2A06D

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2a06D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2a06D02
2BGVX 4XYDB 1FCDC 1L0LD 2AIUA 3VRDA 1R0QA 3JBTB 4O1WA 3RN1A 1HROA 1PPJD 1M60A 2JQRA 1M70A 1COTA 1DW0A 2IBZD 1CRCA 1KB9D 3OCDA 4EICA 2YIUB 1GDVA 4WQ7A 2LIRA 3KHUA 4PWAA 3BCCD 1AOFA 4FA1A 1CTYA 1CNOA 1LC2A 1WVEC 3PH2B 3GW6A 5CICB 1KIBA 5DF5A 1CHJA 3L75D 3WU2V 1C52A 1N50A 1CRIA 1I55A 1EB7A 1A8CA 1F1CA 2QJPB 3O20A 1QYZA 1IO3A 1OCDA 1ETPA 3SXTA 1HZUA 1FI9A 5CIBB 1HJ4A 3OA8A 1NNOA 4A7PA 1NMLA 2I8FA 1YIQA 2XTSB 3PXWA 3ZIYA 1CYCA 4EIDA 1CTZA 1KX7A 3ZOOA 1H33A 1IRWA 1QN2A 3PLNA 1I6EA 1CC5A 1E29A 3C2CA 1W5CT 2BPBB 4WQ9A 1KX2A 5KLIB 1CXAA 1H1OA 1SQVD 1PP9D 1IQCA 1H32A 3TYIA 5CIEB 1BE3D 1QKSA 3CU4A 5CIGB 3NWVA 1IRVA 1CRYA 2QJYB 5KKZB 3PHLA 3A0BV 4FA5A 3HQ6A 3DP5A 155CA 1VYDA 1C2RA 3NBTA 3PXSA 2B12B 2CE1A 1CRJA 3SLEA 3OA8B 5E79V 3X39A 1K3GA 1CCRA 1CIGA 1KB0A 2YK3A 1J3SA 3SWSA 5C9MA 3WUIA 1YFCA 4GEDB 3L4MA 4WQ8A 1CRHA 1SQXD 5DJQC 5B6QA 1S5LV 2V08A 4AAOA 3H1ID 3ZCFA 4KMGA 2C9XB 2GIWA 3WFEC 1HCMA 1CRGA 2ZBOA 3PXTA 4FA4A 3M97X 1CTJA 3ZBMA 3L70D 2MTAC 3NBSA 2D0SA 2C1VA 1DVHA 4FAVA 5TJHA 1YTCA 2B11B 4WQDA 4JCGA 2LITA 1BL9A 3HQ8A 5CYTR 4FB1A 4RSZA 1HJ5A 2KS1A 1I5TA 2JWAA 3HQ7A 3KZIV 4AX3A 2Y0EA 2N9IA 3GG2A 2C1DB 3MK7C 3A0HV 2ZXYA 4WQBA 2DVHA 5GTIV 1KYOD 2PCCB 4PJ0V 3TF5A 3O1YA 2V07A 4K3IA 1YCCA 3WFBC 1B7VA 5DJQB 4H0JA 3L71D 1FI3A 1MG3D 4AAMA 3WFDC 2KNCB 2N3BA 2FRCA 5CIDB 2BH5X 1C6RA 4H0KA 3VNWA 2DGEA 4FANA 3ZOWA 1JDLA 1LS9A 3PTZA 2GC4D 1AKKA 4Y5RA 1YICA 1DVVA 1GIWA 1FOCA 1KYOW 1C6OA 451CA 1RAQA 1N15A 1DIIC 3RMZA 5B5EV 3MK7B 1NU1D 1HZVA 1I6DA 2RN0A 3L72D 1H9XA 2OZ1B 3H1LD 1S6VB 4L1QA 3SJLA 1GKSA 2HV4A 2MHMA 1CIEA 1CIFA 2ORLA 4J20A 3ORVA 3WC8A 5KLVD 1LFMA 2N9YB 5CIFB 4AANA 4YE1A 1YEAA 2Q3EA 2L91A 1A56A 5KAIV 1N90A 2C1DA 2YCCA 1C7MA 2RMZA 5GTHV 1I54A 4NFGB 2PCBB 1HJ3A 3O0RC 3VYMA 4EIEA 3H1KD 1NTMD 2ZONG 1P84D 1HH7A 3PRJA 3TDKA 1CSWA 1U75B 3ZOXA 1WEJF 3ITKA 1DW3A 1FJ0A 1K3HA 2BLFB 1CYIA 2AXTV 1SQQD 3CYTI 1H9YA 1C75A 1W2LA 4DY9A 5AURA 2BCCD 4GYDA 1FI7A 1MG2D 1ZRTD 3RLMA 3WFCC 4L3HA 2N18C 4D6TD 1QL4A 1MZ4A 2C8SA 1FHBA 1CSVA 3ZOYA 2ZOOA 2N3YA 4EDFA 2FWLA 5CIHB 2N9JA 1KV9A 1ZZHA 3H1JD 4EIFA 2Y0CA 1L9BC 3TGUD 1HRCA 1CSUA 2B4ZA 1E2RA 2L4DA 2OZ1A 1BGYD 1I8OA 2QG4A 4WQEA 1CSXA 1NTKD 2EXVA 2C1UA 3CP5A 1AYGA 1F1FA 3FWLA 2B10B 2BH4X 2Y0DA 1L0ND 1H31A 1LMSA 1CEDA 3HQ9A 4V2KA 3DR0A 1NTZD 3O5CA 5EXQA 1RZ5A 4RJTA 351CA 3CXHD 5B66V 1CO6A 2A06D 1L9JC 4PW9B 1RZ6A 2FYNB 3VMAA 4MU8A 4UB6V 2N18B 3SVWA 1DW2A 1NMIA 1CYJA 1C6SA 2D0WA 3L74D 1CCHA 4IL6V 4WQCA 1E8EA 4U3FD 3OCDB 4N0KA 4FA9A 1GQ1A 3H1HD 2FYUD 1CORA 1H31B 1M6ZA 1SQPD 2QJKB 2VHDA 2O3JA 3CXHW 1A2SA 4LJIA 2GC7D 1U74B 1DW1A 4PD4D 1C2NA 1AOQA 3CX5D 3A9FA 1OAEA 3L73D 4WQAA 1N9CA 2ZZS1 4AALA 5DFSA 1YNRA 4O1QA 1BCCD 1QL3A 4Q5PA 1DT1A 1CHHA 1RAPA 1LC1A 2B0ZB 2YQBA 2AI5A 1NIRA 4L3GA 1DIQC 3RN0A 3DMIA 4QAOA 1CXCA 2C2CA 4XXLA 1SQBD 1CHIA 2JTIB 5TISV 1H33B 4P4QB 2CA4B 1GJQA 2CXBA 2GB8B 5IY51 1I8PA 2BCNB 2CE0A 1CIHA 1GU2A 1H32B 3CX5W 2PACA 5C0ZA 2CA3B 5H2FV 1EZVD 1IZL0 5KAFV 2K9JB 3CWBD 3L4OA 4UB8V 1YEBA
chains in the Genus database with same CATH superfamily
2BGVX 2H8PD 5APTA 3VRDA 1Q86Q 2KLVA 3Q5PA 1GD2E 1PPJD 1M60A 1SQQE 2IBZD 1S3JA 1KN7A 1GL2D 1OVUA 3MGNA 3B5NA 3A2AA 2IYPA 1C52A 5APYA 1EZVE 3A5TA 1GK6A 2Z4EA 3NTNA 4I2LC 3L35A 4BWNA 3S9OA 1HJ4A 1LP1A 2GUSA 2I1KA 1J1DB 1HVVA 1SQVK 1X8YA 4WQ9A 1NTZJ 1NO4A 2A45I 1H89A 3A0BE 3AE1C 1PP9D 1LTJC 1HF9A 3G6EP 1BE3D 2KYVA 3V2NA 1IRVA 3L73G 3PP5A 4FA5A 1C2RA 2B12B 2D2CC 1YQ4C 3OA8B 2WQYC 3RK3D 2A45G 3D6YA 1CIGA 1KB0A 2YK3A 4XE5B 3L74J 5C9MA 1YTZT 2KSEA 1EDJA 4WQ8A 4I6MC 1CRHA 2E75C 4YPCA 3R4YA 3H1HE 4CPGA 2FYUJ 1N73C 4WY4C 3H1ID 1RE4A 4KMGA 3HE4B 2OYHA 1RF0A 1SQPJ 4FA4A 1M56D 1QLED 2MTAC 3HE5A 3WUUA 4FAVA 5TJHA 1YTCA 3VOPA 3VYIA 1BCCE 2LITA 2WVRA 1OVVA 3GF7A 4FB1A 1KYOI 1Q2NA 1LTJB 1HJ5A 3A3YB 1I5TA 3QWOC 2W6BA 2QM8A 3SWFA 3HQ7A 4YXDC 1IFJA 4RO0A 2N9IA 1DIPA 2C1DB 2D2CB 3H1IJ 2B89A 1M7LA 1IFDA 4EYYQ 5APXA 5GTIV 1OW7A 3O1YA 2KZIA 1JM0A 4AYCA 3C1LA 2AEMA 4PV1D 3AE4C 2E75B 2YNYA 3MIWA 1KILC 4PV1C 2B9BA 1N73B 4WY4B 3L71G 3CWBJ 1FI3A 1NWQA 1YBKA 2BH5X 3M9HA 4ZKPA 3AE2C 4IL6H 1KD1Q 3P8MC 1JDLA 3MUDA 5CCGA 2H88C 4W7YA 1KB9E 1GIWA 1KYOW 1VQOP 1URQD 1AJYA 1C6OA 1KFMA 1N15A 3BATA 1SVFA 5B5EV 2XZRA 3OA7A 1AQ5A 3AE5C 1HZVA 3A0BH 3L72G 4H13D 3EFFK 1BE3G 3H1LD 1S6VB 4L1QA 1AA0A 3VP8A 1JY2P 4H13C 1FAVA 2HV4A 1CIEA 2ORLA 5KAIE 3VTPC 3ORVA 1KILB 5KLVD 4PV1B 2N9BA 1YEAA 2B87A 2KXPB 1L2PA 4HYTB 1C7MA 2RMZA 5GTHV 1ZR2A 4GKGA 3GF3A 1IFNA 4EIEA 1NTMG 5CCHC 1KQFB 1HH7A 2AXTE 1U75B 2K9YA 1JB0J 1FZFA 3USSA 3H1LJ 1NVOA 1PL5A 1K3HA 2FKWB 3IFMA 4WWIA 2ZAEB 3WMM0 1WRGA 2FFDA 1SQQD 3CYTI 1DX7A 1H9YA 1C75A 4DY9A 2OARA 1JY2O 3G9RA 5M1BA 3TSIA 1MG2D 3RLMA 3WFCC 4L3HA 3RK2D 4D6TG 2LKMA 4H13B 1NKZB 5AW7B 2ZOOA 5AVQB 3Q5SA 1NAYA 2E74D 2N9JA 2E74C 3CL3D 1T2KD 1HRCA 1CSUA 3HTKA 2Q7CA 1JY3N 3B5ND 3L70J 5BU8B 3CXHI 1BGYD 2QJKC 1SQQJ 2FXOA 4L74A 4WQEA 1NTKG 2KI7B 4ZKUA 1LTBC 1HGVA 2B10B 1L0NG 1JCCA 1YI2P 1CEDA 2ZT9D 4K35A 2KSJA 3O5CA 5EXQA 1CZQA 1M8OB 4RJTA 1HBWA 2B88A 3T97B 1GZLA 4OVNF 1KB9H 1GK4A 4DZOA 4PW9B 1VL2A 1H0TB 1KYOE 1VQLP 3D71A 5EFWB 3CC2P 3KQGA 1LT1A 3AECC 2O1KA 2HG5D 4OH8B 3CC4P 1GMJA 1BGYJ 2MJZA 1C6SA 3CCEP 1E8EA 2E74B 3KYQA 3H1HD 5AW3B 1CORA 3IF4A 1H31B 3O8ZA 1S5LX 2QJKB 3CXHW 1A2SA 2HPCA 1U74B 2YXRB 3FXEA 4ASVA 1AOQA 1OAEA 4N78D 1S1CX 1YNRA 4O1QA 1BCCD 2ZT9B 1G1IA 1IZNB 1LP1B 1SQBK 2WWWA 2WTYA 2HLOA 1DT1A 2AXTH 3EQ2A 1RE4C 3L72E 3RN0A 1RF0C 3DMIA 4QAOA 4XXLA 1EZVI 2JTIB 2I1JA 5TISV 4P4QB 4H0LC 2CXBA 5IY51 2IFNA 4Y28J 4BXLA 2C9NY 2M0BA 1ZOYC 5CJ4A 2A45H 1LJ2A 2CE0A 1FDMA 1PZQA 2PACA 1EZVG 2WSEH 5GTIH 3V6IA 1OW8A 5DJUB 2WPQA 1FCDC 1R0QA 4O1WA 3RN1A 1HROA 1NHLA 4AUWA 1KB9D 1NTZK 1GDVA 4WQ7A 2BCCJ 2P58A 5C39A 2LIRA 4PWAA 2E5TA 1VDFA 1Y47A 1OX3A 2HR3A 3PH2B 4D6TE 5CICB 1CHJA 4R4MA 1EDKA 2DW3A 2JKVA 2GA1A 1USEA 1QYZA 3HE5B 1QEXA 4H0LB 2JP3A 3MUDC 5CCGC 3SXTA 3IR9A 3VMZA 1VQ8P 3H1JJ 1KYOH 1M90Q 3K5BA 3TGUE 2FXPA 1NMLA 1MFTA 4C7NA 3LIDA 2R3SA 1CYCA 3V4QA 1NTKE 3IAOA 1VQKP 1FC2C 1URQA 1H33A 3SWYA 1FBMA 2BPBB 5GTHH 1CXAA 1OW6A 3CXHE 1JUNA 2YKOA 1LTTC 3KXDA 1ZW0A 2K9JA 2YKQA 5L8RJ 3A0BV 3DP5A 155CA 1VYDA 3PXSA 1DEBA 1L4AA 1S9KE 2Q5UA 3CCJP 1J3SA 4U3FJ 5BVZA 4GEDB 4JPZB 2ZJSE 1SQXG 3L4MA 2IZ0A 5DJQC 4AAOA 3II6A 1LTSC 2YMYA 1U7JA 1JMMA 2FFDC 2C9XB 3WFEC 1SQVE 3JCUE 3M97X 1JMBA 4LGDE 4ZMDA 1MUUA 1YITP 3NBSA 2C1VA 1FDOA 3L73J 1X22A 1PFIA 1AVOA 3KZIE 2ZYAA 2IPPA 2QM7A 1KV4A 1BL9A 3HQ8A 3MP7B 3QH9A 1KORA 2B87B 2NRGA 1OMIA 1SQBJ 1X79B 4PJ0E 1QL1A 3CCVP 1ZXGA 2ZXYA 4WQBA 1KYOD 1GL2C 5AVTB 3RBZA 1H8AA 1QVGO 1LT9A 1RQVA 1YCCA 3WFBC 1Z56A 1ZP0C 5DJQB 1ZR4A 3L71D 1J2JB 2KNCB 2FFDB 2FRCA 5CIDB 3V2QA 4EOTA 2O01N 1C6RA 1FZCA 1PGOA 4H0KA 2DGEA 2WZ7A 2E76D 3P7KA 2K3RA 2M5AA 2GC4D 2Q1KA 3NXSA 1OIPA 1J1EC 1MV8A 1YICA 1N7SA 1KMIZ 3H6PA 3BCCE 4H44D 1ZLLA 5AW8B 4H44C 1DIIC 3SFEC 3RMZA 3HTKB 2IZ1A 1NU1G 1IFPA 1I6DA 3L71J 4QMAA 3L72D 1H9XA 3AEBC 3CXHH 5KLVK 3SJLA 1GL2B 4ZNCA 2RH0A 1CI6B 3F89A 1W5CE 3HUSA 2M3EA 1QX8A 2O1JA 4AANA 1AFOA 2R44A 2OYOA 3UIAA 1FZGA 1S72P 3RK3C 5TISH 2K88A 2YO3A 1A56A 5KAIV 1N90A 3H25A 2JEEA 3M06A 4NFGB 2PCBB 1HJ3A 2P1JA 3VYMA 3GHGA 1NYHA 1EQ7A 2NPSA 5CBNA 1NTMD 3G3ZA 3BASA 3TDKA 1KC8Q 1SQQK 1CSWA 2K1AA 1YJ9P 3V2PA 1AQTA 1WEJF 1PP9J 1J1EB 1FJ0A 3JCUH 1BE3J 2BLFB 1FOSF 3TK1A 2ZYDA 4H44B 2AXTV 1WMKA 3GMAA 1T3UA 5AURA 4GYDA 3KZIH 1FI7A 2O01H 3VMXA 2UWJE 4D6TD 3C9IA 1MZ4A 1JCDA 2HPCB 3WUVA 4WVZA 1SQXE 2E5YA 3HRNA 3H1KE 5AVYB 1NOHA 1NTMJ 5KTBA 2WPRA 2FWLA 3RK3B 2J5UA 4OGQD 2CPSA 3PH0A 2Y0CA 3OAKA 1L9BC 3TGUD 2B4ZA 3M9QA 2L4DA 1TU3F 4NPEA 4YTPC 3EWKA 1HWTC 2QG4A 2P2UA 2ZYGA 2C0WA 1NTKD 1IK9A 2EXVA 4Y99C 2LXCB 2C1UA 3CP5A 2ZFCA 2ZXEB 1F1FA 2BH4X 2JJLA 1ZRTE 1L0ND 2P67A 4IFMA 3CCRP 2FBWC 2FXMA 4UB6E 3CXHD 2G8YA 2ITAA 1Y9BA 1OWAA 1FS0E 4C7RA 3VMAA 4MU8A 2ZVOB 1URQC 2WPSA 1BDDA 1IK7A 1FZAA 3L74G 1FU1A 1E5WA 4JF7A 1K04A 4WQCA 3CX5I 3S1KA 1KFNA 1K8AQ 4N0KA 4JQ0D 1GQ1A 2FYUG 1L0NJ 3D70A 3JC22 3FWNA 1X9VA 1SQPG 2VHDA 1L4AD 2WSSH 5CHXA 2PRRA 1PGQA 2OGUA 4Y99B 1L4AC 3M0DA 3RL0D 3E7KA 1N9CA 2ZZS1 2BASA 2FY8A 3AE8C 2RKLA 5AW2B 4Q5PA 3H32A 3HD7D 1NU1E 1RAPA 1FE6A 4C7NB 2AI5A 1NIRA 4L3GA 2YMKA 3W67A 5KJ7A 2N1TD 1JNMA 1A02J 1URQB 1H33B 3OJAB 1CW5A 4GODA 2QJPC 5KLVJ 2Y9ZA 5KAFE 3CI9A 3SFDC 3IN6A 4UB8E 2M8RA 2PGDA 1EDIA 3RK2C 3CX5W 5C0ZA 2CA3B 2GM4A 2QRXA 4LC1A 3CCMP 2OQQA 1EZVD 1IZL0 2K9JB 3CWBG 4DT0A 3L4OA 1QVFO 3B4SA 1HJ0A 3LW5H 1N7LA 2W6JH 4I1LA 2O01J 3I55P 4XYDB 3AEEC 4EIJA 4AQRD 2R5BA 1L0LG 4BRYA 2AIUA 3JBTB 3TGUG 1L4AB 1SS1A 4O9BA 3VMYA 2QVAA 2WSCH 1T2KC 1K9MQ 2WPVB 3B5NC 3M91A 1M70A 1COTA 1DW0A 5KLIC 1CRCA 3L36A 4KHXA 1HH0A 3OCDA 1Q82Q 3KHUA 3WU2E 3MD0A 3BCCD 3CLQA 4FA1A 1M57D 1CTYA 1CNOA 1LC2A 5KKZC 5AVXB 3BRTB 2WSFH 5AW4B 1GU4A 1VF5D 1FZCC 3L75G 5DF5A 1S2EA 2ZT9C 2J59M 1CRIA 1EB7A 4NPFX 1A8CA 1F1CA 2QJPB 3O20A 4UB6H 1IO3A 1T3JA 3L4FA 2WT7B 1OCDA 1VQ4P 1ETPA 2K37A 2LXBA 3Q3DA 2V7QH 1N7SD 3U1CA 1FI9A 4I7ZC 5CIBB 3OA8A 3RK2B 1NNOA 2XTSB 1YIQA 3CMEP 1SFCD 1YTZI 1HTLC 4EIDA 1CTZA 1ZV8A 1KX7A 1QN2A 1DH3A 1CC5A 1MFZA 2Y9YA 5KAIH 1NTZE 3B5NB 3CCSP 3HUSC 5KLIB 1JEKA 1SQVG 1H1OA 1IQCA 5CIEB 5CMZA 2Q6QA 5E79E 5CIGB 1CRYA 3Q1MA 5KKZB 3PHLA 2AEFA 1KQSO 3NBTA 1BSHA 1FZCB 1CRJA 2NPSD 2IX7C 3GHGC 1ZN5A 3V2RA 1S5LE 2M5AB 1H88A 2XNXA 3L74E 2OTKE 3SWSA 2OYHC 5APWA 4L73A 1KQGB 1YFCA 4TT3H 4I7ZB 2GUVA 1SQXD 5B6QA 2FYUE 3AEAC 3H1HJ 2IYOA 1SQPE 1EXIA 1HCMA 1CRGA 2ZBOA 1FZEA 3RBXA 3L70G 4UB8H 1N73A 4WY4A 3CX5E 2D0SA 1DVHA 3VP9A 1AVYA 2WITA 1BCCJ 3HUSB 2KS1A 3A0HE 2E42A 2JWAA 3KZIV 1Q7YQ 5AVRB 2CPBA 2Y0EA 1SQXJ 3MK7C 1EC5A 3GHGB 3BCCG 3D6ZA 3WU2H 2CK3H 4PJ0V 2OYHB 2E43A 3U1AA 4WBAA 3JSVC 3W68A 1IFIA 1B7VA 2POHA 4K3AA 4H0JA 5AW5B 3CWBE 1DD4A 3SSUA 1MG3D 4AAMA 1R8EA 2IDBA 1HJBA 2XNDH 2C0XA 1L0LE 2WSFJ 2L5GB 4HKZH 4DOJA 3ZOWA 1VQ9P 3PTZA 1LS9A 4XFJA 3SWKA 5APSA 4Y5RA 4OWFA 2V7QJ 1AV1A 3C8VA 1GU5A 1LNQA 1RAQA 3EFGA 5AW0B 1KILE 1RHZB 1N8RQ 1GW3A 3L75E 2ZXXA 3MK7B 1NJIQ 2W6AA 1NU1D 4IFFA 2RN0A 3B8EB 3GLMA 2VRSA 4XA4A 5E79H 2MHMA 3OW2O 1CIFA 1P84I 4J20A 2N9YB 5CIFB 1IJDB 2ZVNB 3M0AA 4YE1A 4IFDK 3M9BA 2L91A 1NTMK 1G2CA 4ASWA 1S5LH 3AE6C 2YCCA 1QL2A 1OXZA 1I54A 5KJ7D 3O0RC 3H1KG 3RGUA 3ABVC 5KJ7C 2ZONG 5APUA 3HD7A 3PRJA 2QE7H 1NAFA 1NU1J 3ZOXA 3Q5RA 2NZ2A 1DW3A 1S4XA 1USDA 2Z5HA 2N1TA 3H1LE 3MZWB 4YXWH 3CX5H 1X0TA 1YQ3C 1U7MA 2XV5A 1ZMEC 2KUBA 2FYNC 2BEZF 3A0HH 2N18C 1RF1A 1XTGB 2WSEJ 2C8SA 1CSVA 2N3YA 4EDFA 1M1KQ 3H1JG 3H32B 1NTKK 4GOFA 4JYBA 3L70E 2HFED 2OZ1A 4EI2A 1L0NK 1I8OA 2JR8A 1CSXA 1AYGA 4IL6X 1R5SA 2Y0DA 5B66E 1H31A 1LMSA 2KP8A 4RESB 1NTZD 2E76C 4GT1A 2H43A 351CA 3PJSK 2A06G 2XKMA 1VQ6P 1YYCA 2FYNB 4N3YB 4UB6V 2N18B 3SVWA 1DW2A 4IL6E 4L76A 3G71P 4BRYB 2PP6A 1NMIA 1UIXA 1CYJA 1SFCA 1BGYE 4GIFA 2SPZA 2D0WA 4PD4I 3L74D 1CCHA 1JTHA 2HODA 4U3FG 1VQPP 3OCDB 2Q3IA 3L37A 1CSBA 1MZ9A 2YXQB 2FYUD 1GDTA 1G1JA 4R4LA 1M6ZA 3TYYA 1SQPD 2O3JA 3KDPB 3N7NA 4LJIA 4B86A 1C2NA 3V5BA 1FZBA 3CX5D 1JY2N 2D2CD 4AALA 2E76B 1QL3A 1DEEG 2YIUC 4RKUJ 2R5DA 1QGKB 1CHHA 1LC1A 3L72J 2E75D 2HYNA 1SQBG 1JO5A 4WY4D 1U57A 3E1IA 2CA4B 5K5GB 1GJQA 5AVZB 2GB8B 5H2FE 2W90A 2BCNB 1M1JA 3N4XA 3VN0A 2IBZI 4N78E 5KAFV 1BSNA 4PJ0H 3CWBD 3TNUA 4UB8V 3AE3C 1P84E 3BVHA 4L75A 3I5CA 1EXJA 1L0LD 4OGQC 2JDIH 2P7JA 3O6QA 3RL0g 1PPJG 3CCLP 2JQRA 1FDIA 1VQMP 2IBZG 3AEDC 4EICA 2YIUB 2BCCE 1K05A 3B71A 1AOFA 3MTUE 1NH4A 2QJYC 1KTMA 1WVEC 5B66H 1NTZG 3GW6A 4D6TJ 1KIBA 1KILD 3L75D 2PFXA 3WU2V 5APVA 1N50A 3AEGC 1I55A 1LWUA 3G4SP 1LTAC 1HZUA 1RE3A 3H1JE 4DJGA 1L0LJ 2OTLP 4KT0J 2KS1B 3TGUJ 4A7PA 2I8FA 3PXWA 5CBOA 1S9KD 3ZIYA 4N6JA 1W2EA 3CCUP 1NTKJ 4IOIH 3WUTA 3ZOOA 3PLNA 1IRWA 4OGQB 1I6EA 1E29A 3C2CA 1RY3A 1W5CT 3LIEA 4TLFA 1LTIC 1KX2A 3L75J 2QA4P 2QSIA 1PP9G 1SQVD 1H32A 4NPDA 3TYIA 2A06E 1QKSA 3CU4A 3NWVA 1D7MA 2QJYB 1BDCA 2OYIA 3HQ6A 3RL0C 2CE1A 2BEQD 3SLEA 5E79V 3X39A 1SQXK 1K3GA 5AW1B 1CCRA 2KIKA 3HD7C 1VQ7P 3WUIA 1MKMA 1VQNP 4U3FE 1YJNP 1PV3A 1KQLA 1VQ5P 5CCHD 2Q9IA 2N1TC 1S5LV 2V08A 3H1IG 1XTCC 2OTJP 3ZCFA 2GIWA 3PXTA 4HH2A 5H2FH 2FYZA 1SQVJ 1FOSE 3F5HA 1CTJA 4PD4E 3ZBMA 3L70D 3AEFC 4JYCA 3P32A 1LGHB 1YJWP 2W27A 3L73E 2KNCA 1SLQA 2J58A 1RF1C 2B11B 4HJGH 1FJKA 4WQDA 2JWDA 4JCGA 4C46A 5CYTR 1P84H 3P8CE 4RSZA 4W80A 1NKNA 1NGMB 1OVRA 4AX3A 1G2CB 3RL0B 1IO4A 1SQBE 5GTIE 3GG2A 1LT9C 5DJTB 3A0HV 1UIIA 4WB4A 2DVHA 2WMMA 3CCQP 3HD7B 2PCCB 3TF5A 2V07A 4K3IA 3BRVB 1VF5C 2N1TB 4U7JA 3U59A 3WFDC 2N3BA 1GL2A 1SP4A 1CI6A 1LTGC 3VNWA 4GOEA 2LR2A 1N7SC 1FJPA 4FANA 1Q90D 1HUCA 5AW6B 1GTWA 3CC7P 1PPJE 1RF1B 2IBZE 2R3CA 1AKKA 4LLHA 1K73Q 1SFCC 1DVVA 1FOCA 5B5EE 3BCCJ 1NU1K 3AE7C 451CA 2PAJA 1E79H 3HE4A 3AE9C 3FX0A 1LT9B 2P10A 3E1RA 3L71E 1DD3A 2OZ1B 3H1LG 1Q81Q 3FXDA 2XDJA 1GKSA 2H89C 3V4WA 3S4RA 5AVUB 1LTJA 5GTHE 1VF5B 5KLVG 3WC8A 1WT6A 1LFMA 3MHVA 4DCKA 2NPSC 3CPWO 4HB1A 2Q3EA 1N86A 1PGJA 1YHQP 2C1DA 3NMDA 1N7SB 3H1KD 2KZJA 2IFMA 1A02F 1P84D 5APQA 1PP9E 5KAFH 3ITKA 1SFCB 4Z1MH 1BE3E 4MN4C 4PD4H 2XU6A 1CYIA 1JTHB 1SQQG 2HODB 2V4HA 2C9LY 1KZUB 1M1JC 1N2DC 1W2LA 4H0LD 2BCCD 5AVSB 4M3LA 2Z5IA 1R5LA 3RK3E 5BU5A 3A7OA 1ZRTD 1JY3P 4KJMA 2JO1A 2KB7P 1QL4A 3NFQA 1RQUA 1FHBA 3LW5J 3H1KJ 5CJ0A 3ZOYA 1NTME 3H1IE 2W8ZA 2NPSB 1T8ZA 5CIHB 1KV9A 1ZZHA 2AXCA 3H1JD 4EIFA 2R32A 2WSCJ 1E2RA 2YKPA 1BGYG 3CD6P 2YO2A 1T6AA 1LWUC 3FWLA 1KILA 3HQ9A 4V2KA 3DR0A 1RE3C 1RZ5A 1IC2A 1M1JB 1OZHA 1JY3O 5CCGD 5B66V 1CO6A 2A06D 3TNUB 1L9JC 1RZ6A 5B5EH 3I56P 3ZDMA 2M3BA 2H7HA 5AVVB 2I8DA 2FYUK 3O6QB 2QEXP 4IL6V 1OFCX 1RH5B 1SQPK 4U3FD 2W83C 1GW4A 4FA9A 1YIJP 3H1HG 4W7ZA 1PIXA 1L0NE 2KOGA 2MKVA 3M0DC 1Y8AA 2OYIC 2QIWA 2G3AA 2GC7D 1DW1A 4PD4D 1LWUB 2AEJA 1JOCA 3A9FA 3L73D 4WQAA 5DFSA 4JBZA 1BCCG 3P8CD 3KPEA 5TISE 1VPCA 3R2PA 2B0ZB 2YQBA 1DIQC 3CMAP 5CCHA 1CXCA 2C2CA 1SQBD 1CHIA 3D0WA 2KLUA 4GDOA 1W2BO 2BCCG 1PGPA 5AW9B 5KLVE 1I8PA 1EDLA 2KK7A 1CIHA 1GU2A 1H32B 1IFMA 3T97A 3FGAD 5H2FV 2WT7A 1L0LK 3Q2YA 1HGZA 1KB9I 5AVWB 1J1DC 2OYIB 1YEBA 1H0TA
chains in the Genus database with same CATH topology
2BGVX 4XYDB 1FCDC 1L0LD 2AIUA 3VRDA 1R0QA 3JBTB 4O1WA 3RN1A 1HROA 1PPJD 1M60A 2JQRA 1M70A 1COTA 1DW0A 2IBZD 1CRCA 1KB9D 3OCDA 4EICA 2YIUB 1GDVA 4WQ7A 2LIRA 3KHUA 4PWAA 3BCCD 1AOFA 4FA1A 1CTYA 1CNOA 1LC2A 1WVEC 3PH2B 3GW6A 5CICB 1KIBA 5DF5A 1CHJA 3L75D 3WU2V 1C52A 1N50A 1CRIA 1I55A 1EB7A 1A8CA 1F1CA 2QJPB 3O20A 1QYZA 1IO3A 1OCDA 1ETPA 3SXTA 1HZUA 1FI9A 5CIBB 1HJ4A 3OA8A 1NNOA 4A7PA 1NMLA 2I8FA 1YIQA 2XTSB 3PXWA 3ZIYA 1CYCA 4EIDA 1CTZA 1KX7A 3ZOOA 1H33A 1IRWA 1QN2A 3PLNA 1I6EA 1CC5A 1E29A 3C2CA 1W5CT 2BPBB 4WQ9A 1KX2A 5KLIB 1CXAA 1H1OA 1SQVD 1PP9D 1IQCA 1H32A 3TYIA 5CIEB 1BE3D 1QKSA 3CU4A 5CIGB 3NWVA 1IRVA 1CRYA 2QJYB 5KKZB 3PHLA 3A0BV 4FA5A 3HQ6A 3DP5A 155CA 1VYDA 1C2RA 3NBTA 3PXSA 2B12B 2CE1A 1CRJA 3SLEA 3OA8B 5E79V 3X39A 1K3GA 1CCRA 1CIGA 1KB0A 2YK3A 1J3SA 3SWSA 5C9MA 3WUIA 1YFCA 4GEDB 3L4MA 4WQ8A 1CRHA 1SQXD 5DJQC 5B6QA 1S5LV 2V08A 4AAOA 3H1ID 3ZCFA 4KMGA 2C9XB 2GIWA 3WFEC 1HCMA 1CRGA 2ZBOA 3PXTA 4FA4A 3M97X 1CTJA 3ZBMA 3L70D 2MTAC 3NBSA 2D0SA 2C1VA 1DVHA 4FAVA 5TJHA 1YTCA 2B11B 4WQDA 4JCGA 2LITA 1BL9A 3HQ8A 5CYTR 4FB1A 4RSZA 1HJ5A 2KS1A 1I5TA 2JWAA 3HQ7A 3KZIV 4AX3A 2Y0EA 2N9IA 3GG2A 2C1DB 3MK7C 3A0HV 2ZXYA 4WQBA 2DVHA 5GTIV 1KYOD 2PCCB 4PJ0V 3TF5A 3O1YA 2V07A 4K3IA 1YCCA 3WFBC 1B7VA 5DJQB 4H0JA 3L71D 1FI3A 1MG3D 4AAMA 3WFDC 2KNCB 2N3BA 2FRCA 5CIDB 2BH5X 1C6RA 4H0KA 3VNWA 2DGEA 4FANA 3ZOWA 1JDLA 1LS9A 3PTZA 2GC4D 1AKKA 4Y5RA 1YICA 1DVVA 1GIWA 1FOCA 1KYOW 1C6OA 451CA 1RAQA 1N15A 1DIIC 3RMZA 5B5EV 3MK7B 1NU1D 1HZVA 1I6DA 2RN0A 3L72D 1H9XA 2OZ1B 3H1LD 1S6VB 4L1QA 3SJLA 1GKSA 2HV4A 2MHMA 1CIEA 1CIFA 2ORLA 4J20A 3ORVA 3WC8A 5KLVD 1LFMA 2N9YB 5CIFB 4AANA 4YE1A 1YEAA 2Q3EA 2L91A 1A56A 5KAIV 1N90A 2C1DA 2YCCA 1C7MA 2RMZA 5GTHV 1I54A 4NFGB 2PCBB 1HJ3A 3O0RC 3VYMA 4EIEA 3H1KD 1NTMD 2ZONG 1P84D 1HH7A 3PRJA 3TDKA 1CSWA 1U75B 3ZOXA 1WEJF 3ITKA 1DW3A 1FJ0A 1K3HA 2BLFB 1CYIA 2AXTV 1SQQD 3CYTI 1H9YA 1C75A 1W2LA 4DY9A 5AURA 2BCCD 4GYDA 1FI7A 1MG2D 1ZRTD 3RLMA 3WFCC 4L3HA 2N18C 4D6TD 1QL4A 1MZ4A 2C8SA 1FHBA 1CSVA 3ZOYA 2ZOOA 2N3YA 4EDFA 2FWLA 5CIHB 2N9JA 1KV9A 1ZZHA 3H1JD 4EIFA 2Y0CA 1L9BC 3TGUD 1HRCA 1CSUA 2B4ZA 1E2RA 2L4DA 2OZ1A 1BGYD 1I8OA 2QG4A 4WQEA 1CSXA 1NTKD 2EXVA 2C1UA 3CP5A 1AYGA 1F1FA 3FWLA 2B10B 2BH4X 2Y0DA 1L0ND 1H31A 1LMSA 1CEDA 3HQ9A 4V2KA 3DR0A 1NTZD 3O5CA 5EXQA 1RZ5A 4RJTA 351CA 3CXHD 5B66V 1CO6A 2A06D 1L9JC 4PW9B 1RZ6A 2FYNB 3VMAA 4MU8A 4UB6V 2N18B 3SVWA 1DW2A 1NMIA 1CYJA 1C6SA 2D0WA 3L74D 1CCHA 4IL6V 4WQCA 1E8EA 4U3FD 3OCDB 4N0KA 4FA9A 1GQ1A 3H1HD 2FYUD 1CORA 1H31B 1M6ZA 1SQPD 2QJKB 2VHDA 2O3JA 3CXHW 1A2SA 4LJIA 2GC7D 1U74B 1DW1A 4PD4D 1C2NA 1AOQA 3CX5D 3A9FA 1OAEA 3L73D 4WQAA 1N9CA 2ZZS1 4AALA 5DFSA 1YNRA 4O1QA 1BCCD 1QL3A 4Q5PA 1DT1A 1CHHA 1RAPA 1LC1A 2B0ZB 2YQBA 2AI5A 1NIRA 4L3GA 1DIQC 3RN0A 3DMIA 4QAOA 1CXCA 2C2CA 4XXLA 1SQBD 1CHIA 2JTIB 5TISV 1H33B 4P4QB 2CA4B 1GJQA 2CXBA 2GB8B 5IY51 1I8PA 2BCNB 2CE0A 1CIHA 1GU2A 1H32B 3CX5W 2PACA 5C0ZA 2CA3B 5H2FV 1EZVD 1IZL0 5KAFV 2K9JB 3CWBD 3L4OA 4UB8V 1YEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BGV X;  4XYD B;  1FCD C;  1L0L D;  2AIU A;  3VRD A;  1R0Q A;  3JBT B;  4O1W A;  3RN1 A;  1HRO A;  1PPJ D;  1M60 A;  2JQR A;  1M70 A;  1COT A;  1DW0 A;  2IBZ D;  1CRC A;  1KB9 D;  3OCD A;  4EIC A;  2YIU B;  1GDV A;  4WQ7 A;  2LIR A;  3KHU A;  4PWA A;  3BCC D;  1AOF A;  4FA1 A;  1CTY A;  1CNO A;  1LC2 A;  1WVE C;  3PH2 B;  3GW6 A;  5CIC B;  1KIB A;  5DF5 A;  1CHJ A;  3L75 D;  3WU2 V;  1C52 A;  1N50 A;  1CRI A;  1I55 A;  1EB7 A;  1A8C A;  1F1C A;  2QJP B;  3O20 A;  1QYZ A;  1IO3 A;  1OCD A;  1ETP A;  3SXT A;  1HZU A;  1FI9 A;  5CIB B;  1HJ4 A;  3OA8 A;  1NNO A;  4A7P A;  1NML A;  2I8F A;  1YIQ A;  2XTS B;  3PXW A;  3ZIY A;  1CYC A;  4EID A;  1CTZ A;  1KX7 A;  3ZOO A;  1H33 A;  1IRW A;  1QN2 A;  3PLN A;  1I6E A;  1CC5 A;  1E29 A;  3C2C A;  1W5C T;  2BPB B;  4WQ9 A;  1KX2 A;  5KLI B;  1CXA A;  1H1O A;  1SQV D;  1PP9 D;  1IQC A;  1H32 A;  3TYI A;  5CIE B;  1BE3 D;  1QKS A;  3CU4 A;  5CIG B;  3NWV A;  1IRV A;  1CRY A;  2QJY B;  5KKZ B;  3PHL A;  3A0B V;  4FA5 A;  3HQ6 A;  3DP5 A;  155C A;  1VYD A;  1C2R A;  3NBT A;  3PXS A;  2B12 B;  2CE1 A;  1CRJ A;  3SLE A;  3OA8 B;  5E79 V;  3X39 A;  1K3G A;  1CCR A;  1CIG A;  1KB0 A;  2YK3 A;  1J3S A;  3SWS A;  5C9M A;  3WUI A;  1YFC A;  4GED B;  3L4M A;  4WQ8 A;  1CRH A;  1SQX D;  5DJQ C;  5B6Q A;  1S5L V;  2V08 A;  4AAO A;  3H1I D;  3ZCF A;  4KMG A;  2C9X B;  2GIW A;  3WFE C;  1HCM A;  1CRG A;  2ZBO A;  3PXT A;  4FA4 A;  3M97 X;  1CTJ A;  3ZBM A;  3L70 D;  2MTA C;  3NBS A;  2D0S A;  2C1V A;  1DVH A;  4FAV A;  5TJH A;  1YTC A;  2B11 B;  4WQD A;  4JCG A;  2LIT A;  1BL9 A;  3HQ8 A;  5CYT R;  4FB1 A;  4RSZ A;  1HJ5 A;  2KS1 A;  1I5T A;  2JWA A;  3HQ7 A;  3KZI V;  4AX3 A;  2Y0E A;  2N9I A;  3GG2 A;  2C1D B;  3MK7 C;  3A0H V;  2ZXY A;  4WQB A;  2DVH A;  5GTI V;  1KYO D;  2PCC B;  4PJ0 V;  3TF5 A;  3O1Y A;  2V07 A;  4K3I A;  1YCC A;  3WFB C;  1B7V A;  5DJQ B;  4H0J A;  3L71 D;  1FI3 A;  1MG3 D;  4AAM A;  3WFD C;  2KNC B;  2N3B A;  2FRC A;  5CID B;  2BH5 X;  1C6R A;  4H0K A;  3VNW A;  2DGE A;  4FAN A;  3ZOW A;  1JDL A;  1LS9 A;  3PTZ A;  2GC4 D;  1AKK A;  4Y5R A;  1YIC A;  1DVV A;  1GIW A;  1FOC A;  1KYO W;  1C6O A;  451C A;  1RAQ A;  1N15 A;  1DII C;  3RMZ A;  5B5E V;  3MK7 B;  1NU1 D;  1HZV A;  1I6D A;  2RN0 A;  3L72 D;  1H9X A;  2OZ1 B;  3H1L D;  1S6V B;  4L1Q A;  3SJL A;  1GKS A;  2HV4 A;  2MHM A;  1CIE A;  1CIF A;  2ORL A;  4J20 A;  3ORV A;  3WC8 A;  5KLV D;  1LFM A;  2N9Y B;  5CIF B;  4AAN A;  4YE1 A;  1YEA A;  2Q3E A;  2L91 A;  1A56 A;  5KAI V;  1N90 A;  2C1D A;  2YCC A;  1C7M A;  2RMZ A;  5GTH V;  1I54 A;  4NFG B;  2PCB B;  1HJ3 A;  3O0R C;  3VYM A;  4EIE A;  3H1K D;  1NTM D;  2ZON G;  1P84 D;  1HH7 A;  3PRJ A;  3TDK A;  1CSW A;  1U75 B;  3ZOX A;  1WEJ F;  3ITK A;  1DW3 A;  1FJ0 A;  1K3H A;  2BLF B;  1CYI A;  2AXT V;  1SQQ D;  3CYT I;  1H9Y A;  1C75 A;  1W2L A;  4DY9 A;  5AUR A;  2BCC D;  4GYD A;  1FI7 A;  1MG2 D;  1ZRT D;  3RLM A;  3WFC C;  4L3H A;  2N18 C;  4D6T D;  1QL4 A;  1MZ4 A;  2C8S A;  1FHB A;  1CSV A;  3ZOY A;  2ZOO A;  2N3Y A;  4EDF A;  2FWL A;  5CIH B;  2N9J A;  1KV9 A;  1ZZH A;  3H1J D;  4EIF A;  2Y0C A;  1L9B C;  3TGU D;  1HRC A;  1CSU A;  2B4Z A;  1E2R A;  2L4D A;  2OZ1 A;  1BGY D;  1I8O A;  2QG4 A;  4WQE A;  1CSX A;  1NTK D;  2EXV A;  2C1U A;  3CP5 A;  1AYG A;  1F1F A;  3FWL A;  2B10 B;  2BH4 X;  2Y0D A;  1L0N D;  1H31 A;  1LMS A;  1CED A;  3HQ9 A;  4V2K A;  3DR0 A;  1NTZ D;  3O5C A;  5EXQ A;  1RZ5 A;  4RJT A;  351C A;  3CXH D;  5B66 V;  1CO6 A;  2A06 D;  1L9J C;  4PW9 B;  1RZ6 A;  2FYN B;  3VMA A;  4MU8 A;  4UB6 V;  2N18 B;  3SVW A;  1DW2 A;  1NMI A;  1CYJ A;  1C6S A;  2D0W A;  3L74 D;  1CCH A;  4IL6 V;  4WQC A;  1E8E A;  4U3F D;  3OCD B;  4N0K A;  4FA9 A;  1GQ1 A;  3H1H D;  2FYU D;  1COR A;  1H31 B;  1M6Z A;  1SQP D;  2QJK B;  2VHD A;  2O3J A;  3CXH W;  1A2S A;  4LJI A;  2GC7 D;  1U74 B;  1DW1 A;  4PD4 D;  1C2N A;  1AOQ A;  3CX5 D;  3A9F A;  1OAE A;  3L73 D;  4WQA A;  1N9C A;  2ZZS 1;  4AAL A;  5DFS A;  1YNR A;  4O1Q A;  1BCC D;  1QL3 A;  4Q5P A;  1DT1 A;  1CHH A;  1RAP A;  1LC1 A;  2B0Z B;  2YQB A;  2AI5 A;  1NIR A;  4L3G A;  1DIQ C;  3RN0 A;  3DMI A;  4QAO A;  1CXC A;  2C2C A;  4XXL A;  1SQB D;  1CHI A;  2JTI B;  5TIS V;  1H33 B;  4P4Q B;  2CA4 B;  1GJQ A;  2CXB A;  2GB8 B;  5IY5 1;  1I8P A;  2BCN B;  2CE0 A;  1CIH A;  1GU2 A;  1H32 B;  3CX5 W;  2PAC A;  5C0Z A;  2CA3 B;  5H2F V;  1EZV D;  1IZL 0;  5KAF V;  2K9J B;  3CWB D;  3L4O A;  4UB8 V;  1YEB A; 
#chains in the Genus database with same CATH topology
 2BGV X;  2H8P D;  5APT A;  3VRD A;  1Q86 Q;  2KLV A;  3Q5P A;  1GD2 E;  1PPJ D;  1M60 A;  1SQQ E;  2IBZ D;  1S3J A;  1KN7 A;  1GL2 D;  1OVU A;  3MGN A;  3B5N A;  3A2A A;  2IYP A;  1C52 A;  5APY A;  1EZV E;  3A5T A;  1GK6 A;  2Z4E A;  3NTN A;  4I2L C;  3L35 A;  4BWN A;  3S9O A;  1HJ4 A;  1LP1 A;  2GUS A;  2I1K A;  1J1D B;  1HVV A;  1SQV K;  1X8Y A;  4WQ9 A;  1NTZ J;  1NO4 A;  2A45 I;  1H89 A;  3A0B E;  3AE1 C;  1PP9 D;  1LTJ C;  1HF9 A;  3G6E P;  1BE3 D;  2KYV A;  3V2N A;  1IRV A;  3L73 G;  3PP5 A;  4FA5 A;  1C2R A;  2B12 B;  2D2C C;  1YQ4 C;  3OA8 B;  2WQY C;  3RK3 D;  2A45 G;  3D6Y A;  1CIG A;  1KB0 A;  2YK3 A;  4XE5 B;  3L74 J;  5C9M A;  1YTZ T;  2KSE A;  1EDJ A;  4WQ8 A;  4I6M C;  1CRH A;  2E75 C;  4YPC A;  3R4Y A;  3H1H E;  4CPG A;  2FYU J;  1N73 C;  4WY4 C;  3H1I D;  1RE4 A;  4KMG A;  3HE4 B;  2OYH A;  1RF0 A;  1SQP J;  4FA4 A;  1M56 D;  1QLE D;  2MTA C;  3HE5 A;  3WUU A;  4FAV A;  5TJH A;  1YTC A;  3VOP A;  3VYI A;  1BCC E;  2LIT A;  2WVR A;  1OVV A;  3GF7 A;  4FB1 A;  1KYO I;  1Q2N A;  1LTJ B;  1HJ5 A;  3A3Y B;  1I5T A;  3QWO C;  2W6B A;  2QM8 A;  3SWF A;  3HQ7 A;  4YXD C;  1IFJ A;  4RO0 A;  2N9I A;  1DIP A;  2C1D B;  2D2C B;  3H1I J;  2B89 A;  1M7L A;  1IFD A;  4EYY Q;  5APX A;  5GTI V;  1OW7 A;  3O1Y A;  2KZI A;  1JM0 A;  4AYC A;  3C1L A;  2AEM A;  4PV1 D;  3AE4 C;  2E75 B;  2YNY A;  3MIW A;  1KIL C;  4PV1 C;  2B9B A;  1N73 B;  4WY4 B;  3L71 G;  3CWB J;  1FI3 A;  1NWQ A;  1YBK A;  2BH5 X;  3M9H A;  4ZKP A;  3AE2 C;  4IL6 H;  1KD1 Q;  3P8M C;  1JDL A;  3MUD A;  5CCG A;  2H88 C;  4W7Y A;  1KB9 E;  1GIW A;  1KYO W;  1VQO P;  1URQ D;  1AJY A;  1C6O A;  1KFM A;  1N15 A;  3BAT A;  1SVF A;  5B5E V;  2XZR A;  3OA7 A;  1AQ5 A;  3AE5 C;  1HZV A;  3A0B H;  3L72 G;  4H13 D;  3EFF K;  1BE3 G;  3H1L D;  1S6V B;  4L1Q A;  1AA0 A;  3VP8 A;  1JY2 P;  4H13 C;  1FAV A;  2HV4 A;  1CIE A;  2ORL A;  5KAI E;  3VTP C;  3ORV A;  1KIL B;  5KLV D;  4PV1 B;  2N9B A;  1YEA A;  2B87 A;  2KXP B;  1L2P A;  4HYT B;  1C7M A;  2RMZ A;  5GTH V;  1ZR2 A;  4GKG A;  3GF3 A;  1IFN A;  4EIE A;  1NTM G;  5CCH C;  1KQF B;  1HH7 A;  2AXT E;  1U75 B;  2K9Y A;  1JB0 J;  1FZF A;  3USS A;  3H1L J;  1NVO A;  1PL5 A;  1K3H A;  2FKW B;  3IFM A;  4WWI A;  2ZAE B;  3WMM 0;  1WRG A;  2FFD A;  1SQQ D;  3CYT I;  1DX7 A;  1H9Y A;  1C75 A;  4DY9 A;  2OAR A;  1JY2 O;  3G9R A;  5M1B A;  3TSI A;  1MG2 D;  3RLM A;  3WFC C;  4L3H A;  3RK2 D;  4D6T G;  2LKM A;  4H13 B;  1NKZ B;  5AW7 B;  2ZOO A;  5AVQ B;  3Q5S A;  1NAY A;  2E74 D;  2N9J A;  2E74 C;  3CL3 D;  1T2K D;  1HRC A;  1CSU A;  3HTK A;  2Q7C A;  1JY3 N;  3B5N D;  3L70 J;  5BU8 B;  3CXH I;  1BGY D;  2QJK C;  1SQQ J;  2FXO A;  4L74 A;  4WQE A;  1NTK G;  2KI7 B;  4ZKU A;  1LTB C;  1HGV A;  2B10 B;  1L0N G;  1JCC A;  1YI2 P;  1CED A;  2ZT9 D;  4K35 A;  2KSJ A;  3O5C A;  5EXQ A;  1CZQ A;  1M8O B;  4RJT A;  1HBW A;  2B88 A;  3T97 B;  1GZL A;  4OVN F;  1KB9 H;  1GK4 A;  4DZO A;  4PW9 B;  1VL2 A;  1H0T B;  1KYO E;  1VQL P;  3D71 A;  5EFW B;  3CC2 P;  3KQG A;  1LT1 A;  3AEC C;  2O1K A;  2HG5 D;  4OH8 B;  3CC4 P;  1GMJ A;  1BGY J;  2MJZ A;  1C6S A;  3CCE P;  1E8E A;  2E74 B;  3KYQ A;  3H1H D;  5AW3 B;  1COR A;  3IF4 A;  1H31 B;  3O8Z A;  1S5L X;  2QJK B;  3CXH W;  1A2S A;  2HPC A;  1U74 B;  2YXR B;  3FXE A;  4ASV A;  1AOQ A;  1OAE A;  4N78 D;  1S1C X;  1YNR A;  4O1Q A;  1BCC D;  2ZT9 B;  1G1I A;  1IZN B;  1LP1 B;  1SQB K;  2WWW A;  2WTY A;  2HLO A;  1DT1 A;  2AXT H;  3EQ2 A;  1RE4 C;  3L72 E;  3RN0 A;  1RF0 C;  3DMI A;  4QAO A;  4XXL A;  1EZV I;  2JTI B;  2I1J A;  5TIS V;  4P4Q B;  4H0L C;  2CXB A;  5IY5 1;  2IFN A;  4Y28 J;  4BXL A;  2C9N Y;  2M0B A;  1ZOY C;  5CJ4 A;  2A45 H;  1LJ2 A;  2CE0 A;  1FDM A;  1PZQ A;  2PAC A;  1EZV G;  2WSE H;  5GTI H;  3V6I A;  1OW8 A;  5DJU B;  2WPQ A;  1FCD C;  1R0Q A;  4O1W A;  3RN1 A;  1HRO A;  1NHL A;  4AUW A;  1KB9 D;  1NTZ K;  1GDV A;  4WQ7 A;  2BCC J;  2P58 A;  5C39 A;  2LIR A;  4PWA A;  2E5T A;  1VDF A;  1Y47 A;  1OX3 A;  2HR3 A;  3PH2 B;  4D6T E;  5CIC B;  1CHJ A;  4R4M A;  1EDK A;  2DW3 A;  2JKV A;  2GA1 A;  1USE A;  1QYZ A;  3HE5 B;  1QEX A;  4H0L B;  2JP3 A;  3MUD C;  5CCG C;  3SXT A;  3IR9 A;  3VMZ A;  1VQ8 P;  3H1J J;  1KYO H;  1M90 Q;  3K5B A;  3TGU E;  2FXP A;  1NML A;  1MFT A;  4C7N A;  3LID A;  2R3S A;  1CYC A;  3V4Q A;  1NTK E;  3IAO A;  1VQK P;  1FC2 C;  1URQ A;  1H33 A;  3SWY A;  1FBM A;  2BPB B;  5GTH H;  1CXA A;  1OW6 A;  3CXH E;  1JUN A;  2YKO A;  1LTT C;  3KXD A;  1ZW0 A;  2K9J A;  2YKQ A;  5L8R J;  3A0B V;  3DP5 A;  155C A;  1VYD A;  3PXS A;  1DEB A;  1L4A A;  1S9K E;  2Q5U A;  3CCJ P;  1J3S A;  4U3F J;  5BVZ A;  4GED B;  4JPZ B;  2ZJS E;  1SQX G;  3L4M A;  2IZ0 A;  5DJQ C;  4AAO A;  3II6 A;  1LTS C;  2YMY A;  1U7J A;  1JMM A;  2FFD C;  2C9X B;  3WFE C;  1SQV E;  3JCU E;  3M97 X;  1JMB A;  4LGD E;  4ZMD A;  1MUU A;  1YIT P;  3NBS A;  2C1V A;  1FDO A;  3L73 J;  1X22 A;  1PFI A;  1AVO A;  3KZI E;  2ZYA A;  2IPP A;  2QM7 A;  1KV4 A;  1BL9 A;  3HQ8 A;  3MP7 B;  3QH9 A;  1KOR A;  2B87 B;  2NRG A;  1OMI A;  1SQB J;  1X79 B;  4PJ0 E;  1QL1 A;  3CCV P;  1ZXG A;  2ZXY A;  4WQB A;  1KYO D;  1GL2 C;  5AVT B;  3RBZ A;  1H8A A;  1QVG O;  1LT9 A;  1RQV A;  1YCC A;  3WFB C;  1Z56 A;  1ZP0 C;  5DJQ B;  1ZR4 A;  3L71 D;  1J2J B;  2KNC B;  2FFD B;  2FRC A;  5CID B;  3V2Q A;  4EOT A;  2O01 N;  1C6R A;  1FZC A;  1PGO A;  4H0K A;  2DGE A;  2WZ7 A;  2E76 D;  3P7K A;  2K3R A;  2M5A A;  2GC4 D;  2Q1K A;  3NXS A;  1OIP A;  1J1E C;  1MV8 A;  1YIC A;  1N7S A;  1KMI Z;  3H6P A;  3BCC E;  4H44 D;  1ZLL A;  5AW8 B;  4H44 C;  1DII C;  3SFE C;  3RMZ A;  3HTK B;  2IZ1 A;  1NU1 G;  1IFP A;  1I6D A;  3L71 J;  4QMA A;  3L72 D;  1H9X A;  3AEB C;  3CXH H;  5KLV K;  3SJL A;  1GL2 B;  4ZNC A;  2RH0 A;  1CI6 B;  3F89 A;  1W5C E;  3HUS A;  2M3E A;  1QX8 A;  2O1J A;  4AAN A;  1AFO A;  2R44 A;  2OYO A;  3UIA A;  1FZG A;  1S72 P;  3RK3 C;  5TIS H;  2K88 A;  2YO3 A;  1A56 A;  5KAI V;  1N90 A;  3H25 A;  2JEE A;  3M06 A;  4NFG B;  2PCB B;  1HJ3 A;  2P1J A;  3VYM A;  3GHG A;  1NYH A;  1EQ7 A;  2NPS A;  5CBN A;  1NTM D;  3G3Z A;  3BAS A;  3TDK A;  1KC8 Q;  1SQQ K;  1CSW A;  2K1A A;  1YJ9 P;  3V2P A;  1AQT A;  1WEJ F;  1PP9 J;  1J1E B;  1FJ0 A;  3JCU H;  1BE3 J;  2BLF B;  1FOS F;  3TK1 A;  2ZYD A;  4H44 B;  2AXT V;  1WMK A;  3GMA A;  1T3U A;  5AUR A;  4GYD A;  3KZI H;  1FI7 A;  2O01 H;  3VMX A;  2UWJ E;  4D6T D;  3C9I A;  1MZ4 A;  1JCD A;  2HPC B;  3WUV A;  4WVZ A;  1SQX E;  2E5Y A;  3HRN A;  3H1K E;  5AVY B;  1NOH A;  1NTM J;  5KTB A;  2WPR A;  2FWL A;  3RK3 B;  2J5U A;  4OGQ D;  2CPS A;  3PH0 A;  2Y0C A;  3OAK A;  1L9B C;  3TGU D;  2B4Z A;  3M9Q A;  2L4D A;  1TU3 F;  4NPE A;  4YTP C;  3EWK A;  1HWT C;  2QG4 A;  2P2U A;  2ZYG A;  2C0W A;  1NTK D;  1IK9 A;  2EXV A;  4Y99 C;  2LXC B;  2C1U A;  3CP5 A;  2ZFC A;  2ZXE B;  1F1F A;  2BH4 X;  2JJL A;  1ZRT E;  1L0N D;  2P67 A;  4IFM A;  3CCR P;  2FBW C;  2FXM A;  4UB6 E;  3CXH D;  2G8Y A;  2ITA A;  1Y9B A;  1OWA A;  1FS0 E;  4C7R A;  3VMA A;  4MU8 A;  2ZVO B;  1URQ C;  2WPS A;  1BDD A;  1IK7 A;  1FZA A;  3L74 G;  1FU1 A;  1E5W A;  4JF7 A;  1K04 A;  4WQC A;  3CX5 I;  3S1K A;  1KFN A;  1K8A Q;  4N0K A;  4JQ0 D;  1GQ1 A;  2FYU G;  1L0N J;  3D70 A;  3JC2 2;  3FWN A;  1X9V A;  1SQP G;  2VHD A;  1L4A D;  2WSS H;  5CHX A;  2PRR A;  1PGQ A;  2OGU A;  4Y99 B;  1L4A C;  3M0D A;  3RL0 D;  3E7K A;  1N9C A;  2ZZS 1;  2BAS A;  2FY8 A;  3AE8 C;  2RKL A;  5AW2 B;  4Q5P A;  3H32 A;  3HD7 D;  1NU1 E;  1RAP A;  1FE6 A;  4C7N B;  2AI5 A;  1NIR A;  4L3G A;  2YMK A;  3W67 A;  5KJ7 A;  2N1T D;  1JNM A;  1A02 J;  1URQ B;  1H33 B;  3OJA B;  1CW5 A;  4GOD A;  2QJP C;  5KLV J;  2Y9Z A;  5KAF E;  3CI9 A;  3SFD C;  3IN6 A;  4UB8 E;  2M8R A;  2PGD A;  1EDI A;  3RK2 C;  3CX5 W;  5C0Z A;  2CA3 B;  2GM4 A;  2QRX A;  4LC1 A;  3CCM P;  2OQQ A;  1EZV D;  1IZL 0;  2K9J B;  3CWB G;  4DT0 A;  3L4O A;  1QVF O;  3B4S A;  1HJ0 A;  3LW5 H;  1N7L A;  2W6J H;  4I1L A;  2O01 J;  3I55 P;  4XYD B;  3AEE C;  4EIJ A;  4AQR D;  2R5B A;  1L0L G;  4BRY A;  2AIU A;  3JBT B;  3TGU G;  1L4A B;  1SS1 A;  4O9B A;  3VMY A;  2QVA A;  2WSC H;  1T2K C;  1K9M Q;  2WPV B;  3B5N C;  3M91 A;  1M70 A;  1COT A;  1DW0 A;  5KLI C;  1CRC A;  3L36 A;  4KHX A;  1HH0 A;  3OCD A;  1Q82 Q;  3KHU A;  3WU2 E;  3MD0 A;  3BCC D;  3CLQ A;  4FA1 A;  1M57 D;  1CTY A;  1CNO A;  1LC2 A;  5KKZ C;  5AVX B;  3BRT B;  2WSF H;  5AW4 B;  1GU4 A;  1VF5 D;  1FZC C;  3L75 G;  5DF5 A;  1S2E A;  2ZT9 C;  2J59 M;  1CRI A;  1EB7 A;  4NPF X;  1A8C A;  1F1C A;  2QJP B;  3O20 A;  4UB6 H;  1IO3 A;  1T3J A;  3L4F A;  2WT7 B;  1OCD A;  1VQ4 P;  1ETP A;  2K37 A;  2LXB A;  3Q3D A;  2V7Q H;  1N7S D;  3U1C A;  1FI9 A;  4I7Z C;  5CIB B;  3OA8 A;  3RK2 B;  1NNO A;  2XTS B;  1YIQ A;  3CME P;  1SFC D;  1YTZ I;  1HTL C;  4EID A;  1CTZ A;  1ZV8 A;  1KX7 A;  1QN2 A;  1DH3 A;  1CC5 A;  1MFZ A;  2Y9Y A;  5KAI H;  1NTZ E;  3B5N B;  3CCS P;  3HUS C;  5KLI B;  1JEK A;  1SQV G;  1H1O A;  1IQC A;  5CIE B;  5CMZ A;  2Q6Q A;  5E79 E;  5CIG B;  1CRY A;  3Q1M A;  5KKZ B;  3PHL A;  2AEF A;  1KQS O;  3NBT A;  1BSH A;  1FZC B;  1CRJ A;  2NPS D;  2IX7 C;  3GHG C;  1ZN5 A;  3V2R A;  1S5L E;  2M5A B;  1H88 A;  2XNX A;  3L74 E;  2OTK E;  3SWS A;  2OYH C;  5APW A;  4L73 A;  1KQG B;  1YFC A;  4TT3 H;  4I7Z B;  2GUV A;  1SQX D;  5B6Q A;  2FYU E;  3AEA C;  3H1H J;  2IYO A;  1SQP E;  1EXI A;  1HCM A;  1CRG A;  2ZBO A;  1FZE A;  3RBX A;  3L70 G;  4UB8 H;  1N73 A;  4WY4 A;  3CX5 E;  2D0S A;  1DVH A;  3VP9 A;  1AVY A;  2WIT A;  1BCC J;  3HUS B;  2KS1 A;  3A0H E;  2E42 A;  2JWA A;  3KZI V;  1Q7Y Q;  5AVR B;  2CPB A;  2Y0E A;  1SQX J;  3MK7 C;  1EC5 A;  3GHG B;  3BCC G;  3D6Z A;  3WU2 H;  2CK3 H;  4PJ0 V;  2OYH B;  2E43 A;  3U1A A;  4WBA A;  3JSV C;  3W68 A;  1IFI A;  1B7V A;  2POH A;  4K3A A;  4H0J A;  5AW5 B;  3CWB E;  1DD4 A;  3SSU A;  1MG3 D;  4AAM A;  1R8E A;  2IDB A;  1HJB A;  2XND H;  2C0X A;  1L0L E;  2WSF J;  2L5G B;  4HKZ H;  4DOJ A;  3ZOW A;  1VQ9 P;  3PTZ A;  1LS9 A;  4XFJ A;  3SWK A;  5APS A;  4Y5R A;  4OWF A;  2V7Q J;  1AV1 A;  3C8V A;  1GU5 A;  1LNQ A;  1RAQ A;  3EFG A;  5AW0 B;  1KIL E;  1RHZ B;  1N8R Q;  1GW3 A;  3L75 E;  2ZXX A;  3MK7 B;  1NJI Q;  2W6A A;  1NU1 D;  4IFF A;  2RN0 A;  3B8E B;  3GLM A;  2VRS A;  4XA4 A;  5E79 H;  2MHM A;  3OW2 O;  1CIF A;  1P84 I;  4J20 A;  2N9Y B;  5CIF B;  1IJD B;  2ZVN B;  3M0A A;  4YE1 A;  4IFD K;  3M9B A;  2L91 A;  1NTM K;  1G2C A;  4ASW A;  1S5L H;  3AE6 C;  2YCC A;  1QL2 A;  1OXZ A;  1I54 A;  5KJ7 D;  3O0R C;  3H1K G;  3RGU A;  3ABV C;  5KJ7 C;  2ZON G;  5APU A;  3HD7 A;  3PRJ A;  2QE7 H;  1NAF A;  1NU1 J;  3ZOX A;  3Q5R A;  2NZ2 A;  1DW3 A;  1S4X A;  1USD A;  2Z5H A;  2N1T A;  3H1L E;  3MZW B;  4YXW H;  3CX5 H;  1X0T A;  1YQ3 C;  1U7M A;  2XV5 A;  1ZME C;  2KUB A;  2FYN C;  2BEZ F;  3A0H H;  2N18 C;  1RF1 A;  1XTG B;  2WSE J;  2C8S A;  1CSV A;  2N3Y A;  4EDF A;  1M1K Q;  3H1J G;  3H32 B;  1NTK K;  4GOF A;  4JYB A;  3L70 E;  2HFE D;  2OZ1 A;  4EI2 A;  1L0N K;  1I8O A;  2JR8 A;  1CSX A;  1AYG A;  4IL6 X;  1R5S A;  2Y0D A;  5B66 E;  1H31 A;  1LMS A;  2KP8 A;  4RES B;  1NTZ D;  2E76 C;  4GT1 A;  2H43 A;  351C A;  3PJS K;  2A06 G;  2XKM A;  1VQ6 P;  1YYC A;  2FYN B;  4N3Y B;  4UB6 V;  2N18 B;  3SVW A;  1DW2 A;  4IL6 E;  4L76 A;  3G71 P;  4BRY B;  2PP6 A;  1NMI A;  1UIX A;  1CYJ A;  1SFC A;  1BGY E;  4GIF A;  2SPZ A;  2D0W A;  4PD4 I;  3L74 D;  1CCH A;  1JTH A;  2HOD A;  4U3F G;  1VQP P;  3OCD B;  2Q3I A;  3L37 A;  1CSB A;  1MZ9 A;  2YXQ B;  2FYU D;  1GDT A;  1G1J A;  4R4L A;  1M6Z A;  3TYY A;  1SQP D;  2O3J A;  3KDP B;  3N7N A;  4LJI A;  4B86 A;  1C2N A;  3V5B A;  1FZB A;  3CX5 D;  1JY2 N;  2D2C D;  4AAL A;  2E76 B;  1QL3 A;  1DEE G;  2YIU C;  4RKU J;  2R5D A;  1QGK B;  1CHH A;  1LC1 A;  3L72 J;  2E75 D;  2HYN A;  1SQB G;  1JO5 A;  4WY4 D;  1U57 A;  3E1I A;  2CA4 B;  5K5G B;  1GJQ A;  5AVZ B;  2GB8 B;  5H2F E;  2W90 A;  2BCN B;  1M1J A;  3N4X A;  3VN0 A;  2IBZ I;  4N78 E;  5KAF V;  1BSN A;  4PJ0 H;  3CWB D;  3TNU A;  4UB8 V;  3AE3 C;  1P84 E;  3BVH A;  4L75 A;  3I5C A;  1EXJ A;  1L0L D;  4OGQ C;  2JDI H;  2P7J A;  3O6Q A;  3RL0 g;  1PPJ G;  3CCL P;  2JQR A;  1FDI A;  1VQM P;  2IBZ G;  3AED C;  4EIC A;  2YIU B;  2BCC E;  1K05 A;  3B71 A;  1AOF A;  3MTU E;  1NH4 A;  2QJY C;  1KTM A;  1WVE C;  5B66 H;  1NTZ G;  3GW6 A;  4D6T J;  1KIB A;  1KIL D;  3L75 D;  2PFX A;  3WU2 V;  5APV A;  1N50 A;  3AEG C;  1I55 A;  1LWU A;  3G4S P;  1LTA C;  1HZU A;  1RE3 A;  3H1J E;  4DJG A;  1L0L J;  2OTL P;  4KT0 J;  2KS1 B;  3TGU J;  4A7P A;  2I8F A;  3PXW A;  5CBO A;  1S9K D;  3ZIY A;  4N6J A;  1W2E A;  3CCU P;  1NTK J;  4IOI H;  3WUT A;  3ZOO A;  3PLN A;  1IRW A;  4OGQ B;  1I6E A;  1E29 A;  3C2C A;  1RY3 A;  1W5C T;  3LIE A;  4TLF A;  1LTI C;  1KX2 A;  3L75 J;  2QA4 P;  2QSI A;  1PP9 G;  1SQV D;  1H32 A;  4NPD A;  3TYI A;  2A06 E;  1QKS A;  3CU4 A;  3NWV A;  1D7M A;  2QJY B;  1BDC A;  2OYI A;  3HQ6 A;  3RL0 C;  2CE1 A;  2BEQ D;  3SLE A;  5E79 V;  3X39 A;  1SQX K;  1K3G A;  5AW1 B;  1CCR A;  2KIK A;  3HD7 C;  1VQ7 P;  3WUI A;  1MKM A;  1VQN P;  4U3F E;  1YJN P;  1PV3 A;  1KQL A;  1VQ5 P;  5CCH D;  2Q9I A;  2N1T C;  1S5L V;  2V08 A;  3H1I G;  1XTC C;  2OTJ P;  3ZCF A;  2GIW A;  3PXT A;  4HH2 A;  5H2F H;  2FYZ A;  1SQV J;  1FOS E;  3F5H A;  1CTJ A;  4PD4 E;  3ZBM A;  3L70 D;  3AEF C;  4JYC A;  3P32 A;  1LGH B;  1YJW P;  2W27 A;  3L73 E;  2KNC A;  1SLQ A;  2J58 A;  1RF1 C;  2B11 B;  4HJG H;  1FJK A;  4WQD A;  2JWD A;  4JCG A;  4C46 A;  5CYT R;  1P84 H;  3P8C E;  4RSZ A;  4W80 A;  1NKN A;  1NGM B;  1OVR A;  4AX3 A;  1G2C B;  3RL0 B;  1IO4 A;  1SQB E;  5GTI E;  3GG2 A;  1LT9 C;  5DJT B;  3A0H V;  1UII A;  4WB4 A;  2DVH A;  2WMM A;  3CCQ P;  3HD7 B;  2PCC B;  3TF5 A;  2V07 A;  4K3I A;  3BRV B;  1VF5 C;  2N1T B;  4U7J A;  3U59 A;  3WFD C;  2N3B A;  1GL2 A;  1SP4 A;  1CI6 A;  1LTG C;  3VNW A;  4GOE A;  2LR2 A;  1N7S C;  1FJP A;  4FAN A;  1Q90 D;  1HUC A;  5AW6 B;  1GTW A;  3CC7 P;  1PPJ E;  1RF1 B;  2IBZ E;  2R3C A;  1AKK A;  4LLH A;  1K73 Q;  1SFC C;  1DVV A;  1FOC A;  5B5E E;  3BCC J;  1NU1 K;  3AE7 C;  451C A;  2PAJ A;  1E79 H;  3HE4 A;  3AE9 C;  3FX0 A;  1LT9 B;  2P10 A;  3E1R A;  3L71 E;  1DD3 A;  2OZ1 B;  3H1L G;  1Q81 Q;  3FXD A;  2XDJ A;  1GKS A;  2H89 C;  3V4W A;  3S4R A;  5AVU B;  1LTJ A;  5GTH E;  1VF5 B;  5KLV G;  3WC8 A;  1WT6 A;  1LFM A;  3MHV A;  4DCK A;  2NPS C;  3CPW O;  4HB1 A;  2Q3E A;  1N86 A;  1PGJ A;  1YHQ P;  2C1D A;  3NMD A;  1N7S B;  3H1K D;  2KZJ A;  2IFM A;  1A02 F;  1P84 D;  5APQ A;  1PP9 E;  5KAF H;  3ITK A;  1SFC B;  4Z1M H;  1BE3 E;  4MN4 C;  4PD4 H;  2XU6 A;  1CYI A;  1JTH B;  1SQQ G;  2HOD B;  2V4H A;  2C9L Y;  1KZU B;  1M1J C;  1N2D C;  1W2L A;  4H0L D;  2BCC D;  5AVS B;  4M3L A;  2Z5I A;  1R5L A;  3RK3 E;  5BU5 A;  3A7O A;  1ZRT D;  1JY3 P;  4KJM A;  2JO1 A;  2KB7 P;  1QL4 A;  3NFQ A;  1RQU A;  1FHB A;  3LW5 J;  3H1K J;  5CJ0 A;  3ZOY A;  1NTM E;  3H1I E;  2W8Z A;  2NPS B;  1T8Z A;  5CIH B;  1KV9 A;  1ZZH A;  2AXC A;  3H1J D;  4EIF A;  2R32 A;  2WSC J;  1E2R A;  2YKP A;  1BGY G;  3CD6 P;  2YO2 A;  1T6A A;  1LWU C;  3FWL A;  1KIL A;  3HQ9 A;  4V2K A;  3DR0 A;  1RE3 C;  1RZ5 A;  1IC2 A;  1M1J B;  1OZH A;  1JY3 O;  5CCG D;  5B66 V;  1CO6 A;  2A06 D;  3TNU B;  1L9J C;  1RZ6 A;  5B5E H;  3I56 P;  3ZDM A;  2M3B A;  2H7H A;  5AVV B;  2I8D A;  2FYU K;  3O6Q B;  2QEX P;  4IL6 V;  1OFC X;  1RH5 B;  1SQP K;  4U3F D;  2W83 C;  1GW4 A;  4FA9 A;  1YIJ P;  3H1H G;  4W7Z A;  1PIX A;  1L0N E;  2KOG A;  2MKV A;  3M0D C;  1Y8A A;  2OYI C;  2QIW A;  2G3A A;  2GC7 D;  1DW1 A;  4PD4 D;  1LWU B;  2AEJ A;  1JOC A;  3A9F A;  3L73 D;  4WQA A;  5DFS A;  4JBZ A;  1BCC G;  3P8C D;  3KPE A;  5TIS E;  1VPC A;  3R2P A;  2B0Z B;  2YQB A;  1DIQ C;  3CMA P;  5CCH A;  1CXC A;  2C2C A;  1SQB D;  1CHI A;  3D0W A;  2KLU A;  4GDO A;  1W2B O;  2BCC G;  1PGP A;  5AW9 B;  5KLV E;  1I8P A;  1EDL A;  2KK7 A;  1CIH A;  1GU2 A;  1H32 B;  1IFM A;  3T97 A;  3FGA D;  5H2F V;  2WT7 A;  1L0L K;  3Q2Y A;  1HGZ A;  1KB9 I;  5AVW B;  1J1D C;  2OYI B;  1YEB A;  1H0T A; 
#chains in the Genus database with same CATH homology
 2BGV X;  4XYD B;  1FCD C;  1L0L D;  2AIU A;  3VRD A;  1R0Q A;  3JBT B;  4O1W A;  3RN1 A;  1HRO A;  1PPJ D;  1M60 A;  2JQR A;  1M70 A;  1COT A;  1DW0 A;  2IBZ D;  1CRC A;  1KB9 D;  3OCD A;  4EIC A;  2YIU B;  1GDV A;  4WQ7 A;  2LIR A;  3KHU A;  4PWA A;  3BCC D;  1AOF A;  4FA1 A;  1CTY A;  1CNO A;  1LC2 A;  1WVE C;  3PH2 B;  3GW6 A;  5CIC B;  1KIB A;  5DF5 A;  1CHJ A;  3L75 D;  3WU2 V;  1C52 A;  1N50 A;  1CRI A;  1I55 A;  1EB7 A;  1A8C A;  1F1C A;  2QJP B;  3O20 A;  1QYZ A;  1IO3 A;  1OCD A;  1ETP A;  3SXT A;  1HZU A;  1FI9 A;  5CIB B;  1HJ4 A;  3OA8 A;  1NNO A;  4A7P A;  1NML A;  2I8F A;  1YIQ A;  2XTS B;  3PXW A;  3ZIY A;  1CYC A;  4EID A;  1CTZ A;  1KX7 A;  3ZOO A;  1H33 A;  1IRW A;  1QN2 A;  3PLN A;  1I6E A;  1CC5 A;  1E29 A;  3C2C A;  1W5C T;  2BPB B;  4WQ9 A;  1KX2 A;  5KLI B;  1CXA A;  1H1O A;  1SQV D;  1PP9 D;  1IQC A;  1H32 A;  3TYI A;  5CIE B;  1BE3 D;  1QKS A;  3CU4 A;  5CIG B;  3NWV A;  1IRV A;  1CRY A;  2QJY B;  5KKZ B;  3PHL A;  3A0B V;  4FA5 A;  3HQ6 A;  3DP5 A;  155C A;  1VYD A;  1C2R A;  3NBT A;  3PXS A;  2B12 B;  2CE1 A;  1CRJ A;  3SLE A;  3OA8 B;  5E79 V;  3X39 A;  1K3G A;  1CCR A;  1CIG A;  1KB0 A;  2YK3 A;  1J3S A;  3SWS A;  5C9M A;  3WUI A;  1YFC A;  4GED B;  3L4M A;  4WQ8 A;  1CRH A;  1SQX D;  5DJQ C;  5B6Q A;  1S5L V;  2V08 A;  4AAO A;  3H1I D;  3ZCF A;  4KMG A;  2C9X B;  2GIW A;  3WFE C;  1HCM A;  1CRG A;  2ZBO A;  3PXT A;  4FA4 A;  3M97 X;  1CTJ A;  3ZBM A;  3L70 D;  2MTA C;  3NBS A;  2D0S A;  2C1V A;  1DVH A;  4FAV A;  5TJH A;  1YTC A;  2B11 B;  4WQD A;  4JCG A;  2LIT A;  1BL9 A;  3HQ8 A;  5CYT R;  4FB1 A;  4RSZ A;  1HJ5 A;  2KS1 A;  1I5T A;  2JWA A;  3HQ7 A;  3KZI V;  4AX3 A;  2Y0E A;  2N9I A;  3GG2 A;  2C1D B;  3MK7 C;  3A0H V;  2ZXY A;  4WQB A;  2DVH A;  5GTI V;  1KYO D;  2PCC B;  4PJ0 V;  3TF5 A;  3O1Y A;  2V07 A;  4K3I A;  1YCC A;  3WFB C;  1B7V A;  5DJQ B;  4H0J A;  3L71 D;  1FI3 A;  1MG3 D;  4AAM A;  3WFD C;  2KNC B;  2N3B A;  2FRC A;  5CID B;  2BH5 X;  1C6R A;  4H0K A;  3VNW A;  2DGE A;  4FAN A;  3ZOW A;  1JDL A;  1LS9 A;  3PTZ A;  2GC4 D;  1AKK A;  4Y5R A;  1YIC A;  1DVV A;  1GIW A;  1FOC A;  1KYO W;  1C6O A;  451C A;  1RAQ A;  1N15 A;  1DII C;  3RMZ A;  5B5E V;  3MK7 B;  1NU1 D;  1HZV A;  1I6D A;  2RN0 A;  3L72 D;  1H9X A;  2OZ1 B;  3H1L D;  1S6V B;  4L1Q A;  3SJL A;  1GKS A;  2HV4 A;  2MHM A;  1CIE A;  1CIF A;  2ORL A;  4J20 A;  3ORV A;  3WC8 A;  5KLV D;  1LFM A;  2N9Y B;  5CIF B;  4AAN A;  4YE1 A;  1YEA A;  2Q3E A;  2L91 A;  1A56 A;  5KAI V;  1N90 A;  2C1D A;  2YCC A;  1C7M A;  2RMZ A;  5GTH V;  1I54 A;  4NFG B;  2PCB B;  1HJ3 A;  3O0R C;  3VYM A;  4EIE A;  3H1K D;  1NTM D;  2ZON G;  1P84 D;  1HH7 A;  3PRJ A;  3TDK A;  1CSW A;  1U75 B;  3ZOX A;  1WEJ F;  3ITK A;  1DW3 A;  1FJ0 A;  1K3H A;  2BLF B;  1CYI A;  2AXT V;  1SQQ D;  3CYT I;  1H9Y A;  1C75 A;  1W2L A;  4DY9 A;  5AUR A;  2BCC D;  4GYD A;  1FI7 A;  1MG2 D;  1ZRT D;  3RLM A;  3WFC C;  4L3H A;  2N18 C;  4D6T D;  1QL4 A;  1MZ4 A;  2C8S A;  1FHB A;  1CSV A;  3ZOY A;  2ZOO A;  2N3Y A;  4EDF A;  2FWL A;  5CIH B;  2N9J A;  1KV9 A;  1ZZH A;  3H1J D;  4EIF A;  2Y0C A;  1L9B C;  3TGU D;  1HRC A;  1CSU A;  2B4Z A;  1E2R A;  2L4D A;  2OZ1 A;  1BGY D;  1I8O A;  2QG4 A;  4WQE A;  1CSX A;  1NTK D;  2EXV A;  2C1U A;  3CP5 A;  1AYG A;  1F1F A;  3FWL A;  2B10 B;  2BH4 X;  2Y0D A;  1L0N D;  1H31 A;  1LMS A;  1CED A;  3HQ9 A;  4V2K A;  3DR0 A;  1NTZ D;  3O5C A;  5EXQ A;  1RZ5 A;  4RJT A;  351C A;  3CXH D;  5B66 V;  1CO6 A;  2A06 D;  1L9J C;  4PW9 B;  1RZ6 A;  2FYN B;  3VMA A;  4MU8 A;  4UB6 V;  2N18 B;  3SVW A;  1DW2 A;  1NMI A;  1CYJ A;  1C6S A;  2D0W A;  3L74 D;  1CCH A;  4IL6 V;  4WQC A;  1E8E A;  4U3F D;  3OCD B;  4N0K A;  4FA9 A;  1GQ1 A;  3H1H D;  2FYU D;  1COR A;  1H31 B;  1M6Z A;  1SQP D;  2QJK B;  2VHD A;  2O3J A;  3CXH W;  1A2S A;  4LJI A;  2GC7 D;  1U74 B;  1DW1 A;  4PD4 D;  1C2N A;  1AOQ A;  3CX5 D;  3A9F A;  1OAE A;  3L73 D;  4WQA A;  1N9C A;  2ZZS 1;  4AAL A;  5DFS A;  1YNR A;  4O1Q A;  1BCC D;  1QL3 A;  4Q5P A;  1DT1 A;  1CHH A;  1RAP A;  1LC1 A;  2B0Z B;  2YQB A;  2AI5 A;  1NIR A;  4L3G A;  1DIQ C;  3RN0 A;  3DMI A;  4QAO A;  1CXC A;  2C2C A;  4XXL A;  1SQB D;  1CHI A;  2JTI B;  5TIS V;  1H33 B;  4P4Q B;  2CA4 B;  1GJQ A;  2CXB A;  2GB8 B;  5IY5 1;  1I8P A;  2BCN B;  2CE0 A;  1CIH A;  1GU2 A;  1H32 B;  3CX5 W;  2PAC A;  5C0Z A;  2CA3 B;  5H2F V;  1EZV D;  1IZL 0;  5KAF V;  2K9J B;  3CWB D;  3L4O A;  4UB8 V;  1YEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...