9Q A;  1J1D C;  2IDB A;  2QSI A;  4CPG A;  2O01 H;  1BL9 A;  1P84 H;  5B5E E;  3SWK A;  2W90 A;  3WFB C;  2ZXY A;  1KYO H;  2RKL A;  3JCU H;  1ZN5 A;  351C A;  5AW0 B;  4AX3 A;  4WQE A;  3BRT B;  4P4Q B;  4JPZ B;  3SSU A;  2LKM A;  3AE2 C;  1CSB A;  1BDD A;  3OJA B;  3Q1M A;  3RL0 C;  3Q5R A;  4DT0 A;  2W6A A;  1CYC A;  1EQ7 A;  3MHV A;  4WQ7 A;  1N73 B;  2RN0 A;  3H1J E;  1COT A;  1YTZ T;  1Z56 A;  3EQ2 A;  3HE5 B;  2E75 C;  1CW5 A;  4EID A;  3WUT A;  3Q5P A;  5CYT R;  2N3B A;  2OGU A;  1RE3 C;  2WSF J;  4H0J A;  4A7P A;  4H0L C;  3IAO A;  2HV4 A;  1J1D B;  1COR A;  4AAL A;  2WT7 A;  3AEE C;  4OGQ C;  2LIT A;  1YBK A;  2XDJ A;  3II6 A;  1FZG A;  2ZAE B;  3BAT A;  2BGV X;  3HUS A;  1ZRT E;  5KAI H;  1L0L K;  1I8P A;  3O0R C;  3AEA C;  3I56 P;  3KZI V;  3GW6 A;  3A5T A;  1KOR A;  1VL2 A;  5GTH H;  3L70 G;  4OGQ D;  4FA4 A;  1RF0 A;  1VYD A;  4LGD E;  1LTT C;  3BRV B;  1IC2 A;  3LIE A;  1IK9 A;  3I5C A;  2WPV B;  4TLF A;  1SQX J;  1NOH A;  1FOS E;  1N7S B;  3OCD A;  2XNX A;  2OYH A;  1WRG A;  2CPS A;  3L4F A;  1NIR A;  1SQX D;  2KYV A;  3HD7 A;  1NTZ K;  2KNC B;  1QL1 A;  1JY2 P;  4Y99 C;  1SQB D;  2C2C A;  3A0B V;  4U3F J;  4K35 A;  2J59 M;  3ZIY A;  1EDJ A;  1DX7 A;  1OFC X;  4DOJ A;  5KLV D;  2ZFC A;  3DR0 A;  2K88 A;  1ZR2 A;  2B9B A;  5KKZ C;  1CRI A;  2R5B A;  1H8A A;  5IY5 1;  3GHG A;  1LTJ C;  1A2S A;  3M97 X;  5CBO A;  1NMI A;  2JQR A;  1Q90 D;  3GMA A;  1T3J A;  1KQG B;  4WY4 B;  4H0K A;  1L0N E;  4PJ0 E;  1LTS C;  1IZN B;  3ZDM A;  2JP3 A;  4U7J A;  4RSZ A;  1IQC A;  1H9Y A;  1L0L J;  1GD2 E;  3I55 P;  1GDV A;  2W6B A;  4Z1M H;  4BRY B;  5L8R J;  2NPS B;  3H1K E;  3H1I E;  3O6Q B;  3H32 B;  3HQ6 A;  1NO4 A;  3AE1 C;  1JMB A;  3LW5 J;  1RF1 A;  1QL3 A;  2HOD B;  1H32 B;  2QIW A;  2KP8 A;  3IN6 A;  1EDK A;  1SQB K;  1K3G A;  3RL0 B;  1GZL A;  1NNO A;  3G3Z A;  2W6J H;  1FZE A;  5C39 A;  4Q5P A;  1KIB A;  1EXJ A;  4LLH A;  2QEX P;  1CCR A;  1QX8 A;  2BCC D;  2HG5 D;  1VF5 D;  1AQ5 A;  1L0N D;  1U75 B;  2L4D A;  1N7S A;  3A0B E;  3A0H E;  2JDI H;  1GU2 A;  5AW4 B;  5CCH C;  2P1J A;  1CXC A;  1LWU C;  4W80 A;  2QJY C;  1T2K C;  2YIU C;  3BCC D;  3HD7 B;  2K9Y A;  1C6R A;  3L70 E;  2ZYD A;  1L4A C;  2IBZ D;  2WSF H;  3KZI E;  3UIA A;  5GTH V;  3CMA P;  2WSC H;  2O3J A;  3AE5 C;  5B66 H;  5CCH D;  5AVY B;  5CIE B;  1NTM E;  1S5L X;  1S9K D;  2ZVN B;  3V6I A;  3D70 A;  2OQQ A;  2YXQ B;  4HH2 A;  1RZ5 A;  1DW3 A;  2B10 B;  3FXD A;  4N3Y B;  3L72 J;  3PH2 B;  1NTK D;  3KHU A;  3ZCF A;  2JKV A;  2FKW B;  5E79 E;  1CYJ A;  3VMY A;  4L3G A;  5APT A;  1JM0 A;  1SQV K;  1CHI A;  2KSJ A;  1HTL C;  3ZBM A;  2FYU J;  1I55 A;  5TJH A;  1YHQ P;  1YYC A;  5B66 E;  2WSE H;  3L36 A;  3GG2 A;  1EDI A;  1GW4 A;  2Q7C A;  1RY3 A;  2C1V A;  5KKZ B;  1DT1 A;  1X79 B;  3VOP A;  3CX5 D;  2I1J A;  2JTI B;  2L5G B;  1JY3 O;  3H1I D;  2KI7 B;  4DZO A;  1A02 J;  3D6Y A;  1M1J C;  1NTZ E;  2J58 A;  3VP9 A;  3H1L G;  3RK3 C;  1SQB G;  3R4Y A;  4R4M A;  2YIU B;  1A02 F;  1BCC J;  2VRS A;  3RMZ A;  2A06 G;  1KYO W;  1LT9 C;  3VYM A;  3CWB J;  5KLV G;  1NTZ G;  1AA0 A;  3SWY A;  3VMZ A;  1N73 A;  1QVF O;  2OAR A;  4O1W A;  2M3B A;  1ZZH A;  4C7N A;  3L72 G;  2WTY A;  3HE4 A;  3L74 E;  1MFZ A;  1H1O A;  2MKV A;  1FZA A;  5APQ A;  3O20 A;  1QL2 A;  3WMM 0;  4FAV A;  2VHD A;  2B0Z B;  1RZ6 A;  4WBA A;  1YJ9 P;  3CU4 A;  1GK6 A;  1IFI A;  2CE1 A;  1KYO E;  2N18 C;  1M1J B;  3RGU A;  5KLI C;  1GDT A;  2B88 A;  3B71 A;  2E75 B;  1SQP G;  1C6S A;  5TIS H;  2WPS A;  4WY4 C;  2XZR A;  1HJ5 A;  2BAS A;  3H1L J;  1NU1 G;  2J5U A;  4JBZ A;  2FXP A;  3AE4 C;  1S4X A;  4WQ9 A;  4IFM A;  1BCC E;  1CSU A;  2V4H A;  1L0N G;  3A0B H;  1OCD A;  3C1L A;  4H13 D;  1Y8A A;  2W83 C;  1WT6 A;  2C0X A;  3H1K J;  3Q3D A;  1NTM G;  1CRG A;  1Q82 Q;  1JDL A;  3L4O A;  1FZB A;  1URQ B;  1DII C;  3RL0 g;  3TNU A;  2A06 E;  4PWA A;  4GOE A;  2IBZ G;  2IX7 C;  5AW1 B;  1MZ9 A;  2FYN C;  3H1H D;  2E76 B;  2N9J A;  3CWB G;  1FZC A;  2AEF A;  1C2N A;  4RKU J;  1RE4 A;  3P7K A;  2H7H A;  1CIE A;  1NTK G;  3MZW B;  1CXA A;  3E1R A;  5CIB B;  3E7K A;  3S4R A;  1N50 A;  4D6T J;  2AI5 A;  3CPW O;  5GTH E;  3MD0 A;  2IZ1 A;  2D2C B;  2O1J A;  1LTB C;  4EDF A;  1CO6 A;  1AVY A;  4R4L A;  3O5C A;  2C0W A;  1N2D C;  2ITA A;  1KX7 A;  1JEK A;  3K5B A;  1H31 B;  3L73 E;  5BU5 A;  1GL2 D;  3CXH I;  2RMZ A;  2Q9I A;  1FDM A;  2YO3 A;  1SP4 A;  1E29 A;  4KT0 J;  1JCC A;  3VMX A;  3PH0 A;  2CA4 B;  4IFD K;  1X22 A;  3H1I G;  1J1E C;  1J2J B;  1LC1 A;  1BE3 J;  4RO0 A;  2H88 C;  3SJL A;  1YEA A;  3CP5 A;  1QN2 A;  4GKG A;  2V07 A;  1SQV J;  1IO4 A;  1LTI C;  2CXB A;  2R44 A;  2QVA A;  2DVH A;  1C75 A;  2C9L Y;  1NTZ D;  1CHH A;  1HJ0 A;  4QMA A;  1H88 A;  1RE4 C;  2CK3 H;  3WU2 H;  4PV1 D;  1ZW0 A;  1LJ2 A;  2ZT9 D;  2GA1 A;  2Q6Q A;  1FJP A;  1M60 A;  2PGD A;  2YNY A;  5KLV K;  3CCS P;  3TF5 A;  1T3U A;  2BPB B;  2WIT A;  3FX0 A;  1KQL A;  1HCM A;  3CCR P;  4DJG A;  3L70 D;  5AVQ B;  3NBS A;  2FFD A;  1XTC C;  2JWD A;  4WVZ A;  3L74 D;  2ZT9 C;  1YIQ A;  2WSC J;  1A56 A;  2E74 C;  3ZOW A;  1RAP A;  4NPD A;  3MTU E;  3BAS A;  5CHX A;  2OYI A;  5EFW B;  1U74 B;  4I7Z C;  1CSX A;  1SQB J;  4I1L A;  4UB8 H;  2IFM A;  2WPR A;  2H43 A;  2BLF B;  2YQB A;  5DJQ C;  4EYY Q;  1QEX A;  4N6J A;  4W7Y A;  3VN0 A;  3TNU B;  4AAM A;  1Q81 Q;  2YCC A;  3RK3 D;  1FZC C;  1T6A A;  1URQ D;  2QJY B;  1QYZ A;  1YQ4 C;  4AAN A;  1DW0 A;  3H25 A;  2M5A B;  3ABV C;  3M91 A;  3V2P A;  3Q2Y A;  2E76 D;  3OCD B;  2ZOO A;  4FAN A;  1CSV A;  1VQ9 P;  2KZI A;  1YIT P;  1LTJ A;  1LGH B;  2HFE D;  1KFN A;  1CNO A;  1USE A;  1NU1 E;  1R5L A;  1SFC A;  3P8M C;  4IL6 X;  4YXD C;  4Y99 B;  4AQR D;  2ZT9 B;  5AVT B;  1SQP J;  1HZV A;  3OAK A;  2HLO A;  4PJ0 H;  2WT7 B;  3MK7 C;  1KB9 D;  1GW3 A;  2N3Y A;  3AEG C;  3TGU J;  1MUU A;  1CZQ A;  3V2Q A;  2WSS H;  1VQO P;  2R3C A;  3H1J D;  2YXR B;  3HQ9 A;  2QE7 H;  5CCG D;  3TK1 A;  4FB1 A;  2CA3 B;  1LMS A;  2N1T A;  1FI3 A;  5DJU B;  2QJP B;  1VQL P;  1LT1 A;  3A3Y B;  2Q5U A;  2P2U A;  1KZU B;  3NMD A;  2OTJ P;  4ZKU A;  2O1K A;  4L76 A;  2P7J A;  4N78 D;  2K1A A;  1FC2 C;  3DMI A;  3PLN A;  1EZV E;  2A45 H;  1YTZ I;  1DEE G;  1N90 A;  2I8F A;  1AYG A;  3RK3 E;  1LTG C;  3RL0 D;  2FYN B;  1KB9 I;  1YNR A;  2K3R A;  3QH9 A;  4LC1 A;  4L73 A;  1RHZ B;  4PJ0 V;  4UB6 E;  1KTM A;  2ZYG A;  3WFC C;  1RQV A;  1I5T A;  4C7R A;  1FJ0 A;  2PP6 A;  3NXS A;  3AE3 C;  3TSI A;  1CRY A;  1KIL A;  4H0L D;  4ZMD A;  2E74 B;  3ITK A;  4RJT A;  1H33 A;  2R5D A;  3L37 A;  3PTZ A;  4JF7 A;  3CCQ P;  2AEM A;  2V08 A;  2POH A;  3AED C;  1JY3 N;  1LNQ A;  1CIH A;  2IBZ I;  3N4X A;  1OXZ A;  3V2R A;  1HJ3 A;  1N9C A;  4WQC A;  1LTJ B;  4I7Z B;  3CC7 P;  1JO5 A;  1VQP P;  1BSN A;  5DFS A;  3L74 G;  1EZV D;  3PP5 A;  1L0N K;  3TDK A;  1BGY J;  4YTP C;  4XXL A;  1L4A B;  1FBM A;  5APX A;  1MG3 D;  3CX5 E;  3D71 A;  1S1C X;  3L75 E;  1VQM P;  2A45 G;  1NHL A;  1M1K Q;  1I8O A;  1SQQ E;  1K8A Q;  2N9I A;  3A0H V;  1KN7 A;  2KZJ A;  1CC5 A;  1CTZ A;  1DIQ C;  1PPJ D;  3A7O A;  5TIS V;  5APU A;  4OVN F;  3A9F A;  3CCV P;  2N18 B;  3M06 A;  4IL6 H;  1IFN A;  1HF9 A;  3CI9 A;  2AXT H;  2HR3 A;  1YIJ P;  1P84 E;  1KQF B;  1FS0 E;  1LP1 B;  1JTH B;  3H1L D;  4V2K A;  4H44 B;  2GUS A;  1BCC G;  1HH0 A;  2CPB A;  1IRW A;  1RF1 C;  1S5L V;  1SLQ A;  4XYD B;  1VQ6 P;  2A06 D;  3ORV A;  3CX5 W;  4XE5 B;  5DJT B;  2FYU K;  2C8S A;  3SWS A;  1M57 D;  2E75 D;  3E1I A;  4XA4 A;  2YO2 A;  1NH4 A;  2Q3I A;  5AW7 B;  1NTM J;  1QKS A;  2BCC E;  4HYT B;  3RK3 B;  3RK2 B;  1EXI A;  1C52 A;  3O6Q A;  1I54 A;  2YKQ A;  1IZL 0;  5DJQ B;  4N78 E;  1HH7 A;  3L75 J;  3R2P A;  4BRY A;  4FA1 A;  4N0K A;  1IFP A;  3RBX A;  2FXM A;  2M3E A;  2Y9Z A;  2IYP A;  2AXT V;  1FZC B;  1OVR A;  3LW5 H;  4GOD A;  3QWO C;  3VTP C;  1K3H A;  2MTA C;  1S72 P;  4BXL A;  1H32 A;  3HE5 A;  4GIF A;  4UB8 E;  3ZOX A;  1C7M A;  2W8Z A;  3CC2 P;  3CCE P;  1ETP A;  1DW2 A;  1VF5 C;  1F1F A;  3C9I A;  4QAO A;  4JYC A;  4IL6 V;  2B89 A;  3U1A A;  4OWF A;  1AQT A;  2E5Y A;  1NJI Q;  1VQK P;  1RQU A;  3EWK A;  1R8E A;  3ZOY A;  1NTK J;  1L0L E;  3FGA D;  1CRC A;  1B7V A;  5AW8 B;  1BDC A;  3MUD A;  1ZV8 A;  2QM7 A;  1M6Z A;  1L4A D;  1DD4 A;  2ZVO B;  3SVW A;  2HPC A;  3DP5 A;  1G2C B;  3G4S P;  1WEJ F;  3CX5 H;  1S6V B;  4NFG B;  2B87 A;  4JQ0 D;  1K04 A;  2G8Y A;  3KQG A;  155C A;  3JBT B;  3B4S A;  2IYO A;  1LP1 A;  1JTH A;  1CI6 A;  2JJL A;  3HTK A;  3L75 D;  4JYB A;  4HJG H;  1KD1 Q;  1URQ A;  1SQV G;  3CX5 I;  2PCB B;  4W7Z A;  2KLV A;  1W2E A;  3PXW A;  1RE3 A;  2K9J B;  3L74 J;  4ASW A;  4L1Q A;  5KAF H;  2Q3E A;  2AXC A;  3C8V A;  1T8Z A;  1NTZ J;  2WVR A;  4M3L A;  2AXT E;  5CMZ A;  4EIF A;  1UII A;  4L75 A;  5CCH A;  2WZ7 A;  3TYY A;  3G71 P;  1N7S C;  4L74 A;  5GTI H;  1FE6 A;  3WC8 A;  1CI6 B;  2WPQ A;  4D6T D;  1KB9 E;  2FWL A;  1NWQ A;  1OAE A;  3G6E P;  4FA5 A;  3PRJ A;  2BCC J;  5CBN A;  2E74 D;  1QVG O;  1I6E A;  3MGN A;  5AVS B;  5AW9 B;  2N1T C;  1HVV A;  4PD4 H;  1L4A A;  2C1D B;  1BCC D;  4OGQ B;  1FOS F;  1S2E A;  3JCU E;  1CHJ A;  2QJK B;  1BGY G;  3B8E B;  5CID B;  1FU1 A;  3WUV A;  4C7N B;  1HJ4 A;  1X9V A;  1AJY A;  3S9O A;  4EOT A;  3V4W A;  1CIF A;  3CL3 D;  1AV1 A;  3MUD C;  3V5B A;  1VQN P;  1BSH A;  1KIL E;  3L73 J;  4O9B A;  1PGP A;  1M8O B;  1SFC C;  4H13 B;  1C6O A;  1MG2 D;  2CE0 A;  1E8E A;  2OZ1 B;  3OW2 O;  4WQD A;  1R0Q A;  1H0T A;  5AVZ B;  1KX2 A;  1GU4 A;  1IO3 A;  1VF5 B;  1K73 Q;  2IFN A;  1SFC D;  1HBW A;  1SQV E;  1C2R A;  2AIU A;  5AW6 B;  2YMK A;  1GQ1 A;  5AVX B;  3KZI H;  2BH4 X;  1H31 A;  2KNC A;  3B5N D;  2FFD B;  3PXS A;  4IL6 E;  1N8R Q;  2PAJ A;  4H44 C;  1KYO D;  3IFM A;  2OZ1 A;  4IOI H;  3O1Y A;  3PHL A; 
#chains in the Genus database with same CATH homology
 1KB9 D;  2N3Y A;  1QL3 A;  1AKK A;  1H32 B;  1DVV A;  4GED B;  2L91 A;  1K3G A;  1NNO A;  3H1J D;  2N9Y B;  1KV9 A;  3HQ9 A;  4FA9 A;  4UB6 V;  1DVH A;  2BCN B;  4FB1 A;  2CA3 B;  3H1K D;  1LMS A;  1GJQ A;  4Q5P A;  1KIB A;  3WFE C;  1FI3 A;  2QJP B;  1HZU A;  4PW9 B;  1CCR A;  1YFC A;  2D0S A;  2BCC D;  1F1C A;  4LJI A;  4O1Q A;  1A8C A;  1L0N D;  1U75 B;  1FI7 A;  3SLE A;  2L4D A;  1I6D A;  1GU2 A;  3DMI A;  1J3S A;  1CXC A;  5EXQ A;  5DF5 A;  1DW1 A;  5KAF V;  3PLN A;  2D0W A;  5CIH B;  1N90 A;  2GB8 B;  2I8F A;  2LIR A;  3BCC D;  1AYG A;  3CXH D;  3VRD A;  2FYN B;  1C6R A;  1YNR A;  2IBZ D;  5GTH V;  4PJ0 V;  2O3J A;  3RN1 A;  4KMG A;  5CIE B;  3WFC C;  5B6Q A;  4WQA A;  2JWA A;  2ORL A;  3WU2 V;  1I5T A;  1SQV D;  3PXT A;  1FJ0 A;  1RZ5 A;  5CIG B;  4EIC A;  1DW3 A;  2B10 B;  2ZZS 1;  1CRY A;  1N15 A;  3PH2 B;  4AAO A;  1ZRT D;  1NTK D;  3ITK A;  3KHU A;  3ZCF A;  1HRC A;  4RJT A;  1H33 A;  2B11 B;  1CYJ A;  5B5E V;  1W5C T;  3PTZ A;  4L3G A;  2V08 A;  1CIH A;  1CHI A;  2C9X B;  3ZBM A;  1CTJ A;  1I55 A;  4WQB A;  1NML A;  1HJ3 A;  5TJH A;  1N9C A;  4WQC A;  3VNW A;  3GG2 A;  2C1V A;  5DFS A;  1EZV D;  5KKZ B;  1DT1 A;  3OA8 A;  3WFD C;  3TDK A;  4GYD A;  3WUI A;  4L3H A;  4XXL A;  3CX5 D;  1MG3 D;  2JTI B;  3L72 D;  3H1I D;  1FI9 A;  1I8O A;  3MK7 B;  3C2C A;  2N9I A;  3A0H V;  1BGY D;  1CC5 A;  5AUR A;  1CTZ A;  5C0Z A;  1DIQ C;  2YIU B;  2Y0D A;  1BE3 D;  1PPJ D;  5TIS V;  3RMZ A;  1KYO W;  3VYM A;  2ZBO A;  3FWL A;  1H33 B;  3A9F A;  1IRV A;  2N18 B;  4UB8 V;  2KS1 A;  4Y5R A;  2FYU D;  1FHB A;  4O1W A;  1ZZH A;  3TYI A;  2GIW A;  1E2R A;  3H1L D;  4V2K A;  3CYT I;  2GC4 D;  1LFM A;  1FOC A;  2FRC A;  1IRW A;  1H1O A;  1S5L V;  4XYD B;  2A06 D;  3ORV A;  3CX5 W;  3O20 A;  3CXH W;  2C8S A;  3SWS A;  4FAV A;  2VHD A;  2B0Z B;  1RZ6 A;  4DY9 A;  5H2F V;  1NU1 D;  3CU4 A;  2CE1 A;  5CIC B;  2N18 C;  1RAQ A;  1QKS A;  1MZ4 A;  2QG4 A;  1C52 A;  1EB7 A;  1I54 A;  1C6S A;  1NTM D;  4WQ8 A;  3SXT A;  1IZL 0;  5DJQ B;  1HH7 A;  2C1D A;  1L9B C;  1HJ5 A;  4FA1 A;  4N0K A;  1L9J C;  1SQP D;  2EXV A;  5KAI V;  4WQ9 A;  2B4Z A;  1CIG A;  2AXT V;  3X39 A;  1CSU A;  1YEB A;  1LC2 A;  1K3H A;  1KB0 A;  3CWB D;  5C9M A;  2MTA C;  1YTC A;  1H32 A;  2PAC A;  1OCD A;  1AOQ A;  1LS9 A;  1GKS A;  5GTI V;  1WVE C;  1CRG A;  1L0L D;  1JDL A;  3L4O A;  2ZON G;  1DII C;  3ZOX A;  1C7M A;  4PWA A;  1BL9 A;  1CRJ A;  3OA8 B;  1ETP A;  1DW2 A;  1F1F A;  3WFB C;  2ZXY A;  4QAO A;  3H1H D;  4IL6 V;  4MU8 A;  2N9J A;  4JCG A;  351C A;  3RLM A;  4AX3 A;  4WQE A;  3ZOY A;  1C2N A;  4P4Q B;  1HRO A;  1AOF A;  3L71 D;  1CRC A;  1B7V A;  1FCD C;  2XTS B;  1CIE A;  2C1U A;  2BH5 X;  1M6Z A;  1CYC A;  1CXA A;  3SVW A;  5CIB B;  4WQ7 A;  3DP5 A;  1N50 A;  2AI5 A;  2RN0 A;  1WEJ F;  1COT A;  1S6V B;  4NFG B;  155C A;  1CO6 A;  2MHM A;  4EDF A;  3O5C A;  3JBT B;  4EID A;  1KX7 A;  3NWV A;  1H31 B;  1QL4 A;  5CYT R;  2N3B A;  3L75 D;  1M70 A;  4H0J A;  2RMZ A;  4A7P A;  2PCB B;  4J20 A;  2HV4 A;  3PXW A;  4YE1 A;  1COR A;  1E29 A;  1YCC A;  4AAL A;  3HQ7 A;  2K9J B;  2LIT A;  2YK3 A;  2CA4 B;  4L1Q A;  2Q3E A;  1LC1 A;  2BGV X;  1I8P A;  3O0R C;  4EIF A;  1H9X A;  3SJL A;  1YEA A;  3CP5 A;  3KZI V;  1CTY A;  3GW6 A;  1QN2 A;  1GIW A;  5E79 V;  5KLI B;  2V07 A;  4PD4 D;  3NBT A;  2B12 B;  2GC7 D;  1CRH A;  2CXB A;  2DVH A;  1C75 A;  1CSW A;  3WC8 A;  1NTZ D;  4EIE A;  4D6T D;  1CHH A;  4FA4 A;  2FWL A;  1SQQ D;  1OAE A;  3L73 D;  4FA5 A;  1VYD A;  2Y0C A;  3PRJ A;  1YIC A;  1M60 A;  3RN0 A;  1I6E A;  3TF5 A;  3OCD A;  2BPB B;  2C1D B;  1BCC D;  1HCM A;  2DGE A;  1NIR A;  1SQX D;  2PCC B;  1CHJ A;  3L70 D;  2KNC B;  3NBS A;  2QJK B;  1SQB D;  2C2C A;  3L74 D;  1YIQ A;  1A56 A;  3A0B V;  1P84 D;  5CID B;  1W2L A;  3ZOW A;  1RAP A;  1HJ4 A;  3ZIY A;  3HQ8 A;  1U74 B;  1CIF A;  5KLV D;  1CSX A;  3DR0 A;  3VMA A;  2BLF B;  2YQB A;  5DJQ C;  1CRI A;  1C6O A;  1MG2 D;  4AAM A;  2CE0 A;  5IY5 1;  5CIF B;  2YCC A;  1E8E A;  1A2S A;  2OZ1 B;  3M97 X;  2QJY B;  4WQD A;  1R0Q A;  1QYZ A;  1NMI A;  1KX2 A;  4AAN A;  2JQR A;  1DW0 A;  1IO3 A;  4H0K A;  451C A;  3L4M A;  3OCD B;  2ZOO A;  4FAN A;  1CSV A;  1CCH A;  4U3F D;  4K3I A;  3ZOO A;  4RSZ A;  1C2R A;  1CED A;  1IQC A;  1H9Y A;  2AIU A;  1GQ1 A;  1CNO A;  2BH4 X;  1H31 A;  1PP9 D;  1CYI A;  1GDV A;  3PXS A;  2Y0E A;  3TGU D;  3HQ6 A;  1KYO D;  1HZV A;  5B66 V;  2OZ1 A;  3O1Y A;  3PHL A;  3MK7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...