3L72D

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 73
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l72D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l72D02
3VYMA 5KKZB 1E8EA 5KLVD 155CA 3WFEC 1H32B 1K3GA 1NTKD 4H0KA 4FB1A 3M97X 1I54A 2N9YB 2V07A 1CRJA 2MHMA 1FI7A 3CP5A 1NTZD 5GTIV 4H0JA 4EIFA 1H33B 1DIIC 3ITKA 1NTMD 2FYNB 4D6TD 1CRYA 2ZXYA 5CIEB 1H9YA 5CIGB 1CO6A 3CYTI 1CCRA 1N15A 1QL4A 2EXVA 3WFCC 1CSXA 1GQ1A 2KS1A 2Y0CA 1KX2A 1HCMA 2MTAC 1CXAA 1I6DA 3KHUA 3WFDC 1B7VA 2C8SA 5CICB 2Q3EA 1YFCA 3OA8A 4O1QA 1K3HA 2LIRA 3PHLA 4JCGA 1H31B 2B10B 3PTZA 1I8PA 1CNOA 4PD4D 2Y0EA 1C6OA 3H1HD 1SQVD 2L91A 1FI3A 3H1KD 4WQCA 3JBTB 2V08A 2AIUA 3L71D 1SQQD 1S6VB 3SJLA 1KB9D 4NFGB 1CIFA 5DJQC 3O0RC 1CYIA 4FAVA 1PPJD 1ETPA 2L4DA 1CC5A 4U3FD 3A0HV 5B6QA 2ZOOA 1AKKA 1E29A 1HJ4A 2N9JA 1C52A 1M70A 3PXTA 2QG4A 3H1ID 1BE3D 1H1OA 1MG2D 4WQ8A 3RMZA 1GKSA 4WQDA 5C9MA 3PRJA 2C1DB 1L9BC 1JDLA 2CXBA 2LITA 1RZ6A 3SVWA 1LMSA 2DGEA 3L4MA 1HROA 2QJPB 4WQ9A 1QKSA 1CRCA 1KIBA 1SQBD 3ZOWA 5C0ZA 4FA4A 3DR0A 1W2LA 2ORLA 5KAFV 1E2RA 1QYZA 1DVVA 1GU2A 1CRHA 4L3GA 5KLIB 2JWAA 2FYUD 3RLMA 1IO3A 3ZBMA 1OAEA 1C2NA 1OCDA 2C1UA 2BH4X 1CRIA 3L73D 1FCDC 1A2SA 2YCCA 1NU1D 2B11B 1RAQA 1GDVA 2PACA 1HJ5A 1BGYD 1P84D 5EXQA 3VNWA 3SLEA 1CCHA 1L0ND 2B12B 1KB0A 1WVEC 1C6SA 1ZRTD 4XXLA 1LC1A 1HRCA 3L75D 1AOQA 4UB8V 5H2FV 1CYCA 3DP5A 5KAIV 4GEDB 1IRVA 4PWAA 1HZVA 2YIUB 3CX5D 2DVHA 4YE1A 1CIGA 2ZZS1 3ZOXA 1GJQA 3CX5W 4Q5PA 3A0BV 2N9IA 3O20A 1DW3A 1N50A 5CYTR 1FOCA 1MG3D 5TISV 2CA3B 3ZCFA 5IY51 3NWVA 3OCDB 2BCCD 2GIWA 3O1YA 3GW6A 4AAOA 2D0SA 1FHBA 4UB6V 2C9XB 5B5EV 4FA5A 1AOFA 4WQBA 1COTA 1SQXD 1S5LV 1SQPD 3L4OA 3H1LD 4P4QB 4O1WA 3A9FA 1AYGA 1CIEA 1CHHA 1N9CA 1CORA 1YNRA 2ZONG 2YQBA 3WUIA 2I8FA 1DW2A 5CIDB 2C1VA 3C2CA 2K9JB 2RMZA 2RN0A 1PP9D 2N18C 4EDFA 1CSVA 5B66V 2N3YA 1KYOW 3CU4A 1LS9A 4N0KA 1YTCA 5TJHA 2YK3A 3PLNA 1M60A 2N3BA 3HQ9A 3VRDA 2ZBOA 3ZOYA 1I55A 1NIRA 5E79V 3WU2V 1CSUA 1YEBA 3VMAA 4EIEA 3ZIYA 3MK7B 1KV9A 4EICA 1CTZA 2QJYB 2GC7D 3PXWA 3NBSA 2AI5A 3RN1A 2BPBB 1CXCA 2PCBB 3CXHW 4RJTA 1I5TA 2CE1A 1F1CA 2GB8B 3MK7C 1KYOD 1RAPA 1MZ4A 4IL6V 2O3JA 3DMIA 4K3IA 3ZOOA 1C2RA 2BGVX 1CRGA 1W5CT 2JQRA 4KMGA 2Y0DA 2C2CA 3BCCD 1IRWA 1BCCD 351CA 4WQEA 3O5CA 3CXHD 4MU8A 4PW9B 1YIQA 1H33A 1A8CA 4LJIA 3HQ6A 2CE0A 1FI9A 2OZ1A 2IBZD 1BL9A 4RSZA 3TYIA 1FJ0A 1VYDA 1ZZHA 1CHJA 3OA8B 4DY9A 1H31A 1DT1A 1IZL0 3TDKA 1DW1A 2JTIB 1CIHA 1HJ3A 1M6ZA 4FANA 3SWSA 1L0LD 2D0WA 1LFMA 4L3HA 1U74B 1NNOA 3TF5A 1CTJA 1QL3A 3NBTA 5CIHB 3OCDA 2PCCB 2CA4B 4EIDA 1N90A 4WQ7A 5DFSA 1QN2A 1I6EA 1H32A 1L9JC 1NMIA 1WEJF 1YICA 2BH5X 1HH7A 1EZVD 3X39A 2N18B 2A06D 3HQ8A 1C75A 3CWBD 2BLFB 2B4ZA 1C6RA 1CEDA 3L74D 5GTHV 2AXTV 1R0QA 451CA 4L1QA 3H1JD 3SXTA 4WQAA 3HQ7A 2KNCB 3PXSA 2C1DA 4Y5RA 4AAMA 1J3SA 5AURA 1LC2A 4XYDB 2HV4A 4PJ0V 4AANA 1H9XA 5DF5A 4V2KA 5CIBB 5DJQB 1CHIA 2FRCA 2GC4D 4FA1A 1CSWA 3GG2A 1DW0A 1I8OA 1CTYA 2OZ1B 1DVHA 2QJKB 1RZ5A 2XTSB 3ORVA 1KX7A 3KZIV 1C7MA 1U75B 1CYJA 1YCCA 4J20A 3PH2B 3FWLA 1NMLA 1GIWA 2B0ZB 4AALA 4AX3A 1DIQC 4GYDA 1YEAA 2FWLA 2VHDA 3RN0A 2BCNB 4QAOA 1HZUA 3TGUD 1IQCA 3L72D 1EB7A 1F1FA 3L70D 5CIFB 3WFBC 4A7PA 1A56A 4FA9A 3WC8A
chains in the Genus database with same CATH superfamily
3VYMA 2QA4P 1W2EA 5B66E 1IFNA 3H1KE 4H0KA 3TGUG 1T3UA 2R5BA 1CRJA 3CMAP 1FI7A 2L5GB 2YO3A 3GF7A 3GHGB 2A45G 2RKLA 1DIIC 3H1JG 2IZ0A 3A0BE 5CIGB 2UWJE 5AVQB 1N15A 4PJ0E 3AE7C 3KDPB 2KS1A 3AE1C 2Y0CA 1CXAA 3KHUA 1HTLC 5CICB 4EI2A 3OA8A 4O1QA 1K3HA 2MKVA 1NTKG 1IK7A 3PTZA 1SQQJ 4PD4D 5CJ0A 2OTKE 1HVVA 1FI3A 4I1LA 2M5AA 3H1JJ 1VQ9P 5CCGD 2YIUC 4H0LD 1URQA 2OYHA 3CWBG 2OARA 1S6VB 3SJLA 1BSNA 1KB9D 4L73A 1CIFA 1SFCA 1NU1K 1GMJA 1RH5B 1ZR2A 1FBMA 2QEXP 4BXLA 4GOFA 2AEFA 3CCLP 1NTKK 3T97B 3L72J 2FYUE 2ZYDA 1GW4A 5AVYB 3H1ID 1PGQA 1BE3D 1H1OA 1MG2D 2OYHC 4WQDA 1M1JC 1RZ6A 1EZVI 1LMSA 2O01H 1HJBA 1SQVE 2JO1A 1ZRTE 3UIAA 4WQ9A 1QKSA 1WRGA 4H13C 2K9YA 2IYOA 1FDMA 2OYIB 1SQBD 1FU1A 4FA4A 5CCHA 3RL0D 4N78E 4MN4C 4YXWH 1QYZA 1GU2A 5AW1B 3CXHI 5AVTB 3L75J 5CHXA 3B5NA 2FYUD 3RLMA 1YJ9P 2A06E 3HE4A 1IO3A 1RQUA 1FCDC 2YMKA 3H1HE 2G3AA 3NFQA 3RK3C 2B12B 1PP9E 4BWNA 1ZRTD 1LC1A 2QJPC 1FDIA 2WSCJ 1PGPA 3L75D 1GW3A 1VQKP 2YMYA 2O1KA 2GUVA 3TK1A 2IX7C 3SSUA 1G1IA 1GU5A 3RL0B 1IRVA 3A0BH 4PWAA 1HZVA 2YIUB 3BCCG 3FGAD 4B86A 2ITAA 1LTAC 1K8AQ 3SWFA 4YE1A 4C46A 5GTHH 1OXZA 2R5DA 5KLVE 2N9IA 3RK2B 3N7NA 1DW3A 3HTKA 2M8RA 1MG3D 5TISV 1KYOE 3L4FA 1N7SD 2ZT9D 1GL2A 1DX7A 3OCDB 3VMYA 2NPSD 2WTYA 1NTZE 2GIWA 1L4AD 4NPDA 3O1YA 1SQVG 1Y9BA 5AW6B 2GM4A 1J1DC 2C9XB 2I1KA 4FA5A 4GT1A 3BATA 4LLHA 4N6JA 1QEXA 1AYGA 1JNMA 3TYYA 1SQXG 4I7ZC 3GLMA 1H89A 1N9CA 1FZCC 2AEMA 2WITA 5CIDB 2C1VA 3D71A 1KYOI 3AEDC 3C9IA 2N18C 3ZDMA 1AFOA 1S9KE 1BDCA 3L71E 4O9BA 5B66V 2IFMA 3M0DA 1YTCA 3PLNA 3VRDA 2ZBOA 3ZOYA 1Z56A 1I55A 3MD0A 1NIRA 3WU2V 1M7LA 3AE8C 3CX5H 3D6ZA 1X79B 4K35A 1AJYA 1CTZA 2QJYB 1H0TB 2GC7D 5DJTB 5AVRB 4JBZA 2N1TD 3L74E 3K5BA 2CE1A 2KYVA 3CPWO 1JY2P 2O3JA 1KILE 2W90A 3U1AA 2Q3IA 2K37A 1C2RA 1CRGA 2XNDH 1JEKA 4HB1A 1FS0E 2FFDB 2C2CA 1BCCD 1AQTA 3RK3E 3CXHD 1SQBK 1VL2A 4PW9B 4ASWA 2V7QJ 5E79H 2W83C 1SQPG 1AVOA 1CSBA 5KJ7D 3MZWB 2P7JA 4WY4D 3TYIA 1JY3P 1RQVA 4IOIH 1YIJP 3BRVB 1MFZA 2ZJSE 2JTIB 5B5EH 2KP8A 3G9RA 1S72P 1M6ZA 1OW6A 1L0LD 2JWDA 1RF1C 1LFMA 1L0NG 3L75E 1U74B 3GHGC 1LP1A 1S5LH 3HTKB 4I2LC 1BCCE 5CJ4A 2PCCB 3VP9A 2CA4B 1N90A 1M1JB 1M8OB 2KOGA 1QN2A 1I6EA 1H32A 1WEJF 1CZQA 1HH7A 3X39A 1RF0C 1K05A 3H25A 3N4XA 1RHZB 2Q7CA 2BLFB 3RBZA 2B4ZA 2WSSH 1PPJG 3P32A 1ZP0C 1VQLP 3GHGA 1R0QA 4L1QA 3H1JD 1S2EA 3SXTA 1X8YA 1GL2D 1USEA 3L72E 3I5CA 1OFCX 2C1DA 5AURA 3TGUJ 1D7MA 3L70J 4V2KA 5CIBB 2N1TC 5DJQB 3E1IA 1CHIA 2GC4D 4FA1A 4H13D 1CSWA 2BEZF 1KN7A 3A5TA 3M06A 2ZXXA 2OZ1B 1DVHA 3L37A 1VPCA 1GK4A 2IBZE 3AE4C 3VP8A 3Q3DA 2YNYA 3AE5C 4WBAA 3ORVA 1KX7A 2M5AB 5KTBA 2POHA 1C7MA 1BE3J 2K3RA 1CYJA 4J20A 1NTME 3V2NA 1L4AB 1NMLA 2OYHB 3AECC 1L0LJ 3LW5H 4GYDA 1YEAA 1KYOH 3NMDA 1HZUA 1IQCA 1S9KD 5CIFB 4FA9A 1S3JA 1LWUA 5AVUB 2PGDA 3O8ZA 5KKZB 3B5NC 3V5BA 1N73B 1TU3F 1E8EA 1JMMA 1Q2NA 155CA 3HUSC 1ZV8A 2N9YB 3GF3A 3P8CD 3EFFK 2MHMA 1QX8A 3V2PA 1L0LG 2BEQD 3LIEA 4PV1D 4EIFA 2WSCH 4QMAA 3I55P 1KD1Q 5TISE 1NTMD 1NOHA 2FYNB 1SQBE 4D6TD 3MIWA 1CRYA 1Q90D 1IFJA 2ZXYA 2KNCA 1H9YA 3M9HA 2EXVA 1CSXA 5AVSB 1WMKA 3VN0A 1RF1A 1EDLA 1HCMA 2QE7H 1EZVG 1B7VA 3AEFC 2C8SA 2YO2A 5B5EE 2Q3EA 4OGQD 4HYTB 2LIRA 3Q5SA 4JCGA 4D6TG 4AYCA 1I8PA 1CNOA 1L2PA 2W6AA 2Y0EA 5BU8B 1C6OA 3H1HD 1LT9C 2L91A 3D6YA 2R3SA 1JY3N 5KJ7A 2OQQA 2AIUA 1PGOA 1SQBG 3KYQA 1JM0A 5DJQC 1OVVA 2G8YA 4JPZB 1DD3A 1CYIA 1RE4C 4FAVA 1ZMEC 1HGVA 3MGNA 2PRRA 3TGUE 2L4DA 4L76A 1CC5A 3H1HJ 3P8MC 3A0HV 1NWQA 3CCRP 3H1IG 1HJ4A 2ZFCA 3PXTA 4Y99C 1FZCA 1KFNA 1ZXGA 4WQ8A 2WQYC 5C9MA 3AE9C 1FZEA 5E79E 2C1DB 1DH3A 3S1KA 1JDLA 3SVWA 1P84E 3OJAB 3CMEP 2DGEA 3L4MA 1H88A 1CRCA 3B4SA 2KK7A 1NH4A 3QH9A 4H44C 1Q86Q 5C0ZA 4Z1MH 1W2LA 2ORLA 4KT0J 2E75B 2KS1B 1E2RA 3IF4A 1M1KQ 2NRGA 1OW7A 3P7KA 1QVFO 3ZBMA 1C2NA 1JCDA 5EFWB 3TSIA 3FWNA 3L73D 5C39A 2YCCA 1NU1D 4GODA 1PL5A 2B11B 1T2KC 1VF5C 1GDVA 1BGYD 1P84D 3SLEA 1HBWA 2ZT9B 1PFIA 4XXLA 5AVXB 3VTPC 3MUDC 2A45H 4XFJA 3EQ2A 1SQXJ 1HJ0A 5KAIV 2RH0A 1VF5B 2NPSC 4GEDB 3U1CA 1NGMB 1RY3A 2A06G 2AXCA 3E1RA 4CPGA 2HLOA 2KXPB 2ZVNB 2FYZA 2KI7B 2Z4EA 3CCEP 3ZOXA 4TT3H 4ZMDA 2C0XA 4H0LB 2YXQB 4Q5PA 1X22A 3A0BV 3O20A 1J1DB 2QM7A 1R8EA 1FOCA 2CA3B 4ZKUA 3CC4P 3ZCFA 4NPFX 2BCCD 3CX5I 1BGYE 1KZUB 4PV1B 5AW8B 3BRTB 3GW6A 1OZHA 2OYOA 2D0SA 1Q82Q 4UB6V 1EDIA 4D6TE 1VQNP 5B5EV 1AVYA 2V4HA 1AOFA 3NTNA 1DIPA 2D2CD 3H1LD 1DEBA 2FYUG 5GTIH 4EOTA 1NHLA 2Z5HA 1IK9A 1DW2A 3C2CA 3CL3D 2K9JB 4N3YB 5AW2B 2RMZA 1IJDB 1IC2A 1FZCB 1KB9I 1CSVA 1KYOW 2Y9ZA 5TISH 1LTJC 1SP4A 2YK3A 2N3BA 3TNUA 3CD6P 2N1TA 3A3YB 1YEBA 4EIEA 2PAJA 3M91A 3MK7B 1KV9A 4L74A 2NZ2A 4HKZH 1LNQA 1G1JA 2AI5A 1VQ5P 1JB0J 2YKPA 3NXSA 2BPBB 1CXCA 2PCBB 3AE6C 2WSFH 1JOCA 1VQMP 2R44A 5AW7B 1FZBA 1FAVA 3B71A 2KUBA 3DMIA 3ZOOA 2BGVX 5APXA 1KB9E 4KMGA 1ZLLA 1PP9J 3BCCD 1IFMA 1KFMA 5B66H 3A7OA 1GL2C 3O5CA 4IL6H 4PD4E 4LJIA 5CCGC 2IBZD 1YBKA 4Y28J 1MV8A 2O01N 1ZOYC 5CMZA 1CHJA 1J1EC 2OTLP 3OA8B 1LTBC 1SQPK 4PJ0H 1NU1E 4LC1A 2W6JH 2WMMA 1DT1A 3AEBC 1LTSC 3LW5J 2JDIH 3VOPA 4FANA 3SWSA 1SFCC 4L3HA 3QWOC 3WMM0 2J5UA 1BE3G 4W7YA 3TF5A 2JJLA 1J1EB 3JSVC 2FYNC 2OTJP 2ZVOB 1J2JB 3RL0g 1Q7YQ 2M0BA 2QJKC 1USDA 1NTMK 1H0TA 2N9BA 1GU4A 2QSIA 2BH5X 1U7JA 2A06D 3R2PA 1C75A 1AV1A 3CWBD 3CLQA 1C6RA 3L74D 5GTHV 451CA 3KQGA 5BVZA 4ZNCA 3CCJP 1LT9B 1KQFB 3BCCJ 1HF9A 2KNCB 1SQPJ 2BCCE 4Y5RA 4PV1C 4JQ0D 3HD7B 1EDJA 2HV4A 5AW3B 5CCHC 1H9XA 2HR3A 2LXCB 3CC7P 2FRCA 2K9JA 3SWYA 3HE5B 1AQ5A 1FZFA 5KAIH 1CTYA 2D2CB 3MHVA 3H1LE 2I1JA 1JMBA 2ZT9C 2PFXA 4WY4B 3I56P 2I8DA 1SQXK 2HODB 3CWBE 3PH2B 3FWLA 1GZLA 3KXDA 3Q5RA 1NO4A 5H2FH 4AX3A 3D0WA 4KHXA 4YXDC 2VHDA 5H2FE 1AA0A 3TGUD 1NTZJ 5AW0B 1F1FA 3L70D 3RK2D 3WFBC 1A56A 2XU6A 2DW3A 1LGHB 2W8ZA 1BDDA 3MP7B 4UB6H 4EIJA 1YJNP 1LTTC 4JYBA 5KLVD 3WFEC 3VYIA 1H32B 1R5SA 1S4XA 4FB1A 3M97X 3C1LA 1I54A 2V07A 2FXPA 3L70G 1QL1A 1FDOA 3JCUH 1NTZD 5APQA 4WVZA 3HUSB 1SFCD 2CK3H 5CIEB 2HFED 1VQOP 4IFDK 3CYTI 1CCRA 1YHQP 2XDJA 1QL4A 3H1KG 1GQ1A 2E74C 1KX2A 2MTAC 1YFCA 4U3FJ 3CCUP 1OX3A 2KSJA 2B10B 2IBZI 1SQVD 3H1KD 4WQCA 3O6QB 3M0AA 4RKUJ 3JBTB 2V08A 3II6A 3L71D 1PGJA 1M56D 1N8RQ 4NFGB 2E43A 2K88A 4N78D 2XKMA 3O0RC 1OWAA 1H8AA 1EXJA 3IR9A 3FXEA 1MKMA 2LXBA 3F89A 2B87B 4C7RA 1E29A 1PZQA 4WY4C 4C7NA 3G4SP 2N9JA 2JR8A 3RK3D 1M70A 1HUCA 1RF0A 3RMZA 2P58A 3F5HA 3U59A 3KZIH 1FOSE 2HYNA 1GTWA 1FJKA 2CXBA 2E76B 2KZIA 1FC2C 1KILD 3KZIE 1HROA 1CI6A 1BGYG 4Y99B 2C9NY 1KIBA 1NTMG 3WUTA 5CCHD 1KV4A 1LTJA 2MJZA 5KLVG 1IZNB 1VQ7P 3CCQP 1DVVA 1N7SB 2GA1A 2ZXEB 4YTPC 5KLIB 2ZYGA 1U7MA 3LIDA 3H1KJ 1BCCJ 1BGYJ 5AVVB 1OAEA 1VQ8P 2C1UA 1YTZI 2BH4X 3A0HH 1VQ6P 1CRIA 2D2CC 2HG5D 1LT1A 2E76D 3H1IJ 3R4YA 2PACA 1HJ5A 5EXQA 3VNWA 2E74B 1L0ND 1WVEC 3VMXA 1AOQA 1N2DC 1N7LA 2WPQA 5H2FV 4AUWA 1CYCA 3Q2YA 2H43A 3DP5A 2W6BA 4U3FE 4IFFA 1IFIA 4XA4A 2H88C 1L0NJ 1CIGA 3Q5PA 1GD2E 4OVNF 2WVRA 2HPCB 3CX5W 2NPSB 4R4MA 1JTHB 4IFMA 1M57D 5CYTR 1HH0A 1XTCC 5APYA 1MFTA 2J59M 1UIIA 1X0TA 3PP5A 1K9MQ 3AE2C 1GK6A 2WPRA 5AW5B 2OGUA 4AAOA 4XE5B 1KMIZ 2JP3A 3CCMP 3O6QA 1HWTC 2FY8A 4WQBA 1COTA 2QRXA 1S5LV 3L4OA 2Q1KA 1JO5A 1SFCB 1CIEA 2PP6A 3G3ZA 3WUUA 2WPVB 4IL6E 1YNRA 2ZONG 3S4RA 1QL2A 5AW9B 3FX0A 2I8FA 1S1CX 2FXMA 2BCCJ 1KQSO 4JYCA 2QVAA 2WSEJ 3CCVP 1FOSF 2XV5A 2FYUK 1T6AA 4DCKA 4EDFA 2R32A 2N3YA 5TJHA 2QM8A 1M60A 3CXHE 5E79V 2H8PD 1EDKA 1CSUA 3VMAA 1NAYA 3PH0A 1NTKE 1LWUC 2P1JA 3MUDA 4EICA 1SVFA 2OYIA 3PXWA 1GDTA 1NVOA 2LR2A 1N7SA 1F1CA 3MK7C 5APUA 1RAPA 3RL0C 1RE3C 4TLFA 3RGUA 1MZ4A 1XTGB 1L0LE 3IAOA 1KQLA 4H13B 2Y0DA 1M90Q 2FYUJ 1Y8AA 4OGQC 4GOEA 1IO4A 3HD7A 1PIXA 3V2RA 1A02J 2IDBA 1H33A 3HQ6A 2CE0A 1OIPA 2P2UA 3L72G 1VYDA 4GKGA 1RF1B 5GTHE 1FZAA 1LJ2A 1VQPP 2HODA 1BSHA 3WU2E 3GMAA 1P84I 1PPJE 4L75A 1H31A 1ZW0A 3TDKA 1HJ3A 2HPCA 2D0WA 3TNUB 2N1TB 3H1LG 1JTHA 1NNOA 3M9QA 1CTJA 2FFDC 2ZAEB 1KORA 3NBTA 4UB8H 1JUNA 3L73G 3OCDA 4EIDA 2Q5UA 4WQ7A 2E76C 1T2KD 3JC22 3M0DC 1IFDA 4DOJA 2J58A 1EZVD 2N18B 5APSA 2E42A 5KAFE 2Z5IA 1SQQG 1VDFA 1CEDA 1KB9H 2AXTV 4H44B 1PP9G 4WQAA 4ASVA 3HQ7A 2WSEH 3M9BA 1YTZT 3PXSA 4AAMA 1J3SA 2QJYC 2FKWB 1LC2A 2M3EA 2JEEA 2K1AA 1LTGC 3MTUE 4AANA 4EYYQ 2H89C 1OVRA 1Q81Q 5AVZB 3CCSP 1FZGA 1DW0A 1LTIC 1P84H 1I8OA 1DD4A 3L73E 2A45I 3H32B 2O1JA 2QJKB 3CX5E 2YKQA 3P8CE 1RZ5A 1SQVK 2KB7P 1UIXA 2XTSB 3OW2O 5CCGA 3V6IA 1GIWA 2B0ZB 4M3LA 2BCNB 4RO0A 3L72D 5CBOA 1G2CA 3WC8A 4WB4A 1L4AC 3T97A 1ZN5A 4C7NB 3H1IE 3WUVA 1OVUA 1K3GA 1NTKD 2WSFJ 2FXOA 1L0LK 1OW8A 1SLQA 2C9LY 3CP5A 2B89A 5GTIV 4H0JA 1H33B 1CI6B 2W27A 3ITKA 1YJWP 2E74D 1CO6A 4KJMA 4ZKPA 4U7JA 3D70A 3WFCC 1SQXE 4DZOA 4AQRD 3IFMA 1I6DA 3WFDC 1Y47A 3HE5A 5KLVJ 1MUUA 1NJIQ 2IPPA 3B5NB 5KKZC 1W5CE 3PHLA 1H31B 4JF7A 4OWFA 2E5YA 1NTZG 1LP1B 2H7HA 1JY3O 1EXIA 1SQQD 2XNXA 3A0HE 1M1JA 3OAKA 2E75C 3RK2C 3AE3C 5AVWB 1PPJD 1ETPA 4PD4H 4D6TJ 4W7ZA 2LKMA 4U3FD 5B6QA 3BCCE 2ZOOA 1AKKA 5APVA 2JKVA 3RBXA 2M3BA 3L73J 1C52A 1DEEG 2QG4A 1GKSA 3PRJA 5APTA 4PD4I 1L9BC 2LITA 4K3AA 2ZYAA 3L71J 2AEJA 4HJGH 1R5LA 1YYCA 2YKOA 2QJPB 3HUSA 1YITP 2B9BA 3BVHA 2BASA 3H1HG 1SQQE 3H32A 3ZOWA 1OMIA 3DR0A 3WU2H 1PV3A 2XZRA 5KAFV 1VF5D 2IBZG 4LGDE 3V2QA 1QLED 1KILA 1CRHA 1L4AA 4GDOA 2FBWC 4L3GA 3RK3B 2JWAA 1S5LE 2P67A 3CI9A 1FJPA 4H0LC 1T8ZA 1OCDA 2AXTH 5CBNA 1A2SA 4IL6X 1N7SC 2AXTE 1RAQA 1LWUB 2P10A 1RE3A 2IFNA 1CCHA 5KLIC 1KB0A 5KAFH 1VQ4P 1HRCA 4UB8V 4W80A 2SPZA 2VRSA 2E75D 3CC2P 3W68A 1SQPE 3VMZA 2B87A 2YXRB 4RESB 3CX5D 2DVHA 4I7ZB 3IN6A 1X9VA 2ZZS1 1BE3E 1GJQA 2O01J 1NTMJ 3SWKA 1N50A 3G71P 3EFGA 5IY51 3NWVA 4NPEA 4DT0A 4R4LA 1NU1J 1HGZA 3CWBJ 4HH2A 1LTJB 1QVGO 1FHBA 3AEEC 2FFDA 4UB6E 1ZR4A 3A2AA 1SQXD 1SQPD 3BASA 4P4QB 4O1WA 3L36A 2IYPA 3USSA 3A9FA 1LT9A 1CW5A 1FE6A 1N86A 2KZJA 1CHHA 1L0NK 1CORA 2YQBA 3WUIA 1YQ3C 5GTIE 1SQBJ 3FXDA 3SFDC 1S5LX 1JCCA 4OH8B 2RN0A 5DJUB 1PP9D 2WT7A 3L70E 2C0WA 1A02F 5M1BA 3CU4A 1LS9A 3L74G 4N0KA 2V7QH 5KAIE 3HQ9A 4WY4A 3G6EP 3ZIYA 1JY2O 1KILC 1EC5A 1U57A 3S9OA 1E5WA 1JY2N 1EZVE 4BRYA 1URQD 3NBSA 2GUSA 2NPSA 4GIFA 3RN1A 3H1LJ 3B8EB 4OGQB 1NYHA 3CXHW 4RJTA 1I5TA 3L71G 2GB8B 5APWA 5AW4B 1KILB 1GL2B 1NTZK 2CPSA 1KYOD 3H1JE 2KSEA 1YI2P 4IL6V 1KQGB 3EWKA 4K3IA 1MZ9A 1W5CT 2JQRA 1KC8Q 2OYIC 1IRWA 3KPEA 351CA 4WQEA 3B5ND 1YQ4C 2B88A 3AEGC 4U3FG 4MU8A 1YIQA 1A8CA 4DJGA 3E7KA 1FI9A 3JCUE 2E5TA 2OZ1A 1BL9A 4RSZA 2BCCG 1FJ0A 2WPSA 2KLUA 1ZZHA 1NTKJ 1N73C 3AEAC 2IZ1A 2Q6QA 3W67A 3CXHH 1SQVJ 4DY9A 2Y9YA 1IZL0 1DW1A 1NAFA 1CIHA 1G2CB 2KLVA 5K5GB 1SS1A 1IFPA 1RE4A 1W2BO 1QL3A 1URQB 3C8VA 5CIHB 4H44D 1BCCG 1N73A 5DFSA 3HRNA 1NMIA 1L9JC 1E79H 1KTMA 1YICA 3HQ8A 2CPBA 2Q9IA 3V4WA 2WWWA 1T3JA 1URQC 1NU1G 3OA7A 2R3CA 1NKNA 3ABVC 3HD7D 3Q1MA 1QGKB 1K73Q 1EQ7A 4I6MC 5BU5A 1NKZB 4XYDB 5KLVK 4WWIA 4PJ0V 1WT6A 5DF5A 2QIWA 5KJ7C 3GG2A 4YPCA 2WT7B 3H6PA 3HD7C 1L0NE 3L75G 1K04A 5L8RJ 3SFEC 3KZIV 1U75B 3V4QA 1YCCA 1SQQK 3L35A 2KIKA 2WZ7A 3PJSK 4AALA 1DIQC 2FWLA 3HE4B 3L74J 3RN0A 4BRYB 4UB8E 4QAOA 1EB7A 4A7PA 1C6SA
chains in the Genus database with same CATH topology
3VYMA 5KKZB 1E8EA 5KLVD 155CA 3WFEC 1H32B 1K3GA 1NTKD 4H0KA 4FB1A 3M97X 1I54A 2N9YB 2V07A 1CRJA 2MHMA 1FI7A 3CP5A 1NTZD 5GTIV 4H0JA 4EIFA 1H33B 1DIIC 3ITKA 1NTMD 2FYNB 4D6TD 1CRYA 2ZXYA 5CIEB 1H9YA 5CIGB 1CO6A 3CYTI 1CCRA 1N15A 1QL4A 2EXVA 3WFCC 1CSXA 1GQ1A 2KS1A 2Y0CA 1KX2A 1HCMA 2MTAC 1CXAA 1I6DA 3KHUA 3WFDC 1B7VA 2C8SA 5CICB 2Q3EA 1YFCA 3OA8A 4O1QA 1K3HA 2LIRA 3PHLA 4JCGA 1H31B 2B10B 3PTZA 1I8PA 1CNOA 4PD4D 2Y0EA 1C6OA 3H1HD 1SQVD 2L91A 1FI3A 3H1KD 4WQCA 3JBTB 2V08A 2AIUA 3L71D 1SQQD 1S6VB 3SJLA 1KB9D 4NFGB 1CIFA 5DJQC 3O0RC 1CYIA 4FAVA 1PPJD 1ETPA 2L4DA 1CC5A 4U3FD 3A0HV 5B6QA 2ZOOA 1AKKA 1E29A 1HJ4A 2N9JA 1C52A 1M70A 3PXTA 2QG4A 3H1ID 1BE3D 1H1OA 1MG2D 4WQ8A 3RMZA 1GKSA 4WQDA 5C9MA 3PRJA 2C1DB 1L9BC 1JDLA 2CXBA 2LITA 1RZ6A 3SVWA 1LMSA 2DGEA 3L4MA 1HROA 2QJPB 4WQ9A 1QKSA 1CRCA 1KIBA 1SQBD 3ZOWA 5C0ZA 4FA4A 3DR0A 1W2LA 2ORLA 5KAFV 1E2RA 1QYZA 1DVVA 1GU2A 1CRHA 4L3GA 5KLIB 2JWAA 2FYUD 3RLMA 1IO3A 3ZBMA 1OAEA 1C2NA 1OCDA 2C1UA 2BH4X 1CRIA 3L73D 1FCDC 1A2SA 2YCCA 1NU1D 2B11B 1RAQA 1GDVA 2PACA 1HJ5A 1BGYD 1P84D 5EXQA 3VNWA 3SLEA 1CCHA 1L0ND 2B12B 1KB0A 1WVEC 1C6SA 1ZRTD 4XXLA 1LC1A 1HRCA 3L75D 1AOQA 4UB8V 5H2FV 1CYCA 3DP5A 5KAIV 4GEDB 1IRVA 4PWAA 1HZVA 2YIUB 3CX5D 2DVHA 4YE1A 1CIGA 2ZZS1 3ZOXA 1GJQA 3CX5W 4Q5PA 3A0BV 2N9IA 3O20A 1DW3A 1N50A 5CYTR 1FOCA 1MG3D 5TISV 2CA3B 3ZCFA 5IY51 3NWVA 3OCDB 2BCCD 2GIWA 3O1YA 3GW6A 4AAOA 2D0SA 1FHBA 4UB6V 2C9XB 5B5EV 4FA5A 1AOFA 4WQBA 1COTA 1SQXD 1S5LV 1SQPD 3L4OA 3H1LD 4P4QB 4O1WA 3A9FA 1AYGA 1CIEA 1CHHA 1N9CA 1CORA 1YNRA 2ZONG 2YQBA 3WUIA 2I8FA 1DW2A 5CIDB 2C1VA 3C2CA 2K9JB 2RMZA 2RN0A 1PP9D 2N18C 4EDFA 1CSVA 5B66V 2N3YA 1KYOW 3CU4A 1LS9A 4N0KA 1YTCA 5TJHA 2YK3A 3PLNA 1M60A 2N3BA 3HQ9A 3VRDA 2ZBOA 3ZOYA 1I55A 1NIRA 5E79V 3WU2V 1CSUA 1YEBA 3VMAA 4EIEA 3ZIYA 3MK7B 1KV9A 4EICA 1CTZA 2QJYB 2GC7D 3PXWA 3NBSA 2AI5A 3RN1A 2BPBB 1CXCA 2PCBB 3CXHW 4RJTA 1I5TA 2CE1A 1F1CA 2GB8B 3MK7C 1KYOD 1RAPA 1MZ4A 4IL6V 2O3JA 3DMIA 4K3IA 3ZOOA 1C2RA 2BGVX 1CRGA 1W5CT 2JQRA 4KMGA 2Y0DA 2C2CA 3BCCD 1IRWA 1BCCD 351CA 4WQEA 3O5CA 3CXHD 4MU8A 4PW9B 1YIQA 1H33A 1A8CA 4LJIA 3HQ6A 2CE0A 1FI9A 2OZ1A 2IBZD 1BL9A 4RSZA 3TYIA 1FJ0A 1VYDA 1ZZHA 1CHJA 3OA8B 4DY9A 1H31A 1DT1A 1IZL0 3TDKA 1DW1A 2JTIB 1CIHA 1HJ3A 1M6ZA 4FANA 3SWSA 1L0LD 2D0WA 1LFMA 4L3HA 1U74B 1NNOA 3TF5A 1CTJA 1QL3A 3NBTA 5CIHB 3OCDA 2PCCB 2CA4B 4EIDA 1N90A 4WQ7A 5DFSA 1QN2A 1I6EA 1H32A 1L9JC 1NMIA 1WEJF 1YICA 2BH5X 1HH7A 1EZVD 3X39A 2N18B 2A06D 3HQ8A 1C75A 3CWBD 2BLFB 2B4ZA 1C6RA 1CEDA 3L74D 5GTHV 2AXTV 1R0QA 451CA 4L1QA 3H1JD 3SXTA 4WQAA 3HQ7A 2KNCB 3PXSA 2C1DA 4Y5RA 4AAMA 1J3SA 5AURA 1LC2A 4XYDB 2HV4A 4PJ0V 4AANA 1H9XA 5DF5A 4V2KA 5CIBB 5DJQB 1CHIA 2FRCA 2GC4D 4FA1A 1CSWA 3GG2A 1DW0A 1I8OA 1CTYA 2OZ1B 1DVHA 2QJKB 1RZ5A 2XTSB 3ORVA 1KX7A 3KZIV 1C7MA 1U75B 1CYJA 1YCCA 4J20A 3PH2B 3FWLA 1NMLA 1GIWA 2B0ZB 4AALA 4AX3A 1DIQC 4GYDA 1YEAA 2FWLA 2VHDA 3RN0A 2BCNB 4QAOA 1HZUA 3TGUD 1IQCA 3L72D 1EB7A 1F1FA 3L70D 5CIFB 3WFBC 4A7PA 1A56A 4FA9A 3WC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYM A;  5KKZ B;  1E8E A;  5KLV D;  155C A;  3WFE C;  1H32 B;  1K3G A;  1NTK D;  4H0K A;  4FB1 A;  3M97 X;  1I54 A;  2N9Y B;  2V07 A;  1CRJ A;  2MHM A;  1FI7 A;  3CP5 A;  1NTZ D;  5GTI V;  4H0J A;  4EIF A;  1H33 B;  1DII C;  3ITK A;  1NTM D;  2FYN B;  4D6T D;  1CRY A;  2ZXY A;  5CIE B;  1H9Y A;  5CIG B;  1CO6 A;  3CYT I;  1CCR A;  1N15 A;  1QL4 A;  2EXV A;  3WFC C;  1CSX A;  1GQ1 A;  2KS1 A;  2Y0C A;  1KX2 A;  1HCM A;  2MTA C;  1CXA A;  1I6D A;  3KHU A;  3WFD C;  1B7V A;  2C8S A;  5CIC B;  2Q3E A;  1YFC A;  3OA8 A;  4O1Q A;  1K3H A;  2LIR A;  3PHL A;  4JCG A;  1H31 B;  2B10 B;  3PTZ A;  1I8P A;  1CNO A;  4PD4 D;  2Y0E A;  1C6O A;  3H1H D;  1SQV D;  2L91 A;  1FI3 A;  3H1K D;  4WQC A;  3JBT B;  2V08 A;  2AIU A;  3L71 D;  1SQQ D;  1S6V B;  3SJL A;  1KB9 D;  4NFG B;  1CIF A;  5DJQ C;  3O0R C;  1CYI A;  4FAV A;  1PPJ D;  1ETP A;  2L4D A;  1CC5 A;  4U3F D;  3A0H V;  5B6Q A;  2ZOO A;  1AKK A;  1E29 A;  1HJ4 A;  2N9J A;  1C52 A;  1M70 A;  3PXT A;  2QG4 A;  3H1I D;  1BE3 D;  1H1O A;  1MG2 D;  4WQ8 A;  3RMZ A;  1GKS A;  4WQD A;  5C9M A;  3PRJ A;  2C1D B;  1L9B C;  1JDL A;  2CXB A;  2LIT A;  1RZ6 A;  3SVW A;  1LMS A;  2DGE A;  3L4M A;  1HRO A;  2QJP B;  4WQ9 A;  1QKS A;  1CRC A;  1KIB A;  1SQB D;  3ZOW A;  5C0Z A;  4FA4 A;  3DR0 A;  1W2L A;  2ORL A;  5KAF V;  1E2R A;  1QYZ A;  1DVV A;  1GU2 A;  1CRH A;  4L3G A;  5KLI B;  2JWA A;  2FYU D;  3RLM A;  1IO3 A;  3ZBM A;  1OAE A;  1C2N A;  1OCD A;  2C1U A;  2BH4 X;  1CRI A;  3L73 D;  1FCD C;  1A2S A;  2YCC A;  1NU1 D;  2B11 B;  1RAQ A;  1GDV A;  2PAC A;  1HJ5 A;  1BGY D;  1P84 D;  5EXQ A;  3VNW A;  3SLE A;  1CCH A;  1L0N D;  2B12 B;  1KB0 A;  1WVE C;  1C6S A;  1ZRT D;  4XXL A;  1LC1 A;  1HRC A;  3L75 D;  1AOQ A;  4UB8 V;  5H2F V;  1CYC A;  3DP5 A;  5KAI V;  4GED B;  1IRV A;  4PWA A;  1HZV A;  2YIU B;  3CX5 D;  2DVH A;  4YE1 A;  1CIG A;  2ZZS 1;  3ZOX A;  1GJQ A;  3CX5 W;  4Q5P A;  3A0B V;  2N9I A;  3O20 A;  1DW3 A;  1N50 A;  5CYT R;  1FOC A;  1MG3 D;  5TIS V;  2CA3 B;  3ZCF A;  5IY5 1;  3NWV A;  3OCD B;  2BCC D;  2GIW A;  3O1Y A;  3GW6 A;  4AAO A;  2D0S A;  1FHB A;  4UB6 V;  2C9X B;  5B5E V;  4FA5 A;  1AOF A;  4WQB A;  1COT A;  1SQX D;  1S5L V;  1SQP D;  3L4O A;  3H1L D;  4P4Q B;  4O1W A;  3A9F A;  1AYG A;  1CIE A;  1CHH A;  1N9C A;  1COR A;  1YNR A;  2ZON G;  2YQB A;  3WUI A;  2I8F A;  1DW2 A;  5CID B;  2C1V A;  3C2C A;  2K9J B;  2RMZ A;  2RN0 A;  1PP9 D;  2N18 C;  4EDF A;  1CSV A;  5B66 V;  2N3Y A;  1KYO W;  3CU4 A;  1LS9 A;  4N0K A;  1YTC A;  5TJH A;  2YK3 A;  3PLN A;  1M60 A;  2N3B A;  3HQ9 A;  3VRD A;  2ZBO A;  3ZOY A;  1I55 A;  1NIR A;  5E79 V;  3WU2 V;  1CSU A;  1YEB A;  3VMA A;  4EIE A;  3ZIY A;  3MK7 B;  1KV9 A;  4EIC A;  1CTZ A;  2QJY B;  2GC7 D;  3PXW A;  3NBS A;  2AI5 A;  3RN1 A;  2BPB B;  1CXC A;  2PCB B;  3CXH W;  4RJT A;  1I5T A;  2CE1 A;  1F1C A;  2GB8 B;  3MK7 C;  1KYO D;  1RAP A;  1MZ4 A;  4IL6 V;  2O3J A;  3DMI A;  4K3I A;  3ZOO A;  1C2R A;  2BGV X;  1CRG A;  1W5C T;  2JQR A;  4KMG A;  2Y0D A;  2C2C A;  3BCC D;  1IRW A;  1BCC D;  351C A;  4WQE A;  3O5C A;  3CXH D;  4MU8 A;  4PW9 B;  1YIQ A;  1H33 A;  1A8C A;  4LJI A;  3HQ6 A;  2CE0 A;  1FI9 A;  2OZ1 A;  2IBZ D;  1BL9 A;  4RSZ A;  3TYI A;  1FJ0 A;  1VYD A;  1ZZH A;  1CHJ A;  3OA8 B;  4DY9 A;  1H31 A;  1DT1 A;  1IZL 0;  3TDK A;  1DW1 A;  2JTI B;  1CIH A;  1HJ3 A;  1M6Z A;  4FAN A;  3SWS A;  1L0L D;  2D0W A;  1LFM A;  4L3H A;  1U74 B;  1NNO A;  3TF5 A;  1CTJ A;  1QL3 A;  3NBT A;  5CIH B;  3OCD A;  2PCC B;  2CA4 B;  4EID A;  1N90 A;  4WQ7 A;  5DFS A;  1QN2 A;  1I6E A;  1H32 A;  1L9J C;  1NMI A;  1WEJ F;  1YIC A;  2BH5 X;  1HH7 A;  1EZV D;  3X39 A;  2N18 B;  2A06 D;  3HQ8 A;  1C75 A;  3CWB D;  2BLF B;  2B4Z A;  1C6R A;  1CED A;  3L74 D;  5GTH V;  2AXT V;  1R0Q A;  451C A;  4L1Q A;  3H1J D;  3SXT A;  4WQA A;  3HQ7 A;  2KNC B;  3PXS A;  2C1D A;  4Y5R A;  4AAM A;  1J3S A;  5AUR A;  1LC2 A;  4XYD B;  2HV4 A;  4PJ0 V;  4AAN A;  1H9X A;  5DF5 A;  4V2K A;  5CIB B;  5DJQ B;  1CHI A;  2FRC A;  2GC4 D;  4FA1 A;  1CSW A;  3GG2 A;  1DW0 A;  1I8O A;  1CTY A;  2OZ1 B;  1DVH A;  2QJK B;  1RZ5 A;  2XTS B;  3ORV A;  1KX7 A;  3KZI V;  1C7M A;  1U75 B;  1CYJ A;  1YCC A;  4J20 A;  3PH2 B;  3FWL A;  1NML A;  1GIW A;  2B0Z B;  4AAL A;  4AX3 A;  1DIQ C;  4GYD A;  1YEA A;  2FWL A;  2VHD A;  3RN0 A;  2BCN B;  4QAO A;  1HZU A;  3TGU D;  1IQC A;  3L72 D;  1EB7 A;  1F1F A;  3L70 D;  5CIF B;  3WFB C;  4A7P A;  1A56 A;  4FA9 A;  3WC8 A; 
#chains in the Genus database with same CATH topology
 3VYM A;  2QA4 P;  1W2E A;  5B66 E;  1IFN A;  3H1K E;  4H0K A;  3TGU G;  1T3U A;  2R5B A;  1CRJ A;  3CMA P;  1FI7 A;  2L5G B;  2YO3 A;  3GF7 A;  3GHG B;  2A45 G;  2RKL A;  1DII C;  3H1J G;  2IZ0 A;  3A0B E;  5CIG B;  2UWJ E;  5AVQ B;  1N15 A;  4PJ0 E;  3AE7 C;  3KDP B;  2KS1 A;  3AE1 C;  2Y0C A;  1CXA A;  3KHU A;  1HTL C;  5CIC B;  4EI2 A;  3OA8 A;  4O1Q A;  1K3H A;  2MKV A;  1NTK G;  1IK7 A;  3PTZ A;  1SQQ J;  4PD4 D;  5CJ0 A;  2OTK E;  1HVV A;  1FI3 A;  4I1L A;  2M5A A;  3H1J J;  1VQ9 P;  5CCG D;  2YIU C;  4H0L D;  1URQ A;  2OYH A;  3CWB G;  2OAR A;  1S6V B;  3SJL A;  1BSN A;  1KB9 D;  4L73 A;  1CIF A;  1SFC A;  1NU1 K;  1GMJ A;  1RH5 B;  1ZR2 A;  1FBM A;  2QEX P;  4BXL A;  4GOF A;  2AEF A;  3CCL P;  1NTK K;  3T97 B;  3L72 J;  2FYU E;  2ZYD A;  1GW4 A;  5AVY B;  3H1I D;  1PGQ A;  1BE3 D;  1H1O A;  1MG2 D;  2OYH C;  4WQD A;  1M1J C;  1RZ6 A;  1EZV I;  1LMS A;  2O01 H;  1HJB A;  1SQV E;  2JO1 A;  1ZRT E;  3UIA A;  4WQ9 A;  1QKS A;  1WRG A;  4H13 C;  2K9Y A;  2IYO A;  1FDM A;  2OYI B;  1SQB D;  1FU1 A;  4FA4 A;  5CCH A;  3RL0 D;  4N78 E;  4MN4 C;  4YXW H;  1QYZ A;  1GU2 A;  5AW1 B;  3CXH I;  5AVT B;  3L75 J;  5CHX A;  3B5N A;  2FYU D;  3RLM A;  1YJ9 P;  2A06 E;  3HE4 A;  1IO3 A;  1RQU A;  1FCD C;  2YMK A;  3H1H E;  2G3A A;  3NFQ A;  3RK3 C;  2B12 B;  1PP9 E;  4BWN A;  1ZRT D;  1LC1 A;  2QJP C;  1FDI A;  2WSC J;  1PGP A;  3L75 D;  1GW3 A;  1VQK P;  2YMY A;  2O1K A;  2GUV A;  3TK1 A;  2IX7 C;  3SSU A;  1G1I A;  1GU5 A;  3RL0 B;  1IRV A;  3A0B H;  4PWA A;  1HZV A;  2YIU B;  3BCC G;  3FGA D;  4B86 A;  2ITA A;  1LTA C;  1K8A Q;  3SWF A;  4YE1 A;  4C46 A;  5GTH H;  1OXZ A;  2R5D A;  5KLV E;  2N9I A;  3RK2 B;  3N7N A;  1DW3 A;  3HTK A;  2M8R A;  1MG3 D;  5TIS V;  1KYO E;  3L4F A;  1N7S D;  2ZT9 D;  1GL2 A;  1DX7 A;  3OCD B;  3VMY A;  2NPS D;  2WTY A;  1NTZ E;  2GIW A;  1L4A D;  4NPD A;  3O1Y A;  1SQV G;  1Y9B A;  5AW6 B;  2GM4 A;  1J1D C;  2C9X B;  2I1K A;  4FA5 A;  4GT1 A;  3BAT A;  4LLH A;  4N6J A;  1QEX A;  1AYG A;  1JNM A;  3TYY A;  1SQX G;  4I7Z C;  3GLM A;  1H89 A;  1N9C A;  1FZC C;  2AEM A;  2WIT A;  5CID B;  2C1V A;  3D71 A;  1KYO I;  3AED C;  3C9I A;  2N18 C;  3ZDM A;  1AFO A;  1S9K E;  1BDC A;  3L71 E;  4O9B A;  5B66 V;  2IFM A;  3M0D A;  1YTC A;  3PLN A;  3VRD A;  2ZBO A;  3ZOY A;  1Z56 A;  1I55 A;  3MD0 A;  1NIR A;  3WU2 V;  1M7L A;  3AE8 C;  3CX5 H;  3D6Z A;  1X79 B;  4K35 A;  1AJY A;  1CTZ A;  2QJY B;  1H0T B;  2GC7 D;  5DJT B;  5AVR B;  4JBZ A;  2N1T D;  3L74 E;  3K5B A;  2CE1 A;  2KYV A;  3CPW O;  1JY2 P;  2O3J A;  1KIL E;  2W90 A;  3U1A A;  2Q3I A;  2K37 A;  1C2R A;  1CRG A;  2XND H;  1JEK A;  4HB1 A;  1FS0 E;  2FFD B;  2C2C A;  1BCC D;  1AQT A;  3RK3 E;  3CXH D;  1SQB K;  1VL2 A;  4PW9 B;  4ASW A;  2V7Q J;  5E79 H;  2W83 C;  1SQP G;  1AVO A;  1CSB A;  5KJ7 D;  3MZW B;  2P7J A;  4WY4 D;  3TYI A;  1JY3 P;  1RQV A;  4IOI H;  1YIJ P;  3BRV B;  1MFZ A;  2ZJS E;  2JTI B;  5B5E H;  2KP8 A;  3G9R A;  1S72 P;  1M6Z A;  1OW6 A;  1L0L D;  2JWD A;  1RF1 C;  1LFM A;  1L0N G;  3L75 E;  1U74 B;  3GHG C;  1LP1 A;  1S5L H;  3HTK B;  4I2L C;  1BCC E;  5CJ4 A;  2PCC B;  3VP9 A;  2CA4 B;  1N90 A;  1M1J B;  1M8O B;  2KOG A;  1QN2 A;  1I6E A;  1H32 A;  1WEJ F;  1CZQ A;  1HH7 A;  3X39 A;  1RF0 C;  1K05 A;  3H25 A;  3N4X A;  1RHZ B;  2Q7C A;  2BLF B;  3RBZ A;  2B4Z A;  2WSS H;  1PPJ G;  3P32 A;  1ZP0 C;  1VQL P;  3GHG A;  1R0Q A;  4L1Q A;  3H1J D;  1S2E A;  3SXT A;  1X8Y A;  1GL2 D;  1USE A;  3L72 E;  3I5C A;  1OFC X;  2C1D A;  5AUR A;  3TGU J;  1D7M A;  3L70 J;  4V2K A;  5CIB B;  2N1T C;  5DJQ B;  3E1I A;  1CHI A;  2GC4 D;  4FA1 A;  4H13 D;  1CSW A;  2BEZ F;  1KN7 A;  3A5T A;  3M06 A;  2ZXX A;  2OZ1 B;  1DVH A;  3L37 A;  1VPC A;  1GK4 A;  2IBZ E;  3AE4 C;  3VP8 A;  3Q3D A;  2YNY A;  3AE5 C;  4WBA A;  3ORV A;  1KX7 A;  2M5A B;  5KTB A;  2POH A;  1C7M A;  1BE3 J;  2K3R A;  1CYJ A;  4J20 A;  1NTM E;  3V2N A;  1L4A B;  1NML A;  2OYH B;  3AEC C;  1L0L J;  3LW5 H;  4GYD A;  1YEA A;  1KYO H;  3NMD A;  1HZU A;  1IQC A;  1S9K D;  5CIF B;  4FA9 A;  1S3J A;  1LWU A;  5AVU B;  2PGD A;  3O8Z A;  5KKZ B;  3B5N C;  3V5B A;  1N73 B;  1TU3 F;  1E8E A;  1JMM A;  1Q2N A;  155C A;  3HUS C;  1ZV8 A;  2N9Y B;  3GF3 A;  3P8C D;  3EFF K;  2MHM A;  1QX8 A;  3V2P A;  1L0L G;  2BEQ D;  3LIE A;  4PV1 D;  4EIF A;  2WSC H;  4QMA A;  3I55 P;  1KD1 Q;  5TIS E;  1NTM D;  1NOH A;  2FYN B;  1SQB E;  4D6T D;  3MIW A;  1CRY A;  1Q90 D;  1IFJ A;  2ZXY A;  2KNC A;  1H9Y A;  3M9H A;  2EXV A;  1CSX A;  5AVS B;  1WMK A;  3VN0 A;  1RF1 A;  1EDL A;  1HCM A;  2QE7 H;  1EZV G;  1B7V A;  3AEF C;  2C8S A;  2YO2 A;  5B5E E;  2Q3E A;  4OGQ D;  4HYT B;  2LIR A;  3Q5S A;  4JCG A;  4D6T G;  4AYC A;  1I8P A;  1CNO A;  1L2P A;  2W6A A;  2Y0E A;  5BU8 B;  1C6O A;  3H1H D;  1LT9 C;  2L91 A;  3D6Y A;  2R3S A;  1JY3 N;  5KJ7 A;  2OQQ A;  2AIU A;  1PGO A;  1SQB G;  3KYQ A;  1JM0 A;  5DJQ C;  1OVV A;  2G8Y A;  4JPZ B;  1DD3 A;  1CYI A;  1RE4 C;  4FAV A;  1ZME C;  1HGV A;  3MGN A;  2PRR A;  3TGU E;  2L4D A;  4L76 A;  1CC5 A;  3H1H J;  3P8M C;  3A0H V;  1NWQ A;  3CCR P;  3H1I G;  1HJ4 A;  2ZFC A;  3PXT A;  4Y99 C;  1FZC A;  1KFN A;  1ZXG A;  4WQ8 A;  2WQY C;  5C9M A;  3AE9 C;  1FZE A;  5E79 E;  2C1D B;  1DH3 A;  3S1K A;  1JDL A;  3SVW A;  1P84 E;  3OJA B;  3CME P;  2DGE A;  3L4M A;  1H88 A;  1CRC A;  3B4S A;  2KK7 A;  1NH4 A;  3QH9 A;  4H44 C;  1Q86 Q;  5C0Z A;  4Z1M H;  1W2L A;  2ORL A;  4KT0 J;  2E75 B;  2KS1 B;  1E2R A;  3IF4 A;  1M1K Q;  2NRG A;  1OW7 A;  3P7K A;  1QVF O;  3ZBM A;  1C2N A;  1JCD A;  5EFW B;  3TSI A;  3FWN A;  3L73 D;  5C39 A;  2YCC A;  1NU1 D;  4GOD A;  1PL5 A;  2B11 B;  1T2K C;  1VF5 C;  1GDV A;  1BGY D;  1P84 D;  3SLE A;  1HBW A;  2ZT9 B;  1PFI A;  4XXL A;  5AVX B;  3VTP C;  3MUD C;  2A45 H;  4XFJ A;  3EQ2 A;  1SQX J;  1HJ0 A;  5KAI V;  2RH0 A;  1VF5 B;  2NPS C;  4GED B;  3U1C A;  1NGM B;  1RY3 A;  2A06 G;  2AXC A;  3E1R A;  4CPG A;  2HLO A;  2KXP B;  2ZVN B;  2FYZ A;  2KI7 B;  2Z4E A;  3CCE P;  3ZOX A;  4TT3 H;  4ZMD A;  2C0X A;  4H0L B;  2YXQ B;  4Q5P A;  1X22 A;  3A0B V;  3O20 A;  1J1D B;  2QM7 A;  1R8E A;  1FOC A;  2CA3 B;  4ZKU A;  3CC4 P;  3ZCF A;  4NPF X;  2BCC D;  3CX5 I;  1BGY E;  1KZU B;  4PV1 B;  5AW8 B;  3BRT B;  3GW6 A;  1OZH A;  2OYO A;  2D0S A;  1Q82 Q;  4UB6 V;  1EDI A;  4D6T E;  1VQN P;  5B5E V;  1AVY A;  2V4H A;  1AOF A;  3NTN A;  1DIP A;  2D2C D;  3H1L D;  1DEB A;  2FYU G;  5GTI H;  4EOT A;  1NHL A;  2Z5H A;  1IK9 A;  1DW2 A;  3C2C A;  3CL3 D;  2K9J B;  4N3Y B;  5AW2 B;  2RMZ A;  1IJD B;  1IC2 A;  1FZC B;  1KB9 I;  1CSV A;  1KYO W;  2Y9Z A;  5TIS H;  1LTJ C;  1SP4 A;  2YK3 A;  2N3B A;  3TNU A;  3CD6 P;  2N1T A;  3A3Y B;  1YEB A;  4EIE A;  2PAJ A;  3M91 A;  3MK7 B;  1KV9 A;  4L74 A;  2NZ2 A;  4HKZ H;  1LNQ A;  1G1J A;  2AI5 A;  1VQ5 P;  1JB0 J;  2YKP A;  3NXS A;  2BPB B;  1CXC A;  2PCB B;  3AE6 C;  2WSF H;  1JOC A;  1VQM P;  2R44 A;  5AW7 B;  1FZB A;  1FAV A;  3B71 A;  2KUB A;  3DMI A;  3ZOO A;  2BGV X;  5APX A;  1KB9 E;  4KMG A;  1ZLL A;  1PP9 J;  3BCC D;  1IFM A;  1KFM A;  5B66 H;  3A7O A;  1GL2 C;  3O5C A;  4IL6 H;  4PD4 E;  4LJI A;  5CCG C;  2IBZ D;  1YBK A;  4Y28 J;  1MV8 A;  2O01 N;  1ZOY C;  5CMZ A;  1CHJ A;  1J1E C;  2OTL P;  3OA8 B;  1LTB C;  1SQP K;  4PJ0 H;  1NU1 E;  4LC1 A;  2W6J H;  2WMM A;  1DT1 A;  3AEB C;  1LTS C;  3LW5 J;  2JDI H;  3VOP A;  4FAN A;  3SWS A;  1SFC C;  4L3H A;  3QWO C;  3WMM 0;  2J5U A;  1BE3 G;  4W7Y A;  3TF5 A;  2JJL A;  1J1E B;  3JSV C;  2FYN C;  2OTJ P;  2ZVO B;  1J2J B;  3RL0 g;  1Q7Y Q;  2M0B A;  2QJK C;  1USD A;  1NTM K;  1H0T A;  2N9B A;  1GU4 A;  2QSI A;  2BH5 X;  1U7J A;  2A06 D;  3R2P A;  1C75 A;  1AV1 A;  3CWB D;  3CLQ A;  1C6R A;  3L74 D;  5GTH V;  451C A;  3KQG A;  5BVZ A;  4ZNC A;  3CCJ P;  1LT9 B;  1KQF B;  3BCC J;  1HF9 A;  2KNC B;  1SQP J;  2BCC E;  4Y5R A;  4PV1 C;  4JQ0 D;  3HD7 B;  1EDJ A;  2HV4 A;  5AW3 B;  5CCH C;  1H9X A;  2HR3 A;  2LXC B;  3CC7 P;  2FRC A;  2K9J A;  3SWY A;  3HE5 B;  1AQ5 A;  1FZF A;  5KAI H;  1CTY A;  2D2C B;  3MHV A;  3H1L E;  2I1J A;  1JMB A;  2ZT9 C;  2PFX A;  4WY4 B;  3I56 P;  2I8D A;  1SQX K;  2HOD B;  3CWB E;  3PH2 B;  3FWL A;  1GZL A;  3KXD A;  3Q5R A;  1NO4 A;  5H2F H;  4AX3 A;  3D0W A;  4KHX A;  4YXD C;  2VHD A;  5H2F E;  1AA0 A;  3TGU D;  1NTZ J;  5AW0 B;  1F1F A;  3L70 D;  3RK2 D;  3WFB C;  1A56 A;  2XU6 A;  2DW3 A;  1LGH B;  2W8Z A;  1BDD A;  3MP7 B;  4UB6 H;  4EIJ A;  1YJN P;  1LTT C;  4JYB A;  5KLV D;  3WFE C;  3VYI A;  1H32 B;  1R5S A;  1S4X A;  4FB1 A;  3M97 X;  3C1L A;  1I54 A;  2V07 A;  2FXP A;  3L70 G;  1QL1 A;  1FDO A;  3JCU H;  1NTZ D;  5APQ A;  4WVZ A;  3HUS B;  1SFC D;  2CK3 H;  5CIE B;  2HFE D;  1VQO P;  4IFD K;  3CYT I;  1CCR A;  1YHQ P;  2XDJ A;  1QL4 A;  3H1K G;  1GQ1 A;  2E74 C;  1KX2 A;  2MTA C;  1YFC A;  4U3F J;  3CCU P;  1OX3 A;  2KSJ A;  2B10 B;  2IBZ I;  1SQV D;  3H1K D;  4WQC A;  3O6Q B;  3M0A A;  4RKU J;  3JBT B;  2V08 A;  3II6 A;  3L71 D;  1PGJ A;  1M56 D;  1N8R Q;  4NFG B;  2E43 A;  2K88 A;  4N78 D;  2XKM A;  3O0R C;  1OWA A;  1H8A A;  1EXJ A;  3IR9 A;  3FXE A;  1MKM A;  2LXB A;  3F89 A;  2B87 B;  4C7R A;  1E29 A;  1PZQ A;  4WY4 C;  4C7N A;  3G4S P;  2N9J A;  2JR8 A;  3RK3 D;  1M70 A;  1HUC A;  1RF0 A;  3RMZ A;  2P58 A;  3F5H A;  3U59 A;  3KZI H;  1FOS E;  2HYN A;  1GTW A;  1FJK A;  2CXB A;  2E76 B;  2KZI A;  1FC2 C;  1KIL D;  3KZI E;  1HRO A;  1CI6 A;  1BGY G;  4Y99 B;  2C9N Y;  1KIB A;  1NTM G;  3WUT A;  5CCH D;  1KV4 A;  1LTJ A;  2MJZ A;  5KLV G;  1IZN B;  1VQ7 P;  3CCQ P;  1DVV A;  1N7S B;  2GA1 A;  2ZXE B;  4YTP C;  5KLI B;  2ZYG A;  1U7M A;  3LID A;  3H1K J;  1BCC J;  1BGY J;  5AVV B;  1OAE A;  1VQ8 P;  2C1U A;  1YTZ I;  2BH4 X;  3A0H H;  1VQ6 P;  1CRI A;  2D2C C;  2HG5 D;  1LT1 A;  2E76 D;  3H1I J;  3R4Y A;  2PAC A;  1HJ5 A;  5EXQ A;  3VNW A;  2E74 B;  1L0N D;  1WVE C;  3VMX A;  1AOQ A;  1N2D C;  1N7L A;  2WPQ A;  5H2F V;  4AUW A;  1CYC A;  3Q2Y A;  2H43 A;  3DP5 A;  2W6B A;  4U3F E;  4IFF A;  1IFI A;  4XA4 A;  2H88 C;  1L0N J;  1CIG A;  3Q5P A;  1GD2 E;  4OVN F;  2WVR A;  2HPC B;  3CX5 W;  2NPS B;  4R4M A;  1JTH B;  4IFM A;  1M57 D;  5CYT R;  1HH0 A;  1XTC C;  5APY A;  1MFT A;  2J59 M;  1UII A;  1X0T A;  3PP5 A;  1K9M Q;  3AE2 C;  1GK6 A;  2WPR A;  5AW5 B;  2OGU A;  4AAO A;  4XE5 B;  1KMI Z;  2JP3 A;  3CCM P;  3O6Q A;  1HWT C;  2FY8 A;  4WQB A;  1COT A;  2QRX A;  1S5L V;  3L4O A;  2Q1K A;  1JO5 A;  1SFC B;  1CIE A;  2PP6 A;  3G3Z A;  3WUU A;  2WPV B;  4IL6 E;  1YNR A;  2ZON G;  3S4R A;  1QL2 A;  5AW9 B;  3FX0 A;  2I8F A;  1S1C X;  2FXM A;  2BCC J;  1KQS O;  4JYC A;  2QVA A;  2WSE J;  3CCV P;  1FOS F;  2XV5 A;  2FYU K;  1T6A A;  4DCK A;  4EDF A;  2R32 A;  2N3Y A;  5TJH A;  2QM8 A;  1M60 A;  3CXH E;  5E79 V;  2H8P D;  1EDK A;  1CSU A;  3VMA A;  1NAY A;  3PH0 A;  1NTK E;  1LWU C;  2P1J A;  3MUD A;  4EIC A;  1SVF A;  2OYI A;  3PXW A;  1GDT A;  1NVO A;  2LR2 A;  1N7S A;  1F1C A;  3MK7 C;  5APU A;  1RAP A;  3RL0 C;  1RE3 C;  4TLF A;  3RGU A;  1MZ4 A;  1XTG B;  1L0L E;  3IAO A;  1KQL A;  4H13 B;  2Y0D A;  1M90 Q;  2FYU J;  1Y8A A;  4OGQ C;  4GOE A;  1IO4 A;  3HD7 A;  1PIX A;  3V2R A;  1A02 J;  2IDB A;  1H33 A;  3HQ6 A;  2CE0 A;  1OIP A;  2P2U A;  3L72 G;  1VYD A;  4GKG A;  1RF1 B;  5GTH E;  1FZA A;  1LJ2 A;  1VQP P;  2HOD A;  1BSH A;  3WU2 E;  3GMA A;  1P84 I;  1PPJ E;  4L75 A;  1H31 A;  1ZW0 A;  3TDK A;  1HJ3 A;  2HPC A;  2D0W A;  3TNU B;  2N1T B;  3H1L G;  1JTH A;  1NNO A;  3M9Q A;  1CTJ A;  2FFD C;  2ZAE B;  1KOR A;  3NBT A;  4UB8 H;  1JUN A;  3L73 G;  3OCD A;  4EID A;  2Q5U A;  4WQ7 A;  2E76 C;  1T2K D;  3JC2 2;  3M0D C;  1IFD A;  4DOJ A;  2J58 A;  1EZV D;  2N18 B;  5APS A;  2E42 A;  5KAF E;  2Z5I A;  1SQQ G;  1VDF A;  1CED A;  1KB9 H;  2AXT V;  4H44 B;  1PP9 G;  4WQA A;  4ASV A;  3HQ7 A;  2WSE H;  3M9B A;  1YTZ T;  3PXS A;  4AAM A;  1J3S A;  2QJY C;  2FKW B;  1LC2 A;  2M3E A;  2JEE A;  2K1A A;  1LTG C;  3MTU E;  4AAN A;  4EYY Q;  2H89 C;  1OVR A;  1Q81 Q;  5AVZ B;  3CCS P;  1FZG A;  1DW0 A;  1LTI C;  1P84 H;  1I8O A;  1DD4 A;  3L73 E;  2A45 I;  3H32 B;  2O1J A;  2QJK B;  3CX5 E;  2YKQ A;  3P8C E;  1RZ5 A;  1SQV K;  2KB7 P;  1UIX A;  2XTS B;  3OW2 O;  5CCG A;  3V6I A;  1GIW A;  2B0Z B;  4M3L A;  2BCN B;  4RO0 A;  3L72 D;  5CBO A;  1G2C A;  3WC8 A;  4WB4 A;  1L4A C;  3T97 A;  1ZN5 A;  4C7N B;  3H1I E;  3WUV A;  1OVU A;  1K3G A;  1NTK D;  2WSF J;  2FXO A;  1L0L K;  1OW8 A;  1SLQ A;  2C9L Y;  3CP5 A;  2B89 A;  5GTI V;  4H0J A;  1H33 B;  1CI6 B;  2W27 A;  3ITK A;  1YJW P;  2E74 D;  1CO6 A;  4KJM A;  4ZKP A;  4U7J A;  3D70 A;  3WFC C;  1SQX E;  4DZO A;  4AQR D;  3IFM A;  1I6D A;  3WFD C;  1Y47 A;  3HE5 A;  5KLV J;  1MUU A;  1NJI Q;  2IPP A;  3B5N B;  5KKZ C;  1W5C E;  3PHL A;  1H31 B;  4JF7 A;  4OWF A;  2E5Y A;  1NTZ G;  1LP1 B;  2H7H A;  1JY3 O;  1EXI A;  1SQQ D;  2XNX A;  3A0H E;  1M1J A;  3OAK A;  2E75 C;  3RK2 C;  3AE3 C;  5AVW B;  1PPJ D;  1ETP A;  4PD4 H;  4D6T J;  4W7Z A;  2LKM A;  4U3F D;  5B6Q A;  3BCC E;  2ZOO A;  1AKK A;  5APV A;  2JKV A;  3RBX A;  2M3B A;  3L73 J;  1C52 A;  1DEE G;  2QG4 A;  1GKS A;  3PRJ A;  5APT A;  4PD4 I;  1L9B C;  2LIT A;  4K3A A;  2ZYA A;  3L71 J;  2AEJ A;  4HJG H;  1R5L A;  1YYC A;  2YKO A;  2QJP B;  3HUS A;  1YIT P;  2B9B A;  3BVH A;  2BAS A;  3H1H G;  1SQQ E;  3H32 A;  3ZOW A;  1OMI A;  3DR0 A;  3WU2 H;  1PV3 A;  2XZR A;  5KAF V;  1VF5 D;  2IBZ G;  4LGD E;  3V2Q A;  1QLE D;  1KIL A;  1CRH A;  1L4A A;  4GDO A;  2FBW C;  4L3G A;  3RK3 B;  2JWA A;  1S5L E;  2P67 A;  3CI9 A;  1FJP A;  4H0L C;  1T8Z A;  1OCD A;  2AXT H;  5CBN A;  1A2S A;  4IL6 X;  1N7S C;  2AXT E;  1RAQ A;  1LWU B;  2P10 A;  1RE3 A;  2IFN A;  1CCH A;  5KLI C;  1KB0 A;  5KAF H;  1VQ4 P;  1HRC A;  4UB8 V;  4W80 A;  2SPZ A;  2VRS A;  2E75 D;  3CC2 P;  3W68 A;  1SQP E;  3VMZ A;  2B87 A;  2YXR B;  4RES B;  3CX5 D;  2DVH A;  4I7Z B;  3IN6 A;  1X9V A;  2ZZS 1;  1BE3 E;  1GJQ A;  2O01 J;  1NTM J;  3SWK A;  1N50 A;  3G71 P;  3EFG A;  5IY5 1;  3NWV A;  4NPE A;  4DT0 A;  4R4L A;  1NU1 J;  1HGZ A;  3CWB J;  4HH2 A;  1LTJ B;  1QVG O;  1FHB A;  3AEE C;  2FFD A;  4UB6 E;  1ZR4 A;  3A2A A;  1SQX D;  1SQP D;  3BAS A;  4P4Q B;  4O1W A;  3L36 A;  2IYP A;  3USS A;  3A9F A;  1LT9 A;  1CW5 A;  1FE6 A;  1N86 A;  2KZJ A;  1CHH A;  1L0N K;  1COR A;  2YQB A;  3WUI A;  1YQ3 C;  5GTI E;  1SQB J;  3FXD A;  3SFD C;  1S5L X;  1JCC A;  4OH8 B;  2RN0 A;  5DJU B;  1PP9 D;  2WT7 A;  3L70 E;  2C0W A;  1A02 F;  5M1B A;  3CU4 A;  1LS9 A;  3L74 G;  4N0K A;  2V7Q H;  5KAI E;  3HQ9 A;  4WY4 A;  3G6E P;  3ZIY A;  1JY2 O;  1KIL C;  1EC5 A;  1U57 A;  3S9O A;  1E5W A;  1JY2 N;  1EZV E;  4BRY A;  1URQ D;  3NBS A;  2GUS A;  2NPS A;  4GIF A;  3RN1 A;  3H1L J;  3B8E B;  4OGQ B;  1NYH A;  3CXH W;  4RJT A;  1I5T A;  3L71 G;  2GB8 B;  5APW A;  5AW4 B;  1KIL B;  1GL2 B;  1NTZ K;  2CPS A;  1KYO D;  3H1J E;  2KSE A;  1YI2 P;  4IL6 V;  1KQG B;  3EWK A;  4K3I A;  1MZ9 A;  1W5C T;  2JQR A;  1KC8 Q;  2OYI C;  1IRW A;  3KPE A;  351C A;  4WQE A;  3B5N D;  1YQ4 C;  2B88 A;  3AEG C;  4U3F G;  4MU8 A;  1YIQ A;  1A8C A;  4DJG A;  3E7K A;  1FI9 A;  3JCU E;  2E5T A;  2OZ1 A;  1BL9 A;  4RSZ A;  2BCC G;  1FJ0 A;  2WPS A;  2KLU A;  1ZZH A;  1NTK J;  1N73 C;  3AEA C;  2IZ1 A;  2Q6Q A;  3W67 A;  3CXH H;  1SQV J;  4DY9 A;  2Y9Y A;  1IZL 0;  1DW1 A;  1NAF A;  1CIH A;  1G2C B;  2KLV A;  5K5G B;  1SS1 A;  1IFP A;  1RE4 A;  1W2B O;  1QL3 A;  1URQ B;  3C8V A;  5CIH B;  4H44 D;  1BCC G;  1N73 A;  5DFS A;  3HRN A;  1NMI A;  1L9J C;  1E79 H;  1KTM A;  1YIC A;  3HQ8 A;  2CPB A;  2Q9I A;  3V4W A;  2WWW A;  1T3J A;  1URQ C;  1NU1 G;  3OA7 A;  2R3C A;  1NKN A;  3ABV C;  3HD7 D;  3Q1M A;  1QGK B;  1K73 Q;  1EQ7 A;  4I6M C;  5BU5 A;  1NKZ B;  4XYD B;  5KLV K;  4WWI A;  4PJ0 V;  1WT6 A;  5DF5 A;  2QIW A;  5KJ7 C;  3GG2 A;  4YPC A;  2WT7 B;  3H6P A;  3HD7 C;  1L0N E;  3L75 G;  1K04 A;  5L8R J;  3SFE C;  3KZI V;  1U75 B;  3V4Q A;  1YCC A;  1SQQ K;  3L35 A;  2KIK A;  2WZ7 A;  3PJS K;  4AAL A;  1DIQ C;  2FWL A;  3HE4 B;  3L74 J;  3RN0 A;  4BRY B;  4UB8 E;  4QAO A;  1EB7 A;  4A7P A;  1C6S A; 
#chains in the Genus database with same CATH homology
 3VYM A;  5KKZ B;  1E8E A;  5KLV D;  155C A;  3WFE C;  1H32 B;  1K3G A;  1NTK D;  4H0K A;  4FB1 A;  3M97 X;  1I54 A;  2N9Y B;  2V07 A;  1CRJ A;  2MHM A;  1FI7 A;  3CP5 A;  1NTZ D;  5GTI V;  4H0J A;  4EIF A;  1H33 B;  1DII C;  3ITK A;  1NTM D;  2FYN B;  4D6T D;  1CRY A;  2ZXY A;  5CIE B;  1H9Y A;  5CIG B;  1CO6 A;  3CYT I;  1CCR A;  1N15 A;  1QL4 A;  2EXV A;  3WFC C;  1CSX A;  1GQ1 A;  2KS1 A;  2Y0C A;  1KX2 A;  1HCM A;  2MTA C;  1CXA A;  1I6D A;  3KHU A;  3WFD C;  1B7V A;  2C8S A;  5CIC B;  2Q3E A;  1YFC A;  3OA8 A;  4O1Q A;  1K3H A;  2LIR A;  3PHL A;  4JCG A;  1H31 B;  2B10 B;  3PTZ A;  1I8P A;  1CNO A;  4PD4 D;  2Y0E A;  1C6O A;  3H1H D;  1SQV D;  2L91 A;  1FI3 A;  3H1K D;  4WQC A;  3JBT B;  2V08 A;  2AIU A;  3L71 D;  1SQQ D;  1S6V B;  3SJL A;  1KB9 D;  4NFG B;  1CIF A;  5DJQ C;  3O0R C;  1CYI A;  4FAV A;  1PPJ D;  1ETP A;  2L4D A;  1CC5 A;  4U3F D;  3A0H V;  5B6Q A;  2ZOO A;  1AKK A;  1E29 A;  1HJ4 A;  2N9J A;  1C52 A;  1M70 A;  3PXT A;  2QG4 A;  3H1I D;  1BE3 D;  1H1O A;  1MG2 D;  4WQ8 A;  3RMZ A;  1GKS A;  4WQD A;  5C9M A;  3PRJ A;  2C1D B;  1L9B C;  1JDL A;  2CXB A;  2LIT A;  1RZ6 A;  3SVW A;  1LMS A;  2DGE A;  3L4M A;  1HRO A;  2QJP B;  4WQ9 A;  1QKS A;  1CRC A;  1KIB A;  1SQB D;  3ZOW A;  5C0Z A;  4FA4 A;  3DR0 A;  1W2L A;  2ORL A;  5KAF V;  1E2R A;  1QYZ A;  1DVV A;  1GU2 A;  1CRH A;  4L3G A;  5KLI B;  2JWA A;  2FYU D;  3RLM A;  1IO3 A;  3ZBM A;  1OAE A;  1C2N A;  1OCD A;  2C1U A;  2BH4 X;  1CRI A;  3L73 D;  1FCD C;  1A2S A;  2YCC A;  1NU1 D;  2B11 B;  1RAQ A;  1GDV A;  2PAC A;  1HJ5 A;  1BGY D;  1P84 D;  5EXQ A;  3VNW A;  3SLE A;  1CCH A;  1L0N D;  2B12 B;  1KB0 A;  1WVE C;  1C6S A;  1ZRT D;  4XXL A;  1LC1 A;  1HRC A;  3L75 D;  1AOQ A;  4UB8 V;  5H2F V;  1CYC A;  3DP5 A;  5KAI V;  4GED B;  1IRV A;  4PWA A;  1HZV A;  2YIU B;  3CX5 D;  2DVH A;  4YE1 A;  1CIG A;  2ZZS 1;  3ZOX A;  1GJQ A;  3CX5 W;  4Q5P A;  3A0B V;  2N9I A;  3O20 A;  1DW3 A;  1N50 A;  5CYT R;  1FOC A;  1MG3 D;  5TIS V;  2CA3 B;  3ZCF A;  5IY5 1;  3NWV A;  3OCD B;  2BCC D;  2GIW A;  3O1Y A;  3GW6 A;  4AAO A;  2D0S A;  1FHB A;  4UB6 V;  2C9X B;  5B5E V;  4FA5 A;  1AOF A;  4WQB A;  1COT A;  1SQX D;  1S5L V;  1SQP D;  3L4O A;  3H1L D;  4P4Q B;  4O1W A;  3A9F A;  1AYG A;  1CIE A;  1CHH A;  1N9C A;  1COR A;  1YNR A;  2ZON G;  2YQB A;  3WUI A;  2I8F A;  1DW2 A;  5CID B;  2C1V A;  3C2C A;  2K9J B;  2RMZ A;  2RN0 A;  1PP9 D;  2N18 C;  4EDF A;  1CSV A;  5B66 V;  2N3Y A;  1KYO W;  3CU4 A;  1LS9 A;  4N0K A;  1YTC A;  5TJH A;  2YK3 A;  3PLN A;  1M60 A;  2N3B A;  3HQ9 A;  3VRD A;  2ZBO A;  3ZOY A;  1I55 A;  1NIR A;  5E79 V;  3WU2 V;  1CSU A;  1YEB A;  3VMA A;  4EIE A;  3ZIY A;  3MK7 B;  1KV9 A;  4EIC A;  1CTZ A;  2QJY B;  2GC7 D;  3PXW A;  3NBS A;  2AI5 A;  3RN1 A;  2BPB B;  1CXC A;  2PCB B;  3CXH W;  4RJT A;  1I5T A;  2CE1 A;  1F1C A;  2GB8 B;  3MK7 C;  1KYO D;  1RAP A;  1MZ4 A;  4IL6 V;  2O3J A;  3DMI A;  4K3I A;  3ZOO A;  1C2R A;  2BGV X;  1CRG A;  1W5C T;  2JQR A;  4KMG A;  2Y0D A;  2C2C A;  3BCC D;  1IRW A;  1BCC D;  351C A;  4WQE A;  3O5C A;  3CXH D;  4MU8 A;  4PW9 B;  1YIQ A;  1H33 A;  1A8C A;  4LJI A;  3HQ6 A;  2CE0 A;  1FI9 A;  2OZ1 A;  2IBZ D;  1BL9 A;  4RSZ A;  3TYI A;  1FJ0 A;  1VYD A;  1ZZH A;  1CHJ A;  3OA8 B;  4DY9 A;  1H31 A;  1DT1 A;  1IZL 0;  3TDK A;  1DW1 A;  2JTI B;  1CIH A;  1HJ3 A;  1M6Z A;  4FAN A;  3SWS A;  1L0L D;  2D0W A;  1LFM A;  4L3H A;  1U74 B;  1NNO A;  3TF5 A;  1CTJ A;  1QL3 A;  3NBT A;  5CIH B;  3OCD A;  2PCC B;  2CA4 B;  4EID A;  1N90 A;  4WQ7 A;  5DFS A;  1QN2 A;  1I6E A;  1H32 A;  1L9J C;  1NMI A;  1WEJ F;  1YIC A;  2BH5 X;  1HH7 A;  1EZV D;  3X39 A;  2N18 B;  2A06 D;  3HQ8 A;  1C75 A;  3CWB D;  2BLF B;  2B4Z A;  1C6R A;  1CED A;  3L74 D;  5GTH V;  2AXT V;  1R0Q A;  451C A;  4L1Q A;  3H1J D;  3SXT A;  4WQA A;  3HQ7 A;  2KNC B;  3PXS A;  2C1D A;  4Y5R A;  4AAM A;  1J3S A;  5AUR A;  1LC2 A;  4XYD B;  2HV4 A;  4PJ0 V;  4AAN A;  1H9X A;  5DF5 A;  4V2K A;  5CIB B;  5DJQ B;  1CHI A;  2FRC A;  2GC4 D;  4FA1 A;  1CSW A;  3GG2 A;  1DW0 A;  1I8O A;  1CTY A;  2OZ1 B;  1DVH A;  2QJK B;  1RZ5 A;  2XTS B;  3ORV A;  1KX7 A;  3KZI V;  1C7M A;  1U75 B;  1CYJ A;  1YCC A;  4J20 A;  3PH2 B;  3FWL A;  1NML A;  1GIW A;  2B0Z B;  4AAL A;  4AX3 A;  1DIQ C;  4GYD A;  1YEA A;  2FWL A;  2VHD A;  3RN0 A;  2BCN B;  4QAO A;  1HZU A;  3TGU D;  1IQC A;  3L72 D;  1EB7 A;  1F1F A;  3L70 D;  5CIF B;  3WFB C;  4A7P A;  1A56 A;  4FA9 A;  3WC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...