1SQXD

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqxD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqxD02
3ZOYA 1I5TA 4AANA 3PLNA 2N9YB 1CIGA 1CRHA 451CA 1HJ4A 4WQBA 2C1VA 1CORA 2I8FA 2AIUA 1CSXA 3TYIA 1CO6A 2HV4A 3ORVA 2BPBB 2GB8B 3ZOXA 1S6VB 4XYDB 1CHIA 1QYZA 1DVVA 1CXCA 3VRDA 5GTIV 2MTAC 3HQ8A 2BCCD 3JBTB 3OA8B 1F1CA 3RN1A 3SVWA 3NBSA 3HQ7A 1HROA 1DT1A 2ZXYA 1CYIA 3ZOOA 1NMLA 1NTMD 3ITKA 1GJQA 2L4DA 1CIFA 2B0ZB 4GEDB 1BCCD 5CIHB 2EXVA 2LITA 3H1JD 1LC2A 2Y0EA 2QG4A 3VMAA 2JTIB 4QAOA 1HZVA 4J20A 4K3IA 2GC4D 4UB6V 5KAFV 3C2CA 3L4MA 3CYTI 3OA8A 1B7VA 5DJQB 1DVHA 4PWAA 1MG2D 1I54A 1RZ6A 1R0QA 4AALA 1YEAA 3H1ID 3CX5W 351CA 4AAOA 3PTZA 1BL9A 155CA 2XTSB 4WQEA 3CX5D 1HZUA 1PP9D 1GU2A 3A9FA 1M6ZA 1NTKD 4WQ9A 1A2SA 1OAEA 3L74D 3H1HD 1CRYA 5C9MA 2LIRA 1KIBA 1C75A 2B10B 1WVEC 5EXQA 3DR0A 3SXTA 1BGYD 4AX3A 2D0SA 2Y0DA 1SQPD 1CSWA 1KX2A 2N18C 4RJTA 1E2RA 2JWAA 1SQVD 2ZOOA 5DF5A 3WFDC 4O1WA 1A56A 1NNOA 1E29A 1IQCA 3A0HV 3H1KD 2GC7D 1FHBA 1NTZD 4PJ0V 2CXBA 1CTJA 1LFMA 1E8EA 3WC8A 1SQXD 1DW3A 2QJKB 2N9IA 4EIFA 1GIWA 1C7MA 1LMSA 1VYDA 2PCBB 3O0RC 1CRGA 3ZBMA 4L3GA 1M70A 1YICA 3ZCFA 2B11B 3PHLA 1IO3A 5CIFB 3CXHW 3BCCD 4EIEA 1SQBD 3OCDB 1I8OA 4YE1A 2BH5X 1C6OA 2V07A 3NBTA 1IRWA 1CHJA 2ZONG 1FI9A 1J3SA 3CXHD 1I6EA 1C6RA 1DW2A 5H2FV 1H32A 3RN0A 2DGEA 2PACA 4WQAA 1FCDC 1H33B 2C8SA 2DVHA 5TISV 4FA4A 4Y5RA 1A8CA 3O5CA 1RAPA 2QJYB 1CXAA 1AOFA 3L75D 3A0BV 4FA5A 2N9JA 1ZZHA 1FOCA 3DMIA 3L4OA 1L0LD 4WQ8A 1HRCA 3PRJA 1H31B 4PW9B 1FI3A 3L72D 2CA3B 2VHDA 5GTHV 4L1QA 1IZL0 5AURA 1YTCA 3PXSA 4MU8A 4PD4D 2CE0A 1YCCA 3GW6A 1DIQC 1C6SA 5KLVD 1KYOW 2YK3A 1KB9D 1CRCA 3SJLA 5CIBB 5B5EV 2GIWA 5DJQC 1KYOD 1U75B 1QN2A 3SLEA 2C1DB 4UB8V 4KMGA 2ORLA 1QL4A 1I55A 2ZZS1 5TJHA 1QKSA 1CYCA 3KHUA 3MK7B 1CIEA 1CYJA 3L70D 2BGVX 2AXTV 4RSZA 3RLMA 3WU2V 2OZ1B 3L73D 1CIHA 2C1UA 1CSVA 4WQCA 1LS9A 1CNOA 1HJ5A 2D0WA 3CWBD 1C2NA 3FWLA 3TGUD 1YIQA 1H1OA 2FWLA 2O3JA 2YCCA 1CTYA 1NIRA 2RMZA 2C2CA 4JCGA 4U3FD 2BLFB 2KS1A 1DW0A 2BCNB 2CA4B 1FJ0A 5IY51 1CEDA 3WUIA 3VNWA 3X39A 1L9BC 1LC1A 1W2LA 2CE1A 2N3YA 2KNCB 4NFGB 4H0JA 1H9XA 4AAMA 2FYNB 1HH7A 1U74B 2FYUD 4EIDA 1YNRA 1KX7A 3PXTA 3VYMA 4H0KA 2IBZD 2PCCB 4WQDA 1I6DA 3O1YA 1W5CT 2YIUB 3H1LD 1K3GA 1GDVA 2RN0A 2YQBA 1BE3D 1CCHA 4FAVA 1FI7A 1CRJA 2V08A 1C52A 1HJ3A 5CIEB 1MZ4A 3PXWA 1RAQA 1ZRTD 1DW1A 3M97X 1NU1D 4LJIA 3ZIYA 1I8PA 2Q3EA 1KV9A 2FRCA 1K3HA 1H9YA 1N90A 4FANA 2N3BA 3ZOWA 3GG2A 3RMZA 2B4ZA 5KAIV 1SQQD 4P4QB 4FB1A 2B12B 3OCDA 4XXLA 1OCDA 3KZIV 3WFEC 1ETPA 1KB0A 2ZBOA 1AKKA 1H33A 4FA9A 5CIDB 2Y0CA 4GYDA 1NMIA 1GQ1A 4WQ7A 2MHMA 3NWVA 2K9JB 2L91A 1F1FA 4IL6V 4Q5PA 1YEBA 3WFBC 1H31A 4D6TD 1N9CA 4EDFA 5CYTR 3CU4A 3TF5A 2QJPB 3O20A 1PPJD 3MK7C 1AOQA 3CP5A 1GKSA 2C9XB 5CICB 1L0ND 4N0KA 5DFSA 1CSUA 1L9JC 1CTZA 1C2RA 1IRVA 2A06D 2BH4X 4L3HA 1MG3D 3L71D 5C0ZA 1HCMA 4V2KA 5B6QA 5KKZB 3HQ6A 3HQ9A 1P84D 2AI5A 2C1DA 2N18B 1QL3A 3DP5A 1CRIA 3PH2B 1EZVD 1N50A 1COTA 1WEJF 1N15A 5CIGB 4DY9A 1JDLA 1DIIC 2JQRA 2OZ1A 4O1QA 3SWSA 1CCRA 1H32B 1M60A 1CC5A 5B66V 4A7PA 1S5LV 4FA1A 1RZ5A 4EICA 1EB7A 1CHHA 1YFCA 1AYGA 5KLIB 5E79V 3TDKA 3WFCC
chains in the Genus database with same CATH superfamily
1W2EA 4L74A 2AIUA 2RH0A 3TYIA 3FX0A 2KNCA 3ORVA 2M5AB 2GB8B 1S6VB 1DVVA 4JQ0D 3JBTB 1YTZI 2KZIA 5AVYB 2ZXYA 5B5EH 2AEFA 4PV1D 4HKZH 5L8RJ 3CCUP 1KQGB 1HGVA 1LTBC 1NTMD 2KXPB 3BASA 3ITKA 2IBZG 4UB8H 1CIFA 3CXHH 1BCCD 2V4HA 2PGDA 1MFZA 4JF7A 3CPWO 2QG4A 2AXTH 5KTBA 4QAOA 1HZVA 4J20A 1G1IA 4HYTB 2YO2A 2WQYC 2LXBA 4Y99B 1DVHA 4PWAA 1MG2D 1I54A 4N6JA 1YEAA 3H1ID 2QJPC 1OIPA 2OTLP 3PTZA 2KLVA 2RKLA 1CW5A 3L72G 3CMAP 2WT7B 3CX5D 1NKNA 1SQQG 3V2RA 1H0TB 1ZW0A 1A2SA 1OAEA 3L74J 5AW1B 4I6MC 2B87A 1WVEC 3DR0A 2NPSB 3OA7A 1BSHA 1KTMA 5KAIE 2CK3H 1L0NK 2YKOA 2YNYA 3Q5SA 1K9MQ 1A56A 4CPGA 2OYOA 2OARA 2GC7D 3HE4A 5KJ7D 2IBZE 1T3JA 1PPJG 2JDIH 1SQXJ 2C0XA 1GZLA 1DW3A 1LNQA 2A45G 1AQ5A 4LC1A 1GIWA 1VYDA 3P8CD 1HH0A 1EDJA 3ZBMA 1A02F 1SFCB 3TGUG 3L71G 2L5GB 1HBWA 1YICA 1M8OB 4BRYA 4K35A 1SQBD 2IDBA 2V07A 1JY2N 1FI9A 1SQXK 4R4LA 1PGOA 2J59M 3II6A 3CCRP 2PACA 1N2DC 2DVHA 2W6JH 2Y9ZA 1SQQE 4FA4A 3O5CA 3F89A 1RAPA 1ZLLA 1GL2D 4FA5A 4IFFA 1ZZHA 2MKVA 4IL6H 3VMYA 3H25A 2E5YA 1H31B 3MUDC 1FJPA 2YKQA 5GTHV 3AEEC 1EDLA 2I1KA 2M5AA 4GOFA 2XNXA 4IFMA 1K8AQ 2FBWC 2CE0A 5B66E 2XDJA 2YK3A 1KB9D 2NRGA 3SJLA 1JUNA 4M3LA 2GIWA 1PPJE 4Y99C 5BU8B 1U75B 3MUDA 1DEBA 1I55A 2ZZS1 3M9HA 2CPBA 2N9BA 4LGDE 3N7NA 2C0WA 1KV4A 3F5HA 1IO4A 1CIEA 1LTSC 3L70D 1K04A 3L71E 1LTJC 2FXPA 1T8ZA 2IFMA 3RLMA 1KILE 1NTMG 1LP1B 1CIHA 5KKZC 3CMEP 1BCCG 2KLUA 2E74D 3T97B 2NPSC 1HJ5A 1KN7A 1SQVJ 3CWBD 2WSCJ 3MHVA 3OAKA 1H1OA 2P67A 2YCCA 4NPDA 1NIRA 1QX8A 1FZBA 4U3FJ 2BLFB 1NTZJ 2WT7A 1DW0A 1H0TA 3KYQA 1R8EA 1FJ0A 2CPSA 3H1IG 1N7LA 2LKMA 1IFPA 3X39A 2GUVA 4ZMDA 3M0DC 4H0JA 5KAFE 1CSBA 2P2UA 1H9XA 1SQVK 2A06G 3VYIA 2KSEA 4EIDA 1PV3A 1BDCA 3VYMA 4O9BA 2IBZI 2PCCB 3IAOA 1SFCC 1RE4C 3H1LJ 3RK3B 2E43A 1U57A 1NTZK 1RE3C 3HRNA 2FKWB 2NZ2A 1A02J 3H6PA 1JEKA 2V08A 3A5TA 3VMXA 3AE9C 2XU6A 1MZ4A 4BXLA 1RAQA 1KC8Q 1Q81Q 1WT6A 1JO5A 1FOSF 3CLQA 2AXCA 2Q3EA 2XNDH 1KV9A 3L75E 4WY4B 1OW8A 1HVVA 1L0LJ 1SFCA 2H8PD 1N7SD 1FJKA 3VTPC 3GG2A 1RE3A 1BCCE 2B4ZA 3WUUA 5KAIV 2FXMA 1Y47A 4P4QB 2J5UA 3S4RA 2HFED 4IFDK 3A0HE 4EOTA 2PFXA 1L4AC 1ETPA 1D7MA 4PD4E 4PJ0E 1HJBA 1AKKA 1S5LE 2Y0CA 1GQ1A 1SQBG 2BASA 1L0LK 3H1IE 4R4MA 1YQ4C 4Q5PA 1NOHA 1H31A 1G1JA 2WPVB 4D6TJ 3CX5E 2Q5UA 1FS0E 1L2PA 1AOQA 3CP5A 5KLVK 1IZNB 1XTCC 2C9XB 5CICB 2A45I 1L0ND 5H2FE 3CCLP 1L9JC 1C2RA 2FYZA 2MJZA 4XE5B 1IRVA 1QEXA 5TISE 1EQ7A 1M7LA 4L3HA 3S9OA 2V7QH 1YTZT 5CCGA 5B6QA 1P84D 1X9VA 2KUBA 2KOGA 2KK7A 2N18B 3IF4A 2ZT9B 4OH8B 2P1JA 3AE8C 1AVYA 1DIIC 1LP1A 1FE6A 3P8CE 2I8DA 3T97A 3SWSA 1M60A 3L70G 3MP7B 5B66V 2R32A 1S2EA 1SQBE 3Q2YA 1CHHA 1Q2NA 3RK3C 1NH4A 3ZOYA 3CWBG 1I5TA 3TNUB 3P7KA 1HTLC 1CRHA 2R3SA 1LTAC 451CA 2C1VA 2I8FA 2FYUK 2HV4A 3HD7B 2BPBB 5AW0B 1URQB 3MTUE 4XYDB 1LWUB 2H89C 3TK1A 1CXCA 3VRDA 5GTIV 5EFWB 2BCCJ 4WY4C 1F1CA 1HROA 3JCUH 1GW3A 1SVFA 1CYIA 3CCMP 3ZOOA 1NYHA 1GJQA 2P7JA 3H1JJ 2LR2A 3L36A 2FY8A 3VMAA 4WY4A 1S72P 3WU2H 1M1JC 3N4XA 5KAFV 3S1KA 2W6BA 1B7VA 5DJQB 2IYPA 1CI6B 2G8YA 3L70E 3L35A 1RZ6A 4AALA 3EQ2A 3VN0A 4H44D 3R2PA 3CX5W 3V2NA 3CX5I 3M06A 1HZUA 1VQLP 1X22A 3A9FA 3CWBE 2JWDA 3WUTA 2HG5D 1KILD 1S1CX 1C75A 1GW4A 3FWNA 3WMM0 1OMIA 4AX3A 2Y0DA 1SQPD 2Z5IA 4GOEA 2N18C 3GF7A 2ZT9C 1JCCA 1SQVD 5AVTB 2ZOOA 3KPEA 3KZIE 3G4SP 1VQMP 4O1WA 1VQ6P 2ZVNB 1DD3A 2Q6QA 1IQCA 3D6YA 3A0HV 3H1KD 1FHBA 3V2QA 1NTZD 1KORA 4PJ0V 3PP5A 2CXBA 1LFMA 3P8MC 2SPZA 1N8RQ 1HWTC 4EYYQ 1L0NG 2N9IA 1IC2A 3L4FA 1C7MA 1LMSA 3O0RC 1CZQA 1VQNP 2QIWA 3AECC 2YMKA 4L3GA 3PHLA 5CIFB 1LTIC 3OCDB 4YE1A 2BH5X 5AVWB 3CXHD 1K05A 1I6EA 1C6RA 5H2FV 3HD7C 3I55P 4H0LB 1URQC 3HE5B 1FCDC 2C8SA 5TISV 2ZYGA 1A8CA 3MIWA 3L75D 3AE1C 2N9JA 3DMIA 3L4OA 1L0LD 3PRJA 3TNUA 2JR8A 1FI3A 2CA3B 2WMMA 2Z5HA 3FXEA 1M57D 3HD7A 1YTCA 1URQA 3PXSA 1LWUA 4H13B 4MU8A 5AVQB 4PD4D 3RGUA 1MKMA 2KSJA 1RQVA 2V7QJ 5KLVD 1QGKB 1KB9I 5CIBB 1G2CA 5DJQC 1KYOD 1LTGC 3NFQA 1FDOA 5BU5A 2E5TA 3SLEA 1L0NE 4KMGA 2ORLA 1S9KE 3Q5RA 1PP9J 5TJHA 3KHUA 4L73A 3MK7B 1EDKA 3V6IA 1TU3F 3L74E 1YIJP 1P84E 1BGYJ 3L73D 2C1UA 4RESB 1ZP0C 3RBXA 2D2CC 1J2JB 4DJGA 1CI6A 1C2NA 1S5LH 4OGQB 3SFEC 1YIQA 2FWLA 1VPCA 1CTYA 2C2CA 4AYCA 2WTYA 1KQSO 4JCGA 5E79H 4RKUJ 1JCDA 1IK7A 3BVHA 1SQXE 4C46A 3VNWA 2N3YA 4UB6E 1Q7YQ 2FYNB 1HH7A 2FYUD 3I56P 5C39A 1KX7A 4OWFA 1AA0A 2K9YA 3BCCJ 2YIUB 2PP6A 1IFDA 5APUA 1S3JA 5APTA 5CHXA 2QEXP 1SQPG 4YXWH 2QM7A 1FI7A 3AE2C 1SQVG 2W90A 4AUWA 3EFGA 5CIEB 1ZRTD 2B88A 1X79B 2W6AA 4H0LC 3Q3DA 4ZKUA 3H1KG 2FFDB 2IZ0A 5AW3B 3LIDA 1K3HA 1H9YA 1JB0J 3L72J 1GMJA 3M9QA 1SQQJ 4N78D 3OCDA 1OCDA 3KZIV 1OVUA 1OX3A 1KQLA 3WFEC 1YITP 3HE5A 4H13C 3NXSA 1T6AA 1NMIA 3TSIA 4WQ7A 3NWVA 1FDMA 2NPSD 3O8ZA 1KD1Q 1AJYA 1SQQK 2E76B 5CYTR 3BRTB 5AVXB 3OJAB 3MK7C 3L75G 1NVOA 5GTIE 1L0LG 5DFSA 2N1TB 1DIPA 5M1BA 1SQPE 1X0TA 3BRVB 3P32A 2BH4X 1YI2P 1SQVE 3TGUJ 2ZYDA 5CJ4A 2O01H 1HCMA 4V2KA 1KB9H 3HQ6A 4WBAA 3A0BE 3GHGB 3A7OA 1P84I 2AI5A 2HYNA 1JY2O 4OGQC 1GK4A 3H1KE 1SFCD 2OQQA 5KLVG 2BEZF 1EZVD 1T2KC 1NTZE 3E1IA 5CIGB 1YJWP 3RK2B 3TYYA 1JDLA 3GF3A 1FZCB 1OVVA 2JQRA 5CCHC 2WPSA 1M90Q 5AVVB 4O1QA 1N73B 3GLMA 2K1AA 3NMDA 2OYHB 5APVA 4BWNA 4TT3H 1H32B 2P58A 2FYNC 5B5EE 3L73G 3JSVC 4GDOA 2IPPA 1BE3J 4UB8E 3G3ZA 3C1LA 2YIUC 3SWYA 1VQ7P 1YFCA 3CXHE 3WFCC 5AW4B 2ZXEB 4AANA 2JJLA 5CCHA 1T3UA 1FBMA 5AW2B 2AXTE 1L4AD 3B8EB 4WQBA 5GTHH 1NU1J 3CCQP 1JNMA 3KXDA 2DW3A 1QVGO 1USEA 1QYZA 2FFDC 5AW9B 1L0LE 1EC5A 3B71A 4XFJA 3RN1A 1J1EB 4YXDC 3HQ7A 5CCGD 2JEEA 2W83C 2FYUG 1NTMJ 3OW2O 3SFDC 1N86A 2L4DA 3M0AA 1NU1K 5KLVE 4AQRD 1BCCJ 5CIHB 2C9LY 1LC2A 1H89A 2M8RA 2Y0EA 2PAJA 1JY3O 1KYOE 4I2LC 2FFDA 1IJDB 5CCGC 4UB6V 2B89A 2WSFH 3L4MA 3CYTI 3D0WA 3OA8A 3AEFC 1RH5B 2E75B 4HB1A 1NTMK 2E76C 3H1IJ 1PIXA 1GTWA 4EIJA 4AAOA 351CA 3D71A 1PFIA 3L73E 1YYCA 3SWKA 1VF5B 1S9KD 1ZXGA 2XTSB 4WQEA 2GM4A 1PP9D 1GU2A 2N1TC 1RF0A 1M6ZA 4EI2A 3RL0B 4WQ9A 1JMBA 3L74D 1FAVA 5C9MA 2LIRA 2JKVA 3SXTA 1BGYD 1VDFA 2D0SA 1NGMB 1CSWA 2M0BA 1LT9A 1VQKP 1KX2A 4RJTA 3B5NB 1HF9A 1E2RA 5AVUB 3CC7P 1NWQA 4DT0A 3RK3D 3MZWB 4JYBA 5DF5A 2H88C 1NNOA 1E29A 3RK2C 2N1TA 4Y28J 1FZCC 2FYUE 2QA4P 1N73C 1E8EA 1SQXD 4C7NB 1GU5A 3GHGA 2QJKB 1VQ4P 4IL6E 4WY4D 2HODB 1AQTA 1JTHB 1YHQP 1CRGA 1EDIA 3ABVC 1OW6A 1ZRTE 1IO3A 1FZCA 3CXHW 5KAIH 3BCCD 1FZGA 1SQBJ 1I8OA 1HGZA 1SP4A 2O1JA 1IFNA 1N73A 3NBTA 1IRWA 1EZVG 2OYHA 1S5LX 1J3SA 3CXHI 1DW2A 3M9BA 1H32A 3RN0A 2R5BA 2BCCE 3U1CA 2KIKA 4N78E 2K3RA 2Z4EA 1NAYA 1J1EC 3M91A 1G2CB 2QJYB 1CXAA 3A0BV 1Z56A 1FOCA 2WVRA 4WQ8A 1Q86Q 4DZOA 1SQBK 3L72D 3AE7C 2VHDA 2WSEJ 2R3CA 1IZL0 2WPQA 5AURA 2QM8A 4PD4I 3U1AA 1JM0A 3GW6A 3A3YB 1KYOW 2O01J 2XKMA 1AFOA 1W5CE 2JO1A 1CRCA 3Q1MA 5B5EV 3VP9A 1KYOI 2E75C 2O01N 3AE5C 2ZT9D 4PV1B 1QN2A 1QL2A 4UB8V 1QL4A 5BVZA 2WSSH 1QKSA 1VF5C 1NTKJ 3L70J 3H1HJ 2BGVX 1FZFA 2AXTV 4RSZA 3RL0C 2ZFCA 3D70A 2OZ1B 2Q9IA 4DCKA 4JBZA 4WQCA 1CNOA 1EZVE 3CWBJ 2D0WA 2XZRA 2YMYA 3FWLA 1Y9BA 5B66H 3B5NC 1OVRA 3H32B 3TGUD 2O3JA 2PRRA 2O1KA 2RMZA 1YQ3C 1NTKK 4U3FD 5APQA 2A45H 5IY51 1CEDA 2AEJA 3HD7D 1URQD 1W2LA 2CE1A 4NFGB 4YTPC 1UIIA 4AAMA 1PP9G 2QJKC 3B5NA 2YKPA 5GTIH 1AVOA 2K37A 2HR3A 5K5GB 4NPEA 3L74G 2KP8A 4WQDA 3O1YA 3H1LD 1K3GA 1BGYG 1BE3D 1ZR4A 2G3AA 4FAVA 3KDPB 4B86A 4GT1A 2W8ZA 1Q82Q 1C52A 1LWUC 3PXWA 3CD6P 4C7NA 3V4WA 3Q5PA 2HODA 1NU1D 4KHXA 2WSFJ 1JTHA 1KILA 3LW5J 2BEQD 1IFMA 1N90A 2QJYC 3ZOWA 5KAFH 1UIXA 1SQXG 2I1JA 2B12B 1ZV8A 1BDDA 1S4XA 3RL0g 4GODA 1KB0A 2ZBOA 4FA9A 3AEDC 5CIDB 4GYDA 3BCCG 2MHMA 2ZAEB 4NPFX 2D2CD 2B9BA 3JC22 2K9JB 3R4YA 2L91A 1F1FA 4GIFA 4IL6V 1MUUA 1GL2B 1FZEA 4D6TD 4PV1C 1PP9E 4EDFA 2Y9YA 3FXDA 3CU4A 4HH2A 1L0NJ 3AE4C 4N0KA 1BGYE 1OW7A 1CSUA 1J1DB 5CMZA 3A0HH 4KT0J 2A06D 1LTJB 2LXCB 4PD4H 4PJ0H 3RK3E 2E42A 1MG3D 1VQ8P 1DEEG 2ZJSE 5KKZB 3HQ9A 4OVNF 1GD2E 1JY2P 1KYOH 1CRIA 5AW7B 3PH2B 1EZVI 1WEJF 4K3AA 2YXRB 5AVSB 4IOIH 4DY9A 3AE6C 3CX5H 2OYIB 4YPCA 1Q90D 5AVZB 2OZ1A 3QWOC 4I7ZB 1NHLA 4H0LD 4DOJA 1RF1B 3G6EP 5H2FH 3JCUE 1CC5A 4A7PA 1OXZA 2E74B 3H32A 1K73Q 5APYA 5TISH 3BCCE 1RZ5A 1IFJA 3CCVP 1E5WA 4EICA 3V2PA 1HJ0A 1VL2A 1AYGA 5KLIB 3TDKA 1LTTC 3PLNA 1M56D 2N9YB 1CIGA 2GUSA 1FU1A 1H88A 1HJ4A 1CORA 2IZ1A 1CSXA 1CO6A 3WU2E 4H13D 5KJ7C 4U3FG 3ZOXA 3W67A 3PJSK 3E1RA 1NTZG 2IYOA 1CHIA 3USSA 1YJ9P 4WWIA 2MTAC 3HQ8A 2BCCD 3OA8B 3L72E 3SVWA 3NBSA 2KYVA 1DT1A 2FXOA 1QVFO 3G9RA 4MN4C 1ZN5A 2H7HA 1NMLA 4TLFA 5CJ0A 2B0ZB 4GEDB 5KJ7A 1ZR2A 3H1LG 2WPRA 3AEGC 5APXA 2EXVA 2LITA 3H1JD 2XV5A 3WUVA 1BE3G 1L4AB 1U7MA 1XTGB 3MD0A 2JTIB 1JY3P 1ZOYC 4K3IA 2GC4D 1R5SA 1YJNP 3C2CA 1LT9B 1GL2C 3SSUA 1N7SB 3MGNA 4OGQD 1SS1A 3LIEA 1NU1G 4WB4A 3IR9A 1R0QA 1T2KD 5APWA 3VP8A 3CI9A 2WSEH 1BL9A 155CA 3UIAA 2KS1B 5CCHD 1OFCX 1FC2C 1J1DC 1FDIA 1NTKD 3L71J 1VQ9P 3H1HD 1CRYA 1U7JA 3QH9A 3TGUE 2K9JA 2QRXA 1KIBA 2B10B 1YBKA 2QE7H 5EXQA 1GL2A 1LT1A 1SQPJ 2QVAA 4U3FE 3W68A 1OWAA 3RBZA 1R5LA 2JWAA 4W7YA 3V5BA 1GDTA 3WFDC 1JY3N 2OYIC 3H1KJ 4JPZB 4D6TG 3K5BA 4I7ZC 1LTJA 1Y8AA 1CTJA 1RF1C 3WC8A 3GMAA 1MZ9A 1SQPK 3H1LE 1EXIA 2E74C 4EIFA 2NPSA 1BE3E 3I5CA 2PCBB 1NJIQ 3C9IA 1JMMA 5KLIC 4U7JA 1M70A 3ZCFA 2KB7P 2B11B 2R5DA 2OYIA 3VOPA 2P10A 4EIEA 5AW8B 1NU1E 1PGJA 1C6OA 1BSNA 1MFTA 3KZIH 1CHJA 2ZONG 4Z1MH 1RF1A 4W80A 2DGEA 4WQAA 1H33B 3M0DA 3O6QB 4Y5RA 2WWWA 3IFMA 2YXQB 3L75J 1AOFA 5DJTB 1NTME 2E76D 1NAFA 1QLED 1RE4A 1HRCA 3HTKB 5CBOA 4PW9B 1KFMA 4L1QA 2M3BA 1RF0C 3A2AA 2N1TD 3CL3D 1PL5A 3NTNA 1YCCA 1DIQC 4D6TE 3LW5H 1C6SA 5KLVJ 2Q1KA 1KQFB 3EWKA 1PGPA 3VMZA 1LT9C 3FGAD 1N7SC 1M1JB 5E79E 2C1DB 4HJGH 1JOCA 1GU4A 2C9NY 4ZNCA 2BCCG 1CYCA 2A06E 3RK2D 1X8YA 3C8VA 2OTJP 1CYJA 1HUCA 1L4AA 3SWFA 1DH3A 3WU2V 3L73J 3GHGC 1CSVA 2ZXXA 1LS9A 3PH0A 1N7SA 3ZDMA 3H1JG 2JP3A 2ZYAA 1IFIA 2HPCB 3E7KA 5CBNA 4H44B 3HUSB 2KS1A 1DD4A 1OZHA 4JYCA 5AW6B 2Q7CA 1VQPP 3CC4P 3V4QA 4XA4A 2BCNB 4ASVA 2OYHC 2CA4B 1IK9A 3G71P 1NO4A 3WUIA 3BATA 1L9BC 1LC1A 2KNCB 1KILB 2M3EA 4GKGA 2FYUJ 1U74B 5AW5B 3B4SA 1P84H 1YNRA 3PXTA 1NTKG 1PGQA 4H0KA 1ZMEC 3CCJP 2IBZD 1KMIZ 3H1HG 1I6DA 1W5CT 1LGHB 1GDVA 2RN0A 2YQBA 1E79H 5DJUB 1CCHA 2IX7C 1KFNA 3KQGA 1CRJA 1RHZB 1HJ3A 4ZKPA 1DW1A 1FOSE 1RY3A 4I1LA 3M97X 4QMAA 4KJMA 4LJIA 3ZIYA 1I8PA 1H8AA 1FZAA 2FRCA 2ZVOB 4UB6H 4FANA 2N3BA 3IN6A 2E75D 1VQOP 3RMZA 1SQQD 2WITA 3H1JE 4FB1A 2ITAA 5AVRB 4XXLA 4W7ZA 4N3YB 1VF5D 1KZUB 3CCEP 1QL1A 3RL0D 1H33A 1KB9E 3O6QA 3CCSP 2YO3A 1SLQA 2WZ7A 2W27A 2B87B 1PZQA 1YEBA 2KZJA 3B5ND 3CC2P 3WFBC 1WRGA 4LLHA 1N9CA 3HTKA 1M1KQ 3TF5A 1NTKE 2QJPB 3O20A 4L75A 1W2BO 3H1HE 1PPJD 3AEBC 4RO0A 2AEMA 1GKSA 2QSIA 2KI7B 1CTZA 3EFFK 4ASWA 2IFNA 2OGUA 3HE4B 2H43A 2J58A 4IL6X 3L71D 5C0ZA 1M1JA 2GA1A 2C1DA 1WMKA 1DX7A 1QL3A 2D2CB 3DP5A 2HLOA 1N50A 1COTA 4H44C 1MV8A 2R44A 1N15A 1GK6A 5GTHE 3HUSC 5APSA 3U59A 2OTKE 4BRYB 1EXJA 2K88A 2POHA 1VQ5P 1KILC 1CCRA 3AEAC 1AV1A 2UWJE 3L37A 1S5LV 2HPCA 4FA1A 2Q3IA 4L76A 2VRSA 3D6ZA 1USDA 2WSCH 4WVZA 1EB7A 1RQUA 3AE3C 1LJ2A 3HUSA 1NKZB 4C7RA 5E79V 3A0BH
chains in the Genus database with same CATH topology
3ZOYA 1I5TA 4AANA 3PLNA 2N9YB 1CIGA 1CRHA 451CA 1HJ4A 4WQBA 2C1VA 1CORA 2I8FA 2AIUA 1CSXA 3TYIA 1CO6A 2HV4A 3ORVA 2BPBB 2GB8B 3ZOXA 1S6VB 4XYDB 1CHIA 1QYZA 1DVVA 1CXCA 3VRDA 5GTIV 2MTAC 3HQ8A 2BCCD 3JBTB 3OA8B 1F1CA 3RN1A 3SVWA 3NBSA 3HQ7A 1HROA 1DT1A 2ZXYA 1CYIA 3ZOOA 1NMLA 1NTMD 3ITKA 1GJQA 2L4DA 1CIFA 2B0ZB 4GEDB 1BCCD 5CIHB 2EXVA 2LITA 3H1JD 1LC2A 2Y0EA 2QG4A 3VMAA 2JTIB 4QAOA 1HZVA 4J20A 4K3IA 2GC4D 4UB6V 5KAFV 3C2CA 3L4MA 3CYTI 3OA8A 1B7VA 5DJQB 1DVHA 4PWAA 1MG2D 1I54A 1RZ6A 1R0QA 4AALA 1YEAA 3H1ID 3CX5W 351CA 4AAOA 3PTZA 1BL9A 155CA 2XTSB 4WQEA 3CX5D 1HZUA 1PP9D 1GU2A 3A9FA 1M6ZA 1NTKD 4WQ9A 1A2SA 1OAEA 3L74D 3H1HD 1CRYA 5C9MA 2LIRA 1KIBA 1C75A 2B10B 1WVEC 5EXQA 3DR0A 3SXTA 1BGYD 4AX3A 2D0SA 2Y0DA 1SQPD 1CSWA 1KX2A 2N18C 4RJTA 1E2RA 2JWAA 1SQVD 2ZOOA 5DF5A 3WFDC 4O1WA 1A56A 1NNOA 1E29A 1IQCA 3A0HV 3H1KD 2GC7D 1FHBA 1NTZD 4PJ0V 2CXBA 1CTJA 1LFMA 1E8EA 3WC8A 1SQXD 1DW3A 2QJKB 2N9IA 4EIFA 1GIWA 1C7MA 1LMSA 1VYDA 2PCBB 3O0RC 1CRGA 3ZBMA 4L3GA 1M70A 1YICA 3ZCFA 2B11B 3PHLA 1IO3A 5CIFB 3CXHW 3BCCD 4EIEA 1SQBD 3OCDB 1I8OA 4YE1A 2BH5X 1C6OA 2V07A 3NBTA 1IRWA 1CHJA 2ZONG 1FI9A 1J3SA 3CXHD 1I6EA 1C6RA 1DW2A 5H2FV 1H32A 3RN0A 2DGEA 2PACA 4WQAA 1FCDC 1H33B 2C8SA 2DVHA 5TISV 4FA4A 4Y5RA 1A8CA 3O5CA 1RAPA 2QJYB 1CXAA 1AOFA 3L75D 3A0BV 4FA5A 2N9JA 1ZZHA 1FOCA 3DMIA 3L4OA 1L0LD 4WQ8A 1HRCA 3PRJA 1H31B 4PW9B 1FI3A 3L72D 2CA3B 2VHDA 5GTHV 4L1QA 1IZL0 5AURA 1YTCA 3PXSA 4MU8A 4PD4D 2CE0A 1YCCA 3GW6A 1DIQC 1C6SA 5KLVD 1KYOW 2YK3A 1KB9D 1CRCA 3SJLA 5CIBB 5B5EV 2GIWA 5DJQC 1KYOD 1U75B 1QN2A 3SLEA 2C1DB 4UB8V 4KMGA 2ORLA 1QL4A 1I55A 2ZZS1 5TJHA 1QKSA 1CYCA 3KHUA 3MK7B 1CIEA 1CYJA 3L70D 2BGVX 2AXTV 4RSZA 3RLMA 3WU2V 2OZ1B 3L73D 1CIHA 2C1UA 1CSVA 4WQCA 1LS9A 1CNOA 1HJ5A 2D0WA 3CWBD 1C2NA 3FWLA 3TGUD 1YIQA 1H1OA 2FWLA 2O3JA 2YCCA 1CTYA 1NIRA 2RMZA 2C2CA 4JCGA 4U3FD 2BLFB 2KS1A 1DW0A 2BCNB 2CA4B 1FJ0A 5IY51 1CEDA 3WUIA 3VNWA 3X39A 1L9BC 1LC1A 1W2LA 2CE1A 2N3YA 2KNCB 4NFGB 4H0JA 1H9XA 4AAMA 2FYNB 1HH7A 1U74B 2FYUD 4EIDA 1YNRA 1KX7A 3PXTA 3VYMA 4H0KA 2IBZD 2PCCB 4WQDA 1I6DA 3O1YA 1W5CT 2YIUB 3H1LD 1K3GA 1GDVA 2RN0A 2YQBA 1BE3D 1CCHA 4FAVA 1FI7A 1CRJA 2V08A 1C52A 1HJ3A 5CIEB 1MZ4A 3PXWA 1RAQA 1ZRTD 1DW1A 3M97X 1NU1D 4LJIA 3ZIYA 1I8PA 2Q3EA 1KV9A 2FRCA 1K3HA 1H9YA 1N90A 4FANA 2N3BA 3ZOWA 3GG2A 3RMZA 2B4ZA 5KAIV 1SQQD 4P4QB 4FB1A 2B12B 3OCDA 4XXLA 1OCDA 3KZIV 3WFEC 1ETPA 1KB0A 2ZBOA 1AKKA 1H33A 4FA9A 5CIDB 2Y0CA 4GYDA 1NMIA 1GQ1A 4WQ7A 2MHMA 3NWVA 2K9JB 2L91A 1F1FA 4IL6V 4Q5PA 1YEBA 3WFBC 1H31A 4D6TD 1N9CA 4EDFA 5CYTR 3CU4A 3TF5A 2QJPB 3O20A 1PPJD 3MK7C 1AOQA 3CP5A 1GKSA 2C9XB 5CICB 1L0ND 4N0KA 5DFSA 1CSUA 1L9JC 1CTZA 1C2RA 1IRVA 2A06D 2BH4X 4L3HA 1MG3D 3L71D 5C0ZA 1HCMA 4V2KA 5B6QA 5KKZB 3HQ6A 3HQ9A 1P84D 2AI5A 2C1DA 2N18B 1QL3A 3DP5A 1CRIA 3PH2B 1EZVD 1N50A 1COTA 1WEJF 1N15A 5CIGB 4DY9A 1JDLA 1DIIC 2JQRA 2OZ1A 4O1QA 3SWSA 1CCRA 1H32B 1M60A 1CC5A 5B66V 4A7PA 1S5LV 4FA1A 1RZ5A 4EICA 1EB7A 1CHHA 1YFCA 1AYGA 5KLIB 5E79V 3TDKA 3WFCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOY A;  1I5T A;  4AAN A;  3PLN A;  2N9Y B;  1CIG A;  1CRH A;  451C A;  1HJ4 A;  4WQB A;  2C1V A;  1COR A;  2I8F A;  2AIU A;  1CSX A;  3TYI A;  1CO6 A;  2HV4 A;  3ORV A;  2BPB B;  2GB8 B;  3ZOX A;  1S6V B;  4XYD B;  1CHI A;  1QYZ A;  1DVV A;  1CXC A;  3VRD A;  5GTI V;  2MTA C;  3HQ8 A;  2BCC D;  3JBT B;  3OA8 B;  1F1C A;  3RN1 A;  3SVW A;  3NBS A;  3HQ7 A;  1HRO A;  1DT1 A;  2ZXY A;  1CYI A;  3ZOO A;  1NML A;  1NTM D;  3ITK A;  1GJQ A;  2L4D A;  1CIF A;  2B0Z B;  4GED B;  1BCC D;  5CIH B;  2EXV A;  2LIT A;  3H1J D;  1LC2 A;  2Y0E A;  2QG4 A;  3VMA A;  2JTI B;  4QAO A;  1HZV A;  4J20 A;  4K3I A;  2GC4 D;  4UB6 V;  5KAF V;  3C2C A;  3L4M A;  3CYT I;  3OA8 A;  1B7V A;  5DJQ B;  1DVH A;  4PWA A;  1MG2 D;  1I54 A;  1RZ6 A;  1R0Q A;  4AAL A;  1YEA A;  3H1I D;  3CX5 W;  351C A;  4AAO A;  3PTZ A;  1BL9 A;  155C A;  2XTS B;  4WQE A;  3CX5 D;  1HZU A;  1PP9 D;  1GU2 A;  3A9F A;  1M6Z A;  1NTK D;  4WQ9 A;  1A2S A;  1OAE A;  3L74 D;  3H1H D;  1CRY A;  5C9M A;  2LIR A;  1KIB A;  1C75 A;  2B10 B;  1WVE C;  5EXQ A;  3DR0 A;  3SXT A;  1BGY D;  4AX3 A;  2D0S A;  2Y0D A;  1SQP D;  1CSW A;  1KX2 A;  2N18 C;  4RJT A;  1E2R A;  2JWA A;  1SQV D;  2ZOO A;  5DF5 A;  3WFD C;  4O1W A;  1A56 A;  1NNO A;  1E29 A;  1IQC A;  3A0H V;  3H1K D;  2GC7 D;  1FHB A;  1NTZ D;  4PJ0 V;  2CXB A;  1CTJ A;  1LFM A;  1E8E A;  3WC8 A;  1SQX D;  1DW3 A;  2QJK B;  2N9I A;  4EIF A;  1GIW A;  1C7M A;  1LMS A;  1VYD A;  2PCB B;  3O0R C;  1CRG A;  3ZBM A;  4L3G A;  1M70 A;  1YIC A;  3ZCF A;  2B11 B;  3PHL A;  1IO3 A;  5CIF B;  3CXH W;  3BCC D;  4EIE A;  1SQB D;  3OCD B;  1I8O A;  4YE1 A;  2BH5 X;  1C6O A;  2V07 A;  3NBT A;  1IRW A;  1CHJ A;  2ZON G;  1FI9 A;  1J3S A;  3CXH D;  1I6E A;  1C6R A;  1DW2 A;  5H2F V;  1H32 A;  3RN0 A;  2DGE A;  2PAC A;  4WQA A;  1FCD C;  1H33 B;  2C8S A;  2DVH A;  5TIS V;  4FA4 A;  4Y5R A;  1A8C A;  3O5C A;  1RAP A;  2QJY B;  1CXA A;  1AOF A;  3L75 D;  3A0B V;  4FA5 A;  2N9J A;  1ZZH A;  1FOC A;  3DMI A;  3L4O A;  1L0L D;  4WQ8 A;  1HRC A;  3PRJ A;  1H31 B;  4PW9 B;  1FI3 A;  3L72 D;  2CA3 B;  2VHD A;  5GTH V;  4L1Q A;  1IZL 0;  5AUR A;  1YTC A;  3PXS A;  4MU8 A;  4PD4 D;  2CE0 A;  1YCC A;  3GW6 A;  1DIQ C;  1C6S A;  5KLV D;  1KYO W;  2YK3 A;  1KB9 D;  1CRC A;  3SJL A;  5CIB B;  5B5E V;  2GIW A;  5DJQ C;  1KYO D;  1U75 B;  1QN2 A;  3SLE A;  2C1D B;  4UB8 V;  4KMG A;  2ORL A;  1QL4 A;  1I55 A;  2ZZS 1;  5TJH A;  1QKS A;  1CYC A;  3KHU A;  3MK7 B;  1CIE A;  1CYJ A;  3L70 D;  2BGV X;  2AXT V;  4RSZ A;  3RLM A;  3WU2 V;  2OZ1 B;  3L73 D;  1CIH A;  2C1U A;  1CSV A;  4WQC A;  1LS9 A;  1CNO A;  1HJ5 A;  2D0W A;  3CWB D;  1C2N A;  3FWL A;  3TGU D;  1YIQ A;  1H1O A;  2FWL A;  2O3J A;  2YCC A;  1CTY A;  1NIR A;  2RMZ A;  2C2C A;  4JCG A;  4U3F D;  2BLF B;  2KS1 A;  1DW0 A;  2BCN B;  2CA4 B;  1FJ0 A;  5IY5 1;  1CED A;  3WUI A;  3VNW A;  3X39 A;  1L9B C;  1LC1 A;  1W2L A;  2CE1 A;  2N3Y A;  2KNC B;  4NFG B;  4H0J A;  1H9X A;  4AAM A;  2FYN B;  1HH7 A;  1U74 B;  2FYU D;  4EID A;  1YNR A;  1KX7 A;  3PXT A;  3VYM A;  4H0K A;  2IBZ D;  2PCC B;  4WQD A;  1I6D A;  3O1Y A;  1W5C T;  2YIU B;  3H1L D;  1K3G A;  1GDV A;  2RN0 A;  2YQB A;  1BE3 D;  1CCH A;  4FAV A;  1FI7 A;  1CRJ A;  2V08 A;  1C52 A;  1HJ3 A;  5CIE B;  1MZ4 A;  3PXW A;  1RAQ A;  1ZRT D;  1DW1 A;  3M97 X;  1NU1 D;  4LJI A;  3ZIY A;  1I8P A;  2Q3E A;  1KV9 A;  2FRC A;  1K3H A;  1H9Y A;  1N90 A;  4FAN A;  2N3B A;  3ZOW A;  3GG2 A;  3RMZ A;  2B4Z A;  5KAI V;  1SQQ D;  4P4Q B;  4FB1 A;  2B12 B;  3OCD A;  4XXL A;  1OCD A;  3KZI V;  3WFE C;  1ETP A;  1KB0 A;  2ZBO A;  1AKK A;  1H33 A;  4FA9 A;  5CID B;  2Y0C A;  4GYD A;  1NMI A;  1GQ1 A;  4WQ7 A;  2MHM A;  3NWV A;  2K9J B;  2L91 A;  1F1F A;  4IL6 V;  4Q5P A;  1YEB A;  3WFB C;  1H31 A;  4D6T D;  1N9C A;  4EDF A;  5CYT R;  3CU4 A;  3TF5 A;  2QJP B;  3O20 A;  1PPJ D;  3MK7 C;  1AOQ A;  3CP5 A;  1GKS A;  2C9X B;  5CIC B;  1L0N D;  4N0K A;  5DFS A;  1CSU A;  1L9J C;  1CTZ A;  1C2R A;  1IRV A;  2A06 D;  2BH4 X;  4L3H A;  1MG3 D;  3L71 D;  5C0Z A;  1HCM A;  4V2K A;  5B6Q A;  5KKZ B;  3HQ6 A;  3HQ9 A;  1P84 D;  2AI5 A;  2C1D A;  2N18 B;  1QL3 A;  3DP5 A;  1CRI A;  3PH2 B;  1EZV D;  1N50 A;  1COT A;  1WEJ F;  1N15 A;  5CIG B;  4DY9 A;  1JDL A;  1DII C;  2JQR A;  2OZ1 A;  4O1Q A;  3SWS A;  1CCR A;  1H32 B;  1M60 A;  1CC5 A;  5B66 V;  4A7P A;  1S5L V;  4FA1 A;  1RZ5 A;  4EIC A;  1EB7 A;  1CHH A;  1YFC A;  1AYG A;  5KLI B;  5E79 V;  3TDK A;  3WFC C; 
#chains in the Genus database with same CATH topology
 1W2E A;  4L74 A;  2AIU A;  2RH0 A;  3TYI A;  3FX0 A;  2KNC A;  3ORV A;  2M5A B;  2GB8 B;  1S6V B;  1DVV A;  4JQ0 D;  3JBT B;  1YTZ I;  2KZI A;  5AVY B;  2ZXY A;  5B5E H;  2AEF A;  4PV1 D;  4HKZ H;  5L8R J;  3CCU P;  1KQG B;  1HGV A;  1LTB C;  1NTM D;  2KXP B;  3BAS A;  3ITK A;  2IBZ G;  4UB8 H;  1CIF A;  3CXH H;  1BCC D;  2V4H A;  2PGD A;  1MFZ A;  4JF7 A;  3CPW O;  2QG4 A;  2AXT H;  5KTB A;  4QAO A;  1HZV A;  4J20 A;  1G1I A;  4HYT B;  2YO2 A;  2WQY C;  2LXB A;  4Y99 B;  1DVH A;  4PWA A;  1MG2 D;  1I54 A;  4N6J A;  1YEA A;  3H1I D;  2QJP C;  1OIP A;  2OTL P;  3PTZ A;  2KLV A;  2RKL A;  1CW5 A;  3L72 G;  3CMA P;  2WT7 B;  3CX5 D;  1NKN A;  1SQQ G;  3V2R A;  1H0T B;  1ZW0 A;  1A2S A;  1OAE A;  3L74 J;  5AW1 B;  4I6M C;  2B87 A;  1WVE C;  3DR0 A;  2NPS B;  3OA7 A;  1BSH A;  1KTM A;  5KAI E;  2CK3 H;  1L0N K;  2YKO A;  2YNY A;  3Q5S A;  1K9M Q;  1A56 A;  4CPG A;  2OYO A;  2OAR A;  2GC7 D;  3HE4 A;  5KJ7 D;  2IBZ E;  1T3J A;  1PPJ G;  2JDI H;  1SQX J;  2C0X A;  1GZL A;  1DW3 A;  1LNQ A;  2A45 G;  1AQ5 A;  4LC1 A;  1GIW A;  1VYD A;  3P8C D;  1HH0 A;  1EDJ A;  3ZBM A;  1A02 F;  1SFC B;  3TGU G;  3L71 G;  2L5G B;  1HBW A;  1YIC A;  1M8O B;  4BRY A;  4K35 A;  1SQB D;  2IDB A;  2V07 A;  1JY2 N;  1FI9 A;  1SQX K;  4R4L A;  1PGO A;  2J59 M;  3II6 A;  3CCR P;  2PAC A;  1N2D C;  2DVH A;  2W6J H;  2Y9Z A;  1SQQ E;  4FA4 A;  3O5C A;  3F89 A;  1RAP A;  1ZLL A;  1GL2 D;  4FA5 A;  4IFF A;  1ZZH A;  2MKV A;  4IL6 H;  3VMY A;  3H25 A;  2E5Y A;  1H31 B;  3MUD C;  1FJP A;  2YKQ A;  5GTH V;  3AEE C;  1EDL A;  2I1K A;  2M5A A;  4GOF A;  2XNX A;  4IFM A;  1K8A Q;  2FBW C;  2CE0 A;  5B66 E;  2XDJ A;  2YK3 A;  1KB9 D;  2NRG A;  3SJL A;  1JUN A;  4M3L A;  2GIW A;  1PPJ E;  4Y99 C;  5BU8 B;  1U75 B;  3MUD A;  1DEB A;  1I55 A;  2ZZS 1;  3M9H A;  2CPB A;  2N9B A;  4LGD E;  3N7N A;  2C0W A;  1KV4 A;  3F5H A;  1IO4 A;  1CIE A;  1LTS C;  3L70 D;  1K04 A;  3L71 E;  1LTJ C;  2FXP A;  1T8Z A;  2IFM A;  3RLM A;  1KIL E;  1NTM G;  1LP1 B;  1CIH A;  5KKZ C;  3CME P;  1BCC G;  2KLU A;  2E74 D;  3T97 B;  2NPS C;  1HJ5 A;  1KN7 A;  1SQV J;  3CWB D;  2WSC J;  3MHV A;  3OAK A;  1H1O A;  2P67 A;  2YCC A;  4NPD A;  1NIR A;  1QX8 A;  1FZB A;  4U3F J;  2BLF B;  1NTZ J;  2WT7 A;  1DW0 A;  1H0T A;  3KYQ A;  1R8E A;  1FJ0 A;  2CPS A;  3H1I G;  1N7L A;  2LKM A;  1IFP A;  3X39 A;  2GUV A;  4ZMD A;  3M0D C;  4H0J A;  5KAF E;  1CSB A;  2P2U A;  1H9X A;  1SQV K;  2A06 G;  3VYI A;  2KSE A;  4EID A;  1PV3 A;  1BDC A;  3VYM A;  4O9B A;  2IBZ I;  2PCC B;  3IAO A;  1SFC C;  1RE4 C;  3H1L J;  3RK3 B;  2E43 A;  1U57 A;  1NTZ K;  1RE3 C;  3HRN A;  2FKW B;  2NZ2 A;  1A02 J;  3H6P A;  1JEK A;  2V08 A;  3A5T A;  3VMX A;  3AE9 C;  2XU6 A;  1MZ4 A;  4BXL A;  1RAQ A;  1KC8 Q;  1Q81 Q;  1WT6 A;  1JO5 A;  1FOS F;  3CLQ A;  2AXC A;  2Q3E A;  2XND H;  1KV9 A;  3L75 E;  4WY4 B;  1OW8 A;  1HVV A;  1L0L J;  1SFC A;  2H8P D;  1N7S D;  1FJK A;  3VTP C;  3GG2 A;  1RE3 A;  1BCC E;  2B4Z A;  3WUU A;  5KAI V;  2FXM A;  1Y47 A;  4P4Q B;  2J5U A;  3S4R A;  2HFE D;  4IFD K;  3A0H E;  4EOT A;  2PFX A;  1L4A C;  1ETP A;  1D7M A;  4PD4 E;  4PJ0 E;  1HJB A;  1AKK A;  1S5L E;  2Y0C A;  1GQ1 A;  1SQB G;  2BAS A;  1L0L K;  3H1I E;  4R4M A;  1YQ4 C;  4Q5P A;  1NOH A;  1H31 A;  1G1J A;  2WPV B;  4D6T J;  3CX5 E;  2Q5U A;  1FS0 E;  1L2P A;  1AOQ A;  3CP5 A;  5KLV K;  1IZN B;  1XTC C;  2C9X B;  5CIC B;  2A45 I;  1L0N D;  5H2F E;  3CCL P;  1L9J C;  1C2R A;  2FYZ A;  2MJZ A;  4XE5 B;  1IRV A;  1QEX A;  5TIS E;  1EQ7 A;  1M7L A;  4L3H A;  3S9O A;  2V7Q H;  1YTZ T;  5CCG A;  5B6Q A;  1P84 D;  1X9V A;  2KUB A;  2KOG A;  2KK7 A;  2N18 B;  3IF4 A;  2ZT9 B;  4OH8 B;  2P1J A;  3AE8 C;  1AVY A;  1DII C;  1LP1 A;  1FE6 A;  3P8C E;  2I8D A;  3T97 A;  3SWS A;  1M60 A;  3L70 G;  3MP7 B;  5B66 V;  2R32 A;  1S2E A;  1SQB E;  3Q2Y A;  1CHH A;  1Q2N A;  3RK3 C;  1NH4 A;  3ZOY A;  3CWB G;  1I5T A;  3TNU B;  3P7K A;  1HTL C;  1CRH A;  2R3S A;  1LTA C;  451C A;  2C1V A;  2I8F A;  2FYU K;  2HV4 A;  3HD7 B;  2BPB B;  5AW0 B;  1URQ B;  3MTU E;  4XYD B;  1LWU B;  2H89 C;  3TK1 A;  1CXC A;  3VRD A;  5GTI V;  5EFW B;  2BCC J;  4WY4 C;  1F1C A;  1HRO A;  3JCU H;  1GW3 A;  1SVF A;  1CYI A;  3CCM P;  3ZOO A;  1NYH A;  1GJQ A;  2P7J A;  3H1J J;  2LR2 A;  3L36 A;  2FY8 A;  3VMA A;  4WY4 A;  1S72 P;  3WU2 H;  1M1J C;  3N4X A;  5KAF V;  3S1K A;  2W6B A;  1B7V A;  5DJQ B;  2IYP A;  1CI6 B;  2G8Y A;  3L70 E;  3L35 A;  1RZ6 A;  4AAL A;  3EQ2 A;  3VN0 A;  4H44 D;  3R2P A;  3CX5 W;  3V2N A;  3CX5 I;  3M06 A;  1HZU A;  1VQL P;  1X22 A;  3A9F A;  3CWB E;  2JWD A;  3WUT A;  2HG5 D;  1KIL D;  1S1C X;  1C75 A;  1GW4 A;  3FWN A;  3WMM 0;  1OMI A;  4AX3 A;  2Y0D A;  1SQP D;  2Z5I A;  4GOE A;  2N18 C;  3GF7 A;  2ZT9 C;  1JCC A;  1SQV D;  5AVT B;  2ZOO A;  3KPE A;  3KZI E;  3G4S P;  1VQM P;  4O1W A;  1VQ6 P;  2ZVN B;  1DD3 A;  2Q6Q A;  1IQC A;  3D6Y A;  3A0H V;  3H1K D;  1FHB A;  3V2Q A;  1NTZ D;  1KOR A;  4PJ0 V;  3PP5 A;  2CXB A;  1LFM A;  3P8M C;  2SPZ A;  1N8R Q;  1HWT C;  4EYY Q;  1L0N G;  2N9I A;  1IC2 A;  3L4F A;  1C7M A;  1LMS A;  3O0R C;  1CZQ A;  1VQN P;  2QIW A;  3AEC C;  2YMK A;  4L3G A;  3PHL A;  5CIF B;  1LTI C;  3OCD B;  4YE1 A;  2BH5 X;  5AVW B;  3CXH D;  1K05 A;  1I6E A;  1C6R A;  5H2F V;  3HD7 C;  3I55 P;  4H0L B;  1URQ C;  3HE5 B;  1FCD C;  2C8S A;  5TIS V;  2ZYG A;  1A8C A;  3MIW A;  3L75 D;  3AE1 C;  2N9J A;  3DMI A;  3L4O A;  1L0L D;  3PRJ A;  3TNU A;  2JR8 A;  1FI3 A;  2CA3 B;  2WMM A;  2Z5H A;  3FXE A;  1M57 D;  3HD7 A;  1YTC A;  1URQ A;  3PXS A;  1LWU A;  4H13 B;  4MU8 A;  5AVQ B;  4PD4 D;  3RGU A;  1MKM A;  2KSJ A;  1RQV A;  2V7Q J;  5KLV D;  1QGK B;  1KB9 I;  5CIB B;  1G2C A;  5DJQ C;  1KYO D;  1LTG C;  3NFQ A;  1FDO A;  5BU5 A;  2E5T A;  3SLE A;  1L0N E;  4KMG A;  2ORL A;  1S9K E;  3Q5R A;  1PP9 J;  5TJH A;  3KHU A;  4L73 A;  3MK7 B;  1EDK A;  3V6I A;  1TU3 F;  3L74 E;  1YIJ P;  1P84 E;  1BGY J;  3L73 D;  2C1U A;  4RES B;  1ZP0 C;  3RBX A;  2D2C C;  1J2J B;  4DJG A;  1CI6 A;  1C2N A;  1S5L H;  4OGQ B;  3SFE C;  1YIQ A;  2FWL A;  1VPC A;  1CTY A;  2C2C A;  4AYC A;  2WTY A;  1KQS O;  4JCG A;  5E79 H;  4RKU J;  1JCD A;  1IK7 A;  3BVH A;  1SQX E;  4C46 A;  3VNW A;  2N3Y A;  4UB6 E;  1Q7Y Q;  2FYN B;  1HH7 A;  2FYU D;  3I56 P;  5C39 A;  1KX7 A;  4OWF A;  1AA0 A;  2K9Y A;  3BCC J;  2YIU B;  2PP6 A;  1IFD A;  5APU A;  1S3J A;  5APT A;  5CHX A;  2QEX P;  1SQP G;  4YXW H;  2QM7 A;  1FI7 A;  3AE2 C;  1SQV G;  2W90 A;  4AUW A;  3EFG A;  5CIE B;  1ZRT D;  2B88 A;  1X79 B;  2W6A A;  4H0L C;  3Q3D A;  4ZKU A;  3H1K G;  2FFD B;  2IZ0 A;  5AW3 B;  3LID A;  1K3H A;  1H9Y A;  1JB0 J;  3L72 J;  1GMJ A;  3M9Q A;  1SQQ J;  4N78 D;  3OCD A;  1OCD A;  3KZI V;  1OVU A;  1OX3 A;  1KQL A;  3WFE C;  1YIT P;  3HE5 A;  4H13 C;  3NXS A;  1T6A A;  1NMI A;  3TSI A;  4WQ7 A;  3NWV A;  1FDM A;  2NPS D;  3O8Z A;  1KD1 Q;  1AJY A;  1SQQ K;  2E76 B;  5CYT R;  3BRT B;  5AVX B;  3OJA B;  3MK7 C;  3L75 G;  1NVO A;  5GTI E;  1L0L G;  5DFS A;  2N1T B;  1DIP A;  5M1B A;  1SQP E;  1X0T A;  3BRV B;  3P32 A;  2BH4 X;  1YI2 P;  1SQV E;  3TGU J;  2ZYD A;  5CJ4 A;  2O01 H;  1HCM A;  4V2K A;  1KB9 H;  3HQ6 A;  4WBA A;  3A0B E;  3GHG B;  3A7O A;  1P84 I;  2AI5 A;  2HYN A;  1JY2 O;  4OGQ C;  1GK4 A;  3H1K E;  1SFC D;  2OQQ A;  5KLV G;  2BEZ F;  1EZV D;  1T2K C;  1NTZ E;  3E1I A;  5CIG B;  1YJW P;  3RK2 B;  3TYY A;  1JDL A;  3GF3 A;  1FZC B;  1OVV A;  2JQR A;  5CCH C;  2WPS A;  1M90 Q;  5AVV B;  4O1Q A;  1N73 B;  3GLM A;  2K1A A;  3NMD A;  2OYH B;  5APV A;  4BWN A;  4TT3 H;  1H32 B;  2P58 A;  2FYN C;  5B5E E;  3L73 G;  3JSV C;  4GDO A;  2IPP A;  1BE3 J;  4UB8 E;  3G3Z A;  3C1L A;  2YIU C;  3SWY A;  1VQ7 P;  1YFC A;  3CXH E;  3WFC C;  5AW4 B;  2ZXE B;  4AAN A;  2JJL A;  5CCH A;  1T3U A;  1FBM A;  5AW2 B;  2AXT E;  1L4A D;  3B8E B;  4WQB A;  5GTH H;  1NU1 J;  3CCQ P;  1JNM A;  3KXD A;  2DW3 A;  1QVG O;  1USE A;  1QYZ A;  2FFD C;  5AW9 B;  1L0L E;  1EC5 A;  3B71 A;  4XFJ A;  3RN1 A;  1J1E B;  4YXD C;  3HQ7 A;  5CCG D;  2JEE A;  2W83 C;  2FYU G;  1NTM J;  3OW2 O;  3SFD C;  1N86 A;  2L4D A;  3M0A A;  1NU1 K;  5KLV E;  4AQR D;  1BCC J;  5CIH B;  2C9L Y;  1LC2 A;  1H89 A;  2M8R A;  2Y0E A;  2PAJ A;  1JY3 O;  1KYO E;  4I2L C;  2FFD A;  1IJD B;  5CCG C;  4UB6 V;  2B89 A;  2WSF H;  3L4M A;  3CYT I;  3D0W A;  3OA8 A;  3AEF C;  1RH5 B;  2E75 B;  4HB1 A;  1NTM K;  2E76 C;  3H1I J;  1PIX A;  1GTW A;  4EIJ A;  4AAO A;  351C A;  3D71 A;  1PFI A;  3L73 E;  1YYC A;  3SWK A;  1VF5 B;  1S9K D;  1ZXG A;  2XTS B;  4WQE A;  2GM4 A;  1PP9 D;  1GU2 A;  2N1T C;  1RF0 A;  1M6Z A;  4EI2 A;  3RL0 B;  4WQ9 A;  1JMB A;  3L74 D;  1FAV A;  5C9M A;  2LIR A;  2JKV A;  3SXT A;  1BGY D;  1VDF A;  2D0S A;  1NGM B;  1CSW A;  2M0B A;  1LT9 A;  1VQK P;  1KX2 A;  4RJT A;  3B5N B;  1HF9 A;  1E2R A;  5AVU B;  3CC7 P;  1NWQ A;  4DT0 A;  3RK3 D;  3MZW B;  4JYB A;  5DF5 A;  2H88 C;  1NNO A;  1E29 A;  3RK2 C;  2N1T A;  4Y28 J;  1FZC C;  2FYU E;  2QA4 P;  1N73 C;  1E8E A;  1SQX D;  4C7N B;  1GU5 A;  3GHG A;  2QJK B;  1VQ4 P;  4IL6 E;  4WY4 D;  2HOD B;  1AQT A;  1JTH B;  1YHQ P;  1CRG A;  1EDI A;  3ABV C;  1OW6 A;  1ZRT E;  1IO3 A;  1FZC A;  3CXH W;  5KAI H;  3BCC D;  1FZG A;  1SQB J;  1I8O A;  1HGZ A;  1SP4 A;  2O1J A;  1IFN A;  1N73 A;  3NBT A;  1IRW A;  1EZV G;  2OYH A;  1S5L X;  1J3S A;  3CXH I;  1DW2 A;  3M9B A;  1H32 A;  3RN0 A;  2R5B A;  2BCC E;  3U1C A;  2KIK A;  4N78 E;  2K3R A;  2Z4E A;  1NAY A;  1J1E C;  3M91 A;  1G2C B;  2QJY B;  1CXA A;  3A0B V;  1Z56 A;  1FOC A;  2WVR A;  4WQ8 A;  1Q86 Q;  4DZO A;  1SQB K;  3L72 D;  3AE7 C;  2VHD A;  2WSE J;  2R3C A;  1IZL 0;  2WPQ A;  5AUR A;  2QM8 A;  4PD4 I;  3U1A A;  1JM0 A;  3GW6 A;  3A3Y B;  1KYO W;  2O01 J;  2XKM A;  1AFO A;  1W5C E;  2JO1 A;  1CRC A;  3Q1M A;  5B5E V;  3VP9 A;  1KYO I;  2E75 C;  2O01 N;  3AE5 C;  2ZT9 D;  4PV1 B;  1QN2 A;  1QL2 A;  4UB8 V;  1QL4 A;  5BVZ A;  2WSS H;  1QKS A;  1VF5 C;  1NTK J;  3L70 J;  3H1H J;  2BGV X;  1FZF A;  2AXT V;  4RSZ A;  3RL0 C;  2ZFC A;  3D70 A;  2OZ1 B;  2Q9I A;  4DCK A;  4JBZ A;  4WQC A;  1CNO A;  1EZV E;  3CWB J;  2D0W A;  2XZR A;  2YMY A;  3FWL A;  1Y9B A;  5B66 H;  3B5N C;  1OVR A;  3H32 B;  3TGU D;  2O3J A;  2PRR A;  2O1K A;  2RMZ A;  1YQ3 C;  1NTK K;  4U3F D;  5APQ A;  2A45 H;  5IY5 1;  1CED A;  2AEJ A;  3HD7 D;  1URQ D;  1W2L A;  2CE1 A;  4NFG B;  4YTP C;  1UII A;  4AAM A;  1PP9 G;  2QJK C;  3B5N A;  2YKP A;  5GTI H;  1AVO A;  2K37 A;  2HR3 A;  5K5G B;  4NPE A;  3L74 G;  2KP8 A;  4WQD A;  3O1Y A;  3H1L D;  1K3G A;  1BGY G;  1BE3 D;  1ZR4 A;  2G3A A;  4FAV A;  3KDP B;  4B86 A;  4GT1 A;  2W8Z A;  1Q82 Q;  1C52 A;  1LWU C;  3PXW A;  3CD6 P;  4C7N A;  3V4W A;  3Q5P A;  2HOD A;  1NU1 D;  4KHX A;  2WSF J;  1JTH A;  1KIL A;  3LW5 J;  2BEQ D;  1IFM A;  1N90 A;  2QJY C;  3ZOW A;  5KAF H;  1UIX A;  1SQX G;  2I1J A;  2B12 B;  1ZV8 A;  1BDD A;  1S4X A;  3RL0 g;  4GOD A;  1KB0 A;  2ZBO A;  4FA9 A;  3AED C;  5CID B;  4GYD A;  3BCC G;  2MHM A;  2ZAE B;  4NPF X;  2D2C D;  2B9B A;  3JC2 2;  2K9J B;  3R4Y A;  2L91 A;  1F1F A;  4GIF A;  4IL6 V;  1MUU A;  1GL2 B;  1FZE A;  4D6T D;  4PV1 C;  1PP9 E;  4EDF A;  2Y9Y A;  3FXD A;  3CU4 A;  4HH2 A;  1L0N J;  3AE4 C;  4N0K A;  1BGY E;  1OW7 A;  1CSU A;  1J1D B;  5CMZ A;  3A0H H;  4KT0 J;  2A06 D;  1LTJ B;  2LXC B;  4PD4 H;  4PJ0 H;  3RK3 E;  2E42 A;  1MG3 D;  1VQ8 P;  1DEE G;  2ZJS E;  5KKZ B;  3HQ9 A;  4OVN F;  1GD2 E;  1JY2 P;  1KYO H;  1CRI A;  5AW7 B;  3PH2 B;  1EZV I;  1WEJ F;  4K3A A;  2YXR B;  5AVS B;  4IOI H;  4DY9 A;  3AE6 C;  3CX5 H;  2OYI B;  4YPC A;  1Q90 D;  5AVZ B;  2OZ1 A;  3QWO C;  4I7Z B;  1NHL A;  4H0L D;  4DOJ A;  1RF1 B;  3G6E P;  5H2F H;  3JCU E;  1CC5 A;  4A7P A;  1OXZ A;  2E74 B;  3H32 A;  1K73 Q;  5APY A;  5TIS H;  3BCC E;  1RZ5 A;  1IFJ A;  3CCV P;  1E5W A;  4EIC A;  3V2P A;  1HJ0 A;  1VL2 A;  1AYG A;  5KLI B;  3TDK A;  1LTT C;  3PLN A;  1M56 D;  2N9Y B;  1CIG A;  2GUS A;  1FU1 A;  1H88 A;  1HJ4 A;  1COR A;  2IZ1 A;  1CSX A;  1CO6 A;  3WU2 E;  4H13 D;  5KJ7 C;  4U3F G;  3ZOX A;  3W67 A;  3PJS K;  3E1R A;  1NTZ G;  2IYO A;  1CHI A;  3USS A;  1YJ9 P;  4WWI A;  2MTA C;  3HQ8 A;  2BCC D;  3OA8 B;  3L72 E;  3SVW A;  3NBS A;  2KYV A;  1DT1 A;  2FXO A;  1QVF O;  3G9R A;  4MN4 C;  1ZN5 A;  2H7H A;  1NML A;  4TLF A;  5CJ0 A;  2B0Z B;  4GED B;  5KJ7 A;  1ZR2 A;  3H1L G;  2WPR A;  3AEG C;  5APX A;  2EXV A;  2LIT A;  3H1J D;  2XV5 A;  3WUV A;  1BE3 G;  1L4A B;  1U7M A;  1XTG B;  3MD0 A;  2JTI B;  1JY3 P;  1ZOY C;  4K3I A;  2GC4 D;  1R5S A;  1YJN P;  3C2C A;  1LT9 B;  1GL2 C;  3SSU A;  1N7S B;  3MGN A;  4OGQ D;  1SS1 A;  3LIE A;  1NU1 G;  4WB4 A;  3IR9 A;  1R0Q A;  1T2K D;  5APW A;  3VP8 A;  3CI9 A;  2WSE H;  1BL9 A;  155C A;  3UIA A;  2KS1 B;  5CCH D;  1OFC X;  1FC2 C;  1J1D C;  1FDI A;  1NTK D;  3L71 J;  1VQ9 P;  3H1H D;  1CRY A;  1U7J A;  3QH9 A;  3TGU E;  2K9J A;  2QRX A;  1KIB A;  2B10 B;  1YBK A;  2QE7 H;  5EXQ A;  1GL2 A;  1LT1 A;  1SQP J;  2QVA A;  4U3F E;  3W68 A;  1OWA A;  3RBZ A;  1R5L A;  2JWA A;  4W7Y A;  3V5B A;  1GDT A;  3WFD C;  1JY3 N;  2OYI C;  3H1K J;  4JPZ B;  4D6T G;  3K5B A;  4I7Z C;  1LTJ A;  1Y8A A;  1CTJ A;  1RF1 C;  3WC8 A;  3GMA A;  1MZ9 A;  1SQP K;  3H1L E;  1EXI A;  2E74 C;  4EIF A;  2NPS A;  1BE3 E;  3I5C A;  2PCB B;  1NJI Q;  3C9I A;  1JMM A;  5KLI C;  4U7J A;  1M70 A;  3ZCF A;  2KB7 P;  2B11 B;  2R5D A;  2OYI A;  3VOP A;  2P10 A;  4EIE A;  5AW8 B;  1NU1 E;  1PGJ A;  1C6O A;  1BSN A;  1MFT A;  3KZI H;  1CHJ A;  2ZON G;  4Z1M H;  1RF1 A;  4W80 A;  2DGE A;  4WQA A;  1H33 B;  3M0D A;  3O6Q B;  4Y5R A;  2WWW A;  3IFM A;  2YXQ B;  3L75 J;  1AOF A;  5DJT B;  1NTM E;  2E76 D;  1NAF A;  1QLE D;  1RE4 A;  1HRC A;  3HTK B;  5CBO A;  4PW9 B;  1KFM A;  4L1Q A;  2M3B A;  1RF0 C;  3A2A A;  2N1T D;  3CL3 D;  1PL5 A;  3NTN A;  1YCC A;  1DIQ C;  4D6T E;  3LW5 H;  1C6S A;  5KLV J;  2Q1K A;  1KQF B;  3EWK A;  1PGP A;  3VMZ A;  1LT9 C;  3FGA D;  1N7S C;  1M1J B;  5E79 E;  2C1D B;  4HJG H;  1JOC A;  1GU4 A;  2C9N Y;  4ZNC A;  2BCC G;  1CYC A;  2A06 E;  3RK2 D;  1X8Y A;  3C8V A;  2OTJ P;  1CYJ A;  1HUC A;  1L4A A;  3SWF A;  1DH3 A;  3WU2 V;  3L73 J;  3GHG C;  1CSV A;  2ZXX A;  1LS9 A;  3PH0 A;  1N7S A;  3ZDM A;  3H1J G;  2JP3 A;  2ZYA A;  1IFI A;  2HPC B;  3E7K A;  5CBN A;  4H44 B;  3HUS B;  2KS1 A;  1DD4 A;  1OZH A;  4JYC A;  5AW6 B;  2Q7C A;  1VQP P;  3CC4 P;  3V4Q A;  4XA4 A;  2BCN B;  4ASV A;  2OYH C;  2CA4 B;  1IK9 A;  3G71 P;  1NO4 A;  3WUI A;  3BAT A;  1L9B C;  1LC1 A;  2KNC B;  1KIL B;  2M3E A;  4GKG A;  2FYU J;  1U74 B;  5AW5 B;  3B4S A;  1P84 H;  1YNR A;  3PXT A;  1NTK G;  1PGQ A;  4H0K A;  1ZME C;  3CCJ P;  2IBZ D;  1KMI Z;  3H1H G;  1I6D A;  1W5C T;  1LGH B;  1GDV A;  2RN0 A;  2YQB A;  1E79 H;  5DJU B;  1CCH A;  2IX7 C;  1KFN A;  3KQG A;  1CRJ A;  1RHZ B;  1HJ3 A;  4ZKP A;  1DW1 A;  1FOS E;  1RY3 A;  4I1L A;  3M97 X;  4QMA A;  4KJM A;  4LJI A;  3ZIY A;  1I8P A;  1H8A A;  1FZA A;  2FRC A;  2ZVO B;  4UB6 H;  4FAN A;  2N3B A;  3IN6 A;  2E75 D;  1VQO P;  3RMZ A;  1SQQ D;  2WIT A;  3H1J E;  4FB1 A;  2ITA A;  5AVR B;  4XXL A;  4W7Z A;  4N3Y B;  1VF5 D;  1KZU B;  3CCE P;  1QL1 A;  3RL0 D;  1H33 A;  1KB9 E;  3O6Q A;  3CCS P;  2YO3 A;  1SLQ A;  2WZ7 A;  2W27 A;  2B87 B;  1PZQ A;  1YEB A;  2KZJ A;  3B5N D;  3CC2 P;  3WFB C;  1WRG A;  4LLH A;  1N9C A;  3HTK A;  1M1K Q;  3TF5 A;  1NTK E;  2QJP B;  3O20 A;  4L75 A;  1W2B O;  3H1H E;  1PPJ D;  3AEB C;  4RO0 A;  2AEM A;  1GKS A;  2QSI A;  2KI7 B;  1CTZ A;  3EFF K;  4ASW A;  2IFN A;  2OGU A;  3HE4 B;  2H43 A;  2J58 A;  4IL6 X;  3L71 D;  5C0Z A;  1M1J A;  2GA1 A;  2C1D A;  1WMK A;  1DX7 A;  1QL3 A;  2D2C B;  3DP5 A;  2HLO A;  1N50 A;  1COT A;  4H44 C;  1MV8 A;  2R44 A;  1N15 A;  1GK6 A;  5GTH E;  3HUS C;  5APS A;  3U59 A;  2OTK E;  4BRY B;  1EXJ A;  2K88 A;  2POH A;  1VQ5 P;  1KIL C;  1CCR A;  3AEA C;  1AV1 A;  2UWJ E;  3L37 A;  1S5L V;  2HPC A;  4FA1 A;  2Q3I A;  4L76 A;  2VRS A;  3D6Z A;  1USD A;  2WSC H;  4WVZ A;  1EB7 A;  1RQU A;  3AE3 C;  1LJ2 A;  3HUS A;  1NKZ B;  4C7R A;  5E79 V;  3A0B H; 
#chains in the Genus database with same CATH homology
 3ZOY A;  1I5T A;  4AAN A;  3PLN A;  2N9Y B;  1CIG A;  1CRH A;  451C A;  1HJ4 A;  4WQB A;  2C1V A;  1COR A;  2I8F A;  2AIU A;  1CSX A;  3TYI A;  1CO6 A;  2HV4 A;  3ORV A;  2BPB B;  2GB8 B;  3ZOX A;  1S6V B;  4XYD B;  1CHI A;  1QYZ A;  1DVV A;  1CXC A;  3VRD A;  5GTI V;  2MTA C;  3HQ8 A;  2BCC D;  3JBT B;  3OA8 B;  1F1C A;  3RN1 A;  3SVW A;  3NBS A;  3HQ7 A;  1HRO A;  1DT1 A;  2ZXY A;  1CYI A;  3ZOO A;  1NML A;  1NTM D;  3ITK A;  1GJQ A;  2L4D A;  1CIF A;  2B0Z B;  4GED B;  1BCC D;  5CIH B;  2EXV A;  2LIT A;  3H1J D;  1LC2 A;  2Y0E A;  2QG4 A;  3VMA A;  2JTI B;  4QAO A;  1HZV A;  4J20 A;  4K3I A;  2GC4 D;  4UB6 V;  5KAF V;  3C2C A;  3L4M A;  3CYT I;  3OA8 A;  1B7V A;  5DJQ B;  1DVH A;  4PWA A;  1MG2 D;  1I54 A;  1RZ6 A;  1R0Q A;  4AAL A;  1YEA A;  3H1I D;  3CX5 W;  351C A;  4AAO A;  3PTZ A;  1BL9 A;  155C A;  2XTS B;  4WQE A;  3CX5 D;  1HZU A;  1PP9 D;  1GU2 A;  3A9F A;  1M6Z A;  1NTK D;  4WQ9 A;  1A2S A;  1OAE A;  3L74 D;  3H1H D;  1CRY A;  5C9M A;  2LIR A;  1KIB A;  1C75 A;  2B10 B;  1WVE C;  5EXQ A;  3DR0 A;  3SXT A;  1BGY D;  4AX3 A;  2D0S A;  2Y0D A;  1SQP D;  1CSW A;  1KX2 A;  2N18 C;  4RJT A;  1E2R A;  2JWA A;  1SQV D;  2ZOO A;  5DF5 A;  3WFD C;  4O1W A;  1A56 A;  1NNO A;  1E29 A;  1IQC A;  3A0H V;  3H1K D;  2GC7 D;  1FHB A;  1NTZ D;  4PJ0 V;  2CXB A;  1CTJ A;  1LFM A;  1E8E A;  3WC8 A;  1SQX D;  1DW3 A;  2QJK B;  2N9I A;  4EIF A;  1GIW A;  1C7M A;  1LMS A;  1VYD A;  2PCB B;  3O0R C;  1CRG A;  3ZBM A;  4L3G A;  1M70 A;  1YIC A;  3ZCF A;  2B11 B;  3PHL A;  1IO3 A;  5CIF B;  3CXH W;  3BCC D;  4EIE A;  1SQB D;  3OCD B;  1I8O A;  4YE1 A;  2BH5 X;  1C6O A;  2V07 A;  3NBT A;  1IRW A;  1CHJ A;  2ZON G;  1FI9 A;  1J3S A;  3CXH D;  1I6E A;  1C6R A;  1DW2 A;  5H2F V;  1H32 A;  3RN0 A;  2DGE A;  2PAC A;  4WQA A;  1FCD C;  1H33 B;  2C8S A;  2DVH A;  5TIS V;  4FA4 A;  4Y5R A;  1A8C A;  3O5C A;  1RAP A;  2QJY B;  1CXA A;  1AOF A;  3L75 D;  3A0B V;  4FA5 A;  2N9J A;  1ZZH A;  1FOC A;  3DMI A;  3L4O A;  1L0L D;  4WQ8 A;  1HRC A;  3PRJ A;  1H31 B;  4PW9 B;  1FI3 A;  3L72 D;  2CA3 B;  2VHD A;  5GTH V;  4L1Q A;  1IZL 0;  5AUR A;  1YTC A;  3PXS A;  4MU8 A;  4PD4 D;  2CE0 A;  1YCC A;  3GW6 A;  1DIQ C;  1C6S A;  5KLV D;  1KYO W;  2YK3 A;  1KB9 D;  1CRC A;  3SJL A;  5CIB B;  5B5E V;  2GIW A;  5DJQ C;  1KYO D;  1U75 B;  1QN2 A;  3SLE A;  2C1D B;  4UB8 V;  4KMG A;  2ORL A;  1QL4 A;  1I55 A;  2ZZS 1;  5TJH A;  1QKS A;  1CYC A;  3KHU A;  3MK7 B;  1CIE A;  1CYJ A;  3L70 D;  2BGV X;  2AXT V;  4RSZ A;  3RLM A;  3WU2 V;  2OZ1 B;  3L73 D;  1CIH A;  2C1U A;  1CSV A;  4WQC A;  1LS9 A;  1CNO A;  1HJ5 A;  2D0W A;  3CWB D;  1C2N A;  3FWL A;  3TGU D;  1YIQ A;  1H1O A;  2FWL A;  2O3J A;  2YCC A;  1CTY A;  1NIR A;  2RMZ A;  2C2C A;  4JCG A;  4U3F D;  2BLF B;  2KS1 A;  1DW0 A;  2BCN B;  2CA4 B;  1FJ0 A;  5IY5 1;  1CED A;  3WUI A;  3VNW A;  3X39 A;  1L9B C;  1LC1 A;  1W2L A;  2CE1 A;  2N3Y A;  2KNC B;  4NFG B;  4H0J A;  1H9X A;  4AAM A;  2FYN B;  1HH7 A;  1U74 B;  2FYU D;  4EID A;  1YNR A;  1KX7 A;  3PXT A;  3VYM A;  4H0K A;  2IBZ D;  2PCC B;  4WQD A;  1I6D A;  3O1Y A;  1W5C T;  2YIU B;  3H1L D;  1K3G A;  1GDV A;  2RN0 A;  2YQB A;  1BE3 D;  1CCH A;  4FAV A;  1FI7 A;  1CRJ A;  2V08 A;  1C52 A;  1HJ3 A;  5CIE B;  1MZ4 A;  3PXW A;  1RAQ A;  1ZRT D;  1DW1 A;  3M97 X;  1NU1 D;  4LJI A;  3ZIY A;  1I8P A;  2Q3E A;  1KV9 A;  2FRC A;  1K3H A;  1H9Y A;  1N90 A;  4FAN A;  2N3B A;  3ZOW A;  3GG2 A;  3RMZ A;  2B4Z A;  5KAI V;  1SQQ D;  4P4Q B;  4FB1 A;  2B12 B;  3OCD A;  4XXL A;  1OCD A;  3KZI V;  3WFE C;  1ETP A;  1KB0 A;  2ZBO A;  1AKK A;  1H33 A;  4FA9 A;  5CID B;  2Y0C A;  4GYD A;  1NMI A;  1GQ1 A;  4WQ7 A;  2MHM A;  3NWV A;  2K9J B;  2L91 A;  1F1F A;  4IL6 V;  4Q5P A;  1YEB A;  3WFB C;  1H31 A;  4D6T D;  1N9C A;  4EDF A;  5CYT R;  3CU4 A;  3TF5 A;  2QJP B;  3O20 A;  1PPJ D;  3MK7 C;  1AOQ A;  3CP5 A;  1GKS A;  2C9X B;  5CIC B;  1L0N D;  4N0K A;  5DFS A;  1CSU A;  1L9J C;  1CTZ A;  1C2R A;  1IRV A;  2A06 D;  2BH4 X;  4L3H A;  1MG3 D;  3L71 D;  5C0Z A;  1HCM A;  4V2K A;  5B6Q A;  5KKZ B;  3HQ6 A;  3HQ9 A;  1P84 D;  2AI5 A;  2C1D A;  2N18 B;  1QL3 A;  3DP5 A;  1CRI A;  3PH2 B;  1EZV D;  1N50 A;  1COT A;  1WEJ F;  1N15 A;  5CIG B;  4DY9 A;  1JDL A;  1DII C;  2JQR A;  2OZ1 A;  4O1Q A;  3SWS A;  1CCR A;  1H32 B;  1M60 A;  1CC5 A;  5B66 V;  4A7P A;  1S5L V;  4FA1 A;  1RZ5 A;  4EIC A;  1EB7 A;  1CHH A;  1YFC A;  1AYG A;  5KLI B;  5E79 V;  3TDK A;  3WFC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...