3L72D

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 73
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l72D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l72D02
1KYOW 1L9JC 1HZVA 1H31B 1WVEC 1C75A 1NNOA 2MTAC 1DIQC 1NIRA 2PCCB 5KLIB 2ZZS1 1NTMD 1IRWA 1CRJA 1CRYA 2QG4A 2N9JA 2CXBA 3WUIA 4AAMA 2N18B 1F1CA 4K3IA 3FWLA 5B6QA 1N90A 4XYDB 1W2LA 4FA1A 1YICA 2N3BA 5DJQB 1KIBA 1S6VB 1CIFA 2Y0CA 1U74B 3WFDC 1KX7A 2C2CA 5CICB 2K9JB 3OA8A 1FHBA 1CCHA 5CIDB 1CIHA 2N9YB 2JTIB 3PTZA 2N18C 1KB9D 3X39A 1HCMA 1SQQD 1CRGA 1W5CT 3PRJA 5DJQC 5GTIV 3TF5A 1FOCA 3NWVA 4GEDB 2GIWA 1CHJA 2QJKB 3CYTI 3HQ7A 1QKSA 4FA4A 2A06D 3H1KD 1H9YA 1DIIC 1I6DA 4WQBA 4FA5A 3A0HV 2V07A 3ZOXA 3SVWA 1DT1A 4L3GA 1LMSA 4XXLA 2ZBOA 3CP5A 5C0ZA 2KNCB 1CEDA 4UB6V 1NMLA 5CIFB 3CX5W 4WQ7A 2C8SA 4MU8A 5KKZB 1CTJA 3TGUD 1N9CA 1DW0A 1ETPA 4WQCA 3ZOWA 2Y0DA 5DF5A 2IBZD 3O5CA 4DY9A 4WQEA 1A8CA 3OA8B 1IZL0 1HRCA 1K3HA 2CE1A 2B0ZB 2C9XB 3ZIYA 5CIHB 3HQ6A 1YTCA 3ZOYA 3A9FA 4PJ0V 4PD4D 1CSWA 1GIWA 1YIQA 2C1VA 2YIUB 2MHMA 3H1LD 3RLMA 3SWSA 2B11B 2I8FA 4H0KA 1DVVA 1CRCA 5AURA 1I8OA 4FAVA 3PXSA 2YCCA 2B12B 451CA 2FYNB 1PP9D 1CO6A 1AOFA 2VHDA 3NBSA 1CYIA 1MZ4A 1M70A 3L72D 1DW3A 5TISV 2N3YA 1ZRTD 3CWBD 1FI9A 2Y0EA 2DVHA 2BH5X 1HJ3A 1CTZA 3O1YA 1C6RA 4WQ8A 1RAPA 1CSVA 3H1ID 4FA9A 4KMGA 3KHUA 1OAEA 3ZOOA 1RZ5A 351CA 4AAOA 3DR0A 2Q3EA 2FRCA 4FB1A 1FJ0A 2FWLA 1MG3D 1H1OA 3WFCC 2N9IA 1EB7A 4RJTA 1H32A 3H1HD 3L70D 1C6SA 5E79V 1YNRA 2BPBB 1QN2A 2YK3A 1CYJA 1RZ6A 1CC5A 1IQCA 2D0SA 4WQ9A 4U3FD 2BH4X 1DW1A 1HJ4A 3PXWA 1I8PA 1E29A 1FI7A 1H9XA 2JQRA 3L75D 2B10B 1WEJF 3MK7B 2AXTV 3L71D 3SXTA 4EIEA 1YEAA 3GG2A 2O3JA 1CNOA 3TYIA 2KS1A 3VYMA 1GJQA 1KB0A 4A7PA 3HQ9A 1VYDA 2XTSB 1CTYA 1I54A 1C2RA 4AANA 1CHIA 1LFMA 2L91A 1CCRA 3C2CA 2ORLA 2OZ1A 1NTKD 2YQBA 1HJ5A 1EZVD 3CU4A 3A0BV 1KYOD 1A56A 3MK7C 1CRHA 1FCDC 1NU1D 1A2SA 4EDFA 3TDKA 2L4DA 4EICA 1QL4A 1OCDA 3OCDA 1LC1A 1SQXD 5IY51 3VRDA 3SLEA 1H32B 1GDVA 4H0JA 5CIBB 5KAFV 5C9MA 2LIRA 2GC7D 4PW9B 2RN0A 1CRIA 2JWAA 1CIGA 1KX2A 3HQ8A 1M60A 1HZUA 3WC8A 1C7MA 1YFCA 2GC4D 4EIDA 5CYTR 2CA4B 2ZONG 1C2NA 1NTZD 2BCNB 2HV4A 1JDLA 1KV9A 4EIFA 1LS9A 5EXQA 3CXHW 3L4MA 5GTHV 2EXVA 4J20A 1CIEA 2ZXYA 1DW2A 2OZ1B 4L3HA 3WFBC 4AALA 2C1DA 3GW6A 5TJHA 2QJYB 1I5TA 1BE3D 1M6ZA 2DGEA 1LC2A 1GKSA 2V08A 2C1UA 2QJPB 1GQ1A 3OCDB 1COTA 3RMZA 2B4ZA 5B66V 1U75B 1YEBA 1BCCD 3H1JD 3VMAA 1HH7A 4Q5PA 1YCCA 3PHLA 2CA3B 1E2RA 1IRVA 4PWAA 3ITKA 2ZOOA 3SJLA 1C6OA 1ZZHA 3CX5D 4IL6V 4O1QA 1E8EA 1BL9A 1N15A 4P4QB 1MG2D 3RN1A 3L4OA 1I55A 4V2KA 1R0QA 1S5LV 5KLVD 2CE0A 5H2FV 5B5EV 4FANA 1L0ND 155CA 3ORVA 3ZCFA 4UB8V 3DP5A 1CHHA 3O20A 3KZIV 1CSUA 1C52A 1H33A 1RAQA 5CIGB 2BLFB 5KAIV 1SQVD 2BCCD 1CSXA 1AKKA 2AIUA 1I6EA 3L74D 2C1DB 4O1WA 1IO3A 2GB8B 2FYUD 3O0RC 1H31A 2LITA 1SQBD 3M97X 5DFSA 4N0KA 2AI5A 4AX3A 4L1QA 1K3GA 3JBTB 3PH2B 1AOQA 3CXHD 1F1FA 4LJIA 4WQDA 1N50A 3DMIA 4NFGB 5CIEB 1QYZA 4D6TD 1CYCA 1L0LD 3BCCD 1CXAA 3ZBMA 1HROA 1BGYD 1GU2A 3NBTA 3WFEC 2PCBB 3RN0A 3PXTA 1B7VA 4WQAA 1AYGA 1CXCA 1PPJD 1P84D 4RSZA 3PLNA 1QL3A 3L73D 1NMIA 1L9BC 3VNWA 4GYDA 2RMZA 2BGVX 4QAOA 1CORA 1H33B 1DVHA 2D0WA 2PACA 4Y5RA 1FI3A 4YE1A 3WU2V 1J3SA 4JCGA 1SQPD
chains in the Genus database with same CATH superfamily
3OJAB 1BCCE 5CJ0A 1WVEC 4HKZH 2HG5D 2MTAC 2ZT9D 3CC2P 1RE4A 4YXDC 2PCCB 3SFDC 3BCCJ 1K9MQ 1OVVA 1HH0A 3CPWO 3AE9C 1URQA 3G71P 2QG4A 2N9JA 4C7NA 4OGQB 1FJKA 3C8VA 1VPCA 1GK6A 3FXDA 2R3CA 3HD7D 4B86A 2E76B 2N3BA 3W67A 1KIBA 1VQ9P 3NTNA 5C39A 3CCRP 5KLIC 2RKLA 4C46A 2AEJA 2YO2A 5CIDB 1CIHA 2A45H 2FYUE 1HWTC 4XE5B 1VQKP 1U7MA 1HCMA 1SQQD 2ZVOB 1EC5A 1NTMK 5DJQC 2QIWA 1JUNA 5H2FE 3W68A 1YIJP 1CHJA 3CXHE 3CYTI 1EZVG 4FA4A 1S3JA 4YPCA 3LIEA 4D6TE 3AEAC 1PGOA 2WSEJ 1H9YA 1OIPA 2XU6A 1NU1G 2OARA 2BEQD 1BGYE 2KZIA 4FA5A 2VRSA 2V07A 3ZOXA 3SVWA 4L3GA 1LMSA 1JM0A 2ZBOA 1H88A 5C0ZA 1FU1A 3WUVA 1JEKA 5AVRB 5CIFB 4WQ7A 2C8SA 2GUSA 2E42A 3HD7C 3MZWB 4XA4A 2IYOA 3TGUD 1J1EC 1D7MA 5KJ7D 3B5NB 3VMYA 3VN0A 3RK3D 1QVGO 4WQCA 2OTJP 1SQQJ 3CX5I 3HUSB 1IFDA 1DD4A 2IBZD 4PV1D 3O5CA 4K3AA 3MHVA 3IR9A 1IZL0 3AE7C 4H13B 1SS1A 1YTCA 1VF5D 3F89A 2JKVA 4PD4D 1YIQA 2IPPA 1DIPA 3AE8C 3RLMA 4H0KA 5BU8B 3S9OA 1HF9A 1KFNA 1MKMA 1KQLA 4FAVA 3E1RA 5APTA 1CYIA 3WMM0 1NYHA 3A0BH 1VQLP 1R8EA 1EZVI 2DW3A 1ZV8A 2N3YA 1PFIA 1YITP 2DVHA 3TGUJ 1IFMA 1N73B 3I5CA 1BCCG 3Q1MA 1HJ3A 1C6RA 2W90A 2FXMA 2KI7B 3Q2YA 1CSVA 2M5AA 3FXEA 4KMGA 3HTKB 1JCCA 2QE7H 1FDIA 2FYNC 1U57A 5KJ7C 3RK3C 3KPEA 4AQRD 3CCVP 1GW3A 4FB1A 1QVFO 1H1OA 3L75E 4PV1C 2QEXP 1H32A 3K5BA 2Q1KA 1C6SA 1SFCB 3L71E 1YNRA 1QLED 2KLVA 2J59M 2YK3A 1N7SA 1VF5C 5AVYB 1SP4A 3PXWA 3RL0D 2B10B 3VMXA 5TISH 2QJPC 2FKWB 2V7QH 1GU4A 2FYUG 3TK1A 4EIEA 3GF3A 4WBAA 1IK9A 3TYIA 5AW5B 5KJ7A 4O9BA 3HQ9A 2XZRA 4YTPC 3PJSK 4BRYA 2WZ7A 2XV5A 4H0LD 1SVFA 3M0DA 2UWJE 2V4HA 1AQTA 1R5SA 4D6TG 1HJ5A 1EZVD 3CU4A 1J2JB 1QEXA 1UIIA 1BGYG 1NU1D 1OVRA 1M1JC 1IFJA 1ZLLA 2LR2A 4LC1A 3Q3DA 1E5WA 1FZCC 1QX8A 3M06A 1H0TB 1LC1A 3NXSA 3VRDA 1DD3A 1VQPP 2ITAA 2N1TB 2WVRA 2ZFCA 1ZOYC 4H0JA 1ZP0C 3A0BE 5CCHA 2P58A 2E75B 2JWAA 4I1LA 2B87B 3RL0C 3IN6A 3WC8A 1LTBC 2FFDB 5AW6B 5BVZA 1SQPG 4IOIH 3L74J 1JY3P 1T3JA 1NVOA 1NTKK 1SLQA 1N7LA 5CYTR 2CA4B 2WPVB 2WSCJ 1YJNP 4NPFX 2HV4A 3I56P 2YKQA 3V5BA 5AW0B 3OW2O 1NU1J 1NWQA 2ZXYA 3MUDC 2PP6A 1HUCA 4L3HA 3WFBC 5AVWB 4N78D 3GW6A 4K35A 1M56D 5TJHA 3CXHI 2QJYB 3CL3D 3H1HE 3USSA 3V2QA 2V08A 5TISE 4U3FE 2MKVA 2O01H 4CPGA 2A45G 1FZGA 3EFFK 2IYPA 1BCCD 4I7ZB 3VMAA 1BSNA 1L0NE 1UIXA 2QRXA 4PWAA 2E74D 2YNYA 1MUUA 1E8EA 3RK2B 1MG2D 4V2KA 2BCCE 1EDLA 3KYQA 4M3LA 1S5LV 5KLVD 5B5EV 1L4AD 5GTHH 1JMBA 2WSFJ 1CSBA 3ORVA 3ZCFA 4IL6X 1RF1B 3O20A 5KAIV 2KYVA 3E7KA 1FZAA 2W6BA 3H32A 2QSIA 3U59A 1BDDA 3U1CA 2FY8A 1IO3A 3HE4A 2FYUD 1MV8A 2LITA 5APQA 1BCCJ 1KTMA 3HE5B 1IFNA 2K9YA 1NHLA 1L0LE 3H25A 5CCGA 1YJWP 4AX3A 4H13D 3M0AA 3CXHD 1VQNP 4WQDA 1N50A 1QYZA 4D6TD 4KHXA 2QA4P 1L0NK 2E74C 5APVA 1CYCA 2A45I 1IFIA 1BGYD 1NTZE 3CCMP 4UB8H 1H89A 4EOTA 3O6QB 1Q81Q 1JTHB 2CK3H 1L4AC 1PZQA 3MD0A 1HTLC 1IK7A 1A02J 2B88A 3PLNA 1OMIA 1QL3A 3VNWA 2RMZA 2OYHB 1CORA 2FYUJ 1H33B 2K37A 1SQBK 4H44C 2D0WA 3BRTB 1BE3E 1S9KE 3B71A 3O8ZA 5DJTB 3G4SP 1SQPD 1A02F 1GL2B 3H1JE 2R5DA 4D6TJ 1N2DC 4AUWA 1L0LK 1CRJA 1BGYJ 2IFNA 5GTHE 1AVOA 5KTBA 3QH9A 2Q5UA 2CXBA 3E1IA 1WRGA 3H1HG 2N18B 1JY2P 2H8PD 3ABVC 1K73Q 5B6QA 2JO1A 1ZXGA 4U3FG 1S6VB 2M3BA 3B5NA 2GM4A 3L4FA 3WFDC 1SQVE 3CI9A 1KX7A 2C2CA 4HJGH 3HUSA 1XTCC 5CICB 1KQFB 4IFDK 3VYIA 1URQD 2Y9ZA 2WTYA 1SQPJ 1OFCX 2JTIB 2KOGA 4IL6E 1GU5A 3NFQA 3X39A 2KZJA 1CRGA 1W5CT 3NWVA 3WUTA 4UB8E 3M9BA 1DIIC 1PGPA 1MFTA 1RHZB 4HH2A 2E75D 2P67A 1N73A 1AV1A 3CP5A 1PPJE 2KNCB 2LXBA 4DJGA 4UB6V 1NMLA 3CX5W 3HTKA 3WUUA 1S72P 1GDTA 1YBKA 1KYOH 2QM8A 2Y0DA 3H1LE 1JOCA 5DF5A 1URQC 4DY9A 3SFEC 5GTIH 3OA8B 1SFCA 1PV3A 3CCSP 5CIHB 2C9XB 1NTZG 3L71J 1FZBA 3ZOYA 5AVQB 1KQGB 1CSWA 1YTZT 2NRGA 5KKZC 2YIUB 4WB4A 2B11B 2I8FA 4N6JA 1GD2E 5AURA 1NKZB 2YCCA 2B12B 2LKMA 1W2BO 1FS0E 3H1IE 1Y9BA 5AW2B 1CO6A 1BE3G 3NBSA 4GDOA 1EDJA 1MZ9A 1FI9A 2E75C 3TSIA 3H1JG 1VL2A 5APXA 1R5LA 1FAVA 1VQ7P 4FA9A 3KQGA 1LT1A 2WT7B 1OAEA 3CLQA 2HPCB 1GZLA 1FE6A 4AAOA 5BU5A 1OVUA 3DR0A 2Q3EA 1H0TA 4PJ0H 3MGNA 3VMZA 1KILB 4ASWA 2OYIB 2N1TA 1EB7A 4RJTA 3H1HD 3R2PA 3FX0A 2BPBB 3KDPB 3SSUA 1CYJA 1RZ6A 1PGJA 1CC5A 1IQCA 3A7OA 2D0SA 3GMAA 1SQVG 4U3FD 4OH8B 1E29A 5AVZB 4WY4B 2B87A 1HVVA 1S1CX 4Y99B 3L74G 2FFDA 1FOSE 1HJBA 2AXTV 3MTUE 1LTTC 1YEAA 3GG2A 2ZAEB 2ZT9C 2HR3A 4LGDE 2XTSB 1C2RA 1Q82Q 1LNQA 1CHIA 1LFMA 1N7SD 1JB0J 3GHGB 1GK4A 2M8RA 2Z5HA 5GTIE 3A3YB 3C2CA 2ORLA 1IC2A 5M1BA 2KLUA 4R4LA 3AEBC 1VQ4P 3MK7C 1A56A 1CRHA 1FCDC 3H1HJ 5E79H 5AW3B 3TDKA 3NMDA 1VQMP 4U3FJ 1Y47A 1IZNB 2V7QJ 1PPJG 3P7KA 2ZYAA 1GDVA 1S4XA 2G8YA 1L0NJ 2LIRA 2PAJA 2RN0A 1GL2D 1AA0A 2I1JA 2YMYA 1OW8A 4W7YA 4GODA 3L72E 1W5CE 5KAIH 1M60A 2BCCJ 3P32A 1J1DB 1H8AA 2NPSB 3CC4P 1Y8AA 1RF1A 2OQQA 1C2NA 1NTZD 3CCUP 5CCHD 1NTMG 4PJ0E 1N7SC 1JDLA 1KV9A 3PP5A 1LS9A 5EXQA 3CXHW 5AW9B 2EXVA 4TT3H 3EWKA 2H88C 1SQXK 2WMMA 3BASA 3HE5A 4RO0A 1BE3D 2KSEA 3G3ZA 1L0LJ 1S9KD 5KAFH 2KXPB 1GQ1A 3OCDB 2B4ZA 4XFJA 3C9IA 1FJPA 2AEFA 3H1JD 2L5GB 4L76A 3M0DC 2CA3B 1IRVA 1BDCA 2ZOOA 2P1JA 3CX5D 4O1QA 1GL2C 1NAFA 2W27A 2D2CB 3GLMA 1NTZJ 2XKMA 3B4SA 1RE3A 3O6QA 4RESB 1JTHA 2CE0A 5H2FV 1NTKE 1YJ9P 5E79E 3G9RA 1YHQP 3DP5A 1G1IA 1LT9B 3VOPA 2OYHA 1H33A 1RAQA 5CIGB 5CCHC 2AEMA 3AE3C 1SQVD 4IFFA 2O01J 1CZQA 4EI2A 1AKKA 1BE3J 2CPBA 3L74D 3G6EP 3AECC 1LTJB 2C1DB 1K05A 2XNDH 3O0RC 1GL2A 1RY3A 2B89A 3H1JJ 2JEEA 4NPDA 5KAIE 3EFGA 5AVUB 4MN4C 2AI5A 4DOJA 4L1QA 3JBTB 3PH2B 2O01N 1USDA 1NAYA 4GOEA 1KV4A 4NFGB 3L35A 3VP9A 3L73E 1HROA 4JYCA 2Z4EA 3NBTA 2P2UA 5APYA 1GTWA 1YI2P 3KZIH 3AEDC 4WQAA 4QMAA 5CCGD 1SQVJ 2KSJA 1M8OB 1CXCA 1PPJD 4NPEA 4Z1MH 5DJUB 5KAFE 2BGVX 4OGQD 4QAOA 1DVHA 2YXRB 2W6AA 1YQ3C 3L72G 1T3UA 2PACA 4ZMDA 4GIFA 2E76D 4H0LC 2WPSA 1FZFA 4PD4H 1LWUB 1HZVA 4JF7A 1H31B 1C75A 1NNOA 3P8CD 2R32A 3II6A 1QL2A 1NIRA 1KZUB 5KLIB 2ZZS1 1NTMD 1IRWA 4UB6H 2SPZA 1CRYA 3WUIA 4AAMA 2KNCA 3IAOA 1Q90D 3FWLA 3M9QA 1N90A 4XYDB 1W2LA 1YICA 5DJQB 2BASA 1U74B 1N86A 3L75G 5CCGC 2BEZF 1EXIA 1AFOA 3GF7A 4N3YB 3H1LJ 3L71G 3WU2H 3OA8A 1FHBA 5AW1B 2IFMA 4OGQC 3PTZA 1SQBE 1M7LA 3VP8A 5APWA 2E76C 2WWWA 1NTMJ 3TF5A 3V2NA 3B5ND 1FOCA 3R4YA 4GEDB 1KB9H 1NTKG 2C0WA 1TU3F 3HQ7A 3HD7B 1CI6B 1J1EB 3KZIE 2YXQB 1I6DA 4WQBA 1RQVA 2K3RA 3A0HV 3RK3E 1FDOA 3KXDA 1CEDA 2IBZE 3FGAD 1NJIQ 4Y28J 2NPSD 4MU8A 1CTJA 1DX7A 2WT7A 2HPCA 3UIAA 3ZOWA 4PD4E 3FWNA 5APUA 1SQQK 4RKUJ 1KILA 2OYIA 4L73A 4WQEA 1A8CA 4UB6E 1HRCA 2CE1A 2B0ZB 3ZIYA 5EFWB 3T97B 3A9FA 1KFMA 1GIWA 2HFED 4WY4A 2MHMA 2J58A 1DVVA 2NZ2A 3B5NC 1CRCA 1YTZI 1ZR2A 1M90Q 451CA 3HUSC 1Z56A 2FYNB 2FXPA 3RK3B 1AOFA 1SFCD 2IDBA 1DEEG 1M70A 4H13C 3L72D 1DW3A 5TISV 5AW4B 3GHGA 2Y0EA 4PV1B 3S1KA 2K1AA 2Z5IA 1W2EA 3WU2E 4EYYQ 2C0XA 4WQ8A 1VF5B 1J1DC 3JC22 2YO3A 1KB9E 351CA 2HYNA 2H7HA 3AE2C 1FJ0A 2FWLA 1MG3D 2IX7C 1WT6A 1L0NG 2N9IA 3AEEC 2OTKE 1KN7A 1N73C 5CBNA 2A06E 3H1KE 4WQ9A 3LIDA 2BCCG 1HJ4A 5L8RJ 2XDJA 5CMZA 2JQRA 3L75D 4GOFA 3L72J 3BRVB 1X9VA 1WEJF 1NKNA 3V6IA 3L71D 3SXTA 2NPSA 1SQBG 2JP3A 2O3JA 2N1TD 1M1JB 1CNOA 1JCDA 1FZCB 1KB0A 4LLHA 1SFCC 1NGMB 1I54A 4AANA 3Q5PA 2L91A 2G3AA 1CCRA 2E5YA 1BSHA 4IFMA 1G1JA 1FC2C 1NTKD 2YQBA 1L0LG 4JBZA 3CC7P 4ZKPA 1GW4A 3RL0B 4EDFA 2L4DA 4EICA 3B8EB 3OCDA 3L75J 1YYCA 1NOHA 5CIBB 3CCEP 1FBMA 2GC7D 1KILE 1AJYA 1CRIA 1PP9E 4WWIA 5AVVB 2WITA 1KX2A 3CMEP 4ASVA 2XNXA 1HZUA 1ZRTE 3CWBE 3AE6C 3ZDMA 2AXCA 2P7JA 1NTKJ 4EIJA 4EIDA 2N1TC 1KD1Q 1LT9A 2ZONG 2KS1B 4L75A 2BCNB 3MP7B 4OVNF 1LGHB 3S4RA 3OAKA 4EIFA 1NU1K 3L4MA 3RK2D 5GTHV 2W83C 1S2EA 2N9BA 1ZN5A 4U7JA 1DW2A 2OZ1B 1DEBA 1LTJA 2C1DA 3L37A 2FFDC 4W7ZA 1RF0A 3D71A 3L70E 3RBZA 1M6ZA 2DGEA 1X79B 4TLFA 2JWDA 1LTIC 2C1UA 1COTA 5B66V 2OYOA 1U75B 5KLVE 2ZXEB 1AVYA 5APSA 3PHLA 3SJLA 1ZZHA 1LWUC 4IL6V 3L73J 2IBZI 2KP8A 3L4OA 2QJYC 3LW5H 1I55A 1VQOP 4FANA 1L0ND 4PD4I 2IZ0A 155CA 4DCKA 2A06G 4UB8V 3H1KG 2YMKA 1CHHA 2Q7CA 4I7ZC 1JY3N 1KYOE 2FXOA 3P8MC 5AW8B 2BLFB 2BCCD 1S5LX 3SWKA 4HB1A 1LJ2A 1CSXA 3RK2C 1HGZA 1IO4A 3TNUB 1G2CB 5CHXA 1WMKA 2E74B 4ZNCA 1SQXE 1N8RQ 2GB8B 1LWUA 1H31A 1AQ5A 1SQBD 2Q3IA 4BWNA 2WSSH 3A2AA 1RF1C 3F5HA 1K3GA 3JSVC 1L4AB 1NH4A 2M0BA 2K88A 4LJIA 3DMIA 3V2RA 2ZYGA 2IZ1A 5KLVK 2ZVNB 1S5LH 1OW7A 5B5EH 4H44B 1L0LD 1PIXA 1CXAA 1K04A 1PL5A 1GU2A 3WFEC 1IFPA 2PCBB 3PXTA 3H1LG 1B7VA 2KIKA 1AYGA 2M3EA 1X22A 1KB9I 1JO5A 4W80A 1FDMA 4L74A 2R5BA 1SQPE 1HGVA 1NMIA 4GYDA 1KQSO 1PP9G 1L2PA 2FYUK 3QWOC 1HBWA 1P84H 1SQBJ 1PGQA 1T6AA 3AE5C 3CD6P 3CWBG 1FI3A 4ZKUA 4YE1A 3HRNA 1HJ0A 4JCGA 4R4MA 1ZW0A 1RE3C 3A0HH 1KYOW 1L9JC 3V4WA 3HD7A 3H1IG 1CI6A 1DIQC 3D70A 2PGDA 2Y9YA 2OYHC 1OX3A 2E43A 2YKPA 1NO4A 3L70G 1F1CA 4K3IA 4AYCA 3CCJP 3H6PA 4FA1A 2HLOA 2WSEH 1CIFA 1LP1B 2Y0CA 4YXWH 3RL0g 5KLVG 2HODB 1Q7YQ 2K9JB 1T2KD 1EQ7A 1SQPK 1CCHA 4JPZB 2I8DA 2N9YB 2N18C 1VDFA 3T97A 1KB9D 3MIWA 3PRJA 5GTIV 1RQUA 1S5LE 3BATA 5B5EE 2GIWA 2KB7P 2QJKB 1QKSA 3AEFC 2QVAA 2A06D 3H1KD 2C9NY 1VQ6P 1EDIA 3BCCE 2LXCB 3D0WA 1URQB 1SQXG 1DT1A 1VQ8P 2Q9IA 4XXLA 2GUVA 4C7NB 3I55P 1P84E 2RH0A 3C1LA 1JY2N 2OTLP 5KKZB 2WPQA 1N9CA 1DW0A 1ETPA 2I1KA 2P10A 3N4XA 2ZYDA 3A0HE 2H89C 1JY3O 1QL1A 1T2KC 1LTGC 1K3HA 3HQ6A 2Q6QA 3L36A 1OW6A 3H1KJ 4PJ0V 2C1VA 3H1LD 3SWSA 2J5UA 1XTGB 1I8OA 3PXSA 1JNMA 1KILD 1M1JA 3CCQP 3D6ZA 4C7RA 1PP9D 2VHDA 1FZCA 1MZ4A 1Q2NA 1ZRTD 1KYOI 3CWBD 1T8ZA 1EDKA 4WY4D 2YIUC 2BH5X 2FBWC 4WVZA 1CTZA 3O1YA 1LTAC 1RAPA 3H1ID 3KHUA 3ZOOA 1RZ5A 2MJZA 1SQQE 2FRCA 3WFCC 2FYZA 2ZT9B 3L70D 5E79V 1QN2A 1Q86Q 2ZJSE 3AE4C 2BH4X 1DW1A 3VTPC 3MUDA 1PP9J 1I8PA 1FI7A 1H9XA 5CJ4A 3CX5H 3CWBJ 3MK7B 4GKGA 3AE1C 2C9LY 1KILC 2OYIC 3RGUA 2KS1A 3VYMA 1GJQA 4A7PA 4DT0A 1VYDA 3H1IJ 1CTYA 3JCUH 2PFXA 4H44D 5AVSB 2JDIH 2W6JH 2O1JA 3TGUE 2OZ1A 4WY4C 4I2LC 4Y99C 2M5AB 3A0BV 1KYOD 5B66H 3BCCG 1K8AQ 3L70J 1A2SA 2CPSA 2JR8A 2WSCH 1QL4A 4IL6H 2B9BA 2R44A 1OCDA 1SQXD 5IY51 3GHGC 4I6MC 3SLEA 1H32B 5KLVJ 3L73G 1QGKB 1EXJA 5KAFV 1N7SB 5C9MA 2AXTH 2R3SA 2GA1A 4PW9B 1MFZA 1M57D 2W8ZA 4BXLA 1CIGA 3HQ8A 1OZHA 2KK7A 1VQ5P 1KMIZ 5AVXB 1C7MA 1YFCA 2GC4D 3D6YA 1U7JA 1FZEA 4BRYB 4J20A 1CIEA 2D2CD 3TNUA 1G2CA 4DZOA 4GT1A 4AALA 1FOSF 1JY2O 4HYTB 3SWYA 2QM7A 1SQXJ 2WSFH 2NPSC 1ZMEC 1I5TA 1LC2A 1GKSA 3CX5E 1JMMA 3IF4A 2QJPB 1L4AA 3RMZA 5AW7B 3RBXA 1USEA 1YEBA 1HH7A 4Q5PA 1YCCA 1KORA 3EQ2A 2OGUA 3JCUE 1E2RA 1IJDB 3ITKA 3M9HA 1C6OA 3IFMA 1BL9A 1N15A 4P4QB 1P84I 3A5TA 3RN1A 1SQQG 1NTZK 3M91A 2YKOA 3TYYA 1R0QA 3PH0A 3Q5SA 3V4QA 2JJLA 5B66E 3OA7A 1X0TA 3L74E 4KJMA 1CW5A 2WPRA 1OWAA 1EZVE 3KZIV 1OXZA 1CSUA 1GMJA 2H43A 1C52A 1NU1E 4KT0J 2AIUA 2POHA 4JQ0D 1I6EA 1ZR4A 2D2CC 2ZXXA 2AXTE 4O1WA 1DH3A 1KC8Q 3M97X 5DFSA 3LW5J 4N0KA 2WQYC 4OWFA 1LT9C 3TGUG 3V2PA 1AOQA 1F1FA 5AVTB 5CIEB 2IBZG 2E5TA 5H2FH 1LTJC 2PRRA 2QJKC 3CXHH 3BCCD 3ZBMA 1RF0C 2KUBA 3CCLP 4H0LB 3BVHA 3RN0A 1RE4C 1LP1A 3Q5RA 4JYBA 1E79H 1SQVK 3AEGC 3SWFA 2HODA 1P84D 4RSZA 4N78E 3L73D 1L9BC 2K9JA 3U1AA 3N7NA 1YQ4C 2O1KA 3P8CE 5CBOA 1M1KQ 1X8YA 1NTME 3H32B 5K5GB 4Y5RA 3CMAP 1RH5B 3WU2V 1J3SA 1LTSC 3HE4B
chains in the Genus database with same CATH topology
1KYOW 1L9JC 1HZVA 1H31B 1WVEC 1C75A 1NNOA 2MTAC 1DIQC 1NIRA 2PCCB 5KLIB 2ZZS1 1NTMD 1IRWA 1CRJA 1CRYA 2QG4A 2N9JA 2CXBA 3WUIA 4AAMA 2N18B 1F1CA 4K3IA 3FWLA 5B6QA 1N90A 4XYDB 1W2LA 4FA1A 1YICA 2N3BA 5DJQB 1KIBA 1S6VB 1CIFA 2Y0CA 1U74B 3WFDC 1KX7A 2C2CA 5CICB 2K9JB 3OA8A 1FHBA 1CCHA 5CIDB 1CIHA 2N9YB 2JTIB 3PTZA 2N18C 1KB9D 3X39A 1HCMA 1SQQD 1CRGA 1W5CT 3PRJA 5DJQC 5GTIV 3TF5A 1FOCA 3NWVA 4GEDB 2GIWA 1CHJA 2QJKB 3CYTI 3HQ7A 1QKSA 4FA4A 2A06D 3H1KD 1H9YA 1DIIC 1I6DA 4WQBA 4FA5A 3A0HV 2V07A 3ZOXA 3SVWA 1DT1A 4L3GA 1LMSA 4XXLA 2ZBOA 3CP5A 5C0ZA 2KNCB 1CEDA 4UB6V 1NMLA 5CIFB 3CX5W 4WQ7A 2C8SA 4MU8A 5KKZB 1CTJA 3TGUD 1N9CA 1DW0A 1ETPA 4WQCA 3ZOWA 2Y0DA 5DF5A 2IBZD 3O5CA 4DY9A 4WQEA 1A8CA 3OA8B 1IZL0 1HRCA 1K3HA 2CE1A 2B0ZB 2C9XB 3ZIYA 5CIHB 3HQ6A 1YTCA 3ZOYA 3A9FA 4PJ0V 4PD4D 1CSWA 1GIWA 1YIQA 2C1VA 2YIUB 2MHMA 3H1LD 3RLMA 3SWSA 2B11B 2I8FA 4H0KA 1DVVA 1CRCA 5AURA 1I8OA 4FAVA 3PXSA 2YCCA 2B12B 451CA 2FYNB 1PP9D 1CO6A 1AOFA 2VHDA 3NBSA 1CYIA 1MZ4A 1M70A 3L72D 1DW3A 5TISV 2N3YA 1ZRTD 3CWBD 1FI9A 2Y0EA 2DVHA 2BH5X 1HJ3A 1CTZA 3O1YA 1C6RA 4WQ8A 1RAPA 1CSVA 3H1ID 4FA9A 4KMGA 3KHUA 1OAEA 3ZOOA 1RZ5A 351CA 4AAOA 3DR0A 2Q3EA 2FRCA 4FB1A 1FJ0A 2FWLA 1MG3D 1H1OA 3WFCC 2N9IA 1EB7A 4RJTA 1H32A 3H1HD 3L70D 1C6SA 5E79V 1YNRA 2BPBB 1QN2A 2YK3A 1CYJA 1RZ6A 1CC5A 1IQCA 2D0SA 4WQ9A 4U3FD 2BH4X 1DW1A 1HJ4A 3PXWA 1I8PA 1E29A 1FI7A 1H9XA 2JQRA 3L75D 2B10B 1WEJF 3MK7B 2AXTV 3L71D 3SXTA 4EIEA 1YEAA 3GG2A 2O3JA 1CNOA 3TYIA 2KS1A 3VYMA 1GJQA 1KB0A 4A7PA 3HQ9A 1VYDA 2XTSB 1CTYA 1I54A 1C2RA 4AANA 1CHIA 1LFMA 2L91A 1CCRA 3C2CA 2ORLA 2OZ1A 1NTKD 2YQBA 1HJ5A 1EZVD 3CU4A 3A0BV 1KYOD 1A56A 3MK7C 1CRHA 1FCDC 1NU1D 1A2SA 4EDFA 3TDKA 2L4DA 4EICA 1QL4A 1OCDA 3OCDA 1LC1A 1SQXD 5IY51 3VRDA 3SLEA 1H32B 1GDVA 4H0JA 5CIBB 5KAFV 5C9MA 2LIRA 2GC7D 4PW9B 2RN0A 1CRIA 2JWAA 1CIGA 1KX2A 3HQ8A 1M60A 1HZUA 3WC8A 1C7MA 1YFCA 2GC4D 4EIDA 5CYTR 2CA4B 2ZONG 1C2NA 1NTZD 2BCNB 2HV4A 1JDLA 1KV9A 4EIFA 1LS9A 5EXQA 3CXHW 3L4MA 5GTHV 2EXVA 4J20A 1CIEA 2ZXYA 1DW2A 2OZ1B 4L3HA 3WFBC 4AALA 2C1DA 3GW6A 5TJHA 2QJYB 1I5TA 1BE3D 1M6ZA 2DGEA 1LC2A 1GKSA 2V08A 2C1UA 2QJPB 1GQ1A 3OCDB 1COTA 3RMZA 2B4ZA 5B66V 1U75B 1YEBA 1BCCD 3H1JD 3VMAA 1HH7A 4Q5PA 1YCCA 3PHLA 2CA3B 1E2RA 1IRVA 4PWAA 3ITKA 2ZOOA 3SJLA 1C6OA 1ZZHA 3CX5D 4IL6V 4O1QA 1E8EA 1BL9A 1N15A 4P4QB 1MG2D 3RN1A 3L4OA 1I55A 4V2KA 1R0QA 1S5LV 5KLVD 2CE0A 5H2FV 5B5EV 4FANA 1L0ND 155CA 3ORVA 3ZCFA 4UB8V 3DP5A 1CHHA 3O20A 3KZIV 1CSUA 1C52A 1H33A 1RAQA 5CIGB 2BLFB 5KAIV 1SQVD 2BCCD 1CSXA 1AKKA 2AIUA 1I6EA 3L74D 2C1DB 4O1WA 1IO3A 2GB8B 2FYUD 3O0RC 1H31A 2LITA 1SQBD 3M97X 5DFSA 4N0KA 2AI5A 4AX3A 4L1QA 1K3GA 3JBTB 3PH2B 1AOQA 3CXHD 1F1FA 4LJIA 4WQDA 1N50A 3DMIA 4NFGB 5CIEB 1QYZA 4D6TD 1CYCA 1L0LD 3BCCD 1CXAA 3ZBMA 1HROA 1BGYD 1GU2A 3NBTA 3WFEC 2PCBB 3RN0A 3PXTA 1B7VA 4WQAA 1AYGA 1CXCA 1PPJD 1P84D 4RSZA 3PLNA 1QL3A 3L73D 1NMIA 1L9BC 3VNWA 4GYDA 2RMZA 2BGVX 4QAOA 1CORA 1H33B 1DVHA 2D0WA 2PACA 4Y5RA 1FI3A 4YE1A 3WU2V 1J3SA 4JCGA 1SQPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO W;  1L9J C;  1HZV A;  1H31 B;  1WVE C;  1C75 A;  1NNO A;  2MTA C;  1DIQ C;  1NIR A;  2PCC B;  5KLI B;  2ZZS 1;  1NTM D;  1IRW A;  1CRJ A;  1CRY A;  2QG4 A;  2N9J A;  2CXB A;  3WUI A;  4AAM A;  2N18 B;  1F1C A;  4K3I A;  3FWL A;  5B6Q A;  1N90 A;  4XYD B;  1W2L A;  4FA1 A;  1YIC A;  2N3B A;  5DJQ B;  1KIB A;  1S6V B;  1CIF A;  2Y0C A;  1U74 B;  3WFD C;  1KX7 A;  2C2C A;  5CIC B;  2K9J B;  3OA8 A;  1FHB A;  1CCH A;  5CID B;  1CIH A;  2N9Y B;  2JTI B;  3PTZ A;  2N18 C;  1KB9 D;  3X39 A;  1HCM A;  1SQQ D;  1CRG A;  1W5C T;  3PRJ A;  5DJQ C;  5GTI V;  3TF5 A;  1FOC A;  3NWV A;  4GED B;  2GIW A;  1CHJ A;  2QJK B;  3CYT I;  3HQ7 A;  1QKS A;  4FA4 A;  2A06 D;  3H1K D;  1H9Y A;  1DII C;  1I6D A;  4WQB A;  4FA5 A;  3A0H V;  2V07 A;  3ZOX A;  3SVW A;  1DT1 A;  4L3G A;  1LMS A;  4XXL A;  2ZBO A;  3CP5 A;  5C0Z A;  2KNC B;  1CED A;  4UB6 V;  1NML A;  5CIF B;  3CX5 W;  4WQ7 A;  2C8S A;  4MU8 A;  5KKZ B;  1CTJ A;  3TGU D;  1N9C A;  1DW0 A;  1ETP A;  4WQC A;  3ZOW A;  2Y0D A;  5DF5 A;  2IBZ D;  3O5C A;  4DY9 A;  4WQE A;  1A8C A;  3OA8 B;  1IZL 0;  1HRC A;  1K3H A;  2CE1 A;  2B0Z B;  2C9X B;  3ZIY A;  5CIH B;  3HQ6 A;  1YTC A;  3ZOY A;  3A9F A;  4PJ0 V;  4PD4 D;  1CSW A;  1GIW A;  1YIQ A;  2C1V A;  2YIU B;  2MHM A;  3H1L D;  3RLM A;  3SWS A;  2B11 B;  2I8F A;  4H0K A;  1DVV A;  1CRC A;  5AUR A;  1I8O A;  4FAV A;  3PXS A;  2YCC A;  2B12 B;  451C A;  2FYN B;  1PP9 D;  1CO6 A;  1AOF A;  2VHD A;  3NBS A;  1CYI A;  1MZ4 A;  1M70 A;  3L72 D;  1DW3 A;  5TIS V;  2N3Y A;  1ZRT D;  3CWB D;  1FI9 A;  2Y0E A;  2DVH A;  2BH5 X;  1HJ3 A;  1CTZ A;  3O1Y A;  1C6R A;  4WQ8 A;  1RAP A;  1CSV A;  3H1I D;  4FA9 A;  4KMG A;  3KHU A;  1OAE A;  3ZOO A;  1RZ5 A;  351C A;  4AAO A;  3DR0 A;  2Q3E A;  2FRC A;  4FB1 A;  1FJ0 A;  2FWL A;  1MG3 D;  1H1O A;  3WFC C;  2N9I A;  1EB7 A;  4RJT A;  1H32 A;  3H1H D;  3L70 D;  1C6S A;  5E79 V;  1YNR A;  2BPB B;  1QN2 A;  2YK3 A;  1CYJ A;  1RZ6 A;  1CC5 A;  1IQC A;  2D0S A;  4WQ9 A;  4U3F D;  2BH4 X;  1DW1 A;  1HJ4 A;  3PXW A;  1I8P A;  1E29 A;  1FI7 A;  1H9X A;  2JQR A;  3L75 D;  2B10 B;  1WEJ F;  3MK7 B;  2AXT V;  3L71 D;  3SXT A;  4EIE A;  1YEA A;  3GG2 A;  2O3J A;  1CNO A;  3TYI A;  2KS1 A;  3VYM A;  1GJQ A;  1KB0 A;  4A7P A;  3HQ9 A;  1VYD A;  2XTS B;  1CTY A;  1I54 A;  1C2R A;  4AAN A;  1CHI A;  1LFM A;  2L91 A;  1CCR A;  3C2C A;  2ORL A;  2OZ1 A;  1NTK D;  2YQB A;  1HJ5 A;  1EZV D;  3CU4 A;  3A0B V;  1KYO D;  1A56 A;  3MK7 C;  1CRH A;  1FCD C;  1NU1 D;  1A2S A;  4EDF A;  3TDK A;  2L4D A;  4EIC A;  1QL4 A;  1OCD A;  3OCD A;  1LC1 A;  1SQX D;  5IY5 1;  3VRD A;  3SLE A;  1H32 B;  1GDV A;  4H0J A;  5CIB B;  5KAF V;  5C9M A;  2LIR A;  2GC7 D;  4PW9 B;  2RN0 A;  1CRI A;  2JWA A;  1CIG A;  1KX2 A;  3HQ8 A;  1M60 A;  1HZU A;  3WC8 A;  1C7M A;  1YFC A;  2GC4 D;  4EID A;  5CYT R;  2CA4 B;  2ZON G;  1C2N A;  1NTZ D;  2BCN B;  2HV4 A;  1JDL A;  1KV9 A;  4EIF A;  1LS9 A;  5EXQ A;  3CXH W;  3L4M A;  5GTH V;  2EXV A;  4J20 A;  1CIE A;  2ZXY A;  1DW2 A;  2OZ1 B;  4L3H A;  3WFB C;  4AAL A;  2C1D A;  3GW6 A;  5TJH A;  2QJY B;  1I5T A;  1BE3 D;  1M6Z A;  2DGE A;  1LC2 A;  1GKS A;  2V08 A;  2C1U A;  2QJP B;  1GQ1 A;  3OCD B;  1COT A;  3RMZ A;  2B4Z A;  5B66 V;  1U75 B;  1YEB A;  1BCC D;  3H1J D;  3VMA A;  1HH7 A;  4Q5P A;  1YCC A;  3PHL A;  2CA3 B;  1E2R A;  1IRV A;  4PWA A;  3ITK A;  2ZOO A;  3SJL A;  1C6O A;  1ZZH A;  3CX5 D;  4IL6 V;  4O1Q A;  1E8E A;  1BL9 A;  1N15 A;  4P4Q B;  1MG2 D;  3RN1 A;  3L4O A;  1I55 A;  4V2K A;  1R0Q A;  1S5L V;  5KLV D;  2CE0 A;  5H2F V;  5B5E V;  4FAN A;  1L0N D;  155C A;  3ORV A;  3ZCF A;  4UB8 V;  3DP5 A;  1CHH A;  3O20 A;  3KZI V;  1CSU A;  1C52 A;  1H33 A;  1RAQ A;  5CIG B;  2BLF B;  5KAI V;  1SQV D;  2BCC D;  1CSX A;  1AKK A;  2AIU A;  1I6E A;  3L74 D;  2C1D B;  4O1W A;  1IO3 A;  2GB8 B;  2FYU D;  3O0R C;  1H31 A;  2LIT A;  1SQB D;  3M97 X;  5DFS A;  4N0K A;  2AI5 A;  4AX3 A;  4L1Q A;  1K3G A;  3JBT B;  3PH2 B;  1AOQ A;  3CXH D;  1F1F A;  4LJI A;  4WQD A;  1N50 A;  3DMI A;  4NFG B;  5CIE B;  1QYZ A;  4D6T D;  1CYC A;  1L0L D;  3BCC D;  1CXA A;  3ZBM A;  1HRO A;  1BGY D;  1GU2 A;  3NBT A;  3WFE C;  2PCB B;  3RN0 A;  3PXT A;  1B7V A;  4WQA A;  1AYG A;  1CXC A;  1PPJ D;  1P84 D;  4RSZ A;  3PLN A;  1QL3 A;  3L73 D;  1NMI A;  1L9B C;  3VNW A;  4GYD A;  2RMZ A;  2BGV X;  4QAO A;  1COR A;  1H33 B;  1DVH A;  2D0W A;  2PAC A;  4Y5R A;  1FI3 A;  4YE1 A;  3WU2 V;  1J3S A;  4JCG A;  1SQP D; 
#chains in the Genus database with same CATH topology
 3OJA B;  1BCC E;  5CJ0 A;  1WVE C;  4HKZ H;  2HG5 D;  2MTA C;  2ZT9 D;  3CC2 P;  1RE4 A;  4YXD C;  2PCC B;  3SFD C;  3BCC J;  1K9M Q;  1OVV A;  1HH0 A;  3CPW O;  3AE9 C;  1URQ A;  3G71 P;  2QG4 A;  2N9J A;  4C7N A;  4OGQ B;  1FJK A;  3C8V A;  1VPC A;  1GK6 A;  3FXD A;  2R3C A;  3HD7 D;  4B86 A;  2E76 B;  2N3B A;  3W67 A;  1KIB A;  1VQ9 P;  3NTN A;  5C39 A;  3CCR P;  5KLI C;  2RKL A;  4C46 A;  2AEJ A;  2YO2 A;  5CID B;  1CIH A;  2A45 H;  2FYU E;  1HWT C;  4XE5 B;  1VQK P;  1U7M A;  1HCM A;  1SQQ D;  2ZVO B;  1EC5 A;  1NTM K;  5DJQ C;  2QIW A;  1JUN A;  5H2F E;  3W68 A;  1YIJ P;  1CHJ A;  3CXH E;  3CYT I;  1EZV G;  4FA4 A;  1S3J A;  4YPC A;  3LIE A;  4D6T E;  3AEA C;  1PGO A;  2WSE J;  1H9Y A;  1OIP A;  2XU6 A;  1NU1 G;  2OAR A;  2BEQ D;  1BGY E;  2KZI A;  4FA5 A;  2VRS A;  2V07 A;  3ZOX A;  3SVW A;  4L3G A;  1LMS A;  1JM0 A;  2ZBO A;  1H88 A;  5C0Z A;  1FU1 A;  3WUV A;  1JEK A;  5AVR B;  5CIF B;  4WQ7 A;  2C8S A;  2GUS A;  2E42 A;  3HD7 C;  3MZW B;  4XA4 A;  2IYO A;  3TGU D;  1J1E C;  1D7M A;  5KJ7 D;  3B5N B;  3VMY A;  3VN0 A;  3RK3 D;  1QVG O;  4WQC A;  2OTJ P;  1SQQ J;  3CX5 I;  3HUS B;  1IFD A;  1DD4 A;  2IBZ D;  4PV1 D;  3O5C A;  4K3A A;  3MHV A;  3IR9 A;  1IZL 0;  3AE7 C;  4H13 B;  1SS1 A;  1YTC A;  1VF5 D;  3F89 A;  2JKV A;  4PD4 D;  1YIQ A;  2IPP A;  1DIP A;  3AE8 C;  3RLM A;  4H0K A;  5BU8 B;  3S9O A;  1HF9 A;  1KFN A;  1MKM A;  1KQL A;  4FAV A;  3E1R A;  5APT A;  1CYI A;  3WMM 0;  1NYH A;  3A0B H;  1VQL P;  1R8E A;  1EZV I;  2DW3 A;  1ZV8 A;  2N3Y A;  1PFI A;  1YIT P;  2DVH A;  3TGU J;  1IFM A;  1N73 B;  3I5C A;  1BCC G;  3Q1M A;  1HJ3 A;  1C6R A;  2W90 A;  2FXM A;  2KI7 B;  3Q2Y A;  1CSV A;  2M5A A;  3FXE A;  4KMG A;  3HTK B;  1JCC A;  2QE7 H;  1FDI A;  2FYN C;  1U57 A;  5KJ7 C;  3RK3 C;  3KPE A;  4AQR D;  3CCV P;  1GW3 A;  4FB1 A;  1QVF O;  1H1O A;  3L75 E;  4PV1 C;  2QEX P;  1H32 A;  3K5B A;  2Q1K A;  1C6S A;  1SFC B;  3L71 E;  1YNR A;  1QLE D;  2KLV A;  2J59 M;  2YK3 A;  1N7S A;  1VF5 C;  5AVY B;  1SP4 A;  3PXW A;  3RL0 D;  2B10 B;  3VMX A;  5TIS H;  2QJP C;  2FKW B;  2V7Q H;  1GU4 A;  2FYU G;  3TK1 A;  4EIE A;  3GF3 A;  4WBA A;  1IK9 A;  3TYI A;  5AW5 B;  5KJ7 A;  4O9B A;  3HQ9 A;  2XZR A;  4YTP C;  3PJS K;  4BRY A;  2WZ7 A;  2XV5 A;  4H0L D;  1SVF A;  3M0D A;  2UWJ E;  2V4H A;  1AQT A;  1R5S A;  4D6T G;  1HJ5 A;  1EZV D;  3CU4 A;  1J2J B;  1QEX A;  1UII A;  1BGY G;  1NU1 D;  1OVR A;  1M1J C;  1IFJ A;  1ZLL A;  2LR2 A;  4LC1 A;  3Q3D A;  1E5W A;  1FZC C;  1QX8 A;  3M06 A;  1H0T B;  1LC1 A;  3NXS A;  3VRD A;  1DD3 A;  1VQP P;  2ITA A;  2N1T B;  2WVR A;  2ZFC A;  1ZOY C;  4H0J A;  1ZP0 C;  3A0B E;  5CCH A;  2P58 A;  2E75 B;  2JWA A;  4I1L A;  2B87 B;  3RL0 C;  3IN6 A;  3WC8 A;  1LTB C;  2FFD B;  5AW6 B;  5BVZ A;  1SQP G;  4IOI H;  3L74 J;  1JY3 P;  1T3J A;  1NVO A;  1NTK K;  1SLQ A;  1N7L A;  5CYT R;  2CA4 B;  2WPV B;  2WSC J;  1YJN P;  4NPF X;  2HV4 A;  3I56 P;  2YKQ A;  3V5B A;  5AW0 B;  3OW2 O;  1NU1 J;  1NWQ A;  2ZXY A;  3MUD C;  2PP6 A;  1HUC A;  4L3H A;  3WFB C;  5AVW B;  4N78 D;  3GW6 A;  4K35 A;  1M56 D;  5TJH A;  3CXH I;  2QJY B;  3CL3 D;  3H1H E;  3USS A;  3V2Q A;  2V08 A;  5TIS E;  4U3F E;  2MKV A;  2O01 H;  4CPG A;  2A45 G;  1FZG A;  3EFF K;  2IYP A;  1BCC D;  4I7Z B;  3VMA A;  1BSN A;  1L0N E;  1UIX A;  2QRX A;  4PWA A;  2E74 D;  2YNY A;  1MUU A;  1E8E A;  3RK2 B;  1MG2 D;  4V2K A;  2BCC E;  1EDL A;  3KYQ A;  4M3L A;  1S5L V;  5KLV D;  5B5E V;  1L4A D;  5GTH H;  1JMB A;  2WSF J;  1CSB A;  3ORV A;  3ZCF A;  4IL6 X;  1RF1 B;  3O20 A;  5KAI V;  2KYV A;  3E7K A;  1FZA A;  2W6B A;  3H32 A;  2QSI A;  3U59 A;  1BDD A;  3U1C A;  2FY8 A;  1IO3 A;  3HE4 A;  2FYU D;  1MV8 A;  2LIT A;  5APQ A;  1BCC J;  1KTM A;  3HE5 B;  1IFN A;  2K9Y A;  1NHL A;  1L0L E;  3H25 A;  5CCG A;  1YJW P;  4AX3 A;  4H13 D;  3M0A A;  3CXH D;  1VQN P;  4WQD A;  1N50 A;  1QYZ A;  4D6T D;  4KHX A;  2QA4 P;  1L0N K;  2E74 C;  5APV A;  1CYC A;  2A45 I;  1IFI A;  1BGY D;  1NTZ E;  3CCM P;  4UB8 H;  1H89 A;  4EOT A;  3O6Q B;  1Q81 Q;  1JTH B;  2CK3 H;  1L4A C;  1PZQ A;  3MD0 A;  1HTL C;  1IK7 A;  1A02 J;  2B88 A;  3PLN A;  1OMI A;  1QL3 A;  3VNW A;  2RMZ A;  2OYH B;  1COR A;  2FYU J;  1H33 B;  2K37 A;  1SQB K;  4H44 C;  2D0W A;  3BRT B;  1BE3 E;  1S9K E;  3B71 A;  3O8Z A;  5DJT B;  3G4S P;  1SQP D;  1A02 F;  1GL2 B;  3H1J E;  2R5D A;  4D6T J;  1N2D C;  4AUW A;  1L0L K;  1CRJ A;  1BGY J;  2IFN A;  5GTH E;  1AVO A;  5KTB A;  3QH9 A;  2Q5U A;  2CXB A;  3E1I A;  1WRG A;  3H1H G;  2N18 B;  1JY2 P;  2H8P D;  3ABV C;  1K73 Q;  5B6Q A;  2JO1 A;  1ZXG A;  4U3F G;  1S6V B;  2M3B A;  3B5N A;  2GM4 A;  3L4F A;  3WFD C;  1SQV E;  3CI9 A;  1KX7 A;  2C2C A;  4HJG H;  3HUS A;  1XTC C;  5CIC B;  1KQF B;  4IFD K;  3VYI A;  1URQ D;  2Y9Z A;  2WTY A;  1SQP J;  1OFC X;  2JTI B;  2KOG A;  4IL6 E;  1GU5 A;  3NFQ A;  3X39 A;  2KZJ A;  1CRG A;  1W5C T;  3NWV A;  3WUT A;  4UB8 E;  3M9B A;  1DII C;  1PGP A;  1MFT A;  1RHZ B;  4HH2 A;  2E75 D;  2P67 A;  1N73 A;  1AV1 A;  3CP5 A;  1PPJ E;  2KNC B;  2LXB A;  4DJG A;  4UB6 V;  1NML A;  3CX5 W;  3HTK A;  3WUU A;  1S72 P;  1GDT A;  1YBK A;  1KYO H;  2QM8 A;  2Y0D A;  3H1L E;  1JOC A;  5DF5 A;  1URQ C;  4DY9 A;  3SFE C;  5GTI H;  3OA8 B;  1SFC A;  1PV3 A;  3CCS P;  5CIH B;  2C9X B;  1NTZ G;  3L71 J;  1FZB A;  3ZOY A;  5AVQ B;  1KQG B;  1CSW A;  1YTZ T;  2NRG A;  5KKZ C;  2YIU B;  4WB4 A;  2B11 B;  2I8F A;  4N6J A;  1GD2 E;  5AUR A;  1NKZ B;  2YCC A;  2B12 B;  2LKM A;  1W2B O;  1FS0 E;  3H1I E;  1Y9B A;  5AW2 B;  1CO6 A;  1BE3 G;  3NBS A;  4GDO A;  1EDJ A;  1MZ9 A;  1FI9 A;  2E75 C;  3TSI A;  3H1J G;  1VL2 A;  5APX A;  1R5L A;  1FAV A;  1VQ7 P;  4FA9 A;  3KQG A;  1LT1 A;  2WT7 B;  1OAE A;  3CLQ A;  2HPC B;  1GZL A;  1FE6 A;  4AAO A;  5BU5 A;  1OVU A;  3DR0 A;  2Q3E A;  1H0T A;  4PJ0 H;  3MGN A;  3VMZ A;  1KIL B;  4ASW A;  2OYI B;  2N1T A;  1EB7 A;  4RJT A;  3H1H D;  3R2P A;  3FX0 A;  2BPB B;  3KDP B;  3SSU A;  1CYJ A;  1RZ6 A;  1PGJ A;  1CC5 A;  1IQC A;  3A7O A;  2D0S A;  3GMA A;  1SQV G;  4U3F D;  4OH8 B;  1E29 A;  5AVZ B;  4WY4 B;  2B87 A;  1HVV A;  1S1C X;  4Y99 B;  3L74 G;  2FFD A;  1FOS E;  1HJB A;  2AXT V;  3MTU E;  1LTT C;  1YEA A;  3GG2 A;  2ZAE B;  2ZT9 C;  2HR3 A;  4LGD E;  2XTS B;  1C2R A;  1Q82 Q;  1LNQ A;  1CHI A;  1LFM A;  1N7S D;  1JB0 J;  3GHG B;  1GK4 A;  2M8R A;  2Z5H A;  5GTI E;  3A3Y B;  3C2C A;  2ORL A;  1IC2 A;  5M1B A;  2KLU A;  4R4L A;  3AEB C;  1VQ4 P;  3MK7 C;  1A56 A;  1CRH A;  1FCD C;  3H1H J;  5E79 H;  5AW3 B;  3TDK A;  3NMD A;  1VQM P;  4U3F J;  1Y47 A;  1IZN B;  2V7Q J;  1PPJ G;  3P7K A;  2ZYA A;  1GDV A;  1S4X A;  2G8Y A;  1L0N J;  2LIR A;  2PAJ A;  2RN0 A;  1GL2 D;  1AA0 A;  2I1J A;  2YMY A;  1OW8 A;  4W7Y A;  4GOD A;  3L72 E;  1W5C E;  5KAI H;  1M60 A;  2BCC J;  3P32 A;  1J1D B;  1H8A A;  2NPS B;  3CC4 P;  1Y8A A;  1RF1 A;  2OQQ A;  1C2N A;  1NTZ D;  3CCU P;  5CCH D;  1NTM G;  4PJ0 E;  1N7S C;  1JDL A;  1KV9 A;  3PP5 A;  1LS9 A;  5EXQ A;  3CXH W;  5AW9 B;  2EXV A;  4TT3 H;  3EWK A;  2H88 C;  1SQX K;  2WMM A;  3BAS A;  3HE5 A;  4RO0 A;  1BE3 D;  2KSE A;  3G3Z A;  1L0L J;  1S9K D;  5KAF H;  2KXP B;  1GQ1 A;  3OCD B;  2B4Z A;  4XFJ A;  3C9I A;  1FJP A;  2AEF A;  3H1J D;  2L5G B;  4L76 A;  3M0D C;  2CA3 B;  1IRV A;  1BDC A;  2ZOO A;  2P1J A;  3CX5 D;  4O1Q A;  1GL2 C;  1NAF A;  2W27 A;  2D2C B;  3GLM A;  1NTZ J;  2XKM A;  3B4S A;  1RE3 A;  3O6Q A;  4RES B;  1JTH A;  2CE0 A;  5H2F V;  1NTK E;  1YJ9 P;  5E79 E;  3G9R A;  1YHQ P;  3DP5 A;  1G1I A;  1LT9 B;  3VOP A;  2OYH A;  1H33 A;  1RAQ A;  5CIG B;  5CCH C;  2AEM A;  3AE3 C;  1SQV D;  4IFF A;  2O01 J;  1CZQ A;  4EI2 A;  1AKK A;  1BE3 J;  2CPB A;  3L74 D;  3G6E P;  3AEC C;  1LTJ B;  2C1D B;  1K05 A;  2XND H;  3O0R C;  1GL2 A;  1RY3 A;  2B89 A;  3H1J J;  2JEE A;  4NPD A;  5KAI E;  3EFG A;  5AVU B;  4MN4 C;  2AI5 A;  4DOJ A;  4L1Q A;  3JBT B;  3PH2 B;  2O01 N;  1USD A;  1NAY A;  4GOE A;  1KV4 A;  4NFG B;  3L35 A;  3VP9 A;  3L73 E;  1HRO A;  4JYC A;  2Z4E A;  3NBT A;  2P2U A;  5APY A;  1GTW A;  1YI2 P;  3KZI H;  3AED C;  4WQA A;  4QMA A;  5CCG D;  1SQV J;  2KSJ A;  1M8O B;  1CXC A;  1PPJ D;  4NPE A;  4Z1M H;  5DJU B;  5KAF E;  2BGV X;  4OGQ D;  4QAO A;  1DVH A;  2YXR B;  2W6A A;  1YQ3 C;  3L72 G;  1T3U A;  2PAC A;  4ZMD A;  4GIF A;  2E76 D;  4H0L C;  2WPS A;  1FZF A;  4PD4 H;  1LWU B;  1HZV A;  4JF7 A;  1H31 B;  1C75 A;  1NNO A;  3P8C D;  2R32 A;  3II6 A;  1QL2 A;  1NIR A;  1KZU B;  5KLI B;  2ZZS 1;  1NTM D;  1IRW A;  4UB6 H;  2SPZ A;  1CRY A;  3WUI A;  4AAM A;  2KNC A;  3IAO A;  1Q90 D;  3FWL A;  3M9Q A;  1N90 A;  4XYD B;  1W2L A;  1YIC A;  5DJQ B;  2BAS A;  1U74 B;  1N86 A;  3L75 G;  5CCG C;  2BEZ F;  1EXI A;  1AFO A;  3GF7 A;  4N3Y B;  3H1L J;  3L71 G;  3WU2 H;  3OA8 A;  1FHB A;  5AW1 B;  2IFM A;  4OGQ C;  3PTZ A;  1SQB E;  1M7L A;  3VP8 A;  5APW A;  2E76 C;  2WWW A;  1NTM J;  3TF5 A;  3V2N A;  3B5N D;  1FOC A;  3R4Y A;  4GED B;  1KB9 H;  1NTK G;  2C0W A;  1TU3 F;  3HQ7 A;  3HD7 B;  1CI6 B;  1J1E B;  3KZI E;  2YXQ B;  1I6D A;  4WQB A;  1RQV A;  2K3R A;  3A0H V;  3RK3 E;  1FDO A;  3KXD A;  1CED A;  2IBZ E;  3FGA D;  1NJI Q;  4Y28 J;  2NPS D;  4MU8 A;  1CTJ A;  1DX7 A;  2WT7 A;  2HPC A;  3UIA A;  3ZOW A;  4PD4 E;  3FWN A;  5APU A;  1SQQ K;  4RKU J;  1KIL A;  2OYI A;  4L73 A;  4WQE A;  1A8C A;  4UB6 E;  1HRC A;  2CE1 A;  2B0Z B;  3ZIY A;  5EFW B;  3T97 B;  3A9F A;  1KFM A;  1GIW A;  2HFE D;  4WY4 A;  2MHM A;  2J58 A;  1DVV A;  2NZ2 A;  3B5N C;  1CRC A;  1YTZ I;  1ZR2 A;  1M90 Q;  451C A;  3HUS C;  1Z56 A;  2FYN B;  2FXP A;  3RK3 B;  1AOF A;  1SFC D;  2IDB A;  1DEE G;  1M70 A;  4H13 C;  3L72 D;  1DW3 A;  5TIS V;  5AW4 B;  3GHG A;  2Y0E A;  4PV1 B;  3S1K A;  2K1A A;  2Z5I A;  1W2E A;  3WU2 E;  4EYY Q;  2C0X A;  4WQ8 A;  1VF5 B;  1J1D C;  3JC2 2;  2YO3 A;  1KB9 E;  351C A;  2HYN A;  2H7H A;  3AE2 C;  1FJ0 A;  2FWL A;  1MG3 D;  2IX7 C;  1WT6 A;  1L0N G;  2N9I A;  3AEE C;  2OTK E;  1KN7 A;  1N73 C;  5CBN A;  2A06 E;  3H1K E;  4WQ9 A;  3LID A;  2BCC G;  1HJ4 A;  5L8R J;  2XDJ A;  5CMZ A;  2JQR A;  3L75 D;  4GOF A;  3L72 J;  3BRV B;  1X9V A;  1WEJ F;  1NKN A;  3V6I A;  3L71 D;  3SXT A;  2NPS A;  1SQB G;  2JP3 A;  2O3J A;  2N1T D;  1M1J B;  1CNO A;  1JCD A;  1FZC B;  1KB0 A;  4LLH A;  1SFC C;  1NGM B;  1I54 A;  4AAN A;  3Q5P A;  2L91 A;  2G3A A;  1CCR A;  2E5Y A;  1BSH A;  4IFM A;  1G1J A;  1FC2 C;  1NTK D;  2YQB A;  1L0L G;  4JBZ A;  3CC7 P;  4ZKP A;  1GW4 A;  3RL0 B;  4EDF A;  2L4D A;  4EIC A;  3B8E B;  3OCD A;  3L75 J;  1YYC A;  1NOH A;  5CIB B;  3CCE P;  1FBM A;  2GC7 D;  1KIL E;  1AJY A;  1CRI A;  1PP9 E;  4WWI A;  5AVV B;  2WIT A;  1KX2 A;  3CME P;  4ASV A;  2XNX A;  1HZU A;  1ZRT E;  3CWB E;  3AE6 C;  3ZDM A;  2AXC A;  2P7J A;  1NTK J;  4EIJ A;  4EID A;  2N1T C;  1KD1 Q;  1LT9 A;  2ZON G;  2KS1 B;  4L75 A;  2BCN B;  3MP7 B;  4OVN F;  1LGH B;  3S4R A;  3OAK A;  4EIF A;  1NU1 K;  3L4M A;  3RK2 D;  5GTH V;  2W83 C;  1S2E A;  2N9B A;  1ZN5 A;  4U7J A;  1DW2 A;  2OZ1 B;  1DEB A;  1LTJ A;  2C1D A;  3L37 A;  2FFD C;  4W7Z A;  1RF0 A;  3D71 A;  3L70 E;  3RBZ A;  1M6Z A;  2DGE A;  1X79 B;  4TLF A;  2JWD A;  1LTI C;  2C1U A;  1COT A;  5B66 V;  2OYO A;  1U75 B;  5KLV E;  2ZXE B;  1AVY A;  5APS A;  3PHL A;  3SJL A;  1ZZH A;  1LWU C;  4IL6 V;  3L73 J;  2IBZ I;  2KP8 A;  3L4O A;  2QJY C;  3LW5 H;  1I55 A;  1VQO P;  4FAN A;  1L0N D;  4PD4 I;  2IZ0 A;  155C A;  4DCK A;  2A06 G;  4UB8 V;  3H1K G;  2YMK A;  1CHH A;  2Q7C A;  4I7Z C;  1JY3 N;  1KYO E;  2FXO A;  3P8M C;  5AW8 B;  2BLF B;  2BCC D;  1S5L X;  3SWK A;  4HB1 A;  1LJ2 A;  1CSX A;  3RK2 C;  1HGZ A;  1IO4 A;  3TNU B;  1G2C B;  5CHX A;  1WMK A;  2E74 B;  4ZNC A;  1SQX E;  1N8R Q;  2GB8 B;  1LWU A;  1H31 A;  1AQ5 A;  1SQB D;  2Q3I A;  4BWN A;  2WSS H;  3A2A A;  1RF1 C;  3F5H A;  1K3G A;  3JSV C;  1L4A B;  1NH4 A;  2M0B A;  2K88 A;  4LJI A;  3DMI A;  3V2R A;  2ZYG A;  2IZ1 A;  5KLV K;  2ZVN B;  1S5L H;  1OW7 A;  5B5E H;  4H44 B;  1L0L D;  1PIX A;  1CXA A;  1K04 A;  1PL5 A;  1GU2 A;  3WFE C;  1IFP A;  2PCB B;  3PXT A;  3H1L G;  1B7V A;  2KIK A;  1AYG A;  2M3E A;  1X22 A;  1KB9 I;  1JO5 A;  4W80 A;  1FDM A;  4L74 A;  2R5B A;  1SQP E;  1HGV A;  1NMI A;  4GYD A;  1KQS O;  1PP9 G;  1L2P A;  2FYU K;  3QWO C;  1HBW A;  1P84 H;  1SQB J;  1PGQ A;  1T6A A;  3AE5 C;  3CD6 P;  3CWB G;  1FI3 A;  4ZKU A;  4YE1 A;  3HRN A;  1HJ0 A;  4JCG A;  4R4M A;  1ZW0 A;  1RE3 C;  3A0H H;  1KYO W;  1L9J C;  3V4W A;  3HD7 A;  3H1I G;  1CI6 A;  1DIQ C;  3D70 A;  2PGD A;  2Y9Y A;  2OYH C;  1OX3 A;  2E43 A;  2YKP A;  1NO4 A;  3L70 G;  1F1C A;  4K3I A;  4AYC A;  3CCJ P;  3H6P A;  4FA1 A;  2HLO A;  2WSE H;  1CIF A;  1LP1 B;  2Y0C A;  4YXW H;  3RL0 g;  5KLV G;  2HOD B;  1Q7Y Q;  2K9J B;  1T2K D;  1EQ7 A;  1SQP K;  1CCH A;  4JPZ B;  2I8D A;  2N9Y B;  2N18 C;  1VDF A;  3T97 A;  1KB9 D;  3MIW A;  3PRJ A;  5GTI V;  1RQU A;  1S5L E;  3BAT A;  5B5E E;  2GIW A;  2KB7 P;  2QJK B;  1QKS A;  3AEF C;  2QVA A;  2A06 D;  3H1K D;  2C9N Y;  1VQ6 P;  1EDI A;  3BCC E;  2LXC B;  3D0W A;  1URQ B;  1SQX G;  1DT1 A;  1VQ8 P;  2Q9I A;  4XXL A;  2GUV A;  4C7N B;  3I55 P;  1P84 E;  2RH0 A;  3C1L A;  1JY2 N;  2OTL P;  5KKZ B;  2WPQ A;  1N9C A;  1DW0 A;  1ETP A;  2I1K A;  2P10 A;  3N4X A;  2ZYD A;  3A0H E;  2H89 C;  1JY3 O;  1QL1 A;  1T2K C;  1LTG C;  1K3H A;  3HQ6 A;  2Q6Q A;  3L36 A;  1OW6 A;  3H1K J;  4PJ0 V;  2C1V A;  3H1L D;  3SWS A;  2J5U A;  1XTG B;  1I8O A;  3PXS A;  1JNM A;  1KIL D;  1M1J A;  3CCQ P;  3D6Z A;  4C7R A;  1PP9 D;  2VHD A;  1FZC A;  1MZ4 A;  1Q2N A;  1ZRT D;  1KYO I;  3CWB D;  1T8Z A;  1EDK A;  4WY4 D;  2YIU C;  2BH5 X;  2FBW C;  4WVZ A;  1CTZ A;  3O1Y A;  1LTA C;  1RAP A;  3H1I D;  3KHU A;  3ZOO A;  1RZ5 A;  2MJZ A;  1SQQ E;  2FRC A;  3WFC C;  2FYZ A;  2ZT9 B;  3L70 D;  5E79 V;  1QN2 A;  1Q86 Q;  2ZJS E;  3AE4 C;  2BH4 X;  1DW1 A;  3VTP C;  3MUD A;  1PP9 J;  1I8P A;  1FI7 A;  1H9X A;  5CJ4 A;  3CX5 H;  3CWB J;  3MK7 B;  4GKG A;  3AE1 C;  2C9L Y;  1KIL C;  2OYI C;  3RGU A;  2KS1 A;  3VYM A;  1GJQ A;  4A7P A;  4DT0 A;  1VYD A;  3H1I J;  1CTY A;  3JCU H;  2PFX A;  4H44 D;  5AVS B;  2JDI H;  2W6J H;  2O1J A;  3TGU E;  2OZ1 A;  4WY4 C;  4I2L C;  4Y99 C;  2M5A B;  3A0B V;  1KYO D;  5B66 H;  3BCC G;  1K8A Q;  3L70 J;  1A2S A;  2CPS A;  2JR8 A;  2WSC H;  1QL4 A;  4IL6 H;  2B9B A;  2R44 A;  1OCD A;  1SQX D;  5IY5 1;  3GHG C;  4I6M C;  3SLE A;  1H32 B;  5KLV J;  3L73 G;  1QGK B;  1EXJ A;  5KAF V;  1N7S B;  5C9M A;  2AXT H;  2R3S A;  2GA1 A;  4PW9 B;  1MFZ A;  1M57 D;  2W8Z A;  4BXL A;  1CIG A;  3HQ8 A;  1OZH A;  2KK7 A;  1VQ5 P;  1KMI Z;  5AVX B;  1C7M A;  1YFC A;  2GC4 D;  3D6Y A;  1U7J A;  1FZE A;  4BRY B;  4J20 A;  1CIE A;  2D2C D;  3TNU A;  1G2C A;  4DZO A;  4GT1 A;  4AAL A;  1FOS F;  1JY2 O;  4HYT B;  3SWY A;  2QM7 A;  1SQX J;  2WSF H;  2NPS C;  1ZME C;  1I5T A;  1LC2 A;  1GKS A;  3CX5 E;  1JMM A;  3IF4 A;  2QJP B;  1L4A A;  3RMZ A;  5AW7 B;  3RBX A;  1USE A;  1YEB A;  1HH7 A;  4Q5P A;  1YCC A;  1KOR A;  3EQ2 A;  2OGU A;  3JCU E;  1E2R A;  1IJD B;  3ITK A;  3M9H A;  1C6O A;  3IFM A;  1BL9 A;  1N15 A;  4P4Q B;  1P84 I;  3A5T A;  3RN1 A;  1SQQ G;  1NTZ K;  3M91 A;  2YKO A;  3TYY A;  1R0Q A;  3PH0 A;  3Q5S A;  3V4Q A;  2JJL A;  5B66 E;  3OA7 A;  1X0T A;  3L74 E;  4KJM A;  1CW5 A;  2WPR A;  1OWA A;  1EZV E;  3KZI V;  1OXZ A;  1CSU A;  1GMJ A;  2H43 A;  1C52 A;  1NU1 E;  4KT0 J;  2AIU A;  2POH A;  4JQ0 D;  1I6E A;  1ZR4 A;  2D2C C;  2ZXX A;  2AXT E;  4O1W A;  1DH3 A;  1KC8 Q;  3M97 X;  5DFS A;  3LW5 J;  4N0K A;  2WQY C;  4OWF A;  1LT9 C;  3TGU G;  3V2P A;  1AOQ A;  1F1F A;  5AVT B;  5CIE B;  2IBZ G;  2E5T A;  5H2F H;  1LTJ C;  2PRR A;  2QJK C;  3CXH H;  3BCC D;  3ZBM A;  1RF0 C;  2KUB A;  3CCL P;  4H0L B;  3BVH A;  3RN0 A;  1RE4 C;  1LP1 A;  3Q5R A;  4JYB A;  1E79 H;  1SQV K;  3AEG C;  3SWF A;  2HOD A;  1P84 D;  4RSZ A;  4N78 E;  3L73 D;  1L9B C;  2K9J A;  3U1A A;  3N7N A;  1YQ4 C;  2O1K A;  3P8C E;  5CBO A;  1M1K Q;  1X8Y A;  1NTM E;  3H32 B;  5K5G B;  4Y5R A;  3CMA P;  1RH5 B;  3WU2 V;  1J3S A;  1LTS C;  3HE4 B; 
#chains in the Genus database with same CATH homology
 1KYO W;  1L9J C;  1HZV A;  1H31 B;  1WVE C;  1C75 A;  1NNO A;  2MTA C;  1DIQ C;  1NIR A;  2PCC B;  5KLI B;  2ZZS 1;  1NTM D;  1IRW A;  1CRJ A;  1CRY A;  2QG4 A;  2N9J A;  2CXB A;  3WUI A;  4AAM A;  2N18 B;  1F1C A;  4K3I A;  3FWL A;  5B6Q A;  1N90 A;  4XYD B;  1W2L A;  4FA1 A;  1YIC A;  2N3B A;  5DJQ B;  1KIB A;  1S6V B;  1CIF A;  2Y0C A;  1U74 B;  3WFD C;  1KX7 A;  2C2C A;  5CIC B;  2K9J B;  3OA8 A;  1FHB A;  1CCH A;  5CID B;  1CIH A;  2N9Y B;  2JTI B;  3PTZ A;  2N18 C;  1KB9 D;  3X39 A;  1HCM A;  1SQQ D;  1CRG A;  1W5C T;  3PRJ A;  5DJQ C;  5GTI V;  3TF5 A;  1FOC A;  3NWV A;  4GED B;  2GIW A;  1CHJ A;  2QJK B;  3CYT I;  3HQ7 A;  1QKS A;  4FA4 A;  2A06 D;  3H1K D;  1H9Y A;  1DII C;  1I6D A;  4WQB A;  4FA5 A;  3A0H V;  2V07 A;  3ZOX A;  3SVW A;  1DT1 A;  4L3G A;  1LMS A;  4XXL A;  2ZBO A;  3CP5 A;  5C0Z A;  2KNC B;  1CED A;  4UB6 V;  1NML A;  5CIF B;  3CX5 W;  4WQ7 A;  2C8S A;  4MU8 A;  5KKZ B;  1CTJ A;  3TGU D;  1N9C A;  1DW0 A;  1ETP A;  4WQC A;  3ZOW A;  2Y0D A;  5DF5 A;  2IBZ D;  3O5C A;  4DY9 A;  4WQE A;  1A8C A;  3OA8 B;  1IZL 0;  1HRC A;  1K3H A;  2CE1 A;  2B0Z B;  2C9X B;  3ZIY A;  5CIH B;  3HQ6 A;  1YTC A;  3ZOY A;  3A9F A;  4PJ0 V;  4PD4 D;  1CSW A;  1GIW A;  1YIQ A;  2C1V A;  2YIU B;  2MHM A;  3H1L D;  3RLM A;  3SWS A;  2B11 B;  2I8F A;  4H0K A;  1DVV A;  1CRC A;  5AUR A;  1I8O A;  4FAV A;  3PXS A;  2YCC A;  2B12 B;  451C A;  2FYN B;  1PP9 D;  1CO6 A;  1AOF A;  2VHD A;  3NBS A;  1CYI A;  1MZ4 A;  1M70 A;  3L72 D;  1DW3 A;  5TIS V;  2N3Y A;  1ZRT D;  3CWB D;  1FI9 A;  2Y0E A;  2DVH A;  2BH5 X;  1HJ3 A;  1CTZ A;  3O1Y A;  1C6R A;  4WQ8 A;  1RAP A;  1CSV A;  3H1I D;  4FA9 A;  4KMG A;  3KHU A;  1OAE A;  3ZOO A;  1RZ5 A;  351C A;  4AAO A;  3DR0 A;  2Q3E A;  2FRC A;  4FB1 A;  1FJ0 A;  2FWL A;  1MG3 D;  1H1O A;  3WFC C;  2N9I A;  1EB7 A;  4RJT A;  1H32 A;  3H1H D;  3L70 D;  1C6S A;  5E79 V;  1YNR A;  2BPB B;  1QN2 A;  2YK3 A;  1CYJ A;  1RZ6 A;  1CC5 A;  1IQC A;  2D0S A;  4WQ9 A;  4U3F D;  2BH4 X;  1DW1 A;  1HJ4 A;  3PXW A;  1I8P A;  1E29 A;  1FI7 A;  1H9X A;  2JQR A;  3L75 D;  2B10 B;  1WEJ F;  3MK7 B;  2AXT V;  3L71 D;  3SXT A;  4EIE A;  1YEA A;  3GG2 A;  2O3J A;  1CNO A;  3TYI A;  2KS1 A;  3VYM A;  1GJQ A;  1KB0 A;  4A7P A;  3HQ9 A;  1VYD A;  2XTS B;  1CTY A;  1I54 A;  1C2R A;  4AAN A;  1CHI A;  1LFM A;  2L91 A;  1CCR A;  3C2C A;  2ORL A;  2OZ1 A;  1NTK D;  2YQB A;  1HJ5 A;  1EZV D;  3CU4 A;  3A0B V;  1KYO D;  1A56 A;  3MK7 C;  1CRH A;  1FCD C;  1NU1 D;  1A2S A;  4EDF A;  3TDK A;  2L4D A;  4EIC A;  1QL4 A;  1OCD A;  3OCD A;  1LC1 A;  1SQX D;  5IY5 1;  3VRD A;  3SLE A;  1H32 B;  1GDV A;  4H0J A;  5CIB B;  5KAF V;  5C9M A;  2LIR A;  2GC7 D;  4PW9 B;  2RN0 A;  1CRI A;  2JWA A;  1CIG A;  1KX2 A;  3HQ8 A;  1M60 A;  1HZU A;  3WC8 A;  1C7M A;  1YFC A;  2GC4 D;  4EID A;  5CYT R;  2CA4 B;  2ZON G;  1C2N A;  1NTZ D;  2BCN B;  2HV4 A;  1JDL A;  1KV9 A;  4EIF A;  1LS9 A;  5EXQ A;  3CXH W;  3L4M A;  5GTH V;  2EXV A;  4J20 A;  1CIE A;  2ZXY A;  1DW2 A;  2OZ1 B;  4L3H A;  3WFB C;  4AAL A;  2C1D A;  3GW6 A;  5TJH A;  2QJY B;  1I5T A;  1BE3 D;  1M6Z A;  2DGE A;  1LC2 A;  1GKS A;  2V08 A;  2C1U A;  2QJP B;  1GQ1 A;  3OCD B;  1COT A;  3RMZ A;  2B4Z A;  5B66 V;  1U75 B;  1YEB A;  1BCC D;  3H1J D;  3VMA A;  1HH7 A;  4Q5P A;  1YCC A;  3PHL A;  2CA3 B;  1E2R A;  1IRV A;  4PWA A;  3ITK A;  2ZOO A;  3SJL A;  1C6O A;  1ZZH A;  3CX5 D;  4IL6 V;  4O1Q A;  1E8E A;  1BL9 A;  1N15 A;  4P4Q B;  1MG2 D;  3RN1 A;  3L4O A;  1I55 A;  4V2K A;  1R0Q A;  1S5L V;  5KLV D;  2CE0 A;  5H2F V;  5B5E V;  4FAN A;  1L0N D;  155C A;  3ORV A;  3ZCF A;  4UB8 V;  3DP5 A;  1CHH A;  3O20 A;  3KZI V;  1CSU A;  1C52 A;  1H33 A;  1RAQ A;  5CIG B;  2BLF B;  5KAI V;  1SQV D;  2BCC D;  1CSX A;  1AKK A;  2AIU A;  1I6E A;  3L74 D;  2C1D B;  4O1W A;  1IO3 A;  2GB8 B;  2FYU D;  3O0R C;  1H31 A;  2LIT A;  1SQB D;  3M97 X;  5DFS A;  4N0K A;  2AI5 A;  4AX3 A;  4L1Q A;  1K3G A;  3JBT B;  3PH2 B;  1AOQ A;  3CXH D;  1F1F A;  4LJI A;  4WQD A;  1N50 A;  3DMI A;  4NFG B;  5CIE B;  1QYZ A;  4D6T D;  1CYC A;  1L0L D;  3BCC D;  1CXA A;  3ZBM A;  1HRO A;  1BGY D;  1GU2 A;  3NBT A;  3WFE C;  2PCB B;  3RN0 A;  3PXT A;  1B7V A;  4WQA A;  1AYG A;  1CXC A;  1PPJ D;  1P84 D;  4RSZ A;  3PLN A;  1QL3 A;  3L73 D;  1NMI A;  1L9B C;  3VNW A;  4GYD A;  2RMZ A;  2BGV X;  4QAO A;  1COR A;  1H33 B;  1DVH A;  2D0W A;  2PAC A;  4Y5R A;  1FI3 A;  4YE1 A;  3WU2 V;  1J3S A;  4JCG A;  1SQP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...