3L72D

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 73
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l72D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l72D02
2QJYB 3O20A 1IQCA 4H0JA 1HJ4A 4FAVA 1CYJA 2CXBA 4U3FD 2YIUB 2Y0EA 3O1YA 4WQ9A 3SLEA 5B5EV 2Q3EA 1CXAA 2A06D 3H1KD 1IO3A 2DGEA 3PXTA 3GG2A 5CIFB 2C1DA 3M97X 3L4MA 3CYTI 1F1CA 3X39A 3SWSA 4AX3A 5KLVD 3CXHW 4EICA 1KIBA 3L74D 3ZBMA 1KYOW 1C2NA 1RZ5A 1GDVA 5KAIV 3ITKA 3OCDB 2DVHA 3PXSA 1E29A 1CC5A 2ZONG 2I8FA 4XXLA 1QL4A 1QL3A 1YEBA 1AOFA 1LFMA 5B6QA 1BCCD 1K3HA 1QKSA 3A0BV 4EIDA 4GEDB 1HH7A 3HQ6A 1I55A 1M70A 4FANA 1H1OA 1U74B 3WUIA 1L0ND 4O1WA 2RMZA 1FCDC 1GQ1A 1RAQA 2B12B 3TF5A 4LJIA 1H31A 1LC2A 1FI7A 2GB8B 1NMLA 4L3HA 1H32B 1IRVA 1CSVA 4KMGA 2GC4D 4PD4D 2OZ1B 2KNCB 2BCNB 1CO6A 1VYDA 1E8EA 3ZCFA 2C9XB 2AXTV 2CA4B 3A9FA 5TISV 2RN0A 3L72D 4WQEA 3KZIV 1CRJA 2PCBB 2V07A 1ETPA 5IY51 3A0HV 3TGUD 2Y0CA 3NWVA 1C7MA 4WQ8A 4EDFA 4L1QA 3VYMA 2B4ZA 4XYDB 1BGYD 2B0ZB 2AI5A 1HROA 1LC1A 1CRGA 1CSUA 1P84D 4PW9B 5DJQB 4DY9A 155CA 2JQRA 1EZVD 1CXCA 1CIFA 3RMZA 1CRCA 4Q5PA 1QYZA 3SVWA 1CIEA 2MHMA 1N15A 3L4OA 1BL9A 3L73D 5C9MA 1CRHA 1FI3A 2CE0A 3BCCD 1DIQC 2QJKB 1CHHA 4FA4A 351CA 2V08A 3RLMA 1YCCA 3WFEC 1CRYA 4EIEA 5KLIB 3DR0A 1NTKD 5B66V 5KKZB 1DVHA 1MZ4A 4K3IA 3SXTA 1GIWA 4IL6V 1GU2A 1YTCA 2K9JB 1F1FA 4WQ7A 3DMIA 1I6DA 1U75B 4WQCA 1PP9D 1AOQA 1CCRA 3WFCC 4UB6V 2N3BA 1HZVA 1EB7A 1NU1D 2C8SA 1C6OA 1SQXD 3H1JD 3WFBC 1WVEC 3CU4A 2FYUD 1HCMA 2EXVA 1J3SA 2N3YA 2ORLA 4AAMA 2N9YB 5E79V 4AALA 1W2LA 4FA1A 1CYCA 1SQBD 3PTZA 4MU8A 2O3JA 2C1VA 1QN2A 2FYNB 1I5TA 1IZL0 2YK3A 3CX5D 5EXQA 5DFSA 1CTYA 2HV4A 1AKKA 2GC7D 1C2RA 3CWBD 3MK7C 1I8PA 1YIQA 1CIHA 3OA8B 5C0ZA 3ZOOA 1H33B 1K3GA 1NMIA 1N9CA 1CSWA 3PHLA 1FJ0A 1CHJA 4D6TD 2YQBA 3NBTA 1CEDA 1SQVD 3PH2B 2MTAC 1CHIA 4QAOA 2ZXYA 2ZOOA 3PRJA 1NIRA 1DIIC 4Y5RA 5CIGB 2Y0DA 4A7PA 2YCCA 4J20A 1CIGA 5GTHV 4H0KA 4YE1A 3OCDA 2FWLA 3L70D 1YEAA 1C6SA 4RJTA 1CCHA 1CORA 5CICB 2BLFB 1N90A 2C1DB 4AAOA 1A56A 2D0SA 4PJ0V 3CXHD 1YFCA 3RN0A 1KB9D 1A8CA 1CSXA 1KYOD 1H9XA 4WQBA 1DW1A 1HZUA 4PWAA 3CP5A 3WU2V 1JDLA 2BPBB 1DVVA 1NTMD 1L9JC 3H1ID 3PXWA 1KX7A 1L0LD 1C52A 2C1UA 1H32A 3L71D 3ORVA 2OZ1A 2N9IA 4GYDA 4RSZA 1GKSA 2LIRA 4O1QA 1C75A 3ZOYA 1GJQA 4NFGB 1CRIA 2IBZD 2VHDA 1DT1A 1MG3D 2CA3B 3O5CA 1HRCA 1H31B 3H1HD 2JTIB 2KS1A 2ZBOA 1COTA 4L3GA 3HQ8A 3NBSA 1SQPD 1YICA 1S6VB 1MG2D 2CE1A 5CYTR 1R0QA 1NTZD 1IRWA 3MK7B 3WC8A 1CTJA 4FB1A 3WFDC 1DW3A 1RAPA 4P4QB 2JWAA 1DW0A 1S5LV 5CIEB 2QG4A 3JBTB 5CIHB 3TDKA 4FA5A 1DW2A 2B11B 1ZRTD 4WQDA 3VRDA 1W5CT 1FOCA 5DF5A 451CA 4N0KA 2N18B 2BH5X 2B10B 4EIFA 2FRCA 1CYIA 3TYIA 1M60A 5CIBB 5AURA 3PLNA 3RN1A 2N18C 4UB8V 2BH4X 1H9YA 1KB0A 1A2SA 1L9BC 1AYGA 1I54A 1KV9A 2QJPB 4AANA 2BGVX 1M6ZA 2N9JA 3O0RC 5H2FV 3VNWA 1OAEA 1NNOA 1HJ3A 1E2RA 2L4DA 3C2CA 5KAFV 1FI9A 1PPJD 1CNOA 2GIWA 2PCCB 5GTIV 3L75D 4V2KA 1LMSA 3KHUA 2D0WA 1I6EA 3ZOWA 1KX2A 1B7VA 1SQQD 3H1LD 3CX5W 5CIDB 1CTZA 2C2CA 3FWLA 3OA8A 3ZOXA 4WQAA 1H33A 1C6RA 1OCDA 2XTSB 1LS9A 4JCGA 3SJLA 3VMAA 2ZZS1 1I8OA 1ZZHA 2AIUA 4FA9A 1WEJF 3ZIYA 1RZ6A 2BCCD 3HQ9A 5DJQC 3GW6A 2LITA 3DP5A 1FHBA 1YNRA 1N50A 1HJ5A 1BE3D 5TJHA 2L91A 3HQ7A 2PACA
chains in the Genus database with same CATH superfamily
1L4AB 4O9BA 5TISE 1FZCA 2OYIB 2CXBA 1OMIA 2Y0EA 2W6JH 3O1YA 4WQ9A 3U1AA 5B5EV 2WTYA 2A06D 1SQQK 3GG2A 2W6AA 2ZXXA 2BASA 3CYTI 1MZ9A 1BE3J 3X39A 3GHGB 2OQQA 1BSNA 1LTJA 4DT0A 1OWAA 4WY4A 1PZQA 1PPJE 3L74D 3ZBMA 3BRTB 1OVVA 3HD7D 2JR8A 5KAIV 4CPGA 5AW8B 2FBWC 2Q5UA 3A7OA 3PXSA 1PPJG 1RE4A 3H1LE 2H8PD 1KYOI 2ZONG 2I8FA 4W80A 1QL4A 1GU5A 2GM4A 3H1LG 1ZLLA 2ZYGA 1BCCD 4EIDA 2R32A 4GEDB 1I55A 1L0LG 1U74B 1HJ0A 2P67A 1H31A 2IDBA 2NRGA 3WU2H 2FYUK 1OW6A 1IRVA 5CMZA 4PD4D 2GC4D 5E79E 2ZYDA 4IOIH 2KSEA 4N78D 1L4AD 1X22A 2AXTV 3A9FA 5TISV 3H1KE 2PRRA 2HR3A 1FJKA 2PCBB 2V07A 5IY51 2YO2A 1GK6A 2Y0CA 3NWVA 3H1KG 4Y99C 1BGYD 5KLVE 5DJQB 1VPCA 5KLVG 1CRCA 4DCKA 1K8AQ 4I6MC 1CIEA 1QVGO 3L73D 2YKQA 3D70A 2HODA 2K3RA 3IF4A 4FA4A 4BRYB 2FFDA 351CA 3MZWB 3RLMA 3L4FA 1N86A 4LLHA 2XNDH 5CJ0A 5KKZB 3RK3C 3G71P 1MZ4A 3BVHA 2YXRB 3TNUA 2P10A 1F1FA 3DMIA 3UIAA 1U75B 4OGQC 1PP9D 3WFCC 1BDCA 2N3BA 1EB7A 5KJ7C 2OYOA 1SQXD 3H1JD 2M0BA 1NGMB 3CCLP 1N7SC 5GTIE 2ORLA 1VDFA 3CX5H 4C7RA 3L37A 5E79V 5APUA 1RE3C 4FA1A 3ABVC 3S1KA 1SQBD 2BEZF 2C1VA 2Z4EA 1T3UA 1JM0A 1EZVE 5H2FH 1IZL0 2YK3A 2FYUJ 2HV4A 1AKKA 2GC7D 3CWBD 1HBWA 1YI2P 1OXZA 3BCCE 1AJYA 2A45H 3RBXA 1ZR2A 2HPCA 3AECC 2G8YA 3BCCG 3JCUH 1BE3G 1T3JA 1OZHA 3P32A 1LP1B 5APTA 4QAOA 2ZXYA 3PRJA 1NTKG 3EWKA 2Q6QA 3CXHH 3T97A 4JYCA 3OCDA 3IN6A 1YEAA 2OTKE 1CCHA 1NU1G 1YITP 2CPSA 5CICB 1M7LA 2NPSB 1KILC 3Q5RA 1CSXA 5B5EH 2KZJA 1H9XA 2XU6A 1EDJA 3A0BE 3QH9A 1JDLA 2BPBB 3RK3B 4H44B 3BATA 3L70J 4Y28J 5CCHC 3CCSP 1L0LD 4OGQB 1C52A 2C1UA 1H32A 2FKWB 3F89A 3ORVA 2OZ1A 4GODA 3WUVA 5KAIH 1GKSA 3RL0g 4AUWA 1N73A 3ZOYA 1GJQA 2OTLP 1RF1C 3E1IA 1N7SB 2IBZD 1LTGC 2AEMA 4IFMA 1KFMA 2R3CA 1NTMJ 4D6TG 3H1IJ 3OA7A 3A0HE 1EXIA 2QJYC 3L71J 1VF5D 1COTA 1Q86Q 1S6VB 1BDDA 3CC7P 2CE1A 1R0QA 1R8EA 2QIWA 2K88A 1U7JA 1L0LK 2JO1A 1LWUA 4JPZB 3WFDC 1DW3A 1UIXA 4P4QB 1KYOE 1WMKA 5TISH 4H13C 2JWAA 1DW0A 5CIEB 5CIHB 2E76D 1USDA 3TDKA 1JCCA 2M5AA 2B11B 1VQNP 2K9JA 4WQDA 3VRDA 2WPVB 3MUDA 2WITA 1W5CT 451CA 4N0KA 2BH5X 4EIFA 4MN4C 2FRCA 2E75C 4L75A 3IAOA 5AURA 1HH0A 2Q3IA 1NKZB 3PLNA 3RN1A 2N18C 4UB8V 1H9YA 1SLQA 1A2SA 5KJ7D 1Q90D 1WT6A 4AANA 2BGVX 1ZW0A 2IBZI 2E42A 5KLVK 1N7SD 1GL2A 1KILB 3H1HE 3VNWA 3CMAP 1NNOA 4W7ZA 3NXSA 1E2RA 2A06E 4K35A 2N1TC 1PV3A 2KI7B 5AVUB 3RK2C 1FI9A 1NTZE 1FE6A 1M1JC 1I6EA 3ZOWA 1KX2A 5CIDB 2C2CA 3OA8A 3JSVC 4R4MA 1NTZG 5AVRB 1DEBA 1IFMA 1FU1A 3KXDA 1OCDA 2XTSB 2QM8A 1LS9A 1RF1B 1ZZHA 2B9BA 5E79H 3RL0C 3HQ9A 3GW6A 3DP5A 5AW1B 1ZRTE 1FS0E 1X8YA 4R4LA 4TLFA 1BCCE 1BE3D 1FDMA 2PACA 3H1LJ 2QJYB 2JDIH 1LT1A 2ZJSE 1HJ4A 4FAVA 1CYJA 3NTNA 5CJ4A 2YIUB 3VMXA 2ITAA 2QJKC 2WSFH 1L0LJ 3O6QB 3HD7A 5KLIC 2DGEA 5CIFB 1IFJA 1KZUB 3U59A 4Z1MH 1KQFB 2C9NY 3SWSA 4N78E 2IPPA 2ZFCA 1NAFA 5AW6B 4H13B 2LXBA 3L70G 2M8RA 2ZYAA 5AVWB 2QM7A 1KILD 3D0WA 3GHGC 1DD4A 3Q5PA 1QVFO 4DOJA 1CC5A 3L75G 3H1KJ 1KB9I 1RY3A 1A02J 4XXLA 1OVRA 1YEBA 1AOFA 5B6QA 2J59M 2FYZA 1NTKK 3A5TA 1DEEG 1YJ9P 1NTMG 1Z56A 1HH7A 5KLVJ 2WSFJ 4FANA 1L4AA 4O1WA 4OVNF 1NU1K 3HTKA 1FI7A 1K04A 1Q82Q 5AW2B 3M9HA 3S4RA 2Y9YA 2XDJA 1KORA 2N1TB 2E74C 3WMM0 2M3BA 3RK2B 2KNCB 4JF7A 1P84H 1WRGA 2IYOA 1M1JB 4U3FG 1NH4A 4IL6X 3NFQA 1CRJA 1ETPA 5CBNA 4WQ8A 4L1QA 5DJUB 1SQXE 2B4ZA 4XYDB 1IJDB 2B0ZB 3VMZA 4BWNA 1H8AA 1CSUA 4PW9B 4L74A 3RL0B 3R2PA 1G2CB 1NOHA 4DY9A 1JOCA 2HLOA 4H13D 1MKMA 3RMZA 4Q5PA 1QYZA 1QLED 2GUVA 1CRHA 2PAJA 3HUSB 2KK7A 2W8ZA 2QJKB 1CHHA 3G4SP 1JY2P 3VYIA 5AW4B 1S1CX 2E75D 2V08A 3C1LA 3WFEC 4TT3H 3K5BA 5KLIB 1LTJC 3CCVP 1L0NE 2KSJA 2RKLA 3SFDC 1W2BO 1DVHA 1FZBA 3P7KA 5GTHE 3SXTA 1GIWA 1M56D 3M0DA 1L0NG 2QVAA 2I1KA 2CK3H 1X0TA 1HTLC 2QEXP 3MP7B 2N9BA 4RESB 5KKZC 3BCCJ 1A02F 1JY2N 1GTWA 3CU4A 1JY3O 1GK4A 3H32A 2FYUD 2EXVA 3L72E 2N3YA 1LTBC 2O01H 1NTKJ 3TGUE 1JB0J 2LKMA 3G6EP 4XFJA 4UB8H 1CYCA 3TGUG 3HRNA 1QN2A 2Y9ZA 1NU1J 2YO3A 2ZVNB 1URQC 3M9BA 3CI9A 1FC2C 3CX5D 3L36A 3RL0D 3VN0A 3EFGA 1Y9BA 2AEFA 1C2RA 2JEEA 2E74B 3CCQP 2W90A 1DX7A 1E79H 5C0ZA 1S3JA 1IZNB 3GF7A 1W5CE 1H33B 2WQYC 2H43A 1NMIA 1CW5A 1CSWA 1HGZA 1KMIZ 3CC2P 3NMDA 2UWJE 3PH2B 2IX7C 2O01J 1VQ9P 1DIIC 2OYHB 2JP3A 4Y5RA 5CIGB 5AW7B 2Y0DA 2AXCA 1NVOA 2R5BA 5GTHV 1KYOH 5AW0B 4H0KA 1FZCB 1YYCA 1FDIA 3L70D 1C6SA 4D6TJ 2PGDA 1M1KQ 3V6IA 3W68A 2KS1B 1VQKP 3I56P 2MKVA 3M0AA 3P8CD 3CXHD 4B86A 1YFCA 1JMBA 3Q3DA 1PGPA 1XTGB 2WSCH 2NZ2A 5CCGC 4DJGA 1LTJB 1DW1A 1HZUA 2NPSC 4WY4B 1BSHA 3A2AA 4ZMDA 1NTMD 1LNQA 3H1ID 1HJBA 3L71D 1PGQA 2HG5D 4BXLA 1ZOYC 1S5LX 4H44C 2N9IA 4RSZA 2LIRA 1C75A 1NAYA 2JJLA 1G1JA 2VHDA 1MG3D 3V2NA 2CA3B 1PL5A 1SQVE 4JBZA 3O5CA 1SFCC 4PD4I 2KLVA 1SQVG 4U7JA 2XZRA 1H31B 1JTHB 3CCJP 2ZBOA 1HVVA 1NJIQ 4L3GA 3HQ8A 2KIKA 1YICA 1URQB 2WSCJ 2YKPA 3LIDA 1S9KE 1MG2D 1NTMK 3E1RA 2KP8A 4N6JA 1IFIA 1NO4A 1CTJA 2ZVOB 1USEA 2YMYA 1KB9E 1RAPA 3H1HJ 2IYPA 1YQ4C 3CCEP 1EZVG 1OVUA 1G1IA 2IZ1A 3JC22 1QGKB 3CXHI 4FA5A 1GW4A 5KJ7A 1NTZJ 5DF5A 3AE3C 4PV1C 1YJNP 1MUUA 2B10B 4IL6E 2R5DA 2C0WA 3TYIA 1RE3A 2HODB 1YBKA 1X79B 2FFDB 2BH4X 1YTZI 3Q5SA 1KB0A 3B5NC 1L9BC 1AYGA 3AE8C 1IFNA 1AVOA 1ZN5A 5M1BA 2N9JA 1H88A 3TNUB 4DZOA 4EOTA 3VOPA 2RH0A 2YMKA 4LGDE 1MV8A 2WT7A 5AVZB 1SQPE 3M06A 1PPJD 1CNOA 1RF0C 2W6BA 1ZMEC 5GTIV 4V2KA 2J5UA 3ZDMA 3BASA 3H1LD 1URQD 3CX5W 3SFEC 3ZOXA 2ZXEB 1EC5A 4C7NB 1C6RA 3WUUA 1L0NK 3SJLA 3VMAA 2JKVA 2KOGA 2ZZS1 1I8OA 3AEEC 1Q7YQ 4RKUJ 4FA9A 1WEJF 4KJMA 1K05A 1SVFA 3MHVA 1FHBA 1N50A 1SFCB 3L75J 1HJ5A 3KQGA 1VQ8P 2QRXA 3O8ZA 3TSIA 3CLQA 1IQCA 4H0JA 3BRVB 5APYA 1LWUC 1KILA 2HPCB 3VMYA 2QE7H 1IO4A 2Q3EA 3USSA 1CXAA 4OH8B 3HE4A 3H1KD 1IO3A 3PXTA 2C1DA 3M97X 5APVA 1CI6B 2YIUC 5CBOA 5APQA 3FX0A 4ZKUA 3SWYA 3PP5A 1QEXA 4JQ0D 4PJ0E 5KLVD 1AV1A 3CXHW 2B87A 1KIBA 3T97B 4U3FJ 3KPEA 1GDVA 3ITKA 5CCGD 4YPCA 3OCDB 1T6AA 5AVQB 2WPQA 1E29A 2NPSD 2M3EA 1SQQE 4PV1B 4GIFA 5GTHH 3V5BA 3LIEA 1LT9C 2QA4P 1SQQG 1LFMA 5B66E 1K3HA 2O1JA 4WBAA 4H0LC 3A0BV 4KHXA 2KB7P 3Q2YA 3B5NB 3RK3D 4GOFA 1M70A 4H44D 2BCCE 1H1OA 3WUIA 3MGNA 2WVRA 4N3YB 4OGQD 4UB6E 1FCDC 5AW5B 3TF5A 5BVZA 2BCCG 3IR9A 5KTBA 2GB8B 4NPFX 1SFCD 1H32B 4EI2A 1YJWP 2E5TA 2D2CB 5APWA 1CSVA 2OZ1B 1LJ2A 3TK1A 1E8EA 1N73B 3ZCFA 2RN0A 2AEJA 3H1HG 4WQEA 1L0NJ 3II6A 3A0HV 1C7MA 3VTPC 2A06G 4EDFA 3VYMA 2O01N 2IFNA 2AI5A 3C9IA 5C39A 1P84D 3L74E 2I1JA 3LW5H 3H6PA 155CA 2JQRA 1S5LE 1EZVD 3L74G 1CXCA 1CIFA 3HD7C 3L72J 4GOEA 2MHMA 1N15A 5C9MA 3TGUJ 3CD6P 3BCCD 1LWUB 1SQVK 1SS1A 4PV1D 2KZIA 1YCCA 1BCCG 4EIEA 3HUSC 1NTKD 5B66V 4GT1A 1OW8A 3B71A 4I7ZB 3B5ND 1GU2A 2K9JB 3AEAC 4WQ7A 2Z5IA 4UB6V 4PD4E 1IFDA 1NU1D 2C8SA 4AYCA 1C6OA 3WFBC 3LW5J 1IK7A 1HCMA 1HF9A 4AAMA 1FDOA 5BU5A 1LT9B 4AALA 1H0TB 1W2LA 1FOSE 2PFXA 2OARA 1BGYE 3AE9C 1GMJA 4H0LB 1ZV8A 4NPEA 4MU8A 2KYVA 3C8VA 5APSA 1BGYG 2FYNB 5CCHD 1LTIC 1P84I 2JWDA 1I5TA 2K1AA 2KXPB 5EXQA 3L35A 3V4QA 5DFSA 1GW3A 2B89A 2SPZA 1TU3F 2CPBA 3L73E 1NYHA 2OYIA 3OA8B 5GTIH 3L73G 1K3GA 1N9CA 1YQ3C 1FJ0A 1CHJA 4D6TD 1QL2A 3L71E 2WZ7A 3M91A 1CEDA 3GHGA 2ZOOA 2PP6A 1PP9E 1NKNA 1PIXA 4A7PA 1OFCX 1DD3A 1KB9H 1PP9G 3H1JE 2P58A 2FWLA 2OYHC 1NHLA 3HD7B 1SQXG 5KAIE 3H1JG 1SQVJ 1FZCC 2BLFB 2YNYA 1A56A 3SSUA 3V4WA 4ZNCA 1VQPP 1LTAC 1SQBE 3M0DC 4YXDC 1KYOD 3PJSK 4IFFA 2XV5A 1N8RQ 4PWAA 1SQBG 3OAKA 4H0LD 3RGUA 2WSSH 1EDKA 3CWBE 4WY4C 3AE4C 1Q2NA 4WB4A 4C46A 4GYDA 5APXA 3CWBG 3M9QA 4NFGB 5BU8B 1RE4C 4OWFA 4LC1A 4I1LA 2C9LY 2AXTE 3CCMP 2WPRA 5KAFE 2N1TD 3A0BH 3RK2D 3H1HD 3HE5B 3HTKB 3AEFC 4L73A 2KS1A 1LTSC 3NBSA 3L72G 3KYQA 5CYTR 1NTZD 1LTTC 1IFPA 2I8DA 2POHA 3WC8A 2P2UA 4NPDA 4BRYA 1S4XA 1KTMA 2QG4A 3A0HH 1SQPJ 1MFZA 4YTPC 1ZRTD 1L0LE 2P1JA 1KQLA 3B4SA 4M3LA 1VQ4P 3AE5C 4HJGH 1CYIA 1JUNA 1N7LA 1M60A 4PJ0H 2IBZE 2HYNA 1JTHA 1NTZK 4IFDK 1I54A 1VL2A 3MD0A 1GZLA 2IBZG 5AW3B 2V7QH 3N4XA 1URQA 3V2QA 3O0RC 3KDPB 2FFDC 2IFMA 4XE5B 5AVVB 1JY2O 1Y8AA 2FXOA 3C2CA 5B66H 2WPSA 5KAFV 1AA0A 3CC4P 3F5HA 3L75D 1VF5C 1JCDA 2ZAEB 3WUTA 3H32B 2V4HA 1B7VA 4UB6H 3B8EB 3FWLA 4GDOA 4GKGA 4JCGA 3I55P 2AIUA 3CX5I 1LGHB 1LP1A 3D6YA 2FXPA 1FZEA 1QL1A 1K9MQ 1EQ7A 2E43A 2ZT9C 2E74D 1VQ7P 2E76C 2V7QJ 3HQ7A 3RK3E 1SQQJ 3O20A 1IC2A 1T2KC 1PFIA 3AE7C 3OW2O 1CZQA 3KZIE 1M90Q 4U3FD 1M8OB 3SLEA 2BCCJ 1S5LH 5CCGA 1D7MA 2NPSA 2A45I 3SWKA 3L4MA 4HH2A 1F1CA 5AVSB 4AX3A 1XTCC 1NWQA 4EICA 1OIPA 3G9RA 1QX8A 1KYOW 1C2NA 4K3AA 1RZ5A 4C7NA 3I5CA 1YIJP 2DVHA 1T8ZA 2YXQB 1P84E 1R5LA 1YHQP 3MTUE 1FBMA 1QL3A 3N7NA 1SFCA 3IFMA 1N7SA 1QKSA 4WY4D 2OTJP 4PD4H 2IZ0A 3GF3A 3HQ6A 3L74J 1KN7A 1L0ND 2R44A 1YTZT 2RMZA 1EDIA 1GQ1A 1RAQA 2B12B 1BE3E 4LJIA 4HYTB 1OX3A 1EXJA 1LC2A 1SQXK 1NMLA 1FAVA 4L3HA 4AQRD 3CCUP 2H88C 1NTKE 4KMGA 1CI6A 2BCNB 1BCCJ 1CO6A 5AVYB 1VF5B 2K37A 1VYDA 1ZP0C 4Y99B 5AW9B 1J1EC 2C9XB 2CA4B 2D2CC 3L72D 3KZIV 1SQBK 2H89C 3VP9A 3CCRP 1NU1E 3TGUD 1VQOP 2Q7CA 1N73C 1SQPG 1HROA 1LC1A 1CRGA 4XA4A 3Q1MA 3AE2C 1KILE 1GDTA 3FXEA 1S72P 4W7YA 3U1CA 2ZT9B 1OW7A 2E76B 3S9OA 1HGVA 3SVWA 1J2JB 3FGAD 3B5NA 1FZGA 3L4OA 1BL9A 1FI3A 2CE0A 1DIQC 1BGYJ 1L2PA 1CRYA 1J1DC 2E5YA 1DH3A 1PGJA 3DR0A 4L76A 4UB8E 1KQSO 3V2PA 1RF0A 4K3IA 4IL6V 1YTCA 1I6DA 4WQCA 4D6TE 1VQMP 1AOQA 1CCRA 3L73J 1AQTA 1HZVA 1KV4A 4I7ZC 1KQGB 5CCHA 3MUDC 1WVEC 2GA1A 3CL3D 1ZXGA 1J3SA 1UIIA 2N9YB 2W83C 1KFNA 3PH0A 5EFWB 3WU2E 1RF1A 4WVZA 4JYBA 3PTZA 1PP9J 2O3JA 4I2LC 2XKMA 2WT7B 3A3YB 1RHZB 1SP4A 1SQXJ 3H1JJ 1GL2C 1VQ5P 3AEBC 1CTYA 2AXTH 2P7JA 2FYNC 4QMAA 3MK7C 5KAFH 1I8PA 2ZT9D 1YIQA 1CIHA 3ZOOA 3O6QA 3D6ZA 1FZFA 1SQBJ 4HKZH 3VP8A 1T2KD 3GLMA 3PHLA 1J1EB 2FY8A 2KLUA 2G3AA 2WMMA 2YQBA 3NBTA 1JO5A 2MJZA 1SQVD 1HUCA 2MTAC 1CHIA 1NIRA 2LXCB 3CWBJ 2YCCA 4J20A 3MIWA 5AVTB 3AEGC 1E5WA 1CSBA 1CIGA 1LT9A 4KT0J 1H0TA 4YE1A 3TYYA 4RO0A 1FOSF 1S9KD 2FYUE 4RJTA 3V2RA 1CORA 4WWIA 3FWNA 1M57D 2QJPC 3HE4B 2FYUG 2VRSA 1AQ5A 1RQVA 1S2EA 1N90A 2C1DB 1FZAA 4AAOA 2J58A 1KD1Q 2D0SA 3AEDC 4PJ0V 1U7MA 3RN0A 1KB9D 1A8CA 1JMMA 1J1DB 4WQBA 1GD2E 3CP5A 3WU2V 1RH5B 1DVVA 2B87B 5K5GB 3CX5E 5CHXA 1L9JC 3PXWA 1KX7A 2N1TA 1H89A 2KNCA 2L5GB 3H25A 2M5AB 3R4YA 3CPWO 1JEKA 4O1QA 2R3SA 1M1JA 1CRIA 2WSEH 5H2FE 5L8RJ 1DT1A 2O1KA 3RBZA 1VQ6P 3AE6C 4YXWH 1Q81Q 2FXMA 1HRCA 1VQLP 2D2CD 5AVXB 4ASVA 2JTIB 4HB1A 1JNMA 1L4AC 1G2CA 3JCUE 2A45G 1SQPD 3EQ2A 2OYIC 4ASWA 1GL2B 3L70E 2K9YA 4ZKPA 1RQUA 3AE1C 1HWTC 2WWWA 2LR2A 1IRWA 3MK7B 4FB1A 2H7HA 3HUSA 2B88A 3P8CE 3CXHE 1KC8Q 3L75E 2QSIA 1GU4A 3P8MC 3G3ZA 1ZR4A 1EZVI 3KZIH 1FJPA 1S5LV 3GMAA 3JBTB 2WSEJ 1NTME 1DW2A 2E75B 1JY3P 3H1IE 2GUSA 3FXDA 1FOCA 2N18B 3H1IG 2Q1KA 5B5EE 2BEQD 3W67A 1N2DC 3L71G 5CIBB 3E7KA 1SQPK 3HE5A 2Q9IA 1JY3N 1KV9A 2QJPB 1IK9A 3SWFA 1K73Q 1M6ZA 4EIJA 1AVYA 2Z5HA 4U3FE 1MFTA 1PGOA 5H2FV 1OAEA 1HJ3A 2L4DA 1W2EA 2OGUA 2YKOA 2HFED 2DW3A 2C0XA 2GIWA 1X9VA 3CMEP 2PCCB 4IL6H 5DJTB 4EYYQ 1EDLA 1LMSA 3KHUA 2D0WA 1DIPA 1Y47A 1SQQD 1CTZA 1GL2D 1AFOA 3D71A 4WQAA 1H33A 3QWOC 2KUBA 3EFFK 2W27A 1R5SA 3ZIYA 1RZ6A 2BCCD 5DJQC 2LITA 1YNRA 2XNXA 1U57A 3OJAB 5TJHA 2OYHA 2L91A
chains in the Genus database with same CATH topology
2QJYB 3O20A 1IQCA 4H0JA 1HJ4A 4FAVA 1CYJA 2CXBA 4U3FD 2YIUB 2Y0EA 3O1YA 4WQ9A 3SLEA 5B5EV 2Q3EA 1CXAA 2A06D 3H1KD 1IO3A 2DGEA 3PXTA 3GG2A 5CIFB 2C1DA 3M97X 3L4MA 3CYTI 1F1CA 3X39A 3SWSA 4AX3A 5KLVD 3CXHW 4EICA 1KIBA 3L74D 3ZBMA 1KYOW 1C2NA 1RZ5A 1GDVA 5KAIV 3ITKA 3OCDB 2DVHA 3PXSA 1E29A 1CC5A 2ZONG 2I8FA 4XXLA 1QL4A 1QL3A 1YEBA 1AOFA 1LFMA 5B6QA 1BCCD 1K3HA 1QKSA 3A0BV 4EIDA 4GEDB 1HH7A 3HQ6A 1I55A 1M70A 4FANA 1H1OA 1U74B 3WUIA 1L0ND 4O1WA 2RMZA 1FCDC 1GQ1A 1RAQA 2B12B 3TF5A 4LJIA 1H31A 1LC2A 1FI7A 2GB8B 1NMLA 4L3HA 1H32B 1IRVA 1CSVA 4KMGA 2GC4D 4PD4D 2OZ1B 2KNCB 2BCNB 1CO6A 1VYDA 1E8EA 3ZCFA 2C9XB 2AXTV 2CA4B 3A9FA 5TISV 2RN0A 3L72D 4WQEA 3KZIV 1CRJA 2PCBB 2V07A 1ETPA 5IY51 3A0HV 3TGUD 2Y0CA 3NWVA 1C7MA 4WQ8A 4EDFA 4L1QA 3VYMA 2B4ZA 4XYDB 1BGYD 2B0ZB 2AI5A 1HROA 1LC1A 1CRGA 1CSUA 1P84D 4PW9B 5DJQB 4DY9A 155CA 2JQRA 1EZVD 1CXCA 1CIFA 3RMZA 1CRCA 4Q5PA 1QYZA 3SVWA 1CIEA 2MHMA 1N15A 3L4OA 1BL9A 3L73D 5C9MA 1CRHA 1FI3A 2CE0A 3BCCD 1DIQC 2QJKB 1CHHA 4FA4A 351CA 2V08A 3RLMA 1YCCA 3WFEC 1CRYA 4EIEA 5KLIB 3DR0A 1NTKD 5B66V 5KKZB 1DVHA 1MZ4A 4K3IA 3SXTA 1GIWA 4IL6V 1GU2A 1YTCA 2K9JB 1F1FA 4WQ7A 3DMIA 1I6DA 1U75B 4WQCA 1PP9D 1AOQA 1CCRA 3WFCC 4UB6V 2N3BA 1HZVA 1EB7A 1NU1D 2C8SA 1C6OA 1SQXD 3H1JD 3WFBC 1WVEC 3CU4A 2FYUD 1HCMA 2EXVA 1J3SA 2N3YA 2ORLA 4AAMA 2N9YB 5E79V 4AALA 1W2LA 4FA1A 1CYCA 1SQBD 3PTZA 4MU8A 2O3JA 2C1VA 1QN2A 2FYNB 1I5TA 1IZL0 2YK3A 3CX5D 5EXQA 5DFSA 1CTYA 2HV4A 1AKKA 2GC7D 1C2RA 3CWBD 3MK7C 1I8PA 1YIQA 1CIHA 3OA8B 5C0ZA 3ZOOA 1H33B 1K3GA 1NMIA 1N9CA 1CSWA 3PHLA 1FJ0A 1CHJA 4D6TD 2YQBA 3NBTA 1CEDA 1SQVD 3PH2B 2MTAC 1CHIA 4QAOA 2ZXYA 2ZOOA 3PRJA 1NIRA 1DIIC 4Y5RA 5CIGB 2Y0DA 4A7PA 2YCCA 4J20A 1CIGA 5GTHV 4H0KA 4YE1A 3OCDA 2FWLA 3L70D 1YEAA 1C6SA 4RJTA 1CCHA 1CORA 5CICB 2BLFB 1N90A 2C1DB 4AAOA 1A56A 2D0SA 4PJ0V 3CXHD 1YFCA 3RN0A 1KB9D 1A8CA 1CSXA 1KYOD 1H9XA 4WQBA 1DW1A 1HZUA 4PWAA 3CP5A 3WU2V 1JDLA 2BPBB 1DVVA 1NTMD 1L9JC 3H1ID 3PXWA 1KX7A 1L0LD 1C52A 2C1UA 1H32A 3L71D 3ORVA 2OZ1A 2N9IA 4GYDA 4RSZA 1GKSA 2LIRA 4O1QA 1C75A 3ZOYA 1GJQA 4NFGB 1CRIA 2IBZD 2VHDA 1DT1A 1MG3D 2CA3B 3O5CA 1HRCA 1H31B 3H1HD 2JTIB 2KS1A 2ZBOA 1COTA 4L3GA 3HQ8A 3NBSA 1SQPD 1YICA 1S6VB 1MG2D 2CE1A 5CYTR 1R0QA 1NTZD 1IRWA 3MK7B 3WC8A 1CTJA 4FB1A 3WFDC 1DW3A 1RAPA 4P4QB 2JWAA 1DW0A 1S5LV 5CIEB 2QG4A 3JBTB 5CIHB 3TDKA 4FA5A 1DW2A 2B11B 1ZRTD 4WQDA 3VRDA 1W5CT 1FOCA 5DF5A 451CA 4N0KA 2N18B 2BH5X 2B10B 4EIFA 2FRCA 1CYIA 3TYIA 1M60A 5CIBB 5AURA 3PLNA 3RN1A 2N18C 4UB8V 2BH4X 1H9YA 1KB0A 1A2SA 1L9BC 1AYGA 1I54A 1KV9A 2QJPB 4AANA 2BGVX 1M6ZA 2N9JA 3O0RC 5H2FV 3VNWA 1OAEA 1NNOA 1HJ3A 1E2RA 2L4DA 3C2CA 5KAFV 1FI9A 1PPJD 1CNOA 2GIWA 2PCCB 5GTIV 3L75D 4V2KA 1LMSA 3KHUA 2D0WA 1I6EA 3ZOWA 1KX2A 1B7VA 1SQQD 3H1LD 3CX5W 5CIDB 1CTZA 2C2CA 3FWLA 3OA8A 3ZOXA 4WQAA 1H33A 1C6RA 1OCDA 2XTSB 1LS9A 4JCGA 3SJLA 3VMAA 2ZZS1 1I8OA 1ZZHA 2AIUA 4FA9A 1WEJF 3ZIYA 1RZ6A 2BCCD 3HQ9A 5DJQC 3GW6A 2LITA 3DP5A 1FHBA 1YNRA 1N50A 1HJ5A 1BE3D 5TJHA 2L91A 3HQ7A 2PACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJY B;  3O20 A;  1IQC A;  4H0J A;  1HJ4 A;  4FAV A;  1CYJ A;  2CXB A;  4U3F D;  2YIU B;  2Y0E A;  3O1Y A;  4WQ9 A;  3SLE A;  5B5E V;  2Q3E A;  1CXA A;  2A06 D;  3H1K D;  1IO3 A;  2DGE A;  3PXT A;  3GG2 A;  5CIF B;  2C1D A;  3M97 X;  3L4M A;  3CYT I;  1F1C A;  3X39 A;  3SWS A;  4AX3 A;  5KLV D;  3CXH W;  4EIC A;  1KIB A;  3L74 D;  3ZBM A;  1KYO W;  1C2N A;  1RZ5 A;  1GDV A;  5KAI V;  3ITK A;  3OCD B;  2DVH A;  3PXS A;  1E29 A;  1CC5 A;  2ZON G;  2I8F A;  4XXL A;  1QL4 A;  1QL3 A;  1YEB A;  1AOF A;  1LFM A;  5B6Q A;  1BCC D;  1K3H A;  1QKS A;  3A0B V;  4EID A;  4GED B;  1HH7 A;  3HQ6 A;  1I55 A;  1M70 A;  4FAN A;  1H1O A;  1U74 B;  3WUI A;  1L0N D;  4O1W A;  2RMZ A;  1FCD C;  1GQ1 A;  1RAQ A;  2B12 B;  3TF5 A;  4LJI A;  1H31 A;  1LC2 A;  1FI7 A;  2GB8 B;  1NML A;  4L3H A;  1H32 B;  1IRV A;  1CSV A;  4KMG A;  2GC4 D;  4PD4 D;  2OZ1 B;  2KNC B;  2BCN B;  1CO6 A;  1VYD A;  1E8E A;  3ZCF A;  2C9X B;  2AXT V;  2CA4 B;  3A9F A;  5TIS V;  2RN0 A;  3L72 D;  4WQE A;  3KZI V;  1CRJ A;  2PCB B;  2V07 A;  1ETP A;  5IY5 1;  3A0H V;  3TGU D;  2Y0C A;  3NWV A;  1C7M A;  4WQ8 A;  4EDF A;  4L1Q A;  3VYM A;  2B4Z A;  4XYD B;  1BGY D;  2B0Z B;  2AI5 A;  1HRO A;  1LC1 A;  1CRG A;  1CSU A;  1P84 D;  4PW9 B;  5DJQ B;  4DY9 A;  155C A;  2JQR A;  1EZV D;  1CXC A;  1CIF A;  3RMZ A;  1CRC A;  4Q5P A;  1QYZ A;  3SVW A;  1CIE A;  2MHM A;  1N15 A;  3L4O A;  1BL9 A;  3L73 D;  5C9M A;  1CRH A;  1FI3 A;  2CE0 A;  3BCC D;  1DIQ C;  2QJK B;  1CHH A;  4FA4 A;  351C A;  2V08 A;  3RLM A;  1YCC A;  3WFE C;  1CRY A;  4EIE A;  5KLI B;  3DR0 A;  1NTK D;  5B66 V;  5KKZ B;  1DVH A;  1MZ4 A;  4K3I A;  3SXT A;  1GIW A;  4IL6 V;  1GU2 A;  1YTC A;  2K9J B;  1F1F A;  4WQ7 A;  3DMI A;  1I6D A;  1U75 B;  4WQC A;  1PP9 D;  1AOQ A;  1CCR A;  3WFC C;  4UB6 V;  2N3B A;  1HZV A;  1EB7 A;  1NU1 D;  2C8S A;  1C6O A;  1SQX D;  3H1J D;  3WFB C;  1WVE C;  3CU4 A;  2FYU D;  1HCM A;  2EXV A;  1J3S A;  2N3Y A;  2ORL A;  4AAM A;  2N9Y B;  5E79 V;  4AAL A;  1W2L A;  4FA1 A;  1CYC A;  1SQB D;  3PTZ A;  4MU8 A;  2O3J A;  2C1V A;  1QN2 A;  2FYN B;  1I5T A;  1IZL 0;  2YK3 A;  3CX5 D;  5EXQ A;  5DFS A;  1CTY A;  2HV4 A;  1AKK A;  2GC7 D;  1C2R A;  3CWB D;  3MK7 C;  1I8P A;  1YIQ A;  1CIH A;  3OA8 B;  5C0Z A;  3ZOO A;  1H33 B;  1K3G A;  1NMI A;  1N9C A;  1CSW A;  3PHL A;  1FJ0 A;  1CHJ A;  4D6T D;  2YQB A;  3NBT A;  1CED A;  1SQV D;  3PH2 B;  2MTA C;  1CHI A;  4QAO A;  2ZXY A;  2ZOO A;  3PRJ A;  1NIR A;  1DII C;  4Y5R A;  5CIG B;  2Y0D A;  4A7P A;  2YCC A;  4J20 A;  1CIG A;  5GTH V;  4H0K A;  4YE1 A;  3OCD A;  2FWL A;  3L70 D;  1YEA A;  1C6S A;  4RJT A;  1CCH A;  1COR A;  5CIC B;  2BLF B;  1N90 A;  2C1D B;  4AAO A;  1A56 A;  2D0S A;  4PJ0 V;  3CXH D;  1YFC A;  3RN0 A;  1KB9 D;  1A8C A;  1CSX A;  1KYO D;  1H9X A;  4WQB A;  1DW1 A;  1HZU A;  4PWA A;  3CP5 A;  3WU2 V;  1JDL A;  2BPB B;  1DVV A;  1NTM D;  1L9J C;  3H1I D;  3PXW A;  1KX7 A;  1L0L D;  1C52 A;  2C1U A;  1H32 A;  3L71 D;  3ORV A;  2OZ1 A;  2N9I A;  4GYD A;  4RSZ A;  1GKS A;  2LIR A;  4O1Q A;  1C75 A;  3ZOY A;  1GJQ A;  4NFG B;  1CRI A;  2IBZ D;  2VHD A;  1DT1 A;  1MG3 D;  2CA3 B;  3O5C A;  1HRC A;  1H31 B;  3H1H D;  2JTI B;  2KS1 A;  2ZBO A;  1COT A;  4L3G A;  3HQ8 A;  3NBS A;  1SQP D;  1YIC A;  1S6V B;  1MG2 D;  2CE1 A;  5CYT R;  1R0Q A;  1NTZ D;  1IRW A;  3MK7 B;  3WC8 A;  1CTJ A;  4FB1 A;  3WFD C;  1DW3 A;  1RAP A;  4P4Q B;  2JWA A;  1DW0 A;  1S5L V;  5CIE B;  2QG4 A;  3JBT B;  5CIH B;  3TDK A;  4FA5 A;  1DW2 A;  2B11 B;  1ZRT D;  4WQD A;  3VRD A;  1W5C T;  1FOC A;  5DF5 A;  451C A;  4N0K A;  2N18 B;  2BH5 X;  2B10 B;  4EIF A;  2FRC A;  1CYI A;  3TYI A;  1M60 A;  5CIB B;  5AUR A;  3PLN A;  3RN1 A;  2N18 C;  4UB8 V;  2BH4 X;  1H9Y A;  1KB0 A;  1A2S A;  1L9B C;  1AYG A;  1I54 A;  1KV9 A;  2QJP B;  4AAN A;  2BGV X;  1M6Z A;  2N9J A;  3O0R C;  5H2F V;  3VNW A;  1OAE A;  1NNO A;  1HJ3 A;  1E2R A;  2L4D A;  3C2C A;  5KAF V;  1FI9 A;  1PPJ D;  1CNO A;  2GIW A;  2PCC B;  5GTI V;  3L75 D;  4V2K A;  1LMS A;  3KHU A;  2D0W A;  1I6E A;  3ZOW A;  1KX2 A;  1B7V A;  1SQQ D;  3H1L D;  3CX5 W;  5CID B;  1CTZ A;  2C2C A;  3FWL A;  3OA8 A;  3ZOX A;  4WQA A;  1H33 A;  1C6R A;  1OCD A;  2XTS B;  1LS9 A;  4JCG A;  3SJL A;  3VMA A;  2ZZS 1;  1I8O A;  1ZZH A;  2AIU A;  4FA9 A;  1WEJ F;  3ZIY A;  1RZ6 A;  2BCC D;  3HQ9 A;  5DJQ C;  3GW6 A;  2LIT A;  3DP5 A;  1FHB A;  1YNR A;  1N50 A;  1HJ5 A;  1BE3 D;  5TJH A;  2L91 A;  3HQ7 A;  2PAC A; 
#chains in the Genus database with same CATH topology
 1L4A B;  4O9B A;  5TIS E;  1FZC A;  2OYI B;  2CXB A;  1OMI A;  2Y0E A;  2W6J H;  3O1Y A;  4WQ9 A;  3U1A A;  5B5E V;  2WTY A;  2A06 D;  1SQQ K;  3GG2 A;  2W6A A;  2ZXX A;  2BAS A;  3CYT I;  1MZ9 A;  1BE3 J;  3X39 A;  3GHG B;  2OQQ A;  1BSN A;  1LTJ A;  4DT0 A;  1OWA A;  4WY4 A;  1PZQ A;  1PPJ E;  3L74 D;  3ZBM A;  3BRT B;  1OVV A;  3HD7 D;  2JR8 A;  5KAI V;  4CPG A;  5AW8 B;  2FBW C;  2Q5U A;  3A7O A;  3PXS A;  1PPJ G;  1RE4 A;  3H1L E;  2H8P D;  1KYO I;  2ZON G;  2I8F A;  4W80 A;  1QL4 A;  1GU5 A;  2GM4 A;  3H1L G;  1ZLL A;  2ZYG A;  1BCC D;  4EID A;  2R32 A;  4GED B;  1I55 A;  1L0L G;  1U74 B;  1HJ0 A;  2P67 A;  1H31 A;  2IDB A;  2NRG A;  3WU2 H;  2FYU K;  1OW6 A;  1IRV A;  5CMZ A;  4PD4 D;  2GC4 D;  5E79 E;  2ZYD A;  4IOI H;  2KSE A;  4N78 D;  1L4A D;  1X22 A;  2AXT V;  3A9F A;  5TIS V;  3H1K E;  2PRR A;  2HR3 A;  1FJK A;  2PCB B;  2V07 A;  5IY5 1;  2YO2 A;  1GK6 A;  2Y0C A;  3NWV A;  3H1K G;  4Y99 C;  1BGY D;  5KLV E;  5DJQ B;  1VPC A;  5KLV G;  1CRC A;  4DCK A;  1K8A Q;  4I6M C;  1CIE A;  1QVG O;  3L73 D;  2YKQ A;  3D70 A;  2HOD A;  2K3R A;  3IF4 A;  4FA4 A;  4BRY B;  2FFD A;  351C A;  3MZW B;  3RLM A;  3L4F A;  1N86 A;  4LLH A;  2XND H;  5CJ0 A;  5KKZ B;  3RK3 C;  3G71 P;  1MZ4 A;  3BVH A;  2YXR B;  3TNU A;  2P10 A;  1F1F A;  3DMI A;  3UIA A;  1U75 B;  4OGQ C;  1PP9 D;  3WFC C;  1BDC A;  2N3B A;  1EB7 A;  5KJ7 C;  2OYO A;  1SQX D;  3H1J D;  2M0B A;  1NGM B;  3CCL P;  1N7S C;  5GTI E;  2ORL A;  1VDF A;  3CX5 H;  4C7R A;  3L37 A;  5E79 V;  5APU A;  1RE3 C;  4FA1 A;  3ABV C;  3S1K A;  1SQB D;  2BEZ F;  2C1V A;  2Z4E A;  1T3U A;  1JM0 A;  1EZV E;  5H2F H;  1IZL 0;  2YK3 A;  2FYU J;  2HV4 A;  1AKK A;  2GC7 D;  3CWB D;  1HBW A;  1YI2 P;  1OXZ A;  3BCC E;  1AJY A;  2A45 H;  3RBX A;  1ZR2 A;  2HPC A;  3AEC C;  2G8Y A;  3BCC G;  3JCU H;  1BE3 G;  1T3J A;  1OZH A;  3P32 A;  1LP1 B;  5APT A;  4QAO A;  2ZXY A;  3PRJ A;  1NTK G;  3EWK A;  2Q6Q A;  3CXH H;  3T97 A;  4JYC A;  3OCD A;  3IN6 A;  1YEA A;  2OTK E;  1CCH A;  1NU1 G;  1YIT P;  2CPS A;  5CIC B;  1M7L A;  2NPS B;  1KIL C;  3Q5R A;  1CSX A;  5B5E H;  2KZJ A;  1H9X A;  2XU6 A;  1EDJ A;  3A0B E;  3QH9 A;  1JDL A;  2BPB B;  3RK3 B;  4H44 B;  3BAT A;  3L70 J;  4Y28 J;  5CCH C;  3CCS P;  1L0L D;  4OGQ B;  1C52 A;  2C1U A;  1H32 A;  2FKW B;  3F89 A;  3ORV A;  2OZ1 A;  4GOD A;  3WUV A;  5KAI H;  1GKS A;  3RL0 g;  4AUW A;  1N73 A;  3ZOY A;  1GJQ A;  2OTL P;  1RF1 C;  3E1I A;  1N7S B;  2IBZ D;  1LTG C;  2AEM A;  4IFM A;  1KFM A;  2R3C A;  1NTM J;  4D6T G;  3H1I J;  3OA7 A;  3A0H E;  1EXI A;  2QJY C;  3L71 J;  1VF5 D;  1COT A;  1Q86 Q;  1S6V B;  1BDD A;  3CC7 P;  2CE1 A;  1R0Q A;  1R8E A;  2QIW A;  2K88 A;  1U7J A;  1L0L K;  2JO1 A;  1LWU A;  4JPZ B;  3WFD C;  1DW3 A;  1UIX A;  4P4Q B;  1KYO E;  1WMK A;  5TIS H;  4H13 C;  2JWA A;  1DW0 A;  5CIE B;  5CIH B;  2E76 D;  1USD A;  3TDK A;  1JCC A;  2M5A A;  2B11 B;  1VQN P;  2K9J A;  4WQD A;  3VRD A;  2WPV B;  3MUD A;  2WIT A;  1W5C T;  451C A;  4N0K A;  2BH5 X;  4EIF A;  4MN4 C;  2FRC A;  2E75 C;  4L75 A;  3IAO A;  5AUR A;  1HH0 A;  2Q3I A;  1NKZ B;  3PLN A;  3RN1 A;  2N18 C;  4UB8 V;  1H9Y A;  1SLQ A;  1A2S A;  5KJ7 D;  1Q90 D;  1WT6 A;  4AAN A;  2BGV X;  1ZW0 A;  2IBZ I;  2E42 A;  5KLV K;  1N7S D;  1GL2 A;  1KIL B;  3H1H E;  3VNW A;  3CMA P;  1NNO A;  4W7Z A;  3NXS A;  1E2R A;  2A06 E;  4K35 A;  2N1T C;  1PV3 A;  2KI7 B;  5AVU B;  3RK2 C;  1FI9 A;  1NTZ E;  1FE6 A;  1M1J C;  1I6E A;  3ZOW A;  1KX2 A;  5CID B;  2C2C A;  3OA8 A;  3JSV C;  4R4M A;  1NTZ G;  5AVR B;  1DEB A;  1IFM A;  1FU1 A;  3KXD A;  1OCD A;  2XTS B;  2QM8 A;  1LS9 A;  1RF1 B;  1ZZH A;  2B9B A;  5E79 H;  3RL0 C;  3HQ9 A;  3GW6 A;  3DP5 A;  5AW1 B;  1ZRT E;  1FS0 E;  1X8Y A;  4R4L A;  4TLF A;  1BCC E;  1BE3 D;  1FDM A;  2PAC A;  3H1L J;  2QJY B;  2JDI H;  1LT1 A;  2ZJS E;  1HJ4 A;  4FAV A;  1CYJ A;  3NTN A;  5CJ4 A;  2YIU B;  3VMX A;  2ITA A;  2QJK C;  2WSF H;  1L0L J;  3O6Q B;  3HD7 A;  5KLI C;  2DGE A;  5CIF B;  1IFJ A;  1KZU B;  3U59 A;  4Z1M H;  1KQF B;  2C9N Y;  3SWS A;  4N78 E;  2IPP A;  2ZFC A;  1NAF A;  5AW6 B;  4H13 B;  2LXB A;  3L70 G;  2M8R A;  2ZYA A;  5AVW B;  2QM7 A;  1KIL D;  3D0W A;  3GHG C;  1DD4 A;  3Q5P A;  1QVF O;  4DOJ A;  1CC5 A;  3L75 G;  3H1K J;  1KB9 I;  1RY3 A;  1A02 J;  4XXL A;  1OVR A;  1YEB A;  1AOF A;  5B6Q A;  2J59 M;  2FYZ A;  1NTK K;  3A5T A;  1DEE G;  1YJ9 P;  1NTM G;  1Z56 A;  1HH7 A;  5KLV J;  2WSF J;  4FAN A;  1L4A A;  4O1W A;  4OVN F;  1NU1 K;  3HTK A;  1FI7 A;  1K04 A;  1Q82 Q;  5AW2 B;  3M9H A;  3S4R A;  2Y9Y A;  2XDJ A;  1KOR A;  2N1T B;  2E74 C;  3WMM 0;  2M3B A;  3RK2 B;  2KNC B;  4JF7 A;  1P84 H;  1WRG A;  2IYO A;  1M1J B;  4U3F G;  1NH4 A;  4IL6 X;  3NFQ A;  1CRJ A;  1ETP A;  5CBN A;  4WQ8 A;  4L1Q A;  5DJU B;  1SQX E;  2B4Z A;  4XYD B;  1IJD B;  2B0Z B;  3VMZ A;  4BWN A;  1H8A A;  1CSU A;  4PW9 B;  4L74 A;  3RL0 B;  3R2P A;  1G2C B;  1NOH A;  4DY9 A;  1JOC A;  2HLO A;  4H13 D;  1MKM A;  3RMZ A;  4Q5P A;  1QYZ A;  1QLE D;  2GUV A;  1CRH A;  2PAJ A;  3HUS B;  2KK7 A;  2W8Z A;  2QJK B;  1CHH A;  3G4S P;  1JY2 P;  3VYI A;  5AW4 B;  1S1C X;  2E75 D;  2V08 A;  3C1L A;  3WFE C;  4TT3 H;  3K5B A;  5KLI B;  1LTJ C;  3CCV P;  1L0N E;  2KSJ A;  2RKL A;  3SFD C;  1W2B O;  1DVH A;  1FZB A;  3P7K A;  5GTH E;  3SXT A;  1GIW A;  1M56 D;  3M0D A;  1L0N G;  2QVA A;  2I1K A;  2CK3 H;  1X0T A;  1HTL C;  2QEX P;  3MP7 B;  2N9B A;  4RES B;  5KKZ C;  3BCC J;  1A02 F;  1JY2 N;  1GTW A;  3CU4 A;  1JY3 O;  1GK4 A;  3H32 A;  2FYU D;  2EXV A;  3L72 E;  2N3Y A;  1LTB C;  2O01 H;  1NTK J;  3TGU E;  1JB0 J;  2LKM A;  3G6E P;  4XFJ A;  4UB8 H;  1CYC A;  3TGU G;  3HRN A;  1QN2 A;  2Y9Z A;  1NU1 J;  2YO3 A;  2ZVN B;  1URQ C;  3M9B A;  3CI9 A;  1FC2 C;  3CX5 D;  3L36 A;  3RL0 D;  3VN0 A;  3EFG A;  1Y9B A;  2AEF A;  1C2R A;  2JEE A;  2E74 B;  3CCQ P;  2W90 A;  1DX7 A;  1E79 H;  5C0Z A;  1S3J A;  1IZN B;  3GF7 A;  1W5C E;  1H33 B;  2WQY C;  2H43 A;  1NMI A;  1CW5 A;  1CSW A;  1HGZ A;  1KMI Z;  3CC2 P;  3NMD A;  2UWJ E;  3PH2 B;  2IX7 C;  2O01 J;  1VQ9 P;  1DII C;  2OYH B;  2JP3 A;  4Y5R A;  5CIG B;  5AW7 B;  2Y0D A;  2AXC A;  1NVO A;  2R5B A;  5GTH V;  1KYO H;  5AW0 B;  4H0K A;  1FZC B;  1YYC A;  1FDI A;  3L70 D;  1C6S A;  4D6T J;  2PGD A;  1M1K Q;  3V6I A;  3W68 A;  2KS1 B;  1VQK P;  3I56 P;  2MKV A;  3M0A A;  3P8C D;  3CXH D;  4B86 A;  1YFC A;  1JMB A;  3Q3D A;  1PGP A;  1XTG B;  2WSC H;  2NZ2 A;  5CCG C;  4DJG A;  1LTJ B;  1DW1 A;  1HZU A;  2NPS C;  4WY4 B;  1BSH A;  3A2A A;  4ZMD A;  1NTM D;  1LNQ A;  3H1I D;  1HJB A;  3L71 D;  1PGQ A;  2HG5 D;  4BXL A;  1ZOY C;  1S5L X;  4H44 C;  2N9I A;  4RSZ A;  2LIR A;  1C75 A;  1NAY A;  2JJL A;  1G1J A;  2VHD A;  1MG3 D;  3V2N A;  2CA3 B;  1PL5 A;  1SQV E;  4JBZ A;  3O5C A;  1SFC C;  4PD4 I;  2KLV A;  1SQV G;  4U7J A;  2XZR A;  1H31 B;  1JTH B;  3CCJ P;  2ZBO A;  1HVV A;  1NJI Q;  4L3G A;  3HQ8 A;  2KIK A;  1YIC A;  1URQ B;  2WSC J;  2YKP A;  3LID A;  1S9K E;  1MG2 D;  1NTM K;  3E1R A;  2KP8 A;  4N6J A;  1IFI A;  1NO4 A;  1CTJ A;  2ZVO B;  1USE A;  2YMY A;  1KB9 E;  1RAP A;  3H1H J;  2IYP A;  1YQ4 C;  3CCE P;  1EZV G;  1OVU A;  1G1I A;  2IZ1 A;  3JC2 2;  1QGK B;  3CXH I;  4FA5 A;  1GW4 A;  5KJ7 A;  1NTZ J;  5DF5 A;  3AE3 C;  4PV1 C;  1YJN P;  1MUU A;  2B10 B;  4IL6 E;  2R5D A;  2C0W A;  3TYI A;  1RE3 A;  2HOD B;  1YBK A;  1X79 B;  2FFD B;  2BH4 X;  1YTZ I;  3Q5S A;  1KB0 A;  3B5N C;  1L9B C;  1AYG A;  3AE8 C;  1IFN A;  1AVO A;  1ZN5 A;  5M1B A;  2N9J A;  1H88 A;  3TNU B;  4DZO A;  4EOT A;  3VOP A;  2RH0 A;  2YMK A;  4LGD E;  1MV8 A;  2WT7 A;  5AVZ B;  1SQP E;  3M06 A;  1PPJ D;  1CNO A;  1RF0 C;  2W6B A;  1ZME C;  5GTI V;  4V2K A;  2J5U A;  3ZDM A;  3BAS A;  3H1L D;  1URQ D;  3CX5 W;  3SFE C;  3ZOX A;  2ZXE B;  1EC5 A;  4C7N B;  1C6R A;  3WUU A;  1L0N K;  3SJL A;  3VMA A;  2JKV A;  2KOG A;  2ZZS 1;  1I8O A;  3AEE C;  1Q7Y Q;  4RKU J;  4FA9 A;  1WEJ F;  4KJM A;  1K05 A;  1SVF A;  3MHV A;  1FHB A;  1N50 A;  1SFC B;  3L75 J;  1HJ5 A;  3KQG A;  1VQ8 P;  2QRX A;  3O8Z A;  3TSI A;  3CLQ A;  1IQC A;  4H0J A;  3BRV B;  5APY A;  1LWU C;  1KIL A;  2HPC B;  3VMY A;  2QE7 H;  1IO4 A;  2Q3E A;  3USS A;  1CXA A;  4OH8 B;  3HE4 A;  3H1K D;  1IO3 A;  3PXT A;  2C1D A;  3M97 X;  5APV A;  1CI6 B;  2YIU C;  5CBO A;  5APQ A;  3FX0 A;  4ZKU A;  3SWY A;  3PP5 A;  1QEX A;  4JQ0 D;  4PJ0 E;  5KLV D;  1AV1 A;  3CXH W;  2B87 A;  1KIB A;  3T97 B;  4U3F J;  3KPE A;  1GDV A;  3ITK A;  5CCG D;  4YPC A;  3OCD B;  1T6A A;  5AVQ B;  2WPQ A;  1E29 A;  2NPS D;  2M3E A;  1SQQ E;  4PV1 B;  4GIF A;  5GTH H;  3V5B A;  3LIE A;  1LT9 C;  2QA4 P;  1SQQ G;  1LFM A;  5B66 E;  1K3H A;  2O1J A;  4WBA A;  4H0L C;  3A0B V;  4KHX A;  2KB7 P;  3Q2Y A;  3B5N B;  3RK3 D;  4GOF A;  1M70 A;  4H44 D;  2BCC E;  1H1O A;  3WUI A;  3MGN A;  2WVR A;  4N3Y B;  4OGQ D;  4UB6 E;  1FCD C;  5AW5 B;  3TF5 A;  5BVZ A;  2BCC G;  3IR9 A;  5KTB A;  2GB8 B;  4NPF X;  1SFC D;  1H32 B;  4EI2 A;  1YJW P;  2E5T A;  2D2C B;  5APW A;  1CSV A;  2OZ1 B;  1LJ2 A;  3TK1 A;  1E8E A;  1N73 B;  3ZCF A;  2RN0 A;  2AEJ A;  3H1H G;  4WQE A;  1L0N J;  3II6 A;  3A0H V;  1C7M A;  3VTP C;  2A06 G;  4EDF A;  3VYM A;  2O01 N;  2IFN A;  2AI5 A;  3C9I A;  5C39 A;  1P84 D;  3L74 E;  2I1J A;  3LW5 H;  3H6P A;  155C A;  2JQR A;  1S5L E;  1EZV D;  3L74 G;  1CXC A;  1CIF A;  3HD7 C;  3L72 J;  4GOE A;  2MHM A;  1N15 A;  5C9M A;  3TGU J;  3CD6 P;  3BCC D;  1LWU B;  1SQV K;  1SS1 A;  4PV1 D;  2KZI A;  1YCC A;  1BCC G;  4EIE A;  3HUS C;  1NTK D;  5B66 V;  4GT1 A;  1OW8 A;  3B71 A;  4I7Z B;  3B5N D;  1GU2 A;  2K9J B;  3AEA C;  4WQ7 A;  2Z5I A;  4UB6 V;  4PD4 E;  1IFD A;  1NU1 D;  2C8S A;  4AYC A;  1C6O A;  3WFB C;  3LW5 J;  1IK7 A;  1HCM A;  1HF9 A;  4AAM A;  1FDO A;  5BU5 A;  1LT9 B;  4AAL A;  1H0T B;  1W2L A;  1FOS E;  2PFX A;  2OAR A;  1BGY E;  3AE9 C;  1GMJ A;  4H0L B;  1ZV8 A;  4NPE A;  4MU8 A;  2KYV A;  3C8V A;  5APS A;  1BGY G;  2FYN B;  5CCH D;  1LTI C;  1P84 I;  2JWD A;  1I5T A;  2K1A A;  2KXP B;  5EXQ A;  3L35 A;  3V4Q A;  5DFS A;  1GW3 A;  2B89 A;  2SPZ A;  1TU3 F;  2CPB A;  3L73 E;  1NYH A;  2OYI A;  3OA8 B;  5GTI H;  3L73 G;  1K3G A;  1N9C A;  1YQ3 C;  1FJ0 A;  1CHJ A;  4D6T D;  1QL2 A;  3L71 E;  2WZ7 A;  3M91 A;  1CED A;  3GHG A;  2ZOO A;  2PP6 A;  1PP9 E;  1NKN A;  1PIX A;  4A7P A;  1OFC X;  1DD3 A;  1KB9 H;  1PP9 G;  3H1J E;  2P58 A;  2FWL A;  2OYH C;  1NHL A;  3HD7 B;  1SQX G;  5KAI E;  3H1J G;  1SQV J;  1FZC C;  2BLF B;  2YNY A;  1A56 A;  3SSU A;  3V4W A;  4ZNC A;  1VQP P;  1LTA C;  1SQB E;  3M0D C;  4YXD C;  1KYO D;  3PJS K;  4IFF A;  2XV5 A;  1N8R Q;  4PWA A;  1SQB G;  3OAK A;  4H0L D;  3RGU A;  2WSS H;  1EDK A;  3CWB E;  4WY4 C;  3AE4 C;  1Q2N A;  4WB4 A;  4C46 A;  4GYD A;  5APX A;  3CWB G;  3M9Q A;  4NFG B;  5BU8 B;  1RE4 C;  4OWF A;  4LC1 A;  4I1L A;  2C9L Y;  2AXT E;  3CCM P;  2WPR A;  5KAF E;  2N1T D;  3A0B H;  3RK2 D;  3H1H D;  3HE5 B;  3HTK B;  3AEF C;  4L73 A;  2KS1 A;  1LTS C;  3NBS A;  3L72 G;  3KYQ A;  5CYT R;  1NTZ D;  1LTT C;  1IFP A;  2I8D A;  2POH A;  3WC8 A;  2P2U A;  4NPD A;  4BRY A;  1S4X A;  1KTM A;  2QG4 A;  3A0H H;  1SQP J;  1MFZ A;  4YTP C;  1ZRT D;  1L0L E;  2P1J A;  1KQL A;  3B4S A;  4M3L A;  1VQ4 P;  3AE5 C;  4HJG H;  1CYI A;  1JUN A;  1N7L A;  1M60 A;  4PJ0 H;  2IBZ E;  2HYN A;  1JTH A;  1NTZ K;  4IFD K;  1I54 A;  1VL2 A;  3MD0 A;  1GZL A;  2IBZ G;  5AW3 B;  2V7Q H;  3N4X A;  1URQ A;  3V2Q A;  3O0R C;  3KDP B;  2FFD C;  2IFM A;  4XE5 B;  5AVV B;  1JY2 O;  1Y8A A;  2FXO A;  3C2C A;  5B66 H;  2WPS A;  5KAF V;  1AA0 A;  3CC4 P;  3F5H A;  3L75 D;  1VF5 C;  1JCD A;  2ZAE B;  3WUT A;  3H32 B;  2V4H A;  1B7V A;  4UB6 H;  3B8E B;  3FWL A;  4GDO A;  4GKG A;  4JCG A;  3I55 P;  2AIU A;  3CX5 I;  1LGH B;  1LP1 A;  3D6Y A;  2FXP A;  1FZE A;  1QL1 A;  1K9M Q;  1EQ7 A;  2E43 A;  2ZT9 C;  2E74 D;  1VQ7 P;  2E76 C;  2V7Q J;  3HQ7 A;  3RK3 E;  1SQQ J;  3O20 A;  1IC2 A;  1T2K C;  1PFI A;  3AE7 C;  3OW2 O;  1CZQ A;  3KZI E;  1M90 Q;  4U3F D;  1M8O B;  3SLE A;  2BCC J;  1S5L H;  5CCG A;  1D7M A;  2NPS A;  2A45 I;  3SWK A;  3L4M A;  4HH2 A;  1F1C A;  5AVS B;  4AX3 A;  1XTC C;  1NWQ A;  4EIC A;  1OIP A;  3G9R A;  1QX8 A;  1KYO W;  1C2N A;  4K3A A;  1RZ5 A;  4C7N A;  3I5C A;  1YIJ P;  2DVH A;  1T8Z A;  2YXQ B;  1P84 E;  1R5L A;  1YHQ P;  3MTU E;  1FBM A;  1QL3 A;  3N7N A;  1SFC A;  3IFM A;  1N7S A;  1QKS A;  4WY4 D;  2OTJ P;  4PD4 H;  2IZ0 A;  3GF3 A;  3HQ6 A;  3L74 J;  1KN7 A;  1L0N D;  2R44 A;  1YTZ T;  2RMZ A;  1EDI A;  1GQ1 A;  1RAQ A;  2B12 B;  1BE3 E;  4LJI A;  4HYT B;  1OX3 A;  1EXJ A;  1LC2 A;  1SQX K;  1NML A;  1FAV A;  4L3H A;  4AQR D;  3CCU P;  2H88 C;  1NTK E;  4KMG A;  1CI6 A;  2BCN B;  1BCC J;  1CO6 A;  5AVY B;  1VF5 B;  2K37 A;  1VYD A;  1ZP0 C;  4Y99 B;  5AW9 B;  1J1E C;  2C9X B;  2CA4 B;  2D2C C;  3L72 D;  3KZI V;  1SQB K;  2H89 C;  3VP9 A;  3CCR P;  1NU1 E;  3TGU D;  1VQO P;  2Q7C A;  1N73 C;  1SQP G;  1HRO A;  1LC1 A;  1CRG A;  4XA4 A;  3Q1M A;  3AE2 C;  1KIL E;  1GDT A;  3FXE A;  1S72 P;  4W7Y A;  3U1C A;  2ZT9 B;  1OW7 A;  2E76 B;  3S9O A;  1HGV A;  3SVW A;  1J2J B;  3FGA D;  3B5N A;  1FZG A;  3L4O A;  1BL9 A;  1FI3 A;  2CE0 A;  1DIQ C;  1BGY J;  1L2P A;  1CRY A;  1J1D C;  2E5Y A;  1DH3 A;  1PGJ A;  3DR0 A;  4L76 A;  4UB8 E;  1KQS O;  3V2P A;  1RF0 A;  4K3I A;  4IL6 V;  1YTC A;  1I6D A;  4WQC A;  4D6T E;  1VQM P;  1AOQ A;  1CCR A;  3L73 J;  1AQT A;  1HZV A;  1KV4 A;  4I7Z C;  1KQG B;  5CCH A;  3MUD C;  1WVE C;  2GA1 A;  3CL3 D;  1ZXG A;  1J3S A;  1UII A;  2N9Y B;  2W83 C;  1KFN A;  3PH0 A;  5EFW B;  3WU2 E;  1RF1 A;  4WVZ A;  4JYB A;  3PTZ A;  1PP9 J;  2O3J A;  4I2L C;  2XKM A;  2WT7 B;  3A3Y B;  1RHZ B;  1SP4 A;  1SQX J;  3H1J J;  1GL2 C;  1VQ5 P;  3AEB C;  1CTY A;  2AXT H;  2P7J A;  2FYN C;  4QMA A;  3MK7 C;  5KAF H;  1I8P A;  2ZT9 D;  1YIQ A;  1CIH A;  3ZOO A;  3O6Q A;  3D6Z A;  1FZF A;  1SQB J;  4HKZ H;  3VP8 A;  1T2K D;  3GLM A;  3PHL A;  1J1E B;  2FY8 A;  2KLU A;  2G3A A;  2WMM A;  2YQB A;  3NBT A;  1JO5 A;  2MJZ A;  1SQV D;  1HUC A;  2MTA C;  1CHI A;  1NIR A;  2LXC B;  3CWB J;  2YCC A;  4J20 A;  3MIW A;  5AVT B;  3AEG C;  1E5W A;  1CSB A;  1CIG A;  1LT9 A;  4KT0 J;  1H0T A;  4YE1 A;  3TYY A;  4RO0 A;  1FOS F;  1S9K D;  2FYU E;  4RJT A;  3V2R A;  1COR A;  4WWI A;  3FWN A;  1M57 D;  2QJP C;  3HE4 B;  2FYU G;  2VRS A;  1AQ5 A;  1RQV A;  1S2E A;  1N90 A;  2C1D B;  1FZA A;  4AAO A;  2J58 A;  1KD1 Q;  2D0S A;  3AED C;  4PJ0 V;  1U7M A;  3RN0 A;  1KB9 D;  1A8C A;  1JMM A;  1J1D B;  4WQB A;  1GD2 E;  3CP5 A;  3WU2 V;  1RH5 B;  1DVV A;  2B87 B;  5K5G B;  3CX5 E;  5CHX A;  1L9J C;  3PXW A;  1KX7 A;  2N1T A;  1H89 A;  2KNC A;  2L5G B;  3H25 A;  2M5A B;  3R4Y A;  3CPW O;  1JEK A;  4O1Q A;  2R3S A;  1M1J A;  1CRI A;  2WSE H;  5H2F E;  5L8R J;  1DT1 A;  2O1K A;  3RBZ A;  1VQ6 P;  3AE6 C;  4YXW H;  1Q81 Q;  2FXM A;  1HRC A;  1VQL P;  2D2C D;  5AVX B;  4ASV A;  2JTI B;  4HB1 A;  1JNM A;  1L4A C;  1G2C A;  3JCU E;  2A45 G;  1SQP D;  3EQ2 A;  2OYI C;  4ASW A;  1GL2 B;  3L70 E;  2K9Y A;  4ZKP A;  1RQU A;  3AE1 C;  1HWT C;  2WWW A;  2LR2 A;  1IRW A;  3MK7 B;  4FB1 A;  2H7H A;  3HUS A;  2B88 A;  3P8C E;  3CXH E;  1KC8 Q;  3L75 E;  2QSI A;  1GU4 A;  3P8M C;  3G3Z A;  1ZR4 A;  1EZV I;  3KZI H;  1FJP A;  1S5L V;  3GMA A;  3JBT B;  2WSE J;  1NTM E;  1DW2 A;  2E75 B;  1JY3 P;  3H1I E;  2GUS A;  3FXD A;  1FOC A;  2N18 B;  3H1I G;  2Q1K A;  5B5E E;  2BEQ D;  3W67 A;  1N2D C;  3L71 G;  5CIB B;  3E7K A;  1SQP K;  3HE5 A;  2Q9I A;  1JY3 N;  1KV9 A;  2QJP B;  1IK9 A;  3SWF A;  1K73 Q;  1M6Z A;  4EIJ A;  1AVY A;  2Z5H A;  4U3F E;  1MFT A;  1PGO A;  5H2F V;  1OAE A;  1HJ3 A;  2L4D A;  1W2E A;  2OGU A;  2YKO A;  2HFE D;  2DW3 A;  2C0X A;  2GIW A;  1X9V A;  3CME P;  2PCC B;  4IL6 H;  5DJT B;  4EYY Q;  1EDL A;  1LMS A;  3KHU A;  2D0W A;  1DIP A;  1Y47 A;  1SQQ D;  1CTZ A;  1GL2 D;  1AFO A;  3D71 A;  4WQA A;  1H33 A;  3QWO C;  2KUB A;  3EFF K;  2W27 A;  1R5S A;  3ZIY A;  1RZ6 A;  2BCC D;  5DJQ C;  2LIT A;  1YNR A;  2XNX A;  1U57 A;  3OJA B;  5TJH A;  2OYH A;  2L91 A; 
#chains in the Genus database with same CATH homology
 2QJY B;  3O20 A;  1IQC A;  4H0J A;  1HJ4 A;  4FAV A;  1CYJ A;  2CXB A;  4U3F D;  2YIU B;  2Y0E A;  3O1Y A;  4WQ9 A;  3SLE A;  5B5E V;  2Q3E A;  1CXA A;  2A06 D;  3H1K D;  1IO3 A;  2DGE A;  3PXT A;  3GG2 A;  5CIF B;  2C1D A;  3M97 X;  3L4M A;  3CYT I;  1F1C A;  3X39 A;  3SWS A;  4AX3 A;  5KLV D;  3CXH W;  4EIC A;  1KIB A;  3L74 D;  3ZBM A;  1KYO W;  1C2N A;  1RZ5 A;  1GDV A;  5KAI V;  3ITK A;  3OCD B;  2DVH A;  3PXS A;  1E29 A;  1CC5 A;  2ZON G;  2I8F A;  4XXL A;  1QL4 A;  1QL3 A;  1YEB A;  1AOF A;  1LFM A;  5B6Q A;  1BCC D;  1K3H A;  1QKS A;  3A0B V;  4EID A;  4GED B;  1HH7 A;  3HQ6 A;  1I55 A;  1M70 A;  4FAN A;  1H1O A;  1U74 B;  3WUI A;  1L0N D;  4O1W A;  2RMZ A;  1FCD C;  1GQ1 A;  1RAQ A;  2B12 B;  3TF5 A;  4LJI A;  1H31 A;  1LC2 A;  1FI7 A;  2GB8 B;  1NML A;  4L3H A;  1H32 B;  1IRV A;  1CSV A;  4KMG A;  2GC4 D;  4PD4 D;  2OZ1 B;  2KNC B;  2BCN B;  1CO6 A;  1VYD A;  1E8E A;  3ZCF A;  2C9X B;  2AXT V;  2CA4 B;  3A9F A;  5TIS V;  2RN0 A;  3L72 D;  4WQE A;  3KZI V;  1CRJ A;  2PCB B;  2V07 A;  1ETP A;  5IY5 1;  3A0H V;  3TGU D;  2Y0C A;  3NWV A;  1C7M A;  4WQ8 A;  4EDF A;  4L1Q A;  3VYM A;  2B4Z A;  4XYD B;  1BGY D;  2B0Z B;  2AI5 A;  1HRO A;  1LC1 A;  1CRG A;  1CSU A;  1P84 D;  4PW9 B;  5DJQ B;  4DY9 A;  155C A;  2JQR A;  1EZV D;  1CXC A;  1CIF A;  3RMZ A;  1CRC A;  4Q5P A;  1QYZ A;  3SVW A;  1CIE A;  2MHM A;  1N15 A;  3L4O A;  1BL9 A;  3L73 D;  5C9M A;  1CRH A;  1FI3 A;  2CE0 A;  3BCC D;  1DIQ C;  2QJK B;  1CHH A;  4FA4 A;  351C A;  2V08 A;  3RLM A;  1YCC A;  3WFE C;  1CRY A;  4EIE A;  5KLI B;  3DR0 A;  1NTK D;  5B66 V;  5KKZ B;  1DVH A;  1MZ4 A;  4K3I A;  3SXT A;  1GIW A;  4IL6 V;  1GU2 A;  1YTC A;  2K9J B;  1F1F A;  4WQ7 A;  3DMI A;  1I6D A;  1U75 B;  4WQC A;  1PP9 D;  1AOQ A;  1CCR A;  3WFC C;  4UB6 V;  2N3B A;  1HZV A;  1EB7 A;  1NU1 D;  2C8S A;  1C6O A;  1SQX D;  3H1J D;  3WFB C;  1WVE C;  3CU4 A;  2FYU D;  1HCM A;  2EXV A;  1J3S A;  2N3Y A;  2ORL A;  4AAM A;  2N9Y B;  5E79 V;  4AAL A;  1W2L A;  4FA1 A;  1CYC A;  1SQB D;  3PTZ A;  4MU8 A;  2O3J A;  2C1V A;  1QN2 A;  2FYN B;  1I5T A;  1IZL 0;  2YK3 A;  3CX5 D;  5EXQ A;  5DFS A;  1CTY A;  2HV4 A;  1AKK A;  2GC7 D;  1C2R A;  3CWB D;  3MK7 C;  1I8P A;  1YIQ A;  1CIH A;  3OA8 B;  5C0Z A;  3ZOO A;  1H33 B;  1K3G A;  1NMI A;  1N9C A;  1CSW A;  3PHL A;  1FJ0 A;  1CHJ A;  4D6T D;  2YQB A;  3NBT A;  1CED A;  1SQV D;  3PH2 B;  2MTA C;  1CHI A;  4QAO A;  2ZXY A;  2ZOO A;  3PRJ A;  1NIR A;  1DII C;  4Y5R A;  5CIG B;  2Y0D A;  4A7P A;  2YCC A;  4J20 A;  1CIG A;  5GTH V;  4H0K A;  4YE1 A;  3OCD A;  2FWL A;  3L70 D;  1YEA A;  1C6S A;  4RJT A;  1CCH A;  1COR A;  5CIC B;  2BLF B;  1N90 A;  2C1D B;  4AAO A;  1A56 A;  2D0S A;  4PJ0 V;  3CXH D;  1YFC A;  3RN0 A;  1KB9 D;  1A8C A;  1CSX A;  1KYO D;  1H9X A;  4WQB A;  1DW1 A;  1HZU A;  4PWA A;  3CP5 A;  3WU2 V;  1JDL A;  2BPB B;  1DVV A;  1NTM D;  1L9J C;  3H1I D;  3PXW A;  1KX7 A;  1L0L D;  1C52 A;  2C1U A;  1H32 A;  3L71 D;  3ORV A;  2OZ1 A;  2N9I A;  4GYD A;  4RSZ A;  1GKS A;  2LIR A;  4O1Q A;  1C75 A;  3ZOY A;  1GJQ A;  4NFG B;  1CRI A;  2IBZ D;  2VHD A;  1DT1 A;  1MG3 D;  2CA3 B;  3O5C A;  1HRC A;  1H31 B;  3H1H D;  2JTI B;  2KS1 A;  2ZBO A;  1COT A;  4L3G A;  3HQ8 A;  3NBS A;  1SQP D;  1YIC A;  1S6V B;  1MG2 D;  2CE1 A;  5CYT R;  1R0Q A;  1NTZ D;  1IRW A;  3MK7 B;  3WC8 A;  1CTJ A;  4FB1 A;  3WFD C;  1DW3 A;  1RAP A;  4P4Q B;  2JWA A;  1DW0 A;  1S5L V;  5CIE B;  2QG4 A;  3JBT B;  5CIH B;  3TDK A;  4FA5 A;  1DW2 A;  2B11 B;  1ZRT D;  4WQD A;  3VRD A;  1W5C T;  1FOC A;  5DF5 A;  451C A;  4N0K A;  2N18 B;  2BH5 X;  2B10 B;  4EIF A;  2FRC A;  1CYI A;  3TYI A;  1M60 A;  5CIB B;  5AUR A;  3PLN A;  3RN1 A;  2N18 C;  4UB8 V;  2BH4 X;  1H9Y A;  1KB0 A;  1A2S A;  1L9B C;  1AYG A;  1I54 A;  1KV9 A;  2QJP B;  4AAN A;  2BGV X;  1M6Z A;  2N9J A;  3O0R C;  5H2F V;  3VNW A;  1OAE A;  1NNO A;  1HJ3 A;  1E2R A;  2L4D A;  3C2C A;  5KAF V;  1FI9 A;  1PPJ D;  1CNO A;  2GIW A;  2PCC B;  5GTI V;  3L75 D;  4V2K A;  1LMS A;  3KHU A;  2D0W A;  1I6E A;  3ZOW A;  1KX2 A;  1B7V A;  1SQQ D;  3H1L D;  3CX5 W;  5CID B;  1CTZ A;  2C2C A;  3FWL A;  3OA8 A;  3ZOX A;  4WQA A;  1H33 A;  1C6R A;  1OCD A;  2XTS B;  1LS9 A;  4JCG A;  3SJL A;  3VMA A;  2ZZS 1;  1I8O A;  1ZZH A;  2AIU A;  4FA9 A;  1WEJ F;  3ZIY A;  1RZ6 A;  2BCC D;  3HQ9 A;  5DJQ C;  3GW6 A;  2LIT A;  3DP5 A;  1FHB A;  1YNR A;  1N50 A;  1HJ5 A;  1BE3 D;  5TJH A;  2L91 A;  3HQ7 A;  2PAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...