1SQXD

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqxD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqxD02
4FAVA 5EXQA 2ZXYA 3JBTB 1DT1A 1IQCA 5C9MA 1LFMA 1NTMD 4WQAA 3WU2V 1HZVA 5KKZB 1I5TA 4PW9B 2AI5A 2HV4A 1FCDC 2FRCA 4RSZA 3O5CA 3A0BV 5IY51 1HCMA 1S6VB 1L0LD 2AIUA 3OCDB 4N0KA 5H2FV 3SVWA 4J20A 1NTKD 1I8PA 1DVHA 1U75B 2BPBB 1CRGA 1CXCA 2PCBB 3CXHW 2N9YB 1CSUA 4L3HA 1MG3D 3ZOYA 1CXAA 1H32B 3VMAA 1CRYA 3HQ6A 1CYCA 1K3GA 451CA 3KHUA 3NWVA 2N9IA 1H33B 1M70A 3HQ7A 1CO6A 1GU2A 2B4ZA 4XYDB 1YIQA 4GYDA 5KLVD 2BCNB 4AALA 3PH2B 3C2CA 2CA4B 1C2NA 1CTZA 3PLNA 2KS1A 1E2RA 1HROA 1EZVD 2C2CA 1VYDA 3WFCC 1GKSA 4EIDA 4FA5A 1KX7A 1F1CA 4LJIA 3L73D 2XTSB 1BCCD 1CSVA 1LC2A 4PWAA 4WQBA 1YNRA 5CICB 5GTIV 3OA8A 2QJKB 5CYTR 2V07A 4AX3A 1CC5A 3RN1A 5TJHA 1P84D 2B12B 1W5CT 1QL4A 2N3YA 1CHJA 3BCCD 1CRCA 1R0QA 3WFBC 1M6ZA 2PCCB 1CCRA 1QYZA 2GIWA 1FI7A 1ZRTD 2LIRA 1E29A 3O1YA 3HQ8A 1CNOA 1I55A 2B0ZB 4V2KA 1IRVA 2CA3B 1IO3A 2GB8B 4P4QB 1ZZHA 351CA 1N9CA 1BGYD 2L91A 3PXSA 1LC1A 4GEDB 3O0RC 3NBTA 2CE0A 3ZIYA 2YCCA 1GJQA 3NBSA 2L4DA 3VRDA 4AAMA 5B6QA 1GIWA 2YIUB 3ZOWA 1B7VA 1LS9A 2N3BA 4UB8V 1YICA 5E79V 1C6OA 4WQ7A 3ZBMA 3L72D 1WEJF 3PTZA 1H1OA 2DVHA 2MHMA 1YCCA 4RJTA 2RMZA 3DP5A 2C1DA 3ORVA 2JWAA 1A56A 1CIEA 5KAFV 1YEBA 1MG2D 4FB1A 1ETPA 2RN0A 2C1VA 5B66V 3GW6A 2QG4A 3DMIA 3TDKA 2MTAC 2ZOOA 3PXWA 3MK7B 3RMZA 3TF5A 1FOCA 1KV9A 4O1QA 3H1HD 1J3SA 3ZOXA 5KAIV 1CHHA 1N50A 1I6EA 4YE1A 3SWSA 1COTA 1GDVA 5C0ZA 3CX5W 1WVEC 5DF5A 1NMLA 1C6RA 3L71D 1GQ1A 3CP5A 1F1FA 4JCGA 3KZIV 1SQXD 3X39A 1FI9A 2O3JA 2Q3EA 1HH7A 3H1LD 1H9XA 4PD4D 1RAPA 1DVVA 1FHBA 4D6TD 5CIFB 2QJPB 2GC7D 3L74D 1A8CA 3M97X 3PXTA 2LITA 3OCDA 4FA9A 1I54A 1KYOD 1SQVD 1L0ND 1CRJA 4EDFA 4L3GA 1DW1A 3H1JD 1H32A 155CA 1NNOA 1CTJA 5DJQC 4A7PA 2ZBOA 3MK7C 2C1UA 2DGEA 4WQ8A 1CYJA 1I8OA 4NFGB 3VYMA 2D0WA 1HJ4A 1BL9A 1OCDA 1CORA 1SQPD 4XXLA 1PP9D 1KIBA 1SQBD 4QAOA 2C8SA 1NTZD 3WFDC 2N18C 3WFEC 1M60A 4Y5RA 1DIQC 3CU4A 1U74B 4PJ0V 1H9YA 3RLMA 4AAOA 3CWBD 1C7MA 1QL3A 1CIFA 3H1ID 2ZONG 2VHDA 5TISV 1KB0A 1H31A 1IZL0 1A2SA 3ZOOA 1C75A 1QN2A 1PPJD 1AOFA 1HZUA 4FA1A 5B5EV 5CIDB 1BE3D 5DFSA 4K3IA 3PHLA 2BLFB 3WUIA 2Y0EA 1L9BC 1L9JC 1I6DA 1CSXA 2JTIB 3ITKA 1CCHA 1CRHA 2IBZD 1C2RA 1K3HA 3CXHD 2FYUD 2BGVX 2YQBA 1CHIA 3OA8B 1C52A 1HJ3A 1LMSA 1CRIA 3TGUD 4WQCA 3A9FA 2D0SA 1DW0A 1S5LV 3RN0A 2Y0DA 2BH5X 5CIEB 4EICA 2OZ1A 1AOQA 3PRJA 5CIBB 1AYGA 2BH4X 5DJQB 2V08A 1CTYA 1N15A 4EIFA 2A06D 1DW3A 2JQRA 2GC4D 3SLEA 2B11B 1HRCA 1DIIC 1YFCA 4DY9A 3L75D 3DR0A 1NIRA 4O1WA 2EXVA 5AURA 1OAEA 2I8FA 2N18B 2CE1A 1AKKA 4H0JA 2KNCB 1EB7A 3CX5D 4MU8A 2YK3A 1CIGA 4EIEA 4Q5PA 3ZCFA 1IRWA 4KMGA 2K9JB 2BCCD 3WC8A 2AXTV 2FYNB 2QJYB 3L4MA 1H31B 5CIGB 1YEAA 1JDLA 3SJLA 1MZ4A 4U3FD 2CXBA 1RZ5A 2C9XB 1FI3A 1NMIA 3A0HV 2ZZS1 2B10B 4FANA 3GG2A 2ORLA 1RAQA 1KX2A 4IL6V 4WQDA 1HJ5A 1CYIA 4H0KA 3FWLA 2C1DB 3SXTA 1C6SA 4L1QA 3L4OA 1QKSA 3CYTI 1H33A 3TYIA 1SQQD 4WQ9A 1KYOW 2PACA 1W2LA 1DW2A 3H1KD 5KLIB 2Y0CA 3L70D 2FWLA 1CSWA 2OZ1B 3O20A 1YTCA 5GTHV 4FA4A 1FJ0A 1KB9D 3HQ9A 1CEDA 4UB6V 4AANA 4WQEA 1N90A 1RZ6A 2N9JA 5CIHB 3VNWA 1E8EA 1NU1D 1CIHA
chains in the Genus database with same CATH superfamily
2FFDB 1NO4A 2QJYC 4W7YA 3RK2B 2ZXYA 3CC4P 3CPWO 1DEBA 4L76A 1OIPA 4GIFA 4EI2A 1L0LE 5KKZB 1QX8A 2XNXA 1I5TA 3BVHA 1Q7YQ 2R5DA 3LIEA 4U3FJ 1E79H 3VP8A 1VQLP 1NTKE 3O5CA 2ZVNB 1JM0A 1LWUA 2AIUA 3OCDB 3TNUA 5H2FV 4J20A 4GT1A 2M5AB 1EZVI 1DVHA 2AEJA 1QVFO 1PPJG 1CXCA 3CXHW 5AVTB 1OWAA 1AJYA 1DEEG 1HJ0A 3ZOYA 1CXAA 4IFMA 3G9RA 1H32B 2E5TA 3AE4C 3HQ6A 1K3GA 4GODA 2XDJA 4WY4D 5APTA 1CO6A 4GYDA 2R44A 4PV1B 3M0AA 4WY4B 3C2CA 3I55P 3JCUH 1C2NA 1KILC 3PLNA 2C9NY 2ZXXA 3L73E 2C2CA 1PGPA 1VYDA 1LT1A 2YIUC 1QL1A 1BCCD 1L0LJ 1M8OB 1FJPA 5CICB 2JR8A 2V07A 2ZT9C 4ZNCA 3QH9A 1NTKJ 1P84D 2WPRA 4U7JA 2QM8A 3H32B 1MUUA 1X9VA 2PRRA 1M6ZA 2WITA 2PCCB 3KZIE 3II6A 1FI7A 3RK3D 2I1JA 2HYNA 2LIRA 2I8DA 1KTMA 1M1JA 3L74G 4U3FG 1LTGC 1LTBC 1AQTA 1BGYE 2LR2A 1RE4A 4V2KA 1IRVA 1BSNA 4PD4H 1KQLA 4BWNA 2QA4P 2C0XA 2A45H 1H0TA 1N9CA 2KSEA 3A5TA 1KILB 5AVYB 1FZGA 1DX7A 3V2PA 2PFXA 3ZIYA 1GJQA 1T3JA 3F5HA 1JY2O 3HUSA 1VQ4P 2YIUB 2QJKC 2V7QJ 3L73J 5E79V 5AVQB 1C6OA 1UIXA 1ZXGA 1WEJF 2YMYA 1ZOYC 5CCGA 1H1OA 2ZT9B 2DVHA 2MHMA 2OTJP 3DP5A 3ORVA 1H88A 5B5EE 1CIEA 1JMMA 4PD4I 1N8RQ 4FB1A 1ETPA 2B87B 2YKOA 5K5GB 1X8YA 2M0BA 4C7RA 5B66V 1RE3A 2QG4A 4GOFA 2MTAC 1L0LG 1GL2A 3TF5A 3CC2P 3TK1A 3ZOXA 3L71E 2OYIA 2ZVOB 5KAIV 4C46A 1CHHA 1BGYJ 3ABVC 3CXHH 1Q2NA 4EIJA 1S5LX 1KQGB 2CPSA 1I6EA 1COTA 1FJKA 1GDVA 3AE3C 5DF5A 1BCCE 1NMLA 1C6RA 4UB6H 5CCHA 2IFMA 2ITAA 3PP5A 4GKGA 1HH7A 1RAPA 1FHBA 4XFJA 5APVA 4OH8B 5DJUB 4FA9A 1L0NE 2WMMA 3RK3E 1I54A 3WU2H 5CJ0A 3G71P 1KYOD 5AW7B 1BDCA 1S9KD 4EDFA 2AEMA 4L3GA 4A7PA 2C1UA 4WQ8A 1CYJA 2QEXP 4NFGB 3VYMA 3B5NA 1SQPD 4XXLA 2KNCA 3IR9A 3A0HE 3H1IE 2C8SA 1NTZD 2N18C 3AE2C 3CU4A 1AQ5A 1L0LK 4OWFA 4PJ0V 2NZ2A 3CWBD 1S1CX 1CIFA 5TISV 3H1KG 1KB0A 1NTKK 3ZOOA 1A2SA 3L70G 1QN2A 1PPJD 3OJAB 2KI7B 3L71J 4C7NA 1U7MA 3AEEC 5GTHE 3CCJP 1JY3P 3KDPB 1L9JC 2JTIB 1LGHB 3SWYA 2W6JH 1CCHA 3HD7D 1SLQA 2Q5UA 4DJGA 5BVZA 1U7JA 1GTWA 3AE7C 2WSFH 1S5LV 3RN0A 2Y0DA 3I5CA 1RF1A 2BH5X 1L0NJ 5BU8B 2OQQA 3JSVC 1BSHA 3PRJA 5GTIH 2M8RA 1CTYA 1N15A 1Y47A 2JQRA 2GC4D 2B11B 2E74C 4GDOA 2KZIA 1SQBJ 3DR0A 1NIRA 4O1WA 3AEAC 5H2FE 1LP1A 2D2CC 1KC8Q 2EXVA 3C9IA 2MJZA 2I8FA 5CMZA 2N18B 2CE1A 1AKKA 4H0JA 2YK3A 1JB0J 2HODB 3H1IJ 4DT0A 1IRWA 4KMGA 2K9JB 4RKUJ 3Q2YA 1NKNA 1ZMEC 2XKMA 3L4MA 1YEAA 1G1JA 4EOTA 2GM4A 4U3FD 5AVRB 1RZ5A 2LXBA 1FZAA 2FYUJ 1YTZT 2E76C 4YXWH 4H44D 3GG2A 3VMXA 1SQQE 1KX2A 1URQC 1AVOA 3VMYA 4WQDA 1SQPE 3FWLA 4H44B 2B9BA 3L71G 1NTZE 2C0WA 1QKSA 3CYTI 1X79B 2P10A 1KYOW 2PACA 1N73C 1KB9E 5KLIB 1FE6A 3R2PA 1BCCG 1JCCA 2XV5A 3M91A 5KAFH 2OYHA 2C9LY 2R32A 1PIXA 1IZNB 2E74B 4HKZH 3EFGA 1AVYA 5CIHB 1KZUB 1MZ9A 2D2CB 3VNWA 1E8EA 1HUCA 1NTME 3CCRP 3O6QA 3CL3D 1L0NG 1P84H 1IQCA 5C9MA 2OGUA 4WVZA 1N7LA 4Y99C 1XTCC 3FX0A 2KB7P 1KQSO 2FRCA 2R3CA 3A0BV 5CBOA 1IFMA 1YJNP 5IY51 1L0LD 3A7OA 3MUDA 1R5LA 1QLED 2AEFA 1N86A 2FYZA 1NTKD 3H1IG 2GUVA 2V4HA 1U75B 3D0WA 2UWJE 1FZBA 1MFTA 1URQB 2BPBB 2CPBA 2FXMA 1A02J 4BRYA 3WMM0 1FOSE 1SQQJ 2OTKE 1CRYA 2PGDA 1CYCA 1N73B 1L4AA 3KQGA 3NWVA 3V2RA 5E79E 1H33B 3RL0D 3VOPA 2IFNA 2B4ZA 2IYPA 2IYOA 2YO2A 4AALA 3RK2C 4LGDE 3RL0B 1VF5D 5KJ7A 3AE1C 1NAYA 2HG5D 1LT9B 4HJGH 1VF5B 3VTPC 2ZYDA 2HPCA 1L0NK 1NTMJ 3SFEC 2P58A 3D6YA 4EIDA 5B66E 4FA5A 1F1CA 4LJIA 3RGUA 1LTJA 3L73D 1K05A 1YITP 1VL2A 2H8PD 1FZCA 3OA8A 5CYTR 5KAIE 5AVVB 2J59M 5AVSB 1CC5A 1T8ZA 2YNYA 5TJHA 2B12B 3Q3DA 1HTLC 1D7MA 2GIWA 2GA1A 2KK7A 3IF4A 2WPVB 3Q5RA 2OARA 1L2PA 1KV4A 3LW5H 1SS1A 1YHQP 3NFQA 1YJWP 4JQ0D 1IO3A 3RL0g 4P4QB 1ZZHA 351CA 3V4WA 3EWKA 1BGYD 1N7SD 2L91A 5APQA 3CCSP 4GEDB 2W6BA 2OTLP 5AW0B 1N7SB 2LXCB 3Q5PA 2YCCA 3O8ZA 1JY2N 1SQPG 4AAMA 3JC22 1NTZG 1HBWA 1YICA 1FBMA 4WQ7A 1JY3O 3CWBG 2AXTH 1JUNA 1VQ9P 4PJ0E 1YI2P 4UB6E 2WSCH 3PTZA 2NPSA 5TISE 4RJTA 1T6AA 1NYHA 1A56A 3BCCJ 4HH2A 1SP4A 2H89C 1YEBA 3KPEA 3RK3C 3WUUA 3HTKA 4IL6H 1OVUA 3DMIA 1NVOA 1OVVA 2KSJA 3MK7B 1KYOI 2M3BA 1M1JB 1IC2A 3CCLP 5AW3B 1IK7A 1J3SA 4YXDC 1H89A 2FFDA 1FDMA 1S5LE 1N50A 3CCMP 5C0ZA 1WVEC 3L71D 3M0DC 4D6TE 3CMAP 4JCGA 1ZN5A 1F1FA 3FGAD 1AV1A 1FI9A 2O3JA 2Q3EA 1SQQK 3D70A 3AE8C 1DVVA 1SQPK 2WSEH 5CIFB 3B4SA 3CD6P 3SSUA 3M97X 1NTZK 2LITA 3OCDA 4MN4C 5CCGD 3L37A 1DIPA 2K1AA 1L0ND 2QVAA 1CRJA 1DW1A 1H32A 1LTAC 155CA 1CTJA 5DJQC 1GMJA 3IFMA 5KTBA 3T97A 1RF0A 1MKMA 4O9BA 3RK3B 3OW2O 1NTMK 2D0WA 5EFWB 1HJ4A 3GHGC 1KIBA 1SQBD 1GL2D 1YJ9P 4QAOA 4WY4A 1M60A 2N1TA 2H43A 1PGQA 2QE7H 4AAOA 3RLMA 2BASA 2RH0A 1C7MA 3H1ID 2VHDA 1IZL0 1C75A 2KS1B 1HGZA 1OVRA 4FA1A 5CCHD 5DFSA 3GMAA 3PHLA 2BLFB 3G6EP 3WUIA 5AVUB 2DW3A 3H1LJ 3ITKA 4H13D 3S1KA 4D6TJ 3TGUE 5AW6B 2IBZD 1C2RA 1K3HA 2FYUD 3GLMA 2YQBA 4H13B 3EFFK 2HFED 1C52A 1HJ3A 3A9FA 2D0SA 3H32A 1K73Q 2A06E 2VRSA 1S4XA 1OFCX 3H1JJ 5CIBB 4JYCA 3L75E 5DJQB 2V08A 5AVZB 4EIFA 2P67A 2Q9IA 3A0BE 3B5ND 1VQOP 3V2NA 1NHLA 3GHGB 1DIIC 1YFCA 4DY9A 4JF7A 1NTKG 5APYA 1PP9J 1DD4A 3U1AA 2KUBA 4KT0J 2KNCB 3CX5D 3G4SP 2WSFJ 2AXCA 1KILA 1VQPP 2IDBA 2WT7A 2Q7CA 1PV3A 1KFNA 1LTSC 1BE3J 5KAFE 3SFDC 2QSIA 1RQVA 1GU5A 1JDLA 3SJLA 1MZ4A 4C7NB 3HD7C 3V2QA 2R3SA 2C9XB 4AYCA 1NMIA 2O1KA 4Z1MH 1Y8AA 2B10B 3NTNA 1R8EA 1PZQA 1CW5A 3TGUJ 1NKZB 1CYIA 1SQBE 2C1DB 3LIDA 1X22A 2E75D 1PL5A 1FAVA 1SQQD 1OW8A 3L73G 4WQ9A 1W2LA 5APXA 3A3YB 1S3JA 2FWLA 2I1KA 4ASVA 2RKLA 4KHXA 1K9MQ 4WB4A 2WTYA 3L4FA 1EXJA 1HH0A 1KMIZ 3M9HA 3L75J 2V7QH 1KB9D 4UB6V 2G3AA 2E5YA 1N90A 1CI6B 1RZ6A 1ZR4A 5AW9B 3IN6A 3IAOA 4FAVA 1U57A 1LP1B 1CZQA 2IBZE 3JBTB 2FYUE 1ZLLA 2XZRA 1LFMA 1NTMD 2BCCJ 3WU2V 4RO0A 1HZVA 1Y9BA 2AI5A 1FCDC 4RSZA 1FDOA 3HD7B 1BGYG 2NRGA 2ZXEB 4AQRD 4DCKA 3KZIH 4H44C 5CHXA 2JP3A 3SVWA 2GUSA 1I8PA 2Z4EA 3TYYA 3CMEP 5KLIC 1CRGA 2JKVA 2KIKA 2PCBB 1CSUA 4L3HA 3RBZA 3VMAA 5KLVE 3CX5E 1OZHA 2Z5IA 3KHUA 1M7LA 4RESB 1GU2A 4I6MC 1YIQA 2BCNB 1FS0E 2O01N 4EYYQ 3PH2B 1VQKP 3P7KA 3D6ZA 2JWDA 1SFCC 4B86A 1RHZB 3AEGC 3MTUE 1CTZA 3ZDMA 2HR3A 1E2RA 1YTZI 1FU1A 3P8MC 1GKSA 1Z56A 2A06G 3D71A 3L36A 1QVGO 3E1IA 1KD1Q 3S4RA 3AE5C 5B5EH 3FWNA 1CSVA 1LC2A 2H88C 4WQBA 4UB8H 5GTIV 4AX3A 5AW2B 4N6JA 3S9OA 4LC1A 1OXZA 3BCCD 1JO5A 1QGKB 1CRCA 1VDFA 3WFBC 1QYZA 2QIWA 1S2EA 1W2BO 4W80A 4M3LA 1L4AD 1HF9A 4BRYB 1YYCA 3RL0C 3O1YA 1AFOA 1I55A 2CK3H 3P32A 5KLVJ 2GB8B 1LT9C 1SFCD 1VF5C 4IOIH 1Q81Q 2HODA 5AW1B 5KJ7D 1GU4A 1LC1A 2ZJSE 2KLVA 1SFCB 2K9JA 3NBTA 2CE0A 3JCUE 3B8EB 2L4DA 3VRDA 3L72E 1SQBG 1JTHB 1KORA 1HGVA 1GIWA 3ZOWA 1G2CB 4UB8V 2ZAEB 2HPCB 3LW5J 1JY3N 1NWQA 1LWUC 1Q82Q 1LTJB 1NH4A 1NOHA 1AA0A 2XU6A 4R4LA 1IFJA 2P7JA 1YCCA 1M56D 3HE5A 1FZCB 1OW6A 2JWAA 1IFIA 1CSBA 1GDTA 2R5BA 5KAFV 1KQFB 3CCVP 3A0HH 3HE4A 1MG2D 2YKQA 2IZ1A 4Y28J 2IBZG 2FYUG 3H1HE 3GW6A 4IFDK 1EDIA 3PXWA 1M1KQ 3MGNA 3OAKA 3RMZA 3MD0A 3CI9A 3P8CE 3Q1MA 1J2JB 1FOCA 4O1QA 1N7SC 5GTHH 1YQ4C 1SQXE 3AE9C 3KXDA 5AVWB 1OX3A 4PD4E 3AEBC 1GQ1A 3L74E 2L5GB 3X39A 3H1LD 3BCCE 4D6TD 1VPCA 1SQVE 5AW4B 1SQBK 4JPZB 2XNDH 3L72J 2FXPA 4I7ZC 1LWUB 2W90A 2NPSD 3TNUB 3FXEA 1LJ2A 1URQA 3AE6C 3H1JD 2ZBOA 5H2FH 1LTTC 4H0LD 3MK7C 1N73A 1DH3A 2DGEA 1KFMA 1M1JC 3PH0A 1N2DC 2IBZI 3CCEP 1WRGA 1BL9A 1OCDA 1VQ5P 2WSEJ 4H0LB 1RE4C 1PP9D 4CPGA 2ZYGA 2FYUK 3HTKB 3VN0A 3WFEC 1OMIA 4Y5RA 3H1HJ 1DD3A 2H7HA 2E43A 1KYOH 1H9YA 4IL6X 4OVNF 1IFNA 1SQQG 1QL2A 2WZ7A 1H31A 2W83C 4IFFA 5CIDB 1BE3D 4K3IA 2O01H 2FYNC 3HUSC 3F89A 2Q3IA 1J1DB 3CXHE 1SQXJ 1CSXA 3SWFA 1SVFA 1BDDA 3CX5I 4WWIA 3L74J 2BGVX 1CHIA 5CCGC 5KLVK 4I7ZB 4YTPC 1KB9H 1SQVJ 3TGUD 4WQCA 1NTMG 1DW0A 2WPSA 5CIEB 4EICA 2OZ1A 2K88A 3SWKA 3WU2E 2BH4X 1T2KD 1K04A 2A06D 1DW3A 1RE3C 3SLEA 1HRCA 3L72G 3T97B 3HRNA 4PV1D 1GL2C 3L75D 4TT3H 3W68A 1J1EB 2N1TD 1OAEA 2OYIC 1GZLA 1EB7A 3H1LE 1H0TB 2YMKA 5CJ4A 1JNMA 3B71A 1TU3F 2N1TB 1N7SA 5CCHC 2BCCD 3WC8A 2AXTV 2FYNB 2QJYB 3HUSB 5CIGB 1IJDB 5AVXB 1KB9I 4H13C 3MIWA 2M5AA 3GF7A 1FI3A 3H1JE 1VQ8P 3H1HG 4I1LA 2WSSH 1G1IA 3M9QA 4FANA 3V5BA 4N78D 1OW7A 2ORLA 3OA7A 4IL6V 3H1KE 1HJ5A 4NPFX 3L70E 5E79H 1PP9E 3SXTA 1NAFA 1C6SA 3CCUP 5APUA 4AUWA 1SQXG 3K5BA 1DW2A 2K9YA 1EQ7A 3O20A 5APWA 3B5NC 1IO4A 1ZR2A 1NU1E 2A45G 1Q90D 2JJLA 1FJ0A 3QWOC 5GTIE 1BE3E 3HQ9A 1CEDA 2POHA 1GL2B 4WQEA 2KYVA 3BATA 3BCCG 2N9JA 1SQVG 3V4QA 1CIHA 5B66H 2OYIB 2MKVA 2FKWB 5EXQA 1X0TA 3WUTA 1KILD 2IX7C 1DT1A 4WQAA 4BXLA 5KAIH 2WT7B 4PW9B 2HV4A 4HB1A 2WVRA 1GK4A 1HCMA 1Q86Q 2BEQD 1S6VB 4LLHA 1JMBA 4N0KA 2ZT9D 2YKPA 3AEFC 2G8YA 1K8AQ 1RH5B 4ASWA 1RF1C 2E75C 2N9YB 1MG3D 3PJSK 3G3ZA 2E42A 3H1KJ 451CA 3L70J 4UB8E 1HWTC 2N9IA 2W6AA 1M70A 1USDA 1SQXK 3HQ7A 3B5NB 2A45I 4XYDB 2K3RA 5KLVD 2BCCE 1FZFA 3W67A 2CA4B 1EXIA 2PP6A 3H25A 1NU1J 1HJBA 3CCQP 1SQVK 2KS1A 4DOJA 1HROA 1EZVD 3M0DA 5BU5A 2O1JA 3MZWB 4ZMDA 3WFCC 2BEZF 4N78E 4PJ0H 1KX7A 1IFPA 3GF3A 2IZ0A 1A02F 4JYBA 5TISH 1YIJP 1YQ3C 1P84E 2XTSB 4PWAA 1YNRA 2QJKB 1MV8A 1FZEA 3CC7P 3RN1A 1QEXA 1W5CT 1QL4A 1JEKA 2N3YA 2B87A 2FXOA 1CHJA 2KP8A 1GD2E 1R0QA 1XTGB 4L74A 3AECC 1RF1B 3H1LG 1CCRA 2E75B 2K37A 4D6TG 1EC5A 1UIIA 1ZRTD 1RY3A 2J5UA 2Q6QA 3L35A 1PFIA 1E29A 1S5LH 1LTIC 2YXQB 1KILE 2Z5HA 3GHGA 3NMDA 3HQ8A 2FBWC 1CNOA 2OYHC 2B0ZB 3CXHI 5L8RJ 2CA3B 3M06A 1LNQA 4TLFA 1NJIQ 2WPQA 3UIAA 3PXSA 1JOCA 3H1JG 1S72P 4ZKPA 3MHVA 1GW3A 3O0RC 2JDIH 3VP9A 2HLOA 1VQMP 3U1CA 4DZOA 3NBSA 1IK9A 3M9BA 4W7ZA 4KJMA 5B6QA 1PP9G 2J58A 3V6IA 1B7VA 1LS9A 2N3BA 2QJPC 1RQUA 1M57D 5AW5B 3ZBMA 3L72D 3VYIA 1BCCJ 1USEA 2YO3A 3MUDC 2W8ZA 4R4MA 3VMZA 1NU1G 4L75A 1MFZA 1BE3G 1FOSF 4XE5B 3NXSA 2RMZA 3AEDC 2C1DA 1VQNP 2Y9ZA 1L4AC 2RN0A 3RBXA 1VQ7P 2C1VA 2SPZA 1W2EA 3TDKA 2JO1A 2ZOOA 1EZVE 3TGUG 4K35A 1CI6A 2OYHB 3BASA 1KV9A 3H1HD 2ZFCA 5KJ7C 1E5WA 1EDKA 4YE1A 3SWSA 3O6QB 3P8CD 3CX5W 2ZYAA 1GW4A 2FY8A 3CP5A 1EDLA 5DJTB 2B88A 3KZIV 1SQXD 4OGQC 3L75G 1H9XA 4PD4D 1LTJC 1KYOE 3HD7A 1WT6A 2QJPB 3FXDA 5APSA 2KZJA 1S9KE 2GC7D 3L74D 4WBAA 1A8CA 3PXTA 2QM7A 5AW8B 3I56P 1FZCC 4N3YB 1ZRTE 1SQVD 1NGMB 2BCCG 1YBKA 3A0BH 1NU1K 2W27A 2AXTE 1NNOA 3HE5B 4HYTB 4YPCA 1I8OA 3A2AA 1L4AB 2KOGA 1CORA 3HE4B 1JCDA 3CWBE 4K3AA 2E74D 1R5SA 3BRTB 3WFDC 2B89A 5M1BA 2D2CD 1PPJE 1DIQC 5CBNA 1U74B 2YXRB 4IL6E 1ZV8A 1QL3A 1FDIA 1JY2P 2ZONG 3USSA 2N9BA 1AOFA 1HZUA 4OGQD 5B5EV 2LKMA 2Y0EA 3TSIA 1L9BC 1I6DA 4OGQB 1PGOA 1CRHA 1FC2C 3C1LA 3CXHD 2M3EA 2WWWA 2E76D 3OA8B 2NPSC 1LMSA 1CRIA 2Y9YA 4ZKUA 1URQD 2Q1KA 2E76B 3N7NA 1AOQA 3E7KA 3KYQA 2O01J 3E1RA 1AYGA 4H0LC 5C39A 3BRVB 1SQPJ 2WQYC 1EDJA 2WSCJ 2IPPA 1NTZJ 2QRXA 5AURA 3H6PA 2FFDC 4MU8A 1ZW0A 1P84I 4GOEA 3CWBJ 1CIGA 1SFCA 4EIEA 1J1DC 4QMAA 2KLUA 4Q5PA 3ZCFA 1IFDA 4U3FE 5KKZC 1JTHA 1T3UA 1H31B 3EQ2A 1G2CA 2P1JA 5KLVG 4NPEA 1H8AA 4Y99B 2CXBA 3U59A 3N4XA 4L73A 3A0HV 2ZZS1 1WMKA 4JBZA 1EZVG 3MP7B 3CX5H 2NPSB 3C8VA 1RAQA 4H0KA 1W5CE 3R4YA 3WUVA 2OYOA 4L1QA 3L4OA 1H33A 3TYIA 1PGJA 1T2KC 1ZP0C 1RF0C 3H1KD 2Y0CA 3Q5SA 3L70D 1HVVA 1CSWA 2OZ1B 4NPDA 1YTCA 5GTHV 1J1EC 1M90Q 3CLQA 2KXPB 4FA4A 1GK6A 4PV1C 1VQ6P 4I2LC 1KN7A 4WY4C 4AANA 2JEEA 2PAJA 1LT9A 2N1TC 3RK2D 4XA4A 1NU1D 2P2UA
chains in the Genus database with same CATH topology
4FAVA 5EXQA 2ZXYA 3JBTB 1DT1A 1IQCA 5C9MA 1LFMA 1NTMD 4WQAA 3WU2V 1HZVA 5KKZB 1I5TA 4PW9B 2AI5A 2HV4A 1FCDC 2FRCA 4RSZA 3O5CA 3A0BV 5IY51 1HCMA 1S6VB 1L0LD 2AIUA 3OCDB 4N0KA 5H2FV 3SVWA 4J20A 1NTKD 1I8PA 1DVHA 1U75B 2BPBB 1CRGA 1CXCA 2PCBB 3CXHW 2N9YB 1CSUA 4L3HA 1MG3D 3ZOYA 1CXAA 1H32B 3VMAA 1CRYA 3HQ6A 1CYCA 1K3GA 451CA 3KHUA 3NWVA 2N9IA 1H33B 1M70A 3HQ7A 1CO6A 1GU2A 2B4ZA 4XYDB 1YIQA 4GYDA 5KLVD 2BCNB 4AALA 3PH2B 3C2CA 2CA4B 1C2NA 1CTZA 3PLNA 2KS1A 1E2RA 1HROA 1EZVD 2C2CA 1VYDA 3WFCC 1GKSA 4EIDA 4FA5A 1KX7A 1F1CA 4LJIA 3L73D 2XTSB 1BCCD 1CSVA 1LC2A 4PWAA 4WQBA 1YNRA 5CICB 5GTIV 3OA8A 2QJKB 5CYTR 2V07A 4AX3A 1CC5A 3RN1A 5TJHA 1P84D 2B12B 1W5CT 1QL4A 2N3YA 1CHJA 3BCCD 1CRCA 1R0QA 3WFBC 1M6ZA 2PCCB 1CCRA 1QYZA 2GIWA 1FI7A 1ZRTD 2LIRA 1E29A 3O1YA 3HQ8A 1CNOA 1I55A 2B0ZB 4V2KA 1IRVA 2CA3B 1IO3A 2GB8B 4P4QB 1ZZHA 351CA 1N9CA 1BGYD 2L91A 3PXSA 1LC1A 4GEDB 3O0RC 3NBTA 2CE0A 3ZIYA 2YCCA 1GJQA 3NBSA 2L4DA 3VRDA 4AAMA 5B6QA 1GIWA 2YIUB 3ZOWA 1B7VA 1LS9A 2N3BA 4UB8V 1YICA 5E79V 1C6OA 4WQ7A 3ZBMA 3L72D 1WEJF 3PTZA 1H1OA 2DVHA 2MHMA 1YCCA 4RJTA 2RMZA 3DP5A 2C1DA 3ORVA 2JWAA 1A56A 1CIEA 5KAFV 1YEBA 1MG2D 4FB1A 1ETPA 2RN0A 2C1VA 5B66V 3GW6A 2QG4A 3DMIA 3TDKA 2MTAC 2ZOOA 3PXWA 3MK7B 3RMZA 3TF5A 1FOCA 1KV9A 4O1QA 3H1HD 1J3SA 3ZOXA 5KAIV 1CHHA 1N50A 1I6EA 4YE1A 3SWSA 1COTA 1GDVA 5C0ZA 3CX5W 1WVEC 5DF5A 1NMLA 1C6RA 3L71D 1GQ1A 3CP5A 1F1FA 4JCGA 3KZIV 1SQXD 3X39A 1FI9A 2O3JA 2Q3EA 1HH7A 3H1LD 1H9XA 4PD4D 1RAPA 1DVVA 1FHBA 4D6TD 5CIFB 2QJPB 2GC7D 3L74D 1A8CA 3M97X 3PXTA 2LITA 3OCDA 4FA9A 1I54A 1KYOD 1SQVD 1L0ND 1CRJA 4EDFA 4L3GA 1DW1A 3H1JD 1H32A 155CA 1NNOA 1CTJA 5DJQC 4A7PA 2ZBOA 3MK7C 2C1UA 2DGEA 4WQ8A 1CYJA 1I8OA 4NFGB 3VYMA 2D0WA 1HJ4A 1BL9A 1OCDA 1CORA 1SQPD 4XXLA 1PP9D 1KIBA 1SQBD 4QAOA 2C8SA 1NTZD 3WFDC 2N18C 3WFEC 1M60A 4Y5RA 1DIQC 3CU4A 1U74B 4PJ0V 1H9YA 3RLMA 4AAOA 3CWBD 1C7MA 1QL3A 1CIFA 3H1ID 2ZONG 2VHDA 5TISV 1KB0A 1H31A 1IZL0 1A2SA 3ZOOA 1C75A 1QN2A 1PPJD 1AOFA 1HZUA 4FA1A 5B5EV 5CIDB 1BE3D 5DFSA 4K3IA 3PHLA 2BLFB 3WUIA 2Y0EA 1L9BC 1L9JC 1I6DA 1CSXA 2JTIB 3ITKA 1CCHA 1CRHA 2IBZD 1C2RA 1K3HA 3CXHD 2FYUD 2BGVX 2YQBA 1CHIA 3OA8B 1C52A 1HJ3A 1LMSA 1CRIA 3TGUD 4WQCA 3A9FA 2D0SA 1DW0A 1S5LV 3RN0A 2Y0DA 2BH5X 5CIEB 4EICA 2OZ1A 1AOQA 3PRJA 5CIBB 1AYGA 2BH4X 5DJQB 2V08A 1CTYA 1N15A 4EIFA 2A06D 1DW3A 2JQRA 2GC4D 3SLEA 2B11B 1HRCA 1DIIC 1YFCA 4DY9A 3L75D 3DR0A 1NIRA 4O1WA 2EXVA 5AURA 1OAEA 2I8FA 2N18B 2CE1A 1AKKA 4H0JA 2KNCB 1EB7A 3CX5D 4MU8A 2YK3A 1CIGA 4EIEA 4Q5PA 3ZCFA 1IRWA 4KMGA 2K9JB 2BCCD 3WC8A 2AXTV 2FYNB 2QJYB 3L4MA 1H31B 5CIGB 1YEAA 1JDLA 3SJLA 1MZ4A 4U3FD 2CXBA 1RZ5A 2C9XB 1FI3A 1NMIA 3A0HV 2ZZS1 2B10B 4FANA 3GG2A 2ORLA 1RAQA 1KX2A 4IL6V 4WQDA 1HJ5A 1CYIA 4H0KA 3FWLA 2C1DB 3SXTA 1C6SA 4L1QA 3L4OA 1QKSA 3CYTI 1H33A 3TYIA 1SQQD 4WQ9A 1KYOW 2PACA 1W2LA 1DW2A 3H1KD 5KLIB 2Y0CA 3L70D 2FWLA 1CSWA 2OZ1B 3O20A 1YTCA 5GTHV 4FA4A 1FJ0A 1KB9D 3HQ9A 1CEDA 4UB6V 4AANA 4WQEA 1N90A 1RZ6A 2N9JA 5CIHB 3VNWA 1E8EA 1NU1D 1CIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAV A;  5EXQ A;  2ZXY A;  3JBT B;  1DT1 A;  1IQC A;  5C9M A;  1LFM A;  1NTM D;  4WQA A;  3WU2 V;  1HZV A;  5KKZ B;  1I5T A;  4PW9 B;  2AI5 A;  2HV4 A;  1FCD C;  2FRC A;  4RSZ A;  3O5C A;  3A0B V;  5IY5 1;  1HCM A;  1S6V B;  1L0L D;  2AIU A;  3OCD B;  4N0K A;  5H2F V;  3SVW A;  4J20 A;  1NTK D;  1I8P A;  1DVH A;  1U75 B;  2BPB B;  1CRG A;  1CXC A;  2PCB B;  3CXH W;  2N9Y B;  1CSU A;  4L3H A;  1MG3 D;  3ZOY A;  1CXA A;  1H32 B;  3VMA A;  1CRY A;  3HQ6 A;  1CYC A;  1K3G A;  451C A;  3KHU A;  3NWV A;  2N9I A;  1H33 B;  1M70 A;  3HQ7 A;  1CO6 A;  1GU2 A;  2B4Z A;  4XYD B;  1YIQ A;  4GYD A;  5KLV D;  2BCN B;  4AAL A;  3PH2 B;  3C2C A;  2CA4 B;  1C2N A;  1CTZ A;  3PLN A;  2KS1 A;  1E2R A;  1HRO A;  1EZV D;  2C2C A;  1VYD A;  3WFC C;  1GKS A;  4EID A;  4FA5 A;  1KX7 A;  1F1C A;  4LJI A;  3L73 D;  2XTS B;  1BCC D;  1CSV A;  1LC2 A;  4PWA A;  4WQB A;  1YNR A;  5CIC B;  5GTI V;  3OA8 A;  2QJK B;  5CYT R;  2V07 A;  4AX3 A;  1CC5 A;  3RN1 A;  5TJH A;  1P84 D;  2B12 B;  1W5C T;  1QL4 A;  2N3Y A;  1CHJ A;  3BCC D;  1CRC A;  1R0Q A;  3WFB C;  1M6Z A;  2PCC B;  1CCR A;  1QYZ A;  2GIW A;  1FI7 A;  1ZRT D;  2LIR A;  1E29 A;  3O1Y A;  3HQ8 A;  1CNO A;  1I55 A;  2B0Z B;  4V2K A;  1IRV A;  2CA3 B;  1IO3 A;  2GB8 B;  4P4Q B;  1ZZH A;  351C A;  1N9C A;  1BGY D;  2L91 A;  3PXS A;  1LC1 A;  4GED B;  3O0R C;  3NBT A;  2CE0 A;  3ZIY A;  2YCC A;  1GJQ A;  3NBS A;  2L4D A;  3VRD A;  4AAM A;  5B6Q A;  1GIW A;  2YIU B;  3ZOW A;  1B7V A;  1LS9 A;  2N3B A;  4UB8 V;  1YIC A;  5E79 V;  1C6O A;  4WQ7 A;  3ZBM A;  3L72 D;  1WEJ F;  3PTZ A;  1H1O A;  2DVH A;  2MHM A;  1YCC A;  4RJT A;  2RMZ A;  3DP5 A;  2C1D A;  3ORV A;  2JWA A;  1A56 A;  1CIE A;  5KAF V;  1YEB A;  1MG2 D;  4FB1 A;  1ETP A;  2RN0 A;  2C1V A;  5B66 V;  3GW6 A;  2QG4 A;  3DMI A;  3TDK A;  2MTA C;  2ZOO A;  3PXW A;  3MK7 B;  3RMZ A;  3TF5 A;  1FOC A;  1KV9 A;  4O1Q A;  3H1H D;  1J3S A;  3ZOX A;  5KAI V;  1CHH A;  1N50 A;  1I6E A;  4YE1 A;  3SWS A;  1COT A;  1GDV A;  5C0Z A;  3CX5 W;  1WVE C;  5DF5 A;  1NML A;  1C6R A;  3L71 D;  1GQ1 A;  3CP5 A;  1F1F A;  4JCG A;  3KZI V;  1SQX D;  3X39 A;  1FI9 A;  2O3J A;  2Q3E A;  1HH7 A;  3H1L D;  1H9X A;  4PD4 D;  1RAP A;  1DVV A;  1FHB A;  4D6T D;  5CIF B;  2QJP B;  2GC7 D;  3L74 D;  1A8C A;  3M97 X;  3PXT A;  2LIT A;  3OCD A;  4FA9 A;  1I54 A;  1KYO D;  1SQV D;  1L0N D;  1CRJ A;  4EDF A;  4L3G A;  1DW1 A;  3H1J D;  1H32 A;  155C A;  1NNO A;  1CTJ A;  5DJQ C;  4A7P A;  2ZBO A;  3MK7 C;  2C1U A;  2DGE A;  4WQ8 A;  1CYJ A;  1I8O A;  4NFG B;  3VYM A;  2D0W A;  1HJ4 A;  1BL9 A;  1OCD A;  1COR A;  1SQP D;  4XXL A;  1PP9 D;  1KIB A;  1SQB D;  4QAO A;  2C8S A;  1NTZ D;  3WFD C;  2N18 C;  3WFE C;  1M60 A;  4Y5R A;  1DIQ C;  3CU4 A;  1U74 B;  4PJ0 V;  1H9Y A;  3RLM A;  4AAO A;  3CWB D;  1C7M A;  1QL3 A;  1CIF A;  3H1I D;  2ZON G;  2VHD A;  5TIS V;  1KB0 A;  1H31 A;  1IZL 0;  1A2S A;  3ZOO A;  1C75 A;  1QN2 A;  1PPJ D;  1AOF A;  1HZU A;  4FA1 A;  5B5E V;  5CID B;  1BE3 D;  5DFS A;  4K3I A;  3PHL A;  2BLF B;  3WUI A;  2Y0E A;  1L9B C;  1L9J C;  1I6D A;  1CSX A;  2JTI B;  3ITK A;  1CCH A;  1CRH A;  2IBZ D;  1C2R A;  1K3H A;  3CXH D;  2FYU D;  2BGV X;  2YQB A;  1CHI A;  3OA8 B;  1C52 A;  1HJ3 A;  1LMS A;  1CRI A;  3TGU D;  4WQC A;  3A9F A;  2D0S A;  1DW0 A;  1S5L V;  3RN0 A;  2Y0D A;  2BH5 X;  5CIE B;  4EIC A;  2OZ1 A;  1AOQ A;  3PRJ A;  5CIB B;  1AYG A;  2BH4 X;  5DJQ B;  2V08 A;  1CTY A;  1N15 A;  4EIF A;  2A06 D;  1DW3 A;  2JQR A;  2GC4 D;  3SLE A;  2B11 B;  1HRC A;  1DII C;  1YFC A;  4DY9 A;  3L75 D;  3DR0 A;  1NIR A;  4O1W A;  2EXV A;  5AUR A;  1OAE A;  2I8F A;  2N18 B;  2CE1 A;  1AKK A;  4H0J A;  2KNC B;  1EB7 A;  3CX5 D;  4MU8 A;  2YK3 A;  1CIG A;  4EIE A;  4Q5P A;  3ZCF A;  1IRW A;  4KMG A;  2K9J B;  2BCC D;  3WC8 A;  2AXT V;  2FYN B;  2QJY B;  3L4M A;  1H31 B;  5CIG B;  1YEA A;  1JDL A;  3SJL A;  1MZ4 A;  4U3F D;  2CXB A;  1RZ5 A;  2C9X B;  1FI3 A;  1NMI A;  3A0H V;  2ZZS 1;  2B10 B;  4FAN A;  3GG2 A;  2ORL A;  1RAQ A;  1KX2 A;  4IL6 V;  4WQD A;  1HJ5 A;  1CYI A;  4H0K A;  3FWL A;  2C1D B;  3SXT A;  1C6S A;  4L1Q A;  3L4O A;  1QKS A;  3CYT I;  1H33 A;  3TYI A;  1SQQ D;  4WQ9 A;  1KYO W;  2PAC A;  1W2L A;  1DW2 A;  3H1K D;  5KLI B;  2Y0C A;  3L70 D;  2FWL A;  1CSW A;  2OZ1 B;  3O20 A;  1YTC A;  5GTH V;  4FA4 A;  1FJ0 A;  1KB9 D;  3HQ9 A;  1CED A;  4UB6 V;  4AAN A;  4WQE A;  1N90 A;  1RZ6 A;  2N9J A;  5CIH B;  3VNW A;  1E8E A;  1NU1 D;  1CIH A; 
#chains in the Genus database with same CATH topology
 2FFD B;  1NO4 A;  2QJY C;  4W7Y A;  3RK2 B;  2ZXY A;  3CC4 P;  3CPW O;  1DEB A;  4L76 A;  1OIP A;  4GIF A;  4EI2 A;  1L0L E;  5KKZ B;  1QX8 A;  2XNX A;  1I5T A;  3BVH A;  1Q7Y Q;  2R5D A;  3LIE A;  4U3F J;  1E79 H;  3VP8 A;  1VQL P;  1NTK E;  3O5C A;  2ZVN B;  1JM0 A;  1LWU A;  2AIU A;  3OCD B;  3TNU A;  5H2F V;  4J20 A;  4GT1 A;  2M5A B;  1EZV I;  1DVH A;  2AEJ A;  1QVF O;  1PPJ G;  1CXC A;  3CXH W;  5AVT B;  1OWA A;  1AJY A;  1DEE G;  1HJ0 A;  3ZOY A;  1CXA A;  4IFM A;  3G9R A;  1H32 B;  2E5T A;  3AE4 C;  3HQ6 A;  1K3G A;  4GOD A;  2XDJ A;  4WY4 D;  5APT A;  1CO6 A;  4GYD A;  2R44 A;  4PV1 B;  3M0A A;  4WY4 B;  3C2C A;  3I55 P;  3JCU H;  1C2N A;  1KIL C;  3PLN A;  2C9N Y;  2ZXX A;  3L73 E;  2C2C A;  1PGP A;  1VYD A;  1LT1 A;  2YIU C;  1QL1 A;  1BCC D;  1L0L J;  1M8O B;  1FJP A;  5CIC B;  2JR8 A;  2V07 A;  2ZT9 C;  4ZNC A;  3QH9 A;  1NTK J;  1P84 D;  2WPR A;  4U7J A;  2QM8 A;  3H32 B;  1MUU A;  1X9V A;  2PRR A;  1M6Z A;  2WIT A;  2PCC B;  3KZI E;  3II6 A;  1FI7 A;  3RK3 D;  2I1J A;  2HYN A;  2LIR A;  2I8D A;  1KTM A;  1M1J A;  3L74 G;  4U3F G;  1LTG C;  1LTB C;  1AQT A;  1BGY E;  2LR2 A;  1RE4 A;  4V2K A;  1IRV A;  1BSN A;  4PD4 H;  1KQL A;  4BWN A;  2QA4 P;  2C0X A;  2A45 H;  1H0T A;  1N9C A;  2KSE A;  3A5T A;  1KIL B;  5AVY B;  1FZG A;  1DX7 A;  3V2P A;  2PFX A;  3ZIY A;  1GJQ A;  1T3J A;  3F5H A;  1JY2 O;  3HUS A;  1VQ4 P;  2YIU B;  2QJK C;  2V7Q J;  3L73 J;  5E79 V;  5AVQ B;  1C6O A;  1UIX A;  1ZXG A;  1WEJ F;  2YMY A;  1ZOY C;  5CCG A;  1H1O A;  2ZT9 B;  2DVH A;  2MHM A;  2OTJ P;  3DP5 A;  3ORV A;  1H88 A;  5B5E E;  1CIE A;  1JMM A;  4PD4 I;  1N8R Q;  4FB1 A;  1ETP A;  2B87 B;  2YKO A;  5K5G B;  1X8Y A;  2M0B A;  4C7R A;  5B66 V;  1RE3 A;  2QG4 A;  4GOF A;  2MTA C;  1L0L G;  1GL2 A;  3TF5 A;  3CC2 P;  3TK1 A;  3ZOX A;  3L71 E;  2OYI A;  2ZVO B;  5KAI V;  4C46 A;  1CHH A;  1BGY J;  3ABV C;  3CXH H;  1Q2N A;  4EIJ A;  1S5L X;  1KQG B;  2CPS A;  1I6E A;  1COT A;  1FJK A;  1GDV A;  3AE3 C;  5DF5 A;  1BCC E;  1NML A;  1C6R A;  4UB6 H;  5CCH A;  2IFM A;  2ITA A;  3PP5 A;  4GKG A;  1HH7 A;  1RAP A;  1FHB A;  4XFJ A;  5APV A;  4OH8 B;  5DJU B;  4FA9 A;  1L0N E;  2WMM A;  3RK3 E;  1I54 A;  3WU2 H;  5CJ0 A;  3G71 P;  1KYO D;  5AW7 B;  1BDC A;  1S9K D;  4EDF A;  2AEM A;  4L3G A;  4A7P A;  2C1U A;  4WQ8 A;  1CYJ A;  2QEX P;  4NFG B;  3VYM A;  3B5N A;  1SQP D;  4XXL A;  2KNC A;  3IR9 A;  3A0H E;  3H1I E;  2C8S A;  1NTZ D;  2N18 C;  3AE2 C;  3CU4 A;  1AQ5 A;  1L0L K;  4OWF A;  4PJ0 V;  2NZ2 A;  3CWB D;  1S1C X;  1CIF A;  5TIS V;  3H1K G;  1KB0 A;  1NTK K;  3ZOO A;  1A2S A;  3L70 G;  1QN2 A;  1PPJ D;  3OJA B;  2KI7 B;  3L71 J;  4C7N A;  1U7M A;  3AEE C;  5GTH E;  3CCJ P;  1JY3 P;  3KDP B;  1L9J C;  2JTI B;  1LGH B;  3SWY A;  2W6J H;  1CCH A;  3HD7 D;  1SLQ A;  2Q5U A;  4DJG A;  5BVZ A;  1U7J A;  1GTW A;  3AE7 C;  2WSF H;  1S5L V;  3RN0 A;  2Y0D A;  3I5C A;  1RF1 A;  2BH5 X;  1L0N J;  5BU8 B;  2OQQ A;  3JSV C;  1BSH A;  3PRJ A;  5GTI H;  2M8R A;  1CTY A;  1N15 A;  1Y47 A;  2JQR A;  2GC4 D;  2B11 B;  2E74 C;  4GDO A;  2KZI A;  1SQB J;  3DR0 A;  1NIR A;  4O1W A;  3AEA C;  5H2F E;  1LP1 A;  2D2C C;  1KC8 Q;  2EXV A;  3C9I A;  2MJZ A;  2I8F A;  5CMZ A;  2N18 B;  2CE1 A;  1AKK A;  4H0J A;  2YK3 A;  1JB0 J;  2HOD B;  3H1I J;  4DT0 A;  1IRW A;  4KMG A;  2K9J B;  4RKU J;  3Q2Y A;  1NKN A;  1ZME C;  2XKM A;  3L4M A;  1YEA A;  1G1J A;  4EOT A;  2GM4 A;  4U3F D;  5AVR B;  1RZ5 A;  2LXB A;  1FZA A;  2FYU J;  1YTZ T;  2E76 C;  4YXW H;  4H44 D;  3GG2 A;  3VMX A;  1SQQ E;  1KX2 A;  1URQ C;  1AVO A;  3VMY A;  4WQD A;  1SQP E;  3FWL A;  4H44 B;  2B9B A;  3L71 G;  1NTZ E;  2C0W A;  1QKS A;  3CYT I;  1X79 B;  2P10 A;  1KYO W;  2PAC A;  1N73 C;  1KB9 E;  5KLI B;  1FE6 A;  3R2P A;  1BCC G;  1JCC A;  2XV5 A;  3M91 A;  5KAF H;  2OYH A;  2C9L Y;  2R32 A;  1PIX A;  1IZN B;  2E74 B;  4HKZ H;  3EFG A;  1AVY A;  5CIH B;  1KZU B;  1MZ9 A;  2D2C B;  3VNW A;  1E8E A;  1HUC A;  1NTM E;  3CCR P;  3O6Q A;  3CL3 D;  1L0N G;  1P84 H;  1IQC A;  5C9M A;  2OGU A;  4WVZ A;  1N7L A;  4Y99 C;  1XTC C;  3FX0 A;  2KB7 P;  1KQS O;  2FRC A;  2R3C A;  3A0B V;  5CBO A;  1IFM A;  1YJN P;  5IY5 1;  1L0L D;  3A7O A;  3MUD A;  1R5L A;  1QLE D;  2AEF A;  1N86 A;  2FYZ A;  1NTK D;  3H1I G;  2GUV A;  2V4H A;  1U75 B;  3D0W A;  2UWJ E;  1FZB A;  1MFT A;  1URQ B;  2BPB B;  2CPB A;  2FXM A;  1A02 J;  4BRY A;  3WMM 0;  1FOS E;  1SQQ J;  2OTK E;  1CRY A;  2PGD A;  1CYC A;  1N73 B;  1L4A A;  3KQG A;  3NWV A;  3V2R A;  5E79 E;  1H33 B;  3RL0 D;  3VOP A;  2IFN A;  2B4Z A;  2IYP A;  2IYO A;  2YO2 A;  4AAL A;  3RK2 C;  4LGD E;  3RL0 B;  1VF5 D;  5KJ7 A;  3AE1 C;  1NAY A;  2HG5 D;  1LT9 B;  4HJG H;  1VF5 B;  3VTP C;  2ZYD A;  2HPC A;  1L0N K;  1NTM J;  3SFE C;  2P58 A;  3D6Y A;  4EID A;  5B66 E;  4FA5 A;  1F1C A;  4LJI A;  3RGU A;  1LTJ A;  3L73 D;  1K05 A;  1YIT P;  1VL2 A;  2H8P D;  1FZC A;  3OA8 A;  5CYT R;  5KAI E;  5AVV B;  2J59 M;  5AVS B;  1CC5 A;  1T8Z A;  2YNY A;  5TJH A;  2B12 B;  3Q3D A;  1HTL C;  1D7M A;  2GIW A;  2GA1 A;  2KK7 A;  3IF4 A;  2WPV B;  3Q5R A;  2OAR A;  1L2P A;  1KV4 A;  3LW5 H;  1SS1 A;  1YHQ P;  3NFQ A;  1YJW P;  4JQ0 D;  1IO3 A;  3RL0 g;  4P4Q B;  1ZZH A;  351C A;  3V4W A;  3EWK A;  1BGY D;  1N7S D;  2L91 A;  5APQ A;  3CCS P;  4GED B;  2W6B A;  2OTL P;  5AW0 B;  1N7S B;  2LXC B;  3Q5P A;  2YCC A;  3O8Z A;  1JY2 N;  1SQP G;  4AAM A;  3JC2 2;  1NTZ G;  1HBW A;  1YIC A;  1FBM A;  4WQ7 A;  1JY3 O;  3CWB G;  2AXT H;  1JUN A;  1VQ9 P;  4PJ0 E;  1YI2 P;  4UB6 E;  2WSC H;  3PTZ A;  2NPS A;  5TIS E;  4RJT A;  1T6A A;  1NYH A;  1A56 A;  3BCC J;  4HH2 A;  1SP4 A;  2H89 C;  1YEB A;  3KPE A;  3RK3 C;  3WUU A;  3HTK A;  4IL6 H;  1OVU A;  3DMI A;  1NVO A;  1OVV A;  2KSJ A;  3MK7 B;  1KYO I;  2M3B A;  1M1J B;  1IC2 A;  3CCL P;  5AW3 B;  1IK7 A;  1J3S A;  4YXD C;  1H89 A;  2FFD A;  1FDM A;  1S5L E;  1N50 A;  3CCM P;  5C0Z A;  1WVE C;  3L71 D;  3M0D C;  4D6T E;  3CMA P;  4JCG A;  1ZN5 A;  1F1F A;  3FGA D;  1AV1 A;  1FI9 A;  2O3J A;  2Q3E A;  1SQQ K;  3D70 A;  3AE8 C;  1DVV A;  1SQP K;  2WSE H;  5CIF B;  3B4S A;  3CD6 P;  3SSU A;  3M97 X;  1NTZ K;  2LIT A;  3OCD A;  4MN4 C;  5CCG D;  3L37 A;  1DIP A;  2K1A A;  1L0N D;  2QVA A;  1CRJ A;  1DW1 A;  1H32 A;  1LTA C;  155C A;  1CTJ A;  5DJQ C;  1GMJ A;  3IFM A;  5KTB A;  3T97 A;  1RF0 A;  1MKM A;  4O9B A;  3RK3 B;  3OW2 O;  1NTM K;  2D0W A;  5EFW B;  1HJ4 A;  3GHG C;  1KIB A;  1SQB D;  1GL2 D;  1YJ9 P;  4QAO A;  4WY4 A;  1M60 A;  2N1T A;  2H43 A;  1PGQ A;  2QE7 H;  4AAO A;  3RLM A;  2BAS A;  2RH0 A;  1C7M A;  3H1I D;  2VHD A;  1IZL 0;  1C75 A;  2KS1 B;  1HGZ A;  1OVR A;  4FA1 A;  5CCH D;  5DFS A;  3GMA A;  3PHL A;  2BLF B;  3G6E P;  3WUI A;  5AVU B;  2DW3 A;  3H1L J;  3ITK A;  4H13 D;  3S1K A;  4D6T J;  3TGU E;  5AW6 B;  2IBZ D;  1C2R A;  1K3H A;  2FYU D;  3GLM A;  2YQB A;  4H13 B;  3EFF K;  2HFE D;  1C52 A;  1HJ3 A;  3A9F A;  2D0S A;  3H32 A;  1K73 Q;  2A06 E;  2VRS A;  1S4X A;  1OFC X;  3H1J J;  5CIB B;  4JYC A;  3L75 E;  5DJQ B;  2V08 A;  5AVZ B;  4EIF A;  2P67 A;  2Q9I A;  3A0B E;  3B5N D;  1VQO P;  3V2N A;  1NHL A;  3GHG B;  1DII C;  1YFC A;  4DY9 A;  4JF7 A;  1NTK G;  5APY A;  1PP9 J;  1DD4 A;  3U1A A;  2KUB A;  4KT0 J;  2KNC B;  3CX5 D;  3G4S P;  2WSF J;  2AXC A;  1KIL A;  1VQP P;  2IDB A;  2WT7 A;  2Q7C A;  1PV3 A;  1KFN A;  1LTS C;  1BE3 J;  5KAF E;  3SFD C;  2QSI A;  1RQV A;  1GU5 A;  1JDL A;  3SJL A;  1MZ4 A;  4C7N B;  3HD7 C;  3V2Q A;  2R3S A;  2C9X B;  4AYC A;  1NMI A;  2O1K A;  4Z1M H;  1Y8A A;  2B10 B;  3NTN A;  1R8E A;  1PZQ A;  1CW5 A;  3TGU J;  1NKZ B;  1CYI A;  1SQB E;  2C1D B;  3LID A;  1X22 A;  2E75 D;  1PL5 A;  1FAV A;  1SQQ D;  1OW8 A;  3L73 G;  4WQ9 A;  1W2L A;  5APX A;  3A3Y B;  1S3J A;  2FWL A;  2I1K A;  4ASV A;  2RKL A;  4KHX A;  1K9M Q;  4WB4 A;  2WTY A;  3L4F A;  1EXJ A;  1HH0 A;  1KMI Z;  3M9H A;  3L75 J;  2V7Q H;  1KB9 D;  4UB6 V;  2G3A A;  2E5Y A;  1N90 A;  1CI6 B;  1RZ6 A;  1ZR4 A;  5AW9 B;  3IN6 A;  3IAO A;  4FAV A;  1U57 A;  1LP1 B;  1CZQ A;  2IBZ E;  3JBT B;  2FYU E;  1ZLL A;  2XZR A;  1LFM A;  1NTM D;  2BCC J;  3WU2 V;  4RO0 A;  1HZV A;  1Y9B A;  2AI5 A;  1FCD C;  4RSZ A;  1FDO A;  3HD7 B;  1BGY G;  2NRG A;  2ZXE B;  4AQR D;  4DCK A;  3KZI H;  4H44 C;  5CHX A;  2JP3 A;  3SVW A;  2GUS A;  1I8P A;  2Z4E A;  3TYY A;  3CME P;  5KLI C;  1CRG A;  2JKV A;  2KIK A;  2PCB B;  1CSU A;  4L3H A;  3RBZ A;  3VMA A;  5KLV E;  3CX5 E;  1OZH A;  2Z5I A;  3KHU A;  1M7L A;  4RES B;  1GU2 A;  4I6M C;  1YIQ A;  2BCN B;  1FS0 E;  2O01 N;  4EYY Q;  3PH2 B;  1VQK P;  3P7K A;  3D6Z A;  2JWD A;  1SFC C;  4B86 A;  1RHZ B;  3AEG C;  3MTU E;  1CTZ A;  3ZDM A;  2HR3 A;  1E2R A;  1YTZ I;  1FU1 A;  3P8M C;  1GKS A;  1Z56 A;  2A06 G;  3D71 A;  3L36 A;  1QVG O;  3E1I A;  1KD1 Q;  3S4R A;  3AE5 C;  5B5E H;  3FWN A;  1CSV A;  1LC2 A;  2H88 C;  4WQB A;  4UB8 H;  5GTI V;  4AX3 A;  5AW2 B;  4N6J A;  3S9O A;  4LC1 A;  1OXZ A;  3BCC D;  1JO5 A;  1QGK B;  1CRC A;  1VDF A;  3WFB C;  1QYZ A;  2QIW A;  1S2E A;  1W2B O;  4W80 A;  4M3L A;  1L4A D;  1HF9 A;  4BRY B;  1YYC A;  3RL0 C;  3O1Y A;  1AFO A;  1I55 A;  2CK3 H;  3P32 A;  5KLV J;  2GB8 B;  1LT9 C;  1SFC D;  1VF5 C;  4IOI H;  1Q81 Q;  2HOD A;  5AW1 B;  5KJ7 D;  1GU4 A;  1LC1 A;  2ZJS E;  2KLV A;  1SFC B;  2K9J A;  3NBT A;  2CE0 A;  3JCU E;  3B8E B;  2L4D A;  3VRD A;  3L72 E;  1SQB G;  1JTH B;  1KOR A;  1HGV A;  1GIW A;  3ZOW A;  1G2C B;  4UB8 V;  2ZAE B;  2HPC B;  3LW5 J;  1JY3 N;  1NWQ A;  1LWU C;  1Q82 Q;  1LTJ B;  1NH4 A;  1NOH A;  1AA0 A;  2XU6 A;  4R4L A;  1IFJ A;  2P7J A;  1YCC A;  1M56 D;  3HE5 A;  1FZC B;  1OW6 A;  2JWA A;  1IFI A;  1CSB A;  1GDT A;  2R5B A;  5KAF V;  1KQF B;  3CCV P;  3A0H H;  3HE4 A;  1MG2 D;  2YKQ A;  2IZ1 A;  4Y28 J;  2IBZ G;  2FYU G;  3H1H E;  3GW6 A;  4IFD K;  1EDI A;  3PXW A;  1M1K Q;  3MGN A;  3OAK A;  3RMZ A;  3MD0 A;  3CI9 A;  3P8C E;  3Q1M A;  1J2J B;  1FOC A;  4O1Q A;  1N7S C;  5GTH H;  1YQ4 C;  1SQX E;  3AE9 C;  3KXD A;  5AVW B;  1OX3 A;  4PD4 E;  3AEB C;  1GQ1 A;  3L74 E;  2L5G B;  3X39 A;  3H1L D;  3BCC E;  4D6T D;  1VPC A;  1SQV E;  5AW4 B;  1SQB K;  4JPZ B;  2XND H;  3L72 J;  2FXP A;  4I7Z C;  1LWU B;  2W90 A;  2NPS D;  3TNU B;  3FXE A;  1LJ2 A;  1URQ A;  3AE6 C;  3H1J D;  2ZBO A;  5H2F H;  1LTT C;  4H0L D;  3MK7 C;  1N73 A;  1DH3 A;  2DGE A;  1KFM A;  1M1J C;  3PH0 A;  1N2D C;  2IBZ I;  3CCE P;  1WRG A;  1BL9 A;  1OCD A;  1VQ5 P;  2WSE J;  4H0L B;  1RE4 C;  1PP9 D;  4CPG A;  2ZYG A;  2FYU K;  3HTK B;  3VN0 A;  3WFE C;  1OMI A;  4Y5R A;  3H1H J;  1DD3 A;  2H7H A;  2E43 A;  1KYO H;  1H9Y A;  4IL6 X;  4OVN F;  1IFN A;  1SQQ G;  1QL2 A;  2WZ7 A;  1H31 A;  2W83 C;  4IFF A;  5CID B;  1BE3 D;  4K3I A;  2O01 H;  2FYN C;  3HUS C;  3F89 A;  2Q3I A;  1J1D B;  3CXH E;  1SQX J;  1CSX A;  3SWF A;  1SVF A;  1BDD A;  3CX5 I;  4WWI A;  3L74 J;  2BGV X;  1CHI A;  5CCG C;  5KLV K;  4I7Z B;  4YTP C;  1KB9 H;  1SQV J;  3TGU D;  4WQC A;  1NTM G;  1DW0 A;  2WPS A;  5CIE B;  4EIC A;  2OZ1 A;  2K88 A;  3SWK A;  3WU2 E;  2BH4 X;  1T2K D;  1K04 A;  2A06 D;  1DW3 A;  1RE3 C;  3SLE A;  1HRC A;  3L72 G;  3T97 B;  3HRN A;  4PV1 D;  1GL2 C;  3L75 D;  4TT3 H;  3W68 A;  1J1E B;  2N1T D;  1OAE A;  2OYI C;  1GZL A;  1EB7 A;  3H1L E;  1H0T B;  2YMK A;  5CJ4 A;  1JNM A;  3B71 A;  1TU3 F;  2N1T B;  1N7S A;  5CCH C;  2BCC D;  3WC8 A;  2AXT V;  2FYN B;  2QJY B;  3HUS B;  5CIG B;  1IJD B;  5AVX B;  1KB9 I;  4H13 C;  3MIW A;  2M5A A;  3GF7 A;  1FI3 A;  3H1J E;  1VQ8 P;  3H1H G;  4I1L A;  2WSS H;  1G1I A;  3M9Q A;  4FAN A;  3V5B A;  4N78 D;  1OW7 A;  2ORL A;  3OA7 A;  4IL6 V;  3H1K E;  1HJ5 A;  4NPF X;  3L70 E;  5E79 H;  1PP9 E;  3SXT A;  1NAF A;  1C6S A;  3CCU P;  5APU A;  4AUW A;  1SQX G;  3K5B A;  1DW2 A;  2K9Y A;  1EQ7 A;  3O20 A;  5APW A;  3B5N C;  1IO4 A;  1ZR2 A;  1NU1 E;  2A45 G;  1Q90 D;  2JJL A;  1FJ0 A;  3QWO C;  5GTI E;  1BE3 E;  3HQ9 A;  1CED A;  2POH A;  1GL2 B;  4WQE A;  2KYV A;  3BAT A;  3BCC G;  2N9J A;  1SQV G;  3V4Q A;  1CIH A;  5B66 H;  2OYI B;  2MKV A;  2FKW B;  5EXQ A;  1X0T A;  3WUT A;  1KIL D;  2IX7 C;  1DT1 A;  4WQA A;  4BXL A;  5KAI H;  2WT7 B;  4PW9 B;  2HV4 A;  4HB1 A;  2WVR A;  1GK4 A;  1HCM A;  1Q86 Q;  2BEQ D;  1S6V B;  4LLH A;  1JMB A;  4N0K A;  2ZT9 D;  2YKP A;  3AEF C;  2G8Y A;  1K8A Q;  1RH5 B;  4ASW A;  1RF1 C;  2E75 C;  2N9Y B;  1MG3 D;  3PJS K;  3G3Z A;  2E42 A;  3H1K J;  451C A;  3L70 J;  4UB8 E;  1HWT C;  2N9I A;  2W6A A;  1M70 A;  1USD A;  1SQX K;  3HQ7 A;  3B5N B;  2A45 I;  4XYD B;  2K3R A;  5KLV D;  2BCC E;  1FZF A;  3W67 A;  2CA4 B;  1EXI A;  2PP6 A;  3H25 A;  1NU1 J;  1HJB A;  3CCQ P;  1SQV K;  2KS1 A;  4DOJ A;  1HRO A;  1EZV D;  3M0D A;  5BU5 A;  2O1J A;  3MZW B;  4ZMD A;  3WFC C;  2BEZ F;  4N78 E;  4PJ0 H;  1KX7 A;  1IFP A;  3GF3 A;  2IZ0 A;  1A02 F;  4JYB A;  5TIS H;  1YIJ P;  1YQ3 C;  1P84 E;  2XTS B;  4PWA A;  1YNR A;  2QJK B;  1MV8 A;  1FZE A;  3CC7 P;  3RN1 A;  1QEX A;  1W5C T;  1QL4 A;  1JEK A;  2N3Y A;  2B87 A;  2FXO A;  1CHJ A;  2KP8 A;  1GD2 E;  1R0Q A;  1XTG B;  4L74 A;  3AEC C;  1RF1 B;  3H1L G;  1CCR A;  2E75 B;  2K37 A;  4D6T G;  1EC5 A;  1UII A;  1ZRT D;  1RY3 A;  2J5U A;  2Q6Q A;  3L35 A;  1PFI A;  1E29 A;  1S5L H;  1LTI C;  2YXQ B;  1KIL E;  2Z5H A;  3GHG A;  3NMD A;  3HQ8 A;  2FBW C;  1CNO A;  2OYH C;  2B0Z B;  3CXH I;  5L8R J;  2CA3 B;  3M06 A;  1LNQ A;  4TLF A;  1NJI Q;  2WPQ A;  3UIA A;  3PXS A;  1JOC A;  3H1J G;  1S72 P;  4ZKP A;  3MHV A;  1GW3 A;  3O0R C;  2JDI H;  3VP9 A;  2HLO A;  1VQM P;  3U1C A;  4DZO A;  3NBS A;  1IK9 A;  3M9B A;  4W7Z A;  4KJM A;  5B6Q A;  1PP9 G;  2J58 A;  3V6I A;  1B7V A;  1LS9 A;  2N3B A;  2QJP C;  1RQU A;  1M57 D;  5AW5 B;  3ZBM A;  3L72 D;  3VYI A;  1BCC J;  1USE A;  2YO3 A;  3MUD C;  2W8Z A;  4R4M A;  3VMZ A;  1NU1 G;  4L75 A;  1MFZ A;  1BE3 G;  1FOS F;  4XE5 B;  3NXS A;  2RMZ A;  3AED C;  2C1D A;  1VQN P;  2Y9Z A;  1L4A C;  2RN0 A;  3RBX A;  1VQ7 P;  2C1V A;  2SPZ A;  1W2E A;  3TDK A;  2JO1 A;  2ZOO A;  1EZV E;  3TGU G;  4K35 A;  1CI6 A;  2OYH B;  3BAS A;  1KV9 A;  3H1H D;  2ZFC A;  5KJ7 C;  1E5W A;  1EDK A;  4YE1 A;  3SWS A;  3O6Q B;  3P8C D;  3CX5 W;  2ZYA A;  1GW4 A;  2FY8 A;  3CP5 A;  1EDL A;  5DJT B;  2B88 A;  3KZI V;  1SQX D;  4OGQ C;  3L75 G;  1H9X A;  4PD4 D;  1LTJ C;  1KYO E;  3HD7 A;  1WT6 A;  2QJP B;  3FXD A;  5APS A;  2KZJ A;  1S9K E;  2GC7 D;  3L74 D;  4WBA A;  1A8C A;  3PXT A;  2QM7 A;  5AW8 B;  3I56 P;  1FZC C;  4N3Y B;  1ZRT E;  1SQV D;  1NGM B;  2BCC G;  1YBK A;  3A0B H;  1NU1 K;  2W27 A;  2AXT E;  1NNO A;  3HE5 B;  4HYT B;  4YPC A;  1I8O A;  3A2A A;  1L4A B;  2KOG A;  1COR A;  3HE4 B;  1JCD A;  3CWB E;  4K3A A;  2E74 D;  1R5S A;  3BRT B;  3WFD C;  2B89 A;  5M1B A;  2D2C D;  1PPJ E;  1DIQ C;  5CBN A;  1U74 B;  2YXR B;  4IL6 E;  1ZV8 A;  1QL3 A;  1FDI A;  1JY2 P;  2ZON G;  3USS A;  2N9B A;  1AOF A;  1HZU A;  4OGQ D;  5B5E V;  2LKM A;  2Y0E A;  3TSI A;  1L9B C;  1I6D A;  4OGQ B;  1PGO A;  1CRH A;  1FC2 C;  3C1L A;  3CXH D;  2M3E A;  2WWW A;  2E76 D;  3OA8 B;  2NPS C;  1LMS A;  1CRI A;  2Y9Y A;  4ZKU A;  1URQ D;  2Q1K A;  2E76 B;  3N7N A;  1AOQ A;  3E7K A;  3KYQ A;  2O01 J;  3E1R A;  1AYG A;  4H0L C;  5C39 A;  3BRV B;  1SQP J;  2WQY C;  1EDJ A;  2WSC J;  2IPP A;  1NTZ J;  2QRX A;  5AUR A;  3H6P A;  2FFD C;  4MU8 A;  1ZW0 A;  1P84 I;  4GOE A;  3CWB J;  1CIG A;  1SFC A;  4EIE A;  1J1D C;  4QMA A;  2KLU A;  4Q5P A;  3ZCF A;  1IFD A;  4U3F E;  5KKZ C;  1JTH A;  1T3U A;  1H31 B;  3EQ2 A;  1G2C A;  2P1J A;  5KLV G;  4NPE A;  1H8A A;  4Y99 B;  2CXB A;  3U59 A;  3N4X A;  4L73 A;  3A0H V;  2ZZS 1;  1WMK A;  4JBZ A;  1EZV G;  3MP7 B;  3CX5 H;  2NPS B;  3C8V A;  1RAQ A;  4H0K A;  1W5C E;  3R4Y A;  3WUV A;  2OYO A;  4L1Q A;  3L4O A;  1H33 A;  3TYI A;  1PGJ A;  1T2K C;  1ZP0 C;  1RF0 C;  3H1K D;  2Y0C A;  3Q5S A;  3L70 D;  1HVV A;  1CSW A;  2OZ1 B;  4NPD A;  1YTC A;  5GTH V;  1J1E C;  1M90 Q;  3CLQ A;  2KXP B;  4FA4 A;  1GK6 A;  4PV1 C;  1VQ6 P;  4I2L C;  1KN7 A;  4WY4 C;  4AAN A;  2JEE A;  2PAJ A;  1LT9 A;  2N1T C;  3RK2 D;  4XA4 A;  1NU1 D;  2P2U A; 
#chains in the Genus database with same CATH homology
 4FAV A;  5EXQ A;  2ZXY A;  3JBT B;  1DT1 A;  1IQC A;  5C9M A;  1LFM A;  1NTM D;  4WQA A;  3WU2 V;  1HZV A;  5KKZ B;  1I5T A;  4PW9 B;  2AI5 A;  2HV4 A;  1FCD C;  2FRC A;  4RSZ A;  3O5C A;  3A0B V;  5IY5 1;  1HCM A;  1S6V B;  1L0L D;  2AIU A;  3OCD B;  4N0K A;  5H2F V;  3SVW A;  4J20 A;  1NTK D;  1I8P A;  1DVH A;  1U75 B;  2BPB B;  1CRG A;  1CXC A;  2PCB B;  3CXH W;  2N9Y B;  1CSU A;  4L3H A;  1MG3 D;  3ZOY A;  1CXA A;  1H32 B;  3VMA A;  1CRY A;  3HQ6 A;  1CYC A;  1K3G A;  451C A;  3KHU A;  3NWV A;  2N9I A;  1H33 B;  1M70 A;  3HQ7 A;  1CO6 A;  1GU2 A;  2B4Z A;  4XYD B;  1YIQ A;  4GYD A;  5KLV D;  2BCN B;  4AAL A;  3PH2 B;  3C2C A;  2CA4 B;  1C2N A;  1CTZ A;  3PLN A;  2KS1 A;  1E2R A;  1HRO A;  1EZV D;  2C2C A;  1VYD A;  3WFC C;  1GKS A;  4EID A;  4FA5 A;  1KX7 A;  1F1C A;  4LJI A;  3L73 D;  2XTS B;  1BCC D;  1CSV A;  1LC2 A;  4PWA A;  4WQB A;  1YNR A;  5CIC B;  5GTI V;  3OA8 A;  2QJK B;  5CYT R;  2V07 A;  4AX3 A;  1CC5 A;  3RN1 A;  5TJH A;  1P84 D;  2B12 B;  1W5C T;  1QL4 A;  2N3Y A;  1CHJ A;  3BCC D;  1CRC A;  1R0Q A;  3WFB C;  1M6Z A;  2PCC B;  1CCR A;  1QYZ A;  2GIW A;  1FI7 A;  1ZRT D;  2LIR A;  1E29 A;  3O1Y A;  3HQ8 A;  1CNO A;  1I55 A;  2B0Z B;  4V2K A;  1IRV A;  2CA3 B;  1IO3 A;  2GB8 B;  4P4Q B;  1ZZH A;  351C A;  1N9C A;  1BGY D;  2L91 A;  3PXS A;  1LC1 A;  4GED B;  3O0R C;  3NBT A;  2CE0 A;  3ZIY A;  2YCC A;  1GJQ A;  3NBS A;  2L4D A;  3VRD A;  4AAM A;  5B6Q A;  1GIW A;  2YIU B;  3ZOW A;  1B7V A;  1LS9 A;  2N3B A;  4UB8 V;  1YIC A;  5E79 V;  1C6O A;  4WQ7 A;  3ZBM A;  3L72 D;  1WEJ F;  3PTZ A;  1H1O A;  2DVH A;  2MHM A;  1YCC A;  4RJT A;  2RMZ A;  3DP5 A;  2C1D A;  3ORV A;  2JWA A;  1A56 A;  1CIE A;  5KAF V;  1YEB A;  1MG2 D;  4FB1 A;  1ETP A;  2RN0 A;  2C1V A;  5B66 V;  3GW6 A;  2QG4 A;  3DMI A;  3TDK A;  2MTA C;  2ZOO A;  3PXW A;  3MK7 B;  3RMZ A;  3TF5 A;  1FOC A;  1KV9 A;  4O1Q A;  3H1H D;  1J3S A;  3ZOX A;  5KAI V;  1CHH A;  1N50 A;  1I6E A;  4YE1 A;  3SWS A;  1COT A;  1GDV A;  5C0Z A;  3CX5 W;  1WVE C;  5DF5 A;  1NML A;  1C6R A;  3L71 D;  1GQ1 A;  3CP5 A;  1F1F A;  4JCG A;  3KZI V;  1SQX D;  3X39 A;  1FI9 A;  2O3J A;  2Q3E A;  1HH7 A;  3H1L D;  1H9X A;  4PD4 D;  1RAP A;  1DVV A;  1FHB A;  4D6T D;  5CIF B;  2QJP B;  2GC7 D;  3L74 D;  1A8C A;  3M97 X;  3PXT A;  2LIT A;  3OCD A;  4FA9 A;  1I54 A;  1KYO D;  1SQV D;  1L0N D;  1CRJ A;  4EDF A;  4L3G A;  1DW1 A;  3H1J D;  1H32 A;  155C A;  1NNO A;  1CTJ A;  5DJQ C;  4A7P A;  2ZBO A;  3MK7 C;  2C1U A;  2DGE A;  4WQ8 A;  1CYJ A;  1I8O A;  4NFG B;  3VYM A;  2D0W A;  1HJ4 A;  1BL9 A;  1OCD A;  1COR A;  1SQP D;  4XXL A;  1PP9 D;  1KIB A;  1SQB D;  4QAO A;  2C8S A;  1NTZ D;  3WFD C;  2N18 C;  3WFE C;  1M60 A;  4Y5R A;  1DIQ C;  3CU4 A;  1U74 B;  4PJ0 V;  1H9Y A;  3RLM A;  4AAO A;  3CWB D;  1C7M A;  1QL3 A;  1CIF A;  3H1I D;  2ZON G;  2VHD A;  5TIS V;  1KB0 A;  1H31 A;  1IZL 0;  1A2S A;  3ZOO A;  1C75 A;  1QN2 A;  1PPJ D;  1AOF A;  1HZU A;  4FA1 A;  5B5E V;  5CID B;  1BE3 D;  5DFS A;  4K3I A;  3PHL A;  2BLF B;  3WUI A;  2Y0E A;  1L9B C;  1L9J C;  1I6D A;  1CSX A;  2JTI B;  3ITK A;  1CCH A;  1CRH A;  2IBZ D;  1C2R A;  1K3H A;  3CXH D;  2FYU D;  2BGV X;  2YQB A;  1CHI A;  3OA8 B;  1C52 A;  1HJ3 A;  1LMS A;  1CRI A;  3TGU D;  4WQC A;  3A9F A;  2D0S A;  1DW0 A;  1S5L V;  3RN0 A;  2Y0D A;  2BH5 X;  5CIE B;  4EIC A;  2OZ1 A;  1AOQ A;  3PRJ A;  5CIB B;  1AYG A;  2BH4 X;  5DJQ B;  2V08 A;  1CTY A;  1N15 A;  4EIF A;  2A06 D;  1DW3 A;  2JQR A;  2GC4 D;  3SLE A;  2B11 B;  1HRC A;  1DII C;  1YFC A;  4DY9 A;  3L75 D;  3DR0 A;  1NIR A;  4O1W A;  2EXV A;  5AUR A;  1OAE A;  2I8F A;  2N18 B;  2CE1 A;  1AKK A;  4H0J A;  2KNC B;  1EB7 A;  3CX5 D;  4MU8 A;  2YK3 A;  1CIG A;  4EIE A;  4Q5P A;  3ZCF A;  1IRW A;  4KMG A;  2K9J B;  2BCC D;  3WC8 A;  2AXT V;  2FYN B;  2QJY B;  3L4M A;  1H31 B;  5CIG B;  1YEA A;  1JDL A;  3SJL A;  1MZ4 A;  4U3F D;  2CXB A;  1RZ5 A;  2C9X B;  1FI3 A;  1NMI A;  3A0H V;  2ZZS 1;  2B10 B;  4FAN A;  3GG2 A;  2ORL A;  1RAQ A;  1KX2 A;  4IL6 V;  4WQD A;  1HJ5 A;  1CYI A;  4H0K A;  3FWL A;  2C1D B;  3SXT A;  1C6S A;  4L1Q A;  3L4O A;  1QKS A;  3CYT I;  1H33 A;  3TYI A;  1SQQ D;  4WQ9 A;  1KYO W;  2PAC A;  1W2L A;  1DW2 A;  3H1K D;  5KLI B;  2Y0C A;  3L70 D;  2FWL A;  1CSW A;  2OZ1 B;  3O20 A;  1YTC A;  5GTH V;  4FA4 A;  1FJ0 A;  1KB9 D;  3HQ9 A;  1CED A;  4UB6 V;  4AAN A;  4WQE A;  1N90 A;  1RZ6 A;  2N9J A;  5CIH B;  3VNW A;  1E8E A;  1NU1 D;  1CIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...