1SQXD

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqxD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqxD02
1CO6A 4EIFA 2MHMA 3OCDA 3WU2V 2YK3A 2KNCB 2N3BA 4FAVA 1J3SA 2AXTV 1HJ4A 1H9YA 4WQDA 3HQ6A 2A06D 1DW3A 1CYJA 1CTYA 2BH5X 1CXAA 2N18C 4P4QB 451CA 3SWSA 5CICB 2O3JA 1AOQA 3PTZA 2D0SA 4FA5A 3O20A 3ZOOA 4WQBA 1CXCA 2N9IA 1OCDA 3WC8A 3KHUA 4H0KA 1ZZHA 1NNOA 1YICA 1MG3D 4WQ7A 1E8EA 4WQ9A 1N9CA 1AKKA 1AOFA 1KX2A 1W2LA 3OA8B 1LFMA 1NMLA 2L91A 4O1QA 4UB6V 1L0ND 2CA4B 3H1JD 1HH7A 1DVVA 3L73D 4PJ0V 3WFDC 1A8CA 4L3GA 1FI7A 3KZIV 3PXSA 5DFSA 3MK7C 1EZVD 4L1QA 1YNRA 4FA4A 1S5LV 5CIFB 2FYUD 5B6QA 1I6EA 4N0KA 1HZVA 1SQVD 3WUIA 1FJ0A 1KIBA 1PPJD 2KS1A 5CIDB 1B7VA 4FA9A 2CE1A 3TF5A 3VMAA 2MTAC 3L4MA 1CRCA 2RMZA 1FOCA 2JTIB 2C1DB 3PH2B 1KB9D 2DGEA 1C75A 1W5CT 4GYDA 2BLFB 2QJYB 1CHJA 1SQBD 5DJQB 3H1LD 4FANA 1KX7A 1R0QA 4AX3A 1NMIA 1RAPA 3SJLA 4EIEA 3PLNA 3L70D 4XXLA 4K3IA 1JDLA 2FRCA 1YCCA 2XTSB 1HJ3A 2FYNB 1IZL0 1H32A 5KLIB 4IL6V 1CSUA 1ETPA 2ZOOA 1DW0A 1BE3D 1U75B 1GIWA 351CA 2LITA 1C2RA 4PD4D 2CE0A 1NTZD 3GW6A 1LC2A 1F1CA 2K9JB 1CCRA 2Y0DA 2VHDA 5CIBB 1KYOW 3CXHW 4UB8V 2B12B 4YE1A 1QL3A 4J20A 4FB1A 1QN2A 3O1YA 2OZ1B 3PXTA 2JWAA 1H31B 3O5CA 4PW9B 2QG4A 2GIWA 1KYOD 1IO3A 2ZBOA 3CXHD 1CRGA 1CTJA 1F1FA 3WFBC 2BPBB 1M6ZA 3VNWA 3OA8A 1HROA 2V08A 1CHIA 1E29A 2N9YB 1I55A 3FWLA 2YQBA 2C8SA 2N3YA 2BCCD 1P84D 1NTKD 3SLEA 1FI3A 3DR0A 1YEAA 1CEDA 3BCCD 3OCDB 1H9XA 1BGYD 1N50A 1DW2A 4H0JA 1NIRA 3L4OA 1FI9A 1NTMD 3HQ9A 2C1VA 1HZUA 2QJPB 2AI5A 4EICA 3A0HV 1HCMA 3ORVA 1QYZA 1L9BC 3CP5A 3ZOWA 2C1DA 1WEJF 3ZIYA 1YFCA 5GTIV 3PRJA 2Y0CA 1SQQD 1CTZA 1PP9D 1IRVA 1MG2D 5CIGB 1M70A 1N15A 1KV9A 5KAFV 2Y0EA 1A2SA 3HQ7A 5TJHA 1SQPD 3CYTI 4PWAA 2N18B 3CX5W 1COTA 1I5TA 2CXBA 1KB0A 1C6OA 2C9XB 2ZONG 3SXTA 1FHBA 3X39A 1CSWA 3CX5D 3ZOXA 3C2CA 1CSXA 3H1ID 3RLMA 2FWLA 3DP5A 1IQCA 4LJIA 3ZBMA 3CU4A 1C2NA 2B11B 3M97X 3H1HD 3NWVA 1E2RA 2L4DA 1L9JC 1CIFA 5KKZB 1CIEA 3JBTB 3RMZA 5H2FV 1C6SA 3O0RC 1BCCD 2GC7D 5EXQA 1LS9A 2N9JA 5CIEB 3TYIA 4A7PA 3L71D 4Q5PA 1HRCA 3WFEC 3MK7B 2Q3EA 2BCNB 4GEDB 3ZOYA 1DW1A 1WVEC 2ZZS1 5B5EV 2YCCA 2GC4D 1H1OA 1S6VB 1DVHA 3SVWA 3WFCC 1M60A 4WQ8A 2PCCB 3RN0A 4AALA 4D6TD 1CNOA 5B66V 1CC5A 1H32B 2RN0A 2IBZD 2I8FA 1L0LD 2C2CA 3A9FA 2EXVA 5DF5A 3VRDA 2PCBB 1H33B 1CHHA 5IY51 1HJ5A 1CORA 2HV4A 1OAEA 5DJQC 2ORLA 2BGVX 2D0WA 3GG2A 2DVHA 5AURA 5KAIV 1GDVA 1QL4A 3RN1A 4EIDA 4AAOA 1LC1A 1AYGA 2LIRA 2PACA 1C7MA 5C0ZA 2V07A 3ZCFA 3HQ8A 1CIHA 1CRIA 155CA 2JQRA 4L3HA 4RSZA 1C52A 3H1KD 1ZRTD 1CRYA 2ZXYA 1YIQA 1CCHA 3L75D 2C1UA 1YEBA 3L72D 1SQXD 2B0ZB 4MU8A 4DY9A 1RAQA 1I8OA 4Y5RA 1NU1D 5GTHV 3TGUD 3VYMA 2B10B 1A56A 1CSVA 3PXWA 5CYTR 5KLVD 4AAMA 2YIUB 1DT1A 1U74B 4AANA 2GB8B 2AIUA 1K3GA 2BH4X 5CIHB 1CYIA 1I6DA 1GJQA 1MZ4A 1K3HA 1CIGA 1GKSA 1QKSA 4NFGB 1EB7A 3DMIA 1I54A 1YTCA 4KMGA 3CWBD 1BL9A 1DIIC 1CRJA 1GU2A 2B4ZA 3NBTA 1N90A 4V2KA 1RZ5A 4O1WA 1IRWA 1CRHA 2OZ1A 4QAOA 4U3FD 5E79V 1H31A 1LMSA 3PHLA 3NBSA 1VYDA 3A0BV 1DIQC 4XYDB 3ITKA 2QJKB 5C9MA 2CA3B 3TDKA 5TISV 4WQCA 1FCDC 1RZ6A 1CYCA 4RJTA 4WQAA 4FA1A 1GQ1A 4WQEA 1H33A 1C6RA 1I8PA 4JCGA 4EDFA 3L74D
chains in the Genus database with same CATH superfamily
1SQPK 3II6A 3QWOC 2MHMA 1L0LE 1AA0A 5AW4B 3KZIH 1ZOYC 2A45I 3B5ND 2P58A 3IR9A 4K3AA 4FAVA 2AXTV 1HJ4A 2WQYC 2W6BA 3H1LG 1CTYA 2BH5X 1CXAA 451CA 1AOQA 1RF0C 3PTZA 2D0SA 4FA5A 1JMBA 1URQC 2GM4A 5KAFH 3TNUB 4C7NA 1NNOA 2QIWA 1MG3D 5GTIE 3E1RA 1N9CA 1SQXE 1ZN5A 1BCCJ 1BE3G 1AKKA 1HF9A 5BVZA 2HODB 4GT1A 3L74G 1KX2A 3MGNA 1KILC 1NHLA 2C0WA 3AECC 3CX5H 5KKZC 3M9HA 4O1QA 1XTGB 2ZFCA 4PV1B 2CA4B 3H1JD 1HH7A 1DVVA 1SQPE 3I56P 1H89A 3WFDC 2FKWB 1FE6A 3U59A 1FI7A 1PFIA 4AQRD 1IFDA 1DIPA 2PP6A 3FX0A 1G1JA 5H2FH 5AVRB 2C9NY 4ASWA 2M8RA 1SQVD 1D7MA 3IF4A 3P8CD 4NPEA 5CIDB 3H1IE 3CWBE 4JQ0D 1ZMEC 1YTZI 4LGDE 2W83C 1KQGB 3MHVA 1FOCA 3H1HE 2JTIB 5B5EH 1KB9D 4W7YA 1C75A 4H13D 1GDTA 4U3FE 5KJ7A 1FDOA 3A0BE 2R32A 1N86A 3CXHH 4FANA 1KX7A 4L73A 4WB4A 1HUCA 4AX3A 1QVFO 5TISE 1L0NG 4EIEA 3H32B 2J59M 4K3IA 1P84H 1JDLA 1NH4A 1VL2A 4OWFA 1CSUA 1M1JA 3OAKA 5APUA 2ZOOA 2HG5D 1U75B 2CE0A 5B66E 5KLVK 3VMYA 1JUNA 1MUUA 1BDDA 2VHDA 5CIBB 3V2RA 1LWUC 3CXHW 1VQ5P 2B12B 3QH9A 2PFXA 3T97A 1L4AB 4Z1MH 1QN2A 1KQSO 2Q9IA 1H31B 1SQBG 2ZJSE 1NKNA 3KPEA 2QG4A 1KYOD 1IO3A 1CTJA 1EDLA 2YO3A 1M6ZA 3VNWA 3LW5H 4WY4C 3S4RA 5APTA 3CLQA 3I55P 2C8SA 3Q1MA 3PP5A 3RL0C 1LT9C 2E74C 1NTZG 1N50A 4EIJA 4H0JA 1L2PA 2RKLA 2ZT9C 1OVRA 5KLVE 3HQ9A 4EICA 3A0HV 2ITAA 4JBZA 3SWKA 2C1DA 2QA4P 1NWQA 1YFCA 1VQPP 1SQQD 3CCQP 2E76D 3G9RA 1CTZA 1YJ9P 1IRVA 1MG2D 4H0LC 1HJ0A 5AW5B 5K5GB 1OVVA 5BU5A 2JP3A 1AJYA 2IX7C 1KV9A 5KAFV 2Y0EA 1ZXGA 1NKZB 2KXPB 2BCCG 2KYVA 1SQPD 3H1LE 5TJHA 2FFDC 3CYTI 2B87B 2LXBA 5E79E 3SFDC 1GD2E 2YO2A 3BCCG 1FJPA 2KZIA 3CCVP 1BGYG 4NPFX 2CXBA 1USDA 2NPSC 2ZONG 3CD6P 4R4MA 1N7SC 1OWAA 2Q7CA 3C2CA 4JF7A 3IAOA 3H1ID 1M7LA 3VP8A 1K8AQ 1R5LA 2K9JA 1BE3E 2B11B 1GL2B 3H1HD 3TGUJ 5KAIH 2KS1B 2HPCA 2OYHC 3L74E 1L0NK 3H1JJ 3S9OA 3TYYA 1KILB 3KYQA 1PP9G 5KKZB 1E79H 1LTGC 4HH2A 1CIEA 2Z5IA 2H7HA 5H2FV 5EXQA 1PIXA 1U7MA 2Z4EA 2N9JA 1DH3A 5M1BA 3RBZA 1JM0A 1XTCC 1KB9I 1UIIA 3RK2C 1U7JA 4Y99C 1RQUA 3WFEC 1SQVJ 3A5TA 2YIUC 4GEDB 3ZOYA 5AVUB 3H25A 3KQGA 1WVEC 2ZZS1 5B5EV 4W7ZA 3D70A 4UB6H 2RH0A 1DVHA 3AEEC 3SVWA 3HUSC 4PJ0H 4WQ8A 2N1TC 2PCCB 2K1AA 1NO4A 1CNOA 1SQBK 1N73A 1H32B 1YIJP 2PAJA 2XDJA 3HD7D 4YXDC 2LR2A 1H33B 1CHHA 1HJ5A 1IJDB 2UWJE 1FS0E 2WT7A 4M3LA 2HV4A 1GU5A 2XZRA 2KSJA 2BGVX 4RKUJ 1GDVA 1QL4A 1L0NE 1RF1C 4EIDA 2KI7B 1LC1A 1AYGA 3KZIE 1QX8A 2QJKC 3HQ8A 2OGUA 2QVAA 3GHGB 3AE3C 1ZLLA 1IFMA 1KYOI 2IZ1A 1C52A 5KLIC 1YQ3C 2C1UA 1YEBA 3Q5RA 2ZVOB 3RK3E 4DJGA 4TLFA 1MZ9A 1JNMA 5KAFE 4Y5RA 3G6EP 1KC8Q 5CCHC 3KDPB 2IBZG 1CSVA 2BASA 5KLVD 1DT1A 1SQBE 1AQ5A 2N9BA 3CCEP 4AANA 4IOIH 3U1AA 2BH4X 1HGZA 3CX5E 3JC22 1MZ4A 1K3HA 3MTUE 4NFGB 4UB8H 1EB7A 2AXTH 4WY4B 2J58A 1FDMA 1YTCA 3R4YA 1OXZA 1IFJA 1BL9A 1RE4A 1DIIC 1CRJA 3H1KG 1GU2A 3NBTA 3V6IA 3L75G 5H2FE 3CMEP 3L72G 1RZ5A 1X0TA 4O1WA 1LT9B 4QAOA 3L71E 2XV5A 3PHLA 3ITKA 1VQ7P 5B5EE 3RL0g 1SQQJ 2QRXA 1FCDC 3MUDC 1NU1K 1CYCA 3BVHA 3NFQA 1RY3A 2MJZA 1S4XA 1KD1Q 2AEMA 1FZCC 3L74D 2XKMA 1SQPJ 3M9BA 1T8ZA 3PJSK 3WU2V 4BRYA 2KNCB 3P7KA 3CWBG 2BCCE 1P84E 1J3SA 2FFDB 4WQDA 1ZR2A 2IPPA 2A06D 2R44A 1LP1A 2N18C 1BGYE 2O3JA 3H1IJ 4U3FG 2YNYA 1NAYA 5CBNA 2OYHA 1MKMA 1GZLA 1CXCA 2N9IA 1HJBA 1YQ4C 2WSFH 2K37A 1N7SB 1OCDA 1FZGA 2OARA 4CPGA 4H0KA 1YICA 1SFCC 3OW2O 1KILE 3L35A 2Q6QA 3VYIA 1NU1E 1PP9E 1S9KD 1W2LA 1LFMA 3H6PA 1NMLA 5CCGC 1NAFA 4UB6V 1N2DC 2W90A 1L0ND 1IK9A 3AEBC 5AVXB 3L73D 5CBOA 4PJ0V 1EQ7A 5DFSA 3SWYA 1L4AC 1YNRA 4FA4A 1I6EA 1HZVA 3C1LA 3HUSB 2FBWC 3WUIA 1KIBA 2KLVA 1R5SA 3RK3D 4FA9A 3WMM0 2OYOA 2V4HA 1CI6A 4HYTB 2MTAC 1H0TA 3B4SA 5L8RJ 2ZYGA 1BDCA 1K73Q 3GLMA 4DOJA 3E7KA 1S2EA 1SQBD 2WSCJ 3C8VA 1R0QA 2E75D 1OX3A 2PGDA 2G3AA 1NYHA 3CC7P 3CL3D 1G2CB 4OGQB 5AVYB 1MFZA 3BRVB 1YCCA 5KLIB 3EFFK 4IL6V 1DW0A 2R5BA 2D2CC 1C2RA 5KLVJ 1NTZD 1EDKA 1HTLC 2IBZE 1F1CA 2KB7P 3A0HH 1YBKA 3S1KA 2IZ0A 3B5NC 3R2PA 2V7QJ 4UB8V 4AYCA 1PZQA 4YE1A 1QL3A 2XNDH 2JEEA 2OZ1B 1T6AA 2QSIA 2JWAA 5KAIE 2C9LY 3JSVC 3VTPC 3VOPA 2GIWA 1S3JA 4IFMA 3CXHD 2WSEJ 1F1FA 5CMZA 2B89A 2V08A 1CHIA 1Y9BA 3H1KE 3HTKB 1OIPA 1ZRTE 3L36A 4K35A 3L75E 2YQBA 3L72E 2BCCD 1P84D 4KJMA 1GL2C 4U7JA 4UB6E 1FI3A 3DR0A 3W68A 2YKOA 3BCCD 1H9XA 1URQD 1BCCG 1BGYD 2WPVB 2Q1KA 2ZVNB 4PJ0E 3L4OA 3FGAD 1FDIA 3EFGA 2AI5A 1ZW0A 1J1EC 1HCMA 3ORVA 1KZUB 3L74J 4AUWA 3FXEA 1L9BC 3WUVA 4ZNCA 2Y0CA 1FZCB 3V4QA 4C7NB 1PP9D 1M70A 2B9BA 1LTSC 1N15A 1NGMB 1NOHA 3K5BA 3HQ7A 1NTKG 4I6MC 1VQ6P 5AVVB 2YKQA 4PWAA 2N18B 3CX5W 1COTA 2M5AA 1S72P 1A02F 2FXMA 4ZKPA 2BEQD 1JB0J 3FWNA 1CSXA 1LTIC 3RLMA 2FWLA 1SFCB 3GHGC 3Q3DA 1QGKB 1L0NJ 2L4DA 1VF5D 5AVWB 2WZ7A 5AVTB 3L73J 1FOSE 1YI2P 1L9JC 4GKGA 3JBTB 4UB8E 3IN6A 3TSIA 2AXTE 1LS9A 3TYIA 4A7PA 5BU8B 1UIXA 5APVA 1HRCA 2K9YA 1W2BO 2QM8A 2Q3EA 2BCNB 2WSSH 1PGQA 1DW1A 4HKZH 2YCCA 3GMAA 2GC4D 1H1OA 3AEGC 1EXIA 1WMKA 1DEBA 1GMJA 1M60A 3M9QA 1CC5A 1SQBJ 1JY2O 1J2JB 2IBZD 2I8FA 1M1JB 1DX7A 3P8MC 1L0LD 2EXVA 4HJGH 5IY51 2OYIA 4OVNF 1HH0A 1CORA 2JDIH 1OAEA 5DJQC 2ORLA 3GG2A 3PH0A 5AURA 3NXSA 1JTHB 4HB1A 2PACA 1LTJA 3JCUH 3T97B 3L71G 1N7LA 1QL1A 1FJKA 1CRIA 3HE5A 1NTZJ 3NTNA 4DCKA 3RL0D 1BSHA 2JR8A 3H1KD 3CXHI 1ZRTD 2ZXYA 1YIQA 1CCHA 3L75D 2E74D 3L72D 1JMMA 2D2CB 1SQXD 2B87A 2B0ZB 2ZT9D 1RF0A 5GTHV 4D6TG 5KTBA 4LC1A 3LIEA 1A56A 1URQA 5DJUB 3B5NB 3BRTB 1P84I 2E43A 1SVFA 3B8EB 1X22A 1U74B 1OW7A 3BATA 2GB8B 3V4WA 1K3GA 1GL2A 1GU4A 4XFJA 1I6DA 3CCUP 3WU2H 1CIGA 2B88A 3CC4P 4H0LD 4O9BA 2BCCJ 1QKSA 1NTKK 1KILA 1I54A 3BCCJ 3CWBD 1BGYJ 1LT1A 1J1DC 4I2LC 3G71P 1N90A 2WTYA 4V2KA 1S1CX 4B86A 1BCCE 3O6QA 4U3FD 2NPSD 1NU1G 1LMSA 3TGUG 3WUUA 5APSA 1M1KQ 3Q5SA 3NBSA 1N7SD 1A02J 1RQVA 1IK7A 1J1EB 1Q90D 1H33A 1C6RA 2M0BA 3LW5J 1PL5A 1KV4A 4H44D 3RK2D 3OCDA 4WBAA 2YK3A 1GW4A 1EXJA 1NTKE 2HPCB 4MN4C 3HD7C 1RE3C 1H9YA 2W27A 1DW3A 4P4QB 3SWSA 3SSUA 5CICB 3OA7A 3O20A 3ZOOA 2YKPA 2JO1A 2N1TD 2IYOA 3A0HE 4JPZB 3WC8A 2HFED 1FU1A 5APYA 5CJ4A 3U1CA 3KHUA 2FYZA 2J5UA 1ZZHA 1HGVA 4QMAA 4OGQC 4OH8B 4WQ7A 1E8EA 1RHZB 1LWUA 1AOFA 3OA8B 2L91A 3GF7A 2IBZI 1AFOA 1A8CA 2IFNA 4IL6H 4WY4A 1IFNA 1T3JA 2PRRA 2ZYDA 4L1QA 2P10A 1ZV8A 4N78E 1S5LV 5CIFB 4PD4H 5B6QA 3M0DC 2P7JA 4N0KA 3CCJP 2YXQB 1L0LJ 2XU6A 2YMKA 1TU3F 3HE4B 5CCHD 1LT9A 1SP4A 1OW8A 2LKMA 3TF5A 3VMAA 4YTPC 1CRCA 2RMZA 2DW3A 2DGEA 1W5CT 1YYCA 2OTKE 2QJYB 4DZOA 1M56D 1LGHB 5DJQB 3H1LD 3L37A 3UIAA 3V2PA 1VQKP 2Y9YA 1LJ2A 1NMIA 5AW8B 1RAPA 3SJLA 3H1KJ 1EDJA 2Z5HA 3N7NA 3PLNA 3L75J 3L72J 4XXLA 1SQXJ 5AW7B 1EZVG 2KNCA 1HJ3A 2FYUG 1IZL0 1EDIA 2ZAEB 2FFDA 1BE3D 1JO5A 351CA 4R4LA 1PPJG 2E76B 4D6TE 3GW6A 1LC2A 3G3ZA 4PV1D 3L4FA 1CCRA 2NPSA 3HRNA 2P67A 1N7SA 1SQVK 4J20A 1EC5A 3PXTA 3F5HA 1JY2N 1Q2NA 3IFMA 3O5CA 2FXPA 2ZBOA 1M90Q 4EOTA 1CRGA 3CWBJ 2W8ZA 4IL6X 1VPCA 1LTAC 2QE7H 5AVQB 3H1HJ 1PGPA 2KIKA 3L70G 1HROA 1H88A 2JWDA 1HVVA 4U3FJ 3LIDA 1I55A 3FWLA 1J1DB 1NTKD 3SLEA 2XNXA 1LTTC 1T2KD 3V2QA 1KTMA 3TGUE 1JY2P 3H1JE 1ZP0C 2SPZA 3HUSA 4GDOA 1X9VA 3MP7B 2C1VA 1HZUA 4C46A 1LP1B 2QJPB 1SFCD 2A45H 2N1TA 5KJ7C 4Y28J 2P1JA 3E1IA 4I7ZB 2WITA 1QYZA 1SQVE 2I1JA 3P8CE 1WEJF 3ZIYA 5GTIV 5CCGD 3JCUE 4KHXA 1RF1A 1VQ8P 1KMIZ 3F89A 1A2SA 4XA4A 1M1JC 3HD7B 1L4AD 3CCSP 2KLUA 1QLED 4EYYQ 1I5TA 3MZWB 4N78D 1KB0A 2E75C 1C6OA 1KORA 3AE2C 4TT3H 1FZBA 1NTMG 4GOFA 2NRGA 4ZKUA 1CSWA 3CX5D 3ZOXA 3VN0A 5CCHA 1YJNP 3DP5A 1IQCA 3ZBMA 3CU4A 1JCCA 3M97X 3NWVA 1E2RA 2O01J 3OJAB 3USSA 1PGJA 1FZEA 3G4SP 1CI6B 3WU2E 1CIFA 1C6SA 4JYBA 1H0TB 1JY3O 3AE5C 2GC7D 1KN7A 2FYUK 3L71D 4Q5PA 3A7OA 1SQQK 3TNUA 4XE5B 4W80A 5AW9B 1AVYA 3AE1C 2WSFJ 4RESB 5GTHH 4C7RA 1RH5B 3AEDC 3ABVC 2WMMA 3GF3A 3RN0A 3AE9C 2HODA 4D6TD 3AE8C 5B66V 3H1LJ 2RN0A 2A45G 5EFWB 3A9FA 3VRDA 1JOCA 2L5GB 3RBXA 2WWWA 2POHA 3EQ2A 3MUDA 2E42A 1GW3A 2O1KA 2YMYA 4YXWH 2LIRA 1C7MA 1VQLP 1FZCA 2V07A 3ZCFA 1CIHA 1BE3J 1GK4A 1EZVE 3P32A 1OZHA 155CA 4L3HA 2FYUE 4RSZA 1YITP 1GL2D 1SQQE 2FYNC 1PPJE 5DJTB 3FXDA 2QEXP 1KQFB 1KILD 4KT0J 4MU8A 2AEFA 1RAQA 1I8OA 1NU1D 1DEEG 3TGUD 3VYMA 2B10B 2E5TA 2KSEA 3D6YA 1M8OB 3M91A 3PXWA 5CYTR 2A06G 4AAMA 3H32A 4LLHA 4N3YB 4H13C 1SFCA 1KQLA 5CIHB 1GKSA 3L70E 2CK3H 1NTKJ 1E5WA 3DMIA 2I8DA 3SFEC 5CCGA 2H89C 4IL6E 4KMGA 5AW3B 4ASVA 4L75A 3D71A 3M06A 2B4ZA 1W2EA 4PD4E 3Q2YA 1VQMP 3CI9A 1NTMK 2FXOA 1QVGO 1VQ4P 1FZAA 2GUVA 1VF5C 1L4AA 2CPBA 5E79V 1H31A 4DT0A 1N73C 3MD0A 2OTJP 1PV3A 3L73G 4RO0A 5C9MA 3TDKA 1FBMA 3VMXA 4WQCA 1X8YA 4WWIA 2M5AB 4ZMDA 2I1KA 4RJTA 4WQAA 4WQEA 3EWKA 1GTWA 3SWFA 4EDFA 3CX5I 1CO6A 4EIFA 1PGOA 3RK3B 2NZ2A 2Q5UA 1K9MQ 1CSBA 1JTHA 1VQNP 1N8RQ 2GA1A 2N3BA 5CJ0A 3CCMP 1S5LH 3HQ6A 1CYJA 2JJLA 3I5CA 1VDFA 2QJYC 5AVZB 1NTME 4WQBA 2E75B 3N4XA 1Q7YQ 1Q82Q 4WY4D 3V5BA 1KB9H 2M3EA 2VRSA 2H8PD 4WQ9A 3B5NA 1IZNB 1IFIA 2KP8A 3O8ZA 5CHXA 3L71J 1Y8AA 3AEAC 2E76C 1FZFA 1RE4C 2OYIB 4GODA 5AVSB 4L3GA 2Q3IA 3KZIV 3PXSA 3MK7C 1EZVD 4BWNA 2FYUD 4D6TJ 1LTJB 2IFMA 2WPSA 1Q81Q 1FJ0A 1PPJD 4IFFA 1AQTA 2KS1A 4GOEA 1B7VA 3HE5B 3CMAP 1OMIA 2CE1A 1IC2A 3L4MA 1IO4A 2C1DB 3PH2B 5AW6B 3AE6C 4GYDA 1KYOH 5C39A 2BLFB 1CHJA 1QEXA 4L76A 3A2AA 1URQB 1HBWA 1S5LX 5AW0B 3H1JG 1MV8A 3CC2P 2R3SA 2WPQA 3L70D 1YTZT 3KXDA 1JY3N 2QJPC 3B71A 2R3CA 2IDBA 1U57A 2FRCA 4I7ZC 1NU1J 2XTSB 1PP9J 2FYNB 1H32A 1ETPA 1GIWA 2LITA 1SQVG 4PD4D 1QL2A 4NPDA 3CCLP 4H44C 2K9JB 2Y0DA 2FY8A 2A06E 2K3RA 1KYOW 1VQOP 4L74A 3O6QB 3MIWA 4FB1A 3RGUA 5GTIH 3O1YA 2GUSA 4H13B 1BSNA 2OQQA 4PW9B 1JY3P 3GHGA 1Q86Q 3AE7C 2H43A 3WFBC 1VQ9P 2BPBB 3W67A 3OA8A 1SLQA 1LTBC 1OW6A 1USEA 1FOSF 1E29A 1CW5A 2N9YB 1JEKA 2JKVA 1FAVA 2N3YA 1S9KE 2HYNA 3V2NA 2M3BA 2IYPA 1YEAA 1VF5B 1CEDA 5GTHE 2WPRA 3OCDB 1DW2A 2LXCB 3L73E 1N73B 1NIRA 1FI9A 1NTMD 2HLOA 3HE4A 1T3UA 3VMZA 4OGQD 1HWTC 2WT7B 1NTZK 1NJIQ 2OTLP 3CCRP 3CP5A 3ZOWA 3Q5PA 3A0BH 1OFCX 3PRJA 5CIGB 4YPCA 5TISH 1X79B 1AV1A 1SS1A 1L0LG 3D0WA 1LWUB 1YJWP 2E5YA 2AXCA 2CPSA 3D6ZA 4EI2A 2W6JH 5APXA 5APQA 3AEFC 5B66H 2C9XB 3SXTA 5AW1B 1FHBA 3M0AA 3X39A 1KFNA 1EZVI 2H88C 1M57D 4LJIA 1C2NA 3RL0B 1NTZE 1SQXG 2E74B 1SQQG 2ZT9B 3RMZA 3O0RC 1BCCD 2WSCH 5CIEB 4PV1C 2FYUJ 5AW2B 1SQPG 2KK7A 3MK7B 1W5CE 3CXHE 1WRGA 2C0XA 1LNQA 1S6VB 2O01H 3WFCC 3VP9A 1DD4A 4H0LB 2KUBA 2BEZF 4AALA 3H1IG 2HR3A 1IFPA 2C2CA 5DF5A 1AVOA 2PCBB 3H1HG 1KFMA 3BCCE 4PD4I 1JCDA 2V7QH 4WVZA 1T2KC 3L70J 2D0WA 1FC2C 2DVHA 5KAIV 4BRYB 3RN1A 2NPSB 2KZJA 1K04A 4AAOA 3C9IA 4BXLA 5C0ZA 1Y47A 2WSEH 2Y9ZA 1S5LE 1WT6A 1H8AA 2JQRA 4IFDK 2QM7A 3TK1A 2K88A 3A3YB 2OYHB 1YHQP 1CRYA 1GK6A 4I1LA 3HD7A 5E79H 1RE3A 2ZXEB 4DY9A 4H44B 1DD3A 3RK3C 3RK2B 2O1JA 2YXRB 1KB9E 5KJ7D 4Y99B 4GIFA 2O01N 2AEJA 2YIUB 2WVRA 4JYCA 2R5DA 1G2CA 2MKVA 2G8YA 2AIUA 1Z56A 1L0LK 1CYIA 3WUTA 1GJQA 2N1TB 3CPWO 1MFTA 2ZYAA 3BASA 4N6JA 1NTMJ 2ZXXA 2KOGA 3ZDMA 1IRWA 1OVUA 1R8EA 1CRHA 1CZQA 3NMDA 2OZ1A 1RF1B 3M0DA 1VYDA 3A0BV 1DIQC 4XYDB 1K05A 2QJKB 2CA3B 2OYIC 5KLVG 1SQXK 5TISV 2W6AA 1G1IA 1RZ6A 1KYOE 1ZR4A 5APWA 4FA1A 3HTKA 1GQ1A 2P2UA 2D2CD 1I8PA 1LTJC 1NVOA 4JCGA 3AE4C
chains in the Genus database with same CATH topology
1CO6A 4EIFA 2MHMA 3OCDA 3WU2V 2YK3A 2KNCB 2N3BA 4FAVA 1J3SA 2AXTV 1HJ4A 1H9YA 4WQDA 3HQ6A 2A06D 1DW3A 1CYJA 1CTYA 2BH5X 1CXAA 2N18C 4P4QB 451CA 3SWSA 5CICB 2O3JA 1AOQA 3PTZA 2D0SA 4FA5A 3O20A 3ZOOA 4WQBA 1CXCA 2N9IA 1OCDA 3WC8A 3KHUA 4H0KA 1ZZHA 1NNOA 1YICA 1MG3D 4WQ7A 1E8EA 4WQ9A 1N9CA 1AKKA 1AOFA 1KX2A 1W2LA 3OA8B 1LFMA 1NMLA 2L91A 4O1QA 4UB6V 1L0ND 2CA4B 3H1JD 1HH7A 1DVVA 3L73D 4PJ0V 3WFDC 1A8CA 4L3GA 1FI7A 3KZIV 3PXSA 5DFSA 3MK7C 1EZVD 4L1QA 1YNRA 4FA4A 1S5LV 5CIFB 2FYUD 5B6QA 1I6EA 4N0KA 1HZVA 1SQVD 3WUIA 1FJ0A 1KIBA 1PPJD 2KS1A 5CIDB 1B7VA 4FA9A 2CE1A 3TF5A 3VMAA 2MTAC 3L4MA 1CRCA 2RMZA 1FOCA 2JTIB 2C1DB 3PH2B 1KB9D 2DGEA 1C75A 1W5CT 4GYDA 2BLFB 2QJYB 1CHJA 1SQBD 5DJQB 3H1LD 4FANA 1KX7A 1R0QA 4AX3A 1NMIA 1RAPA 3SJLA 4EIEA 3PLNA 3L70D 4XXLA 4K3IA 1JDLA 2FRCA 1YCCA 2XTSB 1HJ3A 2FYNB 1IZL0 1H32A 5KLIB 4IL6V 1CSUA 1ETPA 2ZOOA 1DW0A 1BE3D 1U75B 1GIWA 351CA 2LITA 1C2RA 4PD4D 2CE0A 1NTZD 3GW6A 1LC2A 1F1CA 2K9JB 1CCRA 2Y0DA 2VHDA 5CIBB 1KYOW 3CXHW 4UB8V 2B12B 4YE1A 1QL3A 4J20A 4FB1A 1QN2A 3O1YA 2OZ1B 3PXTA 2JWAA 1H31B 3O5CA 4PW9B 2QG4A 2GIWA 1KYOD 1IO3A 2ZBOA 3CXHD 1CRGA 1CTJA 1F1FA 3WFBC 2BPBB 1M6ZA 3VNWA 3OA8A 1HROA 2V08A 1CHIA 1E29A 2N9YB 1I55A 3FWLA 2YQBA 2C8SA 2N3YA 2BCCD 1P84D 1NTKD 3SLEA 1FI3A 3DR0A 1YEAA 1CEDA 3BCCD 3OCDB 1H9XA 1BGYD 1N50A 1DW2A 4H0JA 1NIRA 3L4OA 1FI9A 1NTMD 3HQ9A 2C1VA 1HZUA 2QJPB 2AI5A 4EICA 3A0HV 1HCMA 3ORVA 1QYZA 1L9BC 3CP5A 3ZOWA 2C1DA 1WEJF 3ZIYA 1YFCA 5GTIV 3PRJA 2Y0CA 1SQQD 1CTZA 1PP9D 1IRVA 1MG2D 5CIGB 1M70A 1N15A 1KV9A 5KAFV 2Y0EA 1A2SA 3HQ7A 5TJHA 1SQPD 3CYTI 4PWAA 2N18B 3CX5W 1COTA 1I5TA 2CXBA 1KB0A 1C6OA 2C9XB 2ZONG 3SXTA 1FHBA 3X39A 1CSWA 3CX5D 3ZOXA 3C2CA 1CSXA 3H1ID 3RLMA 2FWLA 3DP5A 1IQCA 4LJIA 3ZBMA 3CU4A 1C2NA 2B11B 3M97X 3H1HD 3NWVA 1E2RA 2L4DA 1L9JC 1CIFA 5KKZB 1CIEA 3JBTB 3RMZA 5H2FV 1C6SA 3O0RC 1BCCD 2GC7D 5EXQA 1LS9A 2N9JA 5CIEB 3TYIA 4A7PA 3L71D 4Q5PA 1HRCA 3WFEC 3MK7B 2Q3EA 2BCNB 4GEDB 3ZOYA 1DW1A 1WVEC 2ZZS1 5B5EV 2YCCA 2GC4D 1H1OA 1S6VB 1DVHA 3SVWA 3WFCC 1M60A 4WQ8A 2PCCB 3RN0A 4AALA 4D6TD 1CNOA 5B66V 1CC5A 1H32B 2RN0A 2IBZD 2I8FA 1L0LD 2C2CA 3A9FA 2EXVA 5DF5A 3VRDA 2PCBB 1H33B 1CHHA 5IY51 1HJ5A 1CORA 2HV4A 1OAEA 5DJQC 2ORLA 2BGVX 2D0WA 3GG2A 2DVHA 5AURA 5KAIV 1GDVA 1QL4A 3RN1A 4EIDA 4AAOA 1LC1A 1AYGA 2LIRA 2PACA 1C7MA 5C0ZA 2V07A 3ZCFA 3HQ8A 1CIHA 1CRIA 155CA 2JQRA 4L3HA 4RSZA 1C52A 3H1KD 1ZRTD 1CRYA 2ZXYA 1YIQA 1CCHA 3L75D 2C1UA 1YEBA 3L72D 1SQXD 2B0ZB 4MU8A 4DY9A 1RAQA 1I8OA 4Y5RA 1NU1D 5GTHV 3TGUD 3VYMA 2B10B 1A56A 1CSVA 3PXWA 5CYTR 5KLVD 4AAMA 2YIUB 1DT1A 1U74B 4AANA 2GB8B 2AIUA 1K3GA 2BH4X 5CIHB 1CYIA 1I6DA 1GJQA 1MZ4A 1K3HA 1CIGA 1GKSA 1QKSA 4NFGB 1EB7A 3DMIA 1I54A 1YTCA 4KMGA 3CWBD 1BL9A 1DIIC 1CRJA 1GU2A 2B4ZA 3NBTA 1N90A 4V2KA 1RZ5A 4O1WA 1IRWA 1CRHA 2OZ1A 4QAOA 4U3FD 5E79V 1H31A 1LMSA 3PHLA 3NBSA 1VYDA 3A0BV 1DIQC 4XYDB 3ITKA 2QJKB 5C9MA 2CA3B 3TDKA 5TISV 4WQCA 1FCDC 1RZ6A 1CYCA 4RJTA 4WQAA 4FA1A 1GQ1A 4WQEA 1H33A 1C6RA 1I8PA 4JCGA 4EDFA 3L74D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CO6 A;  4EIF A;  2MHM A;  3OCD A;  3WU2 V;  2YK3 A;  2KNC B;  2N3B A;  4FAV A;  1J3S A;  2AXT V;  1HJ4 A;  1H9Y A;  4WQD A;  3HQ6 A;  2A06 D;  1DW3 A;  1CYJ A;  1CTY A;  2BH5 X;  1CXA A;  2N18 C;  4P4Q B;  451C A;  3SWS A;  5CIC B;  2O3J A;  1AOQ A;  3PTZ A;  2D0S A;  4FA5 A;  3O20 A;  3ZOO A;  4WQB A;  1CXC A;  2N9I A;  1OCD A;  3WC8 A;  3KHU A;  4H0K A;  1ZZH A;  1NNO A;  1YIC A;  1MG3 D;  4WQ7 A;  1E8E A;  4WQ9 A;  1N9C A;  1AKK A;  1AOF A;  1KX2 A;  1W2L A;  3OA8 B;  1LFM A;  1NML A;  2L91 A;  4O1Q A;  4UB6 V;  1L0N D;  2CA4 B;  3H1J D;  1HH7 A;  1DVV A;  3L73 D;  4PJ0 V;  3WFD C;  1A8C A;  4L3G A;  1FI7 A;  3KZI V;  3PXS A;  5DFS A;  3MK7 C;  1EZV D;  4L1Q A;  1YNR A;  4FA4 A;  1S5L V;  5CIF B;  2FYU D;  5B6Q A;  1I6E A;  4N0K A;  1HZV A;  1SQV D;  3WUI A;  1FJ0 A;  1KIB A;  1PPJ D;  2KS1 A;  5CID B;  1B7V A;  4FA9 A;  2CE1 A;  3TF5 A;  3VMA A;  2MTA C;  3L4M A;  1CRC A;  2RMZ A;  1FOC A;  2JTI B;  2C1D B;  3PH2 B;  1KB9 D;  2DGE A;  1C75 A;  1W5C T;  4GYD A;  2BLF B;  2QJY B;  1CHJ A;  1SQB D;  5DJQ B;  3H1L D;  4FAN A;  1KX7 A;  1R0Q A;  4AX3 A;  1NMI A;  1RAP A;  3SJL A;  4EIE A;  3PLN A;  3L70 D;  4XXL A;  4K3I A;  1JDL A;  2FRC A;  1YCC A;  2XTS B;  1HJ3 A;  2FYN B;  1IZL 0;  1H32 A;  5KLI B;  4IL6 V;  1CSU A;  1ETP A;  2ZOO A;  1DW0 A;  1BE3 D;  1U75 B;  1GIW A;  351C A;  2LIT A;  1C2R A;  4PD4 D;  2CE0 A;  1NTZ D;  3GW6 A;  1LC2 A;  1F1C A;  2K9J B;  1CCR A;  2Y0D A;  2VHD A;  5CIB B;  1KYO W;  3CXH W;  4UB8 V;  2B12 B;  4YE1 A;  1QL3 A;  4J20 A;  4FB1 A;  1QN2 A;  3O1Y A;  2OZ1 B;  3PXT A;  2JWA A;  1H31 B;  3O5C A;  4PW9 B;  2QG4 A;  2GIW A;  1KYO D;  1IO3 A;  2ZBO A;  3CXH D;  1CRG A;  1CTJ A;  1F1F A;  3WFB C;  2BPB B;  1M6Z A;  3VNW A;  3OA8 A;  1HRO A;  2V08 A;  1CHI A;  1E29 A;  2N9Y B;  1I55 A;  3FWL A;  2YQB A;  2C8S A;  2N3Y A;  2BCC D;  1P84 D;  1NTK D;  3SLE A;  1FI3 A;  3DR0 A;  1YEA A;  1CED A;  3BCC D;  3OCD B;  1H9X A;  1BGY D;  1N50 A;  1DW2 A;  4H0J A;  1NIR A;  3L4O A;  1FI9 A;  1NTM D;  3HQ9 A;  2C1V A;  1HZU A;  2QJP B;  2AI5 A;  4EIC A;  3A0H V;  1HCM A;  3ORV A;  1QYZ A;  1L9B C;  3CP5 A;  3ZOW A;  2C1D A;  1WEJ F;  3ZIY A;  1YFC A;  5GTI V;  3PRJ A;  2Y0C A;  1SQQ D;  1CTZ A;  1PP9 D;  1IRV A;  1MG2 D;  5CIG B;  1M70 A;  1N15 A;  1KV9 A;  5KAF V;  2Y0E A;  1A2S A;  3HQ7 A;  5TJH A;  1SQP D;  3CYT I;  4PWA A;  2N18 B;  3CX5 W;  1COT A;  1I5T A;  2CXB A;  1KB0 A;  1C6O A;  2C9X B;  2ZON G;  3SXT A;  1FHB A;  3X39 A;  1CSW A;  3CX5 D;  3ZOX A;  3C2C A;  1CSX A;  3H1I D;  3RLM A;  2FWL A;  3DP5 A;  1IQC A;  4LJI A;  3ZBM A;  3CU4 A;  1C2N A;  2B11 B;  3M97 X;  3H1H D;  3NWV A;  1E2R A;  2L4D A;  1L9J C;  1CIF A;  5KKZ B;  1CIE A;  3JBT B;  3RMZ A;  5H2F V;  1C6S A;  3O0R C;  1BCC D;  2GC7 D;  5EXQ A;  1LS9 A;  2N9J A;  5CIE B;  3TYI A;  4A7P A;  3L71 D;  4Q5P A;  1HRC A;  3WFE C;  3MK7 B;  2Q3E A;  2BCN B;  4GED B;  3ZOY A;  1DW1 A;  1WVE C;  2ZZS 1;  5B5E V;  2YCC A;  2GC4 D;  1H1O A;  1S6V B;  1DVH A;  3SVW A;  3WFC C;  1M60 A;  4WQ8 A;  2PCC B;  3RN0 A;  4AAL A;  4D6T D;  1CNO A;  5B66 V;  1CC5 A;  1H32 B;  2RN0 A;  2IBZ D;  2I8F A;  1L0L D;  2C2C A;  3A9F A;  2EXV A;  5DF5 A;  3VRD A;  2PCB B;  1H33 B;  1CHH A;  5IY5 1;  1HJ5 A;  1COR A;  2HV4 A;  1OAE A;  5DJQ C;  2ORL A;  2BGV X;  2D0W A;  3GG2 A;  2DVH A;  5AUR A;  5KAI V;  1GDV A;  1QL4 A;  3RN1 A;  4EID A;  4AAO A;  1LC1 A;  1AYG A;  2LIR A;  2PAC A;  1C7M A;  5C0Z A;  2V07 A;  3ZCF A;  3HQ8 A;  1CIH A;  1CRI A;  155C A;  2JQR A;  4L3H A;  4RSZ A;  1C52 A;  3H1K D;  1ZRT D;  1CRY A;  2ZXY A;  1YIQ A;  1CCH A;  3L75 D;  2C1U A;  1YEB A;  3L72 D;  1SQX D;  2B0Z B;  4MU8 A;  4DY9 A;  1RAQ A;  1I8O A;  4Y5R A;  1NU1 D;  5GTH V;  3TGU D;  3VYM A;  2B10 B;  1A56 A;  1CSV A;  3PXW A;  5CYT R;  5KLV D;  4AAM A;  2YIU B;  1DT1 A;  1U74 B;  4AAN A;  2GB8 B;  2AIU A;  1K3G A;  2BH4 X;  5CIH B;  1CYI A;  1I6D A;  1GJQ A;  1MZ4 A;  1K3H A;  1CIG A;  1GKS A;  1QKS A;  4NFG B;  1EB7 A;  3DMI A;  1I54 A;  1YTC A;  4KMG A;  3CWB D;  1BL9 A;  1DII C;  1CRJ A;  1GU2 A;  2B4Z A;  3NBT A;  1N90 A;  4V2K A;  1RZ5 A;  4O1W A;  1IRW A;  1CRH A;  2OZ1 A;  4QAO A;  4U3F D;  5E79 V;  1H31 A;  1LMS A;  3PHL A;  3NBS A;  1VYD A;  3A0B V;  1DIQ C;  4XYD B;  3ITK A;  2QJK B;  5C9M A;  2CA3 B;  3TDK A;  5TIS V;  4WQC A;  1FCD C;  1RZ6 A;  1CYC A;  4RJT A;  4WQA A;  4FA1 A;  1GQ1 A;  4WQE A;  1H33 A;  1C6R A;  1I8P A;  4JCG A;  4EDF A;  3L74 D; 
#chains in the Genus database with same CATH topology
 1SQP K;  3II6 A;  3QWO C;  2MHM A;  1L0L E;  1AA0 A;  5AW4 B;  3KZI H;  1ZOY C;  2A45 I;  3B5N D;  2P58 A;  3IR9 A;  4K3A A;  4FAV A;  2AXT V;  1HJ4 A;  2WQY C;  2W6B A;  3H1L G;  1CTY A;  2BH5 X;  1CXA A;  451C A;  1AOQ A;  1RF0 C;  3PTZ A;  2D0S A;  4FA5 A;  1JMB A;  1URQ C;  2GM4 A;  5KAF H;  3TNU B;  4C7N A;  1NNO A;  2QIW A;  1MG3 D;  5GTI E;  3E1R A;  1N9C A;  1SQX E;  1ZN5 A;  1BCC J;  1BE3 G;  1AKK A;  1HF9 A;  5BVZ A;  2HOD B;  4GT1 A;  3L74 G;  1KX2 A;  3MGN A;  1KIL C;  1NHL A;  2C0W A;  3AEC C;  3CX5 H;  5KKZ C;  3M9H A;  4O1Q A;  1XTG B;  2ZFC A;  4PV1 B;  2CA4 B;  3H1J D;  1HH7 A;  1DVV A;  1SQP E;  3I56 P;  1H89 A;  3WFD C;  2FKW B;  1FE6 A;  3U59 A;  1FI7 A;  1PFI A;  4AQR D;  1IFD A;  1DIP A;  2PP6 A;  3FX0 A;  1G1J A;  5H2F H;  5AVR B;  2C9N Y;  4ASW A;  2M8R A;  1SQV D;  1D7M A;  3IF4 A;  3P8C D;  4NPE A;  5CID B;  3H1I E;  3CWB E;  4JQ0 D;  1ZME C;  1YTZ I;  4LGD E;  2W83 C;  1KQG B;  3MHV A;  1FOC A;  3H1H E;  2JTI B;  5B5E H;  1KB9 D;  4W7Y A;  1C75 A;  4H13 D;  1GDT A;  4U3F E;  5KJ7 A;  1FDO A;  3A0B E;  2R32 A;  1N86 A;  3CXH H;  4FAN A;  1KX7 A;  4L73 A;  4WB4 A;  1HUC A;  4AX3 A;  1QVF O;  5TIS E;  1L0N G;  4EIE A;  3H32 B;  2J59 M;  4K3I A;  1P84 H;  1JDL A;  1NH4 A;  1VL2 A;  4OWF A;  1CSU A;  1M1J A;  3OAK A;  5APU A;  2ZOO A;  2HG5 D;  1U75 B;  2CE0 A;  5B66 E;  5KLV K;  3VMY A;  1JUN A;  1MUU A;  1BDD A;  2VHD A;  5CIB B;  3V2R A;  1LWU C;  3CXH W;  1VQ5 P;  2B12 B;  3QH9 A;  2PFX A;  3T97 A;  1L4A B;  4Z1M H;  1QN2 A;  1KQS O;  2Q9I A;  1H31 B;  1SQB G;  2ZJS E;  1NKN A;  3KPE A;  2QG4 A;  1KYO D;  1IO3 A;  1CTJ A;  1EDL A;  2YO3 A;  1M6Z A;  3VNW A;  3LW5 H;  4WY4 C;  3S4R A;  5APT A;  3CLQ A;  3I55 P;  2C8S A;  3Q1M A;  3PP5 A;  3RL0 C;  1LT9 C;  2E74 C;  1NTZ G;  1N50 A;  4EIJ A;  4H0J A;  1L2P A;  2RKL A;  2ZT9 C;  1OVR A;  5KLV E;  3HQ9 A;  4EIC A;  3A0H V;  2ITA A;  4JBZ A;  3SWK A;  2C1D A;  2QA4 P;  1NWQ A;  1YFC A;  1VQP P;  1SQQ D;  3CCQ P;  2E76 D;  3G9R A;  1CTZ A;  1YJ9 P;  1IRV A;  1MG2 D;  4H0L C;  1HJ0 A;  5AW5 B;  5K5G B;  1OVV A;  5BU5 A;  2JP3 A;  1AJY A;  2IX7 C;  1KV9 A;  5KAF V;  2Y0E A;  1ZXG A;  1NKZ B;  2KXP B;  2BCC G;  2KYV A;  1SQP D;  3H1L E;  5TJH A;  2FFD C;  3CYT I;  2B87 B;  2LXB A;  5E79 E;  3SFD C;  1GD2 E;  2YO2 A;  3BCC G;  1FJP A;  2KZI A;  3CCV P;  1BGY G;  4NPF X;  2CXB A;  1USD A;  2NPS C;  2ZON G;  3CD6 P;  4R4M A;  1N7S C;  1OWA A;  2Q7C A;  3C2C A;  4JF7 A;  3IAO A;  3H1I D;  1M7L A;  3VP8 A;  1K8A Q;  1R5L A;  2K9J A;  1BE3 E;  2B11 B;  1GL2 B;  3H1H D;  3TGU J;  5KAI H;  2KS1 B;  2HPC A;  2OYH C;  3L74 E;  1L0N K;  3H1J J;  3S9O A;  3TYY A;  1KIL B;  3KYQ A;  1PP9 G;  5KKZ B;  1E79 H;  1LTG C;  4HH2 A;  1CIE A;  2Z5I A;  2H7H A;  5H2F V;  5EXQ A;  1PIX A;  1U7M A;  2Z4E A;  2N9J A;  1DH3 A;  5M1B A;  3RBZ A;  1JM0 A;  1XTC C;  1KB9 I;  1UII A;  3RK2 C;  1U7J A;  4Y99 C;  1RQU A;  3WFE C;  1SQV J;  3A5T A;  2YIU C;  4GED B;  3ZOY A;  5AVU B;  3H25 A;  3KQG A;  1WVE C;  2ZZS 1;  5B5E V;  4W7Z A;  3D70 A;  4UB6 H;  2RH0 A;  1DVH A;  3AEE C;  3SVW A;  3HUS C;  4PJ0 H;  4WQ8 A;  2N1T C;  2PCC B;  2K1A A;  1NO4 A;  1CNO A;  1SQB K;  1N73 A;  1H32 B;  1YIJ P;  2PAJ A;  2XDJ A;  3HD7 D;  4YXD C;  2LR2 A;  1H33 B;  1CHH A;  1HJ5 A;  1IJD B;  2UWJ E;  1FS0 E;  2WT7 A;  4M3L A;  2HV4 A;  1GU5 A;  2XZR A;  2KSJ A;  2BGV X;  4RKU J;  1GDV A;  1QL4 A;  1L0N E;  1RF1 C;  4EID A;  2KI7 B;  1LC1 A;  1AYG A;  3KZI E;  1QX8 A;  2QJK C;  3HQ8 A;  2OGU A;  2QVA A;  3GHG B;  3AE3 C;  1ZLL A;  1IFM A;  1KYO I;  2IZ1 A;  1C52 A;  5KLI C;  1YQ3 C;  2C1U A;  1YEB A;  3Q5R A;  2ZVO B;  3RK3 E;  4DJG A;  4TLF A;  1MZ9 A;  1JNM A;  5KAF E;  4Y5R A;  3G6E P;  1KC8 Q;  5CCH C;  3KDP B;  2IBZ G;  1CSV A;  2BAS A;  5KLV D;  1DT1 A;  1SQB E;  1AQ5 A;  2N9B A;  3CCE P;  4AAN A;  4IOI H;  3U1A A;  2BH4 X;  1HGZ A;  3CX5 E;  3JC2 2;  1MZ4 A;  1K3H A;  3MTU E;  4NFG B;  4UB8 H;  1EB7 A;  2AXT H;  4WY4 B;  2J58 A;  1FDM A;  1YTC A;  3R4Y A;  1OXZ A;  1IFJ A;  1BL9 A;  1RE4 A;  1DII C;  1CRJ A;  3H1K G;  1GU2 A;  3NBT A;  3V6I A;  3L75 G;  5H2F E;  3CME P;  3L72 G;  1RZ5 A;  1X0T A;  4O1W A;  1LT9 B;  4QAO A;  3L71 E;  2XV5 A;  3PHL A;  3ITK A;  1VQ7 P;  5B5E E;  3RL0 g;  1SQQ J;  2QRX A;  1FCD C;  3MUD C;  1NU1 K;  1CYC A;  3BVH A;  3NFQ A;  1RY3 A;  2MJZ A;  1S4X A;  1KD1 Q;  2AEM A;  1FZC C;  3L74 D;  2XKM A;  1SQP J;  3M9B A;  1T8Z A;  3PJS K;  3WU2 V;  4BRY A;  2KNC B;  3P7K A;  3CWB G;  2BCC E;  1P84 E;  1J3S A;  2FFD B;  4WQD A;  1ZR2 A;  2IPP A;  2A06 D;  2R44 A;  1LP1 A;  2N18 C;  1BGY E;  2O3J A;  3H1I J;  4U3F G;  2YNY A;  1NAY A;  5CBN A;  2OYH A;  1MKM A;  1GZL A;  1CXC A;  2N9I A;  1HJB A;  1YQ4 C;  2WSF H;  2K37 A;  1N7S B;  1OCD A;  1FZG A;  2OAR A;  4CPG A;  4H0K A;  1YIC A;  1SFC C;  3OW2 O;  1KIL E;  3L35 A;  2Q6Q A;  3VYI A;  1NU1 E;  1PP9 E;  1S9K D;  1W2L A;  1LFM A;  3H6P A;  1NML A;  5CCG C;  1NAF A;  4UB6 V;  1N2D C;  2W90 A;  1L0N D;  1IK9 A;  3AEB C;  5AVX B;  3L73 D;  5CBO A;  4PJ0 V;  1EQ7 A;  5DFS A;  3SWY A;  1L4A C;  1YNR A;  4FA4 A;  1I6E A;  1HZV A;  3C1L A;  3HUS B;  2FBW C;  3WUI A;  1KIB A;  2KLV A;  1R5S A;  3RK3 D;  4FA9 A;  3WMM 0;  2OYO A;  2V4H A;  1CI6 A;  4HYT B;  2MTA C;  1H0T A;  3B4S A;  5L8R J;  2ZYG A;  1BDC A;  1K73 Q;  3GLM A;  4DOJ A;  3E7K A;  1S2E A;  1SQB D;  2WSC J;  3C8V A;  1R0Q A;  2E75 D;  1OX3 A;  2PGD A;  2G3A A;  1NYH A;  3CC7 P;  3CL3 D;  1G2C B;  4OGQ B;  5AVY B;  1MFZ A;  3BRV B;  1YCC A;  5KLI B;  3EFF K;  4IL6 V;  1DW0 A;  2R5B A;  2D2C C;  1C2R A;  5KLV J;  1NTZ D;  1EDK A;  1HTL C;  2IBZ E;  1F1C A;  2KB7 P;  3A0H H;  1YBK A;  3S1K A;  2IZ0 A;  3B5N C;  3R2P A;  2V7Q J;  4UB8 V;  4AYC A;  1PZQ A;  4YE1 A;  1QL3 A;  2XND H;  2JEE A;  2OZ1 B;  1T6A A;  2QSI A;  2JWA A;  5KAI E;  2C9L Y;  3JSV C;  3VTP C;  3VOP A;  2GIW A;  1S3J A;  4IFM A;  3CXH D;  2WSE J;  1F1F A;  5CMZ A;  2B89 A;  2V08 A;  1CHI A;  1Y9B A;  3H1K E;  3HTK B;  1OIP A;  1ZRT E;  3L36 A;  4K35 A;  3L75 E;  2YQB A;  3L72 E;  2BCC D;  1P84 D;  4KJM A;  1GL2 C;  4U7J A;  4UB6 E;  1FI3 A;  3DR0 A;  3W68 A;  2YKO A;  3BCC D;  1H9X A;  1URQ D;  1BCC G;  1BGY D;  2WPV B;  2Q1K A;  2ZVN B;  4PJ0 E;  3L4O A;  3FGA D;  1FDI A;  3EFG A;  2AI5 A;  1ZW0 A;  1J1E C;  1HCM A;  3ORV A;  1KZU B;  3L74 J;  4AUW A;  3FXE A;  1L9B C;  3WUV A;  4ZNC A;  2Y0C A;  1FZC B;  3V4Q A;  4C7N B;  1PP9 D;  1M70 A;  2B9B A;  1LTS C;  1N15 A;  1NGM B;  1NOH A;  3K5B A;  3HQ7 A;  1NTK G;  4I6M C;  1VQ6 P;  5AVV B;  2YKQ A;  4PWA A;  2N18 B;  3CX5 W;  1COT A;  2M5A A;  1S72 P;  1A02 F;  2FXM A;  4ZKP A;  2BEQ D;  1JB0 J;  3FWN A;  1CSX A;  1LTI C;  3RLM A;  2FWL A;  1SFC B;  3GHG C;  3Q3D A;  1QGK B;  1L0N J;  2L4D A;  1VF5 D;  5AVW B;  2WZ7 A;  5AVT B;  3L73 J;  1FOS E;  1YI2 P;  1L9J C;  4GKG A;  3JBT B;  4UB8 E;  3IN6 A;  3TSI A;  2AXT E;  1LS9 A;  3TYI A;  4A7P A;  5BU8 B;  1UIX A;  5APV A;  1HRC A;  2K9Y A;  1W2B O;  2QM8 A;  2Q3E A;  2BCN B;  2WSS H;  1PGQ A;  1DW1 A;  4HKZ H;  2YCC A;  3GMA A;  2GC4 D;  1H1O A;  3AEG C;  1EXI A;  1WMK A;  1DEB A;  1GMJ A;  1M60 A;  3M9Q A;  1CC5 A;  1SQB J;  1JY2 O;  1J2J B;  2IBZ D;  2I8F A;  1M1J B;  1DX7 A;  3P8M C;  1L0L D;  2EXV A;  4HJG H;  5IY5 1;  2OYI A;  4OVN F;  1HH0 A;  1COR A;  2JDI H;  1OAE A;  5DJQ C;  2ORL A;  3GG2 A;  3PH0 A;  5AUR A;  3NXS A;  1JTH B;  4HB1 A;  2PAC A;  1LTJ A;  3JCU H;  3T97 B;  3L71 G;  1N7L A;  1QL1 A;  1FJK A;  1CRI A;  3HE5 A;  1NTZ J;  3NTN A;  4DCK A;  3RL0 D;  1BSH A;  2JR8 A;  3H1K D;  3CXH I;  1ZRT D;  2ZXY A;  1YIQ A;  1CCH A;  3L75 D;  2E74 D;  3L72 D;  1JMM A;  2D2C B;  1SQX D;  2B87 A;  2B0Z B;  2ZT9 D;  1RF0 A;  5GTH V;  4D6T G;  5KTB A;  4LC1 A;  3LIE A;  1A56 A;  1URQ A;  5DJU B;  3B5N B;  3BRT B;  1P84 I;  2E43 A;  1SVF A;  3B8E B;  1X22 A;  1U74 B;  1OW7 A;  3BAT A;  2GB8 B;  3V4W A;  1K3G A;  1GL2 A;  1GU4 A;  4XFJ A;  1I6D A;  3CCU P;  3WU2 H;  1CIG A;  2B88 A;  3CC4 P;  4H0L D;  4O9B A;  2BCC J;  1QKS A;  1NTK K;  1KIL A;  1I54 A;  3BCC J;  3CWB D;  1BGY J;  1LT1 A;  1J1D C;  4I2L C;  3G71 P;  1N90 A;  2WTY A;  4V2K A;  1S1C X;  4B86 A;  1BCC E;  3O6Q A;  4U3F D;  2NPS D;  1NU1 G;  1LMS A;  3TGU G;  3WUU A;  5APS A;  1M1K Q;  3Q5S A;  3NBS A;  1N7S D;  1A02 J;  1RQV A;  1IK7 A;  1J1E B;  1Q90 D;  1H33 A;  1C6R A;  2M0B A;  3LW5 J;  1PL5 A;  1KV4 A;  4H44 D;  3RK2 D;  3OCD A;  4WBA A;  2YK3 A;  1GW4 A;  1EXJ A;  1NTK E;  2HPC B;  4MN4 C;  3HD7 C;  1RE3 C;  1H9Y A;  2W27 A;  1DW3 A;  4P4Q B;  3SWS A;  3SSU A;  5CIC B;  3OA7 A;  3O20 A;  3ZOO A;  2YKP A;  2JO1 A;  2N1T D;  2IYO A;  3A0H E;  4JPZ B;  3WC8 A;  2HFE D;  1FU1 A;  5APY A;  5CJ4 A;  3U1C A;  3KHU A;  2FYZ A;  2J5U A;  1ZZH A;  1HGV A;  4QMA A;  4OGQ C;  4OH8 B;  4WQ7 A;  1E8E A;  1RHZ B;  1LWU A;  1AOF A;  3OA8 B;  2L91 A;  3GF7 A;  2IBZ I;  1AFO A;  1A8C A;  2IFN A;  4IL6 H;  4WY4 A;  1IFN A;  1T3J A;  2PRR A;  2ZYD A;  4L1Q A;  2P10 A;  1ZV8 A;  4N78 E;  1S5L V;  5CIF B;  4PD4 H;  5B6Q A;  3M0D C;  2P7J A;  4N0K A;  3CCJ P;  2YXQ B;  1L0L J;  2XU6 A;  2YMK A;  1TU3 F;  3HE4 B;  5CCH D;  1LT9 A;  1SP4 A;  1OW8 A;  2LKM A;  3TF5 A;  3VMA A;  4YTP C;  1CRC A;  2RMZ A;  2DW3 A;  2DGE A;  1W5C T;  1YYC A;  2OTK E;  2QJY B;  4DZO A;  1M56 D;  1LGH B;  5DJQ B;  3H1L D;  3L37 A;  3UIA A;  3V2P A;  1VQK P;  2Y9Y A;  1LJ2 A;  1NMI A;  5AW8 B;  1RAP A;  3SJL A;  3H1K J;  1EDJ A;  2Z5H A;  3N7N A;  3PLN A;  3L75 J;  3L72 J;  4XXL A;  1SQX J;  5AW7 B;  1EZV G;  2KNC A;  1HJ3 A;  2FYU G;  1IZL 0;  1EDI A;  2ZAE B;  2FFD A;  1BE3 D;  1JO5 A;  351C A;  4R4L A;  1PPJ G;  2E76 B;  4D6T E;  3GW6 A;  1LC2 A;  3G3Z A;  4PV1 D;  3L4F A;  1CCR A;  2NPS A;  3HRN A;  2P67 A;  1N7S A;  1SQV K;  4J20 A;  1EC5 A;  3PXT A;  3F5H A;  1JY2 N;  1Q2N A;  3IFM A;  3O5C A;  2FXP A;  2ZBO A;  1M90 Q;  4EOT A;  1CRG A;  3CWB J;  2W8Z A;  4IL6 X;  1VPC A;  1LTA C;  2QE7 H;  5AVQ B;  3H1H J;  1PGP A;  2KIK A;  3L70 G;  1HRO A;  1H88 A;  2JWD A;  1HVV A;  4U3F J;  3LID A;  1I55 A;  3FWL A;  1J1D B;  1NTK D;  3SLE A;  2XNX A;  1LTT C;  1T2K D;  3V2Q A;  1KTM A;  3TGU E;  1JY2 P;  3H1J E;  1ZP0 C;  2SPZ A;  3HUS A;  4GDO A;  1X9V A;  3MP7 B;  2C1V A;  1HZU A;  4C46 A;  1LP1 B;  2QJP B;  1SFC D;  2A45 H;  2N1T A;  5KJ7 C;  4Y28 J;  2P1J A;  3E1I A;  4I7Z B;  2WIT A;  1QYZ A;  1SQV E;  2I1J A;  3P8C E;  1WEJ F;  3ZIY A;  5GTI V;  5CCG D;  3JCU E;  4KHX A;  1RF1 A;  1VQ8 P;  1KMI Z;  3F89 A;  1A2S A;  4XA4 A;  1M1J C;  3HD7 B;  1L4A D;  3CCS P;  2KLU A;  1QLE D;  4EYY Q;  1I5T A;  3MZW B;  4N78 D;  1KB0 A;  2E75 C;  1C6O A;  1KOR A;  3AE2 C;  4TT3 H;  1FZB A;  1NTM G;  4GOF A;  2NRG A;  4ZKU A;  1CSW A;  3CX5 D;  3ZOX A;  3VN0 A;  5CCH A;  1YJN P;  3DP5 A;  1IQC A;  3ZBM A;  3CU4 A;  1JCC A;  3M97 X;  3NWV A;  1E2R A;  2O01 J;  3OJA B;  3USS A;  1PGJ A;  1FZE A;  3G4S P;  1CI6 B;  3WU2 E;  1CIF A;  1C6S A;  4JYB A;  1H0T B;  1JY3 O;  3AE5 C;  2GC7 D;  1KN7 A;  2FYU K;  3L71 D;  4Q5P A;  3A7O A;  1SQQ K;  3TNU A;  4XE5 B;  4W80 A;  5AW9 B;  1AVY A;  3AE1 C;  2WSF J;  4RES B;  5GTH H;  4C7R A;  1RH5 B;  3AED C;  3ABV C;  2WMM A;  3GF3 A;  3RN0 A;  3AE9 C;  2HOD A;  4D6T D;  3AE8 C;  5B66 V;  3H1L J;  2RN0 A;  2A45 G;  5EFW B;  3A9F A;  3VRD A;  1JOC A;  2L5G B;  3RBX A;  2WWW A;  2POH A;  3EQ2 A;  3MUD A;  2E42 A;  1GW3 A;  2O1K A;  2YMY A;  4YXW H;  2LIR A;  1C7M A;  1VQL P;  1FZC A;  2V07 A;  3ZCF A;  1CIH A;  1BE3 J;  1GK4 A;  1EZV E;  3P32 A;  1OZH A;  155C A;  4L3H A;  2FYU E;  4RSZ A;  1YIT P;  1GL2 D;  1SQQ E;  2FYN C;  1PPJ E;  5DJT B;  3FXD A;  2QEX P;  1KQF B;  1KIL D;  4KT0 J;  4MU8 A;  2AEF A;  1RAQ A;  1I8O A;  1NU1 D;  1DEE G;  3TGU D;  3VYM A;  2B10 B;  2E5T A;  2KSE A;  3D6Y A;  1M8O B;  3M91 A;  3PXW A;  5CYT R;  2A06 G;  4AAM A;  3H32 A;  4LLH A;  4N3Y B;  4H13 C;  1SFC A;  1KQL A;  5CIH B;  1GKS A;  3L70 E;  2CK3 H;  1NTK J;  1E5W A;  3DMI A;  2I8D A;  3SFE C;  5CCG A;  2H89 C;  4IL6 E;  4KMG A;  5AW3 B;  4ASV A;  4L75 A;  3D71 A;  3M06 A;  2B4Z A;  1W2E A;  4PD4 E;  3Q2Y A;  1VQM P;  3CI9 A;  1NTM K;  2FXO A;  1QVG O;  1VQ4 P;  1FZA A;  2GUV A;  1VF5 C;  1L4A A;  2CPB A;  5E79 V;  1H31 A;  4DT0 A;  1N73 C;  3MD0 A;  2OTJ P;  1PV3 A;  3L73 G;  4RO0 A;  5C9M A;  3TDK A;  1FBM A;  3VMX A;  4WQC A;  1X8Y A;  4WWI A;  2M5A B;  4ZMD A;  2I1K A;  4RJT A;  4WQA A;  4WQE A;  3EWK A;  1GTW A;  3SWF A;  4EDF A;  3CX5 I;  1CO6 A;  4EIF A;  1PGO A;  3RK3 B;  2NZ2 A;  2Q5U A;  1K9M Q;  1CSB A;  1JTH A;  1VQN P;  1N8R Q;  2GA1 A;  2N3B A;  5CJ0 A;  3CCM P;  1S5L H;  3HQ6 A;  1CYJ A;  2JJL A;  3I5C A;  1VDF A;  2QJY C;  5AVZ B;  1NTM E;  4WQB A;  2E75 B;  3N4X A;  1Q7Y Q;  1Q82 Q;  4WY4 D;  3V5B A;  1KB9 H;  2M3E A;  2VRS A;  2H8P D;  4WQ9 A;  3B5N A;  1IZN B;  1IFI A;  2KP8 A;  3O8Z A;  5CHX A;  3L71 J;  1Y8A A;  3AEA C;  2E76 C;  1FZF A;  1RE4 C;  2OYI B;  4GOD A;  5AVS B;  4L3G A;  2Q3I A;  3KZI V;  3PXS A;  3MK7 C;  1EZV D;  4BWN A;  2FYU D;  4D6T J;  1LTJ B;  2IFM A;  2WPS A;  1Q81 Q;  1FJ0 A;  1PPJ D;  4IFF A;  1AQT A;  2KS1 A;  4GOE A;  1B7V A;  3HE5 B;  3CMA P;  1OMI A;  2CE1 A;  1IC2 A;  3L4M A;  1IO4 A;  2C1D B;  3PH2 B;  5AW6 B;  3AE6 C;  4GYD A;  1KYO H;  5C39 A;  2BLF B;  1CHJ A;  1QEX A;  4L76 A;  3A2A A;  1URQ B;  1HBW A;  1S5L X;  5AW0 B;  3H1J G;  1MV8 A;  3CC2 P;  2R3S A;  2WPQ A;  3L70 D;  1YTZ T;  3KXD A;  1JY3 N;  2QJP C;  3B71 A;  2R3C A;  2IDB A;  1U57 A;  2FRC A;  4I7Z C;  1NU1 J;  2XTS B;  1PP9 J;  2FYN B;  1H32 A;  1ETP A;  1GIW A;  2LIT A;  1SQV G;  4PD4 D;  1QL2 A;  4NPD A;  3CCL P;  4H44 C;  2K9J B;  2Y0D A;  2FY8 A;  2A06 E;  2K3R A;  1KYO W;  1VQO P;  4L74 A;  3O6Q B;  3MIW A;  4FB1 A;  3RGU A;  5GTI H;  3O1Y A;  2GUS A;  4H13 B;  1BSN A;  2OQQ A;  4PW9 B;  1JY3 P;  3GHG A;  1Q86 Q;  3AE7 C;  2H43 A;  3WFB C;  1VQ9 P;  2BPB B;  3W67 A;  3OA8 A;  1SLQ A;  1LTB C;  1OW6 A;  1USE A;  1FOS F;  1E29 A;  1CW5 A;  2N9Y B;  1JEK A;  2JKV A;  1FAV A;  2N3Y A;  1S9K E;  2HYN A;  3V2N A;  2M3B A;  2IYP A;  1YEA A;  1VF5 B;  1CED A;  5GTH E;  2WPR A;  3OCD B;  1DW2 A;  2LXC B;  3L73 E;  1N73 B;  1NIR A;  1FI9 A;  1NTM D;  2HLO A;  3HE4 A;  1T3U A;  3VMZ A;  4OGQ D;  1HWT C;  2WT7 B;  1NTZ K;  1NJI Q;  2OTL P;  3CCR P;  3CP5 A;  3ZOW A;  3Q5P A;  3A0B H;  1OFC X;  3PRJ A;  5CIG B;  4YPC A;  5TIS H;  1X79 B;  1AV1 A;  1SS1 A;  1L0L G;  3D0W A;  1LWU B;  1YJW P;  2E5Y A;  2AXC A;  2CPS A;  3D6Z A;  4EI2 A;  2W6J H;  5APX A;  5APQ A;  3AEF C;  5B66 H;  2C9X B;  3SXT A;  5AW1 B;  1FHB A;  3M0A A;  3X39 A;  1KFN A;  1EZV I;  2H88 C;  1M57 D;  4LJI A;  1C2N A;  3RL0 B;  1NTZ E;  1SQX G;  2E74 B;  1SQQ G;  2ZT9 B;  3RMZ A;  3O0R C;  1BCC D;  2WSC H;  5CIE B;  4PV1 C;  2FYU J;  5AW2 B;  1SQP G;  2KK7 A;  3MK7 B;  1W5C E;  3CXH E;  1WRG A;  2C0X A;  1LNQ A;  1S6V B;  2O01 H;  3WFC C;  3VP9 A;  1DD4 A;  4H0L B;  2KUB A;  2BEZ F;  4AAL A;  3H1I G;  2HR3 A;  1IFP A;  2C2C A;  5DF5 A;  1AVO A;  2PCB B;  3H1H G;  1KFM A;  3BCC E;  4PD4 I;  1JCD A;  2V7Q H;  4WVZ A;  1T2K C;  3L70 J;  2D0W A;  1FC2 C;  2DVH A;  5KAI V;  4BRY B;  3RN1 A;  2NPS B;  2KZJ A;  1K04 A;  4AAO A;  3C9I A;  4BXL A;  5C0Z A;  1Y47 A;  2WSE H;  2Y9Z A;  1S5L E;  1WT6 A;  1H8A A;  2JQR A;  4IFD K;  2QM7 A;  3TK1 A;  2K88 A;  3A3Y B;  2OYH B;  1YHQ P;  1CRY A;  1GK6 A;  4I1L A;  3HD7 A;  5E79 H;  1RE3 A;  2ZXE B;  4DY9 A;  4H44 B;  1DD3 A;  3RK3 C;  3RK2 B;  2O1J A;  2YXR B;  1KB9 E;  5KJ7 D;  4Y99 B;  4GIF A;  2O01 N;  2AEJ A;  2YIU B;  2WVR A;  4JYC A;  2R5D A;  1G2C A;  2MKV A;  2G8Y A;  2AIU A;  1Z56 A;  1L0L K;  1CYI A;  3WUT A;  1GJQ A;  2N1T B;  3CPW O;  1MFT A;  2ZYA A;  3BAS A;  4N6J A;  1NTM J;  2ZXX A;  2KOG A;  3ZDM A;  1IRW A;  1OVU A;  1R8E A;  1CRH A;  1CZQ A;  3NMD A;  2OZ1 A;  1RF1 B;  3M0D A;  1VYD A;  3A0B V;  1DIQ C;  4XYD B;  1K05 A;  2QJK B;  2CA3 B;  2OYI C;  5KLV G;  1SQX K;  5TIS V;  2W6A A;  1G1I A;  1RZ6 A;  1KYO E;  1ZR4 A;  5APW A;  4FA1 A;  3HTK A;  1GQ1 A;  2P2U A;  2D2C D;  1I8P A;  1LTJ C;  1NVO A;  4JCG A;  3AE4 C; 
#chains in the Genus database with same CATH homology
 1CO6 A;  4EIF A;  2MHM A;  3OCD A;  3WU2 V;  2YK3 A;  2KNC B;  2N3B A;  4FAV A;  1J3S A;  2AXT V;  1HJ4 A;  1H9Y A;  4WQD A;  3HQ6 A;  2A06 D;  1DW3 A;  1CYJ A;  1CTY A;  2BH5 X;  1CXA A;  2N18 C;  4P4Q B;  451C A;  3SWS A;  5CIC B;  2O3J A;  1AOQ A;  3PTZ A;  2D0S A;  4FA5 A;  3O20 A;  3ZOO A;  4WQB A;  1CXC A;  2N9I A;  1OCD A;  3WC8 A;  3KHU A;  4H0K A;  1ZZH A;  1NNO A;  1YIC A;  1MG3 D;  4WQ7 A;  1E8E A;  4WQ9 A;  1N9C A;  1AKK A;  1AOF A;  1KX2 A;  1W2L A;  3OA8 B;  1LFM A;  1NML A;  2L91 A;  4O1Q A;  4UB6 V;  1L0N D;  2CA4 B;  3H1J D;  1HH7 A;  1DVV A;  3L73 D;  4PJ0 V;  3WFD C;  1A8C A;  4L3G A;  1FI7 A;  3KZI V;  3PXS A;  5DFS A;  3MK7 C;  1EZV D;  4L1Q A;  1YNR A;  4FA4 A;  1S5L V;  5CIF B;  2FYU D;  5B6Q A;  1I6E A;  4N0K A;  1HZV A;  1SQV D;  3WUI A;  1FJ0 A;  1KIB A;  1PPJ D;  2KS1 A;  5CID B;  1B7V A;  4FA9 A;  2CE1 A;  3TF5 A;  3VMA A;  2MTA C;  3L4M A;  1CRC A;  2RMZ A;  1FOC A;  2JTI B;  2C1D B;  3PH2 B;  1KB9 D;  2DGE A;  1C75 A;  1W5C T;  4GYD A;  2BLF B;  2QJY B;  1CHJ A;  1SQB D;  5DJQ B;  3H1L D;  4FAN A;  1KX7 A;  1R0Q A;  4AX3 A;  1NMI A;  1RAP A;  3SJL A;  4EIE A;  3PLN A;  3L70 D;  4XXL A;  4K3I A;  1JDL A;  2FRC A;  1YCC A;  2XTS B;  1HJ3 A;  2FYN B;  1IZL 0;  1H32 A;  5KLI B;  4IL6 V;  1CSU A;  1ETP A;  2ZOO A;  1DW0 A;  1BE3 D;  1U75 B;  1GIW A;  351C A;  2LIT A;  1C2R A;  4PD4 D;  2CE0 A;  1NTZ D;  3GW6 A;  1LC2 A;  1F1C A;  2K9J B;  1CCR A;  2Y0D A;  2VHD A;  5CIB B;  1KYO W;  3CXH W;  4UB8 V;  2B12 B;  4YE1 A;  1QL3 A;  4J20 A;  4FB1 A;  1QN2 A;  3O1Y A;  2OZ1 B;  3PXT A;  2JWA A;  1H31 B;  3O5C A;  4PW9 B;  2QG4 A;  2GIW A;  1KYO D;  1IO3 A;  2ZBO A;  3CXH D;  1CRG A;  1CTJ A;  1F1F A;  3WFB C;  2BPB B;  1M6Z A;  3VNW A;  3OA8 A;  1HRO A;  2V08 A;  1CHI A;  1E29 A;  2N9Y B;  1I55 A;  3FWL A;  2YQB A;  2C8S A;  2N3Y A;  2BCC D;  1P84 D;  1NTK D;  3SLE A;  1FI3 A;  3DR0 A;  1YEA A;  1CED A;  3BCC D;  3OCD B;  1H9X A;  1BGY D;  1N50 A;  1DW2 A;  4H0J A;  1NIR A;  3L4O A;  1FI9 A;  1NTM D;  3HQ9 A;  2C1V A;  1HZU A;  2QJP B;  2AI5 A;  4EIC A;  3A0H V;  1HCM A;  3ORV A;  1QYZ A;  1L9B C;  3CP5 A;  3ZOW A;  2C1D A;  1WEJ F;  3ZIY A;  1YFC A;  5GTI V;  3PRJ A;  2Y0C A;  1SQQ D;  1CTZ A;  1PP9 D;  1IRV A;  1MG2 D;  5CIG B;  1M70 A;  1N15 A;  1KV9 A;  5KAF V;  2Y0E A;  1A2S A;  3HQ7 A;  5TJH A;  1SQP D;  3CYT I;  4PWA A;  2N18 B;  3CX5 W;  1COT A;  1I5T A;  2CXB A;  1KB0 A;  1C6O A;  2C9X B;  2ZON G;  3SXT A;  1FHB A;  3X39 A;  1CSW A;  3CX5 D;  3ZOX A;  3C2C A;  1CSX A;  3H1I D;  3RLM A;  2FWL A;  3DP5 A;  1IQC A;  4LJI A;  3ZBM A;  3CU4 A;  1C2N A;  2B11 B;  3M97 X;  3H1H D;  3NWV A;  1E2R A;  2L4D A;  1L9J C;  1CIF A;  5KKZ B;  1CIE A;  3JBT B;  3RMZ A;  5H2F V;  1C6S A;  3O0R C;  1BCC D;  2GC7 D;  5EXQ A;  1LS9 A;  2N9J A;  5CIE B;  3TYI A;  4A7P A;  3L71 D;  4Q5P A;  1HRC A;  3WFE C;  3MK7 B;  2Q3E A;  2BCN B;  4GED B;  3ZOY A;  1DW1 A;  1WVE C;  2ZZS 1;  5B5E V;  2YCC A;  2GC4 D;  1H1O A;  1S6V B;  1DVH A;  3SVW A;  3WFC C;  1M60 A;  4WQ8 A;  2PCC B;  3RN0 A;  4AAL A;  4D6T D;  1CNO A;  5B66 V;  1CC5 A;  1H32 B;  2RN0 A;  2IBZ D;  2I8F A;  1L0L D;  2C2C A;  3A9F A;  2EXV A;  5DF5 A;  3VRD A;  2PCB B;  1H33 B;  1CHH A;  5IY5 1;  1HJ5 A;  1COR A;  2HV4 A;  1OAE A;  5DJQ C;  2ORL A;  2BGV X;  2D0W A;  3GG2 A;  2DVH A;  5AUR A;  5KAI V;  1GDV A;  1QL4 A;  3RN1 A;  4EID A;  4AAO A;  1LC1 A;  1AYG A;  2LIR A;  2PAC A;  1C7M A;  5C0Z A;  2V07 A;  3ZCF A;  3HQ8 A;  1CIH A;  1CRI A;  155C A;  2JQR A;  4L3H A;  4RSZ A;  1C52 A;  3H1K D;  1ZRT D;  1CRY A;  2ZXY A;  1YIQ A;  1CCH A;  3L75 D;  2C1U A;  1YEB A;  3L72 D;  1SQX D;  2B0Z B;  4MU8 A;  4DY9 A;  1RAQ A;  1I8O A;  4Y5R A;  1NU1 D;  5GTH V;  3TGU D;  3VYM A;  2B10 B;  1A56 A;  1CSV A;  3PXW A;  5CYT R;  5KLV D;  4AAM A;  2YIU B;  1DT1 A;  1U74 B;  4AAN A;  2GB8 B;  2AIU A;  1K3G A;  2BH4 X;  5CIH B;  1CYI A;  1I6D A;  1GJQ A;  1MZ4 A;  1K3H A;  1CIG A;  1GKS A;  1QKS A;  4NFG B;  1EB7 A;  3DMI A;  1I54 A;  1YTC A;  4KMG A;  3CWB D;  1BL9 A;  1DII C;  1CRJ A;  1GU2 A;  2B4Z A;  3NBT A;  1N90 A;  4V2K A;  1RZ5 A;  4O1W A;  1IRW A;  1CRH A;  2OZ1 A;  4QAO A;  4U3F D;  5E79 V;  1H31 A;  1LMS A;  3PHL A;  3NBS A;  1VYD A;  3A0B V;  1DIQ C;  4XYD B;  3ITK A;  2QJK B;  5C9M A;  2CA3 B;  3TDK A;  5TIS V;  4WQC A;  1FCD C;  1RZ6 A;  1CYC A;  4RJT A;  4WQA A;  4FA1 A;  1GQ1 A;  4WQE A;  1H33 A;  1C6R A;  1I8P A;  4JCG A;  4EDF A;  3L74 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...