2A06D

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2a06D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2a06D02
4FANA 2N9IA 5EXQA 1CRGA 3HQ8A 4WQ7A 2BCCD 4PWAA 1K3GA 1I6DA 1HJ4A 1GJQA 4AANA 4DY9A 1KYOW 1IRVA 1N15A 2ZOOA 4FA1A 4WQ8A 2D0SA 5H2FV 1CYJA 3TGUD 2B11B 4UB6V 3O5CA 1CHIA 4V2KA 3HQ7A 3WFEC 4O1WA 1OCDA 1W2LA 2XTSB 1M6ZA 1U75B 2C1UA 5CYTR 2CE0A 1KB9D 5IY51 1H32A 1QKSA 1KYOD 5C0ZA 1A56A 1DIIC 1I5TA 1IO3A 2QJPB 1L9BC 4AALA 1H32B 2C8SA 2B4ZA 1C6OA 4UB8V 3PHLA 1F1FA 1U74B 4NFGB 4PW9B 4WQDA 5KAFV 1W5CT 3FWLA 1NNOA 4WQAA 3H1JD 1RZ6A 1H9YA 4XYDB 3MK7B 3DMIA 2EXVA 1PP9D 3H1LD 2L91A 4FA5A 1LFMA 1CCHA 3VNWA 3PLNA 1DW3A 2FYNB 4RJTA 1H31B 5CIEB 5DJQC 1E2RA 1M70A 2Y0DA 1HJ5A 1SQXD 3WU2V 3PTZA 2JWAA 1YEAA 1I8PA 3HQ6A 1LC1A 155CA 4U3FD 1PPJD 1YFCA 2ZONG 1NTKD 2DGEA 1E29A 2OZ1A 3L73D 2N18C 4KMGA 2BCNB 3C2CA 5DF5A 1AOQA 2CE1A 1NTMD 4H0KA 3X39A 1MG2D 1KX7A 1C6RA 2N9JA 1RZ5A 2AIUA 4FA4A 5KLIB 2V07A 2JQRA 2KS1A 2BPBB 1CEDA 4EICA 2O3JA 3L72D 4IL6V 2IBZD 3VYMA 3WC8A 1C6SA 3PXWA 1WVEC 2K9JB 5DFSA 2CA4B 5GTHV 3ZOWA 2FRCA 1SQBD 1CSWA 2PACA 2YK3A 1I55A 1CXAA 1FI7A 1GIWA 1GQ1A 1C2NA 1FHBA 2Y0CA 2GIWA 1CRCA 2JTIB 1J3SA 4L3GA 1CORA 3ITKA 1WEJF 1YTCA 1CIEA 1CTJA 1K3HA 1DVVA 1DIQC 4A7PA 1A8CA 1JDLA 2BH5X 3ZOXA 451CA 2N3YA 1DW0A 1BE3D 1CRHA 1FCDC 3CX5W 3SVWA 3A0HV 4FAVA 3CU4A 2GB8B 1EZVD 4K3IA 3A0BV 3L74D 1E8EA 1I8OA 1P84D 1A2SA 5AURA 2N9YB 3RLMA 3BCCD 3SLEA 1YCCA 1F1CA 1M60A 5E79V 1CRJA 1CIHA 3ZOYA 5GTIV 1FI9A 3DR0A 4EDFA 1QL3A 2RMZA 2C2CA 4Y5RA 2A06D 4GYDA 3WFBC 3O0RC 3CX5D 1HROA 1RAPA 3CYTI 4D6TD 3ORVA 3PXSA 2YQBA 1QYZA 1H31A 2YIUB 2QG4A 1DW2A 3KHUA 1SQQD 3KZIV 5DJQB 1LC2A 2YCCA 4FB1A 1KV9A 1R0QA 2C1DA 1NTZD 5KLVD 1IQCA 4J20A 1GKSA 2BH4X 4QAOA 1CIGA 3SXTA 1CYIA 1FJ0A 1CYCA 2KNCB 2ZXYA 1HZVA 1CIFA 2C1DB 1L0ND 2MHMA 3PXTA 1B7VA 2B0ZB 5CIFB 1BCCD 1YIQA 3CXHW 3H1ID 2N18B 3PH2B 3MK7C 1KIBA 1I6EA 1DVHA 1ETPA 3H1HD 1CRYA 1N90A 3WFDC 4XXLA 3WUIA 1CHJA 4JCGA 1BL9A 1MG3D 1C75A 2ORLA 2I8FA 3HQ9A 1C52A 2B12B 4Q5PA 2GC7D 3L75D 1RAQA 2QJKB 1CC5A 1AKKA 1GDVA 1NMLA 4L3HA 1IRWA 3ZCFA 2L4DA 2LITA 3RN0A 3CXHD 1FOCA 5TJHA 1OAEA 1HH7A 1C7MA 3CWBD 2BLFB 3O20A 2D0WA 4RSZA 2C1VA 1SQPD 1N50A 4H0JA 3SJLA 1C2RA 1YEBA 1CTYA 1DT1A 1BGYD 1NIRA 3RMZA 1FI3A 1LS9A 4WQCA 2RN0A 1HRCA 1H9XA 5CIHB 2B10B 4YE1A 1CSUA 5KKZB 1HCMA 5CIDB 1H33A 1LMSA 3WFCC 3CP5A 3ZOOA 1KB0A 3ZIYA 3H1KD 5CIBB 4GEDB 1CRIA 1H33B 3L71D 3OCDA 2Q3EA 2CXBA 1AYGA 2HV4A 5B66V 2CA3B 5CIGB 3TDKA 1QN2A 1CHHA 3TYIA 3OCDB 2VHDA 2V08A 1L9JC 3SWSA 5B5EV 2DVHA 5C9MA 1HZUA 3ZBMA 2FYUD 3OA8A 4O1QA 1NU1D 1KX2A 1L0LD 3NBTA 3L4OA 4PD4D 4WQBA 1IZL0 3TF5A 1QL4A 1EB7A 1SQVD 1NMIA 1CSVA 1DW1A 3NWVA 4PJ0V 1COTA 1ZZHA 1N9CA 1CSXA 3OA8B 1CNOA 1CXCA 2QJYB 3NBSA 3DP5A 4L1QA 4LJIA 1CCRA 3GG2A 4EIFA 1ZRTD 4N0KA 1YNRA 1H1OA 2N3BA 2Y0EA 1CTZA 3O1YA 4AAOA 4WQEA 1S6VB 2PCBB 2LIRA 1VYDA 4AAMA 2FWLA 1CO6A 2C9XB 2BGVX 2PCCB 3RN1A 1MZ4A 2ZZS1 3A9FA 4EIDA 4EIEA 3L70D 4FA9A 2ZBOA 3VRDA 4WQ9A 5TISV 4AX3A 4P4QB 1GU2A 5KAIV 5CICB 2AXTV 3PRJA 3GW6A 1HJ3A 3JBTB 1YICA 351CA 1AOFA 3M97X 2MTAC 2AI5A 2GC4D 1I54A 1S5LV 5B6QA 3VMAA 2OZ1B 3L4MA 4MU8A
chains in the Genus database with same CATH superfamily
4FANA 1FZFA 2E5TA 5APUA 3RK3C 1VF5D 2O01J 1GJQA 1SQXG 1LTAC 1L0LE 4PV1D 2OYIB 2FYZA 1YJWP 2ZAEB 3EQ2A 2QE7H 2IYOA 1JMMA 1EDKA 3Q5RA 1LT1A 4NPEA 3H1KJ 2P10A 3O5CA 3L73G 1CHIA 4V2KA 3HQ7A 1KILA 3PH0A 1VL2A 2UWJE 1M6ZA 1U75B 1S3JA 5TISE 2C1UA 5AW3B 5CYTR 2CE0A 1DIIC 1I5TA 3L72G 2JEEA 2QJPB 4M3LA 4AALA 3EWKA 1FZCB 3KXDA 3FWNA 3RK2C 4HKZH 1LNQA 1VQ7P 3VMZA 1W2BO 2VRSA 1NGMB 2KOGA 1RZ6A 3EFFK 3MK7B 1T2KD 1SQPK 3FXEA 2L91A 4FA5A 1IFNA 3VNWA 2WTYA 2GUVA 3GHGC 1DH3A 1MV8A 1LT9A 5AW1B 5DJQC 1EZVG 1BSNA 1M70A 3CD6P 1RE3C 2Y0DA 1HJ5A 1SQXD 3WU2V 3JC22 2JWAA 2E75B 5AVUB 1I8PA 1J2JB 3BATA 2M8RA 3HQ6A 155CA 1YFCA 1SFCD 1K04A 4AQRD 1E29A 3L73D 5GTIE 2N18C 3B5NB 3LW5H 2ZT9B 5BU8B 4IFMA 2CPSA 2GA1A 1YJNP 2PP6A 2CE1A 1Q82Q 3UIAA 4Y99C 3VOPA 2OYIA 4ZKUA 2AIUA 4O9BA 1LTJC 2KS1A 2BPBB 2FXOA 4H44D 3L72D 3AE6C 2BCCJ 1XTGB 3PXWA 5DJUB 1I55A 3QWOC 1L0NG 1GIWA 2K1AA 3E7KA 3CI9A 2NPSC 3AEBC 3CX5H 4IFFA 3H25A 4I1LA 1X9VA 2O01N 1SLQA 1K3HA 3VN0A 4R4LA 2OYHB 4A7PA 4L74A 2N3YA 1FCDC 3CX5W 3E1IA 3M9BA 3A0HV 1LTGC 2J5UA 1TU3F 2KLUA 3RL0D 3CU4A 1PZQA 1EZVD 2WPRA 1JTHA 1I8OA 1FZAA 5AVZB 4BRYB 3CWBG 2N9YB 3RLMA 3SLEA 5E79V 2QVAA 2W83C 1CIHA 5GTIV 3AE1C 3CCMP 2YNYA 4NPDA 4EDFA 5KAIH 1QL3A 2C2CA 3L73E 2LR2A 3CX5D 2BCCG 3H1JJ 3CYTI 3K5BA 3ORVA 1QYZA 1AQ5A 3H1LJ 1DW2A 3KHUA 2FY8A 4FB1A 3R4YA 3L72E 4OGQD 2QSIA 2K3RA 1JY3P 4N6JA 3F89A 1IQCA 3HRNA 3CXHH 4KT0J 4IFDK 1FJ0A 3BASA 1L0ND 1N73B 1RQUA 2B0ZB 2QEXP 3Q1MA 1YIQA 3CXHW 3PH2B 3M06A 1NTKJ 1P84I 1ETPA 4YXDC 1QLED 3RK3D 3CCUP 2Q9IA 4XFJA 1N90A 1GZLA 1RF0A 3GLMA 1BL9A 4H0LB 3CCLP 1NTMJ 2ORLA 3HQ9A 2B12B 2SPZA 2C9NY 1RAQA 1EZVE 3TYYA 1OW8A 1EXJA 3CXHD 2WITA 5AVYB 2WSFJ 1OAEA 3HD7C 3CWBD 2BLFB 1GL2B 4I6MC 3O20A 4R4MA 2C1VA 1N50A 1YEBA 1CTYA 1DT1A 3Q2YA 3O6QB 2YO3A 1ZOYC 1HTLC 5CBNA 2OTKE 1HRCA 2M3EA 1H9XA 4HYTB 1J1EB 1KC8Q 5KKZB 1HCMA 3RK2D 2KXPB 1FDIA 5APWA 2I1KA 3D70A 1LMSA 3AE3C 3WFCC 3L70G 4PV1B 2HPCB 1ZR4A 2IZ0A 1CSBA 2FKWB 3V6IA 1VF5C 1CW5A 1L0NE 1ZMEC 1GTWA 3TNUB 1N7SC 2FXMA 2E76B 3BRTB 4C7RA 1RHZB 1K73Q 3RK3E 5EFWB 2ZYDA 4HJGH 1GU5A 3TYIA 3OCDB 2XNDH 2VHDA 1RE4C 1SQQJ 2R3CA 1HZUA 3ZBMA 3GF3A 2FYUD 4RO0A 3OA8A 1KX2A 2R3SA 4EYYQ 1DIPA 2LXBA 1VQ8P 3CXHE 5CMZA 1N73A 3OA7A 3CWBE 3TGUG 2WSCH 2N1TB 1Z56A 2J59M 2QJYB 2I1JA 4I7ZC 1KMIZ 1JOCA 3WUVA 1OWAA 1N2DC 1LWUA 1KD1Q 1ZRTD 1YNRA 1BCCJ 3H1IJ 1NAYA 1AVOA 1H1OA 1CTZA 2H88C 2A45G 2YKPA 5CJ0A 1S6VB 2C0XA 2LIRA 2Q7CA 1AVYA 1T2KC 5CHXA 3RN1A 2NPSD 4EIDA 3L74E 5AVWB 3L70D 1PGPA 1PIXA 1GU2A 5KAIV 2Q3IA 1KQLA 2IFNA 3PRJA 4XE5B 1HJ3A 1PP9G 1KB9H 2FFDC 2MTAC 1SQPJ 3CLQA 1KYOH 1LP1A 3VMAA 3MD0A 2NRGA 1BGYJ 3IF4A 1G1IA 2A45H 2RKLA 1L4AA 2N9IA 5KJ7C 1JY2O 2FYUE 2BEZF 5L8RJ 2HPCA 4AANA 4DY9A 1KYOW 1IRVA 1Y47A 3Q3DA 1NTZE 5KLVE 2ZOOA 3SWYA 4H13B 1JUNA 1BCCG 3TNUA 3H1IG 1AQTA 1T8ZA 1JY3N 3WU2H 3JCUH 3TGUD 2P2UA 4H44C 1ZRTE 4O1WA 1NOHA 3V2QA 2ZYGA 4HH2A 1KB9D 1OVRA 3MUDC 1Q7YQ 1H32A 1KYOD 2ITAA 1NTKK 2WPVB 2M5AA 1KILB 1A56A 3WUUA 2R5BA 5CBOA 1L9BC 4WVZA 2C8SA 2B4ZA 1NTMK 1H0TA 1SQBG 1OVVA 1IK9A 1SQVJ 1SQPG 3L70E 3PHLA 3RL0g 1U74B 4NFGB 4QMAA 3RL0C 2D2CB 2W90A 3FWLA 1Y9BA 1SVFA 2GM4A 2XKMA 4LGDE 3DMIA 2HR3A 1PP9D 2WSSH 1LFMA 3SFDC 3PLNA 1DW3A 3V4WA 4RJTA 1M1JC 1H31B 2R32A 2B87B 3HD7D 4RESB 3HUSC 2N9BA 3A0HH 3II6A 5AVVB 1MFTA 1LT9B 3T97A 3TGUE 3D6ZA 1LC1A 1N7LA 1NYHA 1PPJD 1HGVA 2A06G 1SFCA 3AEDC 2DGEA 3L71E 1YITP 1ZR2A 4KMGA 2BCNB 5E79H 1KB9E 5DF5A 1AOQA 2FXPA 1A02F 1KYOE 1FZBA 2KP8A 1S9KD 1VPCA 2P58A 1EDJA 2V07A 5B5EH 2IBZD 2OGUA 1C6SA 1WVEC 2QJKC 3D71A 2PAJA 5DFSA 1NU1E 2CA4B 1SQQK 1N7SD 1OX3A 3ZOWA 1SQBD 2PACA 3B8EB 1OZHA 2KS1B 1WRGA 1FHBA 1USEA 2Y0CA 1URQC 3OJAB 3WU2E 3JCUE 3GMAA 4YPCA 1WEJF 2JWDA 1PP9E 1ZXGA 1S1CX 1CTJA 3E1RA 4IOIH 2HODA 1JDLA 2BEQD 1CRHA 2Q6QA 3L75G 2OYOA 1GW4A 3RBXA 3RK2B 1YCCA 1F1CA 1PPJE 1K8AQ 1VQMP 1Q2NA 3CXHI 1JTHB 2RMZA 3VYIA 2AXTH 2A06D 4GYDA 3O0RC 2WZ7A 3U1AA 4BWNA 5AVSB 1S9KE 1H31A 2YIUB 2QG4A 3I55P 3SSUA 4GOFA 2B87A 1NKNA 3KZIV 4Z1MH 5DJQB 1LC2A 1KV9A 1N8RQ 1R0QA 2IBZE 1FZCC 1Y8AA 1KTMA 4LC1A 4J20A 4QAOA 1WT6A 3SXTA 1SQBE 3H1KG 3C9IA 3A0HE 1X79B 1DD3A 1GK4A 3M0DC 1FBMA 3PXTA 2ZVOB 2PRRA 1B7VA 3VMYA 2IDBA 1RF1A 3D6YA 2N18B 4U3FJ 3V2RA 3MK7C 2POHA 3P8CD 4UB6H 1KIBA 3CCRP 1I6EA 1JMBA 5KJ7D 1YHQP 1DVHA 1JY2P 5E79E 1T3JA 2O01H 3WUIA 4EI2A 1LTJB 1M7LA 1MZ9A 5CCGD 1MG3D 1W2EA 1VQPP 1N86A 2GC7D 3BRVB 1E5WA 5B5EE 3L75D 1CC5A 2V7QJ 2E75C 3U1CA 3R2PA 2L4DA 2LITA 3RN0A 2JR8A 1FOCA 2LKMA 2O1JA 2P67A 4UB8H 3IAOA 2GUSA 2DW3A 5KAFH 1SQVK 4RSZA 4K35A 3B5NC 2A06E 2ZT9C 4MN4C 1YI2P 5APYA 1EQ7A 3CCSP 1FI3A 1HUCA 3A5TA 4WQCA 1OVUA 2RN0A 2KZJA 2OARA 4PD4H 1BE3J 2PGDA 1KQSO 2WPQA 3AEFC 4WY4C 4TT3H 1H33A 2W6BA 3CP5A 2Z5IA 1SQXE 3A2AA 3H1KD 1PV3A 1UIXA 1QVFO 1CRIA 3BCCJ 2ZJSE 2J58A 3P8CE 2Q3EA 3HTKB 2CA3B 3GHGA 2H8PD 4D6TJ 1RE3A 3SWSA 5B5EV 4GDOA 3CMEP 2WPSA 2MKVA 2W27A 1ZN5A 3L75E 1J1DB 2E74B 1ZW0A 4PD4D 3L4OA 5AVRB 1QL4A 4ZNCA 2H43A 4IL6H 1EB7A 1U57A 1LTIC 1MFZA 1CSVA 1YIJP 1MUUA 3NWVA 5GTHH 3VP9A 1COTA 1ZZHA 1N9CA 3OA8B 1IO4A 3DP5A 3L37A 3GG2A 1VQ4P 4UB6E 1LTJA 3O1YA 2K37A 1WMKA 1YQ4C 3H1HJ 1K05A 4I2LC 4WQEA 1LWUB 1KB9I 2ZVNB 5AW2B 1VYDA 3P8MC 1KYOI 3BCCG 2C9XB 3PJSK 2BGVX 3A3YB 1URQD 1MZ4A 2A45I 1CI6A 1GD2E 1IFMA 1FC2C 2NPSA 2XZRA 3H1KE 1KQFB 2ZBOA 2WQYC 1HH0A 4AX3A 4P4QB 1AFOA 1AV1A 4UB8E 3H1JG 2AXTV 5KAFE 4WB4A 3P7KA 3JBTB 1YICA 3H1LG 1AOFA 2AI5A 2GC4D 1S5LV 1EDIA 1R5SA 3CX5E 1HF9A 3L35A 4MU8A 1QEXA 2QM7A 3FGAD 2K9YA 3HQ8A 2BCCD 1H89A 1I6DA 1HJ4A 2JDIH 1LP1B 3PP5A 2ZYAA 1N15A 1L4AB 4OH8B 4FA1A 3G4SP 3CMAP 4WQ8A 1VF5B 1Q86Q 5APVA 1GL2C 2D0SA 5H2FV 1NTKG 2IFMA 1VQ5P 1EXIA 2HLOA 3HTKA 4UB6V 1SS1A 3L71J 3SFEC 1OCDA 1W2LA 2CPBA 2XTSB 1QX8A 3KQGA 1NTMG 5KAIE 1ZLLA 5IY51 1QKSA 2JO1A 3M91A 5C0ZA 4DZOA 1J1EC 5KKZC 4YXWH 1JY2N 1IO3A 5CCHC 2KB7P 1H32B 4JBZA 1C6OA 2M5AB 1L0LJ 4UB8V 2IBZI 4WQDA 1BDDA 5KAFV 2R5DA 1H0TB 4OWFA 3W68A 2NZ2A 1NNOA 2WSEJ 5APQA 3H1JD 2EXVA 3H1LD 1M56D 2QM8A 4GT1A 2E5YA 1CCHA 1JO5A 2BCCE 2E75D 2FYNB 2FBWC 3MIWA 5CIEB 4EOTA 2WSFH 1IK7A 3D0WA 1KZUB 3HD7A 3M9HA 3PTZA 4HB1A 1NJIQ 3B5ND 2N1TC 2P7JA 2ZT9D 5BVZA 2QJYC 1NWQA 2ZONG 1NTKD 2FFDB 2W6AA 3T97B 4DJGA 3AEAC 3OAKA 5B66H 2L5GB 1SQQG 1H8AA 3L4FA 1NTMD 3VTPC 5AW5B 1SFCB 4WY4D 1C6RA 1RZ5A 4FA4A 5KLIB 2JQRA 2V4HA 2O3JA 1ZV8A 3SWKA 4IL6V 3GF7A 3WC8A 1P84H 3KZIH 2WWWA 4W7ZA 5GTHV 2FYUK 1N7SA 2FRCA 1CSWA 3H32A 5CCGC 1PFIA 1CXAA 2Z4EA 1GQ1A 2KIKA 4H44B 1NO4A 1CRCA 1NTZK 5KLVK 2JTIB 3RBZA 3H1JE 3AECC 1CORA 2YKOA 1RE4A 3H1LE 3L36A 2B89A 3CC2P 3MHVA 1VQKP 2Z5HA 451CA 3CCQP 1FAVA 2JP3A 4FAVA 2HODB 3CCJP 2OTLP 2C9LY 4H13C 1E8EA 1X22A 1P84D 4DCKA 1A2SA 5AURA 3RL0B 1FZGA 5AW0B 4EIJA 1OFCX 3ZOYA 5TISH 3DR0A 3U59A 4XA4A 4Y5RA 4ASWA 1BGYG 4L76A 1EC5A 4W80A 3WFBC 1QGKB 1HGZA 1NTME 2YQBA 1KILC 1SQQD 2YCCA 2KNCA 1FOSF 2C1DA 3HUSB 1FE6A 1CIGA 2YXQB 4JYCA 2E42A 3I56P 2E43A 1CYCA 1HZVA 2BASA 4GKGA 1CIFA 4OGQB 4WWIA 2FFDA 2MHMA 2M0BA 3M0AA 5CIFB 1EZVI 1BCCD 1PGJA 3H1ID 3WUTA 1R5LA 5APSA 1IFIA 1JM0A 5KJ7A 2YXRB 3C1LA 3L73J 5M1BA 4XXLA 5B66E 1IFJA 3TSIA 2Y9ZA 1RF1B 1CHJA 4JCGA 3IR9A 3AEGC 1JCDA 1C75A 1VDFA 1C52A 3RK3B 3CX5I 1SQVG 2QJKB 1GL2D 1GU4A 3S1KA 1NMLA 3L72J 1P84E 3ZCFA 1LT9C 3KZIE 3IN6A 1C7MA 2KSJA 1NU1K 1L0LK 2D0WA 1SQPD 4H0JA 3MUDA 3SJLA 1C2RA 2ZXXA 4U7JA 1BGYD 2G8YA 1NIRA 5CCHD 1Q81Q 2IZ1A 3RMZA 1LS9A 1SQQE 3LW5J 3P32A 4C7NA 3CCVP 3C8VA 5AVTB 2B10B 4JF7A 1E79H 1OW6A 3Q5SA 5CIDB 2OYIC 4TLFA 1NH4A 2E76D 2W8ZA 3ZOOA 2IYPA 1KB0A 4KJMA 1CZQA 2KSEA 3N7NA 5CIBB 3CC4P 4GEDB 1H33B 1LJ2A 4GODA 1BCCE 3H1IE 1YJ9P 2CXBA 5B66V 2IPPA 5CIGB 3TDKA 1DEBA 2H89C 1M1JA 1CHHA 4C46A 1M90Q 1L9JC 2DVHA 3HUSA 5C9MA 1S5LH 3GHGB 2LXCB 2N1TD 1Q90D 5BU5A 2QJPC 3AE7C 4WQBA 3TF5A 3NTNA 1SQVD 3AEEC 1NMIA 1NHLA 1DW1A 1FOSE 1RQVA 2XDJA 1NAFA 2AEMA 4PJ0V 3JSVC 1CSXA 2XNXA 1MKMA 1CNOA 1SQBK 2W6JH 1KFMA 1SQPE 4JYBA 4L75A 2RH0A 4LJIA 1L0NJ 1L2PA 1BGYE 5H2FH 1IFPA 2YIUC 3TK1A 2N3BA 4JQ0D 1FZEA 5DJTB 3EFGA 1U7MA 4Y99B 1FS0E 4AAMA 1S4XA 2PCCB 1URQA 2ZZS1 3MGNA 5AVQB 2G3AA 3A0BH 1GMJA 4EIEA 4WQ9A 5TISV 1X8YA 2MJZA 1CI6B 3CWBJ 1JB0J 2NPSB 3GW6A 4Y28J 3M97X 1IFDA 1JCCA 2OZ1B 1NKZB 3G6EP 2Q1KA 4YE1A 5EXQA 4H13D 1CRGA 4WQ7A 4PWAA 1K3GA 2I8DA 4L73A 4WY4B 1G1JA 1RF0C 5CJ4A 1BSHA 1SQVE 2HYNA 1D7MA 4AYCA 3S9OA 2QRXA 2WT7B 4U3FG 1W5CE 3BVHA 1CYJA 2B11B 3L74J 1SQXK 4DT0A 3MP7B 1KILD 1DEEG 1KORA 3WFEC 1ZP0C 2KLVA 3G9RA 3LIDA 3V2PA 1LTTC 1VQOP 2AXTE 1YQ3C 1VQ9P 2OYHC 1FZCA 4ZKPA 3A7OA 1DX7A 3SWFA 1HJBA 1S5LE 3USSA 2D2CD 2O1KA 2FYUJ 3M0DA 5APXA 1FU1A 1KQGB 4BXLA 2C0WA 1F1FA 1QL2A 3W67A 4PW9B 2YKQA 1NTZJ 5KLVJ 2KYVA 1W5CT 4ASVA 3F5HA 3QH9A 2IX7C 4WQAA 1VQLP 4LLHA 1BDCA 1H9YA 4XYDB 4KHXA 5H2FE 1H88A 1BE3G 3I5CA 2PFXA 1KN7A 2V7QH 3FX0A 2OQQA 1J1DC 2E74C 3L74G 1E2RA 1YTZT 1QL1A 1IC2A 2KUBA 2AEFA 1X0TA 1YEAA 3A0BE 3B5NA 1LGHB 2QA4P 3HE4B 4U3FD 3L70J 3HD7B 2ZFCA 1KILE 1N73C 3HE5B 2ZXEB 4W7YA 2WSCJ 1PGQA 2OZ1A 3V5BA 4D6TG 2YMKA 1IZNB 3C2CA 1S2EA 2FYUG 2H7HA 4H0KA 1LWUC 3CL3D 4WY4A 3X39A 1MG2D 1KX7A 2N9JA 1G2CB 2KZIA 4H0LC 1NTZG 3AE2C 5KLVG 1CEDA 4EICA 5K5GB 1FDMA 3VYMA 3CCEP 3MTUE 2OTJP 1PGOA 2K9JB 2WT7A 3KYQA 4PD4E 1NVOA 1T3UA 2YK3A 4GIFA 1RH5B 1FI7A 1GK6A 1LTSC 1C2NA 1OW7A 4WBAA 2GIWA 3NFQA 3B4SA 4K3AA 2OYHA 1J3SA 1JNMA 3TGUJ 2YO2A 1N7SB 4L3GA 3H1HG 3H32B 3ITKA 1YTCA 1S5LX 1CIEA 1S72P 1DVVA 3O8ZA 1DIQC 1L0NK 1A8CA 2BH5X 5AW7B 3ZOXA 1DW0A 1BE3D 4OVNF 3H6PA 2CK3H 3ABVC 3SVWA 4BRYA 1L4AC 3CPWO 1HJ0A 2GB8B 4K3IA 3A0BV 3L74D 1QVGO 1KFNA 5AW9B 4GOEA 1AA0A 4PV1C 3VMXA 1IJDB 3BCCD 1NU1J 2Q5UA 4IL6E 4U3FE 1M60A 1CRJA 1FI9A 2YMYA 1JEKA 1OIPA 3FXDA 5GTHE 1HWTC 4I7ZB 3IFMA 2E76C 1HROA 2HFED 1RAPA 4D6TD 3PXSA 1PP9J 2QIWA 5C39A 1NTZD 5KLVD 4N3YB 1GKSA 2BH4X 1RY3A 1CYIA 3HE4A 2KNCB 2ZXYA 1YBKA 5APTA 4CPGA 1VQNP 1SP4A 1UIIA 2WMMA 3HE5A 3L71G 2WVRA 1U7JA 2C1DB 1LTBC 4NPFX 1HVVA 3AE8C 2HG5D 5AW6B 3H1HD 4AUWA 1CRYA 1G2CA 3WFDC 2R44A 1VQ6P 3OW2O 1BE3E 2FYNC 3LIEA 1USDA 2AEJA 3ZDMA 5KTBA 5AW8B 2I8FA 1NU1G 2K9JA 1L0LG 3S4RA 4Q5PA 1AKKA 1GL2A 1GDVA 1M8OB 1AJYA 1FJPA 4L3HA 1IRWA 5TJHA 3BCCE 1HH7A 3O6QA 2AXCA 1SQBJ 3RGUA 3KPEA 4N78D 4PJ0H 3CC7P 3Q5PA 1HBWA 2B9BA 4D6TE 1SFCC 5CCHA 3G71P 5KLIC 1KV4A 4IL6X 5CIHB 1CSUA 3AE4C 1FJKA 4B86A 2XU6A 2K88A 1PPJG 1A02J 2P1JA 4C7NB 3WMM0 1K9MQ 3V2NA 3ZIYA 2WSEH 1YTZI 4DOJA 3L71D 2B88A 3OCDA 4RKUJ 4YTPC 1R8EA 1AYGA 1NTKE 3NMDA 2HV4A 4JPZB 3H1HE 2E74D 1QN2A 1FDOA 2IBZG 2V08A 1M1JB 4O1QA 1NU1D 2N1TA 1L0LD 3NBTA 4ZMDA 2XV5A 1YYCA 1IZL0 3M9QA 3B71A 5AW4B 5AVXB 1M1KQ 3AE5C 1T6AA 1SQXJ 3N4XA 1EDLA 2KI7B 1CXCA 4L1QA 3NBSA 4N78E 2D2CC 1CCRA 4EIFA 1PL5A 4N0KA 3AE9C 3KDPB 4H0LD 2Y0EA 2KK7A 2M3BA 1GDTA 3NXSA 1GW3A 4AAOA 2PCBB 1M57D 3MZWB 1OXZA 1OMIA 5CCGA 2FWLA 1CO6A 2JJLA 3L75J 3A9FA 2JKVA 1DD4A 4OGQC 1JY3O 4FA9A 3VRDA 5CICB 1URQB 4PD4I 5GTIH 351CA 4PJ0E 2Y9YA 3VP8A 1I54A 3G3ZA 5B6QA 1RF1C 3L4MA 1XTCC 1L4AD 3V4QA
chains in the Genus database with same CATH topology
4FANA 2N9IA 5EXQA 1CRGA 3HQ8A 4WQ7A 2BCCD 4PWAA 1K3GA 1I6DA 1HJ4A 1GJQA 4AANA 4DY9A 1KYOW 1IRVA 1N15A 2ZOOA 4FA1A 4WQ8A 2D0SA 5H2FV 1CYJA 3TGUD 2B11B 4UB6V 3O5CA 1CHIA 4V2KA 3HQ7A 3WFEC 4O1WA 1OCDA 1W2LA 2XTSB 1M6ZA 1U75B 2C1UA 5CYTR 2CE0A 1KB9D 5IY51 1H32A 1QKSA 1KYOD 5C0ZA 1A56A 1DIIC 1I5TA 1IO3A 2QJPB 1L9BC 4AALA 1H32B 2C8SA 2B4ZA 1C6OA 4UB8V 3PHLA 1F1FA 1U74B 4NFGB 4PW9B 4WQDA 5KAFV 1W5CT 3FWLA 1NNOA 4WQAA 3H1JD 1RZ6A 1H9YA 4XYDB 3MK7B 3DMIA 2EXVA 1PP9D 3H1LD 2L91A 4FA5A 1LFMA 1CCHA 3VNWA 3PLNA 1DW3A 2FYNB 4RJTA 1H31B 5CIEB 5DJQC 1E2RA 1M70A 2Y0DA 1HJ5A 1SQXD 3WU2V 3PTZA 2JWAA 1YEAA 1I8PA 3HQ6A 1LC1A 155CA 4U3FD 1PPJD 1YFCA 2ZONG 1NTKD 2DGEA 1E29A 2OZ1A 3L73D 2N18C 4KMGA 2BCNB 3C2CA 5DF5A 1AOQA 2CE1A 1NTMD 4H0KA 3X39A 1MG2D 1KX7A 1C6RA 2N9JA 1RZ5A 2AIUA 4FA4A 5KLIB 2V07A 2JQRA 2KS1A 2BPBB 1CEDA 4EICA 2O3JA 3L72D 4IL6V 2IBZD 3VYMA 3WC8A 1C6SA 3PXWA 1WVEC 2K9JB 5DFSA 2CA4B 5GTHV 3ZOWA 2FRCA 1SQBD 1CSWA 2PACA 2YK3A 1I55A 1CXAA 1FI7A 1GIWA 1GQ1A 1C2NA 1FHBA 2Y0CA 2GIWA 1CRCA 2JTIB 1J3SA 4L3GA 1CORA 3ITKA 1WEJF 1YTCA 1CIEA 1CTJA 1K3HA 1DVVA 1DIQC 4A7PA 1A8CA 1JDLA 2BH5X 3ZOXA 451CA 2N3YA 1DW0A 1BE3D 1CRHA 1FCDC 3CX5W 3SVWA 3A0HV 4FAVA 3CU4A 2GB8B 1EZVD 4K3IA 3A0BV 3L74D 1E8EA 1I8OA 1P84D 1A2SA 5AURA 2N9YB 3RLMA 3BCCD 3SLEA 1YCCA 1F1CA 1M60A 5E79V 1CRJA 1CIHA 3ZOYA 5GTIV 1FI9A 3DR0A 4EDFA 1QL3A 2RMZA 2C2CA 4Y5RA 2A06D 4GYDA 3WFBC 3O0RC 3CX5D 1HROA 1RAPA 3CYTI 4D6TD 3ORVA 3PXSA 2YQBA 1QYZA 1H31A 2YIUB 2QG4A 1DW2A 3KHUA 1SQQD 3KZIV 5DJQB 1LC2A 2YCCA 4FB1A 1KV9A 1R0QA 2C1DA 1NTZD 5KLVD 1IQCA 4J20A 1GKSA 2BH4X 4QAOA 1CIGA 3SXTA 1CYIA 1FJ0A 1CYCA 2KNCB 2ZXYA 1HZVA 1CIFA 2C1DB 1L0ND 2MHMA 3PXTA 1B7VA 2B0ZB 5CIFB 1BCCD 1YIQA 3CXHW 3H1ID 2N18B 3PH2B 3MK7C 1KIBA 1I6EA 1DVHA 1ETPA 3H1HD 1CRYA 1N90A 3WFDC 4XXLA 3WUIA 1CHJA 4JCGA 1BL9A 1MG3D 1C75A 2ORLA 2I8FA 3HQ9A 1C52A 2B12B 4Q5PA 2GC7D 3L75D 1RAQA 2QJKB 1CC5A 1AKKA 1GDVA 1NMLA 4L3HA 1IRWA 3ZCFA 2L4DA 2LITA 3RN0A 3CXHD 1FOCA 5TJHA 1OAEA 1HH7A 1C7MA 3CWBD 2BLFB 3O20A 2D0WA 4RSZA 2C1VA 1SQPD 1N50A 4H0JA 3SJLA 1C2RA 1YEBA 1CTYA 1DT1A 1BGYD 1NIRA 3RMZA 1FI3A 1LS9A 4WQCA 2RN0A 1HRCA 1H9XA 5CIHB 2B10B 4YE1A 1CSUA 5KKZB 1HCMA 5CIDB 1H33A 1LMSA 3WFCC 3CP5A 3ZOOA 1KB0A 3ZIYA 3H1KD 5CIBB 4GEDB 1CRIA 1H33B 3L71D 3OCDA 2Q3EA 2CXBA 1AYGA 2HV4A 5B66V 2CA3B 5CIGB 3TDKA 1QN2A 1CHHA 3TYIA 3OCDB 2VHDA 2V08A 1L9JC 3SWSA 5B5EV 2DVHA 5C9MA 1HZUA 3ZBMA 2FYUD 3OA8A 4O1QA 1NU1D 1KX2A 1L0LD 3NBTA 3L4OA 4PD4D 4WQBA 1IZL0 3TF5A 1QL4A 1EB7A 1SQVD 1NMIA 1CSVA 1DW1A 3NWVA 4PJ0V 1COTA 1ZZHA 1N9CA 1CSXA 3OA8B 1CNOA 1CXCA 2QJYB 3NBSA 3DP5A 4L1QA 4LJIA 1CCRA 3GG2A 4EIFA 1ZRTD 4N0KA 1YNRA 1H1OA 2N3BA 2Y0EA 1CTZA 3O1YA 4AAOA 4WQEA 1S6VB 2PCBB 2LIRA 1VYDA 4AAMA 2FWLA 1CO6A 2C9XB 2BGVX 2PCCB 3RN1A 1MZ4A 2ZZS1 3A9FA 4EIDA 4EIEA 3L70D 4FA9A 2ZBOA 3VRDA 4WQ9A 5TISV 4AX3A 4P4QB 1GU2A 5KAIV 5CICB 2AXTV 3PRJA 3GW6A 1HJ3A 3JBTB 1YICA 351CA 1AOFA 3M97X 2MTAC 2AI5A 2GC4D 1I54A 1S5LV 5B6QA 3VMAA 2OZ1B 3L4MA 4MU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAN A;  2N9I A;  5EXQ A;  1CRG A;  3HQ8 A;  4WQ7 A;  2BCC D;  4PWA A;  1K3G A;  1I6D A;  1HJ4 A;  1GJQ A;  4AAN A;  4DY9 A;  1KYO W;  1IRV A;  1N15 A;  2ZOO A;  4FA1 A;  4WQ8 A;  2D0S A;  5H2F V;  1CYJ A;  3TGU D;  2B11 B;  4UB6 V;  3O5C A;  1CHI A;  4V2K A;  3HQ7 A;  3WFE C;  4O1W A;  1OCD A;  1W2L A;  2XTS B;  1M6Z A;  1U75 B;  2C1U A;  5CYT R;  2CE0 A;  1KB9 D;  5IY5 1;  1H32 A;  1QKS A;  1KYO D;  5C0Z A;  1A56 A;  1DII C;  1I5T A;  1IO3 A;  2QJP B;  1L9B C;  4AAL A;  1H32 B;  2C8S A;  2B4Z A;  1C6O A;  4UB8 V;  3PHL A;  1F1F A;  1U74 B;  4NFG B;  4PW9 B;  4WQD A;  5KAF V;  1W5C T;  3FWL A;  1NNO A;  4WQA A;  3H1J D;  1RZ6 A;  1H9Y A;  4XYD B;  3MK7 B;  3DMI A;  2EXV A;  1PP9 D;  3H1L D;  2L91 A;  4FA5 A;  1LFM A;  1CCH A;  3VNW A;  3PLN A;  1DW3 A;  2FYN B;  4RJT A;  1H31 B;  5CIE B;  5DJQ C;  1E2R A;  1M70 A;  2Y0D A;  1HJ5 A;  1SQX D;  3WU2 V;  3PTZ A;  2JWA A;  1YEA A;  1I8P A;  3HQ6 A;  1LC1 A;  155C A;  4U3F D;  1PPJ D;  1YFC A;  2ZON G;  1NTK D;  2DGE A;  1E29 A;  2OZ1 A;  3L73 D;  2N18 C;  4KMG A;  2BCN B;  3C2C A;  5DF5 A;  1AOQ A;  2CE1 A;  1NTM D;  4H0K A;  3X39 A;  1MG2 D;  1KX7 A;  1C6R A;  2N9J A;  1RZ5 A;  2AIU A;  4FA4 A;  5KLI B;  2V07 A;  2JQR A;  2KS1 A;  2BPB B;  1CED A;  4EIC A;  2O3J A;  3L72 D;  4IL6 V;  2IBZ D;  3VYM A;  3WC8 A;  1C6S A;  3PXW A;  1WVE C;  2K9J B;  5DFS A;  2CA4 B;  5GTH V;  3ZOW A;  2FRC A;  1SQB D;  1CSW A;  2PAC A;  2YK3 A;  1I55 A;  1CXA A;  1FI7 A;  1GIW A;  1GQ1 A;  1C2N A;  1FHB A;  2Y0C A;  2GIW A;  1CRC A;  2JTI B;  1J3S A;  4L3G A;  1COR A;  3ITK A;  1WEJ F;  1YTC A;  1CIE A;  1CTJ A;  1K3H A;  1DVV A;  1DIQ C;  4A7P A;  1A8C A;  1JDL A;  2BH5 X;  3ZOX A;  451C A;  2N3Y A;  1DW0 A;  1BE3 D;  1CRH A;  1FCD C;  3CX5 W;  3SVW A;  3A0H V;  4FAV A;  3CU4 A;  2GB8 B;  1EZV D;  4K3I A;  3A0B V;  3L74 D;  1E8E A;  1I8O A;  1P84 D;  1A2S A;  5AUR A;  2N9Y B;  3RLM A;  3BCC D;  3SLE A;  1YCC A;  1F1C A;  1M60 A;  5E79 V;  1CRJ A;  1CIH A;  3ZOY A;  5GTI V;  1FI9 A;  3DR0 A;  4EDF A;  1QL3 A;  2RMZ A;  2C2C A;  4Y5R A;  2A06 D;  4GYD A;  3WFB C;  3O0R C;  3CX5 D;  1HRO A;  1RAP A;  3CYT I;  4D6T D;  3ORV A;  3PXS A;  2YQB A;  1QYZ A;  1H31 A;  2YIU B;  2QG4 A;  1DW2 A;  3KHU A;  1SQQ D;  3KZI V;  5DJQ B;  1LC2 A;  2YCC A;  4FB1 A;  1KV9 A;  1R0Q A;  2C1D A;  1NTZ D;  5KLV D;  1IQC A;  4J20 A;  1GKS A;  2BH4 X;  4QAO A;  1CIG A;  3SXT A;  1CYI A;  1FJ0 A;  1CYC A;  2KNC B;  2ZXY A;  1HZV A;  1CIF A;  2C1D B;  1L0N D;  2MHM A;  3PXT A;  1B7V A;  2B0Z B;  5CIF B;  1BCC D;  1YIQ A;  3CXH W;  3H1I D;  2N18 B;  3PH2 B;  3MK7 C;  1KIB A;  1I6E A;  1DVH A;  1ETP A;  3H1H D;  1CRY A;  1N90 A;  3WFD C;  4XXL A;  3WUI A;  1CHJ A;  4JCG A;  1BL9 A;  1MG3 D;  1C75 A;  2ORL A;  2I8F A;  3HQ9 A;  1C52 A;  2B12 B;  4Q5P A;  2GC7 D;  3L75 D;  1RAQ A;  2QJK B;  1CC5 A;  1AKK A;  1GDV A;  1NML A;  4L3H A;  1IRW A;  3ZCF A;  2L4D A;  2LIT A;  3RN0 A;  3CXH D;  1FOC A;  5TJH A;  1OAE A;  1HH7 A;  1C7M A;  3CWB D;  2BLF B;  3O20 A;  2D0W A;  4RSZ A;  2C1V A;  1SQP D;  1N50 A;  4H0J A;  3SJL A;  1C2R A;  1YEB A;  1CTY A;  1DT1 A;  1BGY D;  1NIR A;  3RMZ A;  1FI3 A;  1LS9 A;  4WQC A;  2RN0 A;  1HRC A;  1H9X A;  5CIH B;  2B10 B;  4YE1 A;  1CSU A;  5KKZ B;  1HCM A;  5CID B;  1H33 A;  1LMS A;  3WFC C;  3CP5 A;  3ZOO A;  1KB0 A;  3ZIY A;  3H1K D;  5CIB B;  4GED B;  1CRI A;  1H33 B;  3L71 D;  3OCD A;  2Q3E A;  2CXB A;  1AYG A;  2HV4 A;  5B66 V;  2CA3 B;  5CIG B;  3TDK A;  1QN2 A;  1CHH A;  3TYI A;  3OCD B;  2VHD A;  2V08 A;  1L9J C;  3SWS A;  5B5E V;  2DVH A;  5C9M A;  1HZU A;  3ZBM A;  2FYU D;  3OA8 A;  4O1Q A;  1NU1 D;  1KX2 A;  1L0L D;  3NBT A;  3L4O A;  4PD4 D;  4WQB A;  1IZL 0;  3TF5 A;  1QL4 A;  1EB7 A;  1SQV D;  1NMI A;  1CSV A;  1DW1 A;  3NWV A;  4PJ0 V;  1COT A;  1ZZH A;  1N9C A;  1CSX A;  3OA8 B;  1CNO A;  1CXC A;  2QJY B;  3NBS A;  3DP5 A;  4L1Q A;  4LJI A;  1CCR A;  3GG2 A;  4EIF A;  1ZRT D;  4N0K A;  1YNR A;  1H1O A;  2N3B A;  2Y0E A;  1CTZ A;  3O1Y A;  4AAO A;  4WQE A;  1S6V B;  2PCB B;  2LIR A;  1VYD A;  4AAM A;  2FWL A;  1CO6 A;  2C9X B;  2BGV X;  2PCC B;  3RN1 A;  1MZ4 A;  2ZZS 1;  3A9F A;  4EID A;  4EIE A;  3L70 D;  4FA9 A;  2ZBO A;  3VRD A;  4WQ9 A;  5TIS V;  4AX3 A;  4P4Q B;  1GU2 A;  5KAI V;  5CIC B;  2AXT V;  3PRJ A;  3GW6 A;  1HJ3 A;  3JBT B;  1YIC A;  351C A;  1AOF A;  3M97 X;  2MTA C;  2AI5 A;  2GC4 D;  1I54 A;  1S5L V;  5B6Q A;  3VMA A;  2OZ1 B;  3L4M A;  4MU8 A; 
#chains in the Genus database with same CATH topology
 4FAN A;  1FZF A;  2E5T A;  5APU A;  3RK3 C;  1VF5 D;  2O01 J;  1GJQ A;  1SQX G;  1LTA C;  1L0L E;  4PV1 D;  2OYI B;  2FYZ A;  1YJW P;  2ZAE B;  3EQ2 A;  2QE7 H;  2IYO A;  1JMM A;  1EDK A;  3Q5R A;  1LT1 A;  4NPE A;  3H1K J;  2P10 A;  3O5C A;  3L73 G;  1CHI A;  4V2K A;  3HQ7 A;  1KIL A;  3PH0 A;  1VL2 A;  2UWJ E;  1M6Z A;  1U75 B;  1S3J A;  5TIS E;  2C1U A;  5AW3 B;  5CYT R;  2CE0 A;  1DII C;  1I5T A;  3L72 G;  2JEE A;  2QJP B;  4M3L A;  4AAL A;  3EWK A;  1FZC B;  3KXD A;  3FWN A;  3RK2 C;  4HKZ H;  1LNQ A;  1VQ7 P;  3VMZ A;  1W2B O;  2VRS A;  1NGM B;  2KOG A;  1RZ6 A;  3EFF K;  3MK7 B;  1T2K D;  1SQP K;  3FXE A;  2L91 A;  4FA5 A;  1IFN A;  3VNW A;  2WTY A;  2GUV A;  3GHG C;  1DH3 A;  1MV8 A;  1LT9 A;  5AW1 B;  5DJQ C;  1EZV G;  1BSN A;  1M70 A;  3CD6 P;  1RE3 C;  2Y0D A;  1HJ5 A;  1SQX D;  3WU2 V;  3JC2 2;  2JWA A;  2E75 B;  5AVU B;  1I8P A;  1J2J B;  3BAT A;  2M8R A;  3HQ6 A;  155C A;  1YFC A;  1SFC D;  1K04 A;  4AQR D;  1E29 A;  3L73 D;  5GTI E;  2N18 C;  3B5N B;  3LW5 H;  2ZT9 B;  5BU8 B;  4IFM A;  2CPS A;  2GA1 A;  1YJN P;  2PP6 A;  2CE1 A;  1Q82 Q;  3UIA A;  4Y99 C;  3VOP A;  2OYI A;  4ZKU A;  2AIU A;  4O9B A;  1LTJ C;  2KS1 A;  2BPB B;  2FXO A;  4H44 D;  3L72 D;  3AE6 C;  2BCC J;  1XTG B;  3PXW A;  5DJU B;  1I55 A;  3QWO C;  1L0N G;  1GIW A;  2K1A A;  3E7K A;  3CI9 A;  2NPS C;  3AEB C;  3CX5 H;  4IFF A;  3H25 A;  4I1L A;  1X9V A;  2O01 N;  1SLQ A;  1K3H A;  3VN0 A;  4R4L A;  2OYH B;  4A7P A;  4L74 A;  2N3Y A;  1FCD C;  3CX5 W;  3E1I A;  3M9B A;  3A0H V;  1LTG C;  2J5U A;  1TU3 F;  2KLU A;  3RL0 D;  3CU4 A;  1PZQ A;  1EZV D;  2WPR A;  1JTH A;  1I8O A;  1FZA A;  5AVZ B;  4BRY B;  3CWB G;  2N9Y B;  3RLM A;  3SLE A;  5E79 V;  2QVA A;  2W83 C;  1CIH A;  5GTI V;  3AE1 C;  3CCM P;  2YNY A;  4NPD A;  4EDF A;  5KAI H;  1QL3 A;  2C2C A;  3L73 E;  2LR2 A;  3CX5 D;  2BCC G;  3H1J J;  3CYT I;  3K5B A;  3ORV A;  1QYZ A;  1AQ5 A;  3H1L J;  1DW2 A;  3KHU A;  2FY8 A;  4FB1 A;  3R4Y A;  3L72 E;  4OGQ D;  2QSI A;  2K3R A;  1JY3 P;  4N6J A;  3F89 A;  1IQC A;  3HRN A;  3CXH H;  4KT0 J;  4IFD K;  1FJ0 A;  3BAS A;  1L0N D;  1N73 B;  1RQU A;  2B0Z B;  2QEX P;  3Q1M A;  1YIQ A;  3CXH W;  3PH2 B;  3M06 A;  1NTK J;  1P84 I;  1ETP A;  4YXD C;  1QLE D;  3RK3 D;  3CCU P;  2Q9I A;  4XFJ A;  1N90 A;  1GZL A;  1RF0 A;  3GLM A;  1BL9 A;  4H0L B;  3CCL P;  1NTM J;  2ORL A;  3HQ9 A;  2B12 B;  2SPZ A;  2C9N Y;  1RAQ A;  1EZV E;  3TYY A;  1OW8 A;  1EXJ A;  3CXH D;  2WIT A;  5AVY B;  2WSF J;  1OAE A;  3HD7 C;  3CWB D;  2BLF B;  1GL2 B;  4I6M C;  3O20 A;  4R4M A;  2C1V A;  1N50 A;  1YEB A;  1CTY A;  1DT1 A;  3Q2Y A;  3O6Q B;  2YO3 A;  1ZOY C;  1HTL C;  5CBN A;  2OTK E;  1HRC A;  2M3E A;  1H9X A;  4HYT B;  1J1E B;  1KC8 Q;  5KKZ B;  1HCM A;  3RK2 D;  2KXP B;  1FDI A;  5APW A;  2I1K A;  3D70 A;  1LMS A;  3AE3 C;  3WFC C;  3L70 G;  4PV1 B;  2HPC B;  1ZR4 A;  2IZ0 A;  1CSB A;  2FKW B;  3V6I A;  1VF5 C;  1CW5 A;  1L0N E;  1ZME C;  1GTW A;  3TNU B;  1N7S C;  2FXM A;  2E76 B;  3BRT B;  4C7R A;  1RHZ B;  1K73 Q;  3RK3 E;  5EFW B;  2ZYD A;  4HJG H;  1GU5 A;  3TYI A;  3OCD B;  2XND H;  2VHD A;  1RE4 C;  1SQQ J;  2R3C A;  1HZU A;  3ZBM A;  3GF3 A;  2FYU D;  4RO0 A;  3OA8 A;  1KX2 A;  2R3S A;  4EYY Q;  1DIP A;  2LXB A;  1VQ8 P;  3CXH E;  5CMZ A;  1N73 A;  3OA7 A;  3CWB E;  3TGU G;  2WSC H;  2N1T B;  1Z56 A;  2J59 M;  2QJY B;  2I1J A;  4I7Z C;  1KMI Z;  1JOC A;  3WUV A;  1OWA A;  1N2D C;  1LWU A;  1KD1 Q;  1ZRT D;  1YNR A;  1BCC J;  3H1I J;  1NAY A;  1AVO A;  1H1O A;  1CTZ A;  2H88 C;  2A45 G;  2YKP A;  5CJ0 A;  1S6V B;  2C0X A;  2LIR A;  2Q7C A;  1AVY A;  1T2K C;  5CHX A;  3RN1 A;  2NPS D;  4EID A;  3L74 E;  5AVW B;  3L70 D;  1PGP A;  1PIX A;  1GU2 A;  5KAI V;  2Q3I A;  1KQL A;  2IFN A;  3PRJ A;  4XE5 B;  1HJ3 A;  1PP9 G;  1KB9 H;  2FFD C;  2MTA C;  1SQP J;  3CLQ A;  1KYO H;  1LP1 A;  3VMA A;  3MD0 A;  2NRG A;  1BGY J;  3IF4 A;  1G1I A;  2A45 H;  2RKL A;  1L4A A;  2N9I A;  5KJ7 C;  1JY2 O;  2FYU E;  2BEZ F;  5L8R J;  2HPC A;  4AAN A;  4DY9 A;  1KYO W;  1IRV A;  1Y47 A;  3Q3D A;  1NTZ E;  5KLV E;  2ZOO A;  3SWY A;  4H13 B;  1JUN A;  1BCC G;  3TNU A;  3H1I G;  1AQT A;  1T8Z A;  1JY3 N;  3WU2 H;  3JCU H;  3TGU D;  2P2U A;  4H44 C;  1ZRT E;  4O1W A;  1NOH A;  3V2Q A;  2ZYG A;  4HH2 A;  1KB9 D;  1OVR A;  3MUD C;  1Q7Y Q;  1H32 A;  1KYO D;  2ITA A;  1NTK K;  2WPV B;  2M5A A;  1KIL B;  1A56 A;  3WUU A;  2R5B A;  5CBO A;  1L9B C;  4WVZ A;  2C8S A;  2B4Z A;  1NTM K;  1H0T A;  1SQB G;  1OVV A;  1IK9 A;  1SQV J;  1SQP G;  3L70 E;  3PHL A;  3RL0 g;  1U74 B;  4NFG B;  4QMA A;  3RL0 C;  2D2C B;  2W90 A;  3FWL A;  1Y9B A;  1SVF A;  2GM4 A;  2XKM A;  4LGD E;  3DMI A;  2HR3 A;  1PP9 D;  2WSS H;  1LFM A;  3SFD C;  3PLN A;  1DW3 A;  3V4W A;  4RJT A;  1M1J C;  1H31 B;  2R32 A;  2B87 B;  3HD7 D;  4RES B;  3HUS C;  2N9B A;  3A0H H;  3II6 A;  5AVV B;  1MFT A;  1LT9 B;  3T97 A;  3TGU E;  3D6Z A;  1LC1 A;  1N7L A;  1NYH A;  1PPJ D;  1HGV A;  2A06 G;  1SFC A;  3AED C;  2DGE A;  3L71 E;  1YIT P;  1ZR2 A;  4KMG A;  2BCN B;  5E79 H;  1KB9 E;  5DF5 A;  1AOQ A;  2FXP A;  1A02 F;  1KYO E;  1FZB A;  2KP8 A;  1S9K D;  1VPC A;  2P58 A;  1EDJ A;  2V07 A;  5B5E H;  2IBZ D;  2OGU A;  1C6S A;  1WVE C;  2QJK C;  3D71 A;  2PAJ A;  5DFS A;  1NU1 E;  2CA4 B;  1SQQ K;  1N7S D;  1OX3 A;  3ZOW A;  1SQB D;  2PAC A;  3B8E B;  1OZH A;  2KS1 B;  1WRG A;  1FHB A;  1USE A;  2Y0C A;  1URQ C;  3OJA B;  3WU2 E;  3JCU E;  3GMA A;  4YPC A;  1WEJ F;  2JWD A;  1PP9 E;  1ZXG A;  1S1C X;  1CTJ A;  3E1R A;  4IOI H;  2HOD A;  1JDL A;  2BEQ D;  1CRH A;  2Q6Q A;  3L75 G;  2OYO A;  1GW4 A;  3RBX A;  3RK2 B;  1YCC A;  1F1C A;  1PPJ E;  1K8A Q;  1VQM P;  1Q2N A;  3CXH I;  1JTH B;  2RMZ A;  3VYI A;  2AXT H;  2A06 D;  4GYD A;  3O0R C;  2WZ7 A;  3U1A A;  4BWN A;  5AVS B;  1S9K E;  1H31 A;  2YIU B;  2QG4 A;  3I55 P;  3SSU A;  4GOF A;  2B87 A;  1NKN A;  3KZI V;  4Z1M H;  5DJQ B;  1LC2 A;  1KV9 A;  1N8R Q;  1R0Q A;  2IBZ E;  1FZC C;  1Y8A A;  1KTM A;  4LC1 A;  4J20 A;  4QAO A;  1WT6 A;  3SXT A;  1SQB E;  3H1K G;  3C9I A;  3A0H E;  1X79 B;  1DD3 A;  1GK4 A;  3M0D C;  1FBM A;  3PXT A;  2ZVO B;  2PRR A;  1B7V A;  3VMY A;  2IDB A;  1RF1 A;  3D6Y A;  2N18 B;  4U3F J;  3V2R A;  3MK7 C;  2POH A;  3P8C D;  4UB6 H;  1KIB A;  3CCR P;  1I6E A;  1JMB A;  5KJ7 D;  1YHQ P;  1DVH A;  1JY2 P;  5E79 E;  1T3J A;  2O01 H;  3WUI A;  4EI2 A;  1LTJ B;  1M7L A;  1MZ9 A;  5CCG D;  1MG3 D;  1W2E A;  1VQP P;  1N86 A;  2GC7 D;  3BRV B;  1E5W A;  5B5E E;  3L75 D;  1CC5 A;  2V7Q J;  2E75 C;  3U1C A;  3R2P A;  2L4D A;  2LIT A;  3RN0 A;  2JR8 A;  1FOC A;  2LKM A;  2O1J A;  2P67 A;  4UB8 H;  3IAO A;  2GUS A;  2DW3 A;  5KAF H;  1SQV K;  4RSZ A;  4K35 A;  3B5N C;  2A06 E;  2ZT9 C;  4MN4 C;  1YI2 P;  5APY A;  1EQ7 A;  3CCS P;  1FI3 A;  1HUC A;  3A5T A;  4WQC A;  1OVU A;  2RN0 A;  2KZJ A;  2OAR A;  4PD4 H;  1BE3 J;  2PGD A;  1KQS O;  2WPQ A;  3AEF C;  4WY4 C;  4TT3 H;  1H33 A;  2W6B A;  3CP5 A;  2Z5I A;  1SQX E;  3A2A A;  3H1K D;  1PV3 A;  1UIX A;  1QVF O;  1CRI A;  3BCC J;  2ZJS E;  2J58 A;  3P8C E;  2Q3E A;  3HTK B;  2CA3 B;  3GHG A;  2H8P D;  4D6T J;  1RE3 A;  3SWS A;  5B5E V;  4GDO A;  3CME P;  2WPS A;  2MKV A;  2W27 A;  1ZN5 A;  3L75 E;  1J1D B;  2E74 B;  1ZW0 A;  4PD4 D;  3L4O A;  5AVR B;  1QL4 A;  4ZNC A;  2H43 A;  4IL6 H;  1EB7 A;  1U57 A;  1LTI C;  1MFZ A;  1CSV A;  1YIJ P;  1MUU A;  3NWV A;  5GTH H;  3VP9 A;  1COT A;  1ZZH A;  1N9C A;  3OA8 B;  1IO4 A;  3DP5 A;  3L37 A;  3GG2 A;  1VQ4 P;  4UB6 E;  1LTJ A;  3O1Y A;  2K37 A;  1WMK A;  1YQ4 C;  3H1H J;  1K05 A;  4I2L C;  4WQE A;  1LWU B;  1KB9 I;  2ZVN B;  5AW2 B;  1VYD A;  3P8M C;  1KYO I;  3BCC G;  2C9X B;  3PJS K;  2BGV X;  3A3Y B;  1URQ D;  1MZ4 A;  2A45 I;  1CI6 A;  1GD2 E;  1IFM A;  1FC2 C;  2NPS A;  2XZR A;  3H1K E;  1KQF B;  2ZBO A;  2WQY C;  1HH0 A;  4AX3 A;  4P4Q B;  1AFO A;  1AV1 A;  4UB8 E;  3H1J G;  2AXT V;  5KAF E;  4WB4 A;  3P7K A;  3JBT B;  1YIC A;  3H1L G;  1AOF A;  2AI5 A;  2GC4 D;  1S5L V;  1EDI A;  1R5S A;  3CX5 E;  1HF9 A;  3L35 A;  4MU8 A;  1QEX A;  2QM7 A;  3FGA D;  2K9Y A;  3HQ8 A;  2BCC D;  1H89 A;  1I6D A;  1HJ4 A;  2JDI H;  1LP1 B;  3PP5 A;  2ZYA A;  1N15 A;  1L4A B;  4OH8 B;  4FA1 A;  3G4S P;  3CMA P;  4WQ8 A;  1VF5 B;  1Q86 Q;  5APV A;  1GL2 C;  2D0S A;  5H2F V;  1NTK G;  2IFM A;  1VQ5 P;  1EXI A;  2HLO A;  3HTK A;  4UB6 V;  1SS1 A;  3L71 J;  3SFE C;  1OCD A;  1W2L A;  2CPB A;  2XTS B;  1QX8 A;  3KQG A;  1NTM G;  5KAI E;  1ZLL A;  5IY5 1;  1QKS A;  2JO1 A;  3M91 A;  5C0Z A;  4DZO A;  1J1E C;  5KKZ C;  4YXW H;  1JY2 N;  1IO3 A;  5CCH C;  2KB7 P;  1H32 B;  4JBZ A;  1C6O A;  2M5A B;  1L0L J;  4UB8 V;  2IBZ I;  4WQD A;  1BDD A;  5KAF V;  2R5D A;  1H0T B;  4OWF A;  3W68 A;  2NZ2 A;  1NNO A;  2WSE J;  5APQ A;  3H1J D;  2EXV A;  3H1L D;  1M56 D;  2QM8 A;  4GT1 A;  2E5Y A;  1CCH A;  1JO5 A;  2BCC E;  2E75 D;  2FYN B;  2FBW C;  3MIW A;  5CIE B;  4EOT A;  2WSF H;  1IK7 A;  3D0W A;  1KZU B;  3HD7 A;  3M9H A;  3PTZ A;  4HB1 A;  1NJI Q;  3B5N D;  2N1T C;  2P7J A;  2ZT9 D;  5BVZ A;  2QJY C;  1NWQ A;  2ZON G;  1NTK D;  2FFD B;  2W6A A;  3T97 B;  4DJG A;  3AEA C;  3OAK A;  5B66 H;  2L5G B;  1SQQ G;  1H8A A;  3L4F A;  1NTM D;  3VTP C;  5AW5 B;  1SFC B;  4WY4 D;  1C6R A;  1RZ5 A;  4FA4 A;  5KLI B;  2JQR A;  2V4H A;  2O3J A;  1ZV8 A;  3SWK A;  4IL6 V;  3GF7 A;  3WC8 A;  1P84 H;  3KZI H;  2WWW A;  4W7Z A;  5GTH V;  2FYU K;  1N7S A;  2FRC A;  1CSW A;  3H32 A;  5CCG C;  1PFI A;  1CXA A;  2Z4E A;  1GQ1 A;  2KIK A;  4H44 B;  1NO4 A;  1CRC A;  1NTZ K;  5KLV K;  2JTI B;  3RBZ A;  3H1J E;  3AEC C;  1COR A;  2YKO A;  1RE4 A;  3H1L E;  3L36 A;  2B89 A;  3CC2 P;  3MHV A;  1VQK P;  2Z5H A;  451C A;  3CCQ P;  1FAV A;  2JP3 A;  4FAV A;  2HOD B;  3CCJ P;  2OTL P;  2C9L Y;  4H13 C;  1E8E A;  1X22 A;  1P84 D;  4DCK A;  1A2S A;  5AUR A;  3RL0 B;  1FZG A;  5AW0 B;  4EIJ A;  1OFC X;  3ZOY A;  5TIS H;  3DR0 A;  3U59 A;  4XA4 A;  4Y5R A;  4ASW A;  1BGY G;  4L76 A;  1EC5 A;  4W80 A;  3WFB C;  1QGK B;  1HGZ A;  1NTM E;  2YQB A;  1KIL C;  1SQQ D;  2YCC A;  2KNC A;  1FOS F;  2C1D A;  3HUS B;  1FE6 A;  1CIG A;  2YXQ B;  4JYC A;  2E42 A;  3I56 P;  2E43 A;  1CYC A;  1HZV A;  2BAS A;  4GKG A;  1CIF A;  4OGQ B;  4WWI A;  2FFD A;  2MHM A;  2M0B A;  3M0A A;  5CIF B;  1EZV I;  1BCC D;  1PGJ A;  3H1I D;  3WUT A;  1R5L A;  5APS A;  1IFI A;  1JM0 A;  5KJ7 A;  2YXR B;  3C1L A;  3L73 J;  5M1B A;  4XXL A;  5B66 E;  1IFJ A;  3TSI A;  2Y9Z A;  1RF1 B;  1CHJ A;  4JCG A;  3IR9 A;  3AEG C;  1JCD A;  1C75 A;  1VDF A;  1C52 A;  3RK3 B;  3CX5 I;  1SQV G;  2QJK B;  1GL2 D;  1GU4 A;  3S1K A;  1NML A;  3L72 J;  1P84 E;  3ZCF A;  1LT9 C;  3KZI E;  3IN6 A;  1C7M A;  2KSJ A;  1NU1 K;  1L0L K;  2D0W A;  1SQP D;  4H0J A;  3MUD A;  3SJL A;  1C2R A;  2ZXX A;  4U7J A;  1BGY D;  2G8Y A;  1NIR A;  5CCH D;  1Q81 Q;  2IZ1 A;  3RMZ A;  1LS9 A;  1SQQ E;  3LW5 J;  3P32 A;  4C7N A;  3CCV P;  3C8V A;  5AVT B;  2B10 B;  4JF7 A;  1E79 H;  1OW6 A;  3Q5S A;  5CID B;  2OYI C;  4TLF A;  1NH4 A;  2E76 D;  2W8Z A;  3ZOO A;  2IYP A;  1KB0 A;  4KJM A;  1CZQ A;  2KSE A;  3N7N A;  5CIB B;  3CC4 P;  4GED B;  1H33 B;  1LJ2 A;  4GOD A;  1BCC E;  3H1I E;  1YJ9 P;  2CXB A;  5B66 V;  2IPP A;  5CIG B;  3TDK A;  1DEB A;  2H89 C;  1M1J A;  1CHH A;  4C46 A;  1M90 Q;  1L9J C;  2DVH A;  3HUS A;  5C9M A;  1S5L H;  3GHG B;  2LXC B;  2N1T D;  1Q90 D;  5BU5 A;  2QJP C;  3AE7 C;  4WQB A;  3TF5 A;  3NTN A;  1SQV D;  3AEE C;  1NMI A;  1NHL A;  1DW1 A;  1FOS E;  1RQV A;  2XDJ A;  1NAF A;  2AEM A;  4PJ0 V;  3JSV C;  1CSX A;  2XNX A;  1MKM A;  1CNO A;  1SQB K;  2W6J H;  1KFM A;  1SQP E;  4JYB A;  4L75 A;  2RH0 A;  4LJI A;  1L0N J;  1L2P A;  1BGY E;  5H2F H;  1IFP A;  2YIU C;  3TK1 A;  2N3B A;  4JQ0 D;  1FZE A;  5DJT B;  3EFG A;  1U7M A;  4Y99 B;  1FS0 E;  4AAM A;  1S4X A;  2PCC B;  1URQ A;  2ZZS 1;  3MGN A;  5AVQ B;  2G3A A;  3A0B H;  1GMJ A;  4EIE A;  4WQ9 A;  5TIS V;  1X8Y A;  2MJZ A;  1CI6 B;  3CWB J;  1JB0 J;  2NPS B;  3GW6 A;  4Y28 J;  3M97 X;  1IFD A;  1JCC A;  2OZ1 B;  1NKZ B;  3G6E P;  2Q1K A;  4YE1 A;  5EXQ A;  4H13 D;  1CRG A;  4WQ7 A;  4PWA A;  1K3G A;  2I8D A;  4L73 A;  4WY4 B;  1G1J A;  1RF0 C;  5CJ4 A;  1BSH A;  1SQV E;  2HYN A;  1D7M A;  4AYC A;  3S9O A;  2QRX A;  2WT7 B;  4U3F G;  1W5C E;  3BVH A;  1CYJ A;  2B11 B;  3L74 J;  1SQX K;  4DT0 A;  3MP7 B;  1KIL D;  1DEE G;  1KOR A;  3WFE C;  1ZP0 C;  2KLV A;  3G9R A;  3LID A;  3V2P A;  1LTT C;  1VQO P;  2AXT E;  1YQ3 C;  1VQ9 P;  2OYH C;  1FZC A;  4ZKP A;  3A7O A;  1DX7 A;  3SWF A;  1HJB A;  1S5L E;  3USS A;  2D2C D;  2O1K A;  2FYU J;  3M0D A;  5APX A;  1FU1 A;  1KQG B;  4BXL A;  2C0W A;  1F1F A;  1QL2 A;  3W67 A;  4PW9 B;  2YKQ A;  1NTZ J;  5KLV J;  2KYV A;  1W5C T;  4ASV A;  3F5H A;  3QH9 A;  2IX7 C;  4WQA A;  1VQL P;  4LLH A;  1BDC A;  1H9Y A;  4XYD B;  4KHX A;  5H2F E;  1H88 A;  1BE3 G;  3I5C A;  2PFX A;  1KN7 A;  2V7Q H;  3FX0 A;  2OQQ A;  1J1D C;  2E74 C;  3L74 G;  1E2R A;  1YTZ T;  1QL1 A;  1IC2 A;  2KUB A;  2AEF A;  1X0T A;  1YEA A;  3A0B E;  3B5N A;  1LGH B;  2QA4 P;  3HE4 B;  4U3F D;  3L70 J;  3HD7 B;  2ZFC A;  1KIL E;  1N73 C;  3HE5 B;  2ZXE B;  4W7Y A;  2WSC J;  1PGQ A;  2OZ1 A;  3V5B A;  4D6T G;  2YMK A;  1IZN B;  3C2C A;  1S2E A;  2FYU G;  2H7H A;  4H0K A;  1LWU C;  3CL3 D;  4WY4 A;  3X39 A;  1MG2 D;  1KX7 A;  2N9J A;  1G2C B;  2KZI A;  4H0L C;  1NTZ G;  3AE2 C;  5KLV G;  1CED A;  4EIC A;  5K5G B;  1FDM A;  3VYM A;  3CCE P;  3MTU E;  2OTJ P;  1PGO A;  2K9J B;  2WT7 A;  3KYQ A;  4PD4 E;  1NVO A;  1T3U A;  2YK3 A;  4GIF A;  1RH5 B;  1FI7 A;  1GK6 A;  1LTS C;  1C2N A;  1OW7 A;  4WBA A;  2GIW A;  3NFQ A;  3B4S A;  4K3A A;  2OYH A;  1J3S A;  1JNM A;  3TGU J;  2YO2 A;  1N7S B;  4L3G A;  3H1H G;  3H32 B;  3ITK A;  1YTC A;  1S5L X;  1CIE A;  1S72 P;  1DVV A;  3O8Z A;  1DIQ C;  1L0N K;  1A8C A;  2BH5 X;  5AW7 B;  3ZOX A;  1DW0 A;  1BE3 D;  4OVN F;  3H6P A;  2CK3 H;  3ABV C;  3SVW A;  4BRY A;  1L4A C;  3CPW O;  1HJ0 A;  2GB8 B;  4K3I A;  3A0B V;  3L74 D;  1QVG O;  1KFN A;  5AW9 B;  4GOE A;  1AA0 A;  4PV1 C;  3VMX A;  1IJD B;  3BCC D;  1NU1 J;  2Q5U A;  4IL6 E;  4U3F E;  1M60 A;  1CRJ A;  1FI9 A;  2YMY A;  1JEK A;  1OIP A;  3FXD A;  5GTH E;  1HWT C;  4I7Z B;  3IFM A;  2E76 C;  1HRO A;  2HFE D;  1RAP A;  4D6T D;  3PXS A;  1PP9 J;  2QIW A;  5C39 A;  1NTZ D;  5KLV D;  4N3Y B;  1GKS A;  2BH4 X;  1RY3 A;  1CYI A;  3HE4 A;  2KNC B;  2ZXY A;  1YBK A;  5APT A;  4CPG A;  1VQN P;  1SP4 A;  1UII A;  2WMM A;  3HE5 A;  3L71 G;  2WVR A;  1U7J A;  2C1D B;  1LTB C;  4NPF X;  1HVV A;  3AE8 C;  2HG5 D;  5AW6 B;  3H1H D;  4AUW A;  1CRY A;  1G2C A;  3WFD C;  2R44 A;  1VQ6 P;  3OW2 O;  1BE3 E;  2FYN C;  3LIE A;  1USD A;  2AEJ A;  3ZDM A;  5KTB A;  5AW8 B;  2I8F A;  1NU1 G;  2K9J A;  1L0L G;  3S4R A;  4Q5P A;  1AKK A;  1GL2 A;  1GDV A;  1M8O B;  1AJY A;  1FJP A;  4L3H A;  1IRW A;  5TJH A;  3BCC E;  1HH7 A;  3O6Q A;  2AXC A;  1SQB J;  3RGU A;  3KPE A;  4N78 D;  4PJ0 H;  3CC7 P;  3Q5P A;  1HBW A;  2B9B A;  4D6T E;  1SFC C;  5CCH A;  3G71 P;  5KLI C;  1KV4 A;  4IL6 X;  5CIH B;  1CSU A;  3AE4 C;  1FJK A;  4B86 A;  2XU6 A;  2K88 A;  1PPJ G;  1A02 J;  2P1J A;  4C7N B;  3WMM 0;  1K9M Q;  3V2N A;  3ZIY A;  2WSE H;  1YTZ I;  4DOJ A;  3L71 D;  2B88 A;  3OCD A;  4RKU J;  4YTP C;  1R8E A;  1AYG A;  1NTK E;  3NMD A;  2HV4 A;  4JPZ B;  3H1H E;  2E74 D;  1QN2 A;  1FDO A;  2IBZ G;  2V08 A;  1M1J B;  4O1Q A;  1NU1 D;  2N1T A;  1L0L D;  3NBT A;  4ZMD A;  2XV5 A;  1YYC A;  1IZL 0;  3M9Q A;  3B71 A;  5AW4 B;  5AVX B;  1M1K Q;  3AE5 C;  1T6A A;  1SQX J;  3N4X A;  1EDL A;  2KI7 B;  1CXC A;  4L1Q A;  3NBS A;  4N78 E;  2D2C C;  1CCR A;  4EIF A;  1PL5 A;  4N0K A;  3AE9 C;  3KDP B;  4H0L D;  2Y0E A;  2KK7 A;  2M3B A;  1GDT A;  3NXS A;  1GW3 A;  4AAO A;  2PCB B;  1M57 D;  3MZW B;  1OXZ A;  1OMI A;  5CCG A;  2FWL A;  1CO6 A;  2JJL A;  3L75 J;  3A9F A;  2JKV A;  1DD4 A;  4OGQ C;  1JY3 O;  4FA9 A;  3VRD A;  5CIC B;  1URQ B;  4PD4 I;  5GTI H;  351C A;  4PJ0 E;  2Y9Y A;  3VP8 A;  1I54 A;  3G3Z A;  5B6Q A;  1RF1 C;  3L4M A;  1XTC C;  1L4A D;  3V4Q A; 
#chains in the Genus database with same CATH homology
 4FAN A;  2N9I A;  5EXQ A;  1CRG A;  3HQ8 A;  4WQ7 A;  2BCC D;  4PWA A;  1K3G A;  1I6D A;  1HJ4 A;  1GJQ A;  4AAN A;  4DY9 A;  1KYO W;  1IRV A;  1N15 A;  2ZOO A;  4FA1 A;  4WQ8 A;  2D0S A;  5H2F V;  1CYJ A;  3TGU D;  2B11 B;  4UB6 V;  3O5C A;  1CHI A;  4V2K A;  3HQ7 A;  3WFE C;  4O1W A;  1OCD A;  1W2L A;  2XTS B;  1M6Z A;  1U75 B;  2C1U A;  5CYT R;  2CE0 A;  1KB9 D;  5IY5 1;  1H32 A;  1QKS A;  1KYO D;  5C0Z A;  1A56 A;  1DII C;  1I5T A;  1IO3 A;  2QJP B;  1L9B C;  4AAL A;  1H32 B;  2C8S A;  2B4Z A;  1C6O A;  4UB8 V;  3PHL A;  1F1F A;  1U74 B;  4NFG B;  4PW9 B;  4WQD A;  5KAF V;  1W5C T;  3FWL A;  1NNO A;  4WQA A;  3H1J D;  1RZ6 A;  1H9Y A;  4XYD B;  3MK7 B;  3DMI A;  2EXV A;  1PP9 D;  3H1L D;  2L91 A;  4FA5 A;  1LFM A;  1CCH A;  3VNW A;  3PLN A;  1DW3 A;  2FYN B;  4RJT A;  1H31 B;  5CIE B;  5DJQ C;  1E2R A;  1M70 A;  2Y0D A;  1HJ5 A;  1SQX D;  3WU2 V;  3PTZ A;  2JWA A;  1YEA A;  1I8P A;  3HQ6 A;  1LC1 A;  155C A;  4U3F D;  1PPJ D;  1YFC A;  2ZON G;  1NTK D;  2DGE A;  1E29 A;  2OZ1 A;  3L73 D;  2N18 C;  4KMG A;  2BCN B;  3C2C A;  5DF5 A;  1AOQ A;  2CE1 A;  1NTM D;  4H0K A;  3X39 A;  1MG2 D;  1KX7 A;  1C6R A;  2N9J A;  1RZ5 A;  2AIU A;  4FA4 A;  5KLI B;  2V07 A;  2JQR A;  2KS1 A;  2BPB B;  1CED A;  4EIC A;  2O3J A;  3L72 D;  4IL6 V;  2IBZ D;  3VYM A;  3WC8 A;  1C6S A;  3PXW A;  1WVE C;  2K9J B;  5DFS A;  2CA4 B;  5GTH V;  3ZOW A;  2FRC A;  1SQB D;  1CSW A;  2PAC A;  2YK3 A;  1I55 A;  1CXA A;  1FI7 A;  1GIW A;  1GQ1 A;  1C2N A;  1FHB A;  2Y0C A;  2GIW A;  1CRC A;  2JTI B;  1J3S A;  4L3G A;  1COR A;  3ITK A;  1WEJ F;  1YTC A;  1CIE A;  1CTJ A;  1K3H A;  1DVV A;  1DIQ C;  4A7P A;  1A8C A;  1JDL A;  2BH5 X;  3ZOX A;  451C A;  2N3Y A;  1DW0 A;  1BE3 D;  1CRH A;  1FCD C;  3CX5 W;  3SVW A;  3A0H V;  4FAV A;  3CU4 A;  2GB8 B;  1EZV D;  4K3I A;  3A0B V;  3L74 D;  1E8E A;  1I8O A;  1P84 D;  1A2S A;  5AUR A;  2N9Y B;  3RLM A;  3BCC D;  3SLE A;  1YCC A;  1F1C A;  1M60 A;  5E79 V;  1CRJ A;  1CIH A;  3ZOY A;  5GTI V;  1FI9 A;  3DR0 A;  4EDF A;  1QL3 A;  2RMZ A;  2C2C A;  4Y5R A;  2A06 D;  4GYD A;  3WFB C;  3O0R C;  3CX5 D;  1HRO A;  1RAP A;  3CYT I;  4D6T D;  3ORV A;  3PXS A;  2YQB A;  1QYZ A;  1H31 A;  2YIU B;  2QG4 A;  1DW2 A;  3KHU A;  1SQQ D;  3KZI V;  5DJQ B;  1LC2 A;  2YCC A;  4FB1 A;  1KV9 A;  1R0Q A;  2C1D A;  1NTZ D;  5KLV D;  1IQC A;  4J20 A;  1GKS A;  2BH4 X;  4QAO A;  1CIG A;  3SXT A;  1CYI A;  1FJ0 A;  1CYC A;  2KNC B;  2ZXY A;  1HZV A;  1CIF A;  2C1D B;  1L0N D;  2MHM A;  3PXT A;  1B7V A;  2B0Z B;  5CIF B;  1BCC D;  1YIQ A;  3CXH W;  3H1I D;  2N18 B;  3PH2 B;  3MK7 C;  1KIB A;  1I6E A;  1DVH A;  1ETP A;  3H1H D;  1CRY A;  1N90 A;  3WFD C;  4XXL A;  3WUI A;  1CHJ A;  4JCG A;  1BL9 A;  1MG3 D;  1C75 A;  2ORL A;  2I8F A;  3HQ9 A;  1C52 A;  2B12 B;  4Q5P A;  2GC7 D;  3L75 D;  1RAQ A;  2QJK B;  1CC5 A;  1AKK A;  1GDV A;  1NML A;  4L3H A;  1IRW A;  3ZCF A;  2L4D A;  2LIT A;  3RN0 A;  3CXH D;  1FOC A;  5TJH A;  1OAE A;  1HH7 A;  1C7M A;  3CWB D;  2BLF B;  3O20 A;  2D0W A;  4RSZ A;  2C1V A;  1SQP D;  1N50 A;  4H0J A;  3SJL A;  1C2R A;  1YEB A;  1CTY A;  1DT1 A;  1BGY D;  1NIR A;  3RMZ A;  1FI3 A;  1LS9 A;  4WQC A;  2RN0 A;  1HRC A;  1H9X A;  5CIH B;  2B10 B;  4YE1 A;  1CSU A;  5KKZ B;  1HCM A;  5CID B;  1H33 A;  1LMS A;  3WFC C;  3CP5 A;  3ZOO A;  1KB0 A;  3ZIY A;  3H1K D;  5CIB B;  4GED B;  1CRI A;  1H33 B;  3L71 D;  3OCD A;  2Q3E A;  2CXB A;  1AYG A;  2HV4 A;  5B66 V;  2CA3 B;  5CIG B;  3TDK A;  1QN2 A;  1CHH A;  3TYI A;  3OCD B;  2VHD A;  2V08 A;  1L9J C;  3SWS A;  5B5E V;  2DVH A;  5C9M A;  1HZU A;  3ZBM A;  2FYU D;  3OA8 A;  4O1Q A;  1NU1 D;  1KX2 A;  1L0L D;  3NBT A;  3L4O A;  4PD4 D;  4WQB A;  1IZL 0;  3TF5 A;  1QL4 A;  1EB7 A;  1SQV D;  1NMI A;  1CSV A;  1DW1 A;  3NWV A;  4PJ0 V;  1COT A;  1ZZH A;  1N9C A;  1CSX A;  3OA8 B;  1CNO A;  1CXC A;  2QJY B;  3NBS A;  3DP5 A;  4L1Q A;  4LJI A;  1CCR A;  3GG2 A;  4EIF A;  1ZRT D;  4N0K A;  1YNR A;  1H1O A;  2N3B A;  2Y0E A;  1CTZ A;  3O1Y A;  4AAO A;  4WQE A;  1S6V B;  2PCB B;  2LIR A;  1VYD A;  4AAM A;  2FWL A;  1CO6 A;  2C9X B;  2BGV X;  2PCC B;  3RN1 A;  1MZ4 A;  2ZZS 1;  3A9F A;  4EID A;  4EIE A;  3L70 D;  4FA9 A;  2ZBO A;  3VRD A;  4WQ9 A;  5TIS V;  4AX3 A;  4P4Q B;  1GU2 A;  5KAI V;  5CIC B;  2AXT V;  3PRJ A;  3GW6 A;  1HJ3 A;  3JBT B;  1YIC A;  351C A;  1AOF A;  3M97 X;  2MTA C;  2AI5 A;  2GC4 D;  1I54 A;  1S5L V;  5B6Q A;  3VMA A;  2OZ1 B;  3L4M A;  4MU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...