1SQXD

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqxD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqxD02
3L4OA 2OZ1A 1H31B 4K3IA 1RZ6A 2ZZS1 3DR0A 2ZXYA 1HZUA 2JTIB 1N90A 3NBSA 1AOFA 3ZIYA 1L0ND 5KKZB 2ORLA 1A8CA 1H1OA 3OA8B 3O5CA 3ITKA 1QL3A 2Q3EA 2JWAA 1DW0A 3WU2V 4AANA 1H9XA 2C1UA 1DT1A 1HZVA 1F1CA 4H0JA 1I8OA 1ZRTD 2GC4D 5E79V 1FI9A 2K9JB 3H1JD 3M97X 1ETPA 1AKKA 2GB8B 1HJ4A 2L91A 4UB8V 1CNOA 3TDKA 4KMGA 3VRDA 2AI5A 5B5EV 2QJPB 1DW3A 1E2RA 2ZONG 1C6OA 1I5TA 1LMSA 4WQEA 2KNCB 1CRIA 1L9JC 4EDFA 1S6VB 1CHJA 4N0KA 2QJKB 1RAPA 4WQCA 1U74B 2QJYB 5B66V 4XYDB 2N3YA 2CXBA 1KB9D 1B7VA 5H2FV 1NTMD 4JCGA 2VHDA 5CYTR 4EIEA 1C52A 4FA5A 3X39A 1HRCA 3WFBC 1YCCA 5DJQB 3ORVA 1NTKD 1IRWA 2CA3B 3L73D 5KAIV 3PXSA 1FI3A 2C2CA 4PJ0V 1QL4A 2N3BA 1A56A 1NU1D 1GJQA 4YE1A 1BGYD 1LS9A 1LFMA 3WFDC 4AX3A 5TISV 1WEJF 3VNWA 1NMIA 1H33A 1H32B 1E8EA 2YIUB 1NMLA 3FWLA 2FYNB 2GC7D 4PWAA 3WC8A 3L72D 1C6SA 4LJIA 1IRVA 1CYJA 5CIBB 3L70D 3A0HV 1KX2A 2AIUA 4O1WA 1F1FA 3CX5D 1H32A 1P84D 1CSVA 1KIBA 2DGEA 2D0SA 3L75D 1S5LV 3PXWA 1CSUA 2N18B 4MU8A 1CHHA 1CSXA 1DIQC 1U75B 5CIGB 1CHIA 1SQXD 1CEDA 1FOCA 1CC5A 3JBTB 5C9MA 3PHLA 2B11B 4UB6V 3GG2A 2N18C 1I6DA 3ZOOA 1DVVA 5CIDB 1DIIC 3H1LD 1CTJA 2B12B 1NTZD 3CX5W 3PTZA 2RMZA 3HQ7A 4P4QB 2XTSB 2BH5X 1W5CT 1CIGA 5DFSA 1BCCD 2FYUD 3O0RC 1SQQD 1KYOD 1GU2A 2YQBA 2QG4A 2JQRA 5KLVD 1A2SA 2B0ZB 1YEAA 1I6EA 1CRYA 1PP9D 1SQVD 2O3JA 3L74D 4Q5PA 2C1DB 1AYGA 4FA4A 2YK3A 4V2KA 2BGVX 3NBTA 3BCCD 5GTIV 1CXCA 3CYTI 2C1VA 1I54A 1YFCA 3RN0A 3CP5A 2OZ1B 3CXHW 3OCDB 1QN2A 5CIFB 3TGUD 2BH4X 1FCDC 4RJTA 1CORA 2N9YB 4WQ7A 5C0ZA 1HJ5A 1L0LD 2C1DA 1CCHA 1NNOA 1CTZA 3PLNA 2BCCD 1J3SA 2RN0A 3SLEA 4WQDA 1R0QA 351CA 4AAMA 1L9BC 1I8PA 1NIRA 2YCCA 1CIFA 3O20A 2LIRA 2V07A 2Y0DA 1HROA 1H9YA 1BE3D 1K3GA 1C75A 1HJ3A 2BPBB 3CXHD 1YEBA 2HV4A 1SQPD 1MZ4A 1CIEA 1DVHA 1FHBA 3ZBMA 2CE0A 3A0BV 3ZCFA 1CTYA 5DF5A 3CWBD 3HQ6A 1DW1A 4FA9A 4AALA 3NWVA 4EIFA 2MHMA 1H31A 1C7MA 3DMIA 1CSWA 1BL9A 1CCRA 1IZL0 5EXQA 4NFGB 1M70A 1M60A 4D6TD 3OA8A 1WVEC 2LITA 2Y0CA 4QAOA 1I55A 4FB1A 1GDVA 155CA 1PPJD 4A7PA 1CRGA 3MK7C 4PW9B 4GEDB 2CA4B 1YIQA 5CIEB 1YTCA 3SXTA 1HH7A 1C6RA 1N9CA 4IL6V 2PCBB 1QYZA 3H1KD 2IBZD 3ZOXA 1KV9A 2CE1A 1IQCA 3A9FA 4O1QA 2KS1A 3RN1A 3OCDA 3RMZA 2FRCA 1W2LA 2B4ZA 3SJLA 4EIDA 1CIHA 3PRJA 3C2CA 3GW6A 2ZBOA 4WQ8A 3TYIA 3VYMA 1DW2A 3KHUA 1YNRA 4J20A 5GTHV 3VMAA 3KZIV 2EXVA 2PACA 3PH2B 1K3HA 1JDLA 3WUIA 3WFEC 3WFCC 1MG3D 1GIWA 2A06D 1ZZHA 1E29A 1HCMA 1EZVD 2B10B 5AURA 1KYOW 1CRHA 1CYIA 1C2NA 1AOQA 2ZOOA 5B6QA 2N9IA 4H0KA 2N9JA 3H1ID 2FWLA 4L3HA 1C2RA 1GKSA 4U3FD 3SVWA 1N15A 2V08A 1RZ5A 3ZOWA 1H33B 1OAEA 1SQBD 3H1HD 2DVHA 5CIHB 2PCCB 1CRJA 1RAQA 1KX7A 5KLIB 4RSZA 1N50A 4PD4D 1MG2D 4WQAA 1CXAA 1LC2A 1CYCA 1GQ1A 3MK7B 1KB0A 3L71D 4WQ9A 3PXTA 5CICB 4L3GA 1COTA 1EB7A 3O1YA 3RLMA 3L4MA 2C8SA 2BCNB 1CRCA 4L1QA 5KAFV 3SWSA 1FJ0A 5IY51 1OCDA 4WQBA 5DJQC 3TF5A 1YICA 2BLFB 1QKSA 2Y0EA 4AAOA 4FANA 2MTAC 2D0WA 4DY9A 1VYDA 1IO3A 2C9XB 2L4DA 4FAVA 1CO6A 4FA1A 2I8FA 451CA 3ZOYA 3CU4A 4Y5RA 1LC1A 3HQ8A 4EICA 1FI7A 1M6ZA 4GYDA 4XXLA 3DP5A 5TJHA 2GIWA 3HQ9A 2AXTV
chains in the Genus database with same CATH superfamily
3L4OA 4WVZA 3S4RA 2OZ1A 1H31B 4K3IA 2QE7H 2ZZS1 1YI2P 4OWFA 2HR3A 1FDMA 1VQ7P 1OVRA 2Q9IA 4DOJA 4CPGA 1N90A 3TGUG 1URQA 3HD7D 2JWAA 1JUNA 2WPVB 2C1UA 2I1KA 3OW2O 1F1CA 1KYOI 1M7LA 5TISH 1SFCB 1AVYA 2K9JB 5KJ7D 3M97X 1ETPA 1JNMA 4I1LA 2GB8B 1JY2N 1CNOA 2KIKA 3TDKA 3SWYA 5B5EV 2QJPB 4H0LB 1E2RA 2ZONG 4C46A 1L0NK 3B5NB 2ZYGA 3CWBJ 1NVOA 2GUVA 4XE5B 1CRIA 1L9JC 4N0KA 3WU2E 2QJYB 2N3YA 2CXBA 5H2FV 4JCGA 4EIEA 1PGPA 4FA5A 3B5NA 1PFIA 2KZJA 2XNDH 1OW7A 2Z4EA 1VF5D 3Q5SA 1SQXG 1NTKD 2WMMA 3L73D 1OWAA 2YXQB 3L37A 1NU1D 2YMKA 3FX0A 4YE1A 1BGYD 3BATA 1VF5C 3WUTA 1P84H 3VNWA 1BCCG 1H33A 1ZRTE 1H32B 3CCEP 1SQQK 1YTZT 1CSBA 1NWQA 3CC4P 2PFXA 1IJDB 3BVHA 2FYNB 2O01H 2GC7D 3V5BA 3SWFA 3WC8A 4LJIA 5CBNA 1U7MA 3AE4C 5CIBB 3L70J 3A0HV 3M9BA 2FFDA 2AIUA 3HRNA 1CSVA 2A45I 2NRGA 3CMAP 4W7YA 1SQXE 2E76C 3Q3DA 1S5LV 1M1JA 4MU8A 1LWUB 1PV3A 3GHGB 1U75B 5CIGB 1NAFA 4Z1MH 2V7QJ 3C8VA 5AW8B 2Z5IA 1SFCC 4H13B 3CX5I 2PP6A 2N18C 5CJ0A 1I6DA 1T2KC 4OH8B 2E5TA 5GTHH 1G2CA 1GZLA 2XTSB 2BH5X 3GHGA 1CIGA 1MV8A 1GU2A 1RE3C 2JR8A 1SQVJ 1VQKP 4Y99B 2HPCA 4HKZH 1YEAA 1I6EA 2NPSB 2A45H 3M9HA 2C1DB 5AW2B 4D6TE 1K73Q 2BGVX 2IZ1A 2CPSA 5GTIV 1CXCA 2ZT9D 1M8OB 1YFCA 2OYIC 5AVZB 3CP5A 4GOEA 3OCDB 1FCDC 1KQSO 2E75C 4RJTA 2MKVA 4WQ7A 5CJ4A 2C1DA 1NO4A 2E42A 3SLEA 1W2BO 3P8CE 2WSCH 1RHZB 2O1KA 3C9IA 1RF1C 1NIRA 1AQTA 2W6BA 1YBKA 2OGUA 1HROA 3KQGA 1C75A 2M3BA 2HV4A 1MZ4A 1LJ2A 3FGAD 1GL2B 1DVHA 3HE5A 3ZBMA 4H0LC 1JY3N 2YXRB 4OGQB 2B87B 3VP8A 5DF5A 2K88A 2ZVNB 5AW0B 2E76D 3NWVA 4EIFA 2JEEA 2MHMA 1IK9A 2KLVA 2ZJSE 2QJYC 4LC1A 1Q90D 1S5LX 1RE3A 1EDIA 2E76B 3ZDMA 1VQLP 3AEGC 1HGVA 3R2PA 1M60A 1AV1A 1PGQA 3P7KA 4ZMDA 4QAOA 3H1IJ 2I1JA 1N7SA 4GKGA 1GDVA 155CA 5BU5A 4Y99C 4K3AA 3IFMA 3QH9A 2J58A 2Y9ZA 3MK7C 4PW9B 2VRSA 4WY4A 1JTHA 2Q5UA 1N7LA 3M91A 1HH7A 1C6RA 1EQ7A 1N9CA 5E79E 1QYZA 1N8RQ 3H1KD 3NTNA 1KV9A 3A9FA 1FZCC 1W2LA 2WPRA 3Q2YA 2B4ZA 4GT1A 3SJLA 1CIHA 3PRJA 1AVOA 4B86A 2ZBOA 4WQ8A 3IR9A 1RF0A 1NAYA 1YNRA 4J20A 4PD4I 3VMAA 3KZIV 5KLVG 1NHLA 2KYVA 3WFEC 2YNYA 1MG3D 4H13D 4IL6E 1ZZHA 1HCMA 3CC2P 5AURA 4DCKA 3L72E 3K5BA 2ITAA 3TYYA 1KFMA 2RKLA 1BGYE 2XV5A 1S4XA 3QWOC 4N6JA 2R32A 2N9IA 4H0KA 2R44A 3RBXA 2LXBA 2FWLA 4H44C 3KXDA 2L5GB 3VOPA 1RZ5A 3CPWO 1H33B 3CCLP 1OAEA 1QEXA 2WTYA 1L4AD 1JMMA 3MD0A 1M1JC 2H43A 1RAQA 1ZOYC 5KLIB 1E5WA 4RSZA 1MFTA 1GU4A 4IFDK 4WQAA 2E75D 2FFDB 3MK7B 2HFED 4WQ9A 4WB4A 3LIEA 2QVAA 1NTKJ 1BSNA 1SLQA 4WY4D 1JCCA 1NTKG 3RLMA 2KP8A 1TU3F 1IC2A 3MGNA 2C8SA 1YTZI 3B5NC 1LNQA 3L70G 5IY51 1BE3E 1OCDA 4WQBA 2V4HA 3TF5A 1JY3P 1VYDA 2C9XB 2L4DA 2D2CC 4FA1A 2I8FA 1SQBK 1LTAC 3ZOYA 2E74D 5DJTB 1A02F 1FDOA 4XXLA 3V2RA 5KKZC 1CI6B 5TJHA 2C0XA 3HQ9A 2D2CD 1J2JB 1HWTC 4EI2A 2E74B 1RF0C 1GL2A 2FYUG 1SQQG 2JTIB 3A0HH 3HD7C 5KKZB 1BCCJ 1EC5A 3O5CA 1QL3A 3B5ND 1IK7A 2ZT9C 2Q3EA 1DW0A 3WU2V 4AANA 1H9XA 2FYNC 2JDIH 5KLVK 2WSFH 1HZVA 1I8OA 2KNCA 2GC4D 1N86A 3MHVA 2HODB 1D7MA 3U1CA 1FI9A 3PP5A 2FYUE 1DD3A 1FZAA 2N1TB 2L91A 1JTHB 1U57A 1NOHA 3VRDA 3OA7A 1GL2C 1DW3A 1NKNA 3I56P 2C0WA 3H1KE 4JF7A 1URQC 1I5TA 3EFFK 1CHJA 3T97B 5DJUB 3AEFC 1YJNP 5GTIH 3GF7A 1KB9D 1B7VA 3G9RA 2QM7A 1NTMD 3AE7C 2VHDA 3L74J 2K37A 1NTKK 1LTGC 3Q5PA 1IFDA 3X39A 1HRCA 2FYZA 5BU8B 2KXPB 1LTJC 1G1IA 4TT3H 3A0HE 1IRWA 2CA3B 1QL4A 3CX5H 4JYBA 2N3BA 1A56A 3H1IG 1H0TA 2OYHA 1L2PA 5E79H 1T8ZA 1LS9A 3RBZA 4AX3A 4R4MA 4UB8E 3A3YB 2KI7B 1NU1J 3HUSB 5AVXB 2FYUK 3FWLA 4PWAA 3HE4B 1C6SA 1S9KE 3CCQP 3L70D 1KX2A 1H32A 1KIBA 3F5HA 2DGEA 4I6MC 1R5LA 5KJ7A 1NTMJ 1MFZA 1DH3A 3RK2C 5TISE 1CHIA 1LTBC 4Y28J 1M1KQ 1CEDA 3A0BE 3RL0B 2B11B 4N78D 1SQXJ 4WBAA 3Q5RA 4L76A 4NPFX 1DVVA 1M90Q 2ZYDA 5CIDB 1CTJA 1NTZD 3PTZA 2RMZA 3HQ7A 4P4QB 2HG5D 1W5CT 5DFSA 1SQQD 2YQBA 2GA1A 2QG4A 2W90A 4IFMA 1FZBA 5KJ7C 1YIJP 1KQFB 2AXCA 4H0LD 1Q82Q 3I5CA 4M3LA 1QVGO 3L74D 4Q5PA 1Y9BA 2WSSH 1AYGA 2YK3A 4V2KA 1HGZA 1URQD 1HF9A 3L71J 4L73A 3L71E 4NPEA 2H8PD 2OZ1B 2QIWA 5AW7B 1YITP 1R5SA 1FZEA 1H0TB 1NTME 1L0LD 4AUWA 1NNOA 1CTZA 4IFFA 1BCCE 4WQDA 1DEBA 1R0QA 351CA 1ZN5A 3L70E 5APUA 3H1LE 1DD4A 3SWKA 2FY8A 1S5LE 1QVFO 3H1JG 1BE3D 2H88C 1XTCC 1HJ3A 3CX5E 3HUSC 3Q1MA 3KPEA 1NJIQ 1CIEA 1S2EA 2I8DA 1KZUB 3ZCFA 1Q7YQ 3P8MC 1G1JA 2WQYC 3CWBD 1BGYG 1DW1A 2Q3IA 1ZR4A 1RQVA 3DMIA 1CSWA 1PPJE 1S5LH 5BVZA 2UWJE 1T2KD 5EXQA 5L8RJ 1X9VA 3OA8A 1NGMB 2LITA 2Y0CA 1GU5A 1I55A 5KAIE 5EFWB 2M0BA 1VQ4P 1KQLA 1DX7A 5CCHA 5CIEB 3VMZA 3V2NA 1QGKB 1SQPG 4L74A 2XZRA 3SXTA 2WSEJ 3W68A 1VQNP 4WY4B 1ZXGA 4IL6V 4EIJA 1HH0A 3B71A 1K8AQ 1IQCA 3OCDA 2IZ0A 4JYCA 1KILA 4UB6E 1SQBG 5AVQB 1KMIZ 1DW2A 5KLVJ 1L4AC 1PL5A 2CK3H 2EXVA 4JQ0D 1X22A 3PH2B 4AQRD 3BRVB 1U7JA 2E43A 1K3HA 1IFJA 3RK3C 1JDLA 3WUIA 2JJLA 5KAFE 3WFCC 4H44D 3RL0g 2M8RA 2QRXA 3H1LJ 2P7JA 3WU2H 2K3RA 3KZIH 4UB6H 1KYOW 2YKQA 1NTKE 5CMZA 1GDTA 2XDJA 3LW5J 2ZOOA 1OVUA 4ZKPA 2IBZG 4L3HA 5CCGD 2OTKE 2E5YA 3JCUE 2ZAEB 3SVWA 2PRRA 3TNUB 1KYOE 2R3SA 4OGQD 4DT0A 1W5CE 3H1HD 2DVHA 2B9BA 1WMKA 3A7OA 2N1TD 4QMAA 2C9NY 4PD4D 1MG2D 3L74E 1UIIA 1AJYA 1CYCA 1BE3J 3PXTA 1N73C 1JY3O 4BRYA 4XA4A 3VMXA 4PJ0E 3V2PA 1KILC 1COTA 1EB7A 3O1YA 3D6ZA 3L4MA 1KB9E 2BCNB 4KT0J 4HB1A 5KAFV 2NPSD 3SWSA 3H1KJ 1JM0A 5KLVE 3EWKA 1YJ9P 5DJQC 1YICA 4HYTB 2FYUJ 1CI6A 5KLIC 3AE9C 1RQUA 1KILD 2P10A 1VPCA 4FAVA 3S9OA 1LTTC 1NTZE 2HYNA 3CXHE 1X0TA 3CCJP 3L72G 2O1JA 4Y5RA 3AEEC 3HQ8A 1N7SC 1FI7A 4RO0A 3FXDA 3DP5A 3H6PA 3D6YA 2AXTV 1RZ6A 1EZVI 2ZXYA 2JO1A 1IO4A 1HZUA 1KTMA 5AW9B 1AOFA 3ZIYA 2POHA 1FAVA 2QJPC 3CLQA 3OA8B 1QX8A 1VQPP 5CCGA 1DT1A 1SFCA 1IFPA 2E75B 3O8ZA 1VQ9P 1P84I 2ZXEB 1VQ8P 4KHXA 3H1JD 3CC7P 5KTBA 1AKKA 3GF3A 3HUSA 1MKMA 3VTPC 1HJ4A 1FOSF 4UB8V 4R4LA 4KMGA 2BCCJ 1VQ6P 5K5GB 1M56D 3L72J 4YPCA 1LMSA 1P84E 4EDFA 1S6VB 1A02J 1RAPA 4WQCA 5APYA 1FZCA 2WT7B 1U74B 2WSEH 1N73B 5B66V 1KILB 1EDLA 1YQ3C 3RK3E 5CYTR 4EYYQ 1C52A 1HUCA 3AECC 1Q2NA 5CBOA 2KLUA 4PJ0H 3WFBC 1YCCA 5DJQB 3A5TA 1EDJA 2KSEA 1FI3A 3E7KA 1FZFA 3MUDC 1M57D 3IN6A 2IX7C 1L0LJ 3WFDC 1NTZG 5TISV 2OTJP 1WEJF 1SQVE 1GL2D 1JEKA 2WVRA 3U59A 1NMIA 1JCDA 3CXHH 3G4SP 4ZKUA 5C39A 1E8EA 2KOGA 3A0BH 3UIAA 3G3ZA 3CMEP 1CYJA 1SQVK 3H1KG 1H89A 2YIUC 1F1FA 3CX5D 1P84D 1GW3A 3RK2D 2P2UA 1QL2A 2D0SA 3CD6P 2IYOA 1YQ4C 1DIQC 4IL6H 2M3EA 2O01N 1DIPA 2RH0A 5H2FH 5AVUB 1HJ0A 3JBTB 3GG2A 2YO3A 3HE4A 3E1RA 3ZOOA 4PV1C 1DIIC 2QJKC 1T6AA 2B12B 3CX5W 2A06G 4RESB 3USSA 1DEEG 5M1BA 3CXHI 4JPZB 1EZVG 1KYOH 1L0LE 1YYCA 3VMYA 1RH5B 2OQQA 4I7ZC 3TK1A 3H1IE 1MZ9A 2ZFCA 1CRYA 3H1HE 1SQVD 2BEQD 3KDPB 2IPPA 3BCCD 4O9BA 3H25A 1L4AA 3RN0A 5AW4B 1KQGB 4BRYB 3FXEA 1J1EB 1SQPE 1JMBA 2Q6QA 2BH4X 4PD4E 5B5EE 1N7SD 2W83C 2GM4A 1HJ5A 3PJSK 3PLNA 1J3SA 2RN0A 1NTMG 2FKWB 3LIDA 2WWWA 5AVTB 1L9BC 2YCCA 4U3FJ 3AE5C 2LIRA 2V07A 1VF5B 2Y0DA 4K35A 3SFDC 1JO5A 4GDOA 3TSIA 2BPBB 3CCMP 1SQPD 2XNXA 1ZW0A 1FHBA 2CE0A 3A0BV 1HVVA 3AEAC 2P1JA 3HQ6A 1Y8AA 4FA9A 1BDDA 1JY2O 1T3JA 2B89A 2LKMA 1BL9A 2FXMA 2OTLP 1IZL0 3GLMA 1BSHA 4NFGB 1FJKA 3T97A 5AW3B 2BEZF 4W7ZA 1USEA 3V2QA 5CCHD 4U7JA 2Z5HA 2YMYA 2FFDC 1L0NG 3HD7A 4C7NB 3IF4A 3AEDC 4GEDB 1BE3G 2CA4B 1YIQA 1YTCA 1W2EA 1KD1Q 1LTJA 2PCBB 3B8EB 1LWUA 3M06A 2IBZD 3H1LG 2CE1A 1VQOP 1UIXA 4L75A 3RN1A 5APXA 3RMZA 2FRCA 2Q1KA 4PV1D 1AA0A 4EIDA 5B5EH 3H1HG 1GMJA 3TYIA 3VYMA 4HH2A 2O01J 2D2CB 4ZNCA 1G2CB 3CI9A 1K9MQ 2OYIA 3CCVP 1LTIC 2IFMA 3JCUH 4DZOA 2KSJA 3L75G 3L71G 4WY4C 2A06D 4RKUJ 1E29A 3P8CD 1EZVD 2NPSA 4PD4H 3MIWA 1CYIA 3L73G 4LLHA 2FXOA 5B6QA 1L0LG 3BASA 1NU1G 5AVVB 2N9JA 1KV4A 3MP7B 1Q86Q 1JB0J 1C2RA 2P58A 1GKSA 2Q7CA 4U3FD 2AXTH 2V08A 3MTUE 1S1CX 1S3JA 3ZOWA 1OW6A 1QL1A 1NH4A 2KS1B 1OIPA 1KB9I 4ASVA 3A2AA 1SQBD 2N1TA 2MJZA 2PCCB 2W27A 3L4FA 1FZGA 1YJWP 1KX7A 1SQBJ 1USDA 1PP9G 1X8YA 3L74G 1N50A 1NKZB 2SPZA 1SS1A 1CXAA 2XU6A 1X79B 3N7NA 1OXZA 5KAIH 1IFNA 4EOTA 3JC22 1QLED 3L73E 2AXTE 3D71A 5AVSB 1VQ5P 4L1QA 3F89A 4MN4C 1FJ0A 1QKSA 1T3UA 2Y0EA 4AAOA 4FANA 2D0WA 4DY9A 1IO3A 3HTKB 1CW5A 1EDKA 2NPSC 2KUBA 2W6AA 3MZWB 2KK7A 2PAJA 1SQPJ 4GIFA 3CU4A 1LC1A 2AEMA 4HJGH 2OYOA 1M6ZA 4GYDA 2IBZE 3CWBG 3HTKA 2GIWA 4I7ZB 5AW6B 1AFOA 3DR0A 2QA4P 3M0AA 3P32A 1LT9C 2NZ2A 3NBSA 2N9BA 3TGUE 3H32B 1L0ND 2ORLA 1A8CA 1PIXA 1H1OA 2K9JA 2YKOA 3ITKA 3CCRP 2HPCB 1LWUC 2WSCJ 4H0JA 1N7SB 3I55P 1VDFA 1ZMEC 1HBWA 1ZRTD 5E79V 2WITA 1PPJG 5APSA 4H13C 3V4QA 4XFJA 1GD2E 1IFMA 3HD7B 2BCCG 1S72P 2AI5A 1LT9A 1L0LK 2R5BA 4BXLA 1C6OA 3WUVA 4WQEA 2KNCB 3O6QB 2QJKB 3G6EP 1FBMA 1LGHB 1K05A 4XYDB 2JWDA 1FE6A 2HLOA 3S1KA 2ZVOB 3RGUA 1J1EC 4JBZA 2AEFA 5AW1B 1FDIA 1N2DC 1OZHA 2WT7A 3ORVA 3SFEC 3MUDA 5KAIV 4D6TJ 3PXSA 2OYIB 3AE2C 4IL6X 2C2CA 4PJ0V 1FZCB 4W80A 4D6TG 1L0NE 4TLFA 4C7RA 1GJQA 1LP1B 2FBWC 1LFMA 2HODA 1RF1A 3RK2B 3W67A 1PP9E 4GODA 4YXDC 1Q81Q 1OVVA 1LTSC 3H1HJ 1OFCX 3TGUJ 1EXJA 3M0DC 2YIUB 2DW3A 1NMLA 5APWA 2LXCB 2E74C 3L75J 3CWBE 3RK3B 3CCSP 1LP1A 3L72D 2K1AA 3EQ2A 2K9YA 1IRVA 1SFCD 3FWNA 5CHXA 1OW8A 4O1WA 1L4AB 3NFQA 3L75D 3RK3D 1PGJA 2BCCE 3PXWA 1CSUA 2N18B 2ZT9B 2IFNA 1SP4A 3WUUA 1FOSE 1CHHA 1CSXA 4GOFA 2M5AB 1SQXD 1FOCA 3D70A 1CC5A 5C9MA 3PHLA 2AEJA 4UB6V 2W8ZA 2BASA 2G3AA 1HJBA 2WZ7A 3AE3C 3H1LD 3LW5H 4I2LC 3CL3D 2IDBA 4N3YB 1BCCD 2FYUD 3O0RC 3KZIE 2A45G 1KN7A 1KYOD 1MUUA 1KORA 4U3FE 1PP9J 2JQRA 5KLVD 1A2SA 4ASWA 2B0ZB 1NU1E 1PP9D 1PGOA 2O3JA 4FA4A 2H7HA 5B66H 1NTMK 3NBTA 3H1JE 5APVA 4YXWH 3RL0D 3CYTI 3N4XA 2C1VA 1I54A 4PV1B 4WWIA 4N78E 2PGDA 3CXHW 1SQXK 1QN2A 5CIFB 3TGUD 1PZQA 1RY3A 3O6QA 1CORA 1KB9H 2N9YB 1ZR2A 5C0ZA 3IAOA 1CCHA 1BGYJ 2GUSA 3BCCJ 3L36A 5GTHE 2BCCD 1H8AA 3G71P 2WSFJ 5KAFH 1EXIA 1GTWA 4IOIH 4AAMA 1I8PA 4U3FG 1RE4C 3C1LA 2CPBA 4OGQC 1YHQP 1CIFA 3O20A 3II6A 3B4SA 1H9YA 1AQ5A 2B88A 3L75E 1K3GA 3CXHD 1YEBA 2G8YA 1XTGB 5AVRB 5GTIE 5APQA 1CTYA 3JSVC 3GHGC 3TNUA 4OVNF 4AALA 1H31A 2M5AA 1C7MA 1L0NJ 3L35A 1FU1A 2A06E 1CZQA 5H2FE 1CCRA 1M70A 4D6TD 1WVEC 1IZNB 3V6IA 3M0DA 1N73A 4FB1A 3GMAA 3D0WA 3R4YA 5AVWB 3M9QA 1Z56A 1SQPK 1PPJD 2N1TC 4A7PA 1CRGA 2P67A 3KYQA 2YKPA 2KZIA 2XKMA 1NTZK 3VN0A 2LR2A 2C9LY 4C7NA 5B66E 2FXPA 4UB8H 1LT1A 2ZXXA 1VL2A 3ZOXA 2B87A 4DJGA 1VQMP 1RE4A 3HE5B 3H32A 4O1QA 3AEBC 3BRTB 2KS1A 1BDCA 1J1DC 1FS0E 1SQQJ 3AE6C 3C2CA 3GW6A 1SQQE 3KHUA 2JKVA 3AE1C 5AW5B 5GTHV 1ZV8A 3OJAB 2IBZI 1J1DB 1ZLLA 2PACA 1WT6A 1NU1K 1K04A 1WRGA 1JY2P 1GK6A 1GIWA 1R8EA 2Y9YA 3E1IA 2OYHB 3VP9A 1NYHA 2B10B 1S9KD 1CRHA 2KB7P 3L73J 3BCCE 3PH0A 1OX3A 1LT9B 1C2NA 2IYPA 1AOQA 3ABVC 3H1ID 2WPQA 3OAKA 5APTA 1SQBE 4NPDA 1IFIA 1N15A 1ZP0C 3H1JJ 2JP3A 5CIHB 3VYIA 2J59M 1JOCA 1FJPA 3V4WA 4LGDE 4H44B 1CRJA 3WMM0 1KFNA 1SQVG 1E79H 2WPSA 3U1AA 3NMDA 4BWNA 5CCGC 3CCUP 3BCCG 1LC2A 1GQ1A 1KB0A 1Y47A 3L71D 1EZVE 3EFGA 3SSUA 5CICB 4L3GA 1M1JB 2H89C 2QEXP 2YO2A 1KILE 2W6JH 1SVFA 2OARA 1URQB 1CRCA 4KJMA 2QM8A 3NXSA 1RF1B 1HTLC 1KC8Q 2QSIA 4YTPC 1FC2C 1H88A 2BLFB 2V7QH 3RL0C 5CCHC 1LTJB 1GK4A 2MTAC 1OMIA 3AE8C 1NTZJ 2R3CA 1CO6A 451CA 5AVYB 1GW4A 2R5DA 4EICA 2J5UA 2ZYAA 2OYHC 4AYCA
chains in the Genus database with same CATH topology
3L4OA 2OZ1A 1H31B 4K3IA 1RZ6A 2ZZS1 3DR0A 2ZXYA 1HZUA 2JTIB 1N90A 3NBSA 1AOFA 3ZIYA 1L0ND 5KKZB 2ORLA 1A8CA 1H1OA 3OA8B 3O5CA 3ITKA 1QL3A 2Q3EA 2JWAA 1DW0A 3WU2V 4AANA 1H9XA 2C1UA 1DT1A 1HZVA 1F1CA 4H0JA 1I8OA 1ZRTD 2GC4D 5E79V 1FI9A 2K9JB 3H1JD 3M97X 1ETPA 1AKKA 2GB8B 1HJ4A 2L91A 4UB8V 1CNOA 3TDKA 4KMGA 3VRDA 2AI5A 5B5EV 2QJPB 1DW3A 1E2RA 2ZONG 1C6OA 1I5TA 1LMSA 4WQEA 2KNCB 1CRIA 1L9JC 4EDFA 1S6VB 1CHJA 4N0KA 2QJKB 1RAPA 4WQCA 1U74B 2QJYB 5B66V 4XYDB 2N3YA 2CXBA 1KB9D 1B7VA 5H2FV 1NTMD 4JCGA 2VHDA 5CYTR 4EIEA 1C52A 4FA5A 3X39A 1HRCA 3WFBC 1YCCA 5DJQB 3ORVA 1NTKD 1IRWA 2CA3B 3L73D 5KAIV 3PXSA 1FI3A 2C2CA 4PJ0V 1QL4A 2N3BA 1A56A 1NU1D 1GJQA 4YE1A 1BGYD 1LS9A 1LFMA 3WFDC 4AX3A 5TISV 1WEJF 3VNWA 1NMIA 1H33A 1H32B 1E8EA 2YIUB 1NMLA 3FWLA 2FYNB 2GC7D 4PWAA 3WC8A 3L72D 1C6SA 4LJIA 1IRVA 1CYJA 5CIBB 3L70D 3A0HV 1KX2A 2AIUA 4O1WA 1F1FA 3CX5D 1H32A 1P84D 1CSVA 1KIBA 2DGEA 2D0SA 3L75D 1S5LV 3PXWA 1CSUA 2N18B 4MU8A 1CHHA 1CSXA 1DIQC 1U75B 5CIGB 1CHIA 1SQXD 1CEDA 1FOCA 1CC5A 3JBTB 5C9MA 3PHLA 2B11B 4UB6V 3GG2A 2N18C 1I6DA 3ZOOA 1DVVA 5CIDB 1DIIC 3H1LD 1CTJA 2B12B 1NTZD 3CX5W 3PTZA 2RMZA 3HQ7A 4P4QB 2XTSB 2BH5X 1W5CT 1CIGA 5DFSA 1BCCD 2FYUD 3O0RC 1SQQD 1KYOD 1GU2A 2YQBA 2QG4A 2JQRA 5KLVD 1A2SA 2B0ZB 1YEAA 1I6EA 1CRYA 1PP9D 1SQVD 2O3JA 3L74D 4Q5PA 2C1DB 1AYGA 4FA4A 2YK3A 4V2KA 2BGVX 3NBTA 3BCCD 5GTIV 1CXCA 3CYTI 2C1VA 1I54A 1YFCA 3RN0A 3CP5A 2OZ1B 3CXHW 3OCDB 1QN2A 5CIFB 3TGUD 2BH4X 1FCDC 4RJTA 1CORA 2N9YB 4WQ7A 5C0ZA 1HJ5A 1L0LD 2C1DA 1CCHA 1NNOA 1CTZA 3PLNA 2BCCD 1J3SA 2RN0A 3SLEA 4WQDA 1R0QA 351CA 4AAMA 1L9BC 1I8PA 1NIRA 2YCCA 1CIFA 3O20A 2LIRA 2V07A 2Y0DA 1HROA 1H9YA 1BE3D 1K3GA 1C75A 1HJ3A 2BPBB 3CXHD 1YEBA 2HV4A 1SQPD 1MZ4A 1CIEA 1DVHA 1FHBA 3ZBMA 2CE0A 3A0BV 3ZCFA 1CTYA 5DF5A 3CWBD 3HQ6A 1DW1A 4FA9A 4AALA 3NWVA 4EIFA 2MHMA 1H31A 1C7MA 3DMIA 1CSWA 1BL9A 1CCRA 1IZL0 5EXQA 4NFGB 1M70A 1M60A 4D6TD 3OA8A 1WVEC 2LITA 2Y0CA 4QAOA 1I55A 4FB1A 1GDVA 155CA 1PPJD 4A7PA 1CRGA 3MK7C 4PW9B 4GEDB 2CA4B 1YIQA 5CIEB 1YTCA 3SXTA 1HH7A 1C6RA 1N9CA 4IL6V 2PCBB 1QYZA 3H1KD 2IBZD 3ZOXA 1KV9A 2CE1A 1IQCA 3A9FA 4O1QA 2KS1A 3RN1A 3OCDA 3RMZA 2FRCA 1W2LA 2B4ZA 3SJLA 4EIDA 1CIHA 3PRJA 3C2CA 3GW6A 2ZBOA 4WQ8A 3TYIA 3VYMA 1DW2A 3KHUA 1YNRA 4J20A 5GTHV 3VMAA 3KZIV 2EXVA 2PACA 3PH2B 1K3HA 1JDLA 3WUIA 3WFEC 3WFCC 1MG3D 1GIWA 2A06D 1ZZHA 1E29A 1HCMA 1EZVD 2B10B 5AURA 1KYOW 1CRHA 1CYIA 1C2NA 1AOQA 2ZOOA 5B6QA 2N9IA 4H0KA 2N9JA 3H1ID 2FWLA 4L3HA 1C2RA 1GKSA 4U3FD 3SVWA 1N15A 2V08A 1RZ5A 3ZOWA 1H33B 1OAEA 1SQBD 3H1HD 2DVHA 5CIHB 2PCCB 1CRJA 1RAQA 1KX7A 5KLIB 4RSZA 1N50A 4PD4D 1MG2D 4WQAA 1CXAA 1LC2A 1CYCA 1GQ1A 3MK7B 1KB0A 3L71D 4WQ9A 3PXTA 5CICB 4L3GA 1COTA 1EB7A 3O1YA 3RLMA 3L4MA 2C8SA 2BCNB 1CRCA 4L1QA 5KAFV 3SWSA 1FJ0A 5IY51 1OCDA 4WQBA 5DJQC 3TF5A 1YICA 2BLFB 1QKSA 2Y0EA 4AAOA 4FANA 2MTAC 2D0WA 4DY9A 1VYDA 1IO3A 2C9XB 2L4DA 4FAVA 1CO6A 4FA1A 2I8FA 451CA 3ZOYA 3CU4A 4Y5RA 1LC1A 3HQ8A 4EICA 1FI7A 1M6ZA 4GYDA 4XXLA 3DP5A 5TJHA 2GIWA 3HQ9A 2AXTV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4O A;  2OZ1 A;  1H31 B;  4K3I A;  1RZ6 A;  2ZZS 1;  3DR0 A;  2ZXY A;  1HZU A;  2JTI B;  1N90 A;  3NBS A;  1AOF A;  3ZIY A;  1L0N D;  5KKZ B;  2ORL A;  1A8C A;  1H1O A;  3OA8 B;  3O5C A;  3ITK A;  1QL3 A;  2Q3E A;  2JWA A;  1DW0 A;  3WU2 V;  4AAN A;  1H9X A;  2C1U A;  1DT1 A;  1HZV A;  1F1C A;  4H0J A;  1I8O A;  1ZRT D;  2GC4 D;  5E79 V;  1FI9 A;  2K9J B;  3H1J D;  3M97 X;  1ETP A;  1AKK A;  2GB8 B;  1HJ4 A;  2L91 A;  4UB8 V;  1CNO A;  3TDK A;  4KMG A;  3VRD A;  2AI5 A;  5B5E V;  2QJP B;  1DW3 A;  1E2R A;  2ZON G;  1C6O A;  1I5T A;  1LMS A;  4WQE A;  2KNC B;  1CRI A;  1L9J C;  4EDF A;  1S6V B;  1CHJ A;  4N0K A;  2QJK B;  1RAP A;  4WQC A;  1U74 B;  2QJY B;  5B66 V;  4XYD B;  2N3Y A;  2CXB A;  1KB9 D;  1B7V A;  5H2F V;  1NTM D;  4JCG A;  2VHD A;  5CYT R;  4EIE A;  1C52 A;  4FA5 A;  3X39 A;  1HRC A;  3WFB C;  1YCC A;  5DJQ B;  3ORV A;  1NTK D;  1IRW A;  2CA3 B;  3L73 D;  5KAI V;  3PXS A;  1FI3 A;  2C2C A;  4PJ0 V;  1QL4 A;  2N3B A;  1A56 A;  1NU1 D;  1GJQ A;  4YE1 A;  1BGY D;  1LS9 A;  1LFM A;  3WFD C;  4AX3 A;  5TIS V;  1WEJ F;  3VNW A;  1NMI A;  1H33 A;  1H32 B;  1E8E A;  2YIU B;  1NML A;  3FWL A;  2FYN B;  2GC7 D;  4PWA A;  3WC8 A;  3L72 D;  1C6S A;  4LJI A;  1IRV A;  1CYJ A;  5CIB B;  3L70 D;  3A0H V;  1KX2 A;  2AIU A;  4O1W A;  1F1F A;  3CX5 D;  1H32 A;  1P84 D;  1CSV A;  1KIB A;  2DGE A;  2D0S A;  3L75 D;  1S5L V;  3PXW A;  1CSU A;  2N18 B;  4MU8 A;  1CHH A;  1CSX A;  1DIQ C;  1U75 B;  5CIG B;  1CHI A;  1SQX D;  1CED A;  1FOC A;  1CC5 A;  3JBT B;  5C9M A;  3PHL A;  2B11 B;  4UB6 V;  3GG2 A;  2N18 C;  1I6D A;  3ZOO A;  1DVV A;  5CID B;  1DII C;  3H1L D;  1CTJ A;  2B12 B;  1NTZ D;  3CX5 W;  3PTZ A;  2RMZ A;  3HQ7 A;  4P4Q B;  2XTS B;  2BH5 X;  1W5C T;  1CIG A;  5DFS A;  1BCC D;  2FYU D;  3O0R C;  1SQQ D;  1KYO D;  1GU2 A;  2YQB A;  2QG4 A;  2JQR A;  5KLV D;  1A2S A;  2B0Z B;  1YEA A;  1I6E A;  1CRY A;  1PP9 D;  1SQV D;  2O3J A;  3L74 D;  4Q5P A;  2C1D B;  1AYG A;  4FA4 A;  2YK3 A;  4V2K A;  2BGV X;  3NBT A;  3BCC D;  5GTI V;  1CXC A;  3CYT I;  2C1V A;  1I54 A;  1YFC A;  3RN0 A;  3CP5 A;  2OZ1 B;  3CXH W;  3OCD B;  1QN2 A;  5CIF B;  3TGU D;  2BH4 X;  1FCD C;  4RJT A;  1COR A;  2N9Y B;  4WQ7 A;  5C0Z A;  1HJ5 A;  1L0L D;  2C1D A;  1CCH A;  1NNO A;  1CTZ A;  3PLN A;  2BCC D;  1J3S A;  2RN0 A;  3SLE A;  4WQD A;  1R0Q A;  351C A;  4AAM A;  1L9B C;  1I8P A;  1NIR A;  2YCC A;  1CIF A;  3O20 A;  2LIR A;  2V07 A;  2Y0D A;  1HRO A;  1H9Y A;  1BE3 D;  1K3G A;  1C75 A;  1HJ3 A;  2BPB B;  3CXH D;  1YEB A;  2HV4 A;  1SQP D;  1MZ4 A;  1CIE A;  1DVH A;  1FHB A;  3ZBM A;  2CE0 A;  3A0B V;  3ZCF A;  1CTY A;  5DF5 A;  3CWB D;  3HQ6 A;  1DW1 A;  4FA9 A;  4AAL A;  3NWV A;  4EIF A;  2MHM A;  1H31 A;  1C7M A;  3DMI A;  1CSW A;  1BL9 A;  1CCR A;  1IZL 0;  5EXQ A;  4NFG B;  1M70 A;  1M60 A;  4D6T D;  3OA8 A;  1WVE C;  2LIT A;  2Y0C A;  4QAO A;  1I55 A;  4FB1 A;  1GDV A;  155C A;  1PPJ D;  4A7P A;  1CRG A;  3MK7 C;  4PW9 B;  4GED B;  2CA4 B;  1YIQ A;  5CIE B;  1YTC A;  3SXT A;  1HH7 A;  1C6R A;  1N9C A;  4IL6 V;  2PCB B;  1QYZ A;  3H1K D;  2IBZ D;  3ZOX A;  1KV9 A;  2CE1 A;  1IQC A;  3A9F A;  4O1Q A;  2KS1 A;  3RN1 A;  3OCD A;  3RMZ A;  2FRC A;  1W2L A;  2B4Z A;  3SJL A;  4EID A;  1CIH A;  3PRJ A;  3C2C A;  3GW6 A;  2ZBO A;  4WQ8 A;  3TYI A;  3VYM A;  1DW2 A;  3KHU A;  1YNR A;  4J20 A;  5GTH V;  3VMA A;  3KZI V;  2EXV A;  2PAC A;  3PH2 B;  1K3H A;  1JDL A;  3WUI A;  3WFE C;  3WFC C;  1MG3 D;  1GIW A;  2A06 D;  1ZZH A;  1E29 A;  1HCM A;  1EZV D;  2B10 B;  5AUR A;  1KYO W;  1CRH A;  1CYI A;  1C2N A;  1AOQ A;  2ZOO A;  5B6Q A;  2N9I A;  4H0K A;  2N9J A;  3H1I D;  2FWL A;  4L3H A;  1C2R A;  1GKS A;  4U3F D;  3SVW A;  1N15 A;  2V08 A;  1RZ5 A;  3ZOW A;  1H33 B;  1OAE A;  1SQB D;  3H1H D;  2DVH A;  5CIH B;  2PCC B;  1CRJ A;  1RAQ A;  1KX7 A;  5KLI B;  4RSZ A;  1N50 A;  4PD4 D;  1MG2 D;  4WQA A;  1CXA A;  1LC2 A;  1CYC A;  1GQ1 A;  3MK7 B;  1KB0 A;  3L71 D;  4WQ9 A;  3PXT A;  5CIC B;  4L3G A;  1COT A;  1EB7 A;  3O1Y A;  3RLM A;  3L4M A;  2C8S A;  2BCN B;  1CRC A;  4L1Q A;  5KAF V;  3SWS A;  1FJ0 A;  5IY5 1;  1OCD A;  4WQB A;  5DJQ C;  3TF5 A;  1YIC A;  2BLF B;  1QKS A;  2Y0E A;  4AAO A;  4FAN A;  2MTA C;  2D0W A;  4DY9 A;  1VYD A;  1IO3 A;  2C9X B;  2L4D A;  4FAV A;  1CO6 A;  4FA1 A;  2I8F A;  451C A;  3ZOY A;  3CU4 A;  4Y5R A;  1LC1 A;  3HQ8 A;  4EIC A;  1FI7 A;  1M6Z A;  4GYD A;  4XXL A;  3DP5 A;  5TJH A;  2GIW A;  3HQ9 A;  2AXT V; 
#chains in the Genus database with same CATH topology
 3L4O A;  4WVZ A;  3S4R A;  2OZ1 A;  1H31 B;  4K3I A;  2QE7 H;  2ZZS 1;  1YI2 P;  4OWF A;  2HR3 A;  1FDM A;  1VQ7 P;  1OVR A;  2Q9I A;  4DOJ A;  4CPG A;  1N90 A;  3TGU G;  1URQ A;  3HD7 D;  2JWA A;  1JUN A;  2WPV B;  2C1U A;  2I1K A;  3OW2 O;  1F1C A;  1KYO I;  1M7L A;  5TIS H;  1SFC B;  1AVY A;  2K9J B;  5KJ7 D;  3M97 X;  1ETP A;  1JNM A;  4I1L A;  2GB8 B;  1JY2 N;  1CNO A;  2KIK A;  3TDK A;  3SWY A;  5B5E V;  2QJP B;  4H0L B;  1E2R A;  2ZON G;  4C46 A;  1L0N K;  3B5N B;  2ZYG A;  3CWB J;  1NVO A;  2GUV A;  4XE5 B;  1CRI A;  1L9J C;  4N0K A;  3WU2 E;  2QJY B;  2N3Y A;  2CXB A;  5H2F V;  4JCG A;  4EIE A;  1PGP A;  4FA5 A;  3B5N A;  1PFI A;  2KZJ A;  2XND H;  1OW7 A;  2Z4E A;  1VF5 D;  3Q5S A;  1SQX G;  1NTK D;  2WMM A;  3L73 D;  1OWA A;  2YXQ B;  3L37 A;  1NU1 D;  2YMK A;  3FX0 A;  4YE1 A;  1BGY D;  3BAT A;  1VF5 C;  3WUT A;  1P84 H;  3VNW A;  1BCC G;  1H33 A;  1ZRT E;  1H32 B;  3CCE P;  1SQQ K;  1YTZ T;  1CSB A;  1NWQ A;  3CC4 P;  2PFX A;  1IJD B;  3BVH A;  2FYN B;  2O01 H;  2GC7 D;  3V5B A;  3SWF A;  3WC8 A;  4LJI A;  5CBN A;  1U7M A;  3AE4 C;  5CIB B;  3L70 J;  3A0H V;  3M9B A;  2FFD A;  2AIU A;  3HRN A;  1CSV A;  2A45 I;  2NRG A;  3CMA P;  4W7Y A;  1SQX E;  2E76 C;  3Q3D A;  1S5L V;  1M1J A;  4MU8 A;  1LWU B;  1PV3 A;  3GHG B;  1U75 B;  5CIG B;  1NAF A;  4Z1M H;  2V7Q J;  3C8V A;  5AW8 B;  2Z5I A;  1SFC C;  4H13 B;  3CX5 I;  2PP6 A;  2N18 C;  5CJ0 A;  1I6D A;  1T2K C;  4OH8 B;  2E5T A;  5GTH H;  1G2C A;  1GZL A;  2XTS B;  2BH5 X;  3GHG A;  1CIG A;  1MV8 A;  1GU2 A;  1RE3 C;  2JR8 A;  1SQV J;  1VQK P;  4Y99 B;  2HPC A;  4HKZ H;  1YEA A;  1I6E A;  2NPS B;  2A45 H;  3M9H A;  2C1D B;  5AW2 B;  4D6T E;  1K73 Q;  2BGV X;  2IZ1 A;  2CPS A;  5GTI V;  1CXC A;  2ZT9 D;  1M8O B;  1YFC A;  2OYI C;  5AVZ B;  3CP5 A;  4GOE A;  3OCD B;  1FCD C;  1KQS O;  2E75 C;  4RJT A;  2MKV A;  4WQ7 A;  5CJ4 A;  2C1D A;  1NO4 A;  2E42 A;  3SLE A;  1W2B O;  3P8C E;  2WSC H;  1RHZ B;  2O1K A;  3C9I A;  1RF1 C;  1NIR A;  1AQT A;  2W6B A;  1YBK A;  2OGU A;  1HRO A;  3KQG A;  1C75 A;  2M3B A;  2HV4 A;  1MZ4 A;  1LJ2 A;  3FGA D;  1GL2 B;  1DVH A;  3HE5 A;  3ZBM A;  4H0L C;  1JY3 N;  2YXR B;  4OGQ B;  2B87 B;  3VP8 A;  5DF5 A;  2K88 A;  2ZVN B;  5AW0 B;  2E76 D;  3NWV A;  4EIF A;  2JEE A;  2MHM A;  1IK9 A;  2KLV A;  2ZJS E;  2QJY C;  4LC1 A;  1Q90 D;  1S5L X;  1RE3 A;  1EDI A;  2E76 B;  3ZDM A;  1VQL P;  3AEG C;  1HGV A;  3R2P A;  1M60 A;  1AV1 A;  1PGQ A;  3P7K A;  4ZMD A;  4QAO A;  3H1I J;  2I1J A;  1N7S A;  4GKG A;  1GDV A;  155C A;  5BU5 A;  4Y99 C;  4K3A A;  3IFM A;  3QH9 A;  2J58 A;  2Y9Z A;  3MK7 C;  4PW9 B;  2VRS A;  4WY4 A;  1JTH A;  2Q5U A;  1N7L A;  3M91 A;  1HH7 A;  1C6R A;  1EQ7 A;  1N9C A;  5E79 E;  1QYZ A;  1N8R Q;  3H1K D;  3NTN A;  1KV9 A;  3A9F A;  1FZC C;  1W2L A;  2WPR A;  3Q2Y A;  2B4Z A;  4GT1 A;  3SJL A;  1CIH A;  3PRJ A;  1AVO A;  4B86 A;  2ZBO A;  4WQ8 A;  3IR9 A;  1RF0 A;  1NAY A;  1YNR A;  4J20 A;  4PD4 I;  3VMA A;  3KZI V;  5KLV G;  1NHL A;  2KYV A;  3WFE C;  2YNY A;  1MG3 D;  4H13 D;  4IL6 E;  1ZZH A;  1HCM A;  3CC2 P;  5AUR A;  4DCK A;  3L72 E;  3K5B A;  2ITA A;  3TYY A;  1KFM A;  2RKL A;  1BGY E;  2XV5 A;  1S4X A;  3QWO C;  4N6J A;  2R32 A;  2N9I A;  4H0K A;  2R44 A;  3RBX A;  2LXB A;  2FWL A;  4H44 C;  3KXD A;  2L5G B;  3VOP A;  1RZ5 A;  3CPW O;  1H33 B;  3CCL P;  1OAE A;  1QEX A;  2WTY A;  1L4A D;  1JMM A;  3MD0 A;  1M1J C;  2H43 A;  1RAQ A;  1ZOY C;  5KLI B;  1E5W A;  4RSZ A;  1MFT A;  1GU4 A;  4IFD K;  4WQA A;  2E75 D;  2FFD B;  3MK7 B;  2HFE D;  4WQ9 A;  4WB4 A;  3LIE A;  2QVA A;  1NTK J;  1BSN A;  1SLQ A;  4WY4 D;  1JCC A;  1NTK G;  3RLM A;  2KP8 A;  1TU3 F;  1IC2 A;  3MGN A;  2C8S A;  1YTZ I;  3B5N C;  1LNQ A;  3L70 G;  5IY5 1;  1BE3 E;  1OCD A;  4WQB A;  2V4H A;  3TF5 A;  1JY3 P;  1VYD A;  2C9X B;  2L4D A;  2D2C C;  4FA1 A;  2I8F A;  1SQB K;  1LTA C;  3ZOY A;  2E74 D;  5DJT B;  1A02 F;  1FDO A;  4XXL A;  3V2R A;  5KKZ C;  1CI6 B;  5TJH A;  2C0X A;  3HQ9 A;  2D2C D;  1J2J B;  1HWT C;  4EI2 A;  2E74 B;  1RF0 C;  1GL2 A;  2FYU G;  1SQQ G;  2JTI B;  3A0H H;  3HD7 C;  5KKZ B;  1BCC J;  1EC5 A;  3O5C A;  1QL3 A;  3B5N D;  1IK7 A;  2ZT9 C;  2Q3E A;  1DW0 A;  3WU2 V;  4AAN A;  1H9X A;  2FYN C;  2JDI H;  5KLV K;  2WSF H;  1HZV A;  1I8O A;  2KNC A;  2GC4 D;  1N86 A;  3MHV A;  2HOD B;  1D7M A;  3U1C A;  1FI9 A;  3PP5 A;  2FYU E;  1DD3 A;  1FZA A;  2N1T B;  2L91 A;  1JTH B;  1U57 A;  1NOH A;  3VRD A;  3OA7 A;  1GL2 C;  1DW3 A;  1NKN A;  3I56 P;  2C0W A;  3H1K E;  4JF7 A;  1URQ C;  1I5T A;  3EFF K;  1CHJ A;  3T97 B;  5DJU B;  3AEF C;  1YJN P;  5GTI H;  3GF7 A;  1KB9 D;  1B7V A;  3G9R A;  2QM7 A;  1NTM D;  3AE7 C;  2VHD A;  3L74 J;  2K37 A;  1NTK K;  1LTG C;  3Q5P A;  1IFD A;  3X39 A;  1HRC A;  2FYZ A;  5BU8 B;  2KXP B;  1LTJ C;  1G1I A;  4TT3 H;  3A0H E;  1IRW A;  2CA3 B;  1QL4 A;  3CX5 H;  4JYB A;  2N3B A;  1A56 A;  3H1I G;  1H0T A;  2OYH A;  1L2P A;  5E79 H;  1T8Z A;  1LS9 A;  3RBZ A;  4AX3 A;  4R4M A;  4UB8 E;  3A3Y B;  2KI7 B;  1NU1 J;  3HUS B;  5AVX B;  2FYU K;  3FWL A;  4PWA A;  3HE4 B;  1C6S A;  1S9K E;  3CCQ P;  3L70 D;  1KX2 A;  1H32 A;  1KIB A;  3F5H A;  2DGE A;  4I6M C;  1R5L A;  5KJ7 A;  1NTM J;  1MFZ A;  1DH3 A;  3RK2 C;  5TIS E;  1CHI A;  1LTB C;  4Y28 J;  1M1K Q;  1CED A;  3A0B E;  3RL0 B;  2B11 B;  4N78 D;  1SQX J;  4WBA A;  3Q5R A;  4L76 A;  4NPF X;  1DVV A;  1M90 Q;  2ZYD A;  5CID B;  1CTJ A;  1NTZ D;  3PTZ A;  2RMZ A;  3HQ7 A;  4P4Q B;  2HG5 D;  1W5C T;  5DFS A;  1SQQ D;  2YQB A;  2GA1 A;  2QG4 A;  2W90 A;  4IFM A;  1FZB A;  5KJ7 C;  1YIJ P;  1KQF B;  2AXC A;  4H0L D;  1Q82 Q;  3I5C A;  4M3L A;  1QVG O;  3L74 D;  4Q5P A;  1Y9B A;  2WSS H;  1AYG A;  2YK3 A;  4V2K A;  1HGZ A;  1URQ D;  1HF9 A;  3L71 J;  4L73 A;  3L71 E;  4NPE A;  2H8P D;  2OZ1 B;  2QIW A;  5AW7 B;  1YIT P;  1R5S A;  1FZE A;  1H0T B;  1NTM E;  1L0L D;  4AUW A;  1NNO A;  1CTZ A;  4IFF A;  1BCC E;  4WQD A;  1DEB A;  1R0Q A;  351C A;  1ZN5 A;  3L70 E;  5APU A;  3H1L E;  1DD4 A;  3SWK A;  2FY8 A;  1S5L E;  1QVF O;  3H1J G;  1BE3 D;  2H88 C;  1XTC C;  1HJ3 A;  3CX5 E;  3HUS C;  3Q1M A;  3KPE A;  1NJI Q;  1CIE A;  1S2E A;  2I8D A;  1KZU B;  3ZCF A;  1Q7Y Q;  3P8M C;  1G1J A;  2WQY C;  3CWB D;  1BGY G;  1DW1 A;  2Q3I A;  1ZR4 A;  1RQV A;  3DMI A;  1CSW A;  1PPJ E;  1S5L H;  5BVZ A;  2UWJ E;  1T2K D;  5EXQ A;  5L8R J;  1X9V A;  3OA8 A;  1NGM B;  2LIT A;  2Y0C A;  1GU5 A;  1I55 A;  5KAI E;  5EFW B;  2M0B A;  1VQ4 P;  1KQL A;  1DX7 A;  5CCH A;  5CIE B;  3VMZ A;  3V2N A;  1QGK B;  1SQP G;  4L74 A;  2XZR A;  3SXT A;  2WSE J;  3W68 A;  1VQN P;  4WY4 B;  1ZXG A;  4IL6 V;  4EIJ A;  1HH0 A;  3B71 A;  1K8A Q;  1IQC A;  3OCD A;  2IZ0 A;  4JYC A;  1KIL A;  4UB6 E;  1SQB G;  5AVQ B;  1KMI Z;  1DW2 A;  5KLV J;  1L4A C;  1PL5 A;  2CK3 H;  2EXV A;  4JQ0 D;  1X22 A;  3PH2 B;  4AQR D;  3BRV B;  1U7J A;  2E43 A;  1K3H A;  1IFJ A;  3RK3 C;  1JDL A;  3WUI A;  2JJL A;  5KAF E;  3WFC C;  4H44 D;  3RL0 g;  2M8R A;  2QRX A;  3H1L J;  2P7J A;  3WU2 H;  2K3R A;  3KZI H;  4UB6 H;  1KYO W;  2YKQ A;  1NTK E;  5CMZ A;  1GDT A;  2XDJ A;  3LW5 J;  2ZOO A;  1OVU A;  4ZKP A;  2IBZ G;  4L3H A;  5CCG D;  2OTK E;  2E5Y A;  3JCU E;  2ZAE B;  3SVW A;  2PRR A;  3TNU B;  1KYO E;  2R3S A;  4OGQ D;  4DT0 A;  1W5C E;  3H1H D;  2DVH A;  2B9B A;  1WMK A;  3A7O A;  2N1T D;  4QMA A;  2C9N Y;  4PD4 D;  1MG2 D;  3L74 E;  1UII A;  1AJY A;  1CYC A;  1BE3 J;  3PXT A;  1N73 C;  1JY3 O;  4BRY A;  4XA4 A;  3VMX A;  4PJ0 E;  3V2P A;  1KIL C;  1COT A;  1EB7 A;  3O1Y A;  3D6Z A;  3L4M A;  1KB9 E;  2BCN B;  4KT0 J;  4HB1 A;  5KAF V;  2NPS D;  3SWS A;  3H1K J;  1JM0 A;  5KLV E;  3EWK A;  1YJ9 P;  5DJQ C;  1YIC A;  4HYT B;  2FYU J;  1CI6 A;  5KLI C;  3AE9 C;  1RQU A;  1KIL D;  2P10 A;  1VPC A;  4FAV A;  3S9O A;  1LTT C;  1NTZ E;  2HYN A;  3CXH E;  1X0T A;  3CCJ P;  3L72 G;  2O1J A;  4Y5R A;  3AEE C;  3HQ8 A;  1N7S C;  1FI7 A;  4RO0 A;  3FXD A;  3DP5 A;  3H6P A;  3D6Y A;  2AXT V;  1RZ6 A;  1EZV I;  2ZXY A;  2JO1 A;  1IO4 A;  1HZU A;  1KTM A;  5AW9 B;  1AOF A;  3ZIY A;  2POH A;  1FAV A;  2QJP C;  3CLQ A;  3OA8 B;  1QX8 A;  1VQP P;  5CCG A;  1DT1 A;  1SFC A;  1IFP A;  2E75 B;  3O8Z A;  1VQ9 P;  1P84 I;  2ZXE B;  1VQ8 P;  4KHX A;  3H1J D;  3CC7 P;  5KTB A;  1AKK A;  3GF3 A;  3HUS A;  1MKM A;  3VTP C;  1HJ4 A;  1FOS F;  4UB8 V;  4R4L A;  4KMG A;  2BCC J;  1VQ6 P;  5K5G B;  1M56 D;  3L72 J;  4YPC A;  1LMS A;  1P84 E;  4EDF A;  1S6V B;  1A02 J;  1RAP A;  4WQC A;  5APY A;  1FZC A;  2WT7 B;  1U74 B;  2WSE H;  1N73 B;  5B66 V;  1KIL B;  1EDL A;  1YQ3 C;  3RK3 E;  5CYT R;  4EYY Q;  1C52 A;  1HUC A;  3AEC C;  1Q2N A;  5CBO A;  2KLU A;  4PJ0 H;  3WFB C;  1YCC A;  5DJQ B;  3A5T A;  1EDJ A;  2KSE A;  1FI3 A;  3E7K A;  1FZF A;  3MUD C;  1M57 D;  3IN6 A;  2IX7 C;  1L0L J;  3WFD C;  1NTZ G;  5TIS V;  2OTJ P;  1WEJ F;  1SQV E;  1GL2 D;  1JEK A;  2WVR A;  3U59 A;  1NMI A;  1JCD A;  3CXH H;  3G4S P;  4ZKU A;  5C39 A;  1E8E A;  2KOG A;  3A0B H;  3UIA A;  3G3Z A;  3CME P;  1CYJ A;  1SQV K;  3H1K G;  1H89 A;  2YIU C;  1F1F A;  3CX5 D;  1P84 D;  1GW3 A;  3RK2 D;  2P2U A;  1QL2 A;  2D0S A;  3CD6 P;  2IYO A;  1YQ4 C;  1DIQ C;  4IL6 H;  2M3E A;  2O01 N;  1DIP A;  2RH0 A;  5H2F H;  5AVU B;  1HJ0 A;  3JBT B;  3GG2 A;  2YO3 A;  3HE4 A;  3E1R A;  3ZOO A;  4PV1 C;  1DII C;  2QJK C;  1T6A A;  2B12 B;  3CX5 W;  2A06 G;  4RES B;  3USS A;  1DEE G;  5M1B A;  3CXH I;  4JPZ B;  1EZV G;  1KYO H;  1L0L E;  1YYC A;  3VMY A;  1RH5 B;  2OQQ A;  4I7Z C;  3TK1 A;  3H1I E;  1MZ9 A;  2ZFC A;  1CRY A;  3H1H E;  1SQV D;  2BEQ D;  3KDP B;  2IPP A;  3BCC D;  4O9B A;  3H25 A;  1L4A A;  3RN0 A;  5AW4 B;  1KQG B;  4BRY B;  3FXE A;  1J1E B;  1SQP E;  1JMB A;  2Q6Q A;  2BH4 X;  4PD4 E;  5B5E E;  1N7S D;  2W83 C;  2GM4 A;  1HJ5 A;  3PJS K;  3PLN A;  1J3S A;  2RN0 A;  1NTM G;  2FKW B;  3LID A;  2WWW A;  5AVT B;  1L9B C;  2YCC A;  4U3F J;  3AE5 C;  2LIR A;  2V07 A;  1VF5 B;  2Y0D A;  4K35 A;  3SFD C;  1JO5 A;  4GDO A;  3TSI A;  2BPB B;  3CCM P;  1SQP D;  2XNX A;  1ZW0 A;  1FHB A;  2CE0 A;  3A0B V;  1HVV A;  3AEA C;  2P1J A;  3HQ6 A;  1Y8A A;  4FA9 A;  1BDD A;  1JY2 O;  1T3J A;  2B89 A;  2LKM A;  1BL9 A;  2FXM A;  2OTL P;  1IZL 0;  3GLM A;  1BSH A;  4NFG B;  1FJK A;  3T97 A;  5AW3 B;  2BEZ F;  4W7Z A;  1USE A;  3V2Q A;  5CCH D;  4U7J A;  2Z5H A;  2YMY A;  2FFD C;  1L0N G;  3HD7 A;  4C7N B;  3IF4 A;  3AED C;  4GED B;  1BE3 G;  2CA4 B;  1YIQ A;  1YTC A;  1W2E A;  1KD1 Q;  1LTJ A;  2PCB B;  3B8E B;  1LWU A;  3M06 A;  2IBZ D;  3H1L G;  2CE1 A;  1VQO P;  1UIX A;  4L75 A;  3RN1 A;  5APX A;  3RMZ A;  2FRC A;  2Q1K A;  4PV1 D;  1AA0 A;  4EID A;  5B5E H;  3H1H G;  1GMJ A;  3TYI A;  3VYM A;  4HH2 A;  2O01 J;  2D2C B;  4ZNC A;  1G2C B;  3CI9 A;  1K9M Q;  2OYI A;  3CCV P;  1LTI C;  2IFM A;  3JCU H;  4DZO A;  2KSJ A;  3L75 G;  3L71 G;  4WY4 C;  2A06 D;  4RKU J;  1E29 A;  3P8C D;  1EZV D;  2NPS A;  4PD4 H;  3MIW A;  1CYI A;  3L73 G;  4LLH A;  2FXO A;  5B6Q A;  1L0L G;  3BAS A;  1NU1 G;  5AVV B;  2N9J A;  1KV4 A;  3MP7 B;  1Q86 Q;  1JB0 J;  1C2R A;  2P58 A;  1GKS A;  2Q7C A;  4U3F D;  2AXT H;  2V08 A;  3MTU E;  1S1C X;  1S3J A;  3ZOW A;  1OW6 A;  1QL1 A;  1NH4 A;  2KS1 B;  1OIP A;  1KB9 I;  4ASV A;  3A2A A;  1SQB D;  2N1T A;  2MJZ A;  2PCC B;  2W27 A;  3L4F A;  1FZG A;  1YJW P;  1KX7 A;  1SQB J;  1USD A;  1PP9 G;  1X8Y A;  3L74 G;  1N50 A;  1NKZ B;  2SPZ A;  1SS1 A;  1CXA A;  2XU6 A;  1X79 B;  3N7N A;  1OXZ A;  5KAI H;  1IFN A;  4EOT A;  3JC2 2;  1QLE D;  3L73 E;  2AXT E;  3D71 A;  5AVS B;  1VQ5 P;  4L1Q A;  3F89 A;  4MN4 C;  1FJ0 A;  1QKS A;  1T3U A;  2Y0E A;  4AAO A;  4FAN A;  2D0W A;  4DY9 A;  1IO3 A;  3HTK B;  1CW5 A;  1EDK A;  2NPS C;  2KUB A;  2W6A A;  3MZW B;  2KK7 A;  2PAJ A;  1SQP J;  4GIF A;  3CU4 A;  1LC1 A;  2AEM A;  4HJG H;  2OYO A;  1M6Z A;  4GYD A;  2IBZ E;  3CWB G;  3HTK A;  2GIW A;  4I7Z B;  5AW6 B;  1AFO A;  3DR0 A;  2QA4 P;  3M0A A;  3P32 A;  1LT9 C;  2NZ2 A;  3NBS A;  2N9B A;  3TGU E;  3H32 B;  1L0N D;  2ORL A;  1A8C A;  1PIX A;  1H1O A;  2K9J A;  2YKO A;  3ITK A;  3CCR P;  2HPC B;  1LWU C;  2WSC J;  4H0J A;  1N7S B;  3I55 P;  1VDF A;  1ZME C;  1HBW A;  1ZRT D;  5E79 V;  2WIT A;  1PPJ G;  5APS A;  4H13 C;  3V4Q A;  4XFJ A;  1GD2 E;  1IFM A;  3HD7 B;  2BCC G;  1S72 P;  2AI5 A;  1LT9 A;  1L0L K;  2R5B A;  4BXL A;  1C6O A;  3WUV A;  4WQE A;  2KNC B;  3O6Q B;  2QJK B;  3G6E P;  1FBM A;  1LGH B;  1K05 A;  4XYD B;  2JWD A;  1FE6 A;  2HLO A;  3S1K A;  2ZVO B;  3RGU A;  1J1E C;  4JBZ A;  2AEF A;  5AW1 B;  1FDI A;  1N2D C;  1OZH A;  2WT7 A;  3ORV A;  3SFE C;  3MUD A;  5KAI V;  4D6T J;  3PXS A;  2OYI B;  3AE2 C;  4IL6 X;  2C2C A;  4PJ0 V;  1FZC B;  4W80 A;  4D6T G;  1L0N E;  4TLF A;  4C7R A;  1GJQ A;  1LP1 B;  2FBW C;  1LFM A;  2HOD A;  1RF1 A;  3RK2 B;  3W67 A;  1PP9 E;  4GOD A;  4YXD C;  1Q81 Q;  1OVV A;  1LTS C;  3H1H J;  1OFC X;  3TGU J;  1EXJ A;  3M0D C;  2YIU B;  2DW3 A;  1NML A;  5APW A;  2LXC B;  2E74 C;  3L75 J;  3CWB E;  3RK3 B;  3CCS P;  1LP1 A;  3L72 D;  2K1A A;  3EQ2 A;  2K9Y A;  1IRV A;  1SFC D;  3FWN A;  5CHX A;  1OW8 A;  4O1W A;  1L4A B;  3NFQ A;  3L75 D;  3RK3 D;  1PGJ A;  2BCC E;  3PXW A;  1CSU A;  2N18 B;  2ZT9 B;  2IFN A;  1SP4 A;  3WUU A;  1FOS E;  1CHH A;  1CSX A;  4GOF A;  2M5A B;  1SQX D;  1FOC A;  3D70 A;  1CC5 A;  5C9M A;  3PHL A;  2AEJ A;  4UB6 V;  2W8Z A;  2BAS A;  2G3A A;  1HJB A;  2WZ7 A;  3AE3 C;  3H1L D;  3LW5 H;  4I2L C;  3CL3 D;  2IDB A;  4N3Y B;  1BCC D;  2FYU D;  3O0R C;  3KZI E;  2A45 G;  1KN7 A;  1KYO D;  1MUU A;  1KOR A;  4U3F E;  1PP9 J;  2JQR A;  5KLV D;  1A2S A;  4ASW A;  2B0Z B;  1NU1 E;  1PP9 D;  1PGO A;  2O3J A;  4FA4 A;  2H7H A;  5B66 H;  1NTM K;  3NBT A;  3H1J E;  5APV A;  4YXW H;  3RL0 D;  3CYT I;  3N4X A;  2C1V A;  1I54 A;  4PV1 B;  4WWI A;  4N78 E;  2PGD A;  3CXH W;  1SQX K;  1QN2 A;  5CIF B;  3TGU D;  1PZQ A;  1RY3 A;  3O6Q A;  1COR A;  1KB9 H;  2N9Y B;  1ZR2 A;  5C0Z A;  3IAO A;  1CCH A;  1BGY J;  2GUS A;  3BCC J;  3L36 A;  5GTH E;  2BCC D;  1H8A A;  3G71 P;  2WSF J;  5KAF H;  1EXI A;  1GTW A;  4IOI H;  4AAM A;  1I8P A;  4U3F G;  1RE4 C;  3C1L A;  2CPB A;  4OGQ C;  1YHQ P;  1CIF A;  3O20 A;  3II6 A;  3B4S A;  1H9Y A;  1AQ5 A;  2B88 A;  3L75 E;  1K3G A;  3CXH D;  1YEB A;  2G8Y A;  1XTG B;  5AVR B;  5GTI E;  5APQ A;  1CTY A;  3JSV C;  3GHG C;  3TNU A;  4OVN F;  4AAL A;  1H31 A;  2M5A A;  1C7M A;  1L0N J;  3L35 A;  1FU1 A;  2A06 E;  1CZQ A;  5H2F E;  1CCR A;  1M70 A;  4D6T D;  1WVE C;  1IZN B;  3V6I A;  3M0D A;  1N73 A;  4FB1 A;  3GMA A;  3D0W A;  3R4Y A;  5AVW B;  3M9Q A;  1Z56 A;  1SQP K;  1PPJ D;  2N1T C;  4A7P A;  1CRG A;  2P67 A;  3KYQ A;  2YKP A;  2KZI A;  2XKM A;  1NTZ K;  3VN0 A;  2LR2 A;  2C9L Y;  4C7N A;  5B66 E;  2FXP A;  4UB8 H;  1LT1 A;  2ZXX A;  1VL2 A;  3ZOX A;  2B87 A;  4DJG A;  1VQM P;  1RE4 A;  3HE5 B;  3H32 A;  4O1Q A;  3AEB C;  3BRT B;  2KS1 A;  1BDC A;  1J1D C;  1FS0 E;  1SQQ J;  3AE6 C;  3C2C A;  3GW6 A;  1SQQ E;  3KHU A;  2JKV A;  3AE1 C;  5AW5 B;  5GTH V;  1ZV8 A;  3OJA B;  2IBZ I;  1J1D B;  1ZLL A;  2PAC A;  1WT6 A;  1NU1 K;  1K04 A;  1WRG A;  1JY2 P;  1GK6 A;  1GIW A;  1R8E A;  2Y9Y A;  3E1I A;  2OYH B;  3VP9 A;  1NYH A;  2B10 B;  1S9K D;  1CRH A;  2KB7 P;  3L73 J;  3BCC E;  3PH0 A;  1OX3 A;  1LT9 B;  1C2N A;  2IYP A;  1AOQ A;  3ABV C;  3H1I D;  2WPQ A;  3OAK A;  5APT A;  1SQB E;  4NPD A;  1IFI A;  1N15 A;  1ZP0 C;  3H1J J;  2JP3 A;  5CIH B;  3VYI A;  2J59 M;  1JOC A;  1FJP A;  3V4W A;  4LGD E;  4H44 B;  1CRJ A;  3WMM 0;  1KFN A;  1SQV G;  1E79 H;  2WPS A;  3U1A A;  3NMD A;  4BWN A;  5CCG C;  3CCU P;  3BCC G;  1LC2 A;  1GQ1 A;  1KB0 A;  1Y47 A;  3L71 D;  1EZV E;  3EFG A;  3SSU A;  5CIC B;  4L3G A;  1M1J B;  2H89 C;  2QEX P;  2YO2 A;  1KIL E;  2W6J H;  1SVF A;  2OAR A;  1URQ B;  1CRC A;  4KJM A;  2QM8 A;  3NXS A;  1RF1 B;  1HTL C;  1KC8 Q;  2QSI A;  4YTP C;  1FC2 C;  1H88 A;  2BLF B;  2V7Q H;  3RL0 C;  5CCH C;  1LTJ B;  1GK4 A;  2MTA C;  1OMI A;  3AE8 C;  1NTZ J;  2R3C A;  1CO6 A;  451C A;  5AVY B;  1GW4 A;  2R5D A;  4EIC A;  2J5U A;  2ZYA A;  2OYH C;  4AYC A; 
#chains in the Genus database with same CATH homology
 3L4O A;  2OZ1 A;  1H31 B;  4K3I A;  1RZ6 A;  2ZZS 1;  3DR0 A;  2ZXY A;  1HZU A;  2JTI B;  1N90 A;  3NBS A;  1AOF A;  3ZIY A;  1L0N D;  5KKZ B;  2ORL A;  1A8C A;  1H1O A;  3OA8 B;  3O5C A;  3ITK A;  1QL3 A;  2Q3E A;  2JWA A;  1DW0 A;  3WU2 V;  4AAN A;  1H9X A;  2C1U A;  1DT1 A;  1HZV A;  1F1C A;  4H0J A;  1I8O A;  1ZRT D;  2GC4 D;  5E79 V;  1FI9 A;  2K9J B;  3H1J D;  3M97 X;  1ETP A;  1AKK A;  2GB8 B;  1HJ4 A;  2L91 A;  4UB8 V;  1CNO A;  3TDK A;  4KMG A;  3VRD A;  2AI5 A;  5B5E V;  2QJP B;  1DW3 A;  1E2R A;  2ZON G;  1C6O A;  1I5T A;  1LMS A;  4WQE A;  2KNC B;  1CRI A;  1L9J C;  4EDF A;  1S6V B;  1CHJ A;  4N0K A;  2QJK B;  1RAP A;  4WQC A;  1U74 B;  2QJY B;  5B66 V;  4XYD B;  2N3Y A;  2CXB A;  1KB9 D;  1B7V A;  5H2F V;  1NTM D;  4JCG A;  2VHD A;  5CYT R;  4EIE A;  1C52 A;  4FA5 A;  3X39 A;  1HRC A;  3WFB C;  1YCC A;  5DJQ B;  3ORV A;  1NTK D;  1IRW A;  2CA3 B;  3L73 D;  5KAI V;  3PXS A;  1FI3 A;  2C2C A;  4PJ0 V;  1QL4 A;  2N3B A;  1A56 A;  1NU1 D;  1GJQ A;  4YE1 A;  1BGY D;  1LS9 A;  1LFM A;  3WFD C;  4AX3 A;  5TIS V;  1WEJ F;  3VNW A;  1NMI A;  1H33 A;  1H32 B;  1E8E A;  2YIU B;  1NML A;  3FWL A;  2FYN B;  2GC7 D;  4PWA A;  3WC8 A;  3L72 D;  1C6S A;  4LJI A;  1IRV A;  1CYJ A;  5CIB B;  3L70 D;  3A0H V;  1KX2 A;  2AIU A;  4O1W A;  1F1F A;  3CX5 D;  1H32 A;  1P84 D;  1CSV A;  1KIB A;  2DGE A;  2D0S A;  3L75 D;  1S5L V;  3PXW A;  1CSU A;  2N18 B;  4MU8 A;  1CHH A;  1CSX A;  1DIQ C;  1U75 B;  5CIG B;  1CHI A;  1SQX D;  1CED A;  1FOC A;  1CC5 A;  3JBT B;  5C9M A;  3PHL A;  2B11 B;  4UB6 V;  3GG2 A;  2N18 C;  1I6D A;  3ZOO A;  1DVV A;  5CID B;  1DII C;  3H1L D;  1CTJ A;  2B12 B;  1NTZ D;  3CX5 W;  3PTZ A;  2RMZ A;  3HQ7 A;  4P4Q B;  2XTS B;  2BH5 X;  1W5C T;  1CIG A;  5DFS A;  1BCC D;  2FYU D;  3O0R C;  1SQQ D;  1KYO D;  1GU2 A;  2YQB A;  2QG4 A;  2JQR A;  5KLV D;  1A2S A;  2B0Z B;  1YEA A;  1I6E A;  1CRY A;  1PP9 D;  1SQV D;  2O3J A;  3L74 D;  4Q5P A;  2C1D B;  1AYG A;  4FA4 A;  2YK3 A;  4V2K A;  2BGV X;  3NBT A;  3BCC D;  5GTI V;  1CXC A;  3CYT I;  2C1V A;  1I54 A;  1YFC A;  3RN0 A;  3CP5 A;  2OZ1 B;  3CXH W;  3OCD B;  1QN2 A;  5CIF B;  3TGU D;  2BH4 X;  1FCD C;  4RJT A;  1COR A;  2N9Y B;  4WQ7 A;  5C0Z A;  1HJ5 A;  1L0L D;  2C1D A;  1CCH A;  1NNO A;  1CTZ A;  3PLN A;  2BCC D;  1J3S A;  2RN0 A;  3SLE A;  4WQD A;  1R0Q A;  351C A;  4AAM A;  1L9B C;  1I8P A;  1NIR A;  2YCC A;  1CIF A;  3O20 A;  2LIR A;  2V07 A;  2Y0D A;  1HRO A;  1H9Y A;  1BE3 D;  1K3G A;  1C75 A;  1HJ3 A;  2BPB B;  3CXH D;  1YEB A;  2HV4 A;  1SQP D;  1MZ4 A;  1CIE A;  1DVH A;  1FHB A;  3ZBM A;  2CE0 A;  3A0B V;  3ZCF A;  1CTY A;  5DF5 A;  3CWB D;  3HQ6 A;  1DW1 A;  4FA9 A;  4AAL A;  3NWV A;  4EIF A;  2MHM A;  1H31 A;  1C7M A;  3DMI A;  1CSW A;  1BL9 A;  1CCR A;  1IZL 0;  5EXQ A;  4NFG B;  1M70 A;  1M60 A;  4D6T D;  3OA8 A;  1WVE C;  2LIT A;  2Y0C A;  4QAO A;  1I55 A;  4FB1 A;  1GDV A;  155C A;  1PPJ D;  4A7P A;  1CRG A;  3MK7 C;  4PW9 B;  4GED B;  2CA4 B;  1YIQ A;  5CIE B;  1YTC A;  3SXT A;  1HH7 A;  1C6R A;  1N9C A;  4IL6 V;  2PCB B;  1QYZ A;  3H1K D;  2IBZ D;  3ZOX A;  1KV9 A;  2CE1 A;  1IQC A;  3A9F A;  4O1Q A;  2KS1 A;  3RN1 A;  3OCD A;  3RMZ A;  2FRC A;  1W2L A;  2B4Z A;  3SJL A;  4EID A;  1CIH A;  3PRJ A;  3C2C A;  3GW6 A;  2ZBO A;  4WQ8 A;  3TYI A;  3VYM A;  1DW2 A;  3KHU A;  1YNR A;  4J20 A;  5GTH V;  3VMA A;  3KZI V;  2EXV A;  2PAC A;  3PH2 B;  1K3H A;  1JDL A;  3WUI A;  3WFE C;  3WFC C;  1MG3 D;  1GIW A;  2A06 D;  1ZZH A;  1E29 A;  1HCM A;  1EZV D;  2B10 B;  5AUR A;  1KYO W;  1CRH A;  1CYI A;  1C2N A;  1AOQ A;  2ZOO A;  5B6Q A;  2N9I A;  4H0K A;  2N9J A;  3H1I D;  2FWL A;  4L3H A;  1C2R A;  1GKS A;  4U3F D;  3SVW A;  1N15 A;  2V08 A;  1RZ5 A;  3ZOW A;  1H33 B;  1OAE A;  1SQB D;  3H1H D;  2DVH A;  5CIH B;  2PCC B;  1CRJ A;  1RAQ A;  1KX7 A;  5KLI B;  4RSZ A;  1N50 A;  4PD4 D;  1MG2 D;  4WQA A;  1CXA A;  1LC2 A;  1CYC A;  1GQ1 A;  3MK7 B;  1KB0 A;  3L71 D;  4WQ9 A;  3PXT A;  5CIC B;  4L3G A;  1COT A;  1EB7 A;  3O1Y A;  3RLM A;  3L4M A;  2C8S A;  2BCN B;  1CRC A;  4L1Q A;  5KAF V;  3SWS A;  1FJ0 A;  5IY5 1;  1OCD A;  4WQB A;  5DJQ C;  3TF5 A;  1YIC A;  2BLF B;  1QKS A;  2Y0E A;  4AAO A;  4FAN A;  2MTA C;  2D0W A;  4DY9 A;  1VYD A;  1IO3 A;  2C9X B;  2L4D A;  4FAV A;  1CO6 A;  4FA1 A;  2I8F A;  451C A;  3ZOY A;  3CU4 A;  4Y5R A;  1LC1 A;  3HQ8 A;  4EIC A;  1FI7 A;  1M6Z A;  4GYD A;  4XXL A;  3DP5 A;  5TJH A;  2GIW A;  3HQ9 A;  2AXT V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...