1SQXD

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqxD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqxD02
3DMIA 1I54A 1KX7A 1CIHA 3ZOXA 1LFMA 3A0BV 4PWAA 4L1QA 2L91A 2C1UA 1CYJA 1VYDA 3PXSA 4EIFA 1FI7A 1H9YA 3A0HV 4FAVA 1CRYA 2BGVX 3FWLA 3O20A 1GDVA 4IL6V 3CWBD 2FRCA 2YCCA 3NBSA 4RJTA 1DW0A 3MK7B 3PTZA 1EZVD 1CSUA 2JQRA 1FCDC 4EIEA 1KB0A 3O5CA 1QKSA 1NU1D 1NTKD 1OAEA 5KKZB 1I8OA 4KMGA 4GEDB 155CA 3VNWA 3A9FA 1M6ZA 1LMSA 2AXTV 4AAMA 1C2RA 4FA5A 2ZBOA 5KAIV 3VRDA 1MZ4A 5KAFV 5CIBB 1IRWA 5C9MA 4N0KA 1CTYA 1AKKA 1I55A 1AOFA 2QJYB 3PXWA 3SJLA 2N3YA 5B6QA 1N15A 2D0SA 2RN0A 2D0WA 3CYTI 3L73D 1CNOA 5EXQA 1J3SA 1NNOA 2CA3B 1NMIA 3L74D 1JDLA 2N18C 1YNRA 1C6SA 1H33A 1E2RA 3O1YA 1R0QA 1CORA 1SQPD 4DY9A 1WVEC 1FOCA 1W2LA 2V07A 1K3HA 1HZVA 1L9BC 5AURA 3ORVA 1HCMA 2C1VA 1C75A 2IBZD 1CYIA 3SLEA 2CE0A 3C2CA 3O0RC 1E29A 1L0ND 3ITKA 2YK3A 1I5TA 1DW1A 4QAOA 4AANA 1H31A 1H32B 1CRIA 451CA 2K9JB 2O3JA 1YICA 3CXHW 4FA4A 2YQBA 1CEDA 3PRJA 1HROA 1BGYD 1LC2A 1IZL0 3ZOYA 1ZRTD 3HQ7A 1N9CA 3WU2V 1H33B 1CSVA 4XXLA 4WQBA 2Q3EA 2C8SA 2N18B 2KS1A 1L0LD 3KZIV 4LJIA 2GC4D 3OCDA 3NWVA 4NFGB 4WQCA 5B5EV 2OZ1A 3M97X 1S5LV 2BPBB 4PJ0V 2GIWA 3OA8A 1N50A 1MG3D 4O1QA 1KIBA 1CRGA 1BL9A 5B66V 1H31B 2CE1A 2GC7D 2N3BA 3ZBMA 1K3GA 2FYUD 1CRHA 2MTAC 1H1OA 1BCCD 1LC1A 3H1ID 3HQ6A 1CHHA 2ZONG 2PCBB 3GG2A 1I8PA 1DIIC 2GB8B 4UB8V 2RMZA 1U75B 1QL4A 1DT1A 1CHIA 5C0ZA 3RN0A 1SQBD 4FB1A 4H0JA 1DW3A 1LS9A 2Y0EA 1N90A 4GYDA 1CSWA 1B7VA 1GU2A 1YEAA 1C2NA 1NMLA 5CIDB 3L72D 3H1JD 1YCCA 3PXTA 3OCDB 1OCDA 3TGUD 1EB7A 1YEBA 2OZ1B 1COTA 1A2SA 1BE3D 2B4ZA 4FA1A 3OA8B 1DVVA 1A8CA 1CTJA 1HJ4A 3L4OA 1HH7A 2DVHA 5DF5A 1I6EA 1KB9D 1YFCA 3ZCFA 3PLNA 1MG2D 2PCCB 1P84D 1HRCA 4PD4D 2LIRA 3L70D 1A56A 1KYOW 4A7PA 5E79V 1W5CT 4WQ9A 1CIGA 1C6OA 5CIEB 1AOQA 3TDKA 5GTHV 2V08A 2BH5X 2B12B 3KHUA 3PH2B 4WQEA 2ZOOA 1KYOD 3ZOOA 4UB6V 1CSXA 3H1LD 351CA 2YIUB 2QJPB 5IY51 3WFEC 2C1DA 2MHMA 3NBTA 1C7MA 1CTZA 1CRJA 2VHDA 5CIHB 4K3IA 2PACA 2C2CA 3HQ8A 5CIGB 2DGEA 2Y0DA 4P4QB 3SWSA 4YE1A 1L9JC 3CXHD 3GW6A 1ZZHA 1HJ3A 1NTMD 1S6VB 2BH4X 3DP5A 3L71D 2I8FA 5H2FV 2N9YB 4J20A 5CYTR 4AALA 2EXVA 2JWAA 3ZOWA 1FI3A 1FI9A 2N9JA 2JTIB 3DR0A 3X39A 3H1KD 1M60A 5CICB 3RN1A 4Q5PA 1QL3A 3CX5W 1CCHA 5KLVD 4L3HA 3SXTA 1C52A 1CXCA 1GJQA 4FANA 1DIQC 1RAQA 4WQ8A 4V2KA 2BLFB 4L3GA 1QN2A 5CIFB 3WFCC 1GIWA 5DJQC 2C1DB 1HJ5A 1FHBA 3CX5D 2HV4A 1CO6A 4AX3A 1NTZD 1CRCA 5TISV 2ZXYA 1CXAA 1YIQA 2CA4B 3CP5A 1GQ1A 1KV9A 1RZ6A 3L75D 2B10B 3CU4A 2KNCB 1RAPA 3PHLA 2Y0CA 1FJ0A 1CCRA 2BCCD 3TYIA 5TJHA 1CIFA 3WFBC 4WQ7A 3H1HD 3JBTB 3WUIA 1GKSA 3L4MA 1CHJA 3SVWA 2QJKB 1U74B 1H32A 4MU8A 4O1WA 3WFDC 1AYGA 3VMAA 3BCCD 2XTSB 2N9IA 4PW9B 4D6TD 4XYDB 2ORLA 1SQQD 1SQVD 2A06D 3RLMA 2L4DA 2CXBA 1DW2A 5DJQB 1PP9D 4JCGA 1H9XA 1IQCA 2B0ZB 4WQAA 1IRVA 3MK7C 2B11B 1DVHA 1YTCA 4AAOA 1ETPA 3HQ9A 1NIRA 3RMZA 5KLIB 1WEJF 2FWLA 2FYNB 1CIEA 4H0KA 1CC5A 2QG4A 2ZZS1 5DFSA 4EIDA 3ZIYA 1KX2A 2LITA 3VYMA 1I6DA 1IO3A 1CYCA 4U3FD 3WC8A 2AIUA 4Y5RA 4EDFA 2BCNB 1F1FA 1QYZA 1HZUA 4WQDA 1C6RA 2AI5A 1E8EA 3TF5A 4RSZA 4FA9A 1RZ5A 1SQXD 4EICA 5GTIV 1M70A 1PPJD 2C9XB 1F1CA
chains in the Genus database with same CATH superfamily
1NU1G 1CIHA 1EDLA 3ZOXA 3A0BV 2M3BA 2OYIA 2Q9IA 2L91A 2I8DA 4MN4C 3A0HE 1FI7A 1VF5B 3AEAC 1KV4A 3FWLA 1K05A 4IL6V 2K37A 3AEDC 4OH8B 3WUUA 3AEGC 3MK7B 3CCSP 1EZVD 5C39A 1FCDC 1KB0A 3H1HE 2A45G 1NTKD 3Q5RA 4Y28J 1N7SA 2C9NY 4M3LA 3B4SA 4GEDB 2LXBA 1L0NK 1IFJA 2GUSA 2ZJSE 3MHVA 1XTCC 3V2NA 2N1TA 1WT6A 4DZOA 1YJNP 1IO4A 2AXTV 4AAMA 5KAIE 1JTHA 1QL1A 4UB6H 2ZBOA 3VP9A 1SS1A 1NH4A 1IRWA 2OYIB 5C9MA 3WMM0 1AOFA 2QJYB 2YMYA 1JB0J 1YTZI 4H0LC 2N3YA 3R4YA 2P7JA 1SP4A 2YO3A 1H8AA 3CX5I 3D71A 4JBZA 1CNOA 3H1KJ 5EXQA 2R32A 5GTIH 2K9JA 1L0NE 3RK2B 4R4MA 3TNUB 1NMIA 2NPSD 3JCUH 1N7SB 2N18C 1E2RA 1R0QA 2R3SA 2KLVA 2FFDC 1W2LA 1JTHB 1NTZJ 5CMZA 1HZVA 4TT3H 2QE7H 2P1JA 2OQQA 1VQ5P 1M1JB 1E29A 1L0ND 3M0AA 4QAOA 1H31A 5CBNA 3P7KA 1T2KC 1VQLP 2K9JB 2KI7B 3CXHW 2KXPB 3O8ZA 1QLED 1DX7A 2E74C 3D6YA 1CZQA 4QMAA 1LC2A 3OA7A 2KZJA 3U1AA 2FYUG 3WU2V 2KLUA 5DJUB 1CSVA 4XXLA 1BCCG 1MFTA 1SQQJ 2C8SA 4RESB 4GT1A 3GHGC 2ZXEB 1E79H 4I2LC 3KZIV 3TSIA 4WQCA 5B5EV 1Q2NA 3M97X 4YTPC 1URQD 4H13C 5B66V 1H31B 2GC7D 1ZMEC 2MTAC 4WBAA 2P58A 2ZONG 4Y99B 3B5ND 1YJWP 1CHIA 3S1KA 1SQXJ 2YIUC 2QJPC 1VQ6P 2MKVA 1J1EC 1HH0A 4ZKUA 3IR9A 5AW2B 1VQ8P 4R4LA 1CSWA 1C2NA 1FZEA 5CIDB 5APXA 4RKUJ 1OCDA 1FZFA 2GA1A 4WY4D 1X9VA 1COTA 3CWBJ 2WITA 1FAVA 1CTJA 4L73A 4I7ZC 2DVHA 2ZYAA 3A0HH 4ZNCA 3VTPC 1A02J 2WSCH 1HRCA 4EIJA 3VMYA 2LIRA 1KQLA 3U59A 1A56A 1MV8A 3CCEP 5E79E 3F5HA 5CIEB 4GODA 2V08A 1NTZK 1BDCA 1NTMG 1PFIA 3PH2B 3SSUA 3M9QA 2H88C 2IX7C 1HTLC 1FOSF 1KMIZ 5AW8B 2K3RA 1L4AB 1S72P 4UB8H 2KK7A 5CIHB 3TK1A 2HODA 3L73J 2P2UA 2RH0A 3GW6A 1AJYA 2IBZI 2NZ2A 1NOHA 5H2FV 2N9YB 1BE3J 2E76D 1QEXA 4N6JA 4WVZA 1FI9A 1FOSE 4LC1A 1AVYA 1SQQK 1IFDA 2M8RA 2JTIB 1KYOI 3H1KD 4HH2A 2XZRA 2J59M 3C8VA 1VF5D 2B89A 3SXTA 2K9YA 3RK2C 4YPCA 1GJQA 4NPDA 4W80A 4V2KA 3V4WA 4PV1B 1JUNA 5CIFB 1DEEG 2BCCG 1ZR4A 5BU8B 2M3EA 3CXHI 1NTZD 1CRCA 3T97A 4LLHA 5KLIC 5TISV 4I6MC 2KSEA 2WQYC 4PD4E 1GQ1A 5CCHA 3CMEP 1SQQE 4D6TG 3H32A 1KV9A 1SQXK 2A06G 1EDIA 3VYIA 1QX8A 2RKLA 1GMJA 3P32A 3NTNA 3U1CA 3EQ2A 5AVWB 2I1KA 1NVOA 1HGZA 1KC8Q 2I1JA 4WQ7A 3L4MA 1U74B 3KPEA 1IFPA 3IAOA 3KDPB 1PGJA 4XYDB 3RK2D 5KLVJ 1SQQD 1GL2C 1MZ9A 3NFQA 2CXBA 1N7SD 2XV5A 3T97B 1JNMA 3SFDC 1H9XA 1KD1Q 1IQCA 2B0ZB 3H1IJ 1NAFA 1A02F 1RQUA 1HJ0A 1PPJG 1YTCA 3H32B 1NIRA 3BVHA 3P8CE 2FWLA 1Q81Q 2R5DA 1JY3N 1OVUA 1ZXGA 3IFMA 3W67A 4DJGA 4OGQB 2WPQA 4AYCA 3VYMA 3CWBE 1S4XA 1JY2P 2BCNB 1F1FA 2IFNA 1P84I 1C6RA 1JCDA 1AQ5A 1EZVG 1SQXD 1TU3F 5CCGC 5GTIE 2C9XB 3M0DC 2Q3IA 1F1CA 3DMIA 1NTKG 2YXQB 3JCUE 3P8CD 3AE9C 2ZT9C 2C1UA 4AUWA 1CYJA 3PXSA 4EIFA 1LTAC 3BCCJ 2BGVX 3L70J 1SVFA 1KILA 1SQVJ 3CWBD 2ZXXA 3ABVC 3NBSA 1FDOA 3FGAD 2O1JA 1VQMP 1CSUA 1YQ3C 4DT0A 3O5CA 1QKSA 3H1HG 1I8OA 2IZ1A 2O01N 3FX0A 1ZN5A 1M6ZA 2A06E 4FA5A 3VRDA 1FJPA 4WB4A 5CIBB 2WT7A 2H89C 1CTYA 2BEZF 2D2CB 2QM8A 3F89A 1NYHA 2CPSA 1HJBA 5B6QA 2V7QJ 2D0SA 1KILB 2WPRA 5AVQB 1EZVI 1W2EA 1E5WA 3CYTI 3RBZA 3L73D 2OYHC 3CC2P 4KJMA 5APQA 3HE4A 2OGUA 1L0NG 3CCUP 1SFCB 1YITP 1H33A 5KLVK 3H25A 1CORA 4DY9A 1NKZB 3L4FA 2OTJP 2KYVA 5AURA 3ORVA 1ZRTE 5L8RJ 1NO4A 2WT7B 1J1DB 1VQ4P 3MIWA 5APUA 2CE0A 1OZHA 3G9RA 3L75J 1EXJA 2YK3A 1I5TA 3AEFC 3W68A 3KQGA 2HR3A 2AXTH 1NTKE 1N86A 5AW1B 4HKZH 3V5BA 4FA4A 1L4AD 2J58A 5APTA 1T3JA 2ZYDA 1FU1A 1ZRTD 3HQ7A 4WWIA 1IC2A 2ZYGA 1H33B 5AVYB 4WQBA 3VN0A 3H1IE 1U7JA 2Q3EA 2NPSC 1CI6A 2E75B 1OXZA 2E42A 1SQBE 1PP9J 2DW3A 2R44A 3HTKA 1FZBA 3II6A 1VQPP 5KJ7A 3V6IA 2LXCB 1JCCA 2YKQA 4C7NA 2MJZA 4PJ0E 1S5LV 1N73C 1GK4A 1VQOP 1OVRA 5AVSB 1KIBA 2N3BA 4PV1D 1LC1A 3AE4C 2Y9ZA 3H1ID 4U3FJ 3HQ6A 1CHHA 3MZWB 4UB8E 1I8PA 1DIIC 2RMZA 1FZCC 3AE7C 3RL0g 3RN0A 1SQBD 2ZAEB 2H7HA 1LT9A 1DW3A 3RK3B 1FJKA 4W7ZA 4GOEA 1LS9A 2K88A 3MTUE 1Q7YQ 3HE5A 3L70E 1N90A 4GYDA 1CI6B 4OGQC 1B7VA 1YEAA 1JY2O 1IJDB 2ZFCA 1YEBA 4C7NB 1OW6A 4Z1MH 1A2SA 1OX3A 1A8CA 2PAJA 3WU2H 1KB9D 1YFCA 2N1TB 3ZCFA 3PLNA 2PCCB 3L70D 1URQC 1OFCX 2WSEJ 1KYOW 2A45I 2FYUJ 1CIGA 1GZLA 2W6AA 1C6OA 5GTHE 3TDKA 3V2QA 2C9LY 1LT9B 2BH5X 1KQFB 3HE5B 2ZOOA 5CCHD 1LTGC 1DEBA 4UB6V 1CSXA 3AE3C 3B5NC 3MGNA 2C1DA 3H1KG 3VMXA 3FWNA 1C7MA 1CTZA 3C9IA 5KAFH 4OGQD 1Q82Q 4K3AA 1RF0C 2PACA 2C2CA 3HQ8A 5CIGB 2DGEA 2Y0DA 3LW5J 4YE1A 3CX5E 3M91A 2C0WA 3A7OA 1HJ3A 3DP5A 3L74J 3HUSA 4WY4C 4AALA 2M5AA 1LWUC 1RE3A 2KNCA 3FXEA 2EXVA 1NTZG 3ZOWA 1JO5A 2VRSA 2N9JA 1SQPJ 1LGHB 5AVTB 3DR0A 3UIAA 5CICB 3M0DA 4Q5PA 1AQTA 3MUDC 1QL3A 2YO2A 3L75E 2O01J 5AW6B 1SLQA 1LTIC 2V4HA 4BXLA 1RAQA 1SFCC 4WQ8A 2YNYA 4L3GA 5DJQC 2C1DB 1YJ9P 3CX5D 2W27A 4AX3A 3HD7A 1KILE 1GTWA 3GF7A 1WRGA 2ZXYA 5M1BA 2FYNC 1FZAA 3E1IA 3NMDA 3CI9A 3HUSB 1FDIA 4TLFA 1SQQG 3L75D 1BGYJ 2M5AB 3CU4A 1LTSC 2KNCB 4IL6X 4KHXA 3C1LA 1N8RQ 2Y0CA 1PP9E 2WTYA 1CCRA 3CPWO 2IZ0A 5TJHA 1U7MA 2D2CD 2L5GB 3OJAB 2E76C 1QVGO 1IK9A 1L0LJ 2R3CA 2W6JH 1KILD 4YXDC 2QJKB 1RF1A 1H32A 1KN7A 4O1WA 2WPVB 2XTSB 1HF9A 2N9IA 2P67A 3AE5C 4U3FE 1LTJA 3HD7B 2ORLA 1VF5C 1EQ7A 1SFCD 3RLMA 1LT1A 2Z5HA 4ZKPA 1PP9D 2G3AA 4PJ0H 3MK7C 2FYUK 1HGVA 3RMZA 1RE4C 1WEJF 3CCLP 1VQNP 2XNXA 1CIEA 1YTZT 3H1KE 4H0KA 2QG4A 1JEKA 1KX2A 1JY3P 2NRGA 4AQRD 4U3FD 3WC8A 2BEQD 1FBMA 1Y9BA 1Y47A 2AIUA 4XFJA 1KQSO 1KB9H 3CWBG 5TISH 2WSSH 3L72J 3H1JJ 2JKVA 1RF1B 4PD4I 2OYIC 3TGUJ 4FA9A 3WUVA 1VQ9P 2QJYC 3O6QA 4EI2A 4N78E 1RHZB 1LTJB 1NTZE 2G8YA 3A0BE 1LFMA 4PWAA 4RO0A 1YHQP 4YXWH 4L1QA 1KFNA 3BATA 2WSFJ 1H9YA 3A0HV 1CRYA 3O20A 2W90A 4IL6E 2KOGA 2E75D 1SQPK 2FRCA 2YCCA 1N7SC 4RJTA 4H44B 1DH3A 2YKPA 1R5SA 2IDBA 2JQRA 3RK3E 4EIEA 3SWFA 2N1TC 1UIXA 1OAEA 4N78D 1LTBC 5KKZB 3BASA 4KMGA 3H1LJ 2HODB 5GTHH 3IF4A 3L73G 3VNWA 2B87A 4ZMDA 1H0TA 4GIFA 2AXTE 3O6QB 2V7QH 2FKWB 3L74E 1C2RA 1LJ2A 3G3ZA 5KAIV 1M1JC 1MZ4A 1G1JA 2QVAA 4N0KA 3RL0B 1Z56A 1AKKA 1I55A 1SQPE 4GOFA 3PXWA 1ZR2A 3L71J 3A5TA 3SJLA 4C7RA 1PIXA 2P10A 5APVA 3RK3D 1VPCA 2WPSA 1FZCA 2RN0A 2IBZE 2D0WA 1IZNB 3CX5H 2W6BA 1NNOA 2CA3B 1L0LK 5KJ7D 1OWAA 3G6EP 2PGDA 3L74D 1N2DC 4L75A 1YNRA 3M9HA 1SQXE 2B87B 1H0TB 1SQPD 1WVEC 2N1TD 2V07A 1K3HA 1BGYE 1PGOA 3N7NA 3I56P 3A2AA 4XE5B 1HCMA 2C1VA 1C75A 2IBZD 1X79B 1ZW0A 2FFDA 1NKNA 2QEXP 3O0RC 3ITKA 2IFMA 1DW1A 1BSNA 4Y99C 4JQ0D 2AEJA 4H0LB 1YICA 1Q86Q 3H1HJ 2POHA 1BGYD 1T6AA 3ZOYA 1DIPA 3WU2E 3AE1C 1KQGB 3JC22 3JSVC 3H1IG 1WMKA 3PH0A 2N18B 5AVRB 1H88A 3KZIE 1L0LD 3P8MC 2Q5UA 5BVZA 5APWA 5BU5A 3G71P 4B86A 1SQBG 2FFDB 3NWVA 1YBKA 4NFGB 3I55P 5B5EE 1KTMA 3GHGA 3CCQP 3EFGA 2BPBB 2HLOA 1N50A 3AE2C 5B66E 3CCVP 3L73E 1CRGA 4NPEA 2CE1A 3H1JE 5KTBA 1CRHA 2Q6QA 3TGUE 5AW3B 1QGKB 3MP7B 2ZVNB 3N4XA 1BE3E 2YMKA 3Q1MA 3CC4P 5KAFE 2PCBB 3GG2A 1PL5A 1U75B 1EXIA 1QL4A 4ASVA 4FB1A 1P84E 3B8EB 2E74B 1JY3O 1NJIQ 1AFOA 1L4AC 3L70G 3CMAP 1NMLA 3VOPA 4HJGH 3L72D 3H1JD 1YCCA 3PXTA 4HB1A 3TGUD 1EB7A 3A0BH 1BE3D 2WSEH 2XU6A 2B4ZA 1S9KD 1HJ4A 3L4OA 2GUVA 5DF5A 1MG2D 4IL6H 1NU1J 1P84D 3ZDMA 4H13B 3HD7D 1UIIA 5E79V 1W5CT 2B88A 3H6PA 1Y8AA 2E43A 4PV1C 1M90Q 4JYCA 1JOCA 3L71E 2HYNA 2B12B 3A3YB 1S5LH 3AECC 1EDJA 1MFZA 4IFDK 4WQEA 3D6ZA 3ZOOA 3K5BA 3LW5H 3H1LD 2YIUB 2QJPB 5IY51 3SFEC 3HE4B 4L76A 5KLVE 1CRJA 2JJLA 1N7LA 4K3IA 3L35A 2E5YA 1T3UA 1L9JC 1ZZHA 4EOTA 2O01H 2BH4X 1S6VB 1KORA 3L71D 5H2FE 5CYTR 3QH9A 2C0XA 4I7ZB 1FI3A 1FE6A 1KZUB 1SQVK 4IFMA 1S2EA 2N9BA 2Y9YA 1KYOH 1RH5B 1CCHA 2PFXA 5KLVD 3L75G 2IYPA 1C52A 1CXCA 4FANA 1DIQC 2BLFB 4LGDE 2JO1A 4H44D 2Z4EA 1GIWA 1R8EA 1HJ5A 1FHBA 2HV4A 3TNUA 1CO6A 1HUCA 2W83C 5CCHC 1ZV8A 1VQKP 1KB9E 5TISE 3CXHH 1H89A 2J5UA 3BCCE 2JWDA 4GKGA 4OVNF 2CA4B 1X8YA 4ASWA 1MKMA 1SQVE 3R2PA 2QIWA 1RAPA 3AE6C 3HTKB 1LTTC 1AVOA 1PP9G 3PJSK 3RL0D 2H8PD 1M1JA 5AVUB 1NHLA 5AVXB 3H1HD 3JBTB 3WUIA 1CHJA 3SVWA 1YI2P 3WFDC 1AYGA 1HWTC 3BCCD 4PW9B 2KIKA 1QL2A 4U3FG 3KZIH 1SQVD 2L4DA 4DOJA 1DW2A 5AW0B 1NU1K 4JCGA 1BCCJ 3AE8C 5B5EH 2LKMA 1IRVA 1VQ7P 1GL2A 2B11B 1DVHA 4AAOA 1ETPA 5B66H 4IFFA 5DJTB 5KLIB 2FXPA 1DD3A 1CC5A 5AW4B 1G1IA 4L74A 1DD4A 4CPGA 3IN6A 1IO3A 1CYCA 4Y5RA 2QM7A 3V4QA 1QYZA 1HZUA 1MUUA 1USEA 1E8EA 1P84H 2WSFH 4RSZA 1RZ5A 1G2CA 3PP5A 4H0LD 2XKMA 1ZLLA 4NPFX 5GTIV 3BRVB 1NU1E 1M70A 1NAYA 1AOQA 2D2CC 1I54A 1KX7A 1D7MA 1KILC 3Q3DA 5CCGA 1VYDA 1HBWA 4BWNA 1GL2B 4FAVA 1GK6A 1GDVA 2KUBA 4U7JA 3QWOC 3GMAA 2FBWC 1DW0A 3PTZA 2HG5D 2HPCA 3CCMP 2FY8A 1FDMA 2PRRA 1NU1D 1RQVA 2IPPA 3CLQA 1GW4A 3CCJP 1OW7A 155CA 1J1DC 1G2CB 3A9FA 1LMSA 4N3YB 1K9MQ 3L74G 5KAFV 1M57D 4BRYA 3Q5PA 1T2KD 1NTMJ 1SQPG 1OVVA 2E5TA 3OW2O 1N15A 2E74D 2KSJA 1S5LX 1AV1A 1JMBA 2ZT9B 1K04A 3KXDA 2IBZG 2AEFA 5AVZB 1OIPA 3GLMA 2WVRA 1J3SA 1BSHA 5H2FH 2HPCB 1OMIA 1M7LA 3B71A 1L4AA 1JDLA 3CD6P 2E75C 2OYHA 1C6SA 2LR2A 3M9BA 3O1YA 1SQXG 2FYZA 1FOCA 3AEEC 1GD2E 1M8OB 4H13D 1BGYG 1L9BC 2JEEA 1FS0E 3NXSA 4BRYB 1CYIA 4C46A 1AA0A 3VMZA 1ZOYC 2IYOA 3SLEA 3V2RA 3C2CA 3CC7P 4AANA 1L2PA 1L0LG 4O9BA 1USDA 1H32B 2BCCJ 1CRIA 451CA 2W8ZA 2O3JA 5KAIH 3D0WA 3RK3C 1PGPA 2YQBA 1CEDA 3PRJA 1HROA 5AW7B 1PZQA 1KFMA 1IZL0 2FYUE 2OYHB 3MD0A 3AEBC 1N9CA 1BCCE 4D6TJ 3EWKA 5KJ7C 2UWJE 1IFMA 1M1KQ 2KS1A 1YIJP 4LJIA 2GC4D 2OYOA 1LNQA 3OCDA 1CW5A 2NPSA 4EYYQ 3WUTA 1S5LE 2OZ1A 4PJ0V 1BDDA 2GIWA 3OA8A 1YQ4C 1MG3D 4O1QA 1BL9A 1NGMB 3ZBMA 1PGQA 1K3GA 3Q5SA 2FYUD 3L72G 3H1JG 1GU5A 3RGUA 4JF7A 1EC5A 1H1OA 1BCCD 1K73Q 3TGUG 1N73A 3RBXA 1LT9C 4OWFA 1BE3G 2GB8B 4UB8V 1M56D 4I1LA 1DT1A 5C0ZA 3OAKA 2XNDH 2GM4A 1GW3A 3E7KA 4H0JA 5APSA 1JMMA 2AXCA 2YKOA 2Y0EA 1S1CX 2PP6A 4W7YA 3CCRP 2KS1B 1GU2A 1NTMK 3S9OA 2FXMA 2WWWA 3OCDB 2K1AA 2NPSB 2XDJA 5APYA 2OZ1B 1KYOE 4FA1A 3OA8B 1DVVA 3H1LG 1HH7A 1I6EA 2JP3A 2Z5IA 1W2BO 1NWQA 1N73B 1NTKJ 1OW8A 3CL3D 4JYBA 5CJ4A 4PD4D 4A7PA 2QRXA 1IK7A 4JPZB 3V2PA 4WQ9A 2B9BA 3CXHE 2R5BA 5GTHV 1X22A 2A45H 1NTME 1CSBA 3KHUA 1URQA 2ZVOB 3L71G 1W5CE 2WSCJ 2ITAA 1FZCB 1KYOD 1L0LE 4UB6E 1LP1A 351CA 3S4RA 1SQBJ 3Q2YA 2KP8A 3WFEC 2MHMA 1HVVA 3NBTA 4KT0J 2OARA 5KLVG 2VHDA 3B5NA 2KB7P 3HUSC 2Q1KA 3M06A 3VP8A 1RE3C 4P4QB 3SWSA 5AVVB 3E1RA 3I5CA 3CXHD 5K5GB 1NTMD 1RF0A 2I8FA 2CPBA 4J20A 2JDIH 2JWAA 3L36A 2Q7CA 4HYTB 3EFFK 1VDFA 3X39A 2FXOA 2QJKC 4WY4A 1M60A 1EDKA 3RN1A 3D70A 1LWUA 1URQB 3CX5W 1GL2D 5AW9B 1GDTA 4L3HA 4GDOA 3HD7C 1LP1B 2WZ7A 3L72E 5AW5B 1FZGA 3USSA 1JM0A 2BCCE 1QN2A 2BASA 1QVFO 3WFCC 3MUDA 3L37A 1L0NJ 2YXRB 1GU4A 2HFED 2OTKE 4XA4A 1S9KE 1Q90D 4K35A 1SFCA 3B5NB 5E79H 1T8ZA 2SPZA 3LIEA 1CXAA 1YIQA 3BCCG 1RY3A 4D6TE 3CP5A 2O1KA 1RZ6A 4DCKA 2H43A 2B10B 2WMMA 1SQVG 3PHLA 2QA4P 1FJ0A 2KZIA 2BCCD 3SWKA 5CHXA 3TYIA 5CCGD 1RF1C 4WY4B 3GHGB 1LWUB 3H1LE 1CIFA 3WFBC 1U57A 1LTJC 3HRNA 1GKSA 2ZT9D 3FXDA 4MU8A 1XTGB 1ZP0C 1FC2C 3SWYA 1J2JB 3VMAA 3TYYA 2OTLP 4D6TD 5EFWB 2CK3H 2A06D 5DJQB 1NTKK 3LIDA 4WQAA 2JR8A 4H44C 3BRTB 1PV3A 1PPJE 1YYCA 5CJ0A 2QSIA 3HQ9A 2AEMA 2FYNB 5KKZC 2M0BA 4IOIH 1J1EB 1VL2A 2ZZS1 5DFSA 4EIDA 3ZIYA 3G4SP 2LITA 1X0TA 1JY2N 1I6DA 1RE4A 3GF3A 1KB9I 1IFNA 1SQBK 4EDFA 4WQDA 2AI5A 5CBOA 3KYQA 1EZVE 1IFIA 3TF5A 3RL0C 1R5LA 4PD4H 4EICA 1K8AQ 1PPJD 1S3JA 2E76B
chains in the Genus database with same CATH topology
3DMIA 1I54A 1KX7A 1CIHA 3ZOXA 1LFMA 3A0BV 4PWAA 4L1QA 2L91A 2C1UA 1CYJA 1VYDA 3PXSA 4EIFA 1FI7A 1H9YA 3A0HV 4FAVA 1CRYA 2BGVX 3FWLA 3O20A 1GDVA 4IL6V 3CWBD 2FRCA 2YCCA 3NBSA 4RJTA 1DW0A 3MK7B 3PTZA 1EZVD 1CSUA 2JQRA 1FCDC 4EIEA 1KB0A 3O5CA 1QKSA 1NU1D 1NTKD 1OAEA 5KKZB 1I8OA 4KMGA 4GEDB 155CA 3VNWA 3A9FA 1M6ZA 1LMSA 2AXTV 4AAMA 1C2RA 4FA5A 2ZBOA 5KAIV 3VRDA 1MZ4A 5KAFV 5CIBB 1IRWA 5C9MA 4N0KA 1CTYA 1AKKA 1I55A 1AOFA 2QJYB 3PXWA 3SJLA 2N3YA 5B6QA 1N15A 2D0SA 2RN0A 2D0WA 3CYTI 3L73D 1CNOA 5EXQA 1J3SA 1NNOA 2CA3B 1NMIA 3L74D 1JDLA 2N18C 1YNRA 1C6SA 1H33A 1E2RA 3O1YA 1R0QA 1CORA 1SQPD 4DY9A 1WVEC 1FOCA 1W2LA 2V07A 1K3HA 1HZVA 1L9BC 5AURA 3ORVA 1HCMA 2C1VA 1C75A 2IBZD 1CYIA 3SLEA 2CE0A 3C2CA 3O0RC 1E29A 1L0ND 3ITKA 2YK3A 1I5TA 1DW1A 4QAOA 4AANA 1H31A 1H32B 1CRIA 451CA 2K9JB 2O3JA 1YICA 3CXHW 4FA4A 2YQBA 1CEDA 3PRJA 1HROA 1BGYD 1LC2A 1IZL0 3ZOYA 1ZRTD 3HQ7A 1N9CA 3WU2V 1H33B 1CSVA 4XXLA 4WQBA 2Q3EA 2C8SA 2N18B 2KS1A 1L0LD 3KZIV 4LJIA 2GC4D 3OCDA 3NWVA 4NFGB 4WQCA 5B5EV 2OZ1A 3M97X 1S5LV 2BPBB 4PJ0V 2GIWA 3OA8A 1N50A 1MG3D 4O1QA 1KIBA 1CRGA 1BL9A 5B66V 1H31B 2CE1A 2GC7D 2N3BA 3ZBMA 1K3GA 2FYUD 1CRHA 2MTAC 1H1OA 1BCCD 1LC1A 3H1ID 3HQ6A 1CHHA 2ZONG 2PCBB 3GG2A 1I8PA 1DIIC 2GB8B 4UB8V 2RMZA 1U75B 1QL4A 1DT1A 1CHIA 5C0ZA 3RN0A 1SQBD 4FB1A 4H0JA 1DW3A 1LS9A 2Y0EA 1N90A 4GYDA 1CSWA 1B7VA 1GU2A 1YEAA 1C2NA 1NMLA 5CIDB 3L72D 3H1JD 1YCCA 3PXTA 3OCDB 1OCDA 3TGUD 1EB7A 1YEBA 2OZ1B 1COTA 1A2SA 1BE3D 2B4ZA 4FA1A 3OA8B 1DVVA 1A8CA 1CTJA 1HJ4A 3L4OA 1HH7A 2DVHA 5DF5A 1I6EA 1KB9D 1YFCA 3ZCFA 3PLNA 1MG2D 2PCCB 1P84D 1HRCA 4PD4D 2LIRA 3L70D 1A56A 1KYOW 4A7PA 5E79V 1W5CT 4WQ9A 1CIGA 1C6OA 5CIEB 1AOQA 3TDKA 5GTHV 2V08A 2BH5X 2B12B 3KHUA 3PH2B 4WQEA 2ZOOA 1KYOD 3ZOOA 4UB6V 1CSXA 3H1LD 351CA 2YIUB 2QJPB 5IY51 3WFEC 2C1DA 2MHMA 3NBTA 1C7MA 1CTZA 1CRJA 2VHDA 5CIHB 4K3IA 2PACA 2C2CA 3HQ8A 5CIGB 2DGEA 2Y0DA 4P4QB 3SWSA 4YE1A 1L9JC 3CXHD 3GW6A 1ZZHA 1HJ3A 1NTMD 1S6VB 2BH4X 3DP5A 3L71D 2I8FA 5H2FV 2N9YB 4J20A 5CYTR 4AALA 2EXVA 2JWAA 3ZOWA 1FI3A 1FI9A 2N9JA 2JTIB 3DR0A 3X39A 3H1KD 1M60A 5CICB 3RN1A 4Q5PA 1QL3A 3CX5W 1CCHA 5KLVD 4L3HA 3SXTA 1C52A 1CXCA 1GJQA 4FANA 1DIQC 1RAQA 4WQ8A 4V2KA 2BLFB 4L3GA 1QN2A 5CIFB 3WFCC 1GIWA 5DJQC 2C1DB 1HJ5A 1FHBA 3CX5D 2HV4A 1CO6A 4AX3A 1NTZD 1CRCA 5TISV 2ZXYA 1CXAA 1YIQA 2CA4B 3CP5A 1GQ1A 1KV9A 1RZ6A 3L75D 2B10B 3CU4A 2KNCB 1RAPA 3PHLA 2Y0CA 1FJ0A 1CCRA 2BCCD 3TYIA 5TJHA 1CIFA 3WFBC 4WQ7A 3H1HD 3JBTB 3WUIA 1GKSA 3L4MA 1CHJA 3SVWA 2QJKB 1U74B 1H32A 4MU8A 4O1WA 3WFDC 1AYGA 3VMAA 3BCCD 2XTSB 2N9IA 4PW9B 4D6TD 4XYDB 2ORLA 1SQQD 1SQVD 2A06D 3RLMA 2L4DA 2CXBA 1DW2A 5DJQB 1PP9D 4JCGA 1H9XA 1IQCA 2B0ZB 4WQAA 1IRVA 3MK7C 2B11B 1DVHA 1YTCA 4AAOA 1ETPA 3HQ9A 1NIRA 3RMZA 5KLIB 1WEJF 2FWLA 2FYNB 1CIEA 4H0KA 1CC5A 2QG4A 2ZZS1 5DFSA 4EIDA 3ZIYA 1KX2A 2LITA 3VYMA 1I6DA 1IO3A 1CYCA 4U3FD 3WC8A 2AIUA 4Y5RA 4EDFA 2BCNB 1F1FA 1QYZA 1HZUA 4WQDA 1C6RA 2AI5A 1E8EA 3TF5A 4RSZA 4FA9A 1RZ5A 1SQXD 4EICA 5GTIV 1M70A 1PPJD 2C9XB 1F1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMI A;  1I54 A;  1KX7 A;  1CIH A;  3ZOX A;  1LFM A;  3A0B V;  4PWA A;  4L1Q A;  2L91 A;  2C1U A;  1CYJ A;  1VYD A;  3PXS A;  4EIF A;  1FI7 A;  1H9Y A;  3A0H V;  4FAV A;  1CRY A;  2BGV X;  3FWL A;  3O20 A;  1GDV A;  4IL6 V;  3CWB D;  2FRC A;  2YCC A;  3NBS A;  4RJT A;  1DW0 A;  3MK7 B;  3PTZ A;  1EZV D;  1CSU A;  2JQR A;  1FCD C;  4EIE A;  1KB0 A;  3O5C A;  1QKS A;  1NU1 D;  1NTK D;  1OAE A;  5KKZ B;  1I8O A;  4KMG A;  4GED B;  155C A;  3VNW A;  3A9F A;  1M6Z A;  1LMS A;  2AXT V;  4AAM A;  1C2R A;  4FA5 A;  2ZBO A;  5KAI V;  3VRD A;  1MZ4 A;  5KAF V;  5CIB B;  1IRW A;  5C9M A;  4N0K A;  1CTY A;  1AKK A;  1I55 A;  1AOF A;  2QJY B;  3PXW A;  3SJL A;  2N3Y A;  5B6Q A;  1N15 A;  2D0S A;  2RN0 A;  2D0W A;  3CYT I;  3L73 D;  1CNO A;  5EXQ A;  1J3S A;  1NNO A;  2CA3 B;  1NMI A;  3L74 D;  1JDL A;  2N18 C;  1YNR A;  1C6S A;  1H33 A;  1E2R A;  3O1Y A;  1R0Q A;  1COR A;  1SQP D;  4DY9 A;  1WVE C;  1FOC A;  1W2L A;  2V07 A;  1K3H A;  1HZV A;  1L9B C;  5AUR A;  3ORV A;  1HCM A;  2C1V A;  1C75 A;  2IBZ D;  1CYI A;  3SLE A;  2CE0 A;  3C2C A;  3O0R C;  1E29 A;  1L0N D;  3ITK A;  2YK3 A;  1I5T A;  1DW1 A;  4QAO A;  4AAN A;  1H31 A;  1H32 B;  1CRI A;  451C A;  2K9J B;  2O3J A;  1YIC A;  3CXH W;  4FA4 A;  2YQB A;  1CED A;  3PRJ A;  1HRO A;  1BGY D;  1LC2 A;  1IZL 0;  3ZOY A;  1ZRT D;  3HQ7 A;  1N9C A;  3WU2 V;  1H33 B;  1CSV A;  4XXL A;  4WQB A;  2Q3E A;  2C8S A;  2N18 B;  2KS1 A;  1L0L D;  3KZI V;  4LJI A;  2GC4 D;  3OCD A;  3NWV A;  4NFG B;  4WQC A;  5B5E V;  2OZ1 A;  3M97 X;  1S5L V;  2BPB B;  4PJ0 V;  2GIW A;  3OA8 A;  1N50 A;  1MG3 D;  4O1Q A;  1KIB A;  1CRG A;  1BL9 A;  5B66 V;  1H31 B;  2CE1 A;  2GC7 D;  2N3B A;  3ZBM A;  1K3G A;  2FYU D;  1CRH A;  2MTA C;  1H1O A;  1BCC D;  1LC1 A;  3H1I D;  3HQ6 A;  1CHH A;  2ZON G;  2PCB B;  3GG2 A;  1I8P A;  1DII C;  2GB8 B;  4UB8 V;  2RMZ A;  1U75 B;  1QL4 A;  1DT1 A;  1CHI A;  5C0Z A;  3RN0 A;  1SQB D;  4FB1 A;  4H0J A;  1DW3 A;  1LS9 A;  2Y0E A;  1N90 A;  4GYD A;  1CSW A;  1B7V A;  1GU2 A;  1YEA A;  1C2N A;  1NML A;  5CID B;  3L72 D;  3H1J D;  1YCC A;  3PXT A;  3OCD B;  1OCD A;  3TGU D;  1EB7 A;  1YEB A;  2OZ1 B;  1COT A;  1A2S A;  1BE3 D;  2B4Z A;  4FA1 A;  3OA8 B;  1DVV A;  1A8C A;  1CTJ A;  1HJ4 A;  3L4O A;  1HH7 A;  2DVH A;  5DF5 A;  1I6E A;  1KB9 D;  1YFC A;  3ZCF A;  3PLN A;  1MG2 D;  2PCC B;  1P84 D;  1HRC A;  4PD4 D;  2LIR A;  3L70 D;  1A56 A;  1KYO W;  4A7P A;  5E79 V;  1W5C T;  4WQ9 A;  1CIG A;  1C6O A;  5CIE B;  1AOQ A;  3TDK A;  5GTH V;  2V08 A;  2BH5 X;  2B12 B;  3KHU A;  3PH2 B;  4WQE A;  2ZOO A;  1KYO D;  3ZOO A;  4UB6 V;  1CSX A;  3H1L D;  351C A;  2YIU B;  2QJP B;  5IY5 1;  3WFE C;  2C1D A;  2MHM A;  3NBT A;  1C7M A;  1CTZ A;  1CRJ A;  2VHD A;  5CIH B;  4K3I A;  2PAC A;  2C2C A;  3HQ8 A;  5CIG B;  2DGE A;  2Y0D A;  4P4Q B;  3SWS A;  4YE1 A;  1L9J C;  3CXH D;  3GW6 A;  1ZZH A;  1HJ3 A;  1NTM D;  1S6V B;  2BH4 X;  3DP5 A;  3L71 D;  2I8F A;  5H2F V;  2N9Y B;  4J20 A;  5CYT R;  4AAL A;  2EXV A;  2JWA A;  3ZOW A;  1FI3 A;  1FI9 A;  2N9J A;  2JTI B;  3DR0 A;  3X39 A;  3H1K D;  1M60 A;  5CIC B;  3RN1 A;  4Q5P A;  1QL3 A;  3CX5 W;  1CCH A;  5KLV D;  4L3H A;  3SXT A;  1C52 A;  1CXC A;  1GJQ A;  4FAN A;  1DIQ C;  1RAQ A;  4WQ8 A;  4V2K A;  2BLF B;  4L3G A;  1QN2 A;  5CIF B;  3WFC C;  1GIW A;  5DJQ C;  2C1D B;  1HJ5 A;  1FHB A;  3CX5 D;  2HV4 A;  1CO6 A;  4AX3 A;  1NTZ D;  1CRC A;  5TIS V;  2ZXY A;  1CXA A;  1YIQ A;  2CA4 B;  3CP5 A;  1GQ1 A;  1KV9 A;  1RZ6 A;  3L75 D;  2B10 B;  3CU4 A;  2KNC B;  1RAP A;  3PHL A;  2Y0C A;  1FJ0 A;  1CCR A;  2BCC D;  3TYI A;  5TJH A;  1CIF A;  3WFB C;  4WQ7 A;  3H1H D;  3JBT B;  3WUI A;  1GKS A;  3L4M A;  1CHJ A;  3SVW A;  2QJK B;  1U74 B;  1H32 A;  4MU8 A;  4O1W A;  3WFD C;  1AYG A;  3VMA A;  3BCC D;  2XTS B;  2N9I A;  4PW9 B;  4D6T D;  4XYD B;  2ORL A;  1SQQ D;  1SQV D;  2A06 D;  3RLM A;  2L4D A;  2CXB A;  1DW2 A;  5DJQ B;  1PP9 D;  4JCG A;  1H9X A;  1IQC A;  2B0Z B;  4WQA A;  1IRV A;  3MK7 C;  2B11 B;  1DVH A;  1YTC A;  4AAO A;  1ETP A;  3HQ9 A;  1NIR A;  3RMZ A;  5KLI B;  1WEJ F;  2FWL A;  2FYN B;  1CIE A;  4H0K A;  1CC5 A;  2QG4 A;  2ZZS 1;  5DFS A;  4EID A;  3ZIY A;  1KX2 A;  2LIT A;  3VYM A;  1I6D A;  1IO3 A;  1CYC A;  4U3F D;  3WC8 A;  2AIU A;  4Y5R A;  4EDF A;  2BCN B;  1F1F A;  1QYZ A;  1HZU A;  4WQD A;  1C6R A;  2AI5 A;  1E8E A;  3TF5 A;  4RSZ A;  4FA9 A;  1RZ5 A;  1SQX D;  4EIC A;  5GTI V;  1M70 A;  1PPJ D;  2C9X B;  1F1C A; 
#chains in the Genus database with same CATH topology
 1NU1 G;  1CIH A;  1EDL A;  3ZOX A;  3A0B V;  2M3B A;  2OYI A;  2Q9I A;  2L91 A;  2I8D A;  4MN4 C;  3A0H E;  1FI7 A;  1VF5 B;  3AEA C;  1KV4 A;  3FWL A;  1K05 A;  4IL6 V;  2K37 A;  3AED C;  4OH8 B;  3WUU A;  3AEG C;  3MK7 B;  3CCS P;  1EZV D;  5C39 A;  1FCD C;  1KB0 A;  3H1H E;  2A45 G;  1NTK D;  3Q5R A;  4Y28 J;  1N7S A;  2C9N Y;  4M3L A;  3B4S A;  4GED B;  2LXB A;  1L0N K;  1IFJ A;  2GUS A;  2ZJS E;  3MHV A;  1XTC C;  3V2N A;  2N1T A;  1WT6 A;  4DZO A;  1YJN P;  1IO4 A;  2AXT V;  4AAM A;  5KAI E;  1JTH A;  1QL1 A;  4UB6 H;  2ZBO A;  3VP9 A;  1SS1 A;  1NH4 A;  1IRW A;  2OYI B;  5C9M A;  3WMM 0;  1AOF A;  2QJY B;  2YMY A;  1JB0 J;  1YTZ I;  4H0L C;  2N3Y A;  3R4Y A;  2P7J A;  1SP4 A;  2YO3 A;  1H8A A;  3CX5 I;  3D71 A;  4JBZ A;  1CNO A;  3H1K J;  5EXQ A;  2R32 A;  5GTI H;  2K9J A;  1L0N E;  3RK2 B;  4R4M A;  3TNU B;  1NMI A;  2NPS D;  3JCU H;  1N7S B;  2N18 C;  1E2R A;  1R0Q A;  2R3S A;  2KLV A;  2FFD C;  1W2L A;  1JTH B;  1NTZ J;  5CMZ A;  1HZV A;  4TT3 H;  2QE7 H;  2P1J A;  2OQQ A;  1VQ5 P;  1M1J B;  1E29 A;  1L0N D;  3M0A A;  4QAO A;  1H31 A;  5CBN A;  3P7K A;  1T2K C;  1VQL P;  2K9J B;  2KI7 B;  3CXH W;  2KXP B;  3O8Z A;  1QLE D;  1DX7 A;  2E74 C;  3D6Y A;  1CZQ A;  4QMA A;  1LC2 A;  3OA7 A;  2KZJ A;  3U1A A;  2FYU G;  3WU2 V;  2KLU A;  5DJU B;  1CSV A;  4XXL A;  1BCC G;  1MFT A;  1SQQ J;  2C8S A;  4RES B;  4GT1 A;  3GHG C;  2ZXE B;  1E79 H;  4I2L C;  3KZI V;  3TSI A;  4WQC A;  5B5E V;  1Q2N A;  3M97 X;  4YTP C;  1URQ D;  4H13 C;  5B66 V;  1H31 B;  2GC7 D;  1ZME C;  2MTA C;  4WBA A;  2P58 A;  2ZON G;  4Y99 B;  3B5N D;  1YJW P;  1CHI A;  3S1K A;  1SQX J;  2YIU C;  2QJP C;  1VQ6 P;  2MKV A;  1J1E C;  1HH0 A;  4ZKU A;  3IR9 A;  5AW2 B;  1VQ8 P;  4R4L A;  1CSW A;  1C2N A;  1FZE A;  5CID B;  5APX A;  4RKU J;  1OCD A;  1FZF A;  2GA1 A;  4WY4 D;  1X9V A;  1COT A;  3CWB J;  2WIT A;  1FAV A;  1CTJ A;  4L73 A;  4I7Z C;  2DVH A;  2ZYA A;  3A0H H;  4ZNC A;  3VTP C;  1A02 J;  2WSC H;  1HRC A;  4EIJ A;  3VMY A;  2LIR A;  1KQL A;  3U59 A;  1A56 A;  1MV8 A;  3CCE P;  5E79 E;  3F5H A;  5CIE B;  4GOD A;  2V08 A;  1NTZ K;  1BDC A;  1NTM G;  1PFI A;  3PH2 B;  3SSU A;  3M9Q A;  2H88 C;  2IX7 C;  1HTL C;  1FOS F;  1KMI Z;  5AW8 B;  2K3R A;  1L4A B;  1S72 P;  4UB8 H;  2KK7 A;  5CIH B;  3TK1 A;  2HOD A;  3L73 J;  2P2U A;  2RH0 A;  3GW6 A;  1AJY A;  2IBZ I;  2NZ2 A;  1NOH A;  5H2F V;  2N9Y B;  1BE3 J;  2E76 D;  1QEX A;  4N6J A;  4WVZ A;  1FI9 A;  1FOS E;  4LC1 A;  1AVY A;  1SQQ K;  1IFD A;  2M8R A;  2JTI B;  1KYO I;  3H1K D;  4HH2 A;  2XZR A;  2J59 M;  3C8V A;  1VF5 D;  2B89 A;  3SXT A;  2K9Y A;  3RK2 C;  4YPC A;  1GJQ A;  4NPD A;  4W80 A;  4V2K A;  3V4W A;  4PV1 B;  1JUN A;  5CIF B;  1DEE G;  2BCC G;  1ZR4 A;  5BU8 B;  2M3E A;  3CXH I;  1NTZ D;  1CRC A;  3T97 A;  4LLH A;  5KLI C;  5TIS V;  4I6M C;  2KSE A;  2WQY C;  4PD4 E;  1GQ1 A;  5CCH A;  3CME P;  1SQQ E;  4D6T G;  3H32 A;  1KV9 A;  1SQX K;  2A06 G;  1EDI A;  3VYI A;  1QX8 A;  2RKL A;  1GMJ A;  3P32 A;  3NTN A;  3U1C A;  3EQ2 A;  5AVW B;  2I1K A;  1NVO A;  1HGZ A;  1KC8 Q;  2I1J A;  4WQ7 A;  3L4M A;  1U74 B;  3KPE A;  1IFP A;  3IAO A;  3KDP B;  1PGJ A;  4XYD B;  3RK2 D;  5KLV J;  1SQQ D;  1GL2 C;  1MZ9 A;  3NFQ A;  2CXB A;  1N7S D;  2XV5 A;  3T97 B;  1JNM A;  3SFD C;  1H9X A;  1KD1 Q;  1IQC A;  2B0Z B;  3H1I J;  1NAF A;  1A02 F;  1RQU A;  1HJ0 A;  1PPJ G;  1YTC A;  3H32 B;  1NIR A;  3BVH A;  3P8C E;  2FWL A;  1Q81 Q;  2R5D A;  1JY3 N;  1OVU A;  1ZXG A;  3IFM A;  3W67 A;  4DJG A;  4OGQ B;  2WPQ A;  4AYC A;  3VYM A;  3CWB E;  1S4X A;  1JY2 P;  2BCN B;  1F1F A;  2IFN A;  1P84 I;  1C6R A;  1JCD A;  1AQ5 A;  1EZV G;  1SQX D;  1TU3 F;  5CCG C;  5GTI E;  2C9X B;  3M0D C;  2Q3I A;  1F1C A;  3DMI A;  1NTK G;  2YXQ B;  3JCU E;  3P8C D;  3AE9 C;  2ZT9 C;  2C1U A;  4AUW A;  1CYJ A;  3PXS A;  4EIF A;  1LTA C;  3BCC J;  2BGV X;  3L70 J;  1SVF A;  1KIL A;  1SQV J;  3CWB D;  2ZXX A;  3ABV C;  3NBS A;  1FDO A;  3FGA D;  2O1J A;  1VQM P;  1CSU A;  1YQ3 C;  4DT0 A;  3O5C A;  1QKS A;  3H1H G;  1I8O A;  2IZ1 A;  2O01 N;  3FX0 A;  1ZN5 A;  1M6Z A;  2A06 E;  4FA5 A;  3VRD A;  1FJP A;  4WB4 A;  5CIB B;  2WT7 A;  2H89 C;  1CTY A;  2BEZ F;  2D2C B;  2QM8 A;  3F89 A;  1NYH A;  2CPS A;  1HJB A;  5B6Q A;  2V7Q J;  2D0S A;  1KIL B;  2WPR A;  5AVQ B;  1EZV I;  1W2E A;  1E5W A;  3CYT I;  3RBZ A;  3L73 D;  2OYH C;  3CC2 P;  4KJM A;  5APQ A;  3HE4 A;  2OGU A;  1L0N G;  3CCU P;  1SFC B;  1YIT P;  1H33 A;  5KLV K;  3H25 A;  1COR A;  4DY9 A;  1NKZ B;  3L4F A;  2OTJ P;  2KYV A;  5AUR A;  3ORV A;  1ZRT E;  5L8R J;  1NO4 A;  2WT7 B;  1J1D B;  1VQ4 P;  3MIW A;  5APU A;  2CE0 A;  1OZH A;  3G9R A;  3L75 J;  1EXJ A;  2YK3 A;  1I5T A;  3AEF C;  3W68 A;  3KQG A;  2HR3 A;  2AXT H;  1NTK E;  1N86 A;  5AW1 B;  4HKZ H;  3V5B A;  4FA4 A;  1L4A D;  2J58 A;  5APT A;  1T3J A;  2ZYD A;  1FU1 A;  1ZRT D;  3HQ7 A;  4WWI A;  1IC2 A;  2ZYG A;  1H33 B;  5AVY B;  4WQB A;  3VN0 A;  3H1I E;  1U7J A;  2Q3E A;  2NPS C;  1CI6 A;  2E75 B;  1OXZ A;  2E42 A;  1SQB E;  1PP9 J;  2DW3 A;  2R44 A;  3HTK A;  1FZB A;  3II6 A;  1VQP P;  5KJ7 A;  3V6I A;  2LXC B;  1JCC A;  2YKQ A;  4C7N A;  2MJZ A;  4PJ0 E;  1S5L V;  1N73 C;  1GK4 A;  1VQO P;  1OVR A;  5AVS B;  1KIB A;  2N3B A;  4PV1 D;  1LC1 A;  3AE4 C;  2Y9Z A;  3H1I D;  4U3F J;  3HQ6 A;  1CHH A;  3MZW B;  4UB8 E;  1I8P A;  1DII C;  2RMZ A;  1FZC C;  3AE7 C;  3RL0 g;  3RN0 A;  1SQB D;  2ZAE B;  2H7H A;  1LT9 A;  1DW3 A;  3RK3 B;  1FJK A;  4W7Z A;  4GOE A;  1LS9 A;  2K88 A;  3MTU E;  1Q7Y Q;  3HE5 A;  3L70 E;  1N90 A;  4GYD A;  1CI6 B;  4OGQ C;  1B7V A;  1YEA A;  1JY2 O;  1IJD B;  2ZFC A;  1YEB A;  4C7N B;  1OW6 A;  4Z1M H;  1A2S A;  1OX3 A;  1A8C A;  2PAJ A;  3WU2 H;  1KB9 D;  1YFC A;  2N1T B;  3ZCF A;  3PLN A;  2PCC B;  3L70 D;  1URQ C;  1OFC X;  2WSE J;  1KYO W;  2A45 I;  2FYU J;  1CIG A;  1GZL A;  2W6A A;  1C6O A;  5GTH E;  3TDK A;  3V2Q A;  2C9L Y;  1LT9 B;  2BH5 X;  1KQF B;  3HE5 B;  2ZOO A;  5CCH D;  1LTG C;  1DEB A;  4UB6 V;  1CSX A;  3AE3 C;  3B5N C;  3MGN A;  2C1D A;  3H1K G;  3VMX A;  3FWN A;  1C7M A;  1CTZ A;  3C9I A;  5KAF H;  4OGQ D;  1Q82 Q;  4K3A A;  1RF0 C;  2PAC A;  2C2C A;  3HQ8 A;  5CIG B;  2DGE A;  2Y0D A;  3LW5 J;  4YE1 A;  3CX5 E;  3M91 A;  2C0W A;  3A7O A;  1HJ3 A;  3DP5 A;  3L74 J;  3HUS A;  4WY4 C;  4AAL A;  2M5A A;  1LWU C;  1RE3 A;  2KNC A;  3FXE A;  2EXV A;  1NTZ G;  3ZOW A;  1JO5 A;  2VRS A;  2N9J A;  1SQP J;  1LGH B;  5AVT B;  3DR0 A;  3UIA A;  5CIC B;  3M0D A;  4Q5P A;  1AQT A;  3MUD C;  1QL3 A;  2YO2 A;  3L75 E;  2O01 J;  5AW6 B;  1SLQ A;  1LTI C;  2V4H A;  4BXL A;  1RAQ A;  1SFC C;  4WQ8 A;  2YNY A;  4L3G A;  5DJQ C;  2C1D B;  1YJ9 P;  3CX5 D;  2W27 A;  4AX3 A;  3HD7 A;  1KIL E;  1GTW A;  3GF7 A;  1WRG A;  2ZXY A;  5M1B A;  2FYN C;  1FZA A;  3E1I A;  3NMD A;  3CI9 A;  3HUS B;  1FDI A;  4TLF A;  1SQQ G;  3L75 D;  1BGY J;  2M5A B;  3CU4 A;  1LTS C;  2KNC B;  4IL6 X;  4KHX A;  3C1L A;  1N8R Q;  2Y0C A;  1PP9 E;  2WTY A;  1CCR A;  3CPW O;  2IZ0 A;  5TJH A;  1U7M A;  2D2C D;  2L5G B;  3OJA B;  2E76 C;  1QVG O;  1IK9 A;  1L0L J;  2R3C A;  2W6J H;  1KIL D;  4YXD C;  2QJK B;  1RF1 A;  1H32 A;  1KN7 A;  4O1W A;  2WPV B;  2XTS B;  1HF9 A;  2N9I A;  2P67 A;  3AE5 C;  4U3F E;  1LTJ A;  3HD7 B;  2ORL A;  1VF5 C;  1EQ7 A;  1SFC D;  3RLM A;  1LT1 A;  2Z5H A;  4ZKP A;  1PP9 D;  2G3A A;  4PJ0 H;  3MK7 C;  2FYU K;  1HGV A;  3RMZ A;  1RE4 C;  1WEJ F;  3CCL P;  1VQN P;  2XNX A;  1CIE A;  1YTZ T;  3H1K E;  4H0K A;  2QG4 A;  1JEK A;  1KX2 A;  1JY3 P;  2NRG A;  4AQR D;  4U3F D;  3WC8 A;  2BEQ D;  1FBM A;  1Y9B A;  1Y47 A;  2AIU A;  4XFJ A;  1KQS O;  1KB9 H;  3CWB G;  5TIS H;  2WSS H;  3L72 J;  3H1J J;  2JKV A;  1RF1 B;  4PD4 I;  2OYI C;  3TGU J;  4FA9 A;  3WUV A;  1VQ9 P;  2QJY C;  3O6Q A;  4EI2 A;  4N78 E;  1RHZ B;  1LTJ B;  1NTZ E;  2G8Y A;  3A0B E;  1LFM A;  4PWA A;  4RO0 A;  1YHQ P;  4YXW H;  4L1Q A;  1KFN A;  3BAT A;  2WSF J;  1H9Y A;  3A0H V;  1CRY A;  3O20 A;  2W90 A;  4IL6 E;  2KOG A;  2E75 D;  1SQP K;  2FRC A;  2YCC A;  1N7S C;  4RJT A;  4H44 B;  1DH3 A;  2YKP A;  1R5S A;  2IDB A;  2JQR A;  3RK3 E;  4EIE A;  3SWF A;  2N1T C;  1UIX A;  1OAE A;  4N78 D;  1LTB C;  5KKZ B;  3BAS A;  4KMG A;  3H1L J;  2HOD B;  5GTH H;  3IF4 A;  3L73 G;  3VNW A;  2B87 A;  4ZMD A;  1H0T A;  4GIF A;  2AXT E;  3O6Q B;  2V7Q H;  2FKW B;  3L74 E;  1C2R A;  1LJ2 A;  3G3Z A;  5KAI V;  1M1J C;  1MZ4 A;  1G1J A;  2QVA A;  4N0K A;  3RL0 B;  1Z56 A;  1AKK A;  1I55 A;  1SQP E;  4GOF A;  3PXW A;  1ZR2 A;  3L71 J;  3A5T A;  3SJL A;  4C7R A;  1PIX A;  2P10 A;  5APV A;  3RK3 D;  1VPC A;  2WPS A;  1FZC A;  2RN0 A;  2IBZ E;  2D0W A;  1IZN B;  3CX5 H;  2W6B A;  1NNO A;  2CA3 B;  1L0L K;  5KJ7 D;  1OWA A;  3G6E P;  2PGD A;  3L74 D;  1N2D C;  4L75 A;  1YNR A;  3M9H A;  1SQX E;  2B87 B;  1H0T B;  1SQP D;  1WVE C;  2N1T D;  2V07 A;  1K3H A;  1BGY E;  1PGO A;  3N7N A;  3I56 P;  3A2A A;  4XE5 B;  1HCM A;  2C1V A;  1C75 A;  2IBZ D;  1X79 B;  1ZW0 A;  2FFD A;  1NKN A;  2QEX P;  3O0R C;  3ITK A;  2IFM A;  1DW1 A;  1BSN A;  4Y99 C;  4JQ0 D;  2AEJ A;  4H0L B;  1YIC A;  1Q86 Q;  3H1H J;  2POH A;  1BGY D;  1T6A A;  3ZOY A;  1DIP A;  3WU2 E;  3AE1 C;  1KQG B;  3JC2 2;  3JSV C;  3H1I G;  1WMK A;  3PH0 A;  2N18 B;  5AVR B;  1H88 A;  3KZI E;  1L0L D;  3P8M C;  2Q5U A;  5BVZ A;  5APW A;  5BU5 A;  3G71 P;  4B86 A;  1SQB G;  2FFD B;  3NWV A;  1YBK A;  4NFG B;  3I55 P;  5B5E E;  1KTM A;  3GHG A;  3CCQ P;  3EFG A;  2BPB B;  2HLO A;  1N50 A;  3AE2 C;  5B66 E;  3CCV P;  3L73 E;  1CRG A;  4NPE A;  2CE1 A;  3H1J E;  5KTB A;  1CRH A;  2Q6Q A;  3TGU E;  5AW3 B;  1QGK B;  3MP7 B;  2ZVN B;  3N4X A;  1BE3 E;  2YMK A;  3Q1M A;  3CC4 P;  5KAF E;  2PCB B;  3GG2 A;  1PL5 A;  1U75 B;  1EXI A;  1QL4 A;  4ASV A;  4FB1 A;  1P84 E;  3B8E B;  2E74 B;  1JY3 O;  1NJI Q;  1AFO A;  1L4A C;  3L70 G;  3CMA P;  1NML A;  3VOP A;  4HJG H;  3L72 D;  3H1J D;  1YCC A;  3PXT A;  4HB1 A;  3TGU D;  1EB7 A;  3A0B H;  1BE3 D;  2WSE H;  2XU6 A;  2B4Z A;  1S9K D;  1HJ4 A;  3L4O A;  2GUV A;  5DF5 A;  1MG2 D;  4IL6 H;  1NU1 J;  1P84 D;  3ZDM A;  4H13 B;  3HD7 D;  1UII A;  5E79 V;  1W5C T;  2B88 A;  3H6P A;  1Y8A A;  2E43 A;  4PV1 C;  1M90 Q;  4JYC A;  1JOC A;  3L71 E;  2HYN A;  2B12 B;  3A3Y B;  1S5L H;  3AEC C;  1EDJ A;  1MFZ A;  4IFD K;  4WQE A;  3D6Z A;  3ZOO A;  3K5B A;  3LW5 H;  3H1L D;  2YIU B;  2QJP B;  5IY5 1;  3SFE C;  3HE4 B;  4L76 A;  5KLV E;  1CRJ A;  2JJL A;  1N7L A;  4K3I A;  3L35 A;  2E5Y A;  1T3U A;  1L9J C;  1ZZH A;  4EOT A;  2O01 H;  2BH4 X;  1S6V B;  1KOR A;  3L71 D;  5H2F E;  5CYT R;  3QH9 A;  2C0X A;  4I7Z B;  1FI3 A;  1FE6 A;  1KZU B;  1SQV K;  4IFM A;  1S2E A;  2N9B A;  2Y9Y A;  1KYO H;  1RH5 B;  1CCH A;  2PFX A;  5KLV D;  3L75 G;  2IYP A;  1C52 A;  1CXC A;  4FAN A;  1DIQ C;  2BLF B;  4LGD E;  2JO1 A;  4H44 D;  2Z4E A;  1GIW A;  1R8E A;  1HJ5 A;  1FHB A;  2HV4 A;  3TNU A;  1CO6 A;  1HUC A;  2W83 C;  5CCH C;  1ZV8 A;  1VQK P;  1KB9 E;  5TIS E;  3CXH H;  1H89 A;  2J5U A;  3BCC E;  2JWD A;  4GKG A;  4OVN F;  2CA4 B;  1X8Y A;  4ASW A;  1MKM A;  1SQV E;  3R2P A;  2QIW A;  1RAP A;  3AE6 C;  3HTK B;  1LTT C;  1AVO A;  1PP9 G;  3PJS K;  3RL0 D;  2H8P D;  1M1J A;  5AVU B;  1NHL A;  5AVX B;  3H1H D;  3JBT B;  3WUI A;  1CHJ A;  3SVW A;  1YI2 P;  3WFD C;  1AYG A;  1HWT C;  3BCC D;  4PW9 B;  2KIK A;  1QL2 A;  4U3F G;  3KZI H;  1SQV D;  2L4D A;  4DOJ A;  1DW2 A;  5AW0 B;  1NU1 K;  4JCG A;  1BCC J;  3AE8 C;  5B5E H;  2LKM A;  1IRV A;  1VQ7 P;  1GL2 A;  2B11 B;  1DVH A;  4AAO A;  1ETP A;  5B66 H;  4IFF A;  5DJT B;  5KLI B;  2FXP A;  1DD3 A;  1CC5 A;  5AW4 B;  1G1I A;  4L74 A;  1DD4 A;  4CPG A;  3IN6 A;  1IO3 A;  1CYC A;  4Y5R A;  2QM7 A;  3V4Q A;  1QYZ A;  1HZU A;  1MUU A;  1USE A;  1E8E A;  1P84 H;  2WSF H;  4RSZ A;  1RZ5 A;  1G2C A;  3PP5 A;  4H0L D;  2XKM A;  1ZLL A;  4NPF X;  5GTI V;  3BRV B;  1NU1 E;  1M70 A;  1NAY A;  1AOQ A;  2D2C C;  1I54 A;  1KX7 A;  1D7M A;  1KIL C;  3Q3D A;  5CCG A;  1VYD A;  1HBW A;  4BWN A;  1GL2 B;  4FAV A;  1GK6 A;  1GDV A;  2KUB A;  4U7J A;  3QWO C;  3GMA A;  2FBW C;  1DW0 A;  3PTZ A;  2HG5 D;  2HPC A;  3CCM P;  2FY8 A;  1FDM A;  2PRR A;  1NU1 D;  1RQV A;  2IPP A;  3CLQ A;  1GW4 A;  3CCJ P;  1OW7 A;  155C A;  1J1D C;  1G2C B;  3A9F A;  1LMS A;  4N3Y B;  1K9M Q;  3L74 G;  5KAF V;  1M57 D;  4BRY A;  3Q5P A;  1T2K D;  1NTM J;  1SQP G;  1OVV A;  2E5T A;  3OW2 O;  1N15 A;  2E74 D;  2KSJ A;  1S5L X;  1AV1 A;  1JMB A;  2ZT9 B;  1K04 A;  3KXD A;  2IBZ G;  2AEF A;  5AVZ B;  1OIP A;  3GLM A;  2WVR A;  1J3S A;  1BSH A;  5H2F H;  2HPC B;  1OMI A;  1M7L A;  3B71 A;  1L4A A;  1JDL A;  3CD6 P;  2E75 C;  2OYH A;  1C6S A;  2LR2 A;  3M9B A;  3O1Y A;  1SQX G;  2FYZ A;  1FOC A;  3AEE C;  1GD2 E;  1M8O B;  4H13 D;  1BGY G;  1L9B C;  2JEE A;  1FS0 E;  3NXS A;  4BRY B;  1CYI A;  4C46 A;  1AA0 A;  3VMZ A;  1ZOY C;  2IYO A;  3SLE A;  3V2R A;  3C2C A;  3CC7 P;  4AAN A;  1L2P A;  1L0L G;  4O9B A;  1USD A;  1H32 B;  2BCC J;  1CRI A;  451C A;  2W8Z A;  2O3J A;  5KAI H;  3D0W A;  3RK3 C;  1PGP A;  2YQB A;  1CED A;  3PRJ A;  1HRO A;  5AW7 B;  1PZQ A;  1KFM A;  1IZL 0;  2FYU E;  2OYH B;  3MD0 A;  3AEB C;  1N9C A;  1BCC E;  4D6T J;  3EWK A;  5KJ7 C;  2UWJ E;  1IFM A;  1M1K Q;  2KS1 A;  1YIJ P;  4LJI A;  2GC4 D;  2OYO A;  1LNQ A;  3OCD A;  1CW5 A;  2NPS A;  4EYY Q;  3WUT A;  1S5L E;  2OZ1 A;  4PJ0 V;  1BDD A;  2GIW A;  3OA8 A;  1YQ4 C;  1MG3 D;  4O1Q A;  1BL9 A;  1NGM B;  3ZBM A;  1PGQ A;  1K3G A;  3Q5S A;  2FYU D;  3L72 G;  3H1J G;  1GU5 A;  3RGU A;  4JF7 A;  1EC5 A;  1H1O A;  1BCC D;  1K73 Q;  3TGU G;  1N73 A;  3RBX A;  1LT9 C;  4OWF A;  1BE3 G;  2GB8 B;  4UB8 V;  1M56 D;  4I1L A;  1DT1 A;  5C0Z A;  3OAK A;  2XND H;  2GM4 A;  1GW3 A;  3E7K A;  4H0J A;  5APS A;  1JMM A;  2AXC A;  2YKO A;  2Y0E A;  1S1C X;  2PP6 A;  4W7Y A;  3CCR P;  2KS1 B;  1GU2 A;  1NTM K;  3S9O A;  2FXM A;  2WWW A;  3OCD B;  2K1A A;  2NPS B;  2XDJ A;  5APY A;  2OZ1 B;  1KYO E;  4FA1 A;  3OA8 B;  1DVV A;  3H1L G;  1HH7 A;  1I6E A;  2JP3 A;  2Z5I A;  1W2B O;  1NWQ A;  1N73 B;  1NTK J;  1OW8 A;  3CL3 D;  4JYB A;  5CJ4 A;  4PD4 D;  4A7P A;  2QRX A;  1IK7 A;  4JPZ B;  3V2P A;  4WQ9 A;  2B9B A;  3CXH E;  2R5B A;  5GTH V;  1X22 A;  2A45 H;  1NTM E;  1CSB A;  3KHU A;  1URQ A;  2ZVO B;  3L71 G;  1W5C E;  2WSC J;  2ITA A;  1FZC B;  1KYO D;  1L0L E;  4UB6 E;  1LP1 A;  351C A;  3S4R A;  1SQB J;  3Q2Y A;  2KP8 A;  3WFE C;  2MHM A;  1HVV A;  3NBT A;  4KT0 J;  2OAR A;  5KLV G;  2VHD A;  3B5N A;  2KB7 P;  3HUS C;  2Q1K A;  3M06 A;  3VP8 A;  1RE3 C;  4P4Q B;  3SWS A;  5AVV B;  3E1R A;  3I5C A;  3CXH D;  5K5G B;  1NTM D;  1RF0 A;  2I8F A;  2CPB A;  4J20 A;  2JDI H;  2JWA A;  3L36 A;  2Q7C A;  4HYT B;  3EFF K;  1VDF A;  3X39 A;  2FXO A;  2QJK C;  4WY4 A;  1M60 A;  1EDK A;  3RN1 A;  3D70 A;  1LWU A;  1URQ B;  3CX5 W;  1GL2 D;  5AW9 B;  1GDT A;  4L3H A;  4GDO A;  3HD7 C;  1LP1 B;  2WZ7 A;  3L72 E;  5AW5 B;  1FZG A;  3USS A;  1JM0 A;  2BCC E;  1QN2 A;  2BAS A;  1QVF O;  3WFC C;  3MUD A;  3L37 A;  1L0N J;  2YXR B;  1GU4 A;  2HFE D;  2OTK E;  4XA4 A;  1S9K E;  1Q90 D;  4K35 A;  1SFC A;  3B5N B;  5E79 H;  1T8Z A;  2SPZ A;  3LIE A;  1CXA A;  1YIQ A;  3BCC G;  1RY3 A;  4D6T E;  3CP5 A;  2O1K A;  1RZ6 A;  4DCK A;  2H43 A;  2B10 B;  2WMM A;  1SQV G;  3PHL A;  2QA4 P;  1FJ0 A;  2KZI A;  2BCC D;  3SWK A;  5CHX A;  3TYI A;  5CCG D;  1RF1 C;  4WY4 B;  3GHG B;  1LWU B;  3H1L E;  1CIF A;  3WFB C;  1U57 A;  1LTJ C;  3HRN A;  1GKS A;  2ZT9 D;  3FXD A;  4MU8 A;  1XTG B;  1ZP0 C;  1FC2 C;  3SWY A;  1J2J B;  3VMA A;  3TYY A;  2OTL P;  4D6T D;  5EFW B;  2CK3 H;  2A06 D;  5DJQ B;  1NTK K;  3LID A;  4WQA A;  2JR8 A;  4H44 C;  3BRT B;  1PV3 A;  1PPJ E;  1YYC A;  5CJ0 A;  2QSI A;  3HQ9 A;  2AEM A;  2FYN B;  5KKZ C;  2M0B A;  4IOI H;  1J1E B;  1VL2 A;  2ZZS 1;  5DFS A;  4EID A;  3ZIY A;  3G4S P;  2LIT A;  1X0T A;  1JY2 N;  1I6D A;  1RE4 A;  3GF3 A;  1KB9 I;  1IFN A;  1SQB K;  4EDF A;  4WQD A;  2AI5 A;  5CBO A;  3KYQ A;  1EZV E;  1IFI A;  3TF5 A;  3RL0 C;  1R5L A;  4PD4 H;  4EIC A;  1K8A Q;  1PPJ D;  1S3J A;  2E76 B; 
#chains in the Genus database with same CATH homology
 3DMI A;  1I54 A;  1KX7 A;  1CIH A;  3ZOX A;  1LFM A;  3A0B V;  4PWA A;  4L1Q A;  2L91 A;  2C1U A;  1CYJ A;  1VYD A;  3PXS A;  4EIF A;  1FI7 A;  1H9Y A;  3A0H V;  4FAV A;  1CRY A;  2BGV X;  3FWL A;  3O20 A;  1GDV A;  4IL6 V;  3CWB D;  2FRC A;  2YCC A;  3NBS A;  4RJT A;  1DW0 A;  3MK7 B;  3PTZ A;  1EZV D;  1CSU A;  2JQR A;  1FCD C;  4EIE A;  1KB0 A;  3O5C A;  1QKS A;  1NU1 D;  1NTK D;  1OAE A;  5KKZ B;  1I8O A;  4KMG A;  4GED B;  155C A;  3VNW A;  3A9F A;  1M6Z A;  1LMS A;  2AXT V;  4AAM A;  1C2R A;  4FA5 A;  2ZBO A;  5KAI V;  3VRD A;  1MZ4 A;  5KAF V;  5CIB B;  1IRW A;  5C9M A;  4N0K A;  1CTY A;  1AKK A;  1I55 A;  1AOF A;  2QJY B;  3PXW A;  3SJL A;  2N3Y A;  5B6Q A;  1N15 A;  2D0S A;  2RN0 A;  2D0W A;  3CYT I;  3L73 D;  1CNO A;  5EXQ A;  1J3S A;  1NNO A;  2CA3 B;  1NMI A;  3L74 D;  1JDL A;  2N18 C;  1YNR A;  1C6S A;  1H33 A;  1E2R A;  3O1Y A;  1R0Q A;  1COR A;  1SQP D;  4DY9 A;  1WVE C;  1FOC A;  1W2L A;  2V07 A;  1K3H A;  1HZV A;  1L9B C;  5AUR A;  3ORV A;  1HCM A;  2C1V A;  1C75 A;  2IBZ D;  1CYI A;  3SLE A;  2CE0 A;  3C2C A;  3O0R C;  1E29 A;  1L0N D;  3ITK A;  2YK3 A;  1I5T A;  1DW1 A;  4QAO A;  4AAN A;  1H31 A;  1H32 B;  1CRI A;  451C A;  2K9J B;  2O3J A;  1YIC A;  3CXH W;  4FA4 A;  2YQB A;  1CED A;  3PRJ A;  1HRO A;  1BGY D;  1LC2 A;  1IZL 0;  3ZOY A;  1ZRT D;  3HQ7 A;  1N9C A;  3WU2 V;  1H33 B;  1CSV A;  4XXL A;  4WQB A;  2Q3E A;  2C8S A;  2N18 B;  2KS1 A;  1L0L D;  3KZI V;  4LJI A;  2GC4 D;  3OCD A;  3NWV A;  4NFG B;  4WQC A;  5B5E V;  2OZ1 A;  3M97 X;  1S5L V;  2BPB B;  4PJ0 V;  2GIW A;  3OA8 A;  1N50 A;  1MG3 D;  4O1Q A;  1KIB A;  1CRG A;  1BL9 A;  5B66 V;  1H31 B;  2CE1 A;  2GC7 D;  2N3B A;  3ZBM A;  1K3G A;  2FYU D;  1CRH A;  2MTA C;  1H1O A;  1BCC D;  1LC1 A;  3H1I D;  3HQ6 A;  1CHH A;  2ZON G;  2PCB B;  3GG2 A;  1I8P A;  1DII C;  2GB8 B;  4UB8 V;  2RMZ A;  1U75 B;  1QL4 A;  1DT1 A;  1CHI A;  5C0Z A;  3RN0 A;  1SQB D;  4FB1 A;  4H0J A;  1DW3 A;  1LS9 A;  2Y0E A;  1N90 A;  4GYD A;  1CSW A;  1B7V A;  1GU2 A;  1YEA A;  1C2N A;  1NML A;  5CID B;  3L72 D;  3H1J D;  1YCC A;  3PXT A;  3OCD B;  1OCD A;  3TGU D;  1EB7 A;  1YEB A;  2OZ1 B;  1COT A;  1A2S A;  1BE3 D;  2B4Z A;  4FA1 A;  3OA8 B;  1DVV A;  1A8C A;  1CTJ A;  1HJ4 A;  3L4O A;  1HH7 A;  2DVH A;  5DF5 A;  1I6E A;  1KB9 D;  1YFC A;  3ZCF A;  3PLN A;  1MG2 D;  2PCC B;  1P84 D;  1HRC A;  4PD4 D;  2LIR A;  3L70 D;  1A56 A;  1KYO W;  4A7P A;  5E79 V;  1W5C T;  4WQ9 A;  1CIG A;  1C6O A;  5CIE B;  1AOQ A;  3TDK A;  5GTH V;  2V08 A;  2BH5 X;  2B12 B;  3KHU A;  3PH2 B;  4WQE A;  2ZOO A;  1KYO D;  3ZOO A;  4UB6 V;  1CSX A;  3H1L D;  351C A;  2YIU B;  2QJP B;  5IY5 1;  3WFE C;  2C1D A;  2MHM A;  3NBT A;  1C7M A;  1CTZ A;  1CRJ A;  2VHD A;  5CIH B;  4K3I A;  2PAC A;  2C2C A;  3HQ8 A;  5CIG B;  2DGE A;  2Y0D A;  4P4Q B;  3SWS A;  4YE1 A;  1L9J C;  3CXH D;  3GW6 A;  1ZZH A;  1HJ3 A;  1NTM D;  1S6V B;  2BH4 X;  3DP5 A;  3L71 D;  2I8F A;  5H2F V;  2N9Y B;  4J20 A;  5CYT R;  4AAL A;  2EXV A;  2JWA A;  3ZOW A;  1FI3 A;  1FI9 A;  2N9J A;  2JTI B;  3DR0 A;  3X39 A;  3H1K D;  1M60 A;  5CIC B;  3RN1 A;  4Q5P A;  1QL3 A;  3CX5 W;  1CCH A;  5KLV D;  4L3H A;  3SXT A;  1C52 A;  1CXC A;  1GJQ A;  4FAN A;  1DIQ C;  1RAQ A;  4WQ8 A;  4V2K A;  2BLF B;  4L3G A;  1QN2 A;  5CIF B;  3WFC C;  1GIW A;  5DJQ C;  2C1D B;  1HJ5 A;  1FHB A;  3CX5 D;  2HV4 A;  1CO6 A;  4AX3 A;  1NTZ D;  1CRC A;  5TIS V;  2ZXY A;  1CXA A;  1YIQ A;  2CA4 B;  3CP5 A;  1GQ1 A;  1KV9 A;  1RZ6 A;  3L75 D;  2B10 B;  3CU4 A;  2KNC B;  1RAP A;  3PHL A;  2Y0C A;  1FJ0 A;  1CCR A;  2BCC D;  3TYI A;  5TJH A;  1CIF A;  3WFB C;  4WQ7 A;  3H1H D;  3JBT B;  3WUI A;  1GKS A;  3L4M A;  1CHJ A;  3SVW A;  2QJK B;  1U74 B;  1H32 A;  4MU8 A;  4O1W A;  3WFD C;  1AYG A;  3VMA A;  3BCC D;  2XTS B;  2N9I A;  4PW9 B;  4D6T D;  4XYD B;  2ORL A;  1SQQ D;  1SQV D;  2A06 D;  3RLM A;  2L4D A;  2CXB A;  1DW2 A;  5DJQ B;  1PP9 D;  4JCG A;  1H9X A;  1IQC A;  2B0Z B;  4WQA A;  1IRV A;  3MK7 C;  2B11 B;  1DVH A;  1YTC A;  4AAO A;  1ETP A;  3HQ9 A;  1NIR A;  3RMZ A;  5KLI B;  1WEJ F;  2FWL A;  2FYN B;  1CIE A;  4H0K A;  1CC5 A;  2QG4 A;  2ZZS 1;  5DFS A;  4EID A;  3ZIY A;  1KX2 A;  2LIT A;  3VYM A;  1I6D A;  1IO3 A;  1CYC A;  4U3F D;  3WC8 A;  2AIU A;  4Y5R A;  4EDF A;  2BCN B;  1F1F A;  1QYZ A;  1HZU A;  4WQD A;  1C6R A;  2AI5 A;  1E8E A;  3TF5 A;  4RSZ A;  4FA9 A;  1RZ5 A;  1SQX D;  4EIC A;  5GTI V;  1M70 A;  1PPJ D;  2C9X B;  1F1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...