1SQXD

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqxD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqxD02
1YEAA 2FYNB 1H9XA 3NBSA 2FWLA 1RAPA 4P4QB 1HCMA 1YICA 3RMZA 2QJPB 3L71D 1H32A 1C6SA 1OAEA 4YE1A 2MTAC 1C6OA 1N15A 4UB8V 1CHHA 1KYOD 1CSXA 1RZ6A 3C2CA 3WUIA 4FA9A 1YIQA 1S6VB 1SQPD 3ZOWA 2FRCA 1E2RA 3MK7C 2GIWA 4PD4D 1IQCA 4AALA 1I6EA 1I55A 1CYCA 2OZ1A 1GKSA 1WEJF 2AI5A 1FI7A 3CXHW 3M97X 1NTMD 3FWLA 2DGEA 4NFGB 1FOCA 1QL4A 1DT1A 2D0SA 2O3JA 5CICB 1N9CA 3L4MA 3L75D 5IY51 4Q5PA 2PCBB 2YQBA 2B12B 2AXTV 2OZ1B 1I6DA 1CYJA 5C9MA 4H0JA 2C2CA 1I54A 1NNOA 2C1UA 4AANA 4AAOA 4AX3A 1AOQA 3KZIV 1DW0A 4A7PA 4FAVA 1NIRA 3SXTA 2FYUD 4EIFA 3OCDB 1EB7A 5TISV 5GTHV 1CC5A 4GYDA 3O5CA 3L4OA 2XTSB 2RN0A 1MG3D 1COTA 1C6RA 1ZZHA 3H1LD 3TF5A 4J20A 1NTKD 1H1OA 2QJYB 3X39A 3HQ6A 1CORA 3DR0A 2CA3B 2CE1A 1DW3A 5C0ZA 1C52A 4L3GA 1KX7A 3WFCC 1W5CT 4AAMA 3CYTI 2B11B 2ORLA 1IRVA 2MHMA 4MU8A 5DJQC 4FB1A 1E29A 1DVVA 2L4DA 1FJ0A 3O0RC 2JWAA 2N9IA 3VMAA 3PH2B 2N18C 3CWBD 3PXTA 1DW2A 1GIWA 3CXHD 1C7MA 4WQCA 2ZONG 3SJLA 1CSUA 2AIUA 2YCCA 2GC7D 3ORVA 2Y0EA 4IL6V 1SQBD 1CRIA 2BH5X 3TDKA 4PWAA 3CU4A 155CA 1CHJA 1M70A 3HQ8A 3ZOXA 1K3GA 1DW1A 3PXSA 1OCDA 1NMLA 1DIIC 2JTIB 1FCDC 1FHBA 1KX2A 3L74D 4DY9A 5CIBB 4WQBA 2B10B 3H1ID 2N9YB 1GU2A 2LIRA 5TJHA 1HJ4A 2YK3A 3NBTA 1RAQA 1W2LA 4O1QA 3PRJA 4WQEA 3GW6A 3WFDC 3ITKA 1CO6A 1WVEC 3BCCD 1L9BC 1CIFA 5KLIB 1H31A 4XXLA 3RN0A 3SWSA 1E8EA 1KYOW 1R0QA 1P84D 3OCDA 1ZRTD 1KV9A 3DP5A 2BGVX 4FANA 1CRGA 3A0HV 3TGUD 3L70D 3CP5A 1LS9A 1BCCD 1I5TA 1DIQC 2N9JA 3RN1A 2V08A 2L91A 3O20A 1HROA 1QN2A 2C9XB 4WQ8A 1CRJA 1CYIA 2Y0DA 1MG2D 2CE0A 1CRCA 4FA5A 1S5LV 3WU2V 2I8FA 1CHIA 2RMZA 4U3FD 1BGYD 4PW9B 1CIHA 4V2KA 2YIUB 1LMSA 4GEDB 1IRWA 1H33A 1FI9A 4EDFA 1CSWA 4WQ7A 1PPJD 4EIDA 4LJIA 1YTCA 2BCCD 3VNWA 1H33B 1I8OA 1J3SA 5CIDB 3SVWA 1QYZA 3CX5D 5CIFB 4FA1A 1CCHA 4WQ9A 1F1CA 3OA8A 4UB6V 1FI3A 5KAIV 2BLFB 2C1DA 1CRHA 3L72D 1PP9D 4JCGA 1L0LD 4FA4A 1BE3D 2PCCB 3O1YA 5CIHB 4RJTA 1H9YA 4WQDA 1L9JC 3NWVA 1NMIA 3ZCFA 1CTYA 1KIBA 1C2NA 2A06D 1KB0A 3HQ9A 3ZIYA 3TYIA 1LC2A 1HRCA 2ZBOA 1JDLA 5KKZB 1CCRA 1BL9A 1YNRA 1A56A 2CXBA 1KB9D 1IZL0 4L3HA 2QJKB 1F1FA 2N18B 3PXWA 4H0KA 3PTZA 5AURA 1CIGA 1GJQA 4Y5RA 3HQ7A 3H1JD 1H31B 4L1QA 2D0WA 3PHLA 1QKSA 2Q3EA 2C1DB 1SQVD 4EIEA 1I8PA 2CA4B 4K3IA 3ZOOA 3WFEC 1C75A 1YCCA 3VRDA 1VYDA 1CXCA 2DVHA 4QAOA 2Y0CA 3PLNA 5KAFV 1NU1D 5DF5A 4WQAA 1HJ5A 1NTZD 2C1VA 2N3YA 5CIGB 1CTJA 1CSVA 2LITA 5DJQB 2GC4D 3VYMA 3H1HD 2VHDA 3CX5W 1L0ND 1HJ3A 1DVHA 1CXAA 1YEBA 4PJ0V 3JBTB 2EXVA 1CNOA 1M60A 1N90A 1N50A 1CEDA 2QG4A 1C2RA 3GG2A 3OA8B 5H2FV 4D6TD 4XYDB 5E79V 1CRYA 5B6QA 1GDVA 2K9JB 3DMIA 3H1KD 2B0ZB 1B7VA 2BH4X 1U74B 1EZVD 1SQXD 5EXQA 2KS1A 5CIEB 1A8CA 5CYTR 2KNCB 5DFSA 5B66V 3SLEA 2V07A 2IBZD 4KMGA 1A2SA 1ETPA 1LFMA 2C8SA 451CA 1HZVA 1AKKA 1M6ZA 2PACA 3L73D 3A0BV 3WC8A 2ZOOA 1LC1A 2ZZS1 2ZXYA 1HZUA 1CTZA 1K3HA 351CA 1YFCA 4O1WA 2BPBB 2GB8B 1RZ5A 4EICA 2JQRA 1AOFA 1SQQD 5KLVD 1IO3A 1H32B 3MK7B 1GQ1A 1CIEA 3ZOYA 3A9FA 2HV4A 1AYGA 1U75B 2B4ZA 2BCNB 4N0KA 3ZBMA 1MZ4A 3KHUA 4RSZA 3RLMA 1QL3A 2N3BA 5B5EV 3WFBC 1HH7A 5GTIV
chains in the Genus database with same CATH superfamily
3H1IG 1GTWA 3V2NA 3NBSA 4GODA 2W83C 5CBNA 1DD4A 1J2JB 3GHGC 3B8EB 1YICA 1YTZI 2QJKC 3L71D 1LP1B 1C6SA 1NO4A 1MFTA 2WQYC 1RE4A 3OW2O 1N15A 2V4HA 3HTKA 2FYNC 1NU1J 1JMBA 4ASWA 2BCCE 2AEJA 5KKZC 3HE4B 5GTHH 1S6VB 1EDLA 3V4WA 1SQPD 2W90A 1E2RA 3EFGA 1FBMA 5KLVG 1L4AC 1NGMB 1AVYA 1P84E 1CYCA 2OZ1A 2AI5A 1FI7A 2A45H 3M97X 1L0LJ 3FWLA 1FOCA 3L72J 2KIKA 3GHGB 2D0SA 2O3JA 2WITA 1CI6A 3D6ZA 2WPVB 1HBWA 2GM4A 5CCGA 1FZGA 3L75D 4Q5PA 1XTGB 2E75C 2E43A 2W8ZA 4H44C 4H0JA 1NKZB 1T6AA 1I54A 1N86A 3RBZA 4AAOA 3MZWB 3L71G 4A7PA 1LT9A 1Y9BA 1JY2O 1VQ5P 2J59M 3OCDB 1EB7A 5TISV 1FJPA 2ITAA 4PJ0E 1W2EA 1MG3D 1S5LE 1RF0C 2FFDB 1ZZHA 2NPSB 1EXIA 1SQPG 2NPSA 3D6YA 1BSNA 1QL1A 1LWUC 5AVTB 1KILA 3CL3D 2M0BA 1H1OA 1S5LH 5BU5A 1FC2C 4PJ0H 4NPFX 2QE7H 2B11B 3W68A 4Y28J 3L75E 4L75A 2IBZG 4FB1A 1RQVA 3S9OA 1G2CA 1QVFO 1E29A 4R4MA 3IAOA 1JY2P 3U1CA 1MUUA 4YPCA 3AE1C 3HD7C 2H7HA 3LIDA 3RK2B 1CSUA 1Z56A 1ZR4A 3N7NA 4IL6V 3TGUJ 1EDKA 3TDKA 1GZLA 1SP4A 3HQ8A 1P84H 5AW5B 2IDBA 3AEFC 5CCGD 2SPZA 3KZIE 4I7ZB 3FX0A 4DY9A 5GTHE 2LIRA 3O6QB 1KORA 2KZJA 2KB7P 4PD4H 3IFMA 3JSVC 1W2LA 4O1QA 1FJKA 3HTKB 3OAKA 3WFDC 1HVVA 1L0NG 4PV1C 1H31A 4PD4E 1OX3A 4Z1MH 2ZFCA 3KZIH 1H88A 1G1IA 1IFNA 1U7MA 3DP5A 2BGVX 4RO0A 4FANA 3A0HV 1HGZA 3TGUD 2OYIA 1LS9A 3RL0B 3CCEP 1NOHA 2YIUC 1SQQJ 2XZRA 1IFMA 2ZYDA 1UIIA 2A06G 1H8AA 1U57A 5APWA 3P32A 1MG2D 2CE0A 3A2AA 4FA5A 1YITP 3TK1A 4OH8B 2BEQD 1BGYD 4PW9B 1RF1C 2MJZA 2YIUB 1M1JC 4N3YB 1YI2P 5GTIH 1Q81Q 4EDFA 4WQ7A 1PPJD 4EIDA 2P67A 1YJWP 3VNWA 1OW7A 1QYZA 1PPJE 1MKMA 3MHVA 1L0LE 2Z4EA 1CCHA 3P7KA 4UB6V 1FI3A 3FGAD 1SQXJ 2BLFB 3TGUG 1FOSF 4KHXA 5AW1B 4FA4A 2E76B 4AQRD 2PCCB 5CIHB 1H9YA 1IFDA 3GF3A 1NWQA 1NTKG 4DOJA 4NPEA 1KIBA 3G4SP 2A06D 4JBZA 3H1HE 1NAYA 3ZIYA 3TYIA 3VMXA 1G2CB 1JDLA 1CCRA 4LC1A 4WY4B 2CXBA 2HR3A 2OQQA 2FXMA 3BRVB 1KQGB 3H32A 1S5LX 2M5AB 1L4AB 3HD7D 2ZVOB 2PAJA 4HYTB 1ZXGA 3L70J 3PTZA 4EI2A 5AURA 1CIGA 1ZOYC 4OVNF 1USDA 3BASA 4Y5RA 1N73C 2K3RA 2KOGA 4L1QA 1M7LA 3PHLA 1JTHA 1ZV8A 2Z5HA 1QKSA 1SQPJ 3NFQA 3JCUE 2WSEH 1U7JA 1SQVD 3O6QA 1I8PA 2E5TA 3MIWA 1CXCA 2DVHA 2Y0CA 1NU1D 1PP9E 1IK7A 2NPSD 2LR2A 1FDMA 3V6IA 1M1JB 2R5DA 2Q9IA 5APTA 3VOPA 1QVGO 1BCCE 3CX5W 2YO3A 1NTZK 1DVHA 2PP6A 3NXSA 1YEBA 4R4LA 3CC4P 1IC2A 2EXVA 1CNOA 1EC5A 3GG2A 4XYDB 5E79V 1KB9E 5B6QA 2KZIA 2NZ2A 2H43A 2HG5D 2BH4X 1U74B 1E79H 3A0HH 1PZQA 3A0BE 1A8CA 2E75D 5CYTR 1BGYJ 2OYIB 2Q6QA 1N7SC 2O01H 4L74A 2IBZD 4KMGA 3CX5H 1KILC 1RQUA 451CA 2QM7A 1HZVA 1M6ZA 2PACA 2M3EA 2ZOOA 1LC1A 1K3HA 2WPRA 1YFCA 1M56D 3T97B 1NHLA 2RH0A 2P2UA 1PGOA 4EICA 3L73E 1SQQD 3GHGA 4CPGA 1NH4A 2ZXEB 2BEZF 3A9FA 2HV4A 1OZHA 1AYGA 4N0KA 2MKVA 3NTNA 1MZ4A 3KHUA 1BE3E 1SQQE 3PP5A 2HODB 3WFBC 2OTKE 3CWBE 1HH7A 2QEXP 3L71E 2FYNB 3U1AA 4D6TE 1J1DC 3RL0D 3V2RA 2FWLA 2HYNA 3S1KA 4P4QB 3TSIA 5TISH 1EZVG 1OXZA 1OFCX 3MTUE 4IOIH 1OAEA 1X22A 1SQXE 4YE1A 1LTJB 3IF4A 4AUWA 5EFWB 4UB8V 1NTMK 4RESB 3H32B 3C2CA 3WUIA 4FA9A 3CPWO 1W2BO 4NPDA 4PV1B 4IFMA 1L0NK 1WRGA 4QMAA 4UB8E 1SLQA 2Y9ZA 1PIXA 2DW3A 2IX7C 4LLHA 3V4QA 1RE4C 2JO1A 1KFMA 2R3SA 3IR9A 1IQCA 1EZVI 1I6EA 2DGEA 4NFGB 2IZ1A 2HFED 1DT1A 3GF7A 3B4SA 2ZAEB 1OW6A 2E76D 1LNQA 1NKNA 3B5NA 3UIAA 2PCBB 1KQSO 3MD0A 1N2DC 2AXTV 4OGQC 1I6DA 1URQD 1FZEA 2WT7A 1PPJG 3N4XA 3M9HA 1ZR2A 4MN4C 3A3YB 4HB1A 1H89A 1DW0A 1NTZG 1GL2C 4HKZH 5CCHC 5L8RJ 3AE9C 1PP9J 4XFJA 1QX8A 2GUVA 2J5UA 1Q2NA 2O1JA 4GT1A 3L4OA 2XTSB 1NTKE 3MP7B 1J1EB 1YIJP 1C6RA 4BRYA 4JF7A 2FYUK 1BDCA 4J20A 1JTHB 5APUA 3H1IE 1NTKD 4WVZA 2AXCA 4PD4I 1KYOH 1M90Q 3VP8A 4L3GA 2W6JH 1KX7A 4Y99C 3RBXA 1EXJA 2XDJA 4AAMA 3CYTI 2B88A 3VYIA 2FYZA 3M0DC 5AVRB 3RL0g 1JY3N 3Q5PA 5DJQC 3QWOC 1DVVA 2IFMA 3L70G 1SQXK 2UWJE 4BRYB 3VMAA 3PH2B 3CWBD 2D2CC 5H2FE 3CXHD 2QJPC 2ZONG 1LTAC 3SJLA 2YXRB 1LJ2A 2AIUA 2QSIA 2A45G 1AA0A 3WMM0 2WSSH 4PWAA 1EQ7A 2WSEJ 1N7SD 3HE5B 1K3GA 4EIJA 1KTMA 1T3UA 5B66E 1FCDC 4AYCA 2N9YB 1KX2A 5TJHA 2B10B 3H1ID 3RK3E 2ZXXA 1OWAA 4N6JA 2YK3A 1R5LA 3EFFK 3WU2H 3L71J 1RAQA 3G6EP 3GW6A 1CO6A 1L9BC 3L75J 1DEEG 1CIFA 3V5BA 2VRSA 5KAFH 3OCDA 1OVRA 1ZRTD 3BCCJ 5AW6B 1JY2N 3L70D 3CP5A 2QRXA 2QVAA 3CXHH 4H13C 1FDOA 1SFCB 1VF5C 1CSBA 2XV5A 1FS0E 2N9JA 2V08A 4JPZB 3M9QA 1ZLLA 1FZAA 1QN2A 2H8PD 4WQ8A 1M1KQ 1CRJA 3FWNA 1LTJA 3AE5C 2Y0DA 2D2CD 2OGUA 1CRCA 1JB0J 1S5LV 2HPCB 3WU2V 1D7MA 2WPQA 2I8FA 1T8ZA 1CHIA 3L75G 2RMZA 3B5ND 4U3FD 3RK2C 2B87A 3L74E 4M3LA 1KILD 1LMSA 1FZCC 1H33A 1RE3C 1DIPA 3MUDA 1OW8A 4LJIA 1SQPK 1PV3A 1VQ9P 1URQC 4YXWH 3H1JG 2BCCD 1EDIA 4U3FJ 4JYCA 1J3SA 1HJ0A 5CIDB 3CX5D 3PJSK 4FA1A 2W27A 5K5GB 1N7SA 3CCVP 3T97A 3OA8A 5KAIV 5KLIC 3R2PA 1CRHA 1A02F 4JCGA 5APYA 2H89C 1FE6A 4RJTA 1DH3A 5KAIH 1AFOA 4WQDA 3CLQA 2XKMA 1KQLA 1NMIA 1GU5A 1CTYA 2KSEA 1UIXA 3L36A 1L0NE 2V7QH 2JR8A 2FY8A 4HJGH 3HUSC 2ZBOA 5KKZB 1DD3A 1YNRA 2KI7B 2YNYA 1KB9D 1Q90D 5DJUB 1JCDA 2JWDA 2C9LY 4L3HA 1BGYE 1IJDB 3K5BA 1FZFA 1FOSE 2QJKB 1NTMG 3OJAB 5AW9B 1F1FA 2N18B 3PXWA 4H0KA 1GJQA 3RL0C 3HQ7A 2BCCG 3H1IJ 3L35A 2AXTE 2D0WA 5E79E 2Q3EA 2C1DB 1IFPA 3CX5I 3VTPC 4KJMA 3ZOOA 1C75A 3Q1MA 3VRDA 3LW5J 1JMMA 2JEEA 1PP9G 3PLNA 1K05A 4Y99B 4WY4D 4OWFA 1SQVE 3B71A 3ABVC 1HH0A 4WQAA 2C1VA 2N3YA 3HE4A 5CIGB 3CWBJ 2GC4D 3VYMA 5AVWB 5APVA 1RY3A 1CXAA 4UB6E 2YMKA 1J1EC 3H1KE 5BVZA 2N1TA 1N90A 1N50A 1CEDA 2POHA 3H1JJ 3BATA 1VQKP 1CRYA 5B5EH 1VQ8P 1GDVA 2K9JB 1OVVA 4TLFA 3RK3B 3R4YA 1KFNA 5EXQA 2KS1A 3KQGA 2K1AA 2WVRA 3Q3DA 2YKPA 3CCMP 1FZCA 3G9RA 1A2SA 3SWYA 1ETPA 1LFMA 1AKKA 1YQ4C 3L73D 3B5NB 1KYOI 1AQ5A 2HLOA 1CTZA 2HPCA 4ASVA 351CA 3CWBG 3W67A 4O1WA 2M5AA 2BPBB 1NAFA 3V2PA 2Q3IA 2WPSA 3CCSP 1IO3A 4YXDC 2GUSA 1L4AA 1S3JA 2ZVNB 2IPPA 4GOEA 2B4ZA 3BRTB 3V2QA 4RSZA 1QL3A 2N3BA 3TYYA 2ZT9D 1YYCA 4D6TG 3L74G 5AW0B 1WT6A 3RMZA 2QJPB 4IL6H 5AVYB 1H32A 4ZKPA 2MTAC 4GKGA 3WUUA 1C6OA 2FFDC 3L74J 1RE3A 1CHHA 4I6MC 1X8YA 4H13D 1YIQA 4U3FE 2NRGA 4GIFA 3ZOWA 2FRCA 2D2CB 1M8OB 4PD4D 2ZT9C 1VF5B 1VQMP 3CD6P 5BU8B 1YHQP 1YQ3C 1KMIZ 2FBWC 1RF1A 1WEJF 3CXHW 1LTIC 2BASA 1KD1Q 1VQLP 2A06E 2OYHA 2AEMA 1LP1A 3EQ2A 3KDPB 2YO2A 1N9CA 4N78E 3L4MA 5IY51 2OYIC 3D0WA 2B12B 2KLUA 3L72E 4PV1D 1CYJA 5C9MA 3M0DA 1NNOA 4AANA 4AX3A 1AOQA 4U7JA 2N1TD 4FAVA 3VN0A 4RKUJ 1NIRA 4DJGA 1X0TA 2GA1A 2WSFH 4EIFA 3M9BA 1CC5A 4GYDA 1VQOP 2KUBA 1FDIA 2RN0A 1EZVE 4O9BA 3L72G 1GMJA 3TF5A 2FYUJ 2K88A 3D71A 3P8CD 2XNXA 1VQNP 3X39A 3H1LE 1CORA 3C1LA 3H1JE 3DR0A 2CA3B 1DW3A 1C52A 3BCCG 3HD7A 2KS1B 2ORLA 1IRVA 5APXA 1CZQA 3CCLP 2MHMA 2LKMA 1S9KE 1KV4A 1S1CX 3O0RC 1NJIQ 1NTMJ 2FFDA 2N9IA 3PXTA 1DW2A 1C7MA 1KN7A 4WQCA 1AJYA 3ORVA 2Y0EA 1SQBD 3L37A 1L4AD 1QGKB 1K73Q 1CHJA 1M70A 3H1HJ 3M06A 1OCDA 2FKWB 2JKVA 1GDTA 2G8YA 2E42A 3AE6C 2JTIB 1FHBA 4WQBA 1NTZJ 4JQ0D 1HUCA 2JJLA 5DJTB 1PGJA 4C46A 4W80A 1HJ4A 1JUNA 3NBTA 1IO4A 3B5NC 4K35A 3ITKA 1NU1K 3BCCD 1N7LA 3RK3D 1LT9C 1NVOA 3RN0A 1E8EA 1KYOW 1SS1A 2WMMA 5AVUB 1MFZA 1LTSC 1N7SB 1CRGA 2P7JA 1PL5A 1SQBJ 1BCCD 1I5TA 5CCGC 1DIQC 1BE3G 2PRRA 3VMYA 2I1KA 2L91A 3O20A 1HROA 4WY4C 3KYQA 5CJ0A 2C9XB 3SFDC 3A7OA 2FXOA 3L73G 1S4XA 5AVXB 1KILB 1HJBA 3G3ZA 1T3JA 4WBAA 5CHXA 1CI6B 1VL2A 1QLED 2WSCH 4GEDB 2IBZE 3EWKA 1FI9A 2OTJP 1CSWA 3H1KJ 1PGPA 2YMYA 4K3AA 1YTCA 3BCCE 3II6A 3LW5H 1VQ7P 3SVWA 2J58A 3P8CE 2YKOA 1K9MQ 1NTKK 3HRNA 1SQVG 2I8DA 5CIFB 4W7YA 2LXCB 2C1DA 3E1IA 3MUDC 1BE3D 2IYPA 4UB6H 1L9JC 2QJYC 4I7ZC 1C2NA 2O01N 1KB0A 1T2KD 1EDJA 2AEFA 2KNCA 1H0TA 1M57D 5AW2B 1RHZB 1JOCA 5KLVK 3SFEC 1LC2A 1HRCA 3WUVA 2FXPA 2HODA 2P1JA 1A56A 1BGYG 3QH9A 2R44A 3I55P 4H0LB 4WWIA 5AVSB 4XE5B 1SQVK 5E79H 2FYUE 3TNUB 3IN6A 1H31B 2AXTH 1AVOA 3AEBC 4EIEA 2CA4B 4K3IA 1GK6A 3P8MC 4L73A 1IK9A 2WSFJ 1VYDA 2E74C 1GL2D 5CCHD 5AVVB 5DF5A 2P58A 1HJ5A 3CMEP 1CTJA 5AW3B 2LITA 1LWUB 5APQA 3RK3C 1USEA 5KJ7C 4OGQD 1K04A 4IL6E 5KAIE 2ZJSE 3JBTB 3H25A 2O01J 2Z5IA 1C2RA 3OA8B 1SQBK 1LTJC 2KK7A 2QA4P 2PFXA 1HWTC 3DMIA 1GU4A 3H1KD 3CCJP 1IFIA 3HE5A 1EZVD 1HF9A 4EYYQ 4GOFA 1SQBE 3GMAA 1A02J 3Q5SA 5DFSA 3AEEC 3CC7P 3SLEA 2V07A 4GDOA 1VDFA 3L73J 2C8SA 2JP3A 1QEXA 2W6AA 3KPEA 2E5YA 1BE3J 3F89A 1RZ5A 2JQRA 2LXBA 2CPSA 1R8EA 2OYOA 2OYHB 1GQ1A 1K8AQ 1SQBG 1Q86Q 3ZOYA 4I2LC 1U75B 3A5TA 2E74B 3ZBMA 1SQQK 3WUTA 5B5EV 1LT9B 1L0LK 3PH0A 1VPCA 2KYVA 2Y9YA 5GTIV 5B5EE 3M0AA 1JO5A 1YEAA 1H9XA 1JY3P 3L70E 3CCQP 1RAPA 1ZMEC 1HCMA 1VQPP 3G71P 1DEBA 5AW8B 2C9NY 2Q7CA 5C39A 1FAVA 1KYOD 1W5CE 1CSXA 1RZ6A 2RKLA 3WU2E 3AE3C 4ZNCA 3AEGC 1GW3A 1IFJA 1LTBC 2R3CA 1RH5B 1SVFA 3HD7B 3VP9A 3RGUA 3MK7C 3KXDA 2GIWA 4XA4A 1SQQG 4AALA 1X9VA 1BCCJ 5AW4B 1I55A 2R32A 4N78D 1GKSA 3CCRP 1NTMD 1Q7YQ 1S72P 1QL4A 1KB9I 3C9IA 5CICB 1NTZE 3AECC 1GL2B 2YQBA 1BSHA 4B86A 2OZ1B 1LTGC 3L4FA 2B89A 2XNDH 2C2CA 2C1UA 2N1TC 1LWUA 2M8RA 3KZIV 5KLVJ 4I1LA 3SXTA 2FYUD 5GTHV 1OVUA 3O5CA 4H0LD 5KTBA 3C8VA 3SSUA 3JC22 1COTA 1QL2A 3H1LD 2BCCJ 2K9YA 1NYHA 1MV8A 1NTKJ 3U59A 2IZ0A 3FXEA 4H0LC 2QJYB 4YTPC 3HQ6A 2E75B 2CE1A 5C0ZA 1TU3F 4H44B 3WFCC 3CCUP 2R5BA 1LTTC 1W5CT 4D6TJ 1KC8Q 2WTYA 4BWNA 1YBKA 4MU8A 2WZ7A 1L0NJ 1NU1E 3HUSB 2L4DA 1FJ0A 2JWAA 3FXDA 4TT3H 1PFIA 1L2PA 2N18C 4C7RA 1BDDA 1GIWA 3HUSA 3AE2C 1XTCC 2FYUG 2YCCA 2GC7D 1CRIA 2BH5X 3AEAC 1LT1A 3CU4A 155CA 3CXHE 1YJNP 3ZOXA 1VQ4P 1DW1A 3PXSA 5APSA 1NU1G 1NMLA 1DIIC 1Q82Q 1IZNB 2ZT9B 3L74D 5CIBB 1GW4A 1GU2A 5KAFE 1JEKA 3PRJA 4WQEA 1GD2E 1G1JA 1ZRTE 1WVEC 2WSCJ 5CBOA 1YJ9P 5KLIB 1R5SA 4XXLA 4JYBA 2IBZI 3SWSA 1R0QA 1P84D 3CMAP 3AEDC 1KV9A 1NTME 5B66H 1ZP0C 3D70A 1Y8AA 3H1KG 3CXHI 3RN1A 2YXQB 3I5CA 2E74D 2K9JA 5H2FH 1CYIA 2B87B 1URQA 1P84I 4C7NB 3TNUA 1URQB 1LGHB 1CW5A 2V7QJ 4IFDK 5CMZA 1CIHA 4V2KA 3Q2YA 1IRWA 4WY4A 3CX5E 2G3AA 2WWWA 1VQ6P 3A0BH 3CI9A 1KYOE 1SFCA 3A0HE 1H33B 1I8OA 2IFNA 2QIWA 3Q5RA 2IYOA 3VMZA 2M3BA 1T2KC 4WQ9A 1F1CA 1SQPE 2OTLP 2A45I 1JM0A 3E7KA 1KB9H 3USSA 3L72D 1PP9D 3H6PA 1L0LD 2OYHC 2E76C 3O1YA 1S2EA 1N73A 2YKQA 3NWVA 1YTZT 2O1KA 2C0WA 1DX7A 3ZCFA 3F5HA 2KLVA 1M1JA 1RF1B 3HQ9A 1KZUB 3H1HG 1SFCD 4EOTA 5AVZB 1BL9A 1AV1A 4IFFA 4W7ZA 1WMKA 4U3FG 1PGQA 4DCKA 1FU1A 1IZL0 4BXLA 2CPBA 1JCCA 3AE8C 3JCUH 4IL6X 1SQXG 3H1JD 1E5WA 2ZYGA 2XU6A 1SQVJ 4DZOA 1OMIA 1ZN5A 1VF5D 4KT0J 2CK3H 3WFEC 1YCCA 3S4RA 4UB8H 4QAOA 5KJ7D 4HH2A 5KAFV 1Y47A 1L0LG 1X79B 1NTZD 2Q1KA 1CSVA 2W6BA 1J1DB 5DJQB 4H44D 5AVQB 4ZMDA 1JNMA 2ZYAA 2N1TB 3RK2D 3H1HD 3GLMA 2VHDA 3OA7A 2JDIH 4DT0A 1L0ND 3M91A 5TISE 1HJ3A 2C0XA 2B9BA 3H1LG 4PJ0V 1S9KD 5AW7B 1M60A 3BVHA 2KXPB 2QG4A 3AE4C 5H2FV 4D6TD 1HGVA 1FZBA 5KJ7A 2H88C 3E1RA 3SWFA 1JY3O 2B0ZB 1B7VA 1BCCG 1FZCB 1SFCC 1SQXD 2P10A 5CIEB 4WB4A 2QM8A 2KNCB 1H0TB 5B66V 1KILE 2PGDA 1ZW0A 4OGQB 3H1LJ 1KQFB 5GTIE 3O8ZA 3NMDA 2KP8A 1N73B 1GL2A 5CCHA 3A0BV 3WC8A 2L5GB 2K37A 5KLVE 2ZZS1 4LGDE 1MZ9A 2ZXYA 1HZUA 4C7NA 1AQTA 3AE7C 4H13B 3TGUE 1GK4A 4L76A 1OIPA 2GB8B 3LIEA 1AOFA 5KLVD 3ZDMA 1H32B 3MK7B 3MGNA 1CIEA 2OARA 5M1BA 2N9BA 1N8RQ 2BCNB 1HTLC 2KSJA 1RF0A 3RLMA 2I1JA 4ZKUA 2NPSC 3CC2P 2Q5UA 3SWKA 5CJ4A 2WT7B 3I56P
chains in the Genus database with same CATH topology
1YEAA 2FYNB 1H9XA 3NBSA 2FWLA 1RAPA 4P4QB 1HCMA 1YICA 3RMZA 2QJPB 3L71D 1H32A 1C6SA 1OAEA 4YE1A 2MTAC 1C6OA 1N15A 4UB8V 1CHHA 1KYOD 1CSXA 1RZ6A 3C2CA 3WUIA 4FA9A 1YIQA 1S6VB 1SQPD 3ZOWA 2FRCA 1E2RA 3MK7C 2GIWA 4PD4D 1IQCA 4AALA 1I6EA 1I55A 1CYCA 2OZ1A 1GKSA 1WEJF 2AI5A 1FI7A 3CXHW 3M97X 1NTMD 3FWLA 2DGEA 4NFGB 1FOCA 1QL4A 1DT1A 2D0SA 2O3JA 5CICB 1N9CA 3L4MA 3L75D 5IY51 4Q5PA 2PCBB 2YQBA 2B12B 2AXTV 2OZ1B 1I6DA 1CYJA 5C9MA 4H0JA 2C2CA 1I54A 1NNOA 2C1UA 4AANA 4AAOA 4AX3A 1AOQA 3KZIV 1DW0A 4A7PA 4FAVA 1NIRA 3SXTA 2FYUD 4EIFA 3OCDB 1EB7A 5TISV 5GTHV 1CC5A 4GYDA 3O5CA 3L4OA 2XTSB 2RN0A 1MG3D 1COTA 1C6RA 1ZZHA 3H1LD 3TF5A 4J20A 1NTKD 1H1OA 2QJYB 3X39A 3HQ6A 1CORA 3DR0A 2CA3B 2CE1A 1DW3A 5C0ZA 1C52A 4L3GA 1KX7A 3WFCC 1W5CT 4AAMA 3CYTI 2B11B 2ORLA 1IRVA 2MHMA 4MU8A 5DJQC 4FB1A 1E29A 1DVVA 2L4DA 1FJ0A 3O0RC 2JWAA 2N9IA 3VMAA 3PH2B 2N18C 3CWBD 3PXTA 1DW2A 1GIWA 3CXHD 1C7MA 4WQCA 2ZONG 3SJLA 1CSUA 2AIUA 2YCCA 2GC7D 3ORVA 2Y0EA 4IL6V 1SQBD 1CRIA 2BH5X 3TDKA 4PWAA 3CU4A 155CA 1CHJA 1M70A 3HQ8A 3ZOXA 1K3GA 1DW1A 3PXSA 1OCDA 1NMLA 1DIIC 2JTIB 1FCDC 1FHBA 1KX2A 3L74D 4DY9A 5CIBB 4WQBA 2B10B 3H1ID 2N9YB 1GU2A 2LIRA 5TJHA 1HJ4A 2YK3A 3NBTA 1RAQA 1W2LA 4O1QA 3PRJA 4WQEA 3GW6A 3WFDC 3ITKA 1CO6A 1WVEC 3BCCD 1L9BC 1CIFA 5KLIB 1H31A 4XXLA 3RN0A 3SWSA 1E8EA 1KYOW 1R0QA 1P84D 3OCDA 1ZRTD 1KV9A 3DP5A 2BGVX 4FANA 1CRGA 3A0HV 3TGUD 3L70D 3CP5A 1LS9A 1BCCD 1I5TA 1DIQC 2N9JA 3RN1A 2V08A 2L91A 3O20A 1HROA 1QN2A 2C9XB 4WQ8A 1CRJA 1CYIA 2Y0DA 1MG2D 2CE0A 1CRCA 4FA5A 1S5LV 3WU2V 2I8FA 1CHIA 2RMZA 4U3FD 1BGYD 4PW9B 1CIHA 4V2KA 2YIUB 1LMSA 4GEDB 1IRWA 1H33A 1FI9A 4EDFA 1CSWA 4WQ7A 1PPJD 4EIDA 4LJIA 1YTCA 2BCCD 3VNWA 1H33B 1I8OA 1J3SA 5CIDB 3SVWA 1QYZA 3CX5D 5CIFB 4FA1A 1CCHA 4WQ9A 1F1CA 3OA8A 4UB6V 1FI3A 5KAIV 2BLFB 2C1DA 1CRHA 3L72D 1PP9D 4JCGA 1L0LD 4FA4A 1BE3D 2PCCB 3O1YA 5CIHB 4RJTA 1H9YA 4WQDA 1L9JC 3NWVA 1NMIA 3ZCFA 1CTYA 1KIBA 1C2NA 2A06D 1KB0A 3HQ9A 3ZIYA 3TYIA 1LC2A 1HRCA 2ZBOA 1JDLA 5KKZB 1CCRA 1BL9A 1YNRA 1A56A 2CXBA 1KB9D 1IZL0 4L3HA 2QJKB 1F1FA 2N18B 3PXWA 4H0KA 3PTZA 5AURA 1CIGA 1GJQA 4Y5RA 3HQ7A 3H1JD 1H31B 4L1QA 2D0WA 3PHLA 1QKSA 2Q3EA 2C1DB 1SQVD 4EIEA 1I8PA 2CA4B 4K3IA 3ZOOA 3WFEC 1C75A 1YCCA 3VRDA 1VYDA 1CXCA 2DVHA 4QAOA 2Y0CA 3PLNA 5KAFV 1NU1D 5DF5A 4WQAA 1HJ5A 1NTZD 2C1VA 2N3YA 5CIGB 1CTJA 1CSVA 2LITA 5DJQB 2GC4D 3VYMA 3H1HD 2VHDA 3CX5W 1L0ND 1HJ3A 1DVHA 1CXAA 1YEBA 4PJ0V 3JBTB 2EXVA 1CNOA 1M60A 1N90A 1N50A 1CEDA 2QG4A 1C2RA 3GG2A 3OA8B 5H2FV 4D6TD 4XYDB 5E79V 1CRYA 5B6QA 1GDVA 2K9JB 3DMIA 3H1KD 2B0ZB 1B7VA 2BH4X 1U74B 1EZVD 1SQXD 5EXQA 2KS1A 5CIEB 1A8CA 5CYTR 2KNCB 5DFSA 5B66V 3SLEA 2V07A 2IBZD 4KMGA 1A2SA 1ETPA 1LFMA 2C8SA 451CA 1HZVA 1AKKA 1M6ZA 2PACA 3L73D 3A0BV 3WC8A 2ZOOA 1LC1A 2ZZS1 2ZXYA 1HZUA 1CTZA 1K3HA 351CA 1YFCA 4O1WA 2BPBB 2GB8B 1RZ5A 4EICA 2JQRA 1AOFA 1SQQD 5KLVD 1IO3A 1H32B 3MK7B 1GQ1A 1CIEA 3ZOYA 3A9FA 2HV4A 1AYGA 1U75B 2B4ZA 2BCNB 4N0KA 3ZBMA 1MZ4A 3KHUA 4RSZA 3RLMA 1QL3A 2N3BA 5B5EV 3WFBC 1HH7A 5GTIV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YEA A;  2FYN B;  1H9X A;  3NBS A;  2FWL A;  1RAP A;  4P4Q B;  1HCM A;  1YIC A;  3RMZ A;  2QJP B;  3L71 D;  1H32 A;  1C6S A;  1OAE A;  4YE1 A;  2MTA C;  1C6O A;  1N15 A;  4UB8 V;  1CHH A;  1KYO D;  1CSX A;  1RZ6 A;  3C2C A;  3WUI A;  4FA9 A;  1YIQ A;  1S6V B;  1SQP D;  3ZOW A;  2FRC A;  1E2R A;  3MK7 C;  2GIW A;  4PD4 D;  1IQC A;  4AAL A;  1I6E A;  1I55 A;  1CYC A;  2OZ1 A;  1GKS A;  1WEJ F;  2AI5 A;  1FI7 A;  3CXH W;  3M97 X;  1NTM D;  3FWL A;  2DGE A;  4NFG B;  1FOC A;  1QL4 A;  1DT1 A;  2D0S A;  2O3J A;  5CIC B;  1N9C A;  3L4M A;  3L75 D;  5IY5 1;  4Q5P A;  2PCB B;  2YQB A;  2B12 B;  2AXT V;  2OZ1 B;  1I6D A;  1CYJ A;  5C9M A;  4H0J A;  2C2C A;  1I54 A;  1NNO A;  2C1U A;  4AAN A;  4AAO A;  4AX3 A;  1AOQ A;  3KZI V;  1DW0 A;  4A7P A;  4FAV A;  1NIR A;  3SXT A;  2FYU D;  4EIF A;  3OCD B;  1EB7 A;  5TIS V;  5GTH V;  1CC5 A;  4GYD A;  3O5C A;  3L4O A;  2XTS B;  2RN0 A;  1MG3 D;  1COT A;  1C6R A;  1ZZH A;  3H1L D;  3TF5 A;  4J20 A;  1NTK D;  1H1O A;  2QJY B;  3X39 A;  3HQ6 A;  1COR A;  3DR0 A;  2CA3 B;  2CE1 A;  1DW3 A;  5C0Z A;  1C52 A;  4L3G A;  1KX7 A;  3WFC C;  1W5C T;  4AAM A;  3CYT I;  2B11 B;  2ORL A;  1IRV A;  2MHM A;  4MU8 A;  5DJQ C;  4FB1 A;  1E29 A;  1DVV A;  2L4D A;  1FJ0 A;  3O0R C;  2JWA A;  2N9I A;  3VMA A;  3PH2 B;  2N18 C;  3CWB D;  3PXT A;  1DW2 A;  1GIW A;  3CXH D;  1C7M A;  4WQC A;  2ZON G;  3SJL A;  1CSU A;  2AIU A;  2YCC A;  2GC7 D;  3ORV A;  2Y0E A;  4IL6 V;  1SQB D;  1CRI A;  2BH5 X;  3TDK A;  4PWA A;  3CU4 A;  155C A;  1CHJ A;  1M70 A;  3HQ8 A;  3ZOX A;  1K3G A;  1DW1 A;  3PXS A;  1OCD A;  1NML A;  1DII C;  2JTI B;  1FCD C;  1FHB A;  1KX2 A;  3L74 D;  4DY9 A;  5CIB B;  4WQB A;  2B10 B;  3H1I D;  2N9Y B;  1GU2 A;  2LIR A;  5TJH A;  1HJ4 A;  2YK3 A;  3NBT A;  1RAQ A;  1W2L A;  4O1Q A;  3PRJ A;  4WQE A;  3GW6 A;  3WFD C;  3ITK A;  1CO6 A;  1WVE C;  3BCC D;  1L9B C;  1CIF A;  5KLI B;  1H31 A;  4XXL A;  3RN0 A;  3SWS A;  1E8E A;  1KYO W;  1R0Q A;  1P84 D;  3OCD A;  1ZRT D;  1KV9 A;  3DP5 A;  2BGV X;  4FAN A;  1CRG A;  3A0H V;  3TGU D;  3L70 D;  3CP5 A;  1LS9 A;  1BCC D;  1I5T A;  1DIQ C;  2N9J A;  3RN1 A;  2V08 A;  2L91 A;  3O20 A;  1HRO A;  1QN2 A;  2C9X B;  4WQ8 A;  1CRJ A;  1CYI A;  2Y0D A;  1MG2 D;  2CE0 A;  1CRC A;  4FA5 A;  1S5L V;  3WU2 V;  2I8F A;  1CHI A;  2RMZ A;  4U3F D;  1BGY D;  4PW9 B;  1CIH A;  4V2K A;  2YIU B;  1LMS A;  4GED B;  1IRW A;  1H33 A;  1FI9 A;  4EDF A;  1CSW A;  4WQ7 A;  1PPJ D;  4EID A;  4LJI A;  1YTC A;  2BCC D;  3VNW A;  1H33 B;  1I8O A;  1J3S A;  5CID B;  3SVW A;  1QYZ A;  3CX5 D;  5CIF B;  4FA1 A;  1CCH A;  4WQ9 A;  1F1C A;  3OA8 A;  4UB6 V;  1FI3 A;  5KAI V;  2BLF B;  2C1D A;  1CRH A;  3L72 D;  1PP9 D;  4JCG A;  1L0L D;  4FA4 A;  1BE3 D;  2PCC B;  3O1Y A;  5CIH B;  4RJT A;  1H9Y A;  4WQD A;  1L9J C;  3NWV A;  1NMI A;  3ZCF A;  1CTY A;  1KIB A;  1C2N A;  2A06 D;  1KB0 A;  3HQ9 A;  3ZIY A;  3TYI A;  1LC2 A;  1HRC A;  2ZBO A;  1JDL A;  5KKZ B;  1CCR A;  1BL9 A;  1YNR A;  1A56 A;  2CXB A;  1KB9 D;  1IZL 0;  4L3H A;  2QJK B;  1F1F A;  2N18 B;  3PXW A;  4H0K A;  3PTZ A;  5AUR A;  1CIG A;  1GJQ A;  4Y5R A;  3HQ7 A;  3H1J D;  1H31 B;  4L1Q A;  2D0W A;  3PHL A;  1QKS A;  2Q3E A;  2C1D B;  1SQV D;  4EIE A;  1I8P A;  2CA4 B;  4K3I A;  3ZOO A;  3WFE C;  1C75 A;  1YCC A;  3VRD A;  1VYD A;  1CXC A;  2DVH A;  4QAO A;  2Y0C A;  3PLN A;  5KAF V;  1NU1 D;  5DF5 A;  4WQA A;  1HJ5 A;  1NTZ D;  2C1V A;  2N3Y A;  5CIG B;  1CTJ A;  1CSV A;  2LIT A;  5DJQ B;  2GC4 D;  3VYM A;  3H1H D;  2VHD A;  3CX5 W;  1L0N D;  1HJ3 A;  1DVH A;  1CXA A;  1YEB A;  4PJ0 V;  3JBT B;  2EXV A;  1CNO A;  1M60 A;  1N90 A;  1N50 A;  1CED A;  2QG4 A;  1C2R A;  3GG2 A;  3OA8 B;  5H2F V;  4D6T D;  4XYD B;  5E79 V;  1CRY A;  5B6Q A;  1GDV A;  2K9J B;  3DMI A;  3H1K D;  2B0Z B;  1B7V A;  2BH4 X;  1U74 B;  1EZV D;  1SQX D;  5EXQ A;  2KS1 A;  5CIE B;  1A8C A;  5CYT R;  2KNC B;  5DFS A;  5B66 V;  3SLE A;  2V07 A;  2IBZ D;  4KMG A;  1A2S A;  1ETP A;  1LFM A;  2C8S A;  451C A;  1HZV A;  1AKK A;  1M6Z A;  2PAC A;  3L73 D;  3A0B V;  3WC8 A;  2ZOO A;  1LC1 A;  2ZZS 1;  2ZXY A;  1HZU A;  1CTZ A;  1K3H A;  351C A;  1YFC A;  4O1W A;  2BPB B;  2GB8 B;  1RZ5 A;  4EIC A;  2JQR A;  1AOF A;  1SQQ D;  5KLV D;  1IO3 A;  1H32 B;  3MK7 B;  1GQ1 A;  1CIE A;  3ZOY A;  3A9F A;  2HV4 A;  1AYG A;  1U75 B;  2B4Z A;  2BCN B;  4N0K A;  3ZBM A;  1MZ4 A;  3KHU A;  4RSZ A;  3RLM A;  1QL3 A;  2N3B A;  5B5E V;  3WFB C;  1HH7 A;  5GTI V; 
#chains in the Genus database with same CATH topology
 3H1I G;  1GTW A;  3V2N A;  3NBS A;  4GOD A;  2W83 C;  5CBN A;  1DD4 A;  1J2J B;  3GHG C;  3B8E B;  1YIC A;  1YTZ I;  2QJK C;  3L71 D;  1LP1 B;  1C6S A;  1NO4 A;  1MFT A;  2WQY C;  1RE4 A;  3OW2 O;  1N15 A;  2V4H A;  3HTK A;  2FYN C;  1NU1 J;  1JMB A;  4ASW A;  2BCC E;  2AEJ A;  5KKZ C;  3HE4 B;  5GTH H;  1S6V B;  1EDL A;  3V4W A;  1SQP D;  2W90 A;  1E2R A;  3EFG A;  1FBM A;  5KLV G;  1L4A C;  1NGM B;  1AVY A;  1P84 E;  1CYC A;  2OZ1 A;  2AI5 A;  1FI7 A;  2A45 H;  3M97 X;  1L0L J;  3FWL A;  1FOC A;  3L72 J;  2KIK A;  3GHG B;  2D0S A;  2O3J A;  2WIT A;  1CI6 A;  3D6Z A;  2WPV B;  1HBW A;  2GM4 A;  5CCG A;  1FZG A;  3L75 D;  4Q5P A;  1XTG B;  2E75 C;  2E43 A;  2W8Z A;  4H44 C;  4H0J A;  1NKZ B;  1T6A A;  1I54 A;  1N86 A;  3RBZ A;  4AAO A;  3MZW B;  3L71 G;  4A7P A;  1LT9 A;  1Y9B A;  1JY2 O;  1VQ5 P;  2J59 M;  3OCD B;  1EB7 A;  5TIS V;  1FJP A;  2ITA A;  4PJ0 E;  1W2E A;  1MG3 D;  1S5L E;  1RF0 C;  2FFD B;  1ZZH A;  2NPS B;  1EXI A;  1SQP G;  2NPS A;  3D6Y A;  1BSN A;  1QL1 A;  1LWU C;  5AVT B;  1KIL A;  3CL3 D;  2M0B A;  1H1O A;  1S5L H;  5BU5 A;  1FC2 C;  4PJ0 H;  4NPF X;  2QE7 H;  2B11 B;  3W68 A;  4Y28 J;  3L75 E;  4L75 A;  2IBZ G;  4FB1 A;  1RQV A;  3S9O A;  1G2C A;  1QVF O;  1E29 A;  4R4M A;  3IAO A;  1JY2 P;  3U1C A;  1MUU A;  4YPC A;  3AE1 C;  3HD7 C;  2H7H A;  3LID A;  3RK2 B;  1CSU A;  1Z56 A;  1ZR4 A;  3N7N A;  4IL6 V;  3TGU J;  1EDK A;  3TDK A;  1GZL A;  1SP4 A;  3HQ8 A;  1P84 H;  5AW5 B;  2IDB A;  3AEF C;  5CCG D;  2SPZ A;  3KZI E;  4I7Z B;  3FX0 A;  4DY9 A;  5GTH E;  2LIR A;  3O6Q B;  1KOR A;  2KZJ A;  2KB7 P;  4PD4 H;  3IFM A;  3JSV C;  1W2L A;  4O1Q A;  1FJK A;  3HTK B;  3OAK A;  3WFD C;  1HVV A;  1L0N G;  4PV1 C;  1H31 A;  4PD4 E;  1OX3 A;  4Z1M H;  2ZFC A;  3KZI H;  1H88 A;  1G1I A;  1IFN A;  1U7M A;  3DP5 A;  2BGV X;  4RO0 A;  4FAN A;  3A0H V;  1HGZ A;  3TGU D;  2OYI A;  1LS9 A;  3RL0 B;  3CCE P;  1NOH A;  2YIU C;  1SQQ J;  2XZR A;  1IFM A;  2ZYD A;  1UII A;  2A06 G;  1H8A A;  1U57 A;  5APW A;  3P32 A;  1MG2 D;  2CE0 A;  3A2A A;  4FA5 A;  1YIT P;  3TK1 A;  4OH8 B;  2BEQ D;  1BGY D;  4PW9 B;  1RF1 C;  2MJZ A;  2YIU B;  1M1J C;  4N3Y B;  1YI2 P;  5GTI H;  1Q81 Q;  4EDF A;  4WQ7 A;  1PPJ D;  4EID A;  2P67 A;  1YJW P;  3VNW A;  1OW7 A;  1QYZ A;  1PPJ E;  1MKM A;  3MHV A;  1L0L E;  2Z4E A;  1CCH A;  3P7K A;  4UB6 V;  1FI3 A;  3FGA D;  1SQX J;  2BLF B;  3TGU G;  1FOS F;  4KHX A;  5AW1 B;  4FA4 A;  2E76 B;  4AQR D;  2PCC B;  5CIH B;  1H9Y A;  1IFD A;  3GF3 A;  1NWQ A;  1NTK G;  4DOJ A;  4NPE A;  1KIB A;  3G4S P;  2A06 D;  4JBZ A;  3H1H E;  1NAY A;  3ZIY A;  3TYI A;  3VMX A;  1G2C B;  1JDL A;  1CCR A;  4LC1 A;  4WY4 B;  2CXB A;  2HR3 A;  2OQQ A;  2FXM A;  3BRV B;  1KQG B;  3H32 A;  1S5L X;  2M5A B;  1L4A B;  3HD7 D;  2ZVO B;  2PAJ A;  4HYT B;  1ZXG A;  3L70 J;  3PTZ A;  4EI2 A;  5AUR A;  1CIG A;  1ZOY C;  4OVN F;  1USD A;  3BAS A;  4Y5R A;  1N73 C;  2K3R A;  2KOG A;  4L1Q A;  1M7L A;  3PHL A;  1JTH A;  1ZV8 A;  2Z5H A;  1QKS A;  1SQP J;  3NFQ A;  3JCU E;  2WSE H;  1U7J A;  1SQV D;  3O6Q A;  1I8P A;  2E5T A;  3MIW A;  1CXC A;  2DVH A;  2Y0C A;  1NU1 D;  1PP9 E;  1IK7 A;  2NPS D;  2LR2 A;  1FDM A;  3V6I A;  1M1J B;  2R5D A;  2Q9I A;  5APT A;  3VOP A;  1QVG O;  1BCC E;  3CX5 W;  2YO3 A;  1NTZ K;  1DVH A;  2PP6 A;  3NXS A;  1YEB A;  4R4L A;  3CC4 P;  1IC2 A;  2EXV A;  1CNO A;  1EC5 A;  3GG2 A;  4XYD B;  5E79 V;  1KB9 E;  5B6Q A;  2KZI A;  2NZ2 A;  2H43 A;  2HG5 D;  2BH4 X;  1U74 B;  1E79 H;  3A0H H;  1PZQ A;  3A0B E;  1A8C A;  2E75 D;  5CYT R;  1BGY J;  2OYI B;  2Q6Q A;  1N7S C;  2O01 H;  4L74 A;  2IBZ D;  4KMG A;  3CX5 H;  1KIL C;  1RQU A;  451C A;  2QM7 A;  1HZV A;  1M6Z A;  2PAC A;  2M3E A;  2ZOO A;  1LC1 A;  1K3H A;  2WPR A;  1YFC A;  1M56 D;  3T97 B;  1NHL A;  2RH0 A;  2P2U A;  1PGO A;  4EIC A;  3L73 E;  1SQQ D;  3GHG A;  4CPG A;  1NH4 A;  2ZXE B;  2BEZ F;  3A9F A;  2HV4 A;  1OZH A;  1AYG A;  4N0K A;  2MKV A;  3NTN A;  1MZ4 A;  3KHU A;  1BE3 E;  1SQQ E;  3PP5 A;  2HOD B;  3WFB C;  2OTK E;  3CWB E;  1HH7 A;  2QEX P;  3L71 E;  2FYN B;  3U1A A;  4D6T E;  1J1D C;  3RL0 D;  3V2R A;  2FWL A;  2HYN A;  3S1K A;  4P4Q B;  3TSI A;  5TIS H;  1EZV G;  1OXZ A;  1OFC X;  3MTU E;  4IOI H;  1OAE A;  1X22 A;  1SQX E;  4YE1 A;  1LTJ B;  3IF4 A;  4AUW A;  5EFW B;  4UB8 V;  1NTM K;  4RES B;  3H32 B;  3C2C A;  3WUI A;  4FA9 A;  3CPW O;  1W2B O;  4NPD A;  4PV1 B;  4IFM A;  1L0N K;  1WRG A;  4QMA A;  4UB8 E;  1SLQ A;  2Y9Z A;  1PIX A;  2DW3 A;  2IX7 C;  4LLH A;  3V4Q A;  1RE4 C;  2JO1 A;  1KFM A;  2R3S A;  3IR9 A;  1IQC A;  1EZV I;  1I6E A;  2DGE A;  4NFG B;  2IZ1 A;  2HFE D;  1DT1 A;  3GF7 A;  3B4S A;  2ZAE B;  1OW6 A;  2E76 D;  1LNQ A;  1NKN A;  3B5N A;  3UIA A;  2PCB B;  1KQS O;  3MD0 A;  1N2D C;  2AXT V;  4OGQ C;  1I6D A;  1URQ D;  1FZE A;  2WT7 A;  1PPJ G;  3N4X A;  3M9H A;  1ZR2 A;  4MN4 C;  3A3Y B;  4HB1 A;  1H89 A;  1DW0 A;  1NTZ G;  1GL2 C;  4HKZ H;  5CCH C;  5L8R J;  3AE9 C;  1PP9 J;  4XFJ A;  1QX8 A;  2GUV A;  2J5U A;  1Q2N A;  2O1J A;  4GT1 A;  3L4O A;  2XTS B;  1NTK E;  3MP7 B;  1J1E B;  1YIJ P;  1C6R A;  4BRY A;  4JF7 A;  2FYU K;  1BDC A;  4J20 A;  1JTH B;  5APU A;  3H1I E;  1NTK D;  4WVZ A;  2AXC A;  4PD4 I;  1KYO H;  1M90 Q;  3VP8 A;  4L3G A;  2W6J H;  1KX7 A;  4Y99 C;  3RBX A;  1EXJ A;  2XDJ A;  4AAM A;  3CYT I;  2B88 A;  3VYI A;  2FYZ A;  3M0D C;  5AVR B;  3RL0 g;  1JY3 N;  3Q5P A;  5DJQ C;  3QWO C;  1DVV A;  2IFM A;  3L70 G;  1SQX K;  2UWJ E;  4BRY B;  3VMA A;  3PH2 B;  3CWB D;  2D2C C;  5H2F E;  3CXH D;  2QJP C;  2ZON G;  1LTA C;  3SJL A;  2YXR B;  1LJ2 A;  2AIU A;  2QSI A;  2A45 G;  1AA0 A;  3WMM 0;  2WSS H;  4PWA A;  1EQ7 A;  2WSE J;  1N7S D;  3HE5 B;  1K3G A;  4EIJ A;  1KTM A;  1T3U A;  5B66 E;  1FCD C;  4AYC A;  2N9Y B;  1KX2 A;  5TJH A;  2B10 B;  3H1I D;  3RK3 E;  2ZXX A;  1OWA A;  4N6J A;  2YK3 A;  1R5L A;  3EFF K;  3WU2 H;  3L71 J;  1RAQ A;  3G6E P;  3GW6 A;  1CO6 A;  1L9B C;  3L75 J;  1DEE G;  1CIF A;  3V5B A;  2VRS A;  5KAF H;  3OCD A;  1OVR A;  1ZRT D;  3BCC J;  5AW6 B;  1JY2 N;  3L70 D;  3CP5 A;  2QRX A;  2QVA A;  3CXH H;  4H13 C;  1FDO A;  1SFC B;  1VF5 C;  1CSB A;  2XV5 A;  1FS0 E;  2N9J A;  2V08 A;  4JPZ B;  3M9Q A;  1ZLL A;  1FZA A;  1QN2 A;  2H8P D;  4WQ8 A;  1M1K Q;  1CRJ A;  3FWN A;  1LTJ A;  3AE5 C;  2Y0D A;  2D2C D;  2OGU A;  1CRC A;  1JB0 J;  1S5L V;  2HPC B;  3WU2 V;  1D7M A;  2WPQ A;  2I8F A;  1T8Z A;  1CHI A;  3L75 G;  2RMZ A;  3B5N D;  4U3F D;  3RK2 C;  2B87 A;  3L74 E;  4M3L A;  1KIL D;  1LMS A;  1FZC C;  1H33 A;  1RE3 C;  1DIP A;  3MUD A;  1OW8 A;  4LJI A;  1SQP K;  1PV3 A;  1VQ9 P;  1URQ C;  4YXW H;  3H1J G;  2BCC D;  1EDI A;  4U3F J;  4JYC A;  1J3S A;  1HJ0 A;  5CID B;  3CX5 D;  3PJS K;  4FA1 A;  2W27 A;  5K5G B;  1N7S A;  3CCV P;  3T97 A;  3OA8 A;  5KAI V;  5KLI C;  3R2P A;  1CRH A;  1A02 F;  4JCG A;  5APY A;  2H89 C;  1FE6 A;  4RJT A;  1DH3 A;  5KAI H;  1AFO A;  4WQD A;  3CLQ A;  2XKM A;  1KQL A;  1NMI A;  1GU5 A;  1CTY A;  2KSE A;  1UIX A;  3L36 A;  1L0N E;  2V7Q H;  2JR8 A;  2FY8 A;  4HJG H;  3HUS C;  2ZBO A;  5KKZ B;  1DD3 A;  1YNR A;  2KI7 B;  2YNY A;  1KB9 D;  1Q90 D;  5DJU B;  1JCD A;  2JWD A;  2C9L Y;  4L3H A;  1BGY E;  1IJD B;  3K5B A;  1FZF A;  1FOS E;  2QJK B;  1NTM G;  3OJA B;  5AW9 B;  1F1F A;  2N18 B;  3PXW A;  4H0K A;  1GJQ A;  3RL0 C;  3HQ7 A;  2BCC G;  3H1I J;  3L35 A;  2AXT E;  2D0W A;  5E79 E;  2Q3E A;  2C1D B;  1IFP A;  3CX5 I;  3VTP C;  4KJM A;  3ZOO A;  1C75 A;  3Q1M A;  3VRD A;  3LW5 J;  1JMM A;  2JEE A;  1PP9 G;  3PLN A;  1K05 A;  4Y99 B;  4WY4 D;  4OWF A;  1SQV E;  3B71 A;  3ABV C;  1HH0 A;  4WQA A;  2C1V A;  2N3Y A;  3HE4 A;  5CIG B;  3CWB J;  2GC4 D;  3VYM A;  5AVW B;  5APV A;  1RY3 A;  1CXA A;  4UB6 E;  2YMK A;  1J1E C;  3H1K E;  5BVZ A;  2N1T A;  1N90 A;  1N50 A;  1CED A;  2POH A;  3H1J J;  3BAT A;  1VQK P;  1CRY A;  5B5E H;  1VQ8 P;  1GDV A;  2K9J B;  1OVV A;  4TLF A;  3RK3 B;  3R4Y A;  1KFN A;  5EXQ A;  2KS1 A;  3KQG A;  2K1A A;  2WVR A;  3Q3D A;  2YKP A;  3CCM P;  1FZC A;  3G9R A;  1A2S A;  3SWY A;  1ETP A;  1LFM A;  1AKK A;  1YQ4 C;  3L73 D;  3B5N B;  1KYO I;  1AQ5 A;  2HLO A;  1CTZ A;  2HPC A;  4ASV A;  351C A;  3CWB G;  3W67 A;  4O1W A;  2M5A A;  2BPB B;  1NAF A;  3V2P A;  2Q3I A;  2WPS A;  3CCS P;  1IO3 A;  4YXD C;  2GUS A;  1L4A A;  1S3J A;  2ZVN B;  2IPP A;  4GOE A;  2B4Z A;  3BRT B;  3V2Q A;  4RSZ A;  1QL3 A;  2N3B A;  3TYY A;  2ZT9 D;  1YYC A;  4D6T G;  3L74 G;  5AW0 B;  1WT6 A;  3RMZ A;  2QJP B;  4IL6 H;  5AVY B;  1H32 A;  4ZKP A;  2MTA C;  4GKG A;  3WUU A;  1C6O A;  2FFD C;  3L74 J;  1RE3 A;  1CHH A;  4I6M C;  1X8Y A;  4H13 D;  1YIQ A;  4U3F E;  2NRG A;  4GIF A;  3ZOW A;  2FRC A;  2D2C B;  1M8O B;  4PD4 D;  2ZT9 C;  1VF5 B;  1VQM P;  3CD6 P;  5BU8 B;  1YHQ P;  1YQ3 C;  1KMI Z;  2FBW C;  1RF1 A;  1WEJ F;  3CXH W;  1LTI C;  2BAS A;  1KD1 Q;  1VQL P;  2A06 E;  2OYH A;  2AEM A;  1LP1 A;  3EQ2 A;  3KDP B;  2YO2 A;  1N9C A;  4N78 E;  3L4M A;  5IY5 1;  2OYI C;  3D0W A;  2B12 B;  2KLU A;  3L72 E;  4PV1 D;  1CYJ A;  5C9M A;  3M0D A;  1NNO A;  4AAN A;  4AX3 A;  1AOQ A;  4U7J A;  2N1T D;  4FAV A;  3VN0 A;  4RKU J;  1NIR A;  4DJG A;  1X0T A;  2GA1 A;  2WSF H;  4EIF A;  3M9B A;  1CC5 A;  4GYD A;  1VQO P;  2KUB A;  1FDI A;  2RN0 A;  1EZV E;  4O9B A;  3L72 G;  1GMJ A;  3TF5 A;  2FYU J;  2K88 A;  3D71 A;  3P8C D;  2XNX A;  1VQN P;  3X39 A;  3H1L E;  1COR A;  3C1L A;  3H1J E;  3DR0 A;  2CA3 B;  1DW3 A;  1C52 A;  3BCC G;  3HD7 A;  2KS1 B;  2ORL A;  1IRV A;  5APX A;  1CZQ A;  3CCL P;  2MHM A;  2LKM A;  1S9K E;  1KV4 A;  1S1C X;  3O0R C;  1NJI Q;  1NTM J;  2FFD A;  2N9I A;  3PXT A;  1DW2 A;  1C7M A;  1KN7 A;  4WQC A;  1AJY A;  3ORV A;  2Y0E A;  1SQB D;  3L37 A;  1L4A D;  1QGK B;  1K73 Q;  1CHJ A;  1M70 A;  3H1H J;  3M06 A;  1OCD A;  2FKW B;  2JKV A;  1GDT A;  2G8Y A;  2E42 A;  3AE6 C;  2JTI B;  1FHB A;  4WQB A;  1NTZ J;  4JQ0 D;  1HUC A;  2JJL A;  5DJT B;  1PGJ A;  4C46 A;  4W80 A;  1HJ4 A;  1JUN A;  3NBT A;  1IO4 A;  3B5N C;  4K35 A;  3ITK A;  1NU1 K;  3BCC D;  1N7L A;  3RK3 D;  1LT9 C;  1NVO A;  3RN0 A;  1E8E A;  1KYO W;  1SS1 A;  2WMM A;  5AVU B;  1MFZ A;  1LTS C;  1N7S B;  1CRG A;  2P7J A;  1PL5 A;  1SQB J;  1BCC D;  1I5T A;  5CCG C;  1DIQ C;  1BE3 G;  2PRR A;  3VMY A;  2I1K A;  2L91 A;  3O20 A;  1HRO A;  4WY4 C;  3KYQ A;  5CJ0 A;  2C9X B;  3SFD C;  3A7O A;  2FXO A;  3L73 G;  1S4X A;  5AVX B;  1KIL B;  1HJB A;  3G3Z A;  1T3J A;  4WBA A;  5CHX A;  1CI6 B;  1VL2 A;  1QLE D;  2WSC H;  4GED B;  2IBZ E;  3EWK A;  1FI9 A;  2OTJ P;  1CSW A;  3H1K J;  1PGP A;  2YMY A;  4K3A A;  1YTC A;  3BCC E;  3II6 A;  3LW5 H;  1VQ7 P;  3SVW A;  2J58 A;  3P8C E;  2YKO A;  1K9M Q;  1NTK K;  3HRN A;  1SQV G;  2I8D A;  5CIF B;  4W7Y A;  2LXC B;  2C1D A;  3E1I A;  3MUD C;  1BE3 D;  2IYP A;  4UB6 H;  1L9J C;  2QJY C;  4I7Z C;  1C2N A;  2O01 N;  1KB0 A;  1T2K D;  1EDJ A;  2AEF A;  2KNC A;  1H0T A;  1M57 D;  5AW2 B;  1RHZ B;  1JOC A;  5KLV K;  3SFE C;  1LC2 A;  1HRC A;  3WUV A;  2FXP A;  2HOD A;  2P1J A;  1A56 A;  1BGY G;  3QH9 A;  2R44 A;  3I55 P;  4H0L B;  4WWI A;  5AVS B;  4XE5 B;  1SQV K;  5E79 H;  2FYU E;  3TNU B;  3IN6 A;  1H31 B;  2AXT H;  1AVO A;  3AEB C;  4EIE A;  2CA4 B;  4K3I A;  1GK6 A;  3P8M C;  4L73 A;  1IK9 A;  2WSF J;  1VYD A;  2E74 C;  1GL2 D;  5CCH D;  5AVV B;  5DF5 A;  2P58 A;  1HJ5 A;  3CME P;  1CTJ A;  5AW3 B;  2LIT A;  1LWU B;  5APQ A;  3RK3 C;  1USE A;  5KJ7 C;  4OGQ D;  1K04 A;  4IL6 E;  5KAI E;  2ZJS E;  3JBT B;  3H25 A;  2O01 J;  2Z5I A;  1C2R A;  3OA8 B;  1SQB K;  1LTJ C;  2KK7 A;  2QA4 P;  2PFX A;  1HWT C;  3DMI A;  1GU4 A;  3H1K D;  3CCJ P;  1IFI A;  3HE5 A;  1EZV D;  1HF9 A;  4EYY Q;  4GOF A;  1SQB E;  3GMA A;  1A02 J;  3Q5S A;  5DFS A;  3AEE C;  3CC7 P;  3SLE A;  2V07 A;  4GDO A;  1VDF A;  3L73 J;  2C8S A;  2JP3 A;  1QEX A;  2W6A A;  3KPE A;  2E5Y A;  1BE3 J;  3F89 A;  1RZ5 A;  2JQR A;  2LXB A;  2CPS A;  1R8E A;  2OYO A;  2OYH B;  1GQ1 A;  1K8A Q;  1SQB G;  1Q86 Q;  3ZOY A;  4I2L C;  1U75 B;  3A5T A;  2E74 B;  3ZBM A;  1SQQ K;  3WUT A;  5B5E V;  1LT9 B;  1L0L K;  3PH0 A;  1VPC A;  2KYV A;  2Y9Y A;  5GTI V;  5B5E E;  3M0A A;  1JO5 A;  1YEA A;  1H9X A;  1JY3 P;  3L70 E;  3CCQ P;  1RAP A;  1ZME C;  1HCM A;  1VQP P;  3G71 P;  1DEB A;  5AW8 B;  2C9N Y;  2Q7C A;  5C39 A;  1FAV A;  1KYO D;  1W5C E;  1CSX A;  1RZ6 A;  2RKL A;  3WU2 E;  3AE3 C;  4ZNC A;  3AEG C;  1GW3 A;  1IFJ A;  1LTB C;  2R3C A;  1RH5 B;  1SVF A;  3HD7 B;  3VP9 A;  3RGU A;  3MK7 C;  3KXD A;  2GIW A;  4XA4 A;  1SQQ G;  4AAL A;  1X9V A;  1BCC J;  5AW4 B;  1I55 A;  2R32 A;  4N78 D;  1GKS A;  3CCR P;  1NTM D;  1Q7Y Q;  1S72 P;  1QL4 A;  1KB9 I;  3C9I A;  5CIC B;  1NTZ E;  3AEC C;  1GL2 B;  2YQB A;  1BSH A;  4B86 A;  2OZ1 B;  1LTG C;  3L4F A;  2B89 A;  2XND H;  2C2C A;  2C1U A;  2N1T C;  1LWU A;  2M8R A;  3KZI V;  5KLV J;  4I1L A;  3SXT A;  2FYU D;  5GTH V;  1OVU A;  3O5C A;  4H0L D;  5KTB A;  3C8V A;  3SSU A;  3JC2 2;  1COT A;  1QL2 A;  3H1L D;  2BCC J;  2K9Y A;  1NYH A;  1MV8 A;  1NTK J;  3U59 A;  2IZ0 A;  3FXE A;  4H0L C;  2QJY B;  4YTP C;  3HQ6 A;  2E75 B;  2CE1 A;  5C0Z A;  1TU3 F;  4H44 B;  3WFC C;  3CCU P;  2R5B A;  1LTT C;  1W5C T;  4D6T J;  1KC8 Q;  2WTY A;  4BWN A;  1YBK A;  4MU8 A;  2WZ7 A;  1L0N J;  1NU1 E;  3HUS B;  2L4D A;  1FJ0 A;  2JWA A;  3FXD A;  4TT3 H;  1PFI A;  1L2P A;  2N18 C;  4C7R A;  1BDD A;  1GIW A;  3HUS A;  3AE2 C;  1XTC C;  2FYU G;  2YCC A;  2GC7 D;  1CRI A;  2BH5 X;  3AEA C;  1LT1 A;  3CU4 A;  155C A;  3CXH E;  1YJN P;  3ZOX A;  1VQ4 P;  1DW1 A;  3PXS A;  5APS A;  1NU1 G;  1NML A;  1DII C;  1Q82 Q;  1IZN B;  2ZT9 B;  3L74 D;  5CIB B;  1GW4 A;  1GU2 A;  5KAF E;  1JEK A;  3PRJ A;  4WQE A;  1GD2 E;  1G1J A;  1ZRT E;  1WVE C;  2WSC J;  5CBO A;  1YJ9 P;  5KLI B;  1R5S A;  4XXL A;  4JYB A;  2IBZ I;  3SWS A;  1R0Q A;  1P84 D;  3CMA P;  3AED C;  1KV9 A;  1NTM E;  5B66 H;  1ZP0 C;  3D70 A;  1Y8A A;  3H1K G;  3CXH I;  3RN1 A;  2YXQ B;  3I5C A;  2E74 D;  2K9J A;  5H2F H;  1CYI A;  2B87 B;  1URQ A;  1P84 I;  4C7N B;  3TNU A;  1URQ B;  1LGH B;  1CW5 A;  2V7Q J;  4IFD K;  5CMZ A;  1CIH A;  4V2K A;  3Q2Y A;  1IRW A;  4WY4 A;  3CX5 E;  2G3A A;  2WWW A;  1VQ6 P;  3A0B H;  3CI9 A;  1KYO E;  1SFC A;  3A0H E;  1H33 B;  1I8O A;  2IFN A;  2QIW A;  3Q5R A;  2IYO A;  3VMZ A;  2M3B A;  1T2K C;  4WQ9 A;  1F1C A;  1SQP E;  2OTL P;  2A45 I;  1JM0 A;  3E7K A;  1KB9 H;  3USS A;  3L72 D;  1PP9 D;  3H6P A;  1L0L D;  2OYH C;  2E76 C;  3O1Y A;  1S2E A;  1N73 A;  2YKQ A;  3NWV A;  1YTZ T;  2O1K A;  2C0W A;  1DX7 A;  3ZCF A;  3F5H A;  2KLV A;  1M1J A;  1RF1 B;  3HQ9 A;  1KZU B;  3H1H G;  1SFC D;  4EOT A;  5AVZ B;  1BL9 A;  1AV1 A;  4IFF A;  4W7Z A;  1WMK A;  4U3F G;  1PGQ A;  4DCK A;  1FU1 A;  1IZL 0;  4BXL A;  2CPB A;  1JCC A;  3AE8 C;  3JCU H;  4IL6 X;  1SQX G;  3H1J D;  1E5W A;  2ZYG A;  2XU6 A;  1SQV J;  4DZO A;  1OMI A;  1ZN5 A;  1VF5 D;  4KT0 J;  2CK3 H;  3WFE C;  1YCC A;  3S4R A;  4UB8 H;  4QAO A;  5KJ7 D;  4HH2 A;  5KAF V;  1Y47 A;  1L0L G;  1X79 B;  1NTZ D;  2Q1K A;  1CSV A;  2W6B A;  1J1D B;  5DJQ B;  4H44 D;  5AVQ B;  4ZMD A;  1JNM A;  2ZYA A;  2N1T B;  3RK2 D;  3H1H D;  3GLM A;  2VHD A;  3OA7 A;  2JDI H;  4DT0 A;  1L0N D;  3M91 A;  5TIS E;  1HJ3 A;  2C0X A;  2B9B A;  3H1L G;  4PJ0 V;  1S9K D;  5AW7 B;  1M60 A;  3BVH A;  2KXP B;  2QG4 A;  3AE4 C;  5H2F V;  4D6T D;  1HGV A;  1FZB A;  5KJ7 A;  2H88 C;  3E1R A;  3SWF A;  1JY3 O;  2B0Z B;  1B7V A;  1BCC G;  1FZC B;  1SFC C;  1SQX D;  2P10 A;  5CIE B;  4WB4 A;  2QM8 A;  2KNC B;  1H0T B;  5B66 V;  1KIL E;  2PGD A;  1ZW0 A;  4OGQ B;  3H1L J;  1KQF B;  5GTI E;  3O8Z A;  3NMD A;  2KP8 A;  1N73 B;  1GL2 A;  5CCH A;  3A0B V;  3WC8 A;  2L5G B;  2K37 A;  5KLV E;  2ZZS 1;  4LGD E;  1MZ9 A;  2ZXY A;  1HZU A;  4C7N A;  1AQT A;  3AE7 C;  4H13 B;  3TGU E;  1GK4 A;  4L76 A;  1OIP A;  2GB8 B;  3LIE A;  1AOF A;  5KLV D;  3ZDM A;  1H32 B;  3MK7 B;  3MGN A;  1CIE A;  2OAR A;  5M1B A;  2N9B A;  1N8R Q;  2BCN B;  1HTL C;  2KSJ A;  1RF0 A;  3RLM A;  2I1J A;  4ZKU A;  2NPS C;  3CC2 P;  2Q5U A;  3SWK A;  5CJ4 A;  2WT7 B;  3I56 P; 
#chains in the Genus database with same CATH homology
 1YEA A;  2FYN B;  1H9X A;  3NBS A;  2FWL A;  1RAP A;  4P4Q B;  1HCM A;  1YIC A;  3RMZ A;  2QJP B;  3L71 D;  1H32 A;  1C6S A;  1OAE A;  4YE1 A;  2MTA C;  1C6O A;  1N15 A;  4UB8 V;  1CHH A;  1KYO D;  1CSX A;  1RZ6 A;  3C2C A;  3WUI A;  4FA9 A;  1YIQ A;  1S6V B;  1SQP D;  3ZOW A;  2FRC A;  1E2R A;  3MK7 C;  2GIW A;  4PD4 D;  1IQC A;  4AAL A;  1I6E A;  1I55 A;  1CYC A;  2OZ1 A;  1GKS A;  1WEJ F;  2AI5 A;  1FI7 A;  3CXH W;  3M97 X;  1NTM D;  3FWL A;  2DGE A;  4NFG B;  1FOC A;  1QL4 A;  1DT1 A;  2D0S A;  2O3J A;  5CIC B;  1N9C A;  3L4M A;  3L75 D;  5IY5 1;  4Q5P A;  2PCB B;  2YQB A;  2B12 B;  2AXT V;  2OZ1 B;  1I6D A;  1CYJ A;  5C9M A;  4H0J A;  2C2C A;  1I54 A;  1NNO A;  2C1U A;  4AAN A;  4AAO A;  4AX3 A;  1AOQ A;  3KZI V;  1DW0 A;  4A7P A;  4FAV A;  1NIR A;  3SXT A;  2FYU D;  4EIF A;  3OCD B;  1EB7 A;  5TIS V;  5GTH V;  1CC5 A;  4GYD A;  3O5C A;  3L4O A;  2XTS B;  2RN0 A;  1MG3 D;  1COT A;  1C6R A;  1ZZH A;  3H1L D;  3TF5 A;  4J20 A;  1NTK D;  1H1O A;  2QJY B;  3X39 A;  3HQ6 A;  1COR A;  3DR0 A;  2CA3 B;  2CE1 A;  1DW3 A;  5C0Z A;  1C52 A;  4L3G A;  1KX7 A;  3WFC C;  1W5C T;  4AAM A;  3CYT I;  2B11 B;  2ORL A;  1IRV A;  2MHM A;  4MU8 A;  5DJQ C;  4FB1 A;  1E29 A;  1DVV A;  2L4D A;  1FJ0 A;  3O0R C;  2JWA A;  2N9I A;  3VMA A;  3PH2 B;  2N18 C;  3CWB D;  3PXT A;  1DW2 A;  1GIW A;  3CXH D;  1C7M A;  4WQC A;  2ZON G;  3SJL A;  1CSU A;  2AIU A;  2YCC A;  2GC7 D;  3ORV A;  2Y0E A;  4IL6 V;  1SQB D;  1CRI A;  2BH5 X;  3TDK A;  4PWA A;  3CU4 A;  155C A;  1CHJ A;  1M70 A;  3HQ8 A;  3ZOX A;  1K3G A;  1DW1 A;  3PXS A;  1OCD A;  1NML A;  1DII C;  2JTI B;  1FCD C;  1FHB A;  1KX2 A;  3L74 D;  4DY9 A;  5CIB B;  4WQB A;  2B10 B;  3H1I D;  2N9Y B;  1GU2 A;  2LIR A;  5TJH A;  1HJ4 A;  2YK3 A;  3NBT A;  1RAQ A;  1W2L A;  4O1Q A;  3PRJ A;  4WQE A;  3GW6 A;  3WFD C;  3ITK A;  1CO6 A;  1WVE C;  3BCC D;  1L9B C;  1CIF A;  5KLI B;  1H31 A;  4XXL A;  3RN0 A;  3SWS A;  1E8E A;  1KYO W;  1R0Q A;  1P84 D;  3OCD A;  1ZRT D;  1KV9 A;  3DP5 A;  2BGV X;  4FAN A;  1CRG A;  3A0H V;  3TGU D;  3L70 D;  3CP5 A;  1LS9 A;  1BCC D;  1I5T A;  1DIQ C;  2N9J A;  3RN1 A;  2V08 A;  2L91 A;  3O20 A;  1HRO A;  1QN2 A;  2C9X B;  4WQ8 A;  1CRJ A;  1CYI A;  2Y0D A;  1MG2 D;  2CE0 A;  1CRC A;  4FA5 A;  1S5L V;  3WU2 V;  2I8F A;  1CHI A;  2RMZ A;  4U3F D;  1BGY D;  4PW9 B;  1CIH A;  4V2K A;  2YIU B;  1LMS A;  4GED B;  1IRW A;  1H33 A;  1FI9 A;  4EDF A;  1CSW A;  4WQ7 A;  1PPJ D;  4EID A;  4LJI A;  1YTC A;  2BCC D;  3VNW A;  1H33 B;  1I8O A;  1J3S A;  5CID B;  3SVW A;  1QYZ A;  3CX5 D;  5CIF B;  4FA1 A;  1CCH A;  4WQ9 A;  1F1C A;  3OA8 A;  4UB6 V;  1FI3 A;  5KAI V;  2BLF B;  2C1D A;  1CRH A;  3L72 D;  1PP9 D;  4JCG A;  1L0L D;  4FA4 A;  1BE3 D;  2PCC B;  3O1Y A;  5CIH B;  4RJT A;  1H9Y A;  4WQD A;  1L9J C;  3NWV A;  1NMI A;  3ZCF A;  1CTY A;  1KIB A;  1C2N A;  2A06 D;  1KB0 A;  3HQ9 A;  3ZIY A;  3TYI A;  1LC2 A;  1HRC A;  2ZBO A;  1JDL A;  5KKZ B;  1CCR A;  1BL9 A;  1YNR A;  1A56 A;  2CXB A;  1KB9 D;  1IZL 0;  4L3H A;  2QJK B;  1F1F A;  2N18 B;  3PXW A;  4H0K A;  3PTZ A;  5AUR A;  1CIG A;  1GJQ A;  4Y5R A;  3HQ7 A;  3H1J D;  1H31 B;  4L1Q A;  2D0W A;  3PHL A;  1QKS A;  2Q3E A;  2C1D B;  1SQV D;  4EIE A;  1I8P A;  2CA4 B;  4K3I A;  3ZOO A;  3WFE C;  1C75 A;  1YCC A;  3VRD A;  1VYD A;  1CXC A;  2DVH A;  4QAO A;  2Y0C A;  3PLN A;  5KAF V;  1NU1 D;  5DF5 A;  4WQA A;  1HJ5 A;  1NTZ D;  2C1V A;  2N3Y A;  5CIG B;  1CTJ A;  1CSV A;  2LIT A;  5DJQ B;  2GC4 D;  3VYM A;  3H1H D;  2VHD A;  3CX5 W;  1L0N D;  1HJ3 A;  1DVH A;  1CXA A;  1YEB A;  4PJ0 V;  3JBT B;  2EXV A;  1CNO A;  1M60 A;  1N90 A;  1N50 A;  1CED A;  2QG4 A;  1C2R A;  3GG2 A;  3OA8 B;  5H2F V;  4D6T D;  4XYD B;  5E79 V;  1CRY A;  5B6Q A;  1GDV A;  2K9J B;  3DMI A;  3H1K D;  2B0Z B;  1B7V A;  2BH4 X;  1U74 B;  1EZV D;  1SQX D;  5EXQ A;  2KS1 A;  5CIE B;  1A8C A;  5CYT R;  2KNC B;  5DFS A;  5B66 V;  3SLE A;  2V07 A;  2IBZ D;  4KMG A;  1A2S A;  1ETP A;  1LFM A;  2C8S A;  451C A;  1HZV A;  1AKK A;  1M6Z A;  2PAC A;  3L73 D;  3A0B V;  3WC8 A;  2ZOO A;  1LC1 A;  2ZZS 1;  2ZXY A;  1HZU A;  1CTZ A;  1K3H A;  351C A;  1YFC A;  4O1W A;  2BPB B;  2GB8 B;  1RZ5 A;  4EIC A;  2JQR A;  1AOF A;  1SQQ D;  5KLV D;  1IO3 A;  1H32 B;  3MK7 B;  1GQ1 A;  1CIE A;  3ZOY A;  3A9F A;  2HV4 A;  1AYG A;  1U75 B;  2B4Z A;  2BCN B;  4N0K A;  3ZBM A;  1MZ4 A;  3KHU A;  4RSZ A;  3RLM A;  1QL3 A;  2N3B A;  5B5E V;  3WFB C;  1HH7 A;  5GTI V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...