2BPBB

Sulfite dehydrogenase from starkeya novella
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
APLTYELPDETAQLKPAPQPGFEAAQNNCAACHSVDYINTQPPGKGQAFWDAEVQKMIKVYHAPVDEADAKAIADYLAKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
publication title Molecular Basis of Intramolecular Electron Transfer in Sulfite-Oxidizing Enzymes is Revealed by High Resolution Structure of a Heterodimeric Complex of the Catalytic Molybdopterin Subunit and a C-Type Cytochrome Subunit.
pubmed doi rcsb
source organism Starkeya novella
molecule tags Oxidoreductase
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2bpbB01
4FA9A 1A8CA 2GB8B 2D0WA 2AXTV 2XTSB 5TISV 3SVWA 2BPBB 2OZ1A 1C6SA 3A0BV 1RAPA 3DMIA 1YTCA 3HQ6A 5DJQC 4EIEA 4PJ0V 1KYOW 5E79V 1J3SA 1ETPA 2PACA 3HQ8A 4AAMA 2B0ZB 1GKSA 4EIFA 1SQBD 1CHJA 2GIWA 1H1OA 4DY9A 1LC1A 5DFSA 2QJKB 5CIEB 3CP5A 1BGYD 1H9XA 1AYGA 1L0ND 1CORA 1WVEC 2FYNB 1R0QA 3H1ID 3NWVA 2L4DA 5C0ZA 1AOFA 1CSVA 1HROA 3L70D 1KX7A 3OCDB 1A2SA 1FJ0A 3L72D 1YFCA 2YIUB 1H32B 3OCDA 1CRYA 1DVHA 1PPJD 4V2KA 1BCCD 1DW3A 2HV4A 1HZUA 1SQQD 1OCDA 1CTJA 1FOCA 2GC7D 4GYDA 1CTZA 2C9XB 3O20A 1KB9D 2GC4D 3O0RC 1C7MA 1U75B 1CHIA 2BCCD 5CYTR 3HQ7A 1CSXA 1I5TA 3MK7C 1C6RA 2LITA 3H1KD 1K3GA 2YQBA 1LC2A 1LMSA 1SQVD 3NBTA 4IL6V 3A0HV 4L3HA 1E29A 3ZCFA 5KLIB 1B7VA 4H0JA 3H1JD 2C1DA 3DR0A 2BH5X 3H1LD 3WC8A 2ZONG 1NTZD 3O1YA 1CXAA 4Y5RA 1JDLA 1ZZHA 2PCCB 1I54A 1VYDA 1DIQC 1FI7A 1M60A 3WU2V 3OA8A 2C1UA 4JCGA 1SQXD 2JQRA 1CC5A 1H31B 3RMZA 1IRWA 3PXTA 2BGVX 4RSZA 351CA 3WFDC 3PXWA 1CRIA 1GQ1A 1KYOD 2B10B 2CXBA 2V08A 1NMLA 2DGEA 1NMIA 1DT1A 1H33B 1C2NA 3CWBD 3JBTB 3L74D 1IZL0 1N9CA 1S6VB 5EXQA 4FB1A 3BCCD 5B6QA 1SQPD 4O1WA 1I8OA 3KZIV 2B12B 155CA 1CCRA 1EZVD 5B5EV 2C2CA 1M70A 1ZRTD 1W2LA 2FWLA 3CXHD 1HH7A 1HJ4A 4Q5PA 1F1FA 5CIHB 1NIRA 1CRJA 4J20A 1L0LD 2N18C 2BCNB 1CEDA 4UB6V 3ZBMA 5DJQB 5C9MA 1CXCA 4AX3A 2CA3B 1L9JC 1NTKD 5GTHV 1CYJA 3RN1A 1GIWA 1QL3A 5CIGB 2YK3A 4FA5A 1CYIA 1H32A 1U74B 2LIRA 1GDVA 1CTYA 1FI3A 4YE1A 4WQ9A 2PCBB 1I6DA 1CCHA 5CIDB 4O1QA 1GJQA 3CX5D 2V07A 1HJ5A 2ZBOA 4WQBA 1CHHA 3ZOOA 2I8FA 4WQDA 2A06D 3WFEC 2N18B 4PD4D 1KX2A 5KLVD 4WQAA 3WFBC 4PWAA 3VNWA 1AOQA 4LJIA 1E8EA 1QYZA 1FI9A 3TYIA 1EB7A 2QJPB 3H1HD 4FA1A 1P84D 4P4QB 5KAIV 1YICA 4FAVA 3NBSA 1LFMA 2N9IA 4NFGB 1QN2A 2CE0A 2MHMA 1N90A 2B11B 3DP5A 1C2RA 1E2RA 5AURA 4AALA 2FYUD 1PP9D 3L4MA 1IO3A 3ZOWA 2N9JA 1A56A 2ZOOA 1CSWA 3MK7B 5GTIV 2ORLA 4AAOA 2N3BA 4KMGA 3RN0A 1OAEA 3SWSA 1W5CT 4AANA 1H31A 4K3IA 1C52A 1YCCA 4MU8A 1YEAA 1CRCA 1DIIC 4N0KA 1NNOA 2BH4X 1KV9A 1M6ZA 4XXLA 2QJYB 2OZ1B 1K3HA 2ZXYA 1NTMD 1COTA 3ZOYA 2D0SA 4D6TD 4FANA 1H33A 3WUIA 1C75A 1MG3D 1H9YA 1CIFA 2FRCA 3SXTA 1GU2A 4WQ8A 5H2FV 1CIHA 4L3GA 1HZVA 3CU4A 1RAQA 4WQCA 5CICB 2B4ZA 451CA 1I6EA 1CO6A 1YEBA 3O5CA 3WFCC 1CYCA 1HJ3A 3ZOXA 2DVHA 1I55A 1MZ4A 1WEJF 3ORVA 2YCCA 4U3FD 3A9FA 4WQ7A 1CSUA 1AKKA 4WQEA 3RLMA 3C2CA 3X39A 1N50A 1RZ5A 1DW2A 1KIBA 1IRVA 4QAOA 3L73D 3CXHW 3TGUD 1CIGA 4H0KA 5IY51 1DW0A 1F1CA 1YIQA 3M97X 1BL9A 5DF5A 1S5LV 3L71D 1QL4A 1MG2D 2EXVA 4GEDB 1FHBA 3CYTI 1I8PA 2JTIB 1NU1D 1DW1A 1HRCA 4EIDA 1L9BC 3ZIYA 5KKZB 1CRHA 2AI5A 3VRDA 5CIBB 1DVVA 4XYDB 5B66V 2N3YA 2BLFB 4FA4A 1QKSA 2CE1A 3CX5W 2C1VA 1RZ6A 2ZZS1 1CNOA 3SJLA 2C1DB 1YNRA 1IQCA 2AIUA 2CA4B 3PXSA 1CRGA 1KB0A 1BE3D 2MTAC 1CIEA 1LS9A 3L75D 1C6OA 1HCMA 3HQ9A 4L1QA 4EICA 2VHDA 3OA8B 2IBZD 5KAFV 3L4OA 1FCDC 4UB8V 3PH2B 3SLEA 2C8SA 5CIFB 4PW9B 3VYMA 1N15A
chains in the Genus database with same CATH superfamily
4FA9A 1A8CA 2GB8B 2D0WA 2AXTV 2XTSB 5TISV 3SVWA 2BPBB 2OZ1A 1C6SA 3A0BV 1RAPA 3DMIA 1YTCA 3HQ6A 5DJQC 4EIEA 4PJ0V 1KYOW 5E79V 1J3SA 1ETPA 2PACA 3HQ8A 4AAMA 2B0ZB 1GKSA 4EIFA 1SQBD 1CHJA 2GIWA 1H1OA 4DY9A 1LC1A 5DFSA 2QJKB 5CIEB 3CP5A 1BGYD 1H9XA 1AYGA 1L0ND 1CORA 1WVEC 2FYNB 1R0QA 3H1ID 3NWVA 2L4DA 5C0ZA 1AOFA 1CSVA 1HROA 3L70D 1KX7A 3OCDB 1A2SA 1FJ0A 3L72D 1YFCA 2YIUB 1H32B 3OCDA 1CRYA 1DVHA 1PPJD 4V2KA 1BCCD 1DW3A 2HV4A 1HZUA 1SQQD 1OCDA 1CTJA 1FOCA 2GC7D 4GYDA 1CTZA 2C9XB 3O20A 1KB9D 2GC4D 3O0RC 1C7MA 1U75B 1CHIA 2BCCD 5CYTR 3HQ7A 1CSXA 1I5TA 3MK7C 1C6RA 2LITA 3H1KD 1K3GA 2YQBA 1LC2A 1LMSA 1SQVD 3NBTA 4IL6V 3A0HV 4L3HA 1E29A 3ZCFA 5KLIB 1B7VA 4H0JA 3H1JD 2C1DA 3DR0A 2BH5X 3H1LD 3WC8A 3D0WA 2ZONG 1NTZD 3O1YA 1CXAA 4Y5RA 1JDLA 1ZZHA 2PCCB 1I54A 1VYDA 1DIQC 1FI7A 1M60A 3WU2V 3OA8A 2C1UA 4JCGA 1SQXD 2JQRA 1CC5A 1H31B 3RMZA 1IRWA 3PXTA 2BGVX 4RSZA 351CA 3WFDC 3PXWA 1CRIA 1GQ1A 1KYOD 2B10B 2CXBA 2V08A 1NMLA 2DGEA 1NMIA 1DT1A 1H33B 1C2NA 3CWBD 3JBTB 3L74D 1IZL0 1N9CA 1S6VB 5EXQA 4FB1A 3BCCD 5B6QA 1SQPD 4O1WA 1I8OA 3KZIV 2B12B 155CA 1CCRA 1EZVD 5B5EV 2C2CA 1M70A 1ZRTD 1W2LA 2FWLA 3CXHD 1HH7A 1HJ4A 4Q5PA 1F1FA 5CIHB 1NIRA 1CRJA 4J20A 1L0LD 2N18C 2BCNB 1CEDA 4UB6V 3ZBMA 5DJQB 5C9MA 1CXCA 4AX3A 2CA3B 1L9JC 1NTKD 5GTHV 1CYJA 3RN1A 1GIWA 1QL3A 5CIGB 2YK3A 4FA5A 1CYIA 1H32A 1U74B 2LIRA 1GDVA 1CTYA 1FI3A 4YE1A 4WQ9A 2PCBB 1I6DA 1CCHA 5CIDB 4O1QA 1GJQA 3CX5D 2V07A 1HJ5A 2ZBOA 4WQBA 1CHHA 3ZOOA 2I8FA 4WQDA 2A06D 3WFEC 2N18B 4PD4D 1KX2A 5KLVD 4WQAA 3WFBC 4PWAA 3VNWA 1AOQA 4LJIA 1E8EA 1QYZA 1FI9A 3TYIA 1EB7A 2QJPB 3H1HD 4FA1A 1P84D 4P4QB 5KAIV 1YICA 4FAVA 3NBSA 1LFMA 2N9IA 4NFGB 1QN2A 2CE0A 2MHMA 1N90A 2B11B 3DP5A 1C2RA 1E2RA 5AURA 4AALA 2FYUD 1PP9D 3L4MA 1IO3A 3ZOWA 2N9JA 1A56A 2ZOOA 1CSWA 3MK7B 5GTIV 2ORLA 4AAOA 2N3BA 4KMGA 3RN0A 1OAEA 3SWSA 1W5CT 4AANA 1H31A 4K3IA 1C52A 1YCCA 4MU8A 1YEAA 1CRCA 1DIIC 4N0KA 1NNOA 2BH4X 1KV9A 1M6ZA 4XXLA 2QJYB 2OZ1B 1K3HA 2ZXYA 1NTMD 1COTA 3ZOYA 2D0SA 4D6TD 4FANA 1H33A 3WUIA 1C75A 1MG3D 1H9YA 1CIFA 2FRCA 3SXTA 1GU2A 4WQ8A 5H2FV 1CIHA 4L3GA 1HZVA 3CU4A 1RAQA 4WQCA 5CICB 2B4ZA 451CA 1I6EA 1CO6A 1YEBA 3O5CA 3WFCC 1CYCA 1HJ3A 3ZOXA 2DVHA 1I55A 1MZ4A 1WEJF 3ORVA 2YCCA 4U3FD 3A9FA 4WQ7A 1CSUA 1AKKA 4WQEA 3RLMA 3C2CA 3X39A 1N50A 1RZ5A 1DW2A 1KIBA 1IRVA 4QAOA 3L73D 3CXHW 3TGUD 1CIGA 4H0KA 5IY51 1DW0A 1F1CA 1YIQA 3M97X 1BL9A 5DF5A 1S5LV 3L71D 1QL4A 1MG2D 2EXVA 4GEDB 1FHBA 3CYTI 1I8PA 2JTIB 1NU1D 1DW1A 1HRCA 4EIDA 1L9BC 3ZIYA 5KKZB 1CRHA 2AI5A 3VRDA 5CIBB 1DVVA 4XYDB 5B66V 2N3YA 2BLFB 4FA4A 1QKSA 2CE1A 3CX5W 2C1VA 1RZ6A 2ZZS1 1CNOA 3SJLA 2C1DB 1YNRA 1IQCA 2AIUA 2CA4B 3PXSA 1CRGA 1KB0A 1BE3D 2MTAC 1CIEA 1LS9A 3L75D 1C6OA 1HCMA 3HQ9A 4L1QA 4EICA 2VHDA 3OA8B 2IBZD 5KAFV 3L4OA 1FCDC 4UB8V 3PH2B 3SLEA 2C8SA 5CIFB 4PW9B 3VYMA 1N15A
chains in the Genus database with same CATH topology
4FA9A 1A8CA 2GB8B 2D0WA 2AXTV 2XTSB 5TISV 3SVWA 2BPBB 2OZ1A 1C6SA 3A0BV 1RAPA 3DMIA 1YTCA 3HQ6A 5DJQC 4EIEA 4PJ0V 1KYOW 5E79V 1J3SA 1ETPA 2PACA 3HQ8A 4AAMA 2B0ZB 1GKSA 4EIFA 1SQBD 1CHJA 2GIWA 1H1OA 4DY9A 1LC1A 5DFSA 2QJKB 5CIEB 3CP5A 1BGYD 1H9XA 1AYGA 1L0ND 1CORA 1WVEC 2FYNB 1R0QA 3H1ID 3NWVA 2L4DA 5C0ZA 1AOFA 1CSVA 1HROA 3L70D 1KX7A 3OCDB 1A2SA 1FJ0A 3L72D 1YFCA 2YIUB 1H32B 3OCDA 1CRYA 1DVHA 1PPJD 4V2KA 1BCCD 1DW3A 2HV4A 1HZUA 1SQQD 1OCDA 1CTJA 1FOCA 2GC7D 4GYDA 1CTZA 2C9XB 3O20A 1KB9D 2GC4D 3O0RC 1C7MA 1U75B 1CHIA 2BCCD 5CYTR 3HQ7A 1CSXA 1I5TA 3MK7C 1C6RA 2LITA 3H1KD 1K3GA 2YQBA 1LC2A 1LMSA 1SQVD 3NBTA 4IL6V 3A0HV 4L3HA 1E29A 3ZCFA 5KLIB 1B7VA 4H0JA 3H1JD 2C1DA 3DR0A 2BH5X 3H1LD 3WC8A 2ZONG 1NTZD 3O1YA 1CXAA 4Y5RA 1JDLA 1ZZHA 2PCCB 1I54A 1VYDA 1DIQC 1FI7A 1M60A 3WU2V 3OA8A 2C1UA 4JCGA 1SQXD 2JQRA 1CC5A 1H31B 3RMZA 1IRWA 3PXTA 2BGVX 4RSZA 351CA 3WFDC 3PXWA 1CRIA 1GQ1A 1KYOD 2B10B 2CXBA 2V08A 1NMLA 2DGEA 1NMIA 1DT1A 1H33B 1C2NA 3CWBD 3JBTB 3L74D 1IZL0 1N9CA 1S6VB 5EXQA 4FB1A 3BCCD 5B6QA 1SQPD 4O1WA 1I8OA 3KZIV 2B12B 155CA 1CCRA 1EZVD 5B5EV 2C2CA 1M70A 1ZRTD 1W2LA 2FWLA 3CXHD 1HH7A 1HJ4A 4Q5PA 1F1FA 5CIHB 1NIRA 1CRJA 4J20A 1L0LD 2N18C 2BCNB 1CEDA 4UB6V 3ZBMA 5DJQB 5C9MA 1CXCA 4AX3A 2CA3B 1L9JC 1NTKD 5GTHV 1CYJA 3RN1A 1GIWA 1QL3A 5CIGB 2YK3A 4FA5A 1CYIA 1H32A 1U74B 2LIRA 1GDVA 1CTYA 1FI3A 4YE1A 4WQ9A 2PCBB 1I6DA 1CCHA 5CIDB 4O1QA 1GJQA 3CX5D 2V07A 1HJ5A 2ZBOA 4WQBA 1CHHA 3ZOOA 2I8FA 4WQDA 2A06D 3WFEC 2N18B 4PD4D 1KX2A 5KLVD 4WQAA 3WFBC 4PWAA 3VNWA 1AOQA 4LJIA 1E8EA 1QYZA 1FI9A 3TYIA 1EB7A 2QJPB 3H1HD 4FA1A 1P84D 4P4QB 5KAIV 1YICA 4FAVA 3NBSA 1LFMA 2N9IA 4NFGB 1QN2A 2CE0A 2MHMA 1N90A 2B11B 3DP5A 1C2RA 1E2RA 5AURA 4AALA 2FYUD 1PP9D 3L4MA 1IO3A 3ZOWA 2N9JA 1A56A 2ZOOA 1CSWA 3MK7B 5GTIV 2ORLA 4AAOA 2N3BA 4KMGA 3RN0A 1OAEA 3SWSA 1W5CT 4AANA 1H31A 4K3IA 1C52A 1YCCA 4MU8A 1YEAA 1CRCA 1DIIC 4N0KA 1NNOA 2BH4X 1KV9A 1M6ZA 4XXLA 2QJYB 2OZ1B 1K3HA 2ZXYA 1NTMD 1COTA 3ZOYA 2D0SA 4D6TD 4FANA 1H33A 3WUIA 1C75A 1MG3D 1H9YA 1CIFA 2FRCA 3SXTA 1GU2A 4WQ8A 5H2FV 1CIHA 4L3GA 1HZVA 3CU4A 1RAQA 4WQCA 5CICB 2B4ZA 451CA 1I6EA 1CO6A 1YEBA 3O5CA 3WFCC 1CYCA 1HJ3A 3ZOXA 2DVHA 1I55A 1MZ4A 1WEJF 3ORVA 2YCCA 4U3FD 3A9FA 4WQ7A 1CSUA 1AKKA 4WQEA 3RLMA 3C2CA 3X39A 1N50A 1RZ5A 1DW2A 1KIBA 1IRVA 4QAOA 3L73D 3CXHW 3TGUD 1CIGA 4H0KA 5IY51 1DW0A 1F1CA 1YIQA 3M97X 1BL9A 5DF5A 1S5LV 3L71D 1QL4A 1MG2D 2EXVA 4GEDB 1FHBA 3CYTI 1I8PA 2JTIB 1NU1D 1DW1A 1HRCA 4EIDA 1L9BC 3ZIYA 5KKZB 1CRHA 2AI5A 3VRDA 5CIBB 1DVVA 4XYDB 5B66V 2N3YA 2BLFB 4FA4A 1QKSA 2CE1A 3CX5W 2C1VA 1RZ6A 2ZZS1 1CNOA 3SJLA 2C1DB 1YNRA 1IQCA 2AIUA 2CA4B 3PXSA 1CRGA 1KB0A 1BE3D 2MTAC 1CIEA 1LS9A 3L75D 1C6OA 1HCMA 3HQ9A 4L1QA 4EICA 2VHDA 3OA8B 2IBZD 5KAFV 3L4OA 1FCDC 4UB8V 3PH2B 3SLEA 2C8SA 5CIFB 4PW9B 3VYMA 1N15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA9 A;  1A8C A;  2GB8 B;  2D0W A;  2AXT V;  2XTS B;  5TIS V;  3SVW A;  2BPB B;  2OZ1 A;  1C6S A;  3A0B V;  1RAP A;  3DMI A;  1YTC A;  3HQ6 A;  5DJQ C;  4EIE A;  4PJ0 V;  1KYO W;  5E79 V;  1J3S A;  1ETP A;  2PAC A;  3HQ8 A;  4AAM A;  2B0Z B;  1GKS A;  4EIF A;  1SQB D;  1CHJ A;  2GIW A;  1H1O A;  4DY9 A;  1LC1 A;  5DFS A;  2QJK B;  5CIE B;  3CP5 A;  1BGY D;  1H9X A;  1AYG A;  1L0N D;  1COR A;  1WVE C;  2FYN B;  1R0Q A;  3H1I D;  3NWV A;  2L4D A;  5C0Z A;  1AOF A;  1CSV A;  1HRO A;  3L70 D;  1KX7 A;  3OCD B;  1A2S A;  1FJ0 A;  3L72 D;  1YFC A;  2YIU B;  1H32 B;  3OCD A;  1CRY A;  1DVH A;  1PPJ D;  4V2K A;  1BCC D;  1DW3 A;  2HV4 A;  1HZU A;  1SQQ D;  1OCD A;  1CTJ A;  1FOC A;  2GC7 D;  4GYD A;  1CTZ A;  2C9X B;  3O20 A;  1KB9 D;  2GC4 D;  3O0R C;  1C7M A;  1U75 B;  1CHI A;  2BCC D;  5CYT R;  3HQ7 A;  1CSX A;  1I5T A;  3MK7 C;  1C6R A;  2LIT A;  3H1K D;  1K3G A;  2YQB A;  1LC2 A;  1LMS A;  1SQV D;  3NBT A;  4IL6 V;  3A0H V;  4L3H A;  1E29 A;  3ZCF A;  5KLI B;  1B7V A;  4H0J A;  3H1J D;  2C1D A;  3DR0 A;  2BH5 X;  3H1L D;  3WC8 A;  2ZON G;  1NTZ D;  3O1Y A;  1CXA A;  4Y5R A;  1JDL A;  1ZZH A;  2PCC B;  1I54 A;  1VYD A;  1DIQ C;  1FI7 A;  1M60 A;  3WU2 V;  3OA8 A;  2C1U A;  4JCG A;  1SQX D;  2JQR A;  1CC5 A;  1H31 B;  3RMZ A;  1IRW A;  3PXT A;  2BGV X;  4RSZ A;  351C A;  3WFD C;  3PXW A;  1CRI A;  1GQ1 A;  1KYO D;  2B10 B;  2CXB A;  2V08 A;  1NML A;  2DGE A;  1NMI A;  1DT1 A;  1H33 B;  1C2N A;  3CWB D;  3JBT B;  3L74 D;  1IZL 0;  1N9C A;  1S6V B;  5EXQ A;  4FB1 A;  3BCC D;  5B6Q A;  1SQP D;  4O1W A;  1I8O A;  3KZI V;  2B12 B;  155C A;  1CCR A;  1EZV D;  5B5E V;  2C2C A;  1M70 A;  1ZRT D;  1W2L A;  2FWL A;  3CXH D;  1HH7 A;  1HJ4 A;  4Q5P A;  1F1F A;  5CIH B;  1NIR A;  1CRJ A;  4J20 A;  1L0L D;  2N18 C;  2BCN B;  1CED A;  4UB6 V;  3ZBM A;  5DJQ B;  5C9M A;  1CXC A;  4AX3 A;  2CA3 B;  1L9J C;  1NTK D;  5GTH V;  1CYJ A;  3RN1 A;  1GIW A;  1QL3 A;  5CIG B;  2YK3 A;  4FA5 A;  1CYI A;  1H32 A;  1U74 B;  2LIR A;  1GDV A;  1CTY A;  1FI3 A;  4YE1 A;  4WQ9 A;  2PCB B;  1I6D A;  1CCH A;  5CID B;  4O1Q A;  1GJQ A;  3CX5 D;  2V07 A;  1HJ5 A;  2ZBO A;  4WQB A;  1CHH A;  3ZOO A;  2I8F A;  4WQD A;  2A06 D;  3WFE C;  2N18 B;  4PD4 D;  1KX2 A;  5KLV D;  4WQA A;  3WFB C;  4PWA A;  3VNW A;  1AOQ A;  4LJI A;  1E8E A;  1QYZ A;  1FI9 A;  3TYI A;  1EB7 A;  2QJP B;  3H1H D;  4FA1 A;  1P84 D;  4P4Q B;  5KAI V;  1YIC A;  4FAV A;  3NBS A;  1LFM A;  2N9I A;  4NFG B;  1QN2 A;  2CE0 A;  2MHM A;  1N90 A;  2B11 B;  3DP5 A;  1C2R A;  1E2R A;  5AUR A;  4AAL A;  2FYU D;  1PP9 D;  3L4M A;  1IO3 A;  3ZOW A;  2N9J A;  1A56 A;  2ZOO A;  1CSW A;  3MK7 B;  5GTI V;  2ORL A;  4AAO A;  2N3B A;  4KMG A;  3RN0 A;  1OAE A;  3SWS A;  1W5C T;  4AAN A;  1H31 A;  4K3I A;  1C52 A;  1YCC A;  4MU8 A;  1YEA A;  1CRC A;  1DII C;  4N0K A;  1NNO A;  2BH4 X;  1KV9 A;  1M6Z A;  4XXL A;  2QJY B;  2OZ1 B;  1K3H A;  2ZXY A;  1NTM D;  1COT A;  3ZOY A;  2D0S A;  4D6T D;  4FAN A;  1H33 A;  3WUI A;  1C75 A;  1MG3 D;  1H9Y A;  1CIF A;  2FRC A;  3SXT A;  1GU2 A;  4WQ8 A;  5H2F V;  1CIH A;  4L3G A;  1HZV A;  3CU4 A;  1RAQ A;  4WQC A;  5CIC B;  2B4Z A;  451C A;  1I6E A;  1CO6 A;  1YEB A;  3O5C A;  3WFC C;  1CYC A;  1HJ3 A;  3ZOX A;  2DVH A;  1I55 A;  1MZ4 A;  1WEJ F;  3ORV A;  2YCC A;  4U3F D;  3A9F A;  4WQ7 A;  1CSU A;  1AKK A;  4WQE A;  3RLM A;  3C2C A;  3X39 A;  1N50 A;  1RZ5 A;  1DW2 A;  1KIB A;  1IRV A;  4QAO A;  3L73 D;  3CXH W;  3TGU D;  1CIG A;  4H0K A;  5IY5 1;  1DW0 A;  1F1C A;  1YIQ A;  3M97 X;  1BL9 A;  5DF5 A;  1S5L V;  3L71 D;  1QL4 A;  1MG2 D;  2EXV A;  4GED B;  1FHB A;  3CYT I;  1I8P A;  2JTI B;  1NU1 D;  1DW1 A;  1HRC A;  4EID A;  1L9B C;  3ZIY A;  5KKZ B;  1CRH A;  2AI5 A;  3VRD A;  5CIB B;  1DVV A;  4XYD B;  5B66 V;  2N3Y A;  2BLF B;  4FA4 A;  1QKS A;  2CE1 A;  3CX5 W;  2C1V A;  1RZ6 A;  2ZZS 1;  1CNO A;  3SJL A;  2C1D B;  1YNR A;  1IQC A;  2AIU A;  2CA4 B;  3PXS A;  1CRG A;  1KB0 A;  1BE3 D;  2MTA C;  1CIE A;  1LS9 A;  3L75 D;  1C6O A;  1HCM A;  3HQ9 A;  4L1Q A;  4EIC A;  2VHD A;  3OA8 B;  2IBZ D;  5KAF V;  3L4O A;  1FCD C;  4UB8 V;  3PH2 B;  3SLE A;  2C8S A;  5CIF B;  4PW9 B;  3VYM A;  1N15 A; 
#chains in the Genus database with same CATH topology
 4FA9 A;  1A8C A;  2GB8 B;  2D0W A;  2AXT V;  2XTS B;  5TIS V;  3SVW A;  2BPB B;  2OZ1 A;  1C6S A;  3A0B V;  1RAP A;  3DMI A;  1YTC A;  3HQ6 A;  5DJQ C;  4EIE A;  4PJ0 V;  1KYO W;  5E79 V;  1J3S A;  1ETP A;  2PAC A;  3HQ8 A;  4AAM A;  2B0Z B;  1GKS A;  4EIF A;  1SQB D;  1CHJ A;  2GIW A;  1H1O A;  4DY9 A;  1LC1 A;  5DFS A;  2QJK B;  5CIE B;  3CP5 A;  1BGY D;  1H9X A;  1AYG A;  1L0N D;  1COR A;  1WVE C;  2FYN B;  1R0Q A;  3H1I D;  3NWV A;  2L4D A;  5C0Z A;  1AOF A;  1CSV A;  1HRO A;  3L70 D;  1KX7 A;  3OCD B;  1A2S A;  1FJ0 A;  3L72 D;  1YFC A;  2YIU B;  1H32 B;  3OCD A;  1CRY A;  1DVH A;  1PPJ D;  4V2K A;  1BCC D;  1DW3 A;  2HV4 A;  1HZU A;  1SQQ D;  1OCD A;  1CTJ A;  1FOC A;  2GC7 D;  4GYD A;  1CTZ A;  2C9X B;  3O20 A;  1KB9 D;  2GC4 D;  3O0R C;  1C7M A;  1U75 B;  1CHI A;  2BCC D;  5CYT R;  3HQ7 A;  1CSX A;  1I5T A;  3MK7 C;  1C6R A;  2LIT A;  3H1K D;  1K3G A;  2YQB A;  1LC2 A;  1LMS A;  1SQV D;  3NBT A;  4IL6 V;  3A0H V;  4L3H A;  1E29 A;  3ZCF A;  5KLI B;  1B7V A;  4H0J A;  3H1J D;  2C1D A;  3DR0 A;  2BH5 X;  3H1L D;  3WC8 A;  3D0W A;  2ZON G;  1NTZ D;  3O1Y A;  1CXA A;  4Y5R A;  1JDL A;  1ZZH A;  2PCC B;  1I54 A;  1VYD A;  1DIQ C;  1FI7 A;  1M60 A;  3WU2 V;  3OA8 A;  2C1U A;  4JCG A;  1SQX D;  2JQR A;  1CC5 A;  1H31 B;  3RMZ A;  1IRW A;  3PXT A;  2BGV X;  4RSZ A;  351C A;  3WFD C;  3PXW A;  1CRI A;  1GQ1 A;  1KYO D;  2B10 B;  2CXB A;  2V08 A;  1NML A;  2DGE A;  1NMI A;  1DT1 A;  1H33 B;  1C2N A;  3CWB D;  3JBT B;  3L74 D;  1IZL 0;  1N9C A;  1S6V B;  5EXQ A;  4FB1 A;  3BCC D;  5B6Q A;  1SQP D;  4O1W A;  1I8O A;  3KZI V;  2B12 B;  155C A;  1CCR A;  1EZV D;  5B5E V;  2C2C A;  1M70 A;  1ZRT D;  1W2L A;  2FWL A;  3CXH D;  1HH7 A;  1HJ4 A;  4Q5P A;  1F1F A;  5CIH B;  1NIR A;  1CRJ A;  4J20 A;  1L0L D;  2N18 C;  2BCN B;  1CED A;  4UB6 V;  3ZBM A;  5DJQ B;  5C9M A;  1CXC A;  4AX3 A;  2CA3 B;  1L9J C;  1NTK D;  5GTH V;  1CYJ A;  3RN1 A;  1GIW A;  1QL3 A;  5CIG B;  2YK3 A;  4FA5 A;  1CYI A;  1H32 A;  1U74 B;  2LIR A;  1GDV A;  1CTY A;  1FI3 A;  4YE1 A;  4WQ9 A;  2PCB B;  1I6D A;  1CCH A;  5CID B;  4O1Q A;  1GJQ A;  3CX5 D;  2V07 A;  1HJ5 A;  2ZBO A;  4WQB A;  1CHH A;  3ZOO A;  2I8F A;  4WQD A;  2A06 D;  3WFE C;  2N18 B;  4PD4 D;  1KX2 A;  5KLV D;  4WQA A;  3WFB C;  4PWA A;  3VNW A;  1AOQ A;  4LJI A;  1E8E A;  1QYZ A;  1FI9 A;  3TYI A;  1EB7 A;  2QJP B;  3H1H D;  4FA1 A;  1P84 D;  4P4Q B;  5KAI V;  1YIC A;  4FAV A;  3NBS A;  1LFM A;  2N9I A;  4NFG B;  1QN2 A;  2CE0 A;  2MHM A;  1N90 A;  2B11 B;  3DP5 A;  1C2R A;  1E2R A;  5AUR A;  4AAL A;  2FYU D;  1PP9 D;  3L4M A;  1IO3 A;  3ZOW A;  2N9J A;  1A56 A;  2ZOO A;  1CSW A;  3MK7 B;  5GTI V;  2ORL A;  4AAO A;  2N3B A;  4KMG A;  3RN0 A;  1OAE A;  3SWS A;  1W5C T;  4AAN A;  1H31 A;  4K3I A;  1C52 A;  1YCC A;  4MU8 A;  1YEA A;  1CRC A;  1DII C;  4N0K A;  1NNO A;  2BH4 X;  1KV9 A;  1M6Z A;  4XXL A;  2QJY B;  2OZ1 B;  1K3H A;  2ZXY A;  1NTM D;  1COT A;  3ZOY A;  2D0S A;  4D6T D;  4FAN A;  1H33 A;  3WUI A;  1C75 A;  1MG3 D;  1H9Y A;  1CIF A;  2FRC A;  3SXT A;  1GU2 A;  4WQ8 A;  5H2F V;  1CIH A;  4L3G A;  1HZV A;  3CU4 A;  1RAQ A;  4WQC A;  5CIC B;  2B4Z A;  451C A;  1I6E A;  1CO6 A;  1YEB A;  3O5C A;  3WFC C;  1CYC A;  1HJ3 A;  3ZOX A;  2DVH A;  1I55 A;  1MZ4 A;  1WEJ F;  3ORV A;  2YCC A;  4U3F D;  3A9F A;  4WQ7 A;  1CSU A;  1AKK A;  4WQE A;  3RLM A;  3C2C A;  3X39 A;  1N50 A;  1RZ5 A;  1DW2 A;  1KIB A;  1IRV A;  4QAO A;  3L73 D;  3CXH W;  3TGU D;  1CIG A;  4H0K A;  5IY5 1;  1DW0 A;  1F1C A;  1YIQ A;  3M97 X;  1BL9 A;  5DF5 A;  1S5L V;  3L71 D;  1QL4 A;  1MG2 D;  2EXV A;  4GED B;  1FHB A;  3CYT I;  1I8P A;  2JTI B;  1NU1 D;  1DW1 A;  1HRC A;  4EID A;  1L9B C;  3ZIY A;  5KKZ B;  1CRH A;  2AI5 A;  3VRD A;  5CIB B;  1DVV A;  4XYD B;  5B66 V;  2N3Y A;  2BLF B;  4FA4 A;  1QKS A;  2CE1 A;  3CX5 W;  2C1V A;  1RZ6 A;  2ZZS 1;  1CNO A;  3SJL A;  2C1D B;  1YNR A;  1IQC A;  2AIU A;  2CA4 B;  3PXS A;  1CRG A;  1KB0 A;  1BE3 D;  2MTA C;  1CIE A;  1LS9 A;  3L75 D;  1C6O A;  1HCM A;  3HQ9 A;  4L1Q A;  4EIC A;  2VHD A;  3OA8 B;  2IBZ D;  5KAF V;  3L4O A;  1FCD C;  4UB8 V;  3PH2 B;  3SLE A;  2C8S A;  5CIF B;  4PW9 B;  3VYM A;  1N15 A; 
#chains in the Genus database with same CATH homology
 4FA9 A;  1A8C A;  2GB8 B;  2D0W A;  2AXT V;  2XTS B;  5TIS V;  3SVW A;  2BPB B;  2OZ1 A;  1C6S A;  3A0B V;  1RAP A;  3DMI A;  1YTC A;  3HQ6 A;  5DJQ C;  4EIE A;  4PJ0 V;  1KYO W;  5E79 V;  1J3S A;  1ETP A;  2PAC A;  3HQ8 A;  4AAM A;  2B0Z B;  1GKS A;  4EIF A;  1SQB D;  1CHJ A;  2GIW A;  1H1O A;  4DY9 A;  1LC1 A;  5DFS A;  2QJK B;  5CIE B;  3CP5 A;  1BGY D;  1H9X A;  1AYG A;  1L0N D;  1COR A;  1WVE C;  2FYN B;  1R0Q A;  3H1I D;  3NWV A;  2L4D A;  5C0Z A;  1AOF A;  1CSV A;  1HRO A;  3L70 D;  1KX7 A;  3OCD B;  1A2S A;  1FJ0 A;  3L72 D;  1YFC A;  2YIU B;  1H32 B;  3OCD A;  1CRY A;  1DVH A;  1PPJ D;  4V2K A;  1BCC D;  1DW3 A;  2HV4 A;  1HZU A;  1SQQ D;  1OCD A;  1CTJ A;  1FOC A;  2GC7 D;  4GYD A;  1CTZ A;  2C9X B;  3O20 A;  1KB9 D;  2GC4 D;  3O0R C;  1C7M A;  1U75 B;  1CHI A;  2BCC D;  5CYT R;  3HQ7 A;  1CSX A;  1I5T A;  3MK7 C;  1C6R A;  2LIT A;  3H1K D;  1K3G A;  2YQB A;  1LC2 A;  1LMS A;  1SQV D;  3NBT A;  4IL6 V;  3A0H V;  4L3H A;  1E29 A;  3ZCF A;  5KLI B;  1B7V A;  4H0J A;  3H1J D;  2C1D A;  3DR0 A;  2BH5 X;  3H1L D;  3WC8 A;  2ZON G;  1NTZ D;  3O1Y A;  1CXA A;  4Y5R A;  1JDL A;  1ZZH A;  2PCC B;  1I54 A;  1VYD A;  1DIQ C;  1FI7 A;  1M60 A;  3WU2 V;  3OA8 A;  2C1U A;  4JCG A;  1SQX D;  2JQR A;  1CC5 A;  1H31 B;  3RMZ A;  1IRW A;  3PXT A;  2BGV X;  4RSZ A;  351C A;  3WFD C;  3PXW A;  1CRI A;  1GQ1 A;  1KYO D;  2B10 B;  2CXB A;  2V08 A;  1NML A;  2DGE A;  1NMI A;  1DT1 A;  1H33 B;  1C2N A;  3CWB D;  3JBT B;  3L74 D;  1IZL 0;  1N9C A;  1S6V B;  5EXQ A;  4FB1 A;  3BCC D;  5B6Q A;  1SQP D;  4O1W A;  1I8O A;  3KZI V;  2B12 B;  155C A;  1CCR A;  1EZV D;  5B5E V;  2C2C A;  1M70 A;  1ZRT D;  1W2L A;  2FWL A;  3CXH D;  1HH7 A;  1HJ4 A;  4Q5P A;  1F1F A;  5CIH B;  1NIR A;  1CRJ A;  4J20 A;  1L0L D;  2N18 C;  2BCN B;  1CED A;  4UB6 V;  3ZBM A;  5DJQ B;  5C9M A;  1CXC A;  4AX3 A;  2CA3 B;  1L9J C;  1NTK D;  5GTH V;  1CYJ A;  3RN1 A;  1GIW A;  1QL3 A;  5CIG B;  2YK3 A;  4FA5 A;  1CYI A;  1H32 A;  1U74 B;  2LIR A;  1GDV A;  1CTY A;  1FI3 A;  4YE1 A;  4WQ9 A;  2PCB B;  1I6D A;  1CCH A;  5CID B;  4O1Q A;  1GJQ A;  3CX5 D;  2V07 A;  1HJ5 A;  2ZBO A;  4WQB A;  1CHH A;  3ZOO A;  2I8F A;  4WQD A;  2A06 D;  3WFE C;  2N18 B;  4PD4 D;  1KX2 A;  5KLV D;  4WQA A;  3WFB C;  4PWA A;  3VNW A;  1AOQ A;  4LJI A;  1E8E A;  1QYZ A;  1FI9 A;  3TYI A;  1EB7 A;  2QJP B;  3H1H D;  4FA1 A;  1P84 D;  4P4Q B;  5KAI V;  1YIC A;  4FAV A;  3NBS A;  1LFM A;  2N9I A;  4NFG B;  1QN2 A;  2CE0 A;  2MHM A;  1N90 A;  2B11 B;  3DP5 A;  1C2R A;  1E2R A;  5AUR A;  4AAL A;  2FYU D;  1PP9 D;  3L4M A;  1IO3 A;  3ZOW A;  2N9J A;  1A56 A;  2ZOO A;  1CSW A;  3MK7 B;  5GTI V;  2ORL A;  4AAO A;  2N3B A;  4KMG A;  3RN0 A;  1OAE A;  3SWS A;  1W5C T;  4AAN A;  1H31 A;  4K3I A;  1C52 A;  1YCC A;  4MU8 A;  1YEA A;  1CRC A;  1DII C;  4N0K A;  1NNO A;  2BH4 X;  1KV9 A;  1M6Z A;  4XXL A;  2QJY B;  2OZ1 B;  1K3H A;  2ZXY A;  1NTM D;  1COT A;  3ZOY A;  2D0S A;  4D6T D;  4FAN A;  1H33 A;  3WUI A;  1C75 A;  1MG3 D;  1H9Y A;  1CIF A;  2FRC A;  3SXT A;  1GU2 A;  4WQ8 A;  5H2F V;  1CIH A;  4L3G A;  1HZV A;  3CU4 A;  1RAQ A;  4WQC A;  5CIC B;  2B4Z A;  451C A;  1I6E A;  1CO6 A;  1YEB A;  3O5C A;  3WFC C;  1CYC A;  1HJ3 A;  3ZOX A;  2DVH A;  1I55 A;  1MZ4 A;  1WEJ F;  3ORV A;  2YCC A;  4U3F D;  3A9F A;  4WQ7 A;  1CSU A;  1AKK A;  4WQE A;  3RLM A;  3C2C A;  3X39 A;  1N50 A;  1RZ5 A;  1DW2 A;  1KIB A;  1IRV A;  4QAO A;  3L73 D;  3CXH W;  3TGU D;  1CIG A;  4H0K A;  5IY5 1;  1DW0 A;  1F1C A;  1YIQ A;  3M97 X;  1BL9 A;  5DF5 A;  1S5L V;  3L71 D;  1QL4 A;  1MG2 D;  2EXV A;  4GED B;  1FHB A;  3CYT I;  1I8P A;  2JTI B;  1NU1 D;  1DW1 A;  1HRC A;  4EID A;  1L9B C;  3ZIY A;  5KKZ B;  1CRH A;  2AI5 A;  3VRD A;  5CIB B;  1DVV A;  4XYD B;  5B66 V;  2N3Y A;  2BLF B;  4FA4 A;  1QKS A;  2CE1 A;  3CX5 W;  2C1V A;  1RZ6 A;  2ZZS 1;  1CNO A;  3SJL A;  2C1D B;  1YNR A;  1IQC A;  2AIU A;  2CA4 B;  3PXS A;  1CRG A;  1KB0 A;  1BE3 D;  2MTA C;  1CIE A;  1LS9 A;  3L75 D;  1C6O A;  1HCM A;  3HQ9 A;  4L1Q A;  4EIC A;  2VHD A;  3OA8 B;  2IBZ D;  5KAF V;  3L4O A;  1FCD C;  4UB8 V;  3PH2 B;  3SLE A;  2C8S A;  5CIF B;  4PW9 B;  3VYM A;  1N15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...