3L72D

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 73
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l72D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l72D02
1AYGA 1KB9D 5C9MA 2JWAA 1CIFA 3JBTB 1A56A 4FA4A 1CO6A 5C0ZA 3CXHW 2RN0A 1DW1A 1H9XA 1P84D 1H32A 4AALA 5GTIV 1M70A 1I6EA 3WFCC 5KLVD 2GC7D 2FYUD 1BGYD 4WQ7A 3MK7C 1H1OA 1CSWA 2I8FA 2YIUB 3ZIYA 5H2FV 1NIRA 3HQ7A 1FOCA 2HV4A 5CIHB 2ORLA 1GDVA 3L73D 1OAEA 2FRCA 2B11B 4FB1A 2D0SA 4PD4D 1I6DA 3PXSA 1H31B 4JCGA 1E8EA 2QG4A 1OCDA 3VMAA 1K3HA 1EB7A 1EZVD 2LITA 3L70D 1DVVA 1NMLA 4GYDA 5E79V 2QJKB 5KLIB 4QAOA 1I5TA 4L3GA 1CC5A 2BH5X 1CYJA 5DJQC 2IBZD 1K3GA 3GG2A 4FA1A 1YCCA 1A8CA 1W5CT 1CRHA 2A06D 3HQ8A 1C52A 3O1YA 3PXWA 1QYZA 1AOQA 3C2CA 1C6OA 2PACA 1CYCA 1YICA 1QN2A 1WVEC 5CIEB 4FANA 1U75B 4WQAA 3H1LD 3WC8A 4IL6V 3RN1A 1YEAA 4L3HA 4PW9B 3M97X 1IQCA 2ZXYA 3WUIA 1B7VA 3MK7B 4H0JA 1IRVA 1QL3A 1KX7A 3ZBMA 1J3SA 2D0WA 2ZBOA 1N9CA 1C75A 3A0HV 1L0LD 3GW6A 5IY51 2V07A 3CX5D 1CSUA 1C7MA 1HZVA 4RJTA 4PJ0V 2C8SA 1NNOA 2FYNB 1H9YA 1RZ5A 1MZ4A 5TISV 1GU2A 1M60A 1NU1D 1ETPA 3WU2V 2Y0CA 5CICB 2CA4B 1RAPA 4XXLA 1IZL0 5DJQB 1F1FA 3ZOWA 1CIHA 1CEDA 2VHDA 4EIDA 2K9JB 2BH4X 1YNRA 2N9JA 3CYTI 3NWVA 1MG2D 3A9FA 4WQBA 3KZIV 1CIEA 5KAFV 4Q5PA 3KHUA 5TJHA 4LJIA 3ITKA 4H0KA 1CYIA 2GIWA 1PPJD 4FAVA 5B5EV 4UB8V 2QJYB 3L75D 2BGVX 1KYOD 2N9YB 2QJPB 1DIIC 4DY9A 3NBTA 1CTJA 1S5LV 2GC4D 451CA 1PP9D 1I55A 1F1CA 1M6ZA 3VNWA 2N9IA 3SLEA 1AOFA 2CE1A 1HZUA 3VRDA 1FJ0A 1GJQA 2N3YA 4A7PA 2ZZS1 1GQ1A 1CRGA 1CSXA 1WEJF 1COTA 1SQPD 2LIRA 2AXTV 1BCCD 3PLNA 4GEDB 3A0BV 1CHIA 3CXHD 3OA8A 1HROA 1I8PA 4FA5A 1L9BC 2B12B 5CIFB 1FI3A 1W2LA 1YTCA 3O5CA 1DW0A 5CYTR 5CIBB 1SQXD 2L4DA 2C1DA 1YEBA 1NMIA 2CA3B 3ZCFA 1FHBA 1YIQA 3H1HD 4MU8A 1CXAA 4V2KA 4D6TD 2FWLA 2V08A 3PH2B 2N3BA 1C6RA 4K3IA 3PTZA 3RLMA 1CCRA 1I54A 1N50A 2MHMA 3DR0A 5CIGB 2JQRA 3WFEC 4NFGB 1HJ5A 1HCMA 2AIUA 2L91A 3ZOYA 1CHHA 3OA8B 4WQDA 1HJ3A 1CORA 3FWLA 3RMZA 3WFBC 2C1DB 155CA 2PCBB 1BE3D 2B4ZA 4EIFA 2BCCD 1L0ND 2MTAC 3CP5A 1DIQC 3TF5A 5DF5A 2KS1A 1CCHA 5DFSA 4O1QA 1HJ4A 1KIBA 5KKZB 5AURA 1CTYA 4U3FD 1C6SA 2BPBB 3PXTA 5KAIV 1CRYA 1R0QA 2ZOOA 3WFDC 3ZOXA 3BCCD 1C2RA 3ZOOA 2CXBA 4P4QB 1C2NA 3L71D 1CSVA 2PCCB 4EICA 1FI7A 2O3JA 2GB8B 1AKKA 3TYIA 1CRJA 1NTKD 1SQQD 3PRJA 4EIEA 4O1WA 1CRCA 4UB6V 1CTZA 1A2SA 1N90A 3L74D 1RZ6A 4WQ8A 1NTZD 1SQVD 1N15A 3SWSA 2DVHA 2N18C 3L4MA 1LC2A 3TDKA 2JTIB 4PWAA 2BLFB 2B10B 3X39A 2Y0EA 2CE0A 1CIGA 1HRCA 3CU4A 2C1UA 1E2RA 3PHLA 3OCDA 5CIDB 1ZZHA 2EXVA 2OZ1A 4YE1A 5EXQA 1BL9A 3HQ9A 3ORVA 1KV9A 5GTHV 2XTSB 4FA9A 2BCNB 3SXTA 2Y0DA 3VYMA 4AAOA 3TGUD 5B66V 2Q3EA 4RSZA 4Y5RA 1IO3A 4AAMA 3RN0A 3SJLA 1U74B 1QKSA 3L4OA 4XYDB 2C9XB 4EDFA 1GIWA 3H1KD 1FI9A 4WQCA 1L9JC 1LS9A 3OCDB 1H32B 1HH7A 2OZ1B 2C1VA 3CX5W 4L1QA 2N18B 3NBSA 2B0ZB 2ZONG 1MG3D 1NTMD 4WQEA 1SQBD 2YK3A 1VYDA 1LMSA 1CNOA 1IRWA 1DW2A 1H33A 1ZRTD 1E29A 4KMGA 3L72D 2C2CA 3H1JD 1KB0A 2YQBA 2AI5A 1JDLA 1RAQA 351CA 1YFCA 3H1ID 1DW3A 2RMZA 3DP5A 2DGEA 1S6VB 4J20A 4WQ9A 1I8OA 3SVWA 3HQ6A 1KYOW 4AANA 1LC1A 1KX2A 3O20A 1CHJA 2KNCB 2YCCA 1DT1A 4AX3A 1QL4A 1CXCA 3DMIA 1H31A 1DVHA 1H33B 1GKSA 4N0KA 5B6QA 3O0RC 1FCDC 3CWBD 1LFMA 1CRIA
chains in the Genus database with same CATH superfamily
5BVZA 5C39A 2E75D 1KB9D 2HYNA 5C9MA 2Q6QA 3JBTB 1A56A 1OFCX 4JQ0D 4EYYQ 1A02F 1FZEA 1P84D 3I5CA 1H32A 1QL1A 4R4LA 5GTIV 4UB6E 3NXSA 1PV3A 2V4HA 5KLVD 1FDMA 3B5NC 1H0TA 2FYUD 2OARA 4WQ7A 3G6EP 4H0LC 1CSWA 2YIUB 4RESB 3CI9A 1JMBA 1EXJA 1FOCA 1HGZA 4IFFA 4GDOA 3L73D 1GU5A 3TGUE 2H88C 1YBKA 1JEKA 4PD4D 3B5NA 3PXSA 2Y9ZA 2B89A 1OCDA 1K3HA 1S3JA 1EB7A 1Y9BA 3L70D 1SQVJ 3MD0A 2QJKB 3H25A 1I5TA 2W6AA 5KKZC 5KLVG 3GLMA 3H1KE 2FYUG 2P67A 2OYHC 2IBZD 1LGHB 1YCCA 1A8CA 1W5CT 1W2EA 3HQ8A 1C52A 1OW7A 3L73G 2YKPA 2OTKE 1OVRA 1GL2A 1SQBE 2L5GB 1N7SB 1QVGO 1QN2A 1L4AB 2OYHA 3TSIA 3LIEA 3MTUE 4IL6X 2QJYC 4IL6V 1YEAA 3L70G 3B5ND 2WT7A 2QJPC 3D71A 1IQCA 3WUIA 1M57D 3GHGB 3MK7B 1IRVA 1VF5D 1HUCA 1YQ3C 2IBZG 2D0WA 3SWFA 2KOGA 3H1IE 1N9CA 1L0LD 3GW6A 5IY51 3CX5D 1CSUA 5APSA 5KTBA 1HZVA 4RJTA 4PJ0V 3KXDA 1NTMK 1BDDA 5KAFH 2N1TB 2FFDA 2NPSB 1MZ4A 1GL2D 1JUNA 1M60A 3JSVC 5B5EH 2O01N 3WU2V 3CMAP 5CICB 4WWIA 1IZL0 1F1FA 1YNRA 1PGQA 5CJ0A 1DH3A 4HB1A 3N7NA 2OYIC 1L0LG 3KZIV 1HJBA 4OGQD 3H1JJ 4Q5PA 1T6AA 4LJIA 4N78D 4H0KA 1CYIA 4FAVA 3SFDC 3NMDA 4UB8V 1VPCA 1DIIC 4DY9A 1BSNA 1EZVI 3NBTA 1FZAA 3A0BH 1LT1A 2N9BA 1I55A 3BCCJ 3RK3B 4A7PA 4HH2A 1CRGA 3RBXA 3MIWA 1SQPD 1IFMA 3PLNA 3I55P 1CHIA 2SPZA 1R5LA 4BRYB 1I8PA 1NKZB 2YXRB 1W2LA 1SFCC 1DW0A 3AE7C 5CIBB 3HUSC 2L4DA 1GK6A 1NMIA 2A06E 4H44B 1SQPG 5KLVJ 2FYUJ 2Q7CA 2N3BA 2ZT9D 5E79E 1VQ4P 4OWFA 1RQUA 1Q90D 5AVSB 3L73J 2MHMA 2E74C 1HBWA 3DR0A 5CIGB 3WFEC 1S72P 2O1KA 1FZCB 3FWNA 1M1JA 1NVOA 1HCMA 2AIUA 1G2CB 1ZN5A 3L70J 1OW8A 1MFTA 2ZAEB 4WQDA 4NPEA 3HE5A 3RMZA 2BEQD 2IFMA 1KB9H 3FGAD 155CA 2IPPA 5AW3B 2E43A 1J1EB 1FBMA 2MTAC 1GD2E 2W6BA 3PP5A 1P84H 2YIUC 2KS1A 4O1QA 4WY4B 1G1JA 3PXTA 3Q5RA 4OH8B 3G9RA 4ASWA 3ZOOA 1N7LA 2WMMA 4P4QB 5CCHC 3L71D 2YO3A 2HG5D 1CSVA 2PCCB 4PD4H 1E5WA 4EICA 4KJMA 1FI7A 2QJKC 1VL2A 1WT6A 3TYIA 4EI2A 1R5SA 4ZNCA 1L0LJ 4O1WA 1PGOA 1CTZA 1A2SA 1OMIA 3RK3E 3L74D 1N15A 3F5HA 3PH0A 2K9YA 2JTIB 2C1UA 3L71G 1E2RA 3PHLA 3BRVB 5APYA 1EXIA 1J2JB 5L8RJ 1AFOA 1KV9A 3L74G 3RL0D 4TT3H 3H1HE 5B66V 1PIXA 4RSZA 1GDTA 3CX5H 2YO2A 1KQFB 2WQYC 3B8EB 4AAMA 5APTA 4L73A 1PGPA 1GIWA 4C7NA 3VP8A 1EDLA 1FZBA 1M56D 5AW7B 1SQPJ 3OCDB 1FU1A 1H32B 4YPCA 2OZ1B 3AE4C 1TU3F 3NBSA 5CHXA 1NTMD 2AEMA 2PAJA 1LMSA 2D2CB 1RE4C 1CNOA 1IRWA 2BCCE 1ZRTD 5TISH 5AVVB 3S9OA 1LJ2A 1Q2NA 4O9BA 4U3FE 1FC2C 1FOSE 4DOJA 5CCGC 2ZVOB 3AE1C 2DGEA 1S6VB 5KJ7C 4J20A 1NTMG 1GZLA 2QVAA 1KQGB 3KQGA 3SVWA 3HQ6A 4AANA 1USEA 1CHJA 1JY3P 1GL2B 1SQQE 1N8RQ 2KNCB 1SLQA 1L0NK 1DT1A 4K3AA 5GTIH 1NTZE 3EFFK 3DMIA 1G1IA 3EWKA 3HE4A 4H44C 1VQ5P 1GKSA 4N0KA 2YMYA 3O0RC 1OIPA 5AW4B 1FOSF 4TLFA 1CIFA 2KLVA 1CO6A 3VMYA 1R8EA 4NPFX 2K1AA 3LIDA 1S1CX 2FFDB 4GKGA 1JO5A 1LWUC 3ZIYA 1NIRA 1OVVA 1N73A 2FY8A 1OAEA 2FRCA 3L75J 1OXZA 2Z5IA 1E8EA 3VMAA 2WZ7A 3L74J 2UWJE 4IOIH 4K35A 1DVVA 1NMLA 1DEEG 4GYDA 1NGMB 2Y9YA 4L3GA 1H88A 4IL6H 4JPZB 2R5DA 4DCKA 4BXLA 1K3GA 1QVFO 2M0BA 3IR9A 4PV1B 1CRHA 1KILB 1AV1A 3CCQP 3U1AA 1AOQA 3C2CA 1C6OA 4H13D 3CC4P 1GK4A 4WB4A 4WQAA 3L72E 3WC8A 2XU6A 3RN1A 1SQXJ 3M97X 3S4RA 3CMEP 1LT9C 1X9VA 1B7VA 3WU2H 3QWOC 1NJIQ 2GM4A 1RHZB 1C75A 3OJAB 3V2QA 2E76D 3II6A 2V07A 1URQB 5KAIH 1LT9A 1KFMA 2FYNB 1KB9I 1SQBK 1T2KD 1RZ5A 4JYBA 5TISV 3JCUH 1CI6B 1YJWP 1ETPA 2Y0CA 2CK3H 5DJQB 2M8RA 1KZUB 2ITAA 1NTMJ 2VHDA 2BH4X 4L74A 5AW1B 3CWBE 3CYTI 3Q5SA 1XTCC 4JBZA 2PP6A 2HR3A 1BE3J 3V4WA 5TJHA 3ITKA 1AVOA 3K5BA 2C0XA 2BGVX 3CCMP 2QM8A 1KYOD 4KT0J 3HE5B 3Q2YA 2KZIA 3BASA 1BGYE 2QRXA 1FJKA 3SLEA 2IBZI 2IDBA 2CE1A 3VRDA 1RY3A 1FJ0A 2N3YA 1Q7YQ 2D2CC 3MP7B 1NTKJ 1BCCD 1EZVE 3H32B 1RQVA 1VQLP 3CXHD 1VDFA 4WVZA 2W6JH 2MJZA 5CIFB 1FI3A 3TYYA 2WVRA 1YTCA 5GTHE 3O5CA 1KILE 4U7JA 2WSFJ 2P10A 3CCUP 3OW2O 5AW8B 2CA3B 4XA4A 3RGUA 4DZOA 2HPCB 1YIQA 1RE3C 3EFGA 3V6IA 2H7HA 1CXAA 4V2KA 4D6TD 2FWLA 3CX5I 2V08A 3PH2B 1VQ7P 3H1LE 2HLOA 1C6RA 1OZHA 2XNDH 1FE6A 4Y99C 1BCCG 2K9JA 1FZFA 3RLMA 5BU8B 1I54A 2V7QJ 1KTMA 1KMIZ 4H0LD 1AQTA 3IAOA 1RF0C 3GF3A 1SP4A 4W80A 1HJ5A 1LTTC 2KSEA 3AEAC 5AW9B 3ZOYA 3USSA 1CHHA 3OA8B 2ZYDA 3P8CD 3V2PA 3FWLA 4D6TG 3WFBC 2C1DB 2WSFH 3ABVC 2B4ZA 3M06A 1RF1C 1NU1E 1L2PA 1L0ND 3GMAA 1FS0E 1DIQC 1M90Q 5DF5A 5DFSA 2VRSA 1Z56A 1KIBA 1NO4A 1C6SA 1X8YA 1ZW0A 3W67A 5KAIV 2ZOOA 2B87B 2LKMA 4PJ0E 2V7QH 3SSUA 2CXBA 1GW3A 2H8PD 1PPJE 1C2NA 3I56P 3L75E 1AKKA 1CRJA 1L0NG 2OYIA 4EIEA 5AVTB 1N90A 3WUVA 1PP9E 3M0DC 3SFEC 1KILC 1BDCA 5H2FH 1Q86Q 3KZIE 4AQRD 2KK7A 2N18C 2A45I 3L4MA 1YTZT 3O6QB 3TDKA 4PWAA 2BLFB 2CE0A 1DD3A 1VQOP 1E79H 1KFNA 4UB8E 3AECC 1JTHA 1W2BO 1PL5A 5B66H 1U57A 3RK2B 3D6ZA 1T8ZA 3VTPC 5APWA 3HQ9A 1YI2P 1IFJA 1FJPA 1SQXE 4FA9A 1USDA 3GF7A 2BCNB 1SQVK 1LTGC 2GA1A 2W8ZA 2Y0DA 1URQC 3V4QA 3AEEC 3VYMA 3F89A 2R32A 3TGUD 1LTJB 2Q3EA 2FYNC 4Y5RA 1W5CE 2ZXXA 3HE4B 1QLED 1SFCA 3NFQA 5CMZA 2I1KA 3HUSA 1PZQA 3D70A 3RN0A 4AUWA 4XYDB 4EDFA 1LP1A 3H1KD 1FI9A 4WQCA 1L9JC 1LS9A 3Q5PA 3Q1MA 4L1QA 2C1VA 3CX5W 1NYHA 2JWDA 1MG3D 3A0HH 1M7LA 1KD1Q 1IFNA 3TGUG 1SQBD 1VYDA 1J1DB 1NAFA 1DW2A 1H33A 1E29A 2E42A 4KMGA 1S4XA 4GIFA 1SFCD 1KYOH 1LTAC 2YQBA 1AVYA 3H1KG 1JDLA 2FBWC 1T3UA 3H1ID 4LC1A 2RMZA 3CCRP 3A7OA 3DP5A 3O8ZA 3FX0A 1NWQA 2ZVNB 3P7KA 5CBNA 1SQBG 2JDIH 3IN6A 1LC1A 4AYCA 1IC2A 1NTKE 2RH0A 1K05A 2E74D 2XNXA 5AVXB 3CXHH 3C9IA 1SQVE 4Y28J 3D6YA 5CCHA 2MKVA 3H1IG 3HD7B 2ZFCA 3R2PA 1AYGA 5KAFE 1L0NJ 1N7SC 1L4AC 2E75B 4I2LC 4I6MC 5B5EE 3TNUB 1LTBC 2AXTH 1DW1A 3T97B 1M70A 1I6EA 3WFCC 1IK9A 1S5LE 2GC7D 1N7SA 1SQQK 3GHGC 3MK7C 1X22A 2R3SA 2I8FA 5H2FV 3HQ7A 2HV4A 1YQ4C 5CIHB 2W83C 1NTZK 3CCEP 1NKNA 2B11B 4FB1A 1S9KE 5CCHD 1I6DA 1VQ9P 3GHGA 5APXA 4N6JA 1H31B 3NTNA 2N1TC 2NPSC 2LITA 3A0BE 3OAKA 3CCSP 5KLIB 1MUUA 1T3JA 1CC5A 1U7MA 1EDIA 1SS1A 1DEBA 1KORA 1JCDA 4BWNA 3MHVA 2FYUK 2YNYA 1N86A 3GG2A 4GOFA 1LTIC 1QGKB 4W7ZA 3AEFC 2A06D 3PXWA 5AVWB 5CJ4A 3S1KA 2PACA 1H0TB 1IK7A 1WVEC 5CIEB 1M8OB 4FANA 1OX3A 3L36A 3H1JE 4KHXA 2ZXYA 3B5NB 1HF9A 3TGUJ 3CL3D 1JMMA 1YHQP 1QL3A 1NAYA 2ZBOA 1RE4A 1VF5B 2CPSA 3A0HV 3BVHA 3AE8C 3RK3C 2A06G 3C1LA 3BCCE 1C7MA 2AXCA 2B9BA 3U1CA 2C8SA 1NNOA 1H9YA 3RK2C 3H1KJ 1KQSO 2WTYA 1FDIA 1GU2A 3V5BA 5CCGA 1RAPA 4XXLA 5APQA 4UB6H 3ZOWA 5KJ7A 2OYHB 2K9JB 4EIDA 1SQBJ 3A3YB 3W68A 2FKWB 3NWVA 1K9MQ 2WT7B 4WQBA 1EC5A 1LTJC 1CIEA 1KB9E 3KHUA 2QSIA 4OGQB 2GIWA 2QJYB 3P8MC 1P84E 2WPVB 2J58A 2N9YB 2QJPB 2WPQA 3H1IJ 5KLVE 2FYUE 1CTJA 1D7MA 1JM0A 451CA 4GT1A 1GW4A 2WSSH 1F1CA 1M6ZA 1K04A 3RK3D 2K88A 1FZCC 3VNWA 2N9IA 5CCGD 4NPDA 3L73E 3L71J 1HZUA 5KJ7D 2ZZS1 4PD4E 1J1DC 2LIRA 3WUTA 1QX8A 1YJNP 2Q9IA 2AXTV 3A2AA 1LWUA 3L70E 1FZCA 2ZYGA 4YXWH 2M5AA 4N3YB 3HTKA 1ZLLA 1G2CA 1J1EC 5AVZB 2FXMA 1HROA 3N4XA 2IBZE 4WY4C 5CYTR 1HGVA 4H44D 2Q1KA 1FHBA 3H1HD 4MU8A 2POHA 2HFED 2GUVA 2M3BA 3WUUA 4CPGA 2YXQB 5DJUB 4K3IA 2IYOA 3PTZA 2R44A 4YTPC 1CCRA 2ZT9B 3H6PA 3CCJP 1N50A 3VP9A 1PGJA 2JP3A 3E1RA 4NFGB 2KI7B 2YKQA 2WSEJ 1L0LE 5M1BA 3HD7C 2KIKA 2PRRA 3CX5E 4C46A 1DD4A 1IO4A 3H1HG 2HODA 1HJ3A 2E75C 4ZKPA 2PCBB 2I8DA 2AEJA 2BCCD 4EOTA 4B86A 3PJSK 4EIJA 3CP5A 2XV5A 3TF5A 1KYOI 1CCHA 1HJ4A 1P84I 4HKZH 1QEXA 1HWTC 5AURA 3KYQA 1CTYA 4U3FD 3TK1A 2BPBB 1FZGA 1R0QA 3WFDC 3BCCD 3KDPB 4N78E 5TISE 1M1JB 4PD4I 2BCCG 2WSEH 2WSCJ 3PRJA 1SQQD 2E5YA 2Q3IA 4UB6V 2QIWA 3CXHI 1NU1K 3M91A 2ZXEB 3B71A 1RZ6A 4WQ8A 1NTZD 3SWSA 4OVNF 4U3FG 1X79B 3E7KA 1LC2A 1SQPE 3BCCG 3X39A 2B10B 5BU5A 2KS1B 1HRCA 4XE5B 4ZKUA 3OCDA 5CIDB 3G4SP 2EXVA 2OZ1A 4YE1A 5GTIE 5E79H 1SQQG 1IFPA 1UIXA 2I1JA 2OTLP 2YMKA 5GTHV 3A5TA 2XTSB 3SXTA 1VF5C 1NTZG 1MFZA 4ASVA 3RL0B 4AAOA 2PFXA 2WSCH 1PFIA 4GOEA 5AW5B 1SVFA 1OWAA 3AE3C 1EDKA 3AEBC 1IZNB 1IO3A 1OW6A 3SWYA 2LXCB 1GL2C 1U74B 1VQ8P 4MN4C 3L4OA 2C9XB 3CCVP 2C9LY 1RE3A 5DJTB 3MZWB 3CCLP 3M9BA 1MZ9A 2H43A 3BATA 1ZOYC 1SQXK 2D2CD 3P32A 2KNCA 4YXDC 4OGQC 3WMM0 4R4MA 1Q81Q 1CW5A 1IJDB 1RF0A 2P1JA 4IL6E 1EDJA 3L72D 1HVVA 2K37A 3U59A 3H1HJ 1KB0A 2FFDC 3L4FA 2KXPB 3IFMA 3FXEA 1RAQA 2KB7P 1DW3A 3M9HA 4Z1MH 4I7ZB 1RF1A 1S2EA 4WQ9A 3L71E 5AW2B 4C7NB 3JC22 4IFMA 1I8OA 1KYOW 3L72G 1KC8Q 3WU2E 3VYIA 1YYCA 3L74E 1CXCA 3E1IA 1S5LH 2XKMA 4QMAA 4GODA 5KAIE 4PV1C 3CWBD 1LFMA 2K3RA 1CRIA 2BCCJ 3RBZA 2LXBA 1JNMA 2JWAA 1AQ5A 3JCUE 1LTSC 4HJGH 4FA4A 5C0ZA 3CXHW 1Y8AA 1WRGA 2C0WA 2RN0A 2ZT9C 1H9XA 3M0DA 3CC7P 2OTJP 1KILA 5EFWB 4AALA 2O01J 4U3FJ 1VQ6P 1U7JA 1BGYD 1NTKK 4RKUJ 4JF7A 1H1OA 3AE5C 2WITA 2DW3A 4DJGA 2ORLA 1GDVA 1CZQA 3CWBG 3VMXA 2D0SA 2M3EA 1SQQJ 4JCGA 4XFJA 2C9NY 2KLUA 2QG4A 2XZRA 1EZVD 1NTZJ 2G8YA 1Y47A 5E79V 4WBAA 3VMZA 4QAOA 2ZYAA 2BH5X 1URQA 3OA7A 1CYJA 1MKMA 2P7JA 4I1LA 2W27A 4ZMDA 1K8AQ 5DJQC 1BGYG 3LW5J 4PV1D 5AVRB 1KILD 2JR8A 2G3AA 3D0WA 4FA1A 1KN7A 3O1YA 1CI6A 4HYTB 1QYZA 2O01H 1BCCJ 1NTME 3CC2P 1CYCA 1YICA 2R3CA 1VQKP 1U75B 1M1JC 1ZRTE 4H13B 3H1LD 2ZJSE 3AEGC 1N73B 3CD6P 1BE3E 1EZVG 4L3HA 4PW9B 1OVUA 4H0JA 1LWUB 2A45G 2IFNA 2M5AB 1KX7A 3ZBMA 1J3SA 3HTKB 3FXDA 1ZR4A 4D6TJ 1URQD 1GU4A 2WPRA 3SWKA 1YIJP 3V2RA 1VQNP 1FAVA 3L35A 2E76B 3LW5H 2IYPA 3AE2C 3H1LG 2Q5UA 1NU1D 3G3ZA 2CA4B 2CPBA 1XTGB 1VQPP 1CIHA 1CEDA 2N9JA 3RL0C 3H32A 1MG2D 3A9FA 3L72J 3M0AA 1JY2P 5KAFV 1JY2O 4RO0A 1PPJD 1DX7A 5B5EV 4LGDE 3L75D 1IFIA 2HODB 2HPCA 1NU1G 1S5LX 1LT9B 1S5LV 2GC4D 1PP9D 1LNQA 1L4AA 2FYZA 2QE7H 1AOFA 2R5BA 1HTLC 2P58A 1GJQA 2IX7C 4C7RA 1GQ1A 1CSXA 1WEJF 1A02J 1COTA 1RH5B 2KZJA 2W90A 1PPJG 2IZ0A 1ZP0C 4GEDB 3L75G 3A0BV 2Z5HA 3OA8A 3CWBJ 4FA5A 1L9BC 2B12B 5H2FE 1YJ9P 2QM7A 1SQXD 2J59M 5KLVK 1DIPA 1PP9G 2C1DA 4LLHA 1YEBA 2P2UA 4I7ZC 4DT0A 2N1TA 2IZ1A 3ZCFA 2OQQA 2NPSA 2AEFA 3VOPA 1YITP 1N7SD 5B66E 3CLQA 3MGNA 1L4AD 3B4SA 1BGYJ 1JB0J 3RL0g 2B87A 2FXOA 2JQRA 1H89A 1SQXG 4H0LB 3BRTB 2QEXP 2L91A 2NRGA 1JCCA 4W7YA 1CORA 1FDOA 2N1TD 2NPSD 3HRNA 1BE3D 4EIFA 3IF4A 1NOHA 3O6QA 2WPSA 1JY2N 1YTZI 1NH4A 2OYOA 5KKZB 1Q82Q 3A0HE 1CSBA 5CBOA 3EQ2A 1JOCA 2OGUA 3H1LJ 1CRYA 3ZOXA 2FXPA 1C2RA 1L0LK 1GTWA 4BRYA 1NHLA 5AW6B 1HJ0A 4Y99B 1HH0A 1JY3O 2O3JA 1KYOE 1BE3G 1ZV8A 2GB8B 5K5GB 3QH9A 4L75A 1NTKD 1UIIA 1CRCA 1LTJA 2GUSA 3AE9C 1SQVD 2O1JA 3Q3DA 4IFDK 2A45H 2DVHA 2NZ2A 1EQ7A 3M9QA 5GTHH 3AE6C 1AJYA 5AVYB 1GMJA 2Y0EA 1NU1J 1CIGA 1MV8A 4H13C 3CU4A 3RK2D 1BCCE 2H89C 2JO1A 2KUBA 3G71P 1N73C 2YKOA 2J5UA 1ZZHA 5APVA 3CXHE 1VQMP 1RF1B 5EXQA 1BL9A 1ZR2A 1NTKG 3ORVA 1KV4A 1QL2A 1SQVG 5AW0B 2WWWA 2BEZF 3V2NA 2OYIB 1K73Q 2E76C 1H8AA 4D6TE 5AVUB 1S9KD 2AXTE 1AA0A 1SQPK 4WY4A 1PP9J 1T2KC 1ZXGA 3SJLA 1QKSA 2KYVA 2KP8A 1X0TA 3MUDC 1JTHB 1BSHA 3ZDMA 1HH7A 2JKVA 2N18B 2B88A 5AVQB 2LR2A 2B0ZB 1N2DC 2ZONG 3P8CE 4WQEA 2YK3A 4L76A 2RKLA 1ZMEC 3MUDA 2JEEA 4PJ0H 4M3LA 1L0NE 2C2CA 2KSJA 3H1JD 2JJLA 3HD7A 1WMKA 4WY4D 2AI5A 1SFCB 3TNUA 351CA 1YFCA 3HUSB 1JY3N 3AEDC 3T97A 3L37A 1LP1B 3KZIH 3VN0A 2XDJA 1IFDA 3KPEA 1M1KQ 1KX2A 3O20A 4UB8H 5APUA 5KLIC 3H1JG 2BASA 2YCCA 4AX3A 1QL4A 3R4YA 2QA4P 2E5TA 2PGDA 1H31A 1DVHA 2E74B 1H33B 3C8VA 3HD7D 2Z4EA 5B6QA 1FCDC 4JYCA 3CPWO 1KQLA 3UIAA
chains in the Genus database with same CATH topology
1AYGA 1KB9D 5C9MA 2JWAA 1CIFA 3JBTB 1A56A 4FA4A 1CO6A 5C0ZA 3CXHW 2RN0A 1DW1A 1H9XA 1P84D 1H32A 4AALA 5GTIV 1M70A 1I6EA 3WFCC 5KLVD 2GC7D 2FYUD 1BGYD 4WQ7A 3MK7C 1H1OA 1CSWA 2I8FA 2YIUB 3ZIYA 5H2FV 1NIRA 3HQ7A 1FOCA 2HV4A 5CIHB 2ORLA 1GDVA 3L73D 1OAEA 2FRCA 2B11B 4FB1A 2D0SA 4PD4D 1I6DA 3PXSA 1H31B 4JCGA 1E8EA 2QG4A 1OCDA 3VMAA 1K3HA 1EB7A 1EZVD 2LITA 3L70D 1DVVA 1NMLA 4GYDA 5E79V 2QJKB 5KLIB 4QAOA 1I5TA 4L3GA 1CC5A 2BH5X 1CYJA 5DJQC 2IBZD 1K3GA 3GG2A 4FA1A 1YCCA 1A8CA 1W5CT 1CRHA 2A06D 3HQ8A 1C52A 3O1YA 3PXWA 1QYZA 1AOQA 3C2CA 1C6OA 2PACA 1CYCA 1YICA 1QN2A 1WVEC 5CIEB 4FANA 1U75B 4WQAA 3H1LD 3WC8A 4IL6V 3RN1A 1YEAA 4L3HA 4PW9B 3M97X 1IQCA 2ZXYA 3WUIA 1B7VA 3MK7B 4H0JA 1IRVA 1QL3A 1KX7A 3ZBMA 1J3SA 2D0WA 2ZBOA 1N9CA 1C75A 3A0HV 1L0LD 3GW6A 5IY51 2V07A 3CX5D 1CSUA 1C7MA 1HZVA 4RJTA 4PJ0V 2C8SA 1NNOA 2FYNB 1H9YA 1RZ5A 1MZ4A 5TISV 1GU2A 1M60A 1NU1D 1ETPA 3WU2V 2Y0CA 5CICB 2CA4B 1RAPA 4XXLA 1IZL0 5DJQB 1F1FA 3ZOWA 1CIHA 1CEDA 2VHDA 4EIDA 2K9JB 2BH4X 1YNRA 2N9JA 3CYTI 3NWVA 1MG2D 3A9FA 4WQBA 3KZIV 1CIEA 5KAFV 4Q5PA 3KHUA 5TJHA 4LJIA 3ITKA 4H0KA 1CYIA 2GIWA 1PPJD 4FAVA 5B5EV 4UB8V 2QJYB 3L75D 2BGVX 1KYOD 2N9YB 2QJPB 1DIIC 4DY9A 3NBTA 1CTJA 1S5LV 2GC4D 451CA 1PP9D 1I55A 1F1CA 1M6ZA 3VNWA 2N9IA 3SLEA 1AOFA 2CE1A 1HZUA 3VRDA 1FJ0A 1GJQA 2N3YA 4A7PA 2ZZS1 1GQ1A 1CRGA 1CSXA 1WEJF 1COTA 1SQPD 2LIRA 2AXTV 1BCCD 3PLNA 4GEDB 3A0BV 1CHIA 3CXHD 3OA8A 1HROA 1I8PA 4FA5A 1L9BC 2B12B 5CIFB 1FI3A 1W2LA 1YTCA 3O5CA 1DW0A 5CYTR 5CIBB 1SQXD 2L4DA 2C1DA 1YEBA 1NMIA 2CA3B 3ZCFA 1FHBA 1YIQA 3H1HD 4MU8A 1CXAA 4V2KA 4D6TD 2FWLA 2V08A 3PH2B 2N3BA 1C6RA 4K3IA 3PTZA 3RLMA 1CCRA 1I54A 1N50A 2MHMA 3DR0A 5CIGB 2JQRA 3WFEC 4NFGB 1HJ5A 1HCMA 2AIUA 2L91A 3ZOYA 1CHHA 3OA8B 4WQDA 1HJ3A 1CORA 3FWLA 3RMZA 3WFBC 2C1DB 155CA 2PCBB 1BE3D 2B4ZA 4EIFA 2BCCD 1L0ND 2MTAC 3CP5A 1DIQC 3TF5A 5DF5A 2KS1A 1CCHA 5DFSA 4O1QA 1HJ4A 1KIBA 5KKZB 5AURA 1CTYA 4U3FD 1C6SA 2BPBB 3PXTA 5KAIV 1CRYA 1R0QA 2ZOOA 3WFDC 3ZOXA 3BCCD 1C2RA 3ZOOA 2CXBA 4P4QB 1C2NA 3L71D 1CSVA 2PCCB 4EICA 1FI7A 2O3JA 2GB8B 1AKKA 3TYIA 1CRJA 1NTKD 1SQQD 3PRJA 4EIEA 4O1WA 1CRCA 4UB6V 1CTZA 1A2SA 1N90A 3L74D 1RZ6A 4WQ8A 1NTZD 1SQVD 1N15A 3SWSA 2DVHA 2N18C 3L4MA 1LC2A 3TDKA 2JTIB 4PWAA 2BLFB 2B10B 3X39A 2Y0EA 2CE0A 1CIGA 1HRCA 3CU4A 2C1UA 1E2RA 3PHLA 3OCDA 5CIDB 1ZZHA 2EXVA 2OZ1A 4YE1A 5EXQA 1BL9A 3HQ9A 3ORVA 1KV9A 5GTHV 2XTSB 4FA9A 2BCNB 3SXTA 2Y0DA 3VYMA 4AAOA 3TGUD 5B66V 2Q3EA 4RSZA 4Y5RA 1IO3A 4AAMA 3RN0A 3SJLA 1U74B 1QKSA 3L4OA 4XYDB 2C9XB 4EDFA 1GIWA 3H1KD 1FI9A 4WQCA 1L9JC 1LS9A 3OCDB 1H32B 1HH7A 2OZ1B 2C1VA 3CX5W 4L1QA 2N18B 3NBSA 2B0ZB 2ZONG 1MG3D 1NTMD 4WQEA 1SQBD 2YK3A 1VYDA 1LMSA 1CNOA 1IRWA 1DW2A 1H33A 1ZRTD 1E29A 4KMGA 3L72D 2C2CA 3H1JD 1KB0A 2YQBA 2AI5A 1JDLA 1RAQA 351CA 1YFCA 3H1ID 1DW3A 2RMZA 3DP5A 2DGEA 1S6VB 4J20A 4WQ9A 1I8OA 3SVWA 3HQ6A 1KYOW 4AANA 1LC1A 1KX2A 3O20A 1CHJA 2KNCB 2YCCA 1DT1A 4AX3A 1QL4A 1CXCA 3DMIA 1H31A 1DVHA 1H33B 1GKSA 4N0KA 5B6QA 3O0RC 1FCDC 3CWBD 1LFMA 1CRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYG A;  1KB9 D;  5C9M A;  2JWA A;  1CIF A;  3JBT B;  1A56 A;  4FA4 A;  1CO6 A;  5C0Z A;  3CXH W;  2RN0 A;  1DW1 A;  1H9X A;  1P84 D;  1H32 A;  4AAL A;  5GTI V;  1M70 A;  1I6E A;  3WFC C;  5KLV D;  2GC7 D;  2FYU D;  1BGY D;  4WQ7 A;  3MK7 C;  1H1O A;  1CSW A;  2I8F A;  2YIU B;  3ZIY A;  5H2F V;  1NIR A;  3HQ7 A;  1FOC A;  2HV4 A;  5CIH B;  2ORL A;  1GDV A;  3L73 D;  1OAE A;  2FRC A;  2B11 B;  4FB1 A;  2D0S A;  4PD4 D;  1I6D A;  3PXS A;  1H31 B;  4JCG A;  1E8E A;  2QG4 A;  1OCD A;  3VMA A;  1K3H A;  1EB7 A;  1EZV D;  2LIT A;  3L70 D;  1DVV A;  1NML A;  4GYD A;  5E79 V;  2QJK B;  5KLI B;  4QAO A;  1I5T A;  4L3G A;  1CC5 A;  2BH5 X;  1CYJ A;  5DJQ C;  2IBZ D;  1K3G A;  3GG2 A;  4FA1 A;  1YCC A;  1A8C A;  1W5C T;  1CRH A;  2A06 D;  3HQ8 A;  1C52 A;  3O1Y A;  3PXW A;  1QYZ A;  1AOQ A;  3C2C A;  1C6O A;  2PAC A;  1CYC A;  1YIC A;  1QN2 A;  1WVE C;  5CIE B;  4FAN A;  1U75 B;  4WQA A;  3H1L D;  3WC8 A;  4IL6 V;  3RN1 A;  1YEA A;  4L3H A;  4PW9 B;  3M97 X;  1IQC A;  2ZXY A;  3WUI A;  1B7V A;  3MK7 B;  4H0J A;  1IRV A;  1QL3 A;  1KX7 A;  3ZBM A;  1J3S A;  2D0W A;  2ZBO A;  1N9C A;  1C75 A;  3A0H V;  1L0L D;  3GW6 A;  5IY5 1;  2V07 A;  3CX5 D;  1CSU A;  1C7M A;  1HZV A;  4RJT A;  4PJ0 V;  2C8S A;  1NNO A;  2FYN B;  1H9Y A;  1RZ5 A;  1MZ4 A;  5TIS V;  1GU2 A;  1M60 A;  1NU1 D;  1ETP A;  3WU2 V;  2Y0C A;  5CIC B;  2CA4 B;  1RAP A;  4XXL A;  1IZL 0;  5DJQ B;  1F1F A;  3ZOW A;  1CIH A;  1CED A;  2VHD A;  4EID A;  2K9J B;  2BH4 X;  1YNR A;  2N9J A;  3CYT I;  3NWV A;  1MG2 D;  3A9F A;  4WQB A;  3KZI V;  1CIE A;  5KAF V;  4Q5P A;  3KHU A;  5TJH A;  4LJI A;  3ITK A;  4H0K A;  1CYI A;  2GIW A;  1PPJ D;  4FAV A;  5B5E V;  4UB8 V;  2QJY B;  3L75 D;  2BGV X;  1KYO D;  2N9Y B;  2QJP B;  1DII C;  4DY9 A;  3NBT A;  1CTJ A;  1S5L V;  2GC4 D;  451C A;  1PP9 D;  1I55 A;  1F1C A;  1M6Z A;  3VNW A;  2N9I A;  3SLE A;  1AOF A;  2CE1 A;  1HZU A;  3VRD A;  1FJ0 A;  1GJQ A;  2N3Y A;  4A7P A;  2ZZS 1;  1GQ1 A;  1CRG A;  1CSX A;  1WEJ F;  1COT A;  1SQP D;  2LIR A;  2AXT V;  1BCC D;  3PLN A;  4GED B;  3A0B V;  1CHI A;  3CXH D;  3OA8 A;  1HRO A;  1I8P A;  4FA5 A;  1L9B C;  2B12 B;  5CIF B;  1FI3 A;  1W2L A;  1YTC A;  3O5C A;  1DW0 A;  5CYT R;  5CIB B;  1SQX D;  2L4D A;  2C1D A;  1YEB A;  1NMI A;  2CA3 B;  3ZCF A;  1FHB A;  1YIQ A;  3H1H D;  4MU8 A;  1CXA A;  4V2K A;  4D6T D;  2FWL A;  2V08 A;  3PH2 B;  2N3B A;  1C6R A;  4K3I A;  3PTZ A;  3RLM A;  1CCR A;  1I54 A;  1N50 A;  2MHM A;  3DR0 A;  5CIG B;  2JQR A;  3WFE C;  4NFG B;  1HJ5 A;  1HCM A;  2AIU A;  2L91 A;  3ZOY A;  1CHH A;  3OA8 B;  4WQD A;  1HJ3 A;  1COR A;  3FWL A;  3RMZ A;  3WFB C;  2C1D B;  155C A;  2PCB B;  1BE3 D;  2B4Z A;  4EIF A;  2BCC D;  1L0N D;  2MTA C;  3CP5 A;  1DIQ C;  3TF5 A;  5DF5 A;  2KS1 A;  1CCH A;  5DFS A;  4O1Q A;  1HJ4 A;  1KIB A;  5KKZ B;  5AUR A;  1CTY A;  4U3F D;  1C6S A;  2BPB B;  3PXT A;  5KAI V;  1CRY A;  1R0Q A;  2ZOO A;  3WFD C;  3ZOX A;  3BCC D;  1C2R A;  3ZOO A;  2CXB A;  4P4Q B;  1C2N A;  3L71 D;  1CSV A;  2PCC B;  4EIC A;  1FI7 A;  2O3J A;  2GB8 B;  1AKK A;  3TYI A;  1CRJ A;  1NTK D;  1SQQ D;  3PRJ A;  4EIE A;  4O1W A;  1CRC A;  4UB6 V;  1CTZ A;  1A2S A;  1N90 A;  3L74 D;  1RZ6 A;  4WQ8 A;  1NTZ D;  1SQV D;  1N15 A;  3SWS A;  2DVH A;  2N18 C;  3L4M A;  1LC2 A;  3TDK A;  2JTI B;  4PWA A;  2BLF B;  2B10 B;  3X39 A;  2Y0E A;  2CE0 A;  1CIG A;  1HRC A;  3CU4 A;  2C1U A;  1E2R A;  3PHL A;  3OCD A;  5CID B;  1ZZH A;  2EXV A;  2OZ1 A;  4YE1 A;  5EXQ A;  1BL9 A;  3HQ9 A;  3ORV A;  1KV9 A;  5GTH V;  2XTS B;  4FA9 A;  2BCN B;  3SXT A;  2Y0D A;  3VYM A;  4AAO A;  3TGU D;  5B66 V;  2Q3E A;  4RSZ A;  4Y5R A;  1IO3 A;  4AAM A;  3RN0 A;  3SJL A;  1U74 B;  1QKS A;  3L4O A;  4XYD B;  2C9X B;  4EDF A;  1GIW A;  3H1K D;  1FI9 A;  4WQC A;  1L9J C;  1LS9 A;  3OCD B;  1H32 B;  1HH7 A;  2OZ1 B;  2C1V A;  3CX5 W;  4L1Q A;  2N18 B;  3NBS A;  2B0Z B;  2ZON G;  1MG3 D;  1NTM D;  4WQE A;  1SQB D;  2YK3 A;  1VYD A;  1LMS A;  1CNO A;  1IRW A;  1DW2 A;  1H33 A;  1ZRT D;  1E29 A;  4KMG A;  3L72 D;  2C2C A;  3H1J D;  1KB0 A;  2YQB A;  2AI5 A;  1JDL A;  1RAQ A;  351C A;  1YFC A;  3H1I D;  1DW3 A;  2RMZ A;  3DP5 A;  2DGE A;  1S6V B;  4J20 A;  4WQ9 A;  1I8O A;  3SVW A;  3HQ6 A;  1KYO W;  4AAN A;  1LC1 A;  1KX2 A;  3O20 A;  1CHJ A;  2KNC B;  2YCC A;  1DT1 A;  4AX3 A;  1QL4 A;  1CXC A;  3DMI A;  1H31 A;  1DVH A;  1H33 B;  1GKS A;  4N0K A;  5B6Q A;  3O0R C;  1FCD C;  3CWB D;  1LFM A;  1CRI A; 
#chains in the Genus database with same CATH topology
 5BVZ A;  5C39 A;  2E75 D;  1KB9 D;  2HYN A;  5C9M A;  2Q6Q A;  3JBT B;  1A56 A;  1OFC X;  4JQ0 D;  4EYY Q;  1A02 F;  1FZE A;  1P84 D;  3I5C A;  1H32 A;  1QL1 A;  4R4L A;  5GTI V;  4UB6 E;  3NXS A;  1PV3 A;  2V4H A;  5KLV D;  1FDM A;  3B5N C;  1H0T A;  2FYU D;  2OAR A;  4WQ7 A;  3G6E P;  4H0L C;  1CSW A;  2YIU B;  4RES B;  3CI9 A;  1JMB A;  1EXJ A;  1FOC A;  1HGZ A;  4IFF A;  4GDO A;  3L73 D;  1GU5 A;  3TGU E;  2H88 C;  1YBK A;  1JEK A;  4PD4 D;  3B5N A;  3PXS A;  2Y9Z A;  2B89 A;  1OCD A;  1K3H A;  1S3J A;  1EB7 A;  1Y9B A;  3L70 D;  1SQV J;  3MD0 A;  2QJK B;  3H25 A;  1I5T A;  2W6A A;  5KKZ C;  5KLV G;  3GLM A;  3H1K E;  2FYU G;  2P67 A;  2OYH C;  2IBZ D;  1LGH B;  1YCC A;  1A8C A;  1W5C T;  1W2E A;  3HQ8 A;  1C52 A;  1OW7 A;  3L73 G;  2YKP A;  2OTK E;  1OVR A;  1GL2 A;  1SQB E;  2L5G B;  1N7S B;  1QVG O;  1QN2 A;  1L4A B;  2OYH A;  3TSI A;  3LIE A;  3MTU E;  4IL6 X;  2QJY C;  4IL6 V;  1YEA A;  3L70 G;  3B5N D;  2WT7 A;  2QJP C;  3D71 A;  1IQC A;  3WUI A;  1M57 D;  3GHG B;  3MK7 B;  1IRV A;  1VF5 D;  1HUC A;  1YQ3 C;  2IBZ G;  2D0W A;  3SWF A;  2KOG A;  3H1I E;  1N9C A;  1L0L D;  3GW6 A;  5IY5 1;  3CX5 D;  1CSU A;  5APS A;  5KTB A;  1HZV A;  4RJT A;  4PJ0 V;  3KXD A;  1NTM K;  1BDD A;  5KAF H;  2N1T B;  2FFD A;  2NPS B;  1MZ4 A;  1GL2 D;  1JUN A;  1M60 A;  3JSV C;  5B5E H;  2O01 N;  3WU2 V;  3CMA P;  5CIC B;  4WWI A;  1IZL 0;  1F1F A;  1YNR A;  1PGQ A;  5CJ0 A;  1DH3 A;  4HB1 A;  3N7N A;  2OYI C;  1L0L G;  3KZI V;  1HJB A;  4OGQ D;  3H1J J;  4Q5P A;  1T6A A;  4LJI A;  4N78 D;  4H0K A;  1CYI A;  4FAV A;  3SFD C;  3NMD A;  4UB8 V;  1VPC A;  1DII C;  4DY9 A;  1BSN A;  1EZV I;  3NBT A;  1FZA A;  3A0B H;  1LT1 A;  2N9B A;  1I55 A;  3BCC J;  3RK3 B;  4A7P A;  4HH2 A;  1CRG A;  3RBX A;  3MIW A;  1SQP D;  1IFM A;  3PLN A;  3I55 P;  1CHI A;  2SPZ A;  1R5L A;  4BRY B;  1I8P A;  1NKZ B;  2YXR B;  1W2L A;  1SFC C;  1DW0 A;  3AE7 C;  5CIB B;  3HUS C;  2L4D A;  1GK6 A;  1NMI A;  2A06 E;  4H44 B;  1SQP G;  5KLV J;  2FYU J;  2Q7C A;  2N3B A;  2ZT9 D;  5E79 E;  1VQ4 P;  4OWF A;  1RQU A;  1Q90 D;  5AVS B;  3L73 J;  2MHM A;  2E74 C;  1HBW A;  3DR0 A;  5CIG B;  3WFE C;  1S72 P;  2O1K A;  1FZC B;  3FWN A;  1M1J A;  1NVO A;  1HCM A;  2AIU A;  1G2C B;  1ZN5 A;  3L70 J;  1OW8 A;  1MFT A;  2ZAE B;  4WQD A;  4NPE A;  3HE5 A;  3RMZ A;  2BEQ D;  2IFM A;  1KB9 H;  3FGA D;  155C A;  2IPP A;  5AW3 B;  2E43 A;  1J1E B;  1FBM A;  2MTA C;  1GD2 E;  2W6B A;  3PP5 A;  1P84 H;  2YIU C;  2KS1 A;  4O1Q A;  4WY4 B;  1G1J A;  3PXT A;  3Q5R A;  4OH8 B;  3G9R A;  4ASW A;  3ZOO A;  1N7L A;  2WMM A;  4P4Q B;  5CCH C;  3L71 D;  2YO3 A;  2HG5 D;  1CSV A;  2PCC B;  4PD4 H;  1E5W A;  4EIC A;  4KJM A;  1FI7 A;  2QJK C;  1VL2 A;  1WT6 A;  3TYI A;  4EI2 A;  1R5S A;  4ZNC A;  1L0L J;  4O1W A;  1PGO A;  1CTZ A;  1A2S A;  1OMI A;  3RK3 E;  3L74 D;  1N15 A;  3F5H A;  3PH0 A;  2K9Y A;  2JTI B;  2C1U A;  3L71 G;  1E2R A;  3PHL A;  3BRV B;  5APY A;  1EXI A;  1J2J B;  5L8R J;  1AFO A;  1KV9 A;  3L74 G;  3RL0 D;  4TT3 H;  3H1H E;  5B66 V;  1PIX A;  4RSZ A;  1GDT A;  3CX5 H;  2YO2 A;  1KQF B;  2WQY C;  3B8E B;  4AAM A;  5APT A;  4L73 A;  1PGP A;  1GIW A;  4C7N A;  3VP8 A;  1EDL A;  1FZB A;  1M56 D;  5AW7 B;  1SQP J;  3OCD B;  1FU1 A;  1H32 B;  4YPC A;  2OZ1 B;  3AE4 C;  1TU3 F;  3NBS A;  5CHX A;  1NTM D;  2AEM A;  2PAJ A;  1LMS A;  2D2C B;  1RE4 C;  1CNO A;  1IRW A;  2BCC E;  1ZRT D;  5TIS H;  5AVV B;  3S9O A;  1LJ2 A;  1Q2N A;  4O9B A;  4U3F E;  1FC2 C;  1FOS E;  4DOJ A;  5CCG C;  2ZVO B;  3AE1 C;  2DGE A;  1S6V B;  5KJ7 C;  4J20 A;  1NTM G;  1GZL A;  2QVA A;  1KQG B;  3KQG A;  3SVW A;  3HQ6 A;  4AAN A;  1USE A;  1CHJ A;  1JY3 P;  1GL2 B;  1SQQ E;  1N8R Q;  2KNC B;  1SLQ A;  1L0N K;  1DT1 A;  4K3A A;  5GTI H;  1NTZ E;  3EFF K;  3DMI A;  1G1I A;  3EWK A;  3HE4 A;  4H44 C;  1VQ5 P;  1GKS A;  4N0K A;  2YMY A;  3O0R C;  1OIP A;  5AW4 B;  1FOS F;  4TLF A;  1CIF A;  2KLV A;  1CO6 A;  3VMY A;  1R8E A;  4NPF X;  2K1A A;  3LID A;  1S1C X;  2FFD B;  4GKG A;  1JO5 A;  1LWU C;  3ZIY A;  1NIR A;  1OVV A;  1N73 A;  2FY8 A;  1OAE A;  2FRC A;  3L75 J;  1OXZ A;  2Z5I A;  1E8E A;  3VMA A;  2WZ7 A;  3L74 J;  2UWJ E;  4IOI H;  4K35 A;  1DVV A;  1NML A;  1DEE G;  4GYD A;  1NGM B;  2Y9Y A;  4L3G A;  1H88 A;  4IL6 H;  4JPZ B;  2R5D A;  4DCK A;  4BXL A;  1K3G A;  1QVF O;  2M0B A;  3IR9 A;  4PV1 B;  1CRH A;  1KIL B;  1AV1 A;  3CCQ P;  3U1A A;  1AOQ A;  3C2C A;  1C6O A;  4H13 D;  3CC4 P;  1GK4 A;  4WB4 A;  4WQA A;  3L72 E;  3WC8 A;  2XU6 A;  3RN1 A;  1SQX J;  3M97 X;  3S4R A;  3CME P;  1LT9 C;  1X9V A;  1B7V A;  3WU2 H;  3QWO C;  1NJI Q;  2GM4 A;  1RHZ B;  1C75 A;  3OJA B;  3V2Q A;  2E76 D;  3II6 A;  2V07 A;  1URQ B;  5KAI H;  1LT9 A;  1KFM A;  2FYN B;  1KB9 I;  1SQB K;  1T2K D;  1RZ5 A;  4JYB A;  5TIS V;  3JCU H;  1CI6 B;  1YJW P;  1ETP A;  2Y0C A;  2CK3 H;  5DJQ B;  2M8R A;  1KZU B;  2ITA A;  1NTM J;  2VHD A;  2BH4 X;  4L74 A;  5AW1 B;  3CWB E;  3CYT I;  3Q5S A;  1XTC C;  4JBZ A;  2PP6 A;  2HR3 A;  1BE3 J;  3V4W A;  5TJH A;  3ITK A;  1AVO A;  3K5B A;  2C0X A;  2BGV X;  3CCM P;  2QM8 A;  1KYO D;  4KT0 J;  3HE5 B;  3Q2Y A;  2KZI A;  3BAS A;  1BGY E;  2QRX A;  1FJK A;  3SLE A;  2IBZ I;  2IDB A;  2CE1 A;  3VRD A;  1RY3 A;  1FJ0 A;  2N3Y A;  1Q7Y Q;  2D2C C;  3MP7 B;  1NTK J;  1BCC D;  1EZV E;  3H32 B;  1RQV A;  1VQL P;  3CXH D;  1VDF A;  4WVZ A;  2W6J H;  2MJZ A;  5CIF B;  1FI3 A;  3TYY A;  2WVR A;  1YTC A;  5GTH E;  3O5C A;  1KIL E;  4U7J A;  2WSF J;  2P10 A;  3CCU P;  3OW2 O;  5AW8 B;  2CA3 B;  4XA4 A;  3RGU A;  4DZO A;  2HPC B;  1YIQ A;  1RE3 C;  3EFG A;  3V6I A;  2H7H A;  1CXA A;  4V2K A;  4D6T D;  2FWL A;  3CX5 I;  2V08 A;  3PH2 B;  1VQ7 P;  3H1L E;  2HLO A;  1C6R A;  1OZH A;  2XND H;  1FE6 A;  4Y99 C;  1BCC G;  2K9J A;  1FZF A;  3RLM A;  5BU8 B;  1I54 A;  2V7Q J;  1KTM A;  1KMI Z;  4H0L D;  1AQT A;  3IAO A;  1RF0 C;  3GF3 A;  1SP4 A;  4W80 A;  1HJ5 A;  1LTT C;  2KSE A;  3AEA C;  5AW9 B;  3ZOY A;  3USS A;  1CHH A;  3OA8 B;  2ZYD A;  3P8C D;  3V2P A;  3FWL A;  4D6T G;  3WFB C;  2C1D B;  2WSF H;  3ABV C;  2B4Z A;  3M06 A;  1RF1 C;  1NU1 E;  1L2P A;  1L0N D;  3GMA A;  1FS0 E;  1DIQ C;  1M90 Q;  5DF5 A;  5DFS A;  2VRS A;  1Z56 A;  1KIB A;  1NO4 A;  1C6S A;  1X8Y A;  1ZW0 A;  3W67 A;  5KAI V;  2ZOO A;  2B87 B;  2LKM A;  4PJ0 E;  2V7Q H;  3SSU A;  2CXB A;  1GW3 A;  2H8P D;  1PPJ E;  1C2N A;  3I56 P;  3L75 E;  1AKK A;  1CRJ A;  1L0N G;  2OYI A;  4EIE A;  5AVT B;  1N90 A;  3WUV A;  1PP9 E;  3M0D C;  3SFE C;  1KIL C;  1BDC A;  5H2F H;  1Q86 Q;  3KZI E;  4AQR D;  2KK7 A;  2N18 C;  2A45 I;  3L4M A;  1YTZ T;  3O6Q B;  3TDK A;  4PWA A;  2BLF B;  2CE0 A;  1DD3 A;  1VQO P;  1E79 H;  1KFN A;  4UB8 E;  3AEC C;  1JTH A;  1W2B O;  1PL5 A;  5B66 H;  1U57 A;  3RK2 B;  3D6Z A;  1T8Z A;  3VTP C;  5APW A;  3HQ9 A;  1YI2 P;  1IFJ A;  1FJP A;  1SQX E;  4FA9 A;  1USD A;  3GF7 A;  2BCN B;  1SQV K;  1LTG C;  2GA1 A;  2W8Z A;  2Y0D A;  1URQ C;  3V4Q A;  3AEE C;  3VYM A;  3F89 A;  2R32 A;  3TGU D;  1LTJ B;  2Q3E A;  2FYN C;  4Y5R A;  1W5C E;  2ZXX A;  3HE4 B;  1QLE D;  1SFC A;  3NFQ A;  5CMZ A;  2I1K A;  3HUS A;  1PZQ A;  3D70 A;  3RN0 A;  4AUW A;  4XYD B;  4EDF A;  1LP1 A;  3H1K D;  1FI9 A;  4WQC A;  1L9J C;  1LS9 A;  3Q5P A;  3Q1M A;  4L1Q A;  2C1V A;  3CX5 W;  1NYH A;  2JWD A;  1MG3 D;  3A0H H;  1M7L A;  1KD1 Q;  1IFN A;  3TGU G;  1SQB D;  1VYD A;  1J1D B;  1NAF A;  1DW2 A;  1H33 A;  1E29 A;  2E42 A;  4KMG A;  1S4X A;  4GIF A;  1SFC D;  1KYO H;  1LTA C;  2YQB A;  1AVY A;  3H1K G;  1JDL A;  2FBW C;  1T3U A;  3H1I D;  4LC1 A;  2RMZ A;  3CCR P;  3A7O A;  3DP5 A;  3O8Z A;  3FX0 A;  1NWQ A;  2ZVN B;  3P7K A;  5CBN A;  1SQB G;  2JDI H;  3IN6 A;  1LC1 A;  4AYC A;  1IC2 A;  1NTK E;  2RH0 A;  1K05 A;  2E74 D;  2XNX A;  5AVX B;  3CXH H;  3C9I A;  1SQV E;  4Y28 J;  3D6Y A;  5CCH A;  2MKV A;  3H1I G;  3HD7 B;  2ZFC A;  3R2P A;  1AYG A;  5KAF E;  1L0N J;  1N7S C;  1L4A C;  2E75 B;  4I2L C;  4I6M C;  5B5E E;  3TNU B;  1LTB C;  2AXT H;  1DW1 A;  3T97 B;  1M70 A;  1I6E A;  3WFC C;  1IK9 A;  1S5L E;  2GC7 D;  1N7S A;  1SQQ K;  3GHG C;  3MK7 C;  1X22 A;  2R3S A;  2I8F A;  5H2F V;  3HQ7 A;  2HV4 A;  1YQ4 C;  5CIH B;  2W83 C;  1NTZ K;  3CCE P;  1NKN A;  2B11 B;  4FB1 A;  1S9K E;  5CCH D;  1I6D A;  1VQ9 P;  3GHG A;  5APX A;  4N6J A;  1H31 B;  3NTN A;  2N1T C;  2NPS C;  2LIT A;  3A0B E;  3OAK A;  3CCS P;  5KLI B;  1MUU A;  1T3J A;  1CC5 A;  1U7M A;  1EDI A;  1SS1 A;  1DEB A;  1KOR A;  1JCD A;  4BWN A;  3MHV A;  2FYU K;  2YNY A;  1N86 A;  3GG2 A;  4GOF A;  1LTI C;  1QGK B;  4W7Z A;  3AEF C;  2A06 D;  3PXW A;  5AVW B;  5CJ4 A;  3S1K A;  2PAC A;  1H0T B;  1IK7 A;  1WVE C;  5CIE B;  1M8O B;  4FAN A;  1OX3 A;  3L36 A;  3H1J E;  4KHX A;  2ZXY A;  3B5N B;  1HF9 A;  3TGU J;  3CL3 D;  1JMM A;  1YHQ P;  1QL3 A;  1NAY A;  2ZBO A;  1RE4 A;  1VF5 B;  2CPS A;  3A0H V;  3BVH A;  3AE8 C;  3RK3 C;  2A06 G;  3C1L A;  3BCC E;  1C7M A;  2AXC A;  2B9B A;  3U1C A;  2C8S A;  1NNO A;  1H9Y A;  3RK2 C;  3H1K J;  1KQS O;  2WTY A;  1FDI A;  1GU2 A;  3V5B A;  5CCG A;  1RAP A;  4XXL A;  5APQ A;  4UB6 H;  3ZOW A;  5KJ7 A;  2OYH B;  2K9J B;  4EID A;  1SQB J;  3A3Y B;  3W68 A;  2FKW B;  3NWV A;  1K9M Q;  2WT7 B;  4WQB A;  1EC5 A;  1LTJ C;  1CIE A;  1KB9 E;  3KHU A;  2QSI A;  4OGQ B;  2GIW A;  2QJY B;  3P8M C;  1P84 E;  2WPV B;  2J58 A;  2N9Y B;  2QJP B;  2WPQ A;  3H1I J;  5KLV E;  2FYU E;  1CTJ A;  1D7M A;  1JM0 A;  451C A;  4GT1 A;  1GW4 A;  2WSS H;  1F1C A;  1M6Z A;  1K04 A;  3RK3 D;  2K88 A;  1FZC C;  3VNW A;  2N9I A;  5CCG D;  4NPD A;  3L73 E;  3L71 J;  1HZU A;  5KJ7 D;  2ZZS 1;  4PD4 E;  1J1D C;  2LIR A;  3WUT A;  1QX8 A;  1YJN P;  2Q9I A;  2AXT V;  3A2A A;  1LWU A;  3L70 E;  1FZC A;  2ZYG A;  4YXW H;  2M5A A;  4N3Y B;  3HTK A;  1ZLL A;  1G2C A;  1J1E C;  5AVZ B;  2FXM A;  1HRO A;  3N4X A;  2IBZ E;  4WY4 C;  5CYT R;  1HGV A;  4H44 D;  2Q1K A;  1FHB A;  3H1H D;  4MU8 A;  2POH A;  2HFE D;  2GUV A;  2M3B A;  3WUU A;  4CPG A;  2YXQ B;  5DJU B;  4K3I A;  2IYO A;  3PTZ A;  2R44 A;  4YTP C;  1CCR A;  2ZT9 B;  3H6P A;  3CCJ P;  1N50 A;  3VP9 A;  1PGJ A;  2JP3 A;  3E1R A;  4NFG B;  2KI7 B;  2YKQ A;  2WSE J;  1L0L E;  5M1B A;  3HD7 C;  2KIK A;  2PRR A;  3CX5 E;  4C46 A;  1DD4 A;  1IO4 A;  3H1H G;  2HOD A;  1HJ3 A;  2E75 C;  4ZKP A;  2PCB B;  2I8D A;  2AEJ A;  2BCC D;  4EOT A;  4B86 A;  3PJS K;  4EIJ A;  3CP5 A;  2XV5 A;  3TF5 A;  1KYO I;  1CCH A;  1HJ4 A;  1P84 I;  4HKZ H;  1QEX A;  1HWT C;  5AUR A;  3KYQ A;  1CTY A;  4U3F D;  3TK1 A;  2BPB B;  1FZG A;  1R0Q A;  3WFD C;  3BCC D;  3KDP B;  4N78 E;  5TIS E;  1M1J B;  4PD4 I;  2BCC G;  2WSE H;  2WSC J;  3PRJ A;  1SQQ D;  2E5Y A;  2Q3I A;  4UB6 V;  2QIW A;  3CXH I;  1NU1 K;  3M91 A;  2ZXE B;  3B71 A;  1RZ6 A;  4WQ8 A;  1NTZ D;  3SWS A;  4OVN F;  4U3F G;  1X79 B;  3E7K A;  1LC2 A;  1SQP E;  3BCC G;  3X39 A;  2B10 B;  5BU5 A;  2KS1 B;  1HRC A;  4XE5 B;  4ZKU A;  3OCD A;  5CID B;  3G4S P;  2EXV A;  2OZ1 A;  4YE1 A;  5GTI E;  5E79 H;  1SQQ G;  1IFP A;  1UIX A;  2I1J A;  2OTL P;  2YMK A;  5GTH V;  3A5T A;  2XTS B;  3SXT A;  1VF5 C;  1NTZ G;  1MFZ A;  4ASV A;  3RL0 B;  4AAO A;  2PFX A;  2WSC H;  1PFI A;  4GOE A;  5AW5 B;  1SVF A;  1OWA A;  3AE3 C;  1EDK A;  3AEB C;  1IZN B;  1IO3 A;  1OW6 A;  3SWY A;  2LXC B;  1GL2 C;  1U74 B;  1VQ8 P;  4MN4 C;  3L4O A;  2C9X B;  3CCV P;  2C9L Y;  1RE3 A;  5DJT B;  3MZW B;  3CCL P;  3M9B A;  1MZ9 A;  2H43 A;  3BAT A;  1ZOY C;  1SQX K;  2D2C D;  3P32 A;  2KNC A;  4YXD C;  4OGQ C;  3WMM 0;  4R4M A;  1Q81 Q;  1CW5 A;  1IJD B;  1RF0 A;  2P1J A;  4IL6 E;  1EDJ A;  3L72 D;  1HVV A;  2K37 A;  3U59 A;  3H1H J;  1KB0 A;  2FFD C;  3L4F A;  2KXP B;  3IFM A;  3FXE A;  1RAQ A;  2KB7 P;  1DW3 A;  3M9H A;  4Z1M H;  4I7Z B;  1RF1 A;  1S2E A;  4WQ9 A;  3L71 E;  5AW2 B;  4C7N B;  3JC2 2;  4IFM A;  1I8O A;  1KYO W;  3L72 G;  1KC8 Q;  3WU2 E;  3VYI A;  1YYC A;  3L74 E;  1CXC A;  3E1I A;  1S5L H;  2XKM A;  4QMA A;  4GOD A;  5KAI E;  4PV1 C;  3CWB D;  1LFM A;  2K3R A;  1CRI A;  2BCC J;  3RBZ A;  2LXB A;  1JNM A;  2JWA A;  1AQ5 A;  3JCU E;  1LTS C;  4HJG H;  4FA4 A;  5C0Z A;  3CXH W;  1Y8A A;  1WRG A;  2C0W A;  2RN0 A;  2ZT9 C;  1H9X A;  3M0D A;  3CC7 P;  2OTJ P;  1KIL A;  5EFW B;  4AAL A;  2O01 J;  4U3F J;  1VQ6 P;  1U7J A;  1BGY D;  1NTK K;  4RKU J;  4JF7 A;  1H1O A;  3AE5 C;  2WIT A;  2DW3 A;  4DJG A;  2ORL A;  1GDV A;  1CZQ A;  3CWB G;  3VMX A;  2D0S A;  2M3E A;  1SQQ J;  4JCG A;  4XFJ A;  2C9N Y;  2KLU A;  2QG4 A;  2XZR A;  1EZV D;  1NTZ J;  2G8Y A;  1Y47 A;  5E79 V;  4WBA A;  3VMZ A;  4QAO A;  2ZYA A;  2BH5 X;  1URQ A;  3OA7 A;  1CYJ A;  1MKM A;  2P7J A;  4I1L A;  2W27 A;  4ZMD A;  1K8A Q;  5DJQ C;  1BGY G;  3LW5 J;  4PV1 D;  5AVR B;  1KIL D;  2JR8 A;  2G3A A;  3D0W A;  4FA1 A;  1KN7 A;  3O1Y A;  1CI6 A;  4HYT B;  1QYZ A;  2O01 H;  1BCC J;  1NTM E;  3CC2 P;  1CYC A;  1YIC A;  2R3C A;  1VQK P;  1U75 B;  1M1J C;  1ZRT E;  4H13 B;  3H1L D;  2ZJS E;  3AEG C;  1N73 B;  3CD6 P;  1BE3 E;  1EZV G;  4L3H A;  4PW9 B;  1OVU A;  4H0J A;  1LWU B;  2A45 G;  2IFN A;  2M5A B;  1KX7 A;  3ZBM A;  1J3S A;  3HTK B;  3FXD A;  1ZR4 A;  4D6T J;  1URQ D;  1GU4 A;  2WPR A;  3SWK A;  1YIJ P;  3V2R A;  1VQN P;  1FAV A;  3L35 A;  2E76 B;  3LW5 H;  2IYP A;  3AE2 C;  3H1L G;  2Q5U A;  1NU1 D;  3G3Z A;  2CA4 B;  2CPB A;  1XTG B;  1VQP P;  1CIH A;  1CED A;  2N9J A;  3RL0 C;  3H32 A;  1MG2 D;  3A9F A;  3L72 J;  3M0A A;  1JY2 P;  5KAF V;  1JY2 O;  4RO0 A;  1PPJ D;  1DX7 A;  5B5E V;  4LGD E;  3L75 D;  1IFI A;  2HOD B;  2HPC A;  1NU1 G;  1S5L X;  1LT9 B;  1S5L V;  2GC4 D;  1PP9 D;  1LNQ A;  1L4A A;  2FYZ A;  2QE7 H;  1AOF A;  2R5B A;  1HTL C;  2P58 A;  1GJQ A;  2IX7 C;  4C7R A;  1GQ1 A;  1CSX A;  1WEJ F;  1A02 J;  1COT A;  1RH5 B;  2KZJ A;  2W90 A;  1PPJ G;  2IZ0 A;  1ZP0 C;  4GED B;  3L75 G;  3A0B V;  2Z5H A;  3OA8 A;  3CWB J;  4FA5 A;  1L9B C;  2B12 B;  5H2F E;  1YJ9 P;  2QM7 A;  1SQX D;  2J59 M;  5KLV K;  1DIP A;  1PP9 G;  2C1D A;  4LLH A;  1YEB A;  2P2U A;  4I7Z C;  4DT0 A;  2N1T A;  2IZ1 A;  3ZCF A;  2OQQ A;  2NPS A;  2AEF A;  3VOP A;  1YIT P;  1N7S D;  5B66 E;  3CLQ A;  3MGN A;  1L4A D;  3B4S A;  1BGY J;  1JB0 J;  3RL0 g;  2B87 A;  2FXO A;  2JQR A;  1H89 A;  1SQX G;  4H0L B;  3BRT B;  2QEX P;  2L91 A;  2NRG A;  1JCC A;  4W7Y A;  1COR A;  1FDO A;  2N1T D;  2NPS D;  3HRN A;  1BE3 D;  4EIF A;  3IF4 A;  1NOH A;  3O6Q A;  2WPS A;  1JY2 N;  1YTZ I;  1NH4 A;  2OYO A;  5KKZ B;  1Q82 Q;  3A0H E;  1CSB A;  5CBO A;  3EQ2 A;  1JOC A;  2OGU A;  3H1L J;  1CRY A;  3ZOX A;  2FXP A;  1C2R A;  1L0L K;  1GTW A;  4BRY A;  1NHL A;  5AW6 B;  1HJ0 A;  4Y99 B;  1HH0 A;  1JY3 O;  2O3J A;  1KYO E;  1BE3 G;  1ZV8 A;  2GB8 B;  5K5G B;  3QH9 A;  4L75 A;  1NTK D;  1UII A;  1CRC A;  1LTJ A;  2GUS A;  3AE9 C;  1SQV D;  2O1J A;  3Q3D A;  4IFD K;  2A45 H;  2DVH A;  2NZ2 A;  1EQ7 A;  3M9Q A;  5GTH H;  3AE6 C;  1AJY A;  5AVY B;  1GMJ A;  2Y0E A;  1NU1 J;  1CIG A;  1MV8 A;  4H13 C;  3CU4 A;  3RK2 D;  1BCC E;  2H89 C;  2JO1 A;  2KUB A;  3G71 P;  1N73 C;  2YKO A;  2J5U A;  1ZZH A;  5APV A;  3CXH E;  1VQM P;  1RF1 B;  5EXQ A;  1BL9 A;  1ZR2 A;  1NTK G;  3ORV A;  1KV4 A;  1QL2 A;  1SQV G;  5AW0 B;  2WWW A;  2BEZ F;  3V2N A;  2OYI B;  1K73 Q;  2E76 C;  1H8A A;  4D6T E;  5AVU B;  1S9K D;  2AXT E;  1AA0 A;  1SQP K;  4WY4 A;  1PP9 J;  1T2K C;  1ZXG A;  3SJL A;  1QKS A;  2KYV A;  2KP8 A;  1X0T A;  3MUD C;  1JTH B;  1BSH A;  3ZDM A;  1HH7 A;  2JKV A;  2N18 B;  2B88 A;  5AVQ B;  2LR2 A;  2B0Z B;  1N2D C;  2ZON G;  3P8C E;  4WQE A;  2YK3 A;  4L76 A;  2RKL A;  1ZME C;  3MUD A;  2JEE A;  4PJ0 H;  4M3L A;  1L0N E;  2C2C A;  2KSJ A;  3H1J D;  2JJL A;  3HD7 A;  1WMK A;  4WY4 D;  2AI5 A;  1SFC B;  3TNU A;  351C A;  1YFC A;  3HUS B;  1JY3 N;  3AED C;  3T97 A;  3L37 A;  1LP1 B;  3KZI H;  3VN0 A;  2XDJ A;  1IFD A;  3KPE A;  1M1K Q;  1KX2 A;  3O20 A;  4UB8 H;  5APU A;  5KLI C;  3H1J G;  2BAS A;  2YCC A;  4AX3 A;  1QL4 A;  3R4Y A;  2QA4 P;  2E5T A;  2PGD A;  1H31 A;  1DVH A;  2E74 B;  1H33 B;  3C8V A;  3HD7 D;  2Z4E A;  5B6Q A;  1FCD C;  4JYC A;  3CPW O;  1KQL A;  3UIA A; 
#chains in the Genus database with same CATH homology
 1AYG A;  1KB9 D;  5C9M A;  2JWA A;  1CIF A;  3JBT B;  1A56 A;  4FA4 A;  1CO6 A;  5C0Z A;  3CXH W;  2RN0 A;  1DW1 A;  1H9X A;  1P84 D;  1H32 A;  4AAL A;  5GTI V;  1M70 A;  1I6E A;  3WFC C;  5KLV D;  2GC7 D;  2FYU D;  1BGY D;  4WQ7 A;  3MK7 C;  1H1O A;  1CSW A;  2I8F A;  2YIU B;  3ZIY A;  5H2F V;  1NIR A;  3HQ7 A;  1FOC A;  2HV4 A;  5CIH B;  2ORL A;  1GDV A;  3L73 D;  1OAE A;  2FRC A;  2B11 B;  4FB1 A;  2D0S A;  4PD4 D;  1I6D A;  3PXS A;  1H31 B;  4JCG A;  1E8E A;  2QG4 A;  1OCD A;  3VMA A;  1K3H A;  1EB7 A;  1EZV D;  2LIT A;  3L70 D;  1DVV A;  1NML A;  4GYD A;  5E79 V;  2QJK B;  5KLI B;  4QAO A;  1I5T A;  4L3G A;  1CC5 A;  2BH5 X;  1CYJ A;  5DJQ C;  2IBZ D;  1K3G A;  3GG2 A;  4FA1 A;  1YCC A;  1A8C A;  1W5C T;  1CRH A;  2A06 D;  3HQ8 A;  1C52 A;  3O1Y A;  3PXW A;  1QYZ A;  1AOQ A;  3C2C A;  1C6O A;  2PAC A;  1CYC A;  1YIC A;  1QN2 A;  1WVE C;  5CIE B;  4FAN A;  1U75 B;  4WQA A;  3H1L D;  3WC8 A;  4IL6 V;  3RN1 A;  1YEA A;  4L3H A;  4PW9 B;  3M97 X;  1IQC A;  2ZXY A;  3WUI A;  1B7V A;  3MK7 B;  4H0J A;  1IRV A;  1QL3 A;  1KX7 A;  3ZBM A;  1J3S A;  2D0W A;  2ZBO A;  1N9C A;  1C75 A;  3A0H V;  1L0L D;  3GW6 A;  5IY5 1;  2V07 A;  3CX5 D;  1CSU A;  1C7M A;  1HZV A;  4RJT A;  4PJ0 V;  2C8S A;  1NNO A;  2FYN B;  1H9Y A;  1RZ5 A;  1MZ4 A;  5TIS V;  1GU2 A;  1M60 A;  1NU1 D;  1ETP A;  3WU2 V;  2Y0C A;  5CIC B;  2CA4 B;  1RAP A;  4XXL A;  1IZL 0;  5DJQ B;  1F1F A;  3ZOW A;  1CIH A;  1CED A;  2VHD A;  4EID A;  2K9J B;  2BH4 X;  1YNR A;  2N9J A;  3CYT I;  3NWV A;  1MG2 D;  3A9F A;  4WQB A;  3KZI V;  1CIE A;  5KAF V;  4Q5P A;  3KHU A;  5TJH A;  4LJI A;  3ITK A;  4H0K A;  1CYI A;  2GIW A;  1PPJ D;  4FAV A;  5B5E V;  4UB8 V;  2QJY B;  3L75 D;  2BGV X;  1KYO D;  2N9Y B;  2QJP B;  1DII C;  4DY9 A;  3NBT A;  1CTJ A;  1S5L V;  2GC4 D;  451C A;  1PP9 D;  1I55 A;  1F1C A;  1M6Z A;  3VNW A;  2N9I A;  3SLE A;  1AOF A;  2CE1 A;  1HZU A;  3VRD A;  1FJ0 A;  1GJQ A;  2N3Y A;  4A7P A;  2ZZS 1;  1GQ1 A;  1CRG A;  1CSX A;  1WEJ F;  1COT A;  1SQP D;  2LIR A;  2AXT V;  1BCC D;  3PLN A;  4GED B;  3A0B V;  1CHI A;  3CXH D;  3OA8 A;  1HRO A;  1I8P A;  4FA5 A;  1L9B C;  2B12 B;  5CIF B;  1FI3 A;  1W2L A;  1YTC A;  3O5C A;  1DW0 A;  5CYT R;  5CIB B;  1SQX D;  2L4D A;  2C1D A;  1YEB A;  1NMI A;  2CA3 B;  3ZCF A;  1FHB A;  1YIQ A;  3H1H D;  4MU8 A;  1CXA A;  4V2K A;  4D6T D;  2FWL A;  2V08 A;  3PH2 B;  2N3B A;  1C6R A;  4K3I A;  3PTZ A;  3RLM A;  1CCR A;  1I54 A;  1N50 A;  2MHM A;  3DR0 A;  5CIG B;  2JQR A;  3WFE C;  4NFG B;  1HJ5 A;  1HCM A;  2AIU A;  2L91 A;  3ZOY A;  1CHH A;  3OA8 B;  4WQD A;  1HJ3 A;  1COR A;  3FWL A;  3RMZ A;  3WFB C;  2C1D B;  155C A;  2PCB B;  1BE3 D;  2B4Z A;  4EIF A;  2BCC D;  1L0N D;  2MTA C;  3CP5 A;  1DIQ C;  3TF5 A;  5DF5 A;  2KS1 A;  1CCH A;  5DFS A;  4O1Q A;  1HJ4 A;  1KIB A;  5KKZ B;  5AUR A;  1CTY A;  4U3F D;  1C6S A;  2BPB B;  3PXT A;  5KAI V;  1CRY A;  1R0Q A;  2ZOO A;  3WFD C;  3ZOX A;  3BCC D;  1C2R A;  3ZOO A;  2CXB A;  4P4Q B;  1C2N A;  3L71 D;  1CSV A;  2PCC B;  4EIC A;  1FI7 A;  2O3J A;  2GB8 B;  1AKK A;  3TYI A;  1CRJ A;  1NTK D;  1SQQ D;  3PRJ A;  4EIE A;  4O1W A;  1CRC A;  4UB6 V;  1CTZ A;  1A2S A;  1N90 A;  3L74 D;  1RZ6 A;  4WQ8 A;  1NTZ D;  1SQV D;  1N15 A;  3SWS A;  2DVH A;  2N18 C;  3L4M A;  1LC2 A;  3TDK A;  2JTI B;  4PWA A;  2BLF B;  2B10 B;  3X39 A;  2Y0E A;  2CE0 A;  1CIG A;  1HRC A;  3CU4 A;  2C1U A;  1E2R A;  3PHL A;  3OCD A;  5CID B;  1ZZH A;  2EXV A;  2OZ1 A;  4YE1 A;  5EXQ A;  1BL9 A;  3HQ9 A;  3ORV A;  1KV9 A;  5GTH V;  2XTS B;  4FA9 A;  2BCN B;  3SXT A;  2Y0D A;  3VYM A;  4AAO A;  3TGU D;  5B66 V;  2Q3E A;  4RSZ A;  4Y5R A;  1IO3 A;  4AAM A;  3RN0 A;  3SJL A;  1U74 B;  1QKS A;  3L4O A;  4XYD B;  2C9X B;  4EDF A;  1GIW A;  3H1K D;  1FI9 A;  4WQC A;  1L9J C;  1LS9 A;  3OCD B;  1H32 B;  1HH7 A;  2OZ1 B;  2C1V A;  3CX5 W;  4L1Q A;  2N18 B;  3NBS A;  2B0Z B;  2ZON G;  1MG3 D;  1NTM D;  4WQE A;  1SQB D;  2YK3 A;  1VYD A;  1LMS A;  1CNO A;  1IRW A;  1DW2 A;  1H33 A;  1ZRT D;  1E29 A;  4KMG A;  3L72 D;  2C2C A;  3H1J D;  1KB0 A;  2YQB A;  2AI5 A;  1JDL A;  1RAQ A;  351C A;  1YFC A;  3H1I D;  1DW3 A;  2RMZ A;  3DP5 A;  2DGE A;  1S6V B;  4J20 A;  4WQ9 A;  1I8O A;  3SVW A;  3HQ6 A;  1KYO W;  4AAN A;  1LC1 A;  1KX2 A;  3O20 A;  1CHJ A;  2KNC B;  2YCC A;  1DT1 A;  4AX3 A;  1QL4 A;  1CXC A;  3DMI A;  1H31 A;  1DVH A;  1H33 B;  1GKS A;  4N0K A;  5B6Q A;  3O0R C;  1FCD C;  3CWB D;  1LFM A;  1CRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...