3L72D

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 73
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l72D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l72D02
2XTSB 3TDKA 4GYDA 1H31B 3KHUA 1MG2D 1C2RA 2C2CA 2O3JA 1NNOA 2B0ZB 3MK7B 2CXBA 2PCBB 1CHIA 1BL9A 5KAFV 2BPBB 1FI9A 5DF5A 2BLFB 2ZBOA 5CIGB 4FA9A 1CSUA 2JQRA 2D0SA 3NWVA 1I8OA 3A9FA 1L0LD 2PCCB 3OCDB 1YEAA 2C1VA 4WQBA 3ZCFA 2YQBA 2N3YA 2A06D 1IRWA 3SWSA 4L1QA 3PXSA 1CSWA 2Y0CA 2BCCD 1DIQC 3H1KD 1RAPA 1CTYA 1W5CT 4FA1A 3ZIYA 5KLIB 1MG3D 3BCCD 1NIRA 1H32B 4V2KA 4U3FD 3SVWA 1KX7A 5TISV 1F1FA 1H33A 2EXVA 2ZXYA 1DW1A 1KB0A 1NTKD 5C0ZA 1E29A 1R0QA 5CYTR 2CA3B 3GG2A 4RSZA 5CIFB 1BGYD 3PHLA 4FB1A 1SQVD 2HV4A 5KKZB 2Q3EA 2YK3A 1CYCA 2OZ1B 3KZIV 2MTAC 1CCRA 2CA4B 1FOCA 2ORLA 1CRGA 3VMAA 2B4ZA 3HQ7A 1B7VA 1E8EA 2FYNB 1SQBD 4WQAA 1YTCA 4N0KA 1IO3A 4DY9A 1CEDA 4J20A 4MU8A 1CHJA 2N18C 1GJQA 1EZVD 3O0RC 5E79V 4FA4A 4P4QB 4H0KA 4IL6V 1YIQA 1FI7A 1N50A 5DJQC 1CRCA 4FA5A 3ZOXA 1U74B 2GC4D 3SLEA 2ZZS1 3RN0A 1CIGA 1KB9D 3A0HV 3HQ6A 2ZONG 3X39A 2JWAA 1BE3D 1DVVA 1I55A 1YFCA 1CRYA 1CRJA 3DMIA 1WVEC 1SQXD 4AAOA 3RN1A 2C8SA 5KAIV 3H1LD 1N9CA 1FHBA 2FWLA 2B12B 2Y0EA 1HCMA 2QJPB 1LMSA 1H9YA 3NBTA 2C1DB 1QYZA 2KS1A 1CRIA 1RAQA 3O5CA 2GB8B 1JDLA 2B10B 351CA 1I6EA 1J3SA 2N9JA 4EICA 3CWBD 1VYDA 2IBZD 3CXHW 3ZOWA 1K3HA 4O1WA 3ITKA 4A7PA 4UB8V 2ZOOA 1N15A 3SJLA 3CXHD 4GEDB 2AI5A 1C75A 5GTIV 3PRJA 1I54A 1HJ3A 1C6RA 1C6SA 2DGEA 4WQ7A 5CIBB 1KX2A 3L73D 1LC2A 2VHDA 2QJYB 3NBSA 1A8CA 4WQDA 1C52A 3WFDC 3PXTA 3L71D 5B6QA 4L3GA 3DR0A 1NU1D 5EXQA 1FCDC 3ZBMA 1A56A 4AAMA 5AURA 1COTA 3PLNA 5TJHA 1RZ5A 5GTHV 1M70A 3SXTA 4Y5RA 1M60A 1I8PA 4AANA 1HJ4A 2FRCA 3WUIA 3O1YA 4EIFA 3L72D 1H31A 1CYIA 1CYJA 1GDVA 2FYUD 3VNWA 2YCCA 3ORVA 2RMZA 1QL3A 1I5TA 2QJKB 1W2LA 2AIUA 2D0WA 2GC7D 3L70D 3CU4A 2K9JB 3ZOOA 1CXCA 1IQCA 3M97X 1NMIA 5DFSA 2N9IA 2QG4A 2N9YB 2BH4X 5B66V 2C1DA 2L4DA 4WQ9A 3RLMA 3WU2V 1H33B 3ZOYA 3TGUD 2RN0A 3CP5A 3OCDA 1LC1A 1CTJA 4RJTA 1CIHA 1QKSA 3H1HD 1N90A 1A2SA 2C9XB 2I8FA 3MK7C 1AOQA 1GKSA 1EB7A 1PPJD 5H2FV 3L74D 1S5LV 5B5EV 1IZL0 1LS9A 1HJ5A 5CIEB 2N18B 2KNCB 3A0BV 3L4OA 1CO6A 1H32A 1FI3A 5DJQB 2L91A 3PH2B 2V08A 4FANA 3VRDA 1NTMD 3O20A 1E2RA 1SQQD 1CSXA 2BCNB 3OA8B 1AYGA 1F1CA 1DW2A 4UB6V 1ZRTD 3HQ9A 1QN2A 1NTZD 4PD4D 2OZ1A 3H1ID 1CHHA 1OCDA 4D6TD 4QAOA 1S6VB 1H1OA 4LJIA 3WFEC 4NFGB 2N3BA 3JBTB 1L9BC 4JCGA 4AALA 1RZ6A 5CIDB 1DW3A 4WQCA 1HROA 5IY51 2BGVX 1CIFA 1FJ0A 1CNOA 3DP5A 1CORA 1KV9A 1GU2A 1L9JC 1CTZA 3HQ8A 1M6ZA 1DIIC 2GIWA 3H1JD 1MZ4A 4EDFA 2LIRA 5CIHB 1OAEA 4KMGA 3CYTI 1CC5A 3WC8A 5C9MA 1GIWA 4FAVA 4PWAA 3VYMA 1DVHA 4H0JA 1CSVA 3CX5W 155CA 3L4MA 1YCCA 3WFCC 1CCHA 4K3IA 5CICB 1KIBA 1AOFA 1C7MA 1KYOW 3CX5D 2YIUB 2B11B 1K3GA 1AKKA 4WQ8A 1YNRA 1HH7A 2BH5X 3TF5A 1CRHA 1KYOD 1C6OA 1H9XA 4PW9B 4AX3A 2JTIB 4YE1A 2V07A 1DT1A 4PJ0V 1DW0A 4Q5PA 1C2NA 2AXTV 3L75D 2PACA 5KLVD 1SQPD 1HZUA 1YEBA 2DVHA 2C1UA 2MHMA 3GW6A 1CXAA 1GQ1A 3PXWA 1ETPA 2CE0A 1BCCD 1NMLA 3OA8A 1YICA 2Y0DA 3C2CA 1PP9D 3RMZA 1L0ND 1I6DA 4XYDB 2CE1A 3TYIA 2LITA 451CA 1U75B 4L3HA 1WEJF 1ZZHA 4XXLA 1CIEA 4EIDA 1P84D 4EIEA 3FWLA 1LFMA 1HZVA 1QL4A 1HRCA 1IRVA 4WQEA 3PTZA 4O1QA 3WFBC
chains in the Genus database with same CATH superfamily
2XTSB 3TDKA 1VQ5P 1IJDB 1MG2D 2O3JA 2N1TD 2B0ZB 3MK7B 5AW4B 2IX7C 3RK3B 1YQ4C 3CC7P 2KLVA 2NPSD 1NVOA 1WMKA 2ZAEB 2JQRA 2D0SA 2PP6A 5GTHE 2JR8A 2FYUK 2JP3A 5APUA 3VP8A 4WQBA 3IAOA 1PP9E 2QJYC 2WSCH 3V2QA 5H2FH 1EZVI 2N3YA 1N7SA 2A06D 3JSVC 1KTMA 2B87B 4WY4C 2GM4A 1RAPA 4NPFX 3ZIYA 1H32B 2R44A 1KB9I 4U3FD 5TISV 5B66E 1S9KD 1H33A 1Z56A 5CBOA 1E29A 2BCCJ 2H7HA 1AA0A 2H8PD 1LT9C 2KB7P 5CIFB 2J58A 3BCCJ 2HV4A 2QJKC 1T8ZA 2XNDH 2Q3EA 1SQXE 1S5LE 1CYCA 1M7LA 2PAJA 1NTKJ 1Q90D 3H1LE 1CCRA 1PIXA 2CA4B 1FOCA 2ORLA 1CRGA 2B4ZA 3U1CA 1T6AA 3S9OA 3VMYA 1B7VA 1SQVJ 2FYNB 1YHQP 1YTCA 1IO4A 4DY9A 4U7JA 5GTIH 4J20A 4W7YA 5CJ4A 4MU8A 1FE6A 4AUWA 1Y8AA 2PFXA 3CWBE 5KLVJ 5CHXA 4P4QB 1LWUB 1FI7A 2FXOA 3B5NB 5DJQC 3RK2C 3PP5A 4WWIA 3CXHE 1YITP 3RN0A 3RL0B 2G8YA 3G3ZA 3A5TA 1N7SD 3X39A 4I6MC 1DVVA 1VQPP 2WVRA 2ZXEB 3TK1A 2OTLP 4C46A 3L71E 1LJ2A 1WVEC 3AE6C 3O6QB 1SQXD 4PJ0H 1VQNP 4RESB 3RN1A 4KHXA 2C8SA 3OA7A 1USEA 1GK4A 3H1LD 1YBKA 2I8DA 3U1AA 1L0NG 2FWLA 1OX3A 3WU2H 1Q82Q 2E76D 2Y0EA 2QJPB 2WSCJ 5CCHA 1H9YA 3NBTA 2C1DB 2W90A 1QYZA 2KS1A 2SPZA 2HPCB 2QM7A 1DD4A 1KYOI 1JDLA 3M9HA 3QH9A 3SFEC 351CA 5KLVK 4IFMA 3EQ2A 3CWBD 2E5YA 3CXHW 3NFQA 2XNXA 3BRTB 3Q2YA 1URQC 1FOSE 3CXHD 2J59M 3HE4B 4GEDB 1SFCC 4OGQD 2XKMA 5GTIV 3R4YA 3PRJA 1HJ3A 1GZLA 1NTZG 1W5CE 1KX2A 1KILA 4H0LC 4IFDK 3WFDC 3L71D 3L4FA 1JY2P 3E1IA 4L3GA 4DCKA 3G9RA 1KQLA 2IYOA 1A56A 4AAMA 1ZW0A 2FY8A 2A45H 2UWJE 3H1KG 4ASVA 1ZRTE 1FZCC 1I8PA 1NH4A 4AANA 1HJ4A 2FRCA 1NU1J 3WUIA 4EIFA 1GL2A 2NZ2A 3O6QA 1CYIA 2IDBA 3JCUH 1L0LK 2ZT9C 1I5TA 1OVRA 1W2BO 3L70D 2K9JB 1IQCA 1BGYG 5DFSA 3PJSK 2N9IA 2QG4A 1KN7A 3U59A 3L72J 2C1DA 3WU2V 1FC2C 1HUCA 1R5SA 3H1HD 3KPEA 3MK7C 1AOQA 4DT0A 1QX8A 3RK3C 4XFJA 3KZIH 3Q3DA 1LS9A 1HJ5A 1S72P 3A0BV 1HJ0A 1CO6A 2OARA 4BWNA 4OWFA 3N7NA 2V08A 1QVFO 1S3JA 1E5WA 1CSXA 3FGAD 2JEEA 2Y9YA 4GKGA 2O1KA 1ZRTD 3GLMA 1QN2A 1SQBK 1VQ6P 4IL6H 2OZ1A 4K3AA 3AEDC 1QL2A 4I1LA 1KQGB 4LJIA 3JBTB 1SQPE 1L9BC 2AXCA 1BE3G 2IZ1A 3IF4A 1RZ6A 3A0HH 5CCHC 1H0TA 5IY51 1T3UA 2BGVX 1IFPA 2KP8A 1NTZJ 3ZDMA 1SP4A 2MJZA 5BU5A 1GU2A 1GL2D 3TNUB 1L0NE 3HUSB 1GMJA 1LTJB 2E75B 2R5BA 2E74B 4GOFA 5CIHB 4YPCA 2JDIH 5KAIH 2R3SA 1VQLP 2C9LY 3WC8A 2K9JA 5C9MA 2FYNC 1FDMA 1P84I 2QVAA 2AEJA 3L4MA 2M3EA 1YCCA 3M0DA 3WFCC 1G1JA 3GF3A 1YTZT 4K3IA 2A06G 3A7OA 1C7MA 2OYHB 3I5CA 2YIUB 1K3GA 1AKKA 2K3RA 1YNRA 3SFDC 2BH5X 1N7LA 3B5NC 1DH3A 1NTZE 2IYPA 4YE1A 3A0BE 4JQ0D 1DW0A 4Q5PA 4UB8H 3RL0C 2Z5IA 3NTNA 2NRGA 1SQPD 3II6A 2DVHA 1YEBA 3GW6A 3MTUE 2MHMA 2M8RA 2CE0A 3CX5H 2N9BA 4RKUJ 3B71A 3WUTA 4IL6X 1QL1A 1HGVA 3VYIA 4C7RA 1KORA 1L0ND 1IZNB 2IBZI 1ZLLA 1PFIA 1RQVA 1KYOH 1RE4C 2CE1A 451CA 3H1KE 1JOCA 2WQYC 1BCCJ 4N78E 4L3HA 1WEJF 4BRYB 1G2CB 2QJPC 1CIEA 2FXPA 5GTHH 2YMKA 4EIEA 3FWLA 3VP9A 1ZR4A 1LFMA 2NPSB 2IPPA 5KJ7D 3C1LA 3TNUA 1EXJA 1D7MA 1BGYE 1FZEA 5AW5B 1VQMP 4WQEA 1FJKA 4YXWH 4O1QA 5AVSB 1KFMA 2HFED 2YKOA 1NOHA 3AEAC 3M91A 1C2RA 2HYNA 1NNOA 3WUVA 1NTMJ 1OIPA 1FI9A 4WY4A 4CPGA 3NWVA 1PPJG 1EC5A 3A9FA 3L74G 2OYHA 1FZAA 1VF5D 2YQBA 1EXIA 2HODB 1LT9A 3CMAP 4L1QA 3PXSA 1DIQC 3H1KD 4YTPC 1CTYA 1W5CT 4PV1B 4Y99B 4N78D 4IOIH 1MG3D 3OAKA 4LLHA 3SVWA 1GU4A 5AW9B 1WRGA 5CCGC 4N6JA 2EXVA 1IFIA 1DW1A 3E7KA 1KB0A 1BE3E 5CYTR 4D6TG 2CA3B 1BGYD 1JMMA 2ZFCA 4U3FJ 1HJBA 2YK3A 1NTMK 4BRYA 1SQQK 1G2CA 3W68A 3M0DC 3P8CE 2R32A 1SS1A 1OW7A 1LTIC 1JEKA 1L4AB 1CEDA 2YO3A 4UB6E 2C0WA 2IZ0A 1CHJA 1GDTA 2A06E 2KZJA 4H44B 1EZVD 2MKVA 3AE2C 4WY4D 1NAFA 1PV3A 2D2CB 2VRSA 1N50A 1CRCA 2BEZF 1PP9J 4JF7A 1KB9D 2B89A 3MUDA 3R2PA 1BE3D 1PL5A 3V2RA 1RQUA 1LP1B 2WPSA 2K88A 1CRYA 3L70G 1CRJA 5AW7B 1RE3C 2WSFJ 3DMIA 1JNMA 3PH0A 2AXTH 1OW8A 3NXSA 1K73Q 1N9CA 3C9IA 4O9BA 3H1HG 1P84H 3N4XA 3P8CD 2M5AA 3HD7B 5DJUB 4DJGA 1ZV8A 1LMSA 1LTJC 1SQXJ 2E75C 1URQA 1CRIA 2Q3IA 2KK7A 1SFCA 2GB8B 3H1LJ 2L5GB 2P10A 1K3HA 1CW5A 3TSIA 3RK2D 3ITKA 5AVXB 4XA4A 2OYHC 2WSSH 2ZOOA 1N15A 2YIUC 3JC22 1Y47A 3KDPB 1C75A 3CWBJ 4NPDA 1I54A 3AE3C 1C6RA 3SWYA 4HKZH 5CIBB 1QVGO 1PPJE 4KJMA 3L74E 4H13B 1FZCA 5CMZA 1J1EB 5KAFH 1C52A 4RO0A 2YXQB 5B6QA 1L0LG 1FCDC 2AEFA 3ZBMA 3A3YB 5AURA 1R5LA 3PLNA 1RZ5A 1VQ4P 1KC8Q 1MUUA 5APXA 1M57D 3L71J 2Q5UA 4Y5RA 1M60A 1ZP0C 1Q81Q 1LP1A 5BVZA 1BSHA 3O1YA 1Y9BA 1OXZA 4PD4E 2P58A 1CYJA 2FYUD 1NKZB 4D6TE 4HJGH 5M1BA 1QL3A 1W2LA 3AECC 2D0WA 2NPSC 3CU4A 3OW2O 3M97X 4EYYQ 2QM8A 2OGUA 3RLMA 1SFCD 2RN0A 2P1JA 2WT7B 1CTJA 4GODA 2KOGA 1PGPA 3M0AA 2M0BA 1A2SA 2C9XB 4ZMDA 2I8FA 3L70J 3RK3E 4GIFA 1GKSA 1PPJD 1EDIA 1M1JB 5H2FV 3RL0g 3L74D 3KQGA 2B87A 1SQBG 1SQPG 1NTKK 2KSJA 4B86A 2KNCB 2ZVNB 3H1HJ 1H32A 1PGJA 2M3BA 1SQVK 5TISE 3Q1MA 1RHZB 1QGKB 2L91A 3PH2B 3MUDC 4FANA 3VRDA 3CX5I 4ZKPA 2E42A 1K9MQ 1USDA 4OH8B 2BCNB 1AYGA 3HTKB 5E79H 1DD3A 4PV1C 4Y99C 1NO4A 3RBXA 4PD4D 1CHHA 2ZT9D 3IN6A 4WVZA 4D6TD 1YJWP 4QAOA 1NGMB 2O01J 3WFEC 1RH5B 4NFGB 2N3BA 1SLQA 3L70E 1A02J 4AALA 1HROA 2LXBA 4ZKUA 1KQSO 1FJ0A 4GDOA 1RF0C 3HQ8A 3H1HE 1M6ZA 1DIIC 2GIWA 3RK3D 1MZ4A 2LIRA 1OAEA 1LWUA 3B5NA 1CC5A 1Q7YQ 1GU5A 3M06A 1DVHA 155CA 1L4AC 3HRNA 1KIBA 1MZ9A 2FBWC 1KILE 4H44C 2V7QJ 2KLUA 5H2FE 2W27A 2D2CC 1YTZI 3TF5A 2ZJSE 2WTYA 2KNCA 1RE4A 4PJ0V 2A45G 3IR9A 3CCUP 1GW4A 3VN0A 5KLVD 3L73G 1MV8A 1HZUA 5CCHD 2K1AA 1JTHB 1GQ1A 1L0LE 1L2PA 1ETPA 1K04A 5AW2B 1JY3N 2JWDA 2E5TA 2HPCA 3C2CA 2OYOA 3NMDA 3V5BA 1SQPJ 2Q9IA 1N2DC 4I7ZB 1HH0A 3TYIA 1BSNA 2CPSA 3UIAA 1LGHB 1MKMA 1JY3O 1ZZHA 4XXLA 2H43A 3CXHI 3HD7C 3P7KA 2WSEJ 5APQA 1UIXA 1L0NJ 1P84D 1KV4A 1HWTC 2OYIB 3D71A 3HE4A 1HZVA 5GTIE 5AVYB 1EZVG 1NU1K 1KILD 3P8MC 3PTZA 2G3AA 1FOSF 3B5ND 1H31B 2CPBA 3KHUA 1EDJA 2C2CA 3AE7C 1RF1B 3TGUG 2CXBA 1GW3A 3RL0D 5DF5A 1SQBE 5CIGB 4FA9A 2LR2A 1L0LD 2PCCB 3OCDB 3LW5J 4H13C 1YEAA 2C1VA 1DEEG 2KZIA 5CCGA 2W8ZA 1VQOP 3ZCFA 1J1EC 1HF9A 2OTKE 1IRWA 5B5EH 1OMIA 2PRRA 1KQFB 1QEXA 4PJ0E 3M9BA 1FZGA 2K9YA 1BDCA 1SQQG 1JB0J 3CCEP 1NKNA 1NIRA 1KX7A 3WU2E 1F1FA 1IK9A 2JO1A 1YJ9P 2KI7B 1T2KC 2ZXYA 3H1KJ 3H1IG 2CK3H 1LTAC 4I2LC 3GG2A 3PHLA 4FB1A 1LWUC 5KKZB 3A2AA 3S4RA 3KZIV 3K5BA 1BGYJ 1E8EA 1SQBD 3H1JG 2GUVA 1AQ5A 1NTZK 1FDOA 4N0KA 1ZN5A 1IO3A 1N73B 2P67A 2WMMA 4W80A 1GD2E 1M1JC 4JBZA 3CCSP 3Q5PA 1DEBA 4FA4A 5APWA 2O01N 4H0KA 4IL6V 1NJIQ 1FDIA 1FU1A 1XTCC 1RE3A 2N1TB 1AJYA 5AVRB 2W6BA 3L37A 1KMIZ 4DOJA 5CCGD 3SWKA 3A0HV 3HQ6A 1OFCX 1LTSC 3G71P 5APSA 2FYUG 2JWAA 3L73E 3HUSA 1LTJA 3L75G 3BATA 2K37A 3EFGA 1IK7A 4R4LA 5CJ0A 3JCUE 4AAOA 3D6YA 3GHGB 5KAIV 1BE3J 4L75A 2YXRB 3CI9A 4AYCA 2WSFH 1VPCA 1ZOYC 5B66H 3Q5RA 1HCMA 5AW0B 4L73A 3T97B 1S1CX 2OTJP 1HTLC 3O5CA 2B10B 1S4XA 2PGDA 4Z1MH 3F5HA 1GTWA 3KZIE 1EZVE 3FWNA 3MIWA 1S5LH 3P32A 3TYYA 2B88A 4O1WA 2I1KA 1GK6A 4A7PA 4UB8V 3HE5B 3WUUA 3TGUE 5AW1B 1N73A 1FZBA 1KB9E 3H32B 2P7JA 4C7NB 3AE8C 4L76A 2DGEA 3L73D 1VQ7P 3AE5C 2VHDA 1JY2N 5AVUB 4WBAA 1Q86Q 4IL6E 3DR0A 5EXQA 1VDFA 2WITA 3A0HE 3CXHH 1COTA 5KJ7C 2NPSA 5GTHV 1IC2A 1AVYA 1SQQE 1M70A 3H6PA 2E75D 5APVA 2BCCG 4I7ZC 5APYA 2GA1A 1N7SB 3BCCG 3H1IE 2FFDB 5KAIE 3VNWA 1VQKP 2HLOA 3ORVA 2HR3A 1ZMEC 1NTKG 2AIUA 3ZOOA 1NMIA 1KZUB 1K05A 1SQVG 2BH4X 5B66V 1K8AQ 1H33B 3TGUD 1LC1A 2KUBA 4RJTA 1CIHA 1S5LX 2E76B 1N90A 3LIDA 3H1JE 3AEBC 1RF1C 2FYZA 2HODA 2QRXA 1N8RQ 1S5LV 5KLVG 1IZL0 4LGDE 1IFJA 2N18B 3B4SA 2FKWB 4GT1A 4UB8E 3HE5A 3L4OA 3CC4P 2BASA 1JMBA 2V4HA 3FX0A 3L74J 1NTMD 3O20A 3HUSC 1E2RA 1SQQD 1DW2A 4OGQB 3GMAA 3CLQA 1RF0A 3IFMA 3HQ9A 2E74C 5BU8B 3CC2P 1KYOE 3MD0A 3BRVB 2FYUE 3H1ID 3AE9C 1OCDA 2IFNA 4WB4A 3L75E 2ZXXA 1S6VB 1LT1A 1H1OA 4GOEA 3QWOC 1DW3A 4WQCA 1FS0E 3FXEA 1CIFA 1LTTC 1CNOA 5AVTB 4ZNCA 1CORA 2O01H 3O8ZA 1L4AA 2GUSA 1L9JC 2ZVOB 1CTZA 4D6TJ 5KKZC 1AQTA 1RY3A 3RBZA 2FFDA 3H1JD 5AVVB 3VMXA 2ITAA 1GIWA 2JJLA 4PWAA 3VYMA 2ZYDA 4H0JA 1N73C 1CSVA 3CX5W 1FBMA 4XE5B 1R8EA 1CCHA 3H25A 1NHLA 1SQXK 4QMAA 2R5DA 2IBZG 1KYOW 2KS1B 3CX5D 1JO5A 1U7MA 2B11B 4WQ8A 4JYCA 4PV1D 2R3CA 2Q7CA 2POHA 1KYOD 2N1TC 1J1DB 3OJAB 2V7QH 2JTIB 2V07A 1DIPA 1C2NA 2AXTV 3L75D 1JCDA 3BASA 3MHVA 1LTGC 3E1RA 1AV1A 1X8YA 2QEXP 1YI2P 3W67A 1OZHA 1CXAA 3HD7A 1URQD 1PGOA 1YICA 1PP9D 1NU1G 1KILB 3GHGC 1I6DA 2BCCE 2LITA 4H0LD 1U75B 2Z4EA 3BCCE 1MFZA 3MP7B 2Z5HA 4EIDA 1FJPA 2QIWA 2XDJA 1L4AD 4TT3H 1VQ9P 1NTKE 3L72G 1X9VA 4KT0J 1QL4A 2WSEH 4H44D 1IRVA 2YKQA 1SQVE 1ZR2A 2D2CD 1IFNA 4GYDA 1GL2B 3B8EB 4K35A 1JM0A 2PCBB 1CHIA 1BL9A 5KAFV 2BPBB 3FXDA 2BLFB 2ZBOA 3BVHA 5KLVE 5AW6B 1CSUA 3ABVC 1Q2NA 1I8OA 2FXMA 4L74A 3CCRP 1DX7A 3CCQP 5AW3B 3VMZA 3LW5H 3SWSA 3L36A 2H88C 3V4WA 1CSWA 2Y0CA 2BCCD 1HVVA 1L0LJ 3A0BH 2AXTE 2LXCB 1FZFA 2OQQA 4FA1A 3HD7D 5KLIB 5DJTB 3BCCD 4V2KA 4EIJA 1P84E 5AW8B 1JUNA 1H8AA 1NTKD 5C0ZA 2WT7A 1N7SC 3L35A 2B9BA 1R0QA 3KYQA 4RSZA 2FFDC 4HYTB 1SQVD 2XV5A 1E79H 1M1JA 3D70A 2OZ1B 1EDLA 2MTAC 3CMEP 5KTBA 3VMAA 4EI2A 1EQ7A 1OWAA 3HQ7A 1H0TB 4WQAA 2E76C 1M90Q 1X22A 4H13D 4DZOA 3HTKA 1U57A 4PD4I 2N18C 1GJQA 3O0RC 5E79V 1SQBJ 2IBZE 3G4SP 5KAFE 2LKMA 1M1KQ 3AEGC 2QSIA 1YIQA 2QA4P 3CCLP 4M3LA 1OVUA 1N86A 4FA5A 3GF7A 3ZOXA 1U74B 2GC4D 3SLEA 2ZZS1 1CIGA 1T2KD 2XZRA 2ZONG 4OGQC 2RKLA 3M9QA 2XU6A 4HH2A 1I55A 1YFCA 1VF5B 1LNQA 2P2UA 1KFNA 1BCCG 1NU1E 1SVFA 3EFFK 1PGQA 1BDDA 3AEFC 2KIKA 1KB9H 1FHBA 3D6ZA 2B12B 1YYCA 1HGZA 3AEEC 4MN4C 2Y9ZA 3WMM0 1RAQA 1KD1Q 3L72E 1ZXGA 2HG5D 1I6EA 1SQPK 4Y28J 1J3SA 2N9JA 4EICA 1VYDA 2IBZD 3ZOWA 1A02F 2KYVA 1NTMG 5APTA 1IFDA 1L0NK 4TLFA 2IFMA 2Q1KA 3MGNA 1JTHA 1NAYA 3SJLA 2YNYA 2AI5A 5EFWB 2YKPA 4JPZB 5AVZB 5KJ7A 1C6SA 4UB6H 4WQ7A 1S2EA 4OVNF 2E43A 1J1DC 5E79E 1LC2A 2QJYB 3D0WA 3NBSA 1A8CA 1J2JB 4WQDA 3PXTA 2KSEA 3V6IA 4YXDC 1NU1D 4WY4B 3L73J 1W2EA 2OYIA 5TJHA 3SXTA 1KILC 3KXDA 1H88A 2H89C 3AE1C 1T3JA 3L72D 1H31A 1LT9B 4U3FG 1GDVA 1U7JA 3VTPC 1RF1A 2YCCA 2RMZA 2QJKB 1TU3F 3CL3D 2GC7D 1M8OB 1CXCA 1VL2A 2N9YB 5AVQB 2C0XA 2L4DA 4WQ9A 3ZOYA 4LC1A 1OW6A 1OVVA 3CP5A 2WPVB 3OCDA 1GL2C 1QKSA 1VQ8P 1NWQA 2AEMA 2I1JA 1M56D 1EB7A 3CPWO 5B5EV 3TGUJ 2WPQA 3CCJP 5CIEB 1FAVA 3C8VA 4N3YB 1FI3A 1CSBA 1PP9G 5DJQB 3RK2B 2W6AA 4HB1A 1X0TA 3OA8B 1F1CA 4UB6V 3Q5SA 2O1JA 2ZYAA 4JYBA 2WPRA 1NTZD 3V4QA 4BXLA 3V2PA 5KLIC 3AE4C 1SQQJ 1CI6B 2ZYGA 2W6JH 1IFMA 5L8RJ 4JCGA 5CIDB 3CCMP 3SSUA 1BCCE 3LIEA 3DP5A 1KV9A 3CCVP 3H1IJ 3MZWB 1SQXG 2WWWA 3SWFA 5K5GB 2C9NY 3H1LG 3RGUA 2BEQD 4PD4H 4EDFA 4KMGA 3CYTI 3VOPA 4NPEA 1LTBC 1HBWA 3G6EP 3V2NA 4FAVA 4EOTA 2N1TA 5AVWB 3H1JJ 1AVOA 2M5AB 1PZQA 1XTGB 2JKVA 5CICB 1AOFA 1JY2O 1NTME 1QLED 3CWBG 1URQB 1WT6A 1AFOA 2W83C 1SFCB 3S1KA 1HH7A 2E74D 2QE7H 5B5EE 1YIJP 4W7ZA 2YMYA 2J5UA 1CRHA 2WZ7A 3USSA 1EDKA 1C6OA 1NYHA 1H9XA 4PW9B 4AX3A 3CD6P 4H0LB 3GHGA 3EWKA 1DT1A 1X79B 2OYIC 2PACA 4AQRD 5TISH 2C1UA 5C39A 3PXWA 1BCCD 1NMLA 3OA8A 3T97A 2FYUJ 3L71G 1JCCA 2Y0DA 3RMZA 1VF5C 1JY3P 3F89A 3L75J 3I56P 4IFFA 4XYDB 1YQ3C 1FZCB 1MFTA 3I55P 1H89A 1CI6A 2RH0A 1UIIA 4U3FE 5CBNA 2Q6QA 2ZT9B 4R4MA 1S9KE 1YJNP 1CZQA 2A45I 4ASWA 1G1IA 3H32A 2YO2A 1HRCA 4C7NA 3CX5E 2KXPB 2DW3A 3WFBC
chains in the Genus database with same CATH topology
2XTSB 3TDKA 4GYDA 1H31B 3KHUA 1MG2D 1C2RA 2C2CA 2O3JA 1NNOA 2B0ZB 3MK7B 2CXBA 2PCBB 1CHIA 1BL9A 5KAFV 2BPBB 1FI9A 5DF5A 2BLFB 2ZBOA 5CIGB 4FA9A 1CSUA 2JQRA 2D0SA 3NWVA 1I8OA 3A9FA 1L0LD 2PCCB 3OCDB 1YEAA 2C1VA 4WQBA 3ZCFA 2YQBA 2N3YA 2A06D 1IRWA 3SWSA 4L1QA 3PXSA 1CSWA 2Y0CA 2BCCD 1DIQC 3H1KD 1RAPA 1CTYA 1W5CT 4FA1A 3ZIYA 5KLIB 1MG3D 3BCCD 1NIRA 1H32B 4V2KA 4U3FD 3SVWA 1KX7A 5TISV 1F1FA 1H33A 2EXVA 2ZXYA 1DW1A 1KB0A 1NTKD 5C0ZA 1E29A 1R0QA 5CYTR 2CA3B 3GG2A 4RSZA 5CIFB 1BGYD 3PHLA 4FB1A 1SQVD 2HV4A 5KKZB 2Q3EA 2YK3A 1CYCA 2OZ1B 3KZIV 2MTAC 1CCRA 2CA4B 1FOCA 2ORLA 1CRGA 3VMAA 2B4ZA 3HQ7A 1B7VA 1E8EA 2FYNB 1SQBD 4WQAA 1YTCA 4N0KA 1IO3A 4DY9A 1CEDA 4J20A 4MU8A 1CHJA 2N18C 1GJQA 1EZVD 3O0RC 5E79V 4FA4A 4P4QB 4H0KA 4IL6V 1YIQA 1FI7A 1N50A 5DJQC 1CRCA 4FA5A 3ZOXA 1U74B 2GC4D 3SLEA 2ZZS1 3RN0A 1CIGA 1KB9D 3A0HV 3HQ6A 2ZONG 3X39A 2JWAA 1BE3D 1DVVA 1I55A 1YFCA 1CRYA 1CRJA 3DMIA 1WVEC 1SQXD 4AAOA 3RN1A 2C8SA 5KAIV 3H1LD 1N9CA 1FHBA 2FWLA 2B12B 2Y0EA 1HCMA 2QJPB 1LMSA 1H9YA 3NBTA 2C1DB 1QYZA 2KS1A 1CRIA 1RAQA 3O5CA 2GB8B 1JDLA 2B10B 351CA 1I6EA 1J3SA 2N9JA 4EICA 3CWBD 1VYDA 2IBZD 3CXHW 3ZOWA 1K3HA 4O1WA 3ITKA 4A7PA 4UB8V 2ZOOA 1N15A 3SJLA 3CXHD 4GEDB 2AI5A 1C75A 5GTIV 3PRJA 1I54A 1HJ3A 1C6RA 1C6SA 2DGEA 4WQ7A 5CIBB 1KX2A 3L73D 1LC2A 2VHDA 2QJYB 3NBSA 1A8CA 4WQDA 1C52A 3WFDC 3PXTA 3L71D 5B6QA 4L3GA 3DR0A 1NU1D 5EXQA 1FCDC 3ZBMA 1A56A 4AAMA 5AURA 1COTA 3PLNA 5TJHA 1RZ5A 5GTHV 1M70A 3SXTA 4Y5RA 1M60A 1I8PA 4AANA 1HJ4A 2FRCA 3WUIA 3O1YA 4EIFA 3L72D 1H31A 1CYIA 1CYJA 1GDVA 2FYUD 3VNWA 2YCCA 3ORVA 2RMZA 1QL3A 1I5TA 2QJKB 1W2LA 2AIUA 2D0WA 2GC7D 3L70D 3CU4A 2K9JB 3ZOOA 1CXCA 1IQCA 3M97X 1NMIA 5DFSA 2N9IA 2QG4A 2N9YB 2BH4X 5B66V 2C1DA 2L4DA 4WQ9A 3RLMA 3WU2V 1H33B 3ZOYA 3TGUD 2RN0A 3CP5A 3OCDA 1LC1A 1CTJA 4RJTA 1CIHA 1QKSA 3H1HD 1N90A 1A2SA 2C9XB 2I8FA 3MK7C 1AOQA 1GKSA 1EB7A 1PPJD 5H2FV 3L74D 1S5LV 5B5EV 1IZL0 1LS9A 1HJ5A 5CIEB 2N18B 2KNCB 3A0BV 3L4OA 1CO6A 1H32A 1FI3A 5DJQB 2L91A 3PH2B 2V08A 4FANA 3VRDA 1NTMD 3O20A 1E2RA 1SQQD 1CSXA 2BCNB 3OA8B 1AYGA 1F1CA 1DW2A 4UB6V 1ZRTD 3HQ9A 1QN2A 1NTZD 4PD4D 2OZ1A 3H1ID 1CHHA 1OCDA 4D6TD 4QAOA 1S6VB 1H1OA 4LJIA 3WFEC 4NFGB 2N3BA 3JBTB 1L9BC 4JCGA 4AALA 1RZ6A 5CIDB 1DW3A 4WQCA 1HROA 5IY51 2BGVX 1CIFA 1FJ0A 1CNOA 3DP5A 1CORA 1KV9A 1GU2A 1L9JC 1CTZA 3HQ8A 1M6ZA 1DIIC 2GIWA 3H1JD 1MZ4A 4EDFA 2LIRA 5CIHB 1OAEA 4KMGA 3CYTI 1CC5A 3WC8A 5C9MA 1GIWA 4FAVA 4PWAA 3VYMA 1DVHA 4H0JA 1CSVA 3CX5W 155CA 3L4MA 1YCCA 3WFCC 1CCHA 4K3IA 5CICB 1KIBA 1AOFA 1C7MA 1KYOW 3CX5D 2YIUB 2B11B 1K3GA 1AKKA 4WQ8A 1YNRA 1HH7A 2BH5X 3TF5A 1CRHA 1KYOD 1C6OA 1H9XA 4PW9B 4AX3A 2JTIB 4YE1A 2V07A 1DT1A 4PJ0V 1DW0A 4Q5PA 1C2NA 2AXTV 3L75D 2PACA 5KLVD 1SQPD 1HZUA 1YEBA 2DVHA 2C1UA 2MHMA 3GW6A 1CXAA 1GQ1A 3PXWA 1ETPA 2CE0A 1BCCD 1NMLA 3OA8A 1YICA 2Y0DA 3C2CA 1PP9D 3RMZA 1L0ND 1I6DA 4XYDB 2CE1A 3TYIA 2LITA 451CA 1U75B 4L3HA 1WEJF 1ZZHA 4XXLA 1CIEA 4EIDA 1P84D 4EIEA 3FWLA 1LFMA 1HZVA 1QL4A 1HRCA 1IRVA 4WQEA 3PTZA 4O1QA 3WFBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTS B;  3TDK A;  4GYD A;  1H31 B;  3KHU A;  1MG2 D;  1C2R A;  2C2C A;  2O3J A;  1NNO A;  2B0Z B;  3MK7 B;  2CXB A;  2PCB B;  1CHI A;  1BL9 A;  5KAF V;  2BPB B;  1FI9 A;  5DF5 A;  2BLF B;  2ZBO A;  5CIG B;  4FA9 A;  1CSU A;  2JQR A;  2D0S A;  3NWV A;  1I8O A;  3A9F A;  1L0L D;  2PCC B;  3OCD B;  1YEA A;  2C1V A;  4WQB A;  3ZCF A;  2YQB A;  2N3Y A;  2A06 D;  1IRW A;  3SWS A;  4L1Q A;  3PXS A;  1CSW A;  2Y0C A;  2BCC D;  1DIQ C;  3H1K D;  1RAP A;  1CTY A;  1W5C T;  4FA1 A;  3ZIY A;  5KLI B;  1MG3 D;  3BCC D;  1NIR A;  1H32 B;  4V2K A;  4U3F D;  3SVW A;  1KX7 A;  5TIS V;  1F1F A;  1H33 A;  2EXV A;  2ZXY A;  1DW1 A;  1KB0 A;  1NTK D;  5C0Z A;  1E29 A;  1R0Q A;  5CYT R;  2CA3 B;  3GG2 A;  4RSZ A;  5CIF B;  1BGY D;  3PHL A;  4FB1 A;  1SQV D;  2HV4 A;  5KKZ B;  2Q3E A;  2YK3 A;  1CYC A;  2OZ1 B;  3KZI V;  2MTA C;  1CCR A;  2CA4 B;  1FOC A;  2ORL A;  1CRG A;  3VMA A;  2B4Z A;  3HQ7 A;  1B7V A;  1E8E A;  2FYN B;  1SQB D;  4WQA A;  1YTC A;  4N0K A;  1IO3 A;  4DY9 A;  1CED A;  4J20 A;  4MU8 A;  1CHJ A;  2N18 C;  1GJQ A;  1EZV D;  3O0R C;  5E79 V;  4FA4 A;  4P4Q B;  4H0K A;  4IL6 V;  1YIQ A;  1FI7 A;  1N50 A;  5DJQ C;  1CRC A;  4FA5 A;  3ZOX A;  1U74 B;  2GC4 D;  3SLE A;  2ZZS 1;  3RN0 A;  1CIG A;  1KB9 D;  3A0H V;  3HQ6 A;  2ZON G;  3X39 A;  2JWA A;  1BE3 D;  1DVV A;  1I55 A;  1YFC A;  1CRY A;  1CRJ A;  3DMI A;  1WVE C;  1SQX D;  4AAO A;  3RN1 A;  2C8S A;  5KAI V;  3H1L D;  1N9C A;  1FHB A;  2FWL A;  2B12 B;  2Y0E A;  1HCM A;  2QJP B;  1LMS A;  1H9Y A;  3NBT A;  2C1D B;  1QYZ A;  2KS1 A;  1CRI A;  1RAQ A;  3O5C A;  2GB8 B;  1JDL A;  2B10 B;  351C A;  1I6E A;  1J3S A;  2N9J A;  4EIC A;  3CWB D;  1VYD A;  2IBZ D;  3CXH W;  3ZOW A;  1K3H A;  4O1W A;  3ITK A;  4A7P A;  4UB8 V;  2ZOO A;  1N15 A;  3SJL A;  3CXH D;  4GED B;  2AI5 A;  1C75 A;  5GTI V;  3PRJ A;  1I54 A;  1HJ3 A;  1C6R A;  1C6S A;  2DGE A;  4WQ7 A;  5CIB B;  1KX2 A;  3L73 D;  1LC2 A;  2VHD A;  2QJY B;  3NBS A;  1A8C A;  4WQD A;  1C52 A;  3WFD C;  3PXT A;  3L71 D;  5B6Q A;  4L3G A;  3DR0 A;  1NU1 D;  5EXQ A;  1FCD C;  3ZBM A;  1A56 A;  4AAM A;  5AUR A;  1COT A;  3PLN A;  5TJH A;  1RZ5 A;  5GTH V;  1M70 A;  3SXT A;  4Y5R A;  1M60 A;  1I8P A;  4AAN A;  1HJ4 A;  2FRC A;  3WUI A;  3O1Y A;  4EIF A;  3L72 D;  1H31 A;  1CYI A;  1CYJ A;  1GDV A;  2FYU D;  3VNW A;  2YCC A;  3ORV A;  2RMZ A;  1QL3 A;  1I5T A;  2QJK B;  1W2L A;  2AIU A;  2D0W A;  2GC7 D;  3L70 D;  3CU4 A;  2K9J B;  3ZOO A;  1CXC A;  1IQC A;  3M97 X;  1NMI A;  5DFS A;  2N9I A;  2QG4 A;  2N9Y B;  2BH4 X;  5B66 V;  2C1D A;  2L4D A;  4WQ9 A;  3RLM A;  3WU2 V;  1H33 B;  3ZOY A;  3TGU D;  2RN0 A;  3CP5 A;  3OCD A;  1LC1 A;  1CTJ A;  4RJT A;  1CIH A;  1QKS A;  3H1H D;  1N90 A;  1A2S A;  2C9X B;  2I8F A;  3MK7 C;  1AOQ A;  1GKS A;  1EB7 A;  1PPJ D;  5H2F V;  3L74 D;  1S5L V;  5B5E V;  1IZL 0;  1LS9 A;  1HJ5 A;  5CIE B;  2N18 B;  2KNC B;  3A0B V;  3L4O A;  1CO6 A;  1H32 A;  1FI3 A;  5DJQ B;  2L91 A;  3PH2 B;  2V08 A;  4FAN A;  3VRD A;  1NTM D;  3O20 A;  1E2R A;  1SQQ D;  1CSX A;  2BCN B;  3OA8 B;  1AYG A;  1F1C A;  1DW2 A;  4UB6 V;  1ZRT D;  3HQ9 A;  1QN2 A;  1NTZ D;  4PD4 D;  2OZ1 A;  3H1I D;  1CHH A;  1OCD A;  4D6T D;  4QAO A;  1S6V B;  1H1O A;  4LJI A;  3WFE C;  4NFG B;  2N3B A;  3JBT B;  1L9B C;  4JCG A;  4AAL A;  1RZ6 A;  5CID B;  1DW3 A;  4WQC A;  1HRO A;  5IY5 1;  2BGV X;  1CIF A;  1FJ0 A;  1CNO A;  3DP5 A;  1COR A;  1KV9 A;  1GU2 A;  1L9J C;  1CTZ A;  3HQ8 A;  1M6Z A;  1DII C;  2GIW A;  3H1J D;  1MZ4 A;  4EDF A;  2LIR A;  5CIH B;  1OAE A;  4KMG A;  3CYT I;  1CC5 A;  3WC8 A;  5C9M A;  1GIW A;  4FAV A;  4PWA A;  3VYM A;  1DVH A;  4H0J A;  1CSV A;  3CX5 W;  155C A;  3L4M A;  1YCC A;  3WFC C;  1CCH A;  4K3I A;  5CIC B;  1KIB A;  1AOF A;  1C7M A;  1KYO W;  3CX5 D;  2YIU B;  2B11 B;  1K3G A;  1AKK A;  4WQ8 A;  1YNR A;  1HH7 A;  2BH5 X;  3TF5 A;  1CRH A;  1KYO D;  1C6O A;  1H9X A;  4PW9 B;  4AX3 A;  2JTI B;  4YE1 A;  2V07 A;  1DT1 A;  4PJ0 V;  1DW0 A;  4Q5P A;  1C2N A;  2AXT V;  3L75 D;  2PAC A;  5KLV D;  1SQP D;  1HZU A;  1YEB A;  2DVH A;  2C1U A;  2MHM A;  3GW6 A;  1CXA A;  1GQ1 A;  3PXW A;  1ETP A;  2CE0 A;  1BCC D;  1NML A;  3OA8 A;  1YIC A;  2Y0D A;  3C2C A;  1PP9 D;  3RMZ A;  1L0N D;  1I6D A;  4XYD B;  2CE1 A;  3TYI A;  2LIT A;  451C A;  1U75 B;  4L3H A;  1WEJ F;  1ZZH A;  4XXL A;  1CIE A;  4EID A;  1P84 D;  4EIE A;  3FWL A;  1LFM A;  1HZV A;  1QL4 A;  1HRC A;  1IRV A;  4WQE A;  3PTZ A;  4O1Q A;  3WFB C; 
#chains in the Genus database with same CATH topology
 2XTS B;  3TDK A;  1VQ5 P;  1IJD B;  1MG2 D;  2O3J A;  2N1T D;  2B0Z B;  3MK7 B;  5AW4 B;  2IX7 C;  3RK3 B;  1YQ4 C;  3CC7 P;  2KLV A;  2NPS D;  1NVO A;  1WMK A;  2ZAE B;  2JQR A;  2D0S A;  2PP6 A;  5GTH E;  2JR8 A;  2FYU K;  2JP3 A;  5APU A;  3VP8 A;  4WQB A;  3IAO A;  1PP9 E;  2QJY C;  2WSC H;  3V2Q A;  5H2F H;  1EZV I;  2N3Y A;  1N7S A;  2A06 D;  3JSV C;  1KTM A;  2B87 B;  4WY4 C;  2GM4 A;  1RAP A;  4NPF X;  3ZIY A;  1H32 B;  2R44 A;  1KB9 I;  4U3F D;  5TIS V;  5B66 E;  1S9K D;  1H33 A;  1Z56 A;  5CBO A;  1E29 A;  2BCC J;  2H7H A;  1AA0 A;  2H8P D;  1LT9 C;  2KB7 P;  5CIF B;  2J58 A;  3BCC J;  2HV4 A;  2QJK C;  1T8Z A;  2XND H;  2Q3E A;  1SQX E;  1S5L E;  1CYC A;  1M7L A;  2PAJ A;  1NTK J;  1Q90 D;  3H1L E;  1CCR A;  1PIX A;  2CA4 B;  1FOC A;  2ORL A;  1CRG A;  2B4Z A;  3U1C A;  1T6A A;  3S9O A;  3VMY A;  1B7V A;  1SQV J;  2FYN B;  1YHQ P;  1YTC A;  1IO4 A;  4DY9 A;  4U7J A;  5GTI H;  4J20 A;  4W7Y A;  5CJ4 A;  4MU8 A;  1FE6 A;  4AUW A;  1Y8A A;  2PFX A;  3CWB E;  5KLV J;  5CHX A;  4P4Q B;  1LWU B;  1FI7 A;  2FXO A;  3B5N B;  5DJQ C;  3RK2 C;  3PP5 A;  4WWI A;  3CXH E;  1YIT P;  3RN0 A;  3RL0 B;  2G8Y A;  3G3Z A;  3A5T A;  1N7S D;  3X39 A;  4I6M C;  1DVV A;  1VQP P;  2WVR A;  2ZXE B;  3TK1 A;  2OTL P;  4C46 A;  3L71 E;  1LJ2 A;  1WVE C;  3AE6 C;  3O6Q B;  1SQX D;  4PJ0 H;  1VQN P;  4RES B;  3RN1 A;  4KHX A;  2C8S A;  3OA7 A;  1USE A;  1GK4 A;  3H1L D;  1YBK A;  2I8D A;  3U1A A;  1L0N G;  2FWL A;  1OX3 A;  3WU2 H;  1Q82 Q;  2E76 D;  2Y0E A;  2QJP B;  2WSC J;  5CCH A;  1H9Y A;  3NBT A;  2C1D B;  2W90 A;  1QYZ A;  2KS1 A;  2SPZ A;  2HPC B;  2QM7 A;  1DD4 A;  1KYO I;  1JDL A;  3M9H A;  3QH9 A;  3SFE C;  351C A;  5KLV K;  4IFM A;  3EQ2 A;  3CWB D;  2E5Y A;  3CXH W;  3NFQ A;  2XNX A;  3BRT B;  3Q2Y A;  1URQ C;  1FOS E;  3CXH D;  2J59 M;  3HE4 B;  4GED B;  1SFC C;  4OGQ D;  2XKM A;  5GTI V;  3R4Y A;  3PRJ A;  1HJ3 A;  1GZL A;  1NTZ G;  1W5C E;  1KX2 A;  1KIL A;  4H0L C;  4IFD K;  3WFD C;  3L71 D;  3L4F A;  1JY2 P;  3E1I A;  4L3G A;  4DCK A;  3G9R A;  1KQL A;  2IYO A;  1A56 A;  4AAM A;  1ZW0 A;  2FY8 A;  2A45 H;  2UWJ E;  3H1K G;  4ASV A;  1ZRT E;  1FZC C;  1I8P A;  1NH4 A;  4AAN A;  1HJ4 A;  2FRC A;  1NU1 J;  3WUI A;  4EIF A;  1GL2 A;  2NZ2 A;  3O6Q A;  1CYI A;  2IDB A;  3JCU H;  1L0L K;  2ZT9 C;  1I5T A;  1OVR A;  1W2B O;  3L70 D;  2K9J B;  1IQC A;  1BGY G;  5DFS A;  3PJS K;  2N9I A;  2QG4 A;  1KN7 A;  3U59 A;  3L72 J;  2C1D A;  3WU2 V;  1FC2 C;  1HUC A;  1R5S A;  3H1H D;  3KPE A;  3MK7 C;  1AOQ A;  4DT0 A;  1QX8 A;  3RK3 C;  4XFJ A;  3KZI H;  3Q3D A;  1LS9 A;  1HJ5 A;  1S72 P;  3A0B V;  1HJ0 A;  1CO6 A;  2OAR A;  4BWN A;  4OWF A;  3N7N A;  2V08 A;  1QVF O;  1S3J A;  1E5W A;  1CSX A;  3FGA D;  2JEE A;  2Y9Y A;  4GKG A;  2O1K A;  1ZRT D;  3GLM A;  1QN2 A;  1SQB K;  1VQ6 P;  4IL6 H;  2OZ1 A;  4K3A A;  3AED C;  1QL2 A;  4I1L A;  1KQG B;  4LJI A;  3JBT B;  1SQP E;  1L9B C;  2AXC A;  1BE3 G;  2IZ1 A;  3IF4 A;  1RZ6 A;  3A0H H;  5CCH C;  1H0T A;  5IY5 1;  1T3U A;  2BGV X;  1IFP A;  2KP8 A;  1NTZ J;  3ZDM A;  1SP4 A;  2MJZ A;  5BU5 A;  1GU2 A;  1GL2 D;  3TNU B;  1L0N E;  3HUS B;  1GMJ A;  1LTJ B;  2E75 B;  2R5B A;  2E74 B;  4GOF A;  5CIH B;  4YPC A;  2JDI H;  5KAI H;  2R3S A;  1VQL P;  2C9L Y;  3WC8 A;  2K9J A;  5C9M A;  2FYN C;  1FDM A;  1P84 I;  2QVA A;  2AEJ A;  3L4M A;  2M3E A;  1YCC A;  3M0D A;  3WFC C;  1G1J A;  3GF3 A;  1YTZ T;  4K3I A;  2A06 G;  3A7O A;  1C7M A;  2OYH B;  3I5C A;  2YIU B;  1K3G A;  1AKK A;  2K3R A;  1YNR A;  3SFD C;  2BH5 X;  1N7L A;  3B5N C;  1DH3 A;  1NTZ E;  2IYP A;  4YE1 A;  3A0B E;  4JQ0 D;  1DW0 A;  4Q5P A;  4UB8 H;  3RL0 C;  2Z5I A;  3NTN A;  2NRG A;  1SQP D;  3II6 A;  2DVH A;  1YEB A;  3GW6 A;  3MTU E;  2MHM A;  2M8R A;  2CE0 A;  3CX5 H;  2N9B A;  4RKU J;  3B71 A;  3WUT A;  4IL6 X;  1QL1 A;  1HGV A;  3VYI A;  4C7R A;  1KOR A;  1L0N D;  1IZN B;  2IBZ I;  1ZLL A;  1PFI A;  1RQV A;  1KYO H;  1RE4 C;  2CE1 A;  451C A;  3H1K E;  1JOC A;  2WQY C;  1BCC J;  4N78 E;  4L3H A;  1WEJ F;  4BRY B;  1G2C B;  2QJP C;  1CIE A;  2FXP A;  5GTH H;  2YMK A;  4EIE A;  3FWL A;  3VP9 A;  1ZR4 A;  1LFM A;  2NPS B;  2IPP A;  5KJ7 D;  3C1L A;  3TNU A;  1EXJ A;  1D7M A;  1BGY E;  1FZE A;  5AW5 B;  1VQM P;  4WQE A;  1FJK A;  4YXW H;  4O1Q A;  5AVS B;  1KFM A;  2HFE D;  2YKO A;  1NOH A;  3AEA C;  3M91 A;  1C2R A;  2HYN A;  1NNO A;  3WUV A;  1NTM J;  1OIP A;  1FI9 A;  4WY4 A;  4CPG A;  3NWV A;  1PPJ G;  1EC5 A;  3A9F A;  3L74 G;  2OYH A;  1FZA A;  1VF5 D;  2YQB A;  1EXI A;  2HOD B;  1LT9 A;  3CMA P;  4L1Q A;  3PXS A;  1DIQ C;  3H1K D;  4YTP C;  1CTY A;  1W5C T;  4PV1 B;  4Y99 B;  4N78 D;  4IOI H;  1MG3 D;  3OAK A;  4LLH A;  3SVW A;  1GU4 A;  5AW9 B;  1WRG A;  5CCG C;  4N6J A;  2EXV A;  1IFI A;  1DW1 A;  3E7K A;  1KB0 A;  1BE3 E;  5CYT R;  4D6T G;  2CA3 B;  1BGY D;  1JMM A;  2ZFC A;  4U3F J;  1HJB A;  2YK3 A;  1NTM K;  4BRY A;  1SQQ K;  1G2C A;  3W68 A;  3M0D C;  3P8C E;  2R32 A;  1SS1 A;  1OW7 A;  1LTI C;  1JEK A;  1L4A B;  1CED A;  2YO3 A;  4UB6 E;  2C0W A;  2IZ0 A;  1CHJ A;  1GDT A;  2A06 E;  2KZJ A;  4H44 B;  1EZV D;  2MKV A;  3AE2 C;  4WY4 D;  1NAF A;  1PV3 A;  2D2C B;  2VRS A;  1N50 A;  1CRC A;  2BEZ F;  1PP9 J;  4JF7 A;  1KB9 D;  2B89 A;  3MUD A;  3R2P A;  1BE3 D;  1PL5 A;  3V2R A;  1RQU A;  1LP1 B;  2WPS A;  2K88 A;  1CRY A;  3L70 G;  1CRJ A;  5AW7 B;  1RE3 C;  2WSF J;  3DMI A;  1JNM A;  3PH0 A;  2AXT H;  1OW8 A;  3NXS A;  1K73 Q;  1N9C A;  3C9I A;  4O9B A;  3H1H G;  1P84 H;  3N4X A;  3P8C D;  2M5A A;  3HD7 B;  5DJU B;  4DJG A;  1ZV8 A;  1LMS A;  1LTJ C;  1SQX J;  2E75 C;  1URQ A;  1CRI A;  2Q3I A;  2KK7 A;  1SFC A;  2GB8 B;  3H1L J;  2L5G B;  2P10 A;  1K3H A;  1CW5 A;  3TSI A;  3RK2 D;  3ITK A;  5AVX B;  4XA4 A;  2OYH C;  2WSS H;  2ZOO A;  1N15 A;  2YIU C;  3JC2 2;  1Y47 A;  3KDP B;  1C75 A;  3CWB J;  4NPD A;  1I54 A;  3AE3 C;  1C6R A;  3SWY A;  4HKZ H;  5CIB B;  1QVG O;  1PPJ E;  4KJM A;  3L74 E;  4H13 B;  1FZC A;  5CMZ A;  1J1E B;  5KAF H;  1C52 A;  4RO0 A;  2YXQ B;  5B6Q A;  1L0L G;  1FCD C;  2AEF A;  3ZBM A;  3A3Y B;  5AUR A;  1R5L A;  3PLN A;  1RZ5 A;  1VQ4 P;  1KC8 Q;  1MUU A;  5APX A;  1M57 D;  3L71 J;  2Q5U A;  4Y5R A;  1M60 A;  1ZP0 C;  1Q81 Q;  1LP1 A;  5BVZ A;  1BSH A;  3O1Y A;  1Y9B A;  1OXZ A;  4PD4 E;  2P58 A;  1CYJ A;  2FYU D;  1NKZ B;  4D6T E;  4HJG H;  5M1B A;  1QL3 A;  1W2L A;  3AEC C;  2D0W A;  2NPS C;  3CU4 A;  3OW2 O;  3M97 X;  4EYY Q;  2QM8 A;  2OGU A;  3RLM A;  1SFC D;  2RN0 A;  2P1J A;  2WT7 B;  1CTJ A;  4GOD A;  2KOG A;  1PGP A;  3M0A A;  2M0B A;  1A2S A;  2C9X B;  4ZMD A;  2I8F A;  3L70 J;  3RK3 E;  4GIF A;  1GKS A;  1PPJ D;  1EDI A;  1M1J B;  5H2F V;  3RL0 g;  3L74 D;  3KQG A;  2B87 A;  1SQB G;  1SQP G;  1NTK K;  2KSJ A;  4B86 A;  2KNC B;  2ZVN B;  3H1H J;  1H32 A;  1PGJ A;  2M3B A;  1SQV K;  5TIS E;  3Q1M A;  1RHZ B;  1QGK B;  2L91 A;  3PH2 B;  3MUD C;  4FAN A;  3VRD A;  3CX5 I;  4ZKP A;  2E42 A;  1K9M Q;  1USD A;  4OH8 B;  2BCN B;  1AYG A;  3HTK B;  5E79 H;  1DD3 A;  4PV1 C;  4Y99 C;  1NO4 A;  3RBX A;  4PD4 D;  1CHH A;  2ZT9 D;  3IN6 A;  4WVZ A;  4D6T D;  1YJW P;  4QAO A;  1NGM B;  2O01 J;  3WFE C;  1RH5 B;  4NFG B;  2N3B A;  1SLQ A;  3L70 E;  1A02 J;  4AAL A;  1HRO A;  2LXB A;  4ZKU A;  1KQS O;  1FJ0 A;  4GDO A;  1RF0 C;  3HQ8 A;  3H1H E;  1M6Z A;  1DII C;  2GIW A;  3RK3 D;  1MZ4 A;  2LIR A;  1OAE A;  1LWU A;  3B5N A;  1CC5 A;  1Q7Y Q;  1GU5 A;  3M06 A;  1DVH A;  155C A;  1L4A C;  3HRN A;  1KIB A;  1MZ9 A;  2FBW C;  1KIL E;  4H44 C;  2V7Q J;  2KLU A;  5H2F E;  2W27 A;  2D2C C;  1YTZ I;  3TF5 A;  2ZJS E;  2WTY A;  2KNC A;  1RE4 A;  4PJ0 V;  2A45 G;  3IR9 A;  3CCU P;  1GW4 A;  3VN0 A;  5KLV D;  3L73 G;  1MV8 A;  1HZU A;  5CCH D;  2K1A A;  1JTH B;  1GQ1 A;  1L0L E;  1L2P A;  1ETP A;  1K04 A;  5AW2 B;  1JY3 N;  2JWD A;  2E5T A;  2HPC A;  3C2C A;  2OYO A;  3NMD A;  3V5B A;  1SQP J;  2Q9I A;  1N2D C;  4I7Z B;  1HH0 A;  3TYI A;  1BSN A;  2CPS A;  3UIA A;  1LGH B;  1MKM A;  1JY3 O;  1ZZH A;  4XXL A;  2H43 A;  3CXH I;  3HD7 C;  3P7K A;  2WSE J;  5APQ A;  1UIX A;  1L0N J;  1P84 D;  1KV4 A;  1HWT C;  2OYI B;  3D71 A;  3HE4 A;  1HZV A;  5GTI E;  5AVY B;  1EZV G;  1NU1 K;  1KIL D;  3P8M C;  3PTZ A;  2G3A A;  1FOS F;  3B5N D;  1H31 B;  2CPB A;  3KHU A;  1EDJ A;  2C2C A;  3AE7 C;  1RF1 B;  3TGU G;  2CXB A;  1GW3 A;  3RL0 D;  5DF5 A;  1SQB E;  5CIG B;  4FA9 A;  2LR2 A;  1L0L D;  2PCC B;  3OCD B;  3LW5 J;  4H13 C;  1YEA A;  2C1V A;  1DEE G;  2KZI A;  5CCG A;  2W8Z A;  1VQO P;  3ZCF A;  1J1E C;  1HF9 A;  2OTK E;  1IRW A;  5B5E H;  1OMI A;  2PRR A;  1KQF B;  1QEX A;  4PJ0 E;  3M9B A;  1FZG A;  2K9Y A;  1BDC A;  1SQQ G;  1JB0 J;  3CCE P;  1NKN A;  1NIR A;  1KX7 A;  3WU2 E;  1F1F A;  1IK9 A;  2JO1 A;  1YJ9 P;  2KI7 B;  1T2K C;  2ZXY A;  3H1K J;  3H1I G;  2CK3 H;  1LTA C;  4I2L C;  3GG2 A;  3PHL A;  4FB1 A;  1LWU C;  5KKZ B;  3A2A A;  3S4R A;  3KZI V;  3K5B A;  1BGY J;  1E8E A;  1SQB D;  3H1J G;  2GUV A;  1AQ5 A;  1NTZ K;  1FDO A;  4N0K A;  1ZN5 A;  1IO3 A;  1N73 B;  2P67 A;  2WMM A;  4W80 A;  1GD2 E;  1M1J C;  4JBZ A;  3CCS P;  3Q5P A;  1DEB A;  4FA4 A;  5APW A;  2O01 N;  4H0K A;  4IL6 V;  1NJI Q;  1FDI A;  1FU1 A;  1XTC C;  1RE3 A;  2N1T B;  1AJY A;  5AVR B;  2W6B A;  3L37 A;  1KMI Z;  4DOJ A;  5CCG D;  3SWK A;  3A0H V;  3HQ6 A;  1OFC X;  1LTS C;  3G71 P;  5APS A;  2FYU G;  2JWA A;  3L73 E;  3HUS A;  1LTJ A;  3L75 G;  3BAT A;  2K37 A;  3EFG A;  1IK7 A;  4R4L A;  5CJ0 A;  3JCU E;  4AAO A;  3D6Y A;  3GHG B;  5KAI V;  1BE3 J;  4L75 A;  2YXR B;  3CI9 A;  4AYC A;  2WSF H;  1VPC A;  1ZOY C;  5B66 H;  3Q5R A;  1HCM A;  5AW0 B;  4L73 A;  3T97 B;  1S1C X;  2OTJ P;  1HTL C;  3O5C A;  2B10 B;  1S4X A;  2PGD A;  4Z1M H;  3F5H A;  1GTW A;  3KZI E;  1EZV E;  3FWN A;  3MIW A;  1S5L H;  3P32 A;  3TYY A;  2B88 A;  4O1W A;  2I1K A;  1GK6 A;  4A7P A;  4UB8 V;  3HE5 B;  3WUU A;  3TGU E;  5AW1 B;  1N73 A;  1FZB A;  1KB9 E;  3H32 B;  2P7J A;  4C7N B;  3AE8 C;  4L76 A;  2DGE A;  3L73 D;  1VQ7 P;  3AE5 C;  2VHD A;  1JY2 N;  5AVU B;  4WBA A;  1Q86 Q;  4IL6 E;  3DR0 A;  5EXQ A;  1VDF A;  2WIT A;  3A0H E;  3CXH H;  1COT A;  5KJ7 C;  2NPS A;  5GTH V;  1IC2 A;  1AVY A;  1SQQ E;  1M70 A;  3H6P A;  2E75 D;  5APV A;  2BCC G;  4I7Z C;  5APY A;  2GA1 A;  1N7S B;  3BCC G;  3H1I E;  2FFD B;  5KAI E;  3VNW A;  1VQK P;  2HLO A;  3ORV A;  2HR3 A;  1ZME C;  1NTK G;  2AIU A;  3ZOO A;  1NMI A;  1KZU B;  1K05 A;  1SQV G;  2BH4 X;  5B66 V;  1K8A Q;  1H33 B;  3TGU D;  1LC1 A;  2KUB A;  4RJT A;  1CIH A;  1S5L X;  2E76 B;  1N90 A;  3LID A;  3H1J E;  3AEB C;  1RF1 C;  2FYZ A;  2HOD A;  2QRX A;  1N8R Q;  1S5L V;  5KLV G;  1IZL 0;  4LGD E;  1IFJ A;  2N18 B;  3B4S A;  2FKW B;  4GT1 A;  4UB8 E;  3HE5 A;  3L4O A;  3CC4 P;  2BAS A;  1JMB A;  2V4H A;  3FX0 A;  3L74 J;  1NTM D;  3O20 A;  3HUS C;  1E2R A;  1SQQ D;  1DW2 A;  4OGQ B;  3GMA A;  3CLQ A;  1RF0 A;  3IFM A;  3HQ9 A;  2E74 C;  5BU8 B;  3CC2 P;  1KYO E;  3MD0 A;  3BRV B;  2FYU E;  3H1I D;  3AE9 C;  1OCD A;  2IFN A;  4WB4 A;  3L75 E;  2ZXX A;  1S6V B;  1LT1 A;  1H1O A;  4GOE A;  3QWO C;  1DW3 A;  4WQC A;  1FS0 E;  3FXE A;  1CIF A;  1LTT C;  1CNO A;  5AVT B;  4ZNC A;  1COR A;  2O01 H;  3O8Z A;  1L4A A;  2GUS A;  1L9J C;  2ZVO B;  1CTZ A;  4D6T J;  5KKZ C;  1AQT A;  1RY3 A;  3RBZ A;  2FFD A;  3H1J D;  5AVV B;  3VMX A;  2ITA A;  1GIW A;  2JJL A;  4PWA A;  3VYM A;  2ZYD A;  4H0J A;  1N73 C;  1CSV A;  3CX5 W;  1FBM A;  4XE5 B;  1R8E A;  1CCH A;  3H25 A;  1NHL A;  1SQX K;  4QMA A;  2R5D A;  2IBZ G;  1KYO W;  2KS1 B;  3CX5 D;  1JO5 A;  1U7M A;  2B11 B;  4WQ8 A;  4JYC A;  4PV1 D;  2R3C A;  2Q7C A;  2POH A;  1KYO D;  2N1T C;  1J1D B;  3OJA B;  2V7Q H;  2JTI B;  2V07 A;  1DIP A;  1C2N A;  2AXT V;  3L75 D;  1JCD A;  3BAS A;  3MHV A;  1LTG C;  3E1R A;  1AV1 A;  1X8Y A;  2QEX P;  1YI2 P;  3W67 A;  1OZH A;  1CXA A;  3HD7 A;  1URQ D;  1PGO A;  1YIC A;  1PP9 D;  1NU1 G;  1KIL B;  3GHG C;  1I6D A;  2BCC E;  2LIT A;  4H0L D;  1U75 B;  2Z4E A;  3BCC E;  1MFZ A;  3MP7 B;  2Z5H A;  4EID A;  1FJP A;  2QIW A;  2XDJ A;  1L4A D;  4TT3 H;  1VQ9 P;  1NTK E;  3L72 G;  1X9V A;  4KT0 J;  1QL4 A;  2WSE H;  4H44 D;  1IRV A;  2YKQ A;  1SQV E;  1ZR2 A;  2D2C D;  1IFN A;  4GYD A;  1GL2 B;  3B8E B;  4K35 A;  1JM0 A;  2PCB B;  1CHI A;  1BL9 A;  5KAF V;  2BPB B;  3FXD A;  2BLF B;  2ZBO A;  3BVH A;  5KLV E;  5AW6 B;  1CSU A;  3ABV C;  1Q2N A;  1I8O A;  2FXM A;  4L74 A;  3CCR P;  1DX7 A;  3CCQ P;  5AW3 B;  3VMZ A;  3LW5 H;  3SWS A;  3L36 A;  2H88 C;  3V4W A;  1CSW A;  2Y0C A;  2BCC D;  1HVV A;  1L0L J;  3A0B H;  2AXT E;  2LXC B;  1FZF A;  2OQQ A;  4FA1 A;  3HD7 D;  5KLI B;  5DJT B;  3BCC D;  4V2K A;  4EIJ A;  1P84 E;  5AW8 B;  1JUN A;  1H8A A;  1NTK D;  5C0Z A;  2WT7 A;  1N7S C;  3L35 A;  2B9B A;  1R0Q A;  3KYQ A;  4RSZ A;  2FFD C;  4HYT B;  1SQV D;  2XV5 A;  1E79 H;  1M1J A;  3D70 A;  2OZ1 B;  1EDL A;  2MTA C;  3CME P;  5KTB A;  3VMA A;  4EI2 A;  1EQ7 A;  1OWA A;  3HQ7 A;  1H0T B;  4WQA A;  2E76 C;  1M90 Q;  1X22 A;  4H13 D;  4DZO A;  3HTK A;  1U57 A;  4PD4 I;  2N18 C;  1GJQ A;  3O0R C;  5E79 V;  1SQB J;  2IBZ E;  3G4S P;  5KAF E;  2LKM A;  1M1K Q;  3AEG C;  2QSI A;  1YIQ A;  2QA4 P;  3CCL P;  4M3L A;  1OVU A;  1N86 A;  4FA5 A;  3GF7 A;  3ZOX A;  1U74 B;  2GC4 D;  3SLE A;  2ZZS 1;  1CIG A;  1T2K D;  2XZR A;  2ZON G;  4OGQ C;  2RKL A;  3M9Q A;  2XU6 A;  4HH2 A;  1I55 A;  1YFC A;  1VF5 B;  1LNQ A;  2P2U A;  1KFN A;  1BCC G;  1NU1 E;  1SVF A;  3EFF K;  1PGQ A;  1BDD A;  3AEF C;  2KIK A;  1KB9 H;  1FHB A;  3D6Z A;  2B12 B;  1YYC A;  1HGZ A;  3AEE C;  4MN4 C;  2Y9Z A;  3WMM 0;  1RAQ A;  1KD1 Q;  3L72 E;  1ZXG A;  2HG5 D;  1I6E A;  1SQP K;  4Y28 J;  1J3S A;  2N9J A;  4EIC A;  1VYD A;  2IBZ D;  3ZOW A;  1A02 F;  2KYV A;  1NTM G;  5APT A;  1IFD A;  1L0N K;  4TLF A;  2IFM A;  2Q1K A;  3MGN A;  1JTH A;  1NAY A;  3SJL A;  2YNY A;  2AI5 A;  5EFW B;  2YKP A;  4JPZ B;  5AVZ B;  5KJ7 A;  1C6S A;  4UB6 H;  4WQ7 A;  1S2E A;  4OVN F;  2E43 A;  1J1D C;  5E79 E;  1LC2 A;  2QJY B;  3D0W A;  3NBS A;  1A8C A;  1J2J B;  4WQD A;  3PXT A;  2KSE A;  3V6I A;  4YXD C;  1NU1 D;  4WY4 B;  3L73 J;  1W2E A;  2OYI A;  5TJH A;  3SXT A;  1KIL C;  3KXD A;  1H88 A;  2H89 C;  3AE1 C;  1T3J A;  3L72 D;  1H31 A;  1LT9 B;  4U3F G;  1GDV A;  1U7J A;  3VTP C;  1RF1 A;  2YCC A;  2RMZ A;  2QJK B;  1TU3 F;  3CL3 D;  2GC7 D;  1M8O B;  1CXC A;  1VL2 A;  2N9Y B;  5AVQ B;  2C0X A;  2L4D A;  4WQ9 A;  3ZOY A;  4LC1 A;  1OW6 A;  1OVV A;  3CP5 A;  2WPV B;  3OCD A;  1GL2 C;  1QKS A;  1VQ8 P;  1NWQ A;  2AEM A;  2I1J A;  1M56 D;  1EB7 A;  3CPW O;  5B5E V;  3TGU J;  2WPQ A;  3CCJ P;  5CIE B;  1FAV A;  3C8V A;  4N3Y B;  1FI3 A;  1CSB A;  1PP9 G;  5DJQ B;  3RK2 B;  2W6A A;  4HB1 A;  1X0T A;  3OA8 B;  1F1C A;  4UB6 V;  3Q5S A;  2O1J A;  2ZYA A;  4JYB A;  2WPR A;  1NTZ D;  3V4Q A;  4BXL A;  3V2P A;  5KLI C;  3AE4 C;  1SQQ J;  1CI6 B;  2ZYG A;  2W6J H;  1IFM A;  5L8R J;  4JCG A;  5CID B;  3CCM P;  3SSU A;  1BCC E;  3LIE A;  3DP5 A;  1KV9 A;  3CCV P;  3H1I J;  3MZW B;  1SQX G;  2WWW A;  3SWF A;  5K5G B;  2C9N Y;  3H1L G;  3RGU A;  2BEQ D;  4PD4 H;  4EDF A;  4KMG A;  3CYT I;  3VOP A;  4NPE A;  1LTB C;  1HBW A;  3G6E P;  3V2N A;  4FAV A;  4EOT A;  2N1T A;  5AVW B;  3H1J J;  1AVO A;  2M5A B;  1PZQ A;  1XTG B;  2JKV A;  5CIC B;  1AOF A;  1JY2 O;  1NTM E;  1QLE D;  3CWB G;  1URQ B;  1WT6 A;  1AFO A;  2W83 C;  1SFC B;  3S1K A;  1HH7 A;  2E74 D;  2QE7 H;  5B5E E;  1YIJ P;  4W7Z A;  2YMY A;  2J5U A;  1CRH A;  2WZ7 A;  3USS A;  1EDK A;  1C6O A;  1NYH A;  1H9X A;  4PW9 B;  4AX3 A;  3CD6 P;  4H0L B;  3GHG A;  3EWK A;  1DT1 A;  1X79 B;  2OYI C;  2PAC A;  4AQR D;  5TIS H;  2C1U A;  5C39 A;  3PXW A;  1BCC D;  1NML A;  3OA8 A;  3T97 A;  2FYU J;  3L71 G;  1JCC A;  2Y0D A;  3RMZ A;  1VF5 C;  1JY3 P;  3F89 A;  3L75 J;  3I56 P;  4IFF A;  4XYD B;  1YQ3 C;  1FZC B;  1MFT A;  3I55 P;  1H89 A;  1CI6 A;  2RH0 A;  1UII A;  4U3F E;  5CBN A;  2Q6Q A;  2ZT9 B;  4R4M A;  1S9K E;  1YJN P;  1CZQ A;  2A45 I;  4ASW A;  1G1I A;  3H32 A;  2YO2 A;  1HRC A;  4C7N A;  3CX5 E;  2KXP B;  2DW3 A;  3WFB C; 
#chains in the Genus database with same CATH homology
 2XTS B;  3TDK A;  4GYD A;  1H31 B;  3KHU A;  1MG2 D;  1C2R A;  2C2C A;  2O3J A;  1NNO A;  2B0Z B;  3MK7 B;  2CXB A;  2PCB B;  1CHI A;  1BL9 A;  5KAF V;  2BPB B;  1FI9 A;  5DF5 A;  2BLF B;  2ZBO A;  5CIG B;  4FA9 A;  1CSU A;  2JQR A;  2D0S A;  3NWV A;  1I8O A;  3A9F A;  1L0L D;  2PCC B;  3OCD B;  1YEA A;  2C1V A;  4WQB A;  3ZCF A;  2YQB A;  2N3Y A;  2A06 D;  1IRW A;  3SWS A;  4L1Q A;  3PXS A;  1CSW A;  2Y0C A;  2BCC D;  1DIQ C;  3H1K D;  1RAP A;  1CTY A;  1W5C T;  4FA1 A;  3ZIY A;  5KLI B;  1MG3 D;  3BCC D;  1NIR A;  1H32 B;  4V2K A;  4U3F D;  3SVW A;  1KX7 A;  5TIS V;  1F1F A;  1H33 A;  2EXV A;  2ZXY A;  1DW1 A;  1KB0 A;  1NTK D;  5C0Z A;  1E29 A;  1R0Q A;  5CYT R;  2CA3 B;  3GG2 A;  4RSZ A;  5CIF B;  1BGY D;  3PHL A;  4FB1 A;  1SQV D;  2HV4 A;  5KKZ B;  2Q3E A;  2YK3 A;  1CYC A;  2OZ1 B;  3KZI V;  2MTA C;  1CCR A;  2CA4 B;  1FOC A;  2ORL A;  1CRG A;  3VMA A;  2B4Z A;  3HQ7 A;  1B7V A;  1E8E A;  2FYN B;  1SQB D;  4WQA A;  1YTC A;  4N0K A;  1IO3 A;  4DY9 A;  1CED A;  4J20 A;  4MU8 A;  1CHJ A;  2N18 C;  1GJQ A;  1EZV D;  3O0R C;  5E79 V;  4FA4 A;  4P4Q B;  4H0K A;  4IL6 V;  1YIQ A;  1FI7 A;  1N50 A;  5DJQ C;  1CRC A;  4FA5 A;  3ZOX A;  1U74 B;  2GC4 D;  3SLE A;  2ZZS 1;  3RN0 A;  1CIG A;  1KB9 D;  3A0H V;  3HQ6 A;  2ZON G;  3X39 A;  2JWA A;  1BE3 D;  1DVV A;  1I55 A;  1YFC A;  1CRY A;  1CRJ A;  3DMI A;  1WVE C;  1SQX D;  4AAO A;  3RN1 A;  2C8S A;  5KAI V;  3H1L D;  1N9C A;  1FHB A;  2FWL A;  2B12 B;  2Y0E A;  1HCM A;  2QJP B;  1LMS A;  1H9Y A;  3NBT A;  2C1D B;  1QYZ A;  2KS1 A;  1CRI A;  1RAQ A;  3O5C A;  2GB8 B;  1JDL A;  2B10 B;  351C A;  1I6E A;  1J3S A;  2N9J A;  4EIC A;  3CWB D;  1VYD A;  2IBZ D;  3CXH W;  3ZOW A;  1K3H A;  4O1W A;  3ITK A;  4A7P A;  4UB8 V;  2ZOO A;  1N15 A;  3SJL A;  3CXH D;  4GED B;  2AI5 A;  1C75 A;  5GTI V;  3PRJ A;  1I54 A;  1HJ3 A;  1C6R A;  1C6S A;  2DGE A;  4WQ7 A;  5CIB B;  1KX2 A;  3L73 D;  1LC2 A;  2VHD A;  2QJY B;  3NBS A;  1A8C A;  4WQD A;  1C52 A;  3WFD C;  3PXT A;  3L71 D;  5B6Q A;  4L3G A;  3DR0 A;  1NU1 D;  5EXQ A;  1FCD C;  3ZBM A;  1A56 A;  4AAM A;  5AUR A;  1COT A;  3PLN A;  5TJH A;  1RZ5 A;  5GTH V;  1M70 A;  3SXT A;  4Y5R A;  1M60 A;  1I8P A;  4AAN A;  1HJ4 A;  2FRC A;  3WUI A;  3O1Y A;  4EIF A;  3L72 D;  1H31 A;  1CYI A;  1CYJ A;  1GDV A;  2FYU D;  3VNW A;  2YCC A;  3ORV A;  2RMZ A;  1QL3 A;  1I5T A;  2QJK B;  1W2L A;  2AIU A;  2D0W A;  2GC7 D;  3L70 D;  3CU4 A;  2K9J B;  3ZOO A;  1CXC A;  1IQC A;  3M97 X;  1NMI A;  5DFS A;  2N9I A;  2QG4 A;  2N9Y B;  2BH4 X;  5B66 V;  2C1D A;  2L4D A;  4WQ9 A;  3RLM A;  3WU2 V;  1H33 B;  3ZOY A;  3TGU D;  2RN0 A;  3CP5 A;  3OCD A;  1LC1 A;  1CTJ A;  4RJT A;  1CIH A;  1QKS A;  3H1H D;  1N90 A;  1A2S A;  2C9X B;  2I8F A;  3MK7 C;  1AOQ A;  1GKS A;  1EB7 A;  1PPJ D;  5H2F V;  3L74 D;  1S5L V;  5B5E V;  1IZL 0;  1LS9 A;  1HJ5 A;  5CIE B;  2N18 B;  2KNC B;  3A0B V;  3L4O A;  1CO6 A;  1H32 A;  1FI3 A;  5DJQ B;  2L91 A;  3PH2 B;  2V08 A;  4FAN A;  3VRD A;  1NTM D;  3O20 A;  1E2R A;  1SQQ D;  1CSX A;  2BCN B;  3OA8 B;  1AYG A;  1F1C A;  1DW2 A;  4UB6 V;  1ZRT D;  3HQ9 A;  1QN2 A;  1NTZ D;  4PD4 D;  2OZ1 A;  3H1I D;  1CHH A;  1OCD A;  4D6T D;  4QAO A;  1S6V B;  1H1O A;  4LJI A;  3WFE C;  4NFG B;  2N3B A;  3JBT B;  1L9B C;  4JCG A;  4AAL A;  1RZ6 A;  5CID B;  1DW3 A;  4WQC A;  1HRO A;  5IY5 1;  2BGV X;  1CIF A;  1FJ0 A;  1CNO A;  3DP5 A;  1COR A;  1KV9 A;  1GU2 A;  1L9J C;  1CTZ A;  3HQ8 A;  1M6Z A;  1DII C;  2GIW A;  3H1J D;  1MZ4 A;  4EDF A;  2LIR A;  5CIH B;  1OAE A;  4KMG A;  3CYT I;  1CC5 A;  3WC8 A;  5C9M A;  1GIW A;  4FAV A;  4PWA A;  3VYM A;  1DVH A;  4H0J A;  1CSV A;  3CX5 W;  155C A;  3L4M A;  1YCC A;  3WFC C;  1CCH A;  4K3I A;  5CIC B;  1KIB A;  1AOF A;  1C7M A;  1KYO W;  3CX5 D;  2YIU B;  2B11 B;  1K3G A;  1AKK A;  4WQ8 A;  1YNR A;  1HH7 A;  2BH5 X;  3TF5 A;  1CRH A;  1KYO D;  1C6O A;  1H9X A;  4PW9 B;  4AX3 A;  2JTI B;  4YE1 A;  2V07 A;  1DT1 A;  4PJ0 V;  1DW0 A;  4Q5P A;  1C2N A;  2AXT V;  3L75 D;  2PAC A;  5KLV D;  1SQP D;  1HZU A;  1YEB A;  2DVH A;  2C1U A;  2MHM A;  3GW6 A;  1CXA A;  1GQ1 A;  3PXW A;  1ETP A;  2CE0 A;  1BCC D;  1NML A;  3OA8 A;  1YIC A;  2Y0D A;  3C2C A;  1PP9 D;  3RMZ A;  1L0N D;  1I6D A;  4XYD B;  2CE1 A;  3TYI A;  2LIT A;  451C A;  1U75 B;  4L3H A;  1WEJ F;  1ZZH A;  4XXL A;  1CIE A;  4EID A;  1P84 D;  4EIE A;  3FWL A;  1LFM A;  1HZV A;  1QL4 A;  1HRC A;  1IRV A;  4WQE A;  3PTZ A;  4O1Q A;  3WFB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...