2BCCD

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGPLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSVREGLYFNPYFPGQAIGMAPPIYNDVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLVPLVYYMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2bccD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2bccD01
2N9IA 1EB7A 1H33A 1DVHA 2KNCB 2C9XB 5IY51 1CHIA 2YK3A 2JWAA 3GW6A 5TISV 1CYCA 1H9XA 1IO3A 1AOFA 1QL4A 4L3GA 1FHBA 3L70D 3L73D 3VRDA 3PXTA 1KIBA 2GIWA 4UB8V 3SWSA 2KS1A 2Y0EA 5CIFB 1CXCA 1CIFA 5KAIV 5E79V 2JTIB 1RZ6A 1H9YA 2DGEA 3VNWA 2B4ZA 4WQEA 1DVVA 1C52A 3KHUA 4WQ7A 4WQAA 1LC2A 2C1DA 1HJ5A 2BLFB 5AURA 3OA8B 4L3HA 1CSWA 1FJ0A 3TGUD 1NIRA 1DW2A 4EIEA 2CE1A 4H0JA 2QJPB 1SQVD 1KV9A 1IQCA 5H2FV 4AX3A 2FWLA 3WFCC 5CIDB 1QKSA 3OA8A 3NWVA 1VYDA 2CXBA 451CA 2B12B 4AAOA 4FA1A 2N18B 2N18C 2PCCB 1GU2A 2RN0A 1RAPA 2BCCD 4MU8A 3DP5A 4J20A 1GIWA 1BL9A 1R0QA 3NBTA 5GTHV 1CRHA 1WVEC 1NU1D 2D0SA 2ZBOA 3MK7C 1U75B 2ZZS1 1IRWA 1MG2D 1A2SA 1L9JC 1J3SA 1HJ3A 1OCDA 4FA4A 1PP9D 3WFBC 3PH2B 3WFDC 4DY9A 1HH7A 3SVWA 2N3YA 1CTZA 1H32B 2LIRA 1DT1A 1WEJF 351CA 3HQ7A 1LS9A 2B11B 3O20A 3CWBD 1E8EA 1BGYD 3RLMA 1HZVA 4FA9A 2B0ZB 1DIIC 2YCCA 1ZRTD 3L74D 3VMAA 1SQQD 1L0ND 2AI5A 4PWAA 1H32A 1YNRA 2JQRA 1C2RA 3PLNA 2B10B 4FANA 5GTIV 1PPJD 3ORVA 1U74B 1RZ5A 1GQ1A 1I6EA 1HZUA 5TJHA 1F1CA 2FYNB 2CA4B 3O0RC 4JCGA 1CIEA 3L4MA 1MZ4A 3CX5D 3L72D 4WQ8A 4GYDA 1C6SA 1C7MA 1I8OA 3SXTA 5KLIB 1GJQA 2C1VA 3DMIA 1CC5A 3NBSA 1QYZA 1DIQC 1C75A 1NNOA 1B7VA 2QJKB 2V08A 1EZVD 1QN2A 2CE0A 3RMZA 1DW1A 1H1OA 1YEAA 4XXLA 4U3FD 155CA 4WQBA 3O5CA 1CCRA 1I8PA 5DJQB 1A8CA 3ZOOA 1NMLA 1CHHA 1HROA 3HQ8A 1HRCA 5EXQA 2ZOOA 3A0BV 1M60A 1OAEA 4PJ0V 2N9YB 1CTYA 1K3GA 1CXAA 2MHMA 2MTAC 2BCNB 1I6DA 2O3JA 4GEDB 1YFCA 1S6VB 4AALA 1CYJA 5B5EV 3CXHD 1SQXD 2YIUB 5CIBB 5CIEB 5CIGB 1KB9D 3SJLA 2BH4X 4RSZA 1L0LD 1I5TA 1P84D 2K9JB 2HV4A 1HCMA 4PW9B 5C9MA 3ZOWA 2YQBA 1CYIA 3H1KD 1JDLA 5KAFV 4WQCA 4H0KA 5CICB 1CRCA 1KB0A 2BPBB 3X39A 2GB8B 4NFGB 3OCDB 1CIGA 3DR0A 3SLEA 1FI9A 4LJIA 2PCBB 4QAOA 2LITA 3ZIYA 1FCDC 2XTSB 3JBTB 1KX7A 1RAQA 2Q3EA 1CHJA 5C0ZA 1YCCA 3A9FA 1E29A 3ZOXA 1CRJA 3H1JD 5B6QA 1QL3A 3PXSA 2BGVX 4EIDA 1IRVA 4YE1A 3OCDA 1E2RA 1CIHA 1DW3A 3M97X 4Q5PA 1L9BC 4FAVA 1LFMA 2DVHA 1I54A 2Y0CA 3TYIA 3L71D 4K3IA 5KKZB 5DF5A 1SQBD 3PRJA 2A06D 1AYGA 5B66V 1GKSA 1KYOD 1M6ZA 1W5CT 1C2NA 3CX5W 1NTKD 4WQ9A 4P4QB 2VHDA 4EDFA 1YEBA 4EICA 1H31B 4KMGA 3ZCFA 1NTMD 3PXWA 1N9CA 5CIHB 1KYOW 1HJ4A 2C1DB 3RN0A 2D0WA 4A7PA 2BH5X 2IBZD 5DJQC 1N90A 3O1YA 2OZ1B 2AIUA 2PACA 1DW0A 3L4OA 1GDVA 4Y5RA 1M70A 1I55A 1H31A 2GC4D 1KX2A 4UB6V 4FA5A 3FWLA 3L75D 3TDKA 4AANA 4RJTA 2Y0DA 1K3HA 2C1UA 3WUIA 3H1HD 1CORA 1AKKA 3H1ID 3CU4A 2C8SA 4O1WA 3WC8A 2OZ1A 3CYTI 2N3BA 2N9JA 2I8FA 4FB1A 3BCCD 4N0KA 3A0HV 4V2KA 2QJYB 2CA3B 1C6RA 3GG2A 1COTA 3PHLA 2L91A 3ZOYA 1CEDA 3ITKA 1YIQA 3CXHW 1NMIA 1IZL0 2ZONG 1AOQA 1W2LA 3RN1A 1FOCA 1BCCD 4EIFA 1CSUA 1SQPD 1ETPA 2QG4A 3CP5A 2GC7D 1YTCA 3TF5A 3HQ6A 3MK7B 1LC1A 1CRIA 1N50A 5CYTR 4IL6V 4AAMA 3WFEC 1A56A 4XYDB 1CNOA 1CCHA 4L1QA 1FI3A 1CSVA 2FYUD 2FRCA 1FI7A 2RMZA 4WQDA 3WU2V 1CO6A 1F1FA 1BE3D 3PTZA 5KLVD 2ORLA 3H1LD 1NTZD 4O1QA 1MG3D 1LMSA 3C2CA 1H33B 1CRGA 2EXVA 2ZXYA 1CTJA 1YICA 2AXTV 2C2CA 2L4DA 1C6OA 5DFSA 1ZZHA 3HQ9A 1CSXA 4PD4D 1S5LV 2V07A 1N15A 1CRYA 3ZBMA 4D6TD 3VYMA 3KZIV
chains in the Genus database with same CATH superfamily
2E76D 3CD6P 3A0HH 2N9IA 3AEGC 1H33A 3Q5RA 3MUDA 1DVHA 3OW2O 3M0AA 4JQ0D 3MZWB 2KS1B 3VMYA 1BCCE 1H0TA 5IY51 1SQPE 2C9LY 2OGUA 2O1JA 1CYCA 2ZT9C 1FHBA 1FBMA 4WY4C 5APWA 2KNCA 3GLMA 2AEJA 3AE4C 2WPSA 1CSBA 5AVXB 2DGEA 3VNWA 4GT1A 1DVVA 2N1TD 3KHUA 3S1KA 4WQ7A 4WQAA 2C1DA 1HJ5A 4WY4A 2FKWB 4L3HA 3TGUD 5AW2B 5DJTB 4OWFA 1L4AC 4H0JA 1L0NK 2QJPB 3HTKA 4D6TE 1KV9A 1FZEA 2FYUG 1RF1B 1T3JA 2JR8A 1KQLA 1BE3G 1VQ9P 2QSIA 1S2EA 3AE5C 3AECC 3OA8A 3VYIA 3NWVA 1VYDA 1Q90D 2ZVNB 3B5ND 451CA 1EDIA 3HUSB 3Q1MA 2N18C 1Z56A 1GU2A 1RAPA 2E75D 1MFTA 4PV1C 5B5EE 5TISH 5GTHV 1S72P 2B87B 1WVEC 3L70E 1NU1D 3MK7C 1VL2A 3A5TA 1FZFA 3L73E 2ZZS1 2JKVA 1L9JC 1J3SA 3CCLP 3KDPB 1EZVE 3WFBC 2NPSD 4DY9A 2N3YA 1DEBA 3LW5J 4IFDK 1H32B 3UIAA 1LS9A 3CWBD 4ZNCA 3RLMA 1HZVA 1JB0J 2BCCJ 2YCCA 3U1CA 3P7KA 1VQOP 2AI5A 3RL0g 2E76B 1EXJA 1DD4A 3EWKA 2B10B 4WVZA 1RZ5A 1GQ1A 5AW9B 1HZUA 2H88C 3O0RC 1JCDA 1MZ4A 3L72D 3E1RA 4WQ8A 1C6SA 3N7NA 3CPWO 1VF5C 3RL0D 1BGYJ 1Y47A 3SXTA 1GJQA 3DMIA 1S5LE 1SFCC 5CHXA 1EZVD 2Z5IA 2CE0A 1GK4A 3I5CA 1SQPK 4U3FD 2N1TB 2E5TA 2ZYDA 3SWKA 2OYIC 3O5CA 1CCRA 2PFXA 4HJGH 4I1LA 1LTGC 1PP9G 5AVZB 2HYNA 5APSA 1SQQE 3HQ8A 1ZN5A 1KD1Q 3A0BV 2N9YB 2K3RA 2OYIA 1PPJE 2E42A 2MTAC 2KSEA 1S6VB 3USSA 3B5NB 2P1JA 1SQXD 2Z4EA 3L74G 5CIBB 2YIUC 2E75B 1L0NG 1KZUB 1IK7A 1L4AD 1P84D 5M1BA 2HV4A 3TNUA 3LIDA 5C9MA 1W2BO 2QVAA 2R44A 1GL2C 3H1KD 5AW1B 1T2KC 2NPSB 2JWDA 1NTKK 1R5LA 1JDLA 4GIFA 2KP8A 4WQCA 2I1JA 5CICB 1CRCA 1KB0A 2L5GB 1QVFO 4NFGB 3T97B 4PV1D 1X0TA 1NAYA 1IFPA 2LITA 5C0ZA 3A9FA 1E29A 3F89A 5B6QA 4IL6E 3AEBC 4Q5PA 1Q82Q 1L9BC 4FAVA 1Y9BA 1GZLA 1QX8A 3L35A 2JO1A 2ITAA 1P84I 5APXA 5B5EH 3RL0B 3M9BA 2Q9IA 3G71P 1FU1A 5CBNA 1N7SC 1M7LA 5AW5B 3IR9A 3TK1A 2AXTE 4GODA 2GM4A 1M6ZA 3H1HG 3H1JJ 3CX5W 2FBWC 3KZIE 1G1IA 1GU5A 4P4QB 4AYCA 1YEBA 3JSVC 4YTPC 1H31B 1VF5D 2A45I 3U1AA 1NTMD 3Q5SA 1KYOW 2KK7A 2C1DB 1QLED 4BRYA 4U7JA 1USDA 3L71J 1SFCD 1SQBJ 1DW0A 3HTKB 1J1DC 1N73C 1ZV8A 3HE4A 4UB6V 3HRNA 2VRSA 2YMKA 4AANA 3AE6C 4UB8E 1K3HA 5KAIE 4PD4I 5AW7B 1AKKA 3W67A 2YO3A 2OZ1A 1BDCA 3CYTI 2N9JA 4EIJA 4C7NA 2I8FA 1L4AB 3L4FA 2FFDA 4L75A 3II6A 3R2PA 1RE4A 1H89A 2CA3B 1KYOE 1DD3A 2J59M 3H1LG 3BRVB 1VQKP 1C6RA 1IO4A 2L91A 3A0BE 1IZL0 2YXRB 3VP8A 2R3SA 4GOFA 1LTIC 3CCSP 1CSUA 3BVHA 1IFNA 1X79B 1D7MA 2OYHC 1YTCA 3H1IJ 3TF5A 3GF3A 3MK7B 4W7YA 3TGUJ 2WT7A 1GL2D 2FY8A 2HPCB 4WBAA 1NTKG 1A56A 4XYDB 1NGMB 3R4YA 4QMAA 1MUUA 1FS0E 1VQ7P 2W6BA 4XA4A 2FYUD 1GU4A 1FI7A 2RMZA 1BE3D 1HF9A 2ZXEB 3Q5PA 1MG3D 3PJSK 4NPDA 1BCCJ 1LT1A 1QL2A 2C2CA 2OARA 3WUTA 2WPRA 3BCCE 1CSXA 2V07A 4I2LC 3L75G 4Y28J 3BASA 1EB7A 1QVGO 1QEXA 4H0LC 2J58A 3HD7C 2C9XB 1JTHB 1RQUA 1VF5B 2P10A 1LTJA 1H9XA 1QL4A 1G2CA 4L3GA 1N7SD 2E5YA 2KOGA 3CCVP 2GA1A 3HD7A 4IL6H 1SFCB 2XNDH 2GIWA 3SWSA 5CIFB 5E79V 1M56D 2JTIB 1RZ6A 4NPEA 1JY3P 1HGZA 3QWOC 2OYIB 5KLVE 3CC4P 3L72J 2J5UA 3OA7A 2BLFB 5AURA 1RE3C 5EFWB 1CSWA 2WVRA 1NIRA 1CI6A 2AXTH 4EIEA 2CE1A 2HODA 2I8DA 3GF7A 3VMZA 3L70J 5H2FV 3V5BA 2FWLA 2QJYC 1YQ4C 3TNUB 3KZIH 4IFMA 5AVSB 3B71A 1H88A 4K3AA 1UIXA 4U3FJ 4AAOA 2HG5D 2JEEA 3M0DA 4J20A 3HE5B 2M0BA 1GIWA 1BL9A 3P8CD 1FJKA 4H13C 2D0SA 2WSFJ 3KYQA 1GL2B 2E43A 2H43A 1JCCA 1OCDA 4FA4A 2XU6A 1PP9D 1M1JC 4WB4A 4UB8H 2LXCB 5KAIH 1HH7A 1N2DC 1KQGB 2YXQB 2LIRA 4BWNA 4L73A 351CA 3HQ7A 2IFNA 3MUDC 1EQ7A 4FA9A 1Q7YQ 2M5AB 1M1JA 1DIIC 3L74D 1KYOH 5AVYB 3VMAA 1VQLP 1L0ND 2H89C 1YNRA 1K8AQ 3A0BH 2JQRA 4XE5B 2M8RA 3H1KJ 2V4HA 5AW4B 3ORVA 1SS1A 4YXDC 1I6EA 5TJHA 3WMM0 5AW8B 4LC1A 4JCGA 1RQVA 1IFMA 4GYDA 2QRXA 1SQVG 1L0LE 3V4QA 3GMAA 1I8OA 1NU1E 5KLIC 1N7SB 1LWUA 1HJ0A 2IYPA 4BRYB 1CC5A 1HH0A 1SQQJ 2IZ1A 4H0LD 3F5HA 1NNOA 1IFJA 3SFEC 1TU3F 2WMMA 1DW1A 2BCCG 1H1OA 1YEAA 4XXLA 5AW3B 1URQC 1OFCX 1Q2NA 1I8PA 3CWBE 2B9BA 3IFMA 1PZQA 1G1JA 4W80A 2O1KA 1CHHA 5CMZA 1HROA 3V6IA 4PJ0V 1J1DB 2HLOA 1N73B 1PV3A 3SFDC 1URQA 1UIIA 2MHMA 1OWAA 2O3JA 2IDBA 4GEDB 5KJ7D 1BGYG 3G6EP 1Y8AA 5APYA 3CCEP 3CXHD 3L72E 4DOJA 1KB9D 4HB1A 1J1EC 1Q86Q 3RGUA 3ZDMA 2YMYA 1H8AA 1L0LD 1I5TA 1SQBK 3BRTB 3O8ZA 4R4LA 3LIEA 4PW9B 1LP1A 4TT3H 3E7KA 2YQBA 2ZYAA 3ABVC 1OW8A 1LJ2A 4C7RA 4DCKA 5H2FE 5KAFV 1YTZI 4U3FE 1PL5A 4HKZH 3V2RA 2OYHB 2K9JA 5APQA 1CIGA 1NWQA 1BSNA 4H13D 2IX7C 3CI9A 4DJGA 5BVZA 5K5GB 2PCBB 1FCDC 2XTSB 1LTAC 2Q3EA 1CHJA 1E79H 4Z1MH 2FYZA 1QL3A 2Z5HA 3NTNA 1IRVA 4YE1A 3OCDA 5CBOA 2K1AA 3CXHI 1NYHA 2AXCA 1CIHA 3M97X 1NJIQ 1VQPP 1FZCA 1KB9I 3W68A 2FYNC 1SQXE 2H7HA 2N9BA 5AVQB 1LFMA 1RHZB 3WU2E 1I54A 5CJ0A 1P84E 3D70A 4HH2A 4K3IA 2POHA 2A06D 1AYGA 5B66V 1BDDA 2QA4P 3RBXA 1X8YA 3H1KE 4H0LB 1T3UA 4GKGA 1W5CT 1GTWA 1C2NA 2LR2A 1NTKD 4WQ9A 2QJKC 1M57D 1BE3J 4EICA 3M91A 3ZCFA 1K73Q 5CIHB 2ZT9D 1NU1K 3O6QB 3RN0A 1EDJA 4WY4D 3CCRP 1AQ5A 2MJZA 3L36A 4GOEA 3L4OA 1CI6B 4Y5RA 1NKNA 1MZ9A 2HODB 1I55A 1U57A 3EQ2A 1ZR2A 2GC4D 1KX2A 1KILC 2YKPA 1IZNB 3L75D 3TDKA 4KT0J 1HUCA 1JY3N 2WPVB 2KIKA 4O1WA 3WC8A 1YITP 2N3BA 4KHXA 3CMEP 4FB1A 3H1JG 4DZOA 3L37A 3A0HV 1KILA 4V2KA 2QJYB 5APUA 1RY3A 1VQNP 3ZOYA 1CEDA 1NMIA 1NOHA 1JY2N 2Y9YA 1AOQA 1W2LA 1HVVA 1NAFA 3AE7C 4EIFA 1AFOA 3L71G 3FWNA 3RK3C 2GC7D 1NTME 4YXWH 4O9BA 2MKVA 1SQBG 3GHGA 4H13B 2NZ2A 3HQ6A 1CRIA 4IFFA 4ZKPA 3BCCJ 1M1JB 1CNOA 2D2CC 4AQRD 1N86A 4L1QA 2ZXXA 5GTHE 4RESB 3H32B 1LTBC 4JYCA 1NTZD 3VTPC 4WWIA 1LMSA 1RF0C 3A2AA 2BEZF 3AE2C 1H33B 4TLFA 1L2PA 2IBZG 2EXVA 1CTJA 2KI7B 5CCGC 2L4DA 5DFSA 3CC2P 1FJPA 1BSHA 1SLQA 2ZVOB 1H0TB 1IC2A 2W83C 4PD4D 1N15A 4I7ZC 1HTLC 3FWLA 1NVOA 2QIWA 5KKZC 2FXPA 1S3JA 3OJAB 5H2FH 1R8EA 1RF0A 2WZ7A 4JPZB 5CJ4A 2JP3A 2KSJA 3H1IG 1AVOA 4B86A 1JMBA 5CCGA 4C46A 4IOIH 2BEQD 3TGUG 2KNCB 1YHQP 4LLHA 1FDMA 1KFMA 4YPCA 4XFJA 5KLVJ 2YK3A 5TISV 2WSFH 2ZT9B 2O01N 1KTMA 2KLUA 1AOFA 4WY4B 3PXTA 1KIBA 2KS1A 2Y0EA 1CXCA 1CIFA 1WT6A 1KN7A 1BCCG 2FYUE 5B66E 1SQPG 3CCQP 2FFDC 2C0WA 1AVYA 1AA0A 1RE4C 1BE3E 1S4XA 3QH9A 4ASVA 1LC2A 3WU2H 2Q3IA 4ZMDA 1P84H 3OA8B 1YQ3C 2QM8A 5AVVB 3CCUP 1SP4A 2RH0A 1SQQK 3CCJP 3VP9A 1SQVD 1USEA 2G3AA 1ZW0A 1S5LH 2Q5UA 3WFCC 2IYOA 5CIDB 1M90Q 1QKSA 2XNXA 4JF7A 1LGHB 3D6YA 3N4XA 3S9OA 2B12B 1DH3A 2N18B 4NPFX 5CCHA 2WPQA 2A45H 2BCCD 1J1EB 1RF1A 4D6TG 1PFIA 1R0QA 4PV1B 1CRHA 2ZBOA 1IFDA 3V2PA 4K35A 1VQ6P 1U75B 2IFMA 1MG2D 1A2SA 1NO4A 1HJ3A 3L72G 3HUSA 1T2KD 1A02F 3AEDC 1CTZA 2G8YA 1NTMK 3RK3D 2B87A 1WMKA 3E1IA 2K37A 2B11B 3NFQA 1FZAA 3L70G 4DT0A 5APTA 3WUUA 1BGYD 3L73G 1L0LJ 2DW3A 3FXDA 1EZVG 1K05A 1KORA 2D2CD 1NU1J 4PWAA 1YBKA 1H32A 1LTJC 1C2RA 3AEEC 5BU8B 5GTIV 3JCUE 3NMDA 5DJUB 3IAOA 3AEAC 2FYNB 3OAKA 1ZOYC 4EI2A 3L4MA 3CX5D 1GK6A 1S9KD 2K88A 4BXLA 3CWBJ 3P8CE 1NHLA 1C7MA 2PGDA 5GTHH 1JY3O 3NBSA 1PP9E 1QYZA 1DIQC 2QJKB 2RKLA 1QN2A 1DEEG 1FZBA 155CA 2N1TC 4WQBA 2W8ZA 2IZ0A 1GDTA 3Q3DA 2XKMA 3L74E 2LXBA 1FDIA 1L0NE 5EXQA 2W6JH 4RO0A 1M60A 1OAEA 3M0DC 1EC5A 2FYUK 2N1TA 4OGQC 1CTYA 2BCNB 3AE3C 3CX5I 1JY2P 1YFCA 4AALA 3B5NC 5B5EV 5AVUB 2YIUB 4UB6E 5CIEB 3H6PA 1FOSE 1SQQG 1KYOI 1HWTC 1VQMP 4RSZA 1VPCA 3M06A 1PPJG 1AV1A 4L76A 1S5LX 5B66H 3B5NA 1X9VA 4M3LA 3B8EB 1PGJA 4KJMA 1AJYA 3B4SA 3MHVA 4H0KA 1NH4A 2C0XA 3RK3B 3G9RA 3BATA 1SQXJ 1KQSO 2W90A 3SLEA 1FI9A 4EOTA 4I6MC 2NPSA 1HBWA 4QAOA 1YJNP 1KX7A 2D2CB 1RAQA 1A02J 3WUVA 3ZOXA 3H1JD 2FXMA 1U7JA 2XDJA 2BGVX 2WSCH 4GDOA 3NXSA 3T97A 1DW3A 1LWUC 2ZFCA 3CXHE 3AE8C 3CMAP 2W6AA 1KB9E 1LTTC 3RL0C 1IFIA 2Y0CA 3TYIA 3L71D 1YYCA 4I7ZB 5KKZB 3FGAD 1LNQA 5DF5A 1SQBD 5AVRB 1OXZA 1FAVA 3PRJA 1LT9C 1GKSA 1YTZT 2OQQA 1XTGB 2O01H 3HD7D 1FE6A 5GTIE 4EDFA 2B89A 1NTZJ 1JEKA 4HYTB 3HE4B 4OH8B 1N9CA 2SPZA 1LT9A 1HJ4A 1T6AA 2D0WA 1JUNA 2BH5X 2IBZD 5DJQC 1GW4A 2KB7P 1FDOA 1ZLLA 2OZ1B 2AIUA 2PACA 1W2EA 1X22A 3MIWA 3JCUH 4C7NB 1M70A 4IL6X 2FFDB 3C1LA 1H31A 2AEMA 3H1LE 2QEXP 5KLVK 4RJTA 3WUIA 5E79E 3H1HD 3H1ID 3CU4A 2C8SA 4N6JA 3SWYA 2ZYGA 4CPGA 1NTMJ 1SVFA 1GMJA 1YJWP 2ZAEB 3M9QA 2A06E 4OGQD 3V2NA 1COTA 3PHLA 2WT7B 3H25A 1NTKE 2OTJP 1L4AA 1FOCA 3IF4A 5BU5A 1BCCD 1N8RQ 1SQPD 1ETPA 4ASWA 2IBZI 5AW6B 1W5CE 2M3BA 1N50A 5CYTR 4IL6V 5AVWB 1FZCC 2YO2A 1K9MQ 1HJBA 1SQVJ 2B88A 1CCHA 1FI3A 2FRCA 4R4MA 4WQDA 3L75E 1CO6A 4W7ZA 1F1FA 2YKQA 4UB6H 2V7QJ 2ORLA 3H1LD 4O1QA 2HPCA 1DIPA 2ZXYA 1YICA 3RK2C 2AXTV 1ZZHA 2HFED 3ZBMA 2KUBA 4D6TD 1LTJB 3KZIV 2CPBA 3IN6A 2H8PD 1WRGA 1G2CB 3Q2YA 3VMXA 3HD7B 3CLQA 2FYUJ 3G3ZA 1DX7A 2P67A 1CHIA 2R3CA 3BCCG 5L8RJ 2JWAA 1L0LK 3GW6A 1JNMA 2GUSA 1IO3A 2WSEH 3L70D 4Y99C 3V4WA 1FOSF 3L73D 3SWFA 3VRDA 4UB8V 2Q6QA 3K5BA 5KAIV 1IJDB 1JTHA 1H9YA 3CXHH 3AE1C 1YJ9P 2B4ZA 4WQEA 1C52A 2E74C 1NTZE 1KB9H 1URQD 2WSCJ 1N7LA 2R5DA 1SFCA 1ZRTE 1FJ0A 4PD4E 1DW2A 1IQCA 4OGQB 4AX3A 4N78E 3AE9C 3V2QA 3GHGC 5KLVG 5GTIH 4PJ0E 2CXBA 1ZMEC 3D6ZA 3PP5A 4FA1A 3KQGA 2PCCB 3FXEA 4OVNF 2O01J 2RN0A 1M1KQ 4MU8A 3DP5A 3FX0A 2P2UA 3NBTA 1AQTA 4H44C 1OVUA 5KTBA 1EZVI 3AEFC 2QE7H 1IRWA 1KV4A 3MP7B 1OW6A 1VDFA 2GUVA 5APVA 1EDKA 3PH2B 3WFDC 5E79H 3SVWA 1OW7A 3HE5A 3S4RA 1DT1A 1WEJF 1J2JB 1GL2A 3O20A 1E8EA 5KAFE 3KXDA 2B0ZB 1ZRTD 1SQVE 2PAJA 3RBZA 1SQQD 1QGKB 3PLNA 1KILE 5AW0B 4FANA 1PPJD 4N78D 1U74B 1LWUB 1PP9J 1F1CA 3VN0A 2CA4B 2HR3A 1KC8Q 1GD2E 2M5AA 1SQXK 1CIEA 2YNYA 3RK2D 1HGVA 2BCCE 2PRRA 1FZGA 5KLIB 1LT9B 2C1VA 2P58A 1VQ8P 3L74J 1U7MA 1L0NJ 3SSUA 1ZXGA 1C75A 1B7VA 4EYYQ 2V08A 3RMZA 2XZRA 1L0LG 3RK3E 3EFGA 2OYOA 2QM7A 1URQB 1N7SA 2BASA 1NU1G 2KZJA 3KPEA 1BGYE 4RKUJ 3TYYA 2CPSA 5DJQB 1A8CA 3ZOOA 1NMLA 1MFZA 2CK3H 1GW3A 4ZKUA 1CZQA 5CCHC 1HRCA 2QJPC 2ZOOA 1JM0A 1NKZB 1RF1C 3TSIA 1K3GA 1JMMA 3P32A 1CXAA 1ZR4A 1I6DA 1KILD 1NTZK 2E74D 3CWBG 1LP1B 2WQYC 1K04A 1CYJA 3CX5E 2WTYA 3HUSC 5CIGB 1S9KE 3U59A 1MV8A 3SJLA 2BH4X 1N73A 3I55P 2JJLA 1JO5A 2I1KA 2K9JB 2K9YA 1EXIA 2KYVA 1HCMA 3ZOWA 1JOCA 1CYIA 1KMIZ 1ZP0C 2WSEJ 3A0HE 2P7JA 4MN4C 2Q1KA 1XTCC 3G4SP 2BPBB 3EFFK 1PGQA 3H1HJ 3X39A 2GB8B 3OCDB 2KXPB 2A06G 4PD4H 4H44D 3DR0A 1FZCB 4LJIA 2M3EA 3MD0A 3ZIYA 3JBTB 1VQ5P 2IPPA 5AVTB 3D71A 1PGOA 1YCCA 1CRJA 1OVVA 4U3FG 4LGDE 2W27A 2OYHA 3PXSA 2E76C 4PJ0H 4EIDA 4N3YB 2NRGA 1E2RA 2KLVA 1S1CX 3JC22 1SQPJ 3RK2B 3C9IA 2DVHA 2R5BA 5CCGD 3A7OA 1OMIA 1SQVK 2C9NY 3CCMP 3M9HA 1KYOD 1Q81Q 2JDIH 1SQXG 1OZHA 1EDLA 2VHDA 2XV5A 3H1LJ 5KAFH 4KMGA 1VQ4P 3PXWA 1OX3A 4Y99B 3C8VA 4A7PA 3H1KG 2WSSH 1N90A 3O1YA 2ZJSE 5TISE 2YKOA 4D6TJ 1JY2O 2WITA 3LW5H 2AEFA 3H1JE 1GDVA 4AUWA 1PIXA 2V7QH 1RH5B 4FA5A 1KILB 2E74B 2PP6A 3O6QA 5KJ7C 2Y0DA 1NTKJ 2C1UA 1CORA 2A45G 2Q7CA 1QL1A 1FC2C 3I56P 1OVRA 3L71E 2E75C 5CCHD 3BCCD 1YIJP 1SQBE 4N0KA 1R5SA 3L73J 3GHGB 5KJ7A 1E5WA 1NTZG 3D0WA 3GG2A 2OTKE 1PGPA 2Y9ZA 1RE3A 1YI2P 3ITKA 1YIQA 3CXHW 2NPSC 2ZONG 2FXOA 1OIPA 4L74A 3CC7P 3RN1A 3P8MC 3L75J 3CL3D 2QG4A 3CP5A 2LKMA 1KFNA 4H44B 1KQFB 1LC1A 2IBZE 2KZIA 1T8ZA 4JYBA 1LTSC 4AAMA 1M8OB 5C39A 3A3YB 3WFEC 2UWJE 1MKMA 1CW5A 4JBZA 1CSVA 2OTLP 3CX5H 3VOPA 3WU2V 1NTMG 3PTZA 5KLVD 3H1HE 3C2CA 1IK9A 3MGNA 3H1IE 1CRGA 3MTUE 2R32A 3PH0A 3TGUE 1C6OA 2WWWA 3HQ9A 1S5LV 1CRYA 3H32A 3VYMA
chains in the Genus database with same CATH topology
2N9IA 1EB7A 1H33A 1DVHA 2KNCB 2C9XB 5IY51 1CHIA 2YK3A 2JWAA 3GW6A 5TISV 1CYCA 1H9XA 1IO3A 1AOFA 1QL4A 4L3GA 1FHBA 3L70D 3L73D 3VRDA 3PXTA 1KIBA 2GIWA 4UB8V 3SWSA 2KS1A 2Y0EA 5CIFB 1CXCA 1CIFA 5KAIV 5E79V 2JTIB 1RZ6A 1H9YA 2DGEA 3VNWA 2B4ZA 4WQEA 1DVVA 1C52A 3KHUA 4WQ7A 4WQAA 1LC2A 2C1DA 1HJ5A 2BLFB 5AURA 3OA8B 4L3HA 1CSWA 1FJ0A 3TGUD 1NIRA 1DW2A 4EIEA 2CE1A 4H0JA 2QJPB 1SQVD 1KV9A 1IQCA 5H2FV 4AX3A 2FWLA 3WFCC 5CIDB 1QKSA 3OA8A 3NWVA 1VYDA 2CXBA 451CA 2B12B 4AAOA 4FA1A 2N18B 2N18C 2PCCB 1GU2A 2RN0A 1RAPA 2BCCD 4MU8A 3DP5A 4J20A 1GIWA 1BL9A 1R0QA 3NBTA 5GTHV 1CRHA 1WVEC 1NU1D 2D0SA 2ZBOA 3MK7C 1U75B 2ZZS1 1IRWA 1MG2D 1A2SA 1L9JC 1J3SA 1HJ3A 1OCDA 4FA4A 1PP9D 3WFBC 3PH2B 3WFDC 4DY9A 1HH7A 3SVWA 2N3YA 1CTZA 1H32B 2LIRA 1DT1A 1WEJF 351CA 3HQ7A 1LS9A 2B11B 3O20A 3CWBD 1E8EA 1BGYD 3RLMA 1HZVA 4FA9A 2B0ZB 1DIIC 2YCCA 1ZRTD 3L74D 3VMAA 1SQQD 1L0ND 2AI5A 4PWAA 1H32A 1YNRA 2JQRA 1C2RA 3PLNA 2B10B 4FANA 5GTIV 1PPJD 3ORVA 1U74B 1RZ5A 1GQ1A 1I6EA 1HZUA 5TJHA 1F1CA 2FYNB 2CA4B 3O0RC 4JCGA 1CIEA 3L4MA 1MZ4A 3CX5D 3L72D 4WQ8A 4GYDA 1C6SA 1C7MA 1I8OA 3SXTA 5KLIB 1GJQA 2C1VA 3DMIA 1CC5A 3NBSA 1QYZA 1DIQC 1C75A 1NNOA 1B7VA 2QJKB 2V08A 1EZVD 1QN2A 2CE0A 3RMZA 1DW1A 1H1OA 1YEAA 4XXLA 4U3FD 155CA 4WQBA 3O5CA 1CCRA 1I8PA 5DJQB 1A8CA 3ZOOA 1NMLA 1CHHA 1HROA 3HQ8A 1HRCA 5EXQA 2ZOOA 3A0BV 1M60A 1OAEA 4PJ0V 2N9YB 1CTYA 1K3GA 1CXAA 2MHMA 2MTAC 2BCNB 1I6DA 2O3JA 4GEDB 1YFCA 1S6VB 4AALA 1CYJA 5B5EV 3CXHD 1SQXD 2YIUB 5CIBB 5CIEB 5CIGB 1KB9D 3SJLA 2BH4X 4RSZA 1L0LD 1I5TA 1P84D 2K9JB 2HV4A 1HCMA 4PW9B 5C9MA 3ZOWA 2YQBA 1CYIA 3H1KD 1JDLA 5KAFV 4WQCA 4H0KA 5CICB 1CRCA 1KB0A 2BPBB 3X39A 2GB8B 4NFGB 3OCDB 1CIGA 3DR0A 3SLEA 1FI9A 4LJIA 2PCBB 4QAOA 2LITA 3ZIYA 1FCDC 2XTSB 3JBTB 1KX7A 1RAQA 2Q3EA 1CHJA 5C0ZA 1YCCA 3A9FA 1E29A 3ZOXA 1CRJA 3H1JD 5B6QA 1QL3A 3PXSA 2BGVX 4EIDA 1IRVA 4YE1A 3OCDA 1E2RA 1CIHA 1DW3A 3M97X 4Q5PA 1L9BC 4FAVA 1LFMA 2DVHA 1I54A 2Y0CA 3TYIA 3L71D 4K3IA 5KKZB 5DF5A 1SQBD 3PRJA 2A06D 1AYGA 5B66V 1GKSA 1KYOD 1M6ZA 1W5CT 1C2NA 3CX5W 1NTKD 4WQ9A 4P4QB 2VHDA 4EDFA 1YEBA 4EICA 1H31B 4KMGA 3ZCFA 1NTMD 3PXWA 1N9CA 5CIHB 1KYOW 1HJ4A 2C1DB 3RN0A 2D0WA 4A7PA 2BH5X 2IBZD 5DJQC 1N90A 3O1YA 2OZ1B 2AIUA 2PACA 1DW0A 3L4OA 1GDVA 4Y5RA 1M70A 1I55A 1H31A 2GC4D 1KX2A 4UB6V 4FA5A 3FWLA 3L75D 3TDKA 4AANA 4RJTA 2Y0DA 1K3HA 2C1UA 3WUIA 3H1HD 1CORA 1AKKA 3H1ID 3CU4A 2C8SA 4O1WA 3WC8A 2OZ1A 3CYTI 2N3BA 2N9JA 2I8FA 4FB1A 3BCCD 4N0KA 3A0HV 4V2KA 2QJYB 2CA3B 1C6RA 3GG2A 1COTA 3PHLA 2L91A 3ZOYA 1CEDA 3ITKA 1YIQA 3CXHW 1NMIA 1IZL0 2ZONG 1AOQA 1W2LA 3RN1A 1FOCA 1BCCD 4EIFA 1CSUA 1SQPD 1ETPA 2QG4A 3CP5A 2GC7D 1YTCA 3TF5A 3HQ6A 3MK7B 1LC1A 1CRIA 1N50A 5CYTR 4IL6V 4AAMA 3WFEC 1A56A 4XYDB 1CNOA 1CCHA 4L1QA 1FI3A 1CSVA 2FYUD 2FRCA 1FI7A 2RMZA 4WQDA 3WU2V 1CO6A 1F1FA 1BE3D 3PTZA 5KLVD 2ORLA 3H1LD 1NTZD 4O1QA 1MG3D 1LMSA 3C2CA 1H33B 1CRGA 2EXVA 2ZXYA 1CTJA 1YICA 2AXTV 2C2CA 2L4DA 1C6OA 5DFSA 1ZZHA 3HQ9A 1CSXA 4PD4D 1S5LV 2V07A 1N15A 1CRYA 3ZBMA 4D6TD 3VYMA 3KZIV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9I A;  1EB7 A;  1H33 A;  1DVH A;  2KNC B;  2C9X B;  5IY5 1;  1CHI A;  2YK3 A;  2JWA A;  3GW6 A;  5TIS V;  1CYC A;  1H9X A;  1IO3 A;  1AOF A;  1QL4 A;  4L3G A;  1FHB A;  3L70 D;  3L73 D;  3VRD A;  3PXT A;  1KIB A;  2GIW A;  4UB8 V;  3SWS A;  2KS1 A;  2Y0E A;  5CIF B;  1CXC A;  1CIF A;  5KAI V;  5E79 V;  2JTI B;  1RZ6 A;  1H9Y A;  2DGE A;  3VNW A;  2B4Z A;  4WQE A;  1DVV A;  1C52 A;  3KHU A;  4WQ7 A;  4WQA A;  1LC2 A;  2C1D A;  1HJ5 A;  2BLF B;  5AUR A;  3OA8 B;  4L3H A;  1CSW A;  1FJ0 A;  3TGU D;  1NIR A;  1DW2 A;  4EIE A;  2CE1 A;  4H0J A;  2QJP B;  1SQV D;  1KV9 A;  1IQC A;  5H2F V;  4AX3 A;  2FWL A;  3WFC C;  5CID B;  1QKS A;  3OA8 A;  3NWV A;  1VYD A;  2CXB A;  451C A;  2B12 B;  4AAO A;  4FA1 A;  2N18 B;  2N18 C;  2PCC B;  1GU2 A;  2RN0 A;  1RAP A;  2BCC D;  4MU8 A;  3DP5 A;  4J20 A;  1GIW A;  1BL9 A;  1R0Q A;  3NBT A;  5GTH V;  1CRH A;  1WVE C;  1NU1 D;  2D0S A;  2ZBO A;  3MK7 C;  1U75 B;  2ZZS 1;  1IRW A;  1MG2 D;  1A2S A;  1L9J C;  1J3S A;  1HJ3 A;  1OCD A;  4FA4 A;  1PP9 D;  3WFB C;  3PH2 B;  3WFD C;  4DY9 A;  1HH7 A;  3SVW A;  2N3Y A;  1CTZ A;  1H32 B;  2LIR A;  1DT1 A;  1WEJ F;  351C A;  3HQ7 A;  1LS9 A;  2B11 B;  3O20 A;  3CWB D;  1E8E A;  1BGY D;  3RLM A;  1HZV A;  4FA9 A;  2B0Z B;  1DII C;  2YCC A;  1ZRT D;  3L74 D;  3VMA A;  1SQQ D;  1L0N D;  2AI5 A;  4PWA A;  1H32 A;  1YNR A;  2JQR A;  1C2R A;  3PLN A;  2B10 B;  4FAN A;  5GTI V;  1PPJ D;  3ORV A;  1U74 B;  1RZ5 A;  1GQ1 A;  1I6E A;  1HZU A;  5TJH A;  1F1C A;  2FYN B;  2CA4 B;  3O0R C;  4JCG A;  1CIE A;  3L4M A;  1MZ4 A;  3CX5 D;  3L72 D;  4WQ8 A;  4GYD A;  1C6S A;  1C7M A;  1I8O A;  3SXT A;  5KLI B;  1GJQ A;  2C1V A;  3DMI A;  1CC5 A;  3NBS A;  1QYZ A;  1DIQ C;  1C75 A;  1NNO A;  1B7V A;  2QJK B;  2V08 A;  1EZV D;  1QN2 A;  2CE0 A;  3RMZ A;  1DW1 A;  1H1O A;  1YEA A;  4XXL A;  4U3F D;  155C A;  4WQB A;  3O5C A;  1CCR A;  1I8P A;  5DJQ B;  1A8C A;  3ZOO A;  1NML A;  1CHH A;  1HRO A;  3HQ8 A;  1HRC A;  5EXQ A;  2ZOO A;  3A0B V;  1M60 A;  1OAE A;  4PJ0 V;  2N9Y B;  1CTY A;  1K3G A;  1CXA A;  2MHM A;  2MTA C;  2BCN B;  1I6D A;  2O3J A;  4GED B;  1YFC A;  1S6V B;  4AAL A;  1CYJ A;  5B5E V;  3CXH D;  1SQX D;  2YIU B;  5CIB B;  5CIE B;  5CIG B;  1KB9 D;  3SJL A;  2BH4 X;  4RSZ A;  1L0L D;  1I5T A;  1P84 D;  2K9J B;  2HV4 A;  1HCM A;  4PW9 B;  5C9M A;  3ZOW A;  2YQB A;  1CYI A;  3H1K D;  1JDL A;  5KAF V;  4WQC A;  4H0K A;  5CIC B;  1CRC A;  1KB0 A;  2BPB B;  3X39 A;  2GB8 B;  4NFG B;  3OCD B;  1CIG A;  3DR0 A;  3SLE A;  1FI9 A;  4LJI A;  2PCB B;  4QAO A;  2LIT A;  3ZIY A;  1FCD C;  2XTS B;  3JBT B;  1KX7 A;  1RAQ A;  2Q3E A;  1CHJ A;  5C0Z A;  1YCC A;  3A9F A;  1E29 A;  3ZOX A;  1CRJ A;  3H1J D;  5B6Q A;  1QL3 A;  3PXS A;  2BGV X;  4EID A;  1IRV A;  4YE1 A;  3OCD A;  1E2R A;  1CIH A;  1DW3 A;  3M97 X;  4Q5P A;  1L9B C;  4FAV A;  1LFM A;  2DVH A;  1I54 A;  2Y0C A;  3TYI A;  3L71 D;  4K3I A;  5KKZ B;  5DF5 A;  1SQB D;  3PRJ A;  2A06 D;  1AYG A;  5B66 V;  1GKS A;  1KYO D;  1M6Z A;  1W5C T;  1C2N A;  3CX5 W;  1NTK D;  4WQ9 A;  4P4Q B;  2VHD A;  4EDF A;  1YEB A;  4EIC A;  1H31 B;  4KMG A;  3ZCF A;  1NTM D;  3PXW A;  1N9C A;  5CIH B;  1KYO W;  1HJ4 A;  2C1D B;  3RN0 A;  2D0W A;  4A7P A;  2BH5 X;  2IBZ D;  5DJQ C;  1N90 A;  3O1Y A;  2OZ1 B;  2AIU A;  2PAC A;  1DW0 A;  3L4O A;  1GDV A;  4Y5R A;  1M70 A;  1I55 A;  1H31 A;  2GC4 D;  1KX2 A;  4UB6 V;  4FA5 A;  3FWL A;  3L75 D;  3TDK A;  4AAN A;  4RJT A;  2Y0D A;  1K3H A;  2C1U A;  3WUI A;  3H1H D;  1COR A;  1AKK A;  3H1I D;  3CU4 A;  2C8S A;  4O1W A;  3WC8 A;  2OZ1 A;  3CYT I;  2N3B A;  2N9J A;  2I8F A;  4FB1 A;  3BCC D;  4N0K A;  3A0H V;  4V2K A;  2QJY B;  2CA3 B;  1C6R A;  3GG2 A;  1COT A;  3PHL A;  2L91 A;  3ZOY A;  1CED A;  3ITK A;  1YIQ A;  3CXH W;  1NMI A;  1IZL 0;  2ZON G;  1AOQ A;  1W2L A;  3RN1 A;  1FOC A;  1BCC D;  4EIF A;  1CSU A;  1SQP D;  1ETP A;  2QG4 A;  3CP5 A;  2GC7 D;  1YTC A;  3TF5 A;  3HQ6 A;  3MK7 B;  1LC1 A;  1CRI A;  1N50 A;  5CYT R;  4IL6 V;  4AAM A;  3WFE C;  1A56 A;  4XYD B;  1CNO A;  1CCH A;  4L1Q A;  1FI3 A;  1CSV A;  2FYU D;  2FRC A;  1FI7 A;  2RMZ A;  4WQD A;  3WU2 V;  1CO6 A;  1F1F A;  1BE3 D;  3PTZ A;  5KLV D;  2ORL A;  3H1L D;  1NTZ D;  4O1Q A;  1MG3 D;  1LMS A;  3C2C A;  1H33 B;  1CRG A;  2EXV A;  2ZXY A;  1CTJ A;  1YIC A;  2AXT V;  2C2C A;  2L4D A;  1C6O A;  5DFS A;  1ZZH A;  3HQ9 A;  1CSX A;  4PD4 D;  1S5L V;  2V07 A;  1N15 A;  1CRY A;  3ZBM A;  4D6T D;  3VYM A;  3KZI V; 
#chains in the Genus database with same CATH topology
 2E76 D;  3CD6 P;  3A0H H;  2N9I A;  3AEG C;  1H33 A;  3Q5R A;  3MUD A;  1DVH A;  3OW2 O;  3M0A A;  4JQ0 D;  3MZW B;  2KS1 B;  3VMY A;  1BCC E;  1H0T A;  5IY5 1;  1SQP E;  2C9L Y;  2OGU A;  2O1J A;  1CYC A;  2ZT9 C;  1FHB A;  1FBM A;  4WY4 C;  5APW A;  2KNC A;  3GLM A;  2AEJ A;  3AE4 C;  2WPS A;  1CSB A;  5AVX B;  2DGE A;  3VNW A;  4GT1 A;  1DVV A;  2N1T D;  3KHU A;  3S1K A;  4WQ7 A;  4WQA A;  2C1D A;  1HJ5 A;  4WY4 A;  2FKW B;  4L3H A;  3TGU D;  5AW2 B;  5DJT B;  4OWF A;  1L4A C;  4H0J A;  1L0N K;  2QJP B;  3HTK A;  4D6T E;  1KV9 A;  1FZE A;  2FYU G;  1RF1 B;  1T3J A;  2JR8 A;  1KQL A;  1BE3 G;  1VQ9 P;  2QSI A;  1S2E A;  3AE5 C;  3AEC C;  3OA8 A;  3VYI A;  3NWV A;  1VYD A;  1Q90 D;  2ZVN B;  3B5N D;  451C A;  1EDI A;  3HUS B;  3Q1M A;  2N18 C;  1Z56 A;  1GU2 A;  1RAP A;  2E75 D;  1MFT A;  4PV1 C;  5B5E E;  5TIS H;  5GTH V;  1S72 P;  2B87 B;  1WVE C;  3L70 E;  1NU1 D;  3MK7 C;  1VL2 A;  3A5T A;  1FZF A;  3L73 E;  2ZZS 1;  2JKV A;  1L9J C;  1J3S A;  3CCL P;  3KDP B;  1EZV E;  3WFB C;  2NPS D;  4DY9 A;  2N3Y A;  1DEB A;  3LW5 J;  4IFD K;  1H32 B;  3UIA A;  1LS9 A;  3CWB D;  4ZNC A;  3RLM A;  1HZV A;  1JB0 J;  2BCC J;  2YCC A;  3U1C A;  3P7K A;  1VQO P;  2AI5 A;  3RL0 g;  2E76 B;  1EXJ A;  1DD4 A;  3EWK A;  2B10 B;  4WVZ A;  1RZ5 A;  1GQ1 A;  5AW9 B;  1HZU A;  2H88 C;  3O0R C;  1JCD A;  1MZ4 A;  3L72 D;  3E1R A;  4WQ8 A;  1C6S A;  3N7N A;  3CPW O;  1VF5 C;  3RL0 D;  1BGY J;  1Y47 A;  3SXT A;  1GJQ A;  3DMI A;  1S5L E;  1SFC C;  5CHX A;  1EZV D;  2Z5I A;  2CE0 A;  1GK4 A;  3I5C A;  1SQP K;  4U3F D;  2N1T B;  2E5T A;  2ZYD A;  3SWK A;  2OYI C;  3O5C A;  1CCR A;  2PFX A;  4HJG H;  4I1L A;  1LTG C;  1PP9 G;  5AVZ B;  2HYN A;  5APS A;  1SQQ E;  3HQ8 A;  1ZN5 A;  1KD1 Q;  3A0B V;  2N9Y B;  2K3R A;  2OYI A;  1PPJ E;  2E42 A;  2MTA C;  2KSE A;  1S6V B;  3USS A;  3B5N B;  2P1J A;  1SQX D;  2Z4E A;  3L74 G;  5CIB B;  2YIU C;  2E75 B;  1L0N G;  1KZU B;  1IK7 A;  1L4A D;  1P84 D;  5M1B A;  2HV4 A;  3TNU A;  3LID A;  5C9M A;  1W2B O;  2QVA A;  2R44 A;  1GL2 C;  3H1K D;  5AW1 B;  1T2K C;  2NPS B;  2JWD A;  1NTK K;  1R5L A;  1JDL A;  4GIF A;  2KP8 A;  4WQC A;  2I1J A;  5CIC B;  1CRC A;  1KB0 A;  2L5G B;  1QVF O;  4NFG B;  3T97 B;  4PV1 D;  1X0T A;  1NAY A;  1IFP A;  2LIT A;  5C0Z A;  3A9F A;  1E29 A;  3F89 A;  5B6Q A;  4IL6 E;  3AEB C;  4Q5P A;  1Q82 Q;  1L9B C;  4FAV A;  1Y9B A;  1GZL A;  1QX8 A;  3L35 A;  2JO1 A;  2ITA A;  1P84 I;  5APX A;  5B5E H;  3RL0 B;  3M9B A;  2Q9I A;  3G71 P;  1FU1 A;  5CBN A;  1N7S C;  1M7L A;  5AW5 B;  3IR9 A;  3TK1 A;  2AXT E;  4GOD A;  2GM4 A;  1M6Z A;  3H1H G;  3H1J J;  3CX5 W;  2FBW C;  3KZI E;  1G1I A;  1GU5 A;  4P4Q B;  4AYC A;  1YEB A;  3JSV C;  4YTP C;  1H31 B;  1VF5 D;  2A45 I;  3U1A A;  1NTM D;  3Q5S A;  1KYO W;  2KK7 A;  2C1D B;  1QLE D;  4BRY A;  4U7J A;  1USD A;  3L71 J;  1SFC D;  1SQB J;  1DW0 A;  3HTK B;  1J1D C;  1N73 C;  1ZV8 A;  3HE4 A;  4UB6 V;  3HRN A;  2VRS A;  2YMK A;  4AAN A;  3AE6 C;  4UB8 E;  1K3H A;  5KAI E;  4PD4 I;  5AW7 B;  1AKK A;  3W67 A;  2YO3 A;  2OZ1 A;  1BDC A;  3CYT I;  2N9J A;  4EIJ A;  4C7N A;  2I8F A;  1L4A B;  3L4F A;  2FFD A;  4L75 A;  3II6 A;  3R2P A;  1RE4 A;  1H89 A;  2CA3 B;  1KYO E;  1DD3 A;  2J59 M;  3H1L G;  3BRV B;  1VQK P;  1C6R A;  1IO4 A;  2L91 A;  3A0B E;  1IZL 0;  2YXR B;  3VP8 A;  2R3S A;  4GOF A;  1LTI C;  3CCS P;  1CSU A;  3BVH A;  1IFN A;  1X79 B;  1D7M A;  2OYH C;  1YTC A;  3H1I J;  3TF5 A;  3GF3 A;  3MK7 B;  4W7Y A;  3TGU J;  2WT7 A;  1GL2 D;  2FY8 A;  2HPC B;  4WBA A;  1NTK G;  1A56 A;  4XYD B;  1NGM B;  3R4Y A;  4QMA A;  1MUU A;  1FS0 E;  1VQ7 P;  2W6B A;  4XA4 A;  2FYU D;  1GU4 A;  1FI7 A;  2RMZ A;  1BE3 D;  1HF9 A;  2ZXE B;  3Q5P A;  1MG3 D;  3PJS K;  4NPD A;  1BCC J;  1LT1 A;  1QL2 A;  2C2C A;  2OAR A;  3WUT A;  2WPR A;  3BCC E;  1CSX A;  2V07 A;  4I2L C;  3L75 G;  4Y28 J;  3BAS A;  1EB7 A;  1QVG O;  1QEX A;  4H0L C;  2J58 A;  3HD7 C;  2C9X B;  1JTH B;  1RQU A;  1VF5 B;  2P10 A;  1LTJ A;  1H9X A;  1QL4 A;  1G2C A;  4L3G A;  1N7S D;  2E5Y A;  2KOG A;  3CCV P;  2GA1 A;  3HD7 A;  4IL6 H;  1SFC B;  2XND H;  2GIW A;  3SWS A;  5CIF B;  5E79 V;  1M56 D;  2JTI B;  1RZ6 A;  4NPE A;  1JY3 P;  1HGZ A;  3QWO C;  2OYI B;  5KLV E;  3CC4 P;  3L72 J;  2J5U A;  3OA7 A;  2BLF B;  5AUR A;  1RE3 C;  5EFW B;  1CSW A;  2WVR A;  1NIR A;  1CI6 A;  2AXT H;  4EIE A;  2CE1 A;  2HOD A;  2I8D A;  3GF7 A;  3VMZ A;  3L70 J;  5H2F V;  3V5B A;  2FWL A;  2QJY C;  1YQ4 C;  3TNU B;  3KZI H;  4IFM A;  5AVS B;  3B71 A;  1H88 A;  4K3A A;  1UIX A;  4U3F J;  4AAO A;  2HG5 D;  2JEE A;  3M0D A;  4J20 A;  3HE5 B;  2M0B A;  1GIW A;  1BL9 A;  3P8C D;  1FJK A;  4H13 C;  2D0S A;  2WSF J;  3KYQ A;  1GL2 B;  2E43 A;  2H43 A;  1JCC A;  1OCD A;  4FA4 A;  2XU6 A;  1PP9 D;  1M1J C;  4WB4 A;  4UB8 H;  2LXC B;  5KAI H;  1HH7 A;  1N2D C;  1KQG B;  2YXQ B;  2LIR A;  4BWN A;  4L73 A;  351C A;  3HQ7 A;  2IFN A;  3MUD C;  1EQ7 A;  4FA9 A;  1Q7Y Q;  2M5A B;  1M1J A;  1DII C;  3L74 D;  1KYO H;  5AVY B;  3VMA A;  1VQL P;  1L0N D;  2H89 C;  1YNR A;  1K8A Q;  3A0B H;  2JQR A;  4XE5 B;  2M8R A;  3H1K J;  2V4H A;  5AW4 B;  3ORV A;  1SS1 A;  4YXD C;  1I6E A;  5TJH A;  3WMM 0;  5AW8 B;  4LC1 A;  4JCG A;  1RQV A;  1IFM A;  4GYD A;  2QRX A;  1SQV G;  1L0L E;  3V4Q A;  3GMA A;  1I8O A;  1NU1 E;  5KLI C;  1N7S B;  1LWU A;  1HJ0 A;  2IYP A;  4BRY B;  1CC5 A;  1HH0 A;  1SQQ J;  2IZ1 A;  4H0L D;  3F5H A;  1NNO A;  1IFJ A;  3SFE C;  1TU3 F;  2WMM A;  1DW1 A;  2BCC G;  1H1O A;  1YEA A;  4XXL A;  5AW3 B;  1URQ C;  1OFC X;  1Q2N A;  1I8P A;  3CWB E;  2B9B A;  3IFM A;  1PZQ A;  1G1J A;  4W80 A;  2O1K A;  1CHH A;  5CMZ A;  1HRO A;  3V6I A;  4PJ0 V;  1J1D B;  2HLO A;  1N73 B;  1PV3 A;  3SFD C;  1URQ A;  1UII A;  2MHM A;  1OWA A;  2O3J A;  2IDB A;  4GED B;  5KJ7 D;  1BGY G;  3G6E P;  1Y8A A;  5APY A;  3CCE P;  3CXH D;  3L72 E;  4DOJ A;  1KB9 D;  4HB1 A;  1J1E C;  1Q86 Q;  3RGU A;  3ZDM A;  2YMY A;  1H8A A;  1L0L D;  1I5T A;  1SQB K;  3BRT B;  3O8Z A;  4R4L A;  3LIE A;  4PW9 B;  1LP1 A;  4TT3 H;  3E7K A;  2YQB A;  2ZYA A;  3ABV C;  1OW8 A;  1LJ2 A;  4C7R A;  4DCK A;  5H2F E;  5KAF V;  1YTZ I;  4U3F E;  1PL5 A;  4HKZ H;  3V2R A;  2OYH B;  2K9J A;  5APQ A;  1CIG A;  1NWQ A;  1BSN A;  4H13 D;  2IX7 C;  3CI9 A;  4DJG A;  5BVZ A;  5K5G B;  2PCB B;  1FCD C;  2XTS B;  1LTA C;  2Q3E A;  1CHJ A;  1E79 H;  4Z1M H;  2FYZ A;  1QL3 A;  2Z5H A;  3NTN A;  1IRV A;  4YE1 A;  3OCD A;  5CBO A;  2K1A A;  3CXH I;  1NYH A;  2AXC A;  1CIH A;  3M97 X;  1NJI Q;  1VQP P;  1FZC A;  1KB9 I;  3W68 A;  2FYN C;  1SQX E;  2H7H A;  2N9B A;  5AVQ B;  1LFM A;  1RHZ B;  3WU2 E;  1I54 A;  5CJ0 A;  1P84 E;  3D70 A;  4HH2 A;  4K3I A;  2POH A;  2A06 D;  1AYG A;  5B66 V;  1BDD A;  2QA4 P;  3RBX A;  1X8Y A;  3H1K E;  4H0L B;  1T3U A;  4GKG A;  1W5C T;  1GTW A;  1C2N A;  2LR2 A;  1NTK D;  4WQ9 A;  2QJK C;  1M57 D;  1BE3 J;  4EIC A;  3M91 A;  3ZCF A;  1K73 Q;  5CIH B;  2ZT9 D;  1NU1 K;  3O6Q B;  3RN0 A;  1EDJ A;  4WY4 D;  3CCR P;  1AQ5 A;  2MJZ A;  3L36 A;  4GOE A;  3L4O A;  1CI6 B;  4Y5R A;  1NKN A;  1MZ9 A;  2HOD B;  1I55 A;  1U57 A;  3EQ2 A;  1ZR2 A;  2GC4 D;  1KX2 A;  1KIL C;  2YKP A;  1IZN B;  3L75 D;  3TDK A;  4KT0 J;  1HUC A;  1JY3 N;  2WPV B;  2KIK A;  4O1W A;  3WC8 A;  1YIT P;  2N3B A;  4KHX A;  3CME P;  4FB1 A;  3H1J G;  4DZO A;  3L37 A;  3A0H V;  1KIL A;  4V2K A;  2QJY B;  5APU A;  1RY3 A;  1VQN P;  3ZOY A;  1CED A;  1NMI A;  1NOH A;  1JY2 N;  2Y9Y A;  1AOQ A;  1W2L A;  1HVV A;  1NAF A;  3AE7 C;  4EIF A;  1AFO A;  3L71 G;  3FWN A;  3RK3 C;  2GC7 D;  1NTM E;  4YXW H;  4O9B A;  2MKV A;  1SQB G;  3GHG A;  4H13 B;  2NZ2 A;  3HQ6 A;  1CRI A;  4IFF A;  4ZKP A;  3BCC J;  1M1J B;  1CNO A;  2D2C C;  4AQR D;  1N86 A;  4L1Q A;  2ZXX A;  5GTH E;  4RES B;  3H32 B;  1LTB C;  4JYC A;  1NTZ D;  3VTP C;  4WWI A;  1LMS A;  1RF0 C;  3A2A A;  2BEZ F;  3AE2 C;  1H33 B;  4TLF A;  1L2P A;  2IBZ G;  2EXV A;  1CTJ A;  2KI7 B;  5CCG C;  2L4D A;  5DFS A;  3CC2 P;  1FJP A;  1BSH A;  1SLQ A;  2ZVO B;  1H0T B;  1IC2 A;  2W83 C;  4PD4 D;  1N15 A;  4I7Z C;  1HTL C;  3FWL A;  1NVO A;  2QIW A;  5KKZ C;  2FXP A;  1S3J A;  3OJA B;  5H2F H;  1R8E A;  1RF0 A;  2WZ7 A;  4JPZ B;  5CJ4 A;  2JP3 A;  2KSJ A;  3H1I G;  1AVO A;  4B86 A;  1JMB A;  5CCG A;  4C46 A;  4IOI H;  2BEQ D;  3TGU G;  2KNC B;  1YHQ P;  4LLH A;  1FDM A;  1KFM A;  4YPC A;  4XFJ A;  5KLV J;  2YK3 A;  5TIS V;  2WSF H;  2ZT9 B;  2O01 N;  1KTM A;  2KLU A;  1AOF A;  4WY4 B;  3PXT A;  1KIB A;  2KS1 A;  2Y0E A;  1CXC A;  1CIF A;  1WT6 A;  1KN7 A;  1BCC G;  2FYU E;  5B66 E;  1SQP G;  3CCQ P;  2FFD C;  2C0W A;  1AVY A;  1AA0 A;  1RE4 C;  1BE3 E;  1S4X A;  3QH9 A;  4ASV A;  1LC2 A;  3WU2 H;  2Q3I A;  4ZMD A;  1P84 H;  3OA8 B;  1YQ3 C;  2QM8 A;  5AVV B;  3CCU P;  1SP4 A;  2RH0 A;  1SQQ K;  3CCJ P;  3VP9 A;  1SQV D;  1USE A;  2G3A A;  1ZW0 A;  1S5L H;  2Q5U A;  3WFC C;  2IYO A;  5CID B;  1M90 Q;  1QKS A;  2XNX A;  4JF7 A;  1LGH B;  3D6Y A;  3N4X A;  3S9O A;  2B12 B;  1DH3 A;  2N18 B;  4NPF X;  5CCH A;  2WPQ A;  2A45 H;  2BCC D;  1J1E B;  1RF1 A;  4D6T G;  1PFI A;  1R0Q A;  4PV1 B;  1CRH A;  2ZBO A;  1IFD A;  3V2P A;  4K35 A;  1VQ6 P;  1U75 B;  2IFM A;  1MG2 D;  1A2S A;  1NO4 A;  1HJ3 A;  3L72 G;  3HUS A;  1T2K D;  1A02 F;  3AED C;  1CTZ A;  2G8Y A;  1NTM K;  3RK3 D;  2B87 A;  1WMK A;  3E1I A;  2K37 A;  2B11 B;  3NFQ A;  1FZA A;  3L70 G;  4DT0 A;  5APT A;  3WUU A;  1BGY D;  3L73 G;  1L0L J;  2DW3 A;  3FXD A;  1EZV G;  1K05 A;  1KOR A;  2D2C D;  1NU1 J;  4PWA A;  1YBK A;  1H32 A;  1LTJ C;  1C2R A;  3AEE C;  5BU8 B;  5GTI V;  3JCU E;  3NMD A;  5DJU B;  3IAO A;  3AEA C;  2FYN B;  3OAK A;  1ZOY C;  4EI2 A;  3L4M A;  3CX5 D;  1GK6 A;  1S9K D;  2K88 A;  4BXL A;  3CWB J;  3P8C E;  1NHL A;  1C7M A;  2PGD A;  5GTH H;  1JY3 O;  3NBS A;  1PP9 E;  1QYZ A;  1DIQ C;  2QJK B;  2RKL A;  1QN2 A;  1DEE G;  1FZB A;  155C A;  2N1T C;  4WQB A;  2W8Z A;  2IZ0 A;  1GDT A;  3Q3D A;  2XKM A;  3L74 E;  2LXB A;  1FDI A;  1L0N E;  5EXQ A;  2W6J H;  4RO0 A;  1M60 A;  1OAE A;  3M0D C;  1EC5 A;  2FYU K;  2N1T A;  4OGQ C;  1CTY A;  2BCN B;  3AE3 C;  3CX5 I;  1JY2 P;  1YFC A;  4AAL A;  3B5N C;  5B5E V;  5AVU B;  2YIU B;  4UB6 E;  5CIE B;  3H6P A;  1FOS E;  1SQQ G;  1KYO I;  1HWT C;  1VQM P;  4RSZ A;  1VPC A;  3M06 A;  1PPJ G;  1AV1 A;  4L76 A;  1S5L X;  5B66 H;  3B5N A;  1X9V A;  4M3L A;  3B8E B;  1PGJ A;  4KJM A;  1AJY A;  3B4S A;  3MHV A;  4H0K A;  1NH4 A;  2C0X A;  3RK3 B;  3G9R A;  3BAT A;  1SQX J;  1KQS O;  2W90 A;  3SLE A;  1FI9 A;  4EOT A;  4I6M C;  2NPS A;  1HBW A;  4QAO A;  1YJN P;  1KX7 A;  2D2C B;  1RAQ A;  1A02 J;  3WUV A;  3ZOX A;  3H1J D;  2FXM A;  1U7J A;  2XDJ A;  2BGV X;  2WSC H;  4GDO A;  3NXS A;  3T97 A;  1DW3 A;  1LWU C;  2ZFC A;  3CXH E;  3AE8 C;  3CMA P;  2W6A A;  1KB9 E;  1LTT C;  3RL0 C;  1IFI A;  2Y0C A;  3TYI A;  3L71 D;  1YYC A;  4I7Z B;  5KKZ B;  3FGA D;  1LNQ A;  5DF5 A;  1SQB D;  5AVR B;  1OXZ A;  1FAV A;  3PRJ A;  1LT9 C;  1GKS A;  1YTZ T;  2OQQ A;  1XTG B;  2O01 H;  3HD7 D;  1FE6 A;  5GTI E;  4EDF A;  2B89 A;  1NTZ J;  1JEK A;  4HYT B;  3HE4 B;  4OH8 B;  1N9C A;  2SPZ A;  1LT9 A;  1HJ4 A;  1T6A A;  2D0W A;  1JUN A;  2BH5 X;  2IBZ D;  5DJQ C;  1GW4 A;  2KB7 P;  1FDO A;  1ZLL A;  2OZ1 B;  2AIU A;  2PAC A;  1W2E A;  1X22 A;  3MIW A;  3JCU H;  4C7N B;  1M70 A;  4IL6 X;  2FFD B;  3C1L A;  1H31 A;  2AEM A;  3H1L E;  2QEX P;  5KLV K;  4RJT A;  3WUI A;  5E79 E;  3H1H D;  3H1I D;  3CU4 A;  2C8S A;  4N6J A;  3SWY A;  2ZYG A;  4CPG A;  1NTM J;  1SVF A;  1GMJ A;  1YJW P;  2ZAE B;  3M9Q A;  2A06 E;  4OGQ D;  3V2N A;  1COT A;  3PHL A;  2WT7 B;  3H25 A;  1NTK E;  2OTJ P;  1L4A A;  1FOC A;  3IF4 A;  5BU5 A;  1BCC D;  1N8R Q;  1SQP D;  1ETP A;  4ASW A;  2IBZ I;  5AW6 B;  1W5C E;  2M3B A;  1N50 A;  5CYT R;  4IL6 V;  5AVW B;  1FZC C;  2YO2 A;  1K9M Q;  1HJB A;  1SQV J;  2B88 A;  1CCH A;  1FI3 A;  2FRC A;  4R4M A;  4WQD A;  3L75 E;  1CO6 A;  4W7Z A;  1F1F A;  2YKQ A;  4UB6 H;  2V7Q J;  2ORL A;  3H1L D;  4O1Q A;  2HPC A;  1DIP A;  2ZXY A;  1YIC A;  3RK2 C;  2AXT V;  1ZZH A;  2HFE D;  3ZBM A;  2KUB A;  4D6T D;  1LTJ B;  3KZI V;  2CPB A;  3IN6 A;  2H8P D;  1WRG A;  1G2C B;  3Q2Y A;  3VMX A;  3HD7 B;  3CLQ A;  2FYU J;  3G3Z A;  1DX7 A;  2P67 A;  1CHI A;  2R3C A;  3BCC G;  5L8R J;  2JWA A;  1L0L K;  3GW6 A;  1JNM A;  2GUS A;  1IO3 A;  2WSE H;  3L70 D;  4Y99 C;  3V4W A;  1FOS F;  3L73 D;  3SWF A;  3VRD A;  4UB8 V;  2Q6Q A;  3K5B A;  5KAI V;  1IJD B;  1JTH A;  1H9Y A;  3CXH H;  3AE1 C;  1YJ9 P;  2B4Z A;  4WQE A;  1C52 A;  2E74 C;  1NTZ E;  1KB9 H;  1URQ D;  2WSC J;  1N7L A;  2R5D A;  1SFC A;  1ZRT E;  1FJ0 A;  4PD4 E;  1DW2 A;  1IQC A;  4OGQ B;  4AX3 A;  4N78 E;  3AE9 C;  3V2Q A;  3GHG C;  5KLV G;  5GTI H;  4PJ0 E;  2CXB A;  1ZME C;  3D6Z A;  3PP5 A;  4FA1 A;  3KQG A;  2PCC B;  3FXE A;  4OVN F;  2O01 J;  2RN0 A;  1M1K Q;  4MU8 A;  3DP5 A;  3FX0 A;  2P2U A;  3NBT A;  1AQT A;  4H44 C;  1OVU A;  5KTB A;  1EZV I;  3AEF C;  2QE7 H;  1IRW A;  1KV4 A;  3MP7 B;  1OW6 A;  1VDF A;  2GUV A;  5APV A;  1EDK A;  3PH2 B;  3WFD C;  5E79 H;  3SVW A;  1OW7 A;  3HE5 A;  3S4R A;  1DT1 A;  1WEJ F;  1J2J B;  1GL2 A;  3O20 A;  1E8E A;  5KAF E;  3KXD A;  2B0Z B;  1ZRT D;  1SQV E;  2PAJ A;  3RBZ A;  1SQQ D;  1QGK B;  3PLN A;  1KIL E;  5AW0 B;  4FAN A;  1PPJ D;  4N78 D;  1U74 B;  1LWU B;  1PP9 J;  1F1C A;  3VN0 A;  2CA4 B;  2HR3 A;  1KC8 Q;  1GD2 E;  2M5A A;  1SQX K;  1CIE A;  2YNY A;  3RK2 D;  1HGV A;  2BCC E;  2PRR A;  1FZG A;  5KLI B;  1LT9 B;  2C1V A;  2P58 A;  1VQ8 P;  3L74 J;  1U7M A;  1L0N J;  3SSU A;  1ZXG A;  1C75 A;  1B7V A;  4EYY Q;  2V08 A;  3RMZ A;  2XZR A;  1L0L G;  3RK3 E;  3EFG A;  2OYO A;  2QM7 A;  1URQ B;  1N7S A;  2BAS A;  1NU1 G;  2KZJ A;  3KPE A;  1BGY E;  4RKU J;  3TYY A;  2CPS A;  5DJQ B;  1A8C A;  3ZOO A;  1NML A;  1MFZ A;  2CK3 H;  1GW3 A;  4ZKU A;  1CZQ A;  5CCH C;  1HRC A;  2QJP C;  2ZOO A;  1JM0 A;  1NKZ B;  1RF1 C;  3TSI A;  1K3G A;  1JMM A;  3P32 A;  1CXA A;  1ZR4 A;  1I6D A;  1KIL D;  1NTZ K;  2E74 D;  3CWB G;  1LP1 B;  2WQY C;  1K04 A;  1CYJ A;  3CX5 E;  2WTY A;  3HUS C;  5CIG B;  1S9K E;  3U59 A;  1MV8 A;  3SJL A;  2BH4 X;  1N73 A;  3I55 P;  2JJL A;  1JO5 A;  2I1K A;  2K9J B;  2K9Y A;  1EXI A;  2KYV A;  1HCM A;  3ZOW A;  1JOC A;  1CYI A;  1KMI Z;  1ZP0 C;  2WSE J;  3A0H E;  2P7J A;  4MN4 C;  2Q1K A;  1XTC C;  3G4S P;  2BPB B;  3EFF K;  1PGQ A;  3H1H J;  3X39 A;  2GB8 B;  3OCD B;  2KXP B;  2A06 G;  4PD4 H;  4H44 D;  3DR0 A;  1FZC B;  4LJI A;  2M3E A;  3MD0 A;  3ZIY A;  3JBT B;  1VQ5 P;  2IPP A;  5AVT B;  3D71 A;  1PGO A;  1YCC A;  1CRJ A;  1OVV A;  4U3F G;  4LGD E;  2W27 A;  2OYH A;  3PXS A;  2E76 C;  4PJ0 H;  4EID A;  4N3Y B;  2NRG A;  1E2R A;  2KLV A;  1S1C X;  3JC2 2;  1SQP J;  3RK2 B;  3C9I A;  2DVH A;  2R5B A;  5CCG D;  3A7O A;  1OMI A;  1SQV K;  2C9N Y;  3CCM P;  3M9H A;  1KYO D;  1Q81 Q;  2JDI H;  1SQX G;  1OZH A;  1EDL A;  2VHD A;  2XV5 A;  3H1L J;  5KAF H;  4KMG A;  1VQ4 P;  3PXW A;  1OX3 A;  4Y99 B;  3C8V A;  4A7P A;  3H1K G;  2WSS H;  1N90 A;  3O1Y A;  2ZJS E;  5TIS E;  2YKO A;  4D6T J;  1JY2 O;  2WIT A;  3LW5 H;  2AEF A;  3H1J E;  1GDV A;  4AUW A;  1PIX A;  2V7Q H;  1RH5 B;  4FA5 A;  1KIL B;  2E74 B;  2PP6 A;  3O6Q A;  5KJ7 C;  2Y0D A;  1NTK J;  2C1U A;  1COR A;  2A45 G;  2Q7C A;  1QL1 A;  1FC2 C;  3I56 P;  1OVR A;  3L71 E;  2E75 C;  5CCH D;  3BCC D;  1YIJ P;  1SQB E;  4N0K A;  1R5S A;  3L73 J;  3GHG B;  5KJ7 A;  1E5W A;  1NTZ G;  3D0W A;  3GG2 A;  2OTK E;  1PGP A;  2Y9Z A;  1RE3 A;  1YI2 P;  3ITK A;  1YIQ A;  3CXH W;  2NPS C;  2ZON G;  2FXO A;  1OIP A;  4L74 A;  3CC7 P;  3RN1 A;  3P8M C;  3L75 J;  3CL3 D;  2QG4 A;  3CP5 A;  2LKM A;  1KFN A;  4H44 B;  1KQF B;  1LC1 A;  2IBZ E;  2KZI A;  1T8Z A;  4JYB A;  1LTS C;  4AAM A;  1M8O B;  5C39 A;  3A3Y B;  3WFE C;  2UWJ E;  1MKM A;  1CW5 A;  4JBZ A;  1CSV A;  2OTL P;  3CX5 H;  3VOP A;  3WU2 V;  1NTM G;  3PTZ A;  5KLV D;  3H1H E;  3C2C A;  1IK9 A;  3MGN A;  3H1I E;  1CRG A;  3MTU E;  2R32 A;  3PH0 A;  3TGU E;  1C6O A;  2WWW A;  3HQ9 A;  1S5L V;  1CRY A;  3H32 A;  3VYM A; 
#chains in the Genus database with same CATH homology
 2N9I A;  1EB7 A;  1H33 A;  1DVH A;  2KNC B;  2C9X B;  5IY5 1;  1CHI A;  2YK3 A;  2JWA A;  3GW6 A;  5TIS V;  1CYC A;  1H9X A;  1IO3 A;  1AOF A;  1QL4 A;  4L3G A;  1FHB A;  3L70 D;  3L73 D;  3VRD A;  3PXT A;  1KIB A;  2GIW A;  4UB8 V;  3SWS A;  2KS1 A;  2Y0E A;  5CIF B;  1CXC A;  1CIF A;  5KAI V;  5E79 V;  2JTI B;  1RZ6 A;  1H9Y A;  2DGE A;  3VNW A;  2B4Z A;  4WQE A;  1DVV A;  1C52 A;  3KHU A;  4WQ7 A;  4WQA A;  1LC2 A;  2C1D A;  1HJ5 A;  2BLF B;  5AUR A;  3OA8 B;  4L3H A;  1CSW A;  1FJ0 A;  3TGU D;  1NIR A;  1DW2 A;  4EIE A;  2CE1 A;  4H0J A;  2QJP B;  1SQV D;  1KV9 A;  1IQC A;  5H2F V;  4AX3 A;  2FWL A;  3WFC C;  5CID B;  1QKS A;  3OA8 A;  3NWV A;  1VYD A;  2CXB A;  451C A;  2B12 B;  4AAO A;  4FA1 A;  2N18 B;  2N18 C;  2PCC B;  1GU2 A;  2RN0 A;  1RAP A;  2BCC D;  4MU8 A;  3DP5 A;  4J20 A;  1GIW A;  1BL9 A;  1R0Q A;  3NBT A;  5GTH V;  1CRH A;  1WVE C;  1NU1 D;  2D0S A;  2ZBO A;  3MK7 C;  1U75 B;  2ZZS 1;  1IRW A;  1MG2 D;  1A2S A;  1L9J C;  1J3S A;  1HJ3 A;  1OCD A;  4FA4 A;  1PP9 D;  3WFB C;  3PH2 B;  3WFD C;  4DY9 A;  1HH7 A;  3SVW A;  2N3Y A;  1CTZ A;  1H32 B;  2LIR A;  1DT1 A;  1WEJ F;  351C A;  3HQ7 A;  1LS9 A;  2B11 B;  3O20 A;  3CWB D;  1E8E A;  1BGY D;  3RLM A;  1HZV A;  4FA9 A;  2B0Z B;  1DII C;  2YCC A;  1ZRT D;  3L74 D;  3VMA A;  1SQQ D;  1L0N D;  2AI5 A;  4PWA A;  1H32 A;  1YNR A;  2JQR A;  1C2R A;  3PLN A;  2B10 B;  4FAN A;  5GTI V;  1PPJ D;  3ORV A;  1U74 B;  1RZ5 A;  1GQ1 A;  1I6E A;  1HZU A;  5TJH A;  1F1C A;  2FYN B;  2CA4 B;  3O0R C;  4JCG A;  1CIE A;  3L4M A;  1MZ4 A;  3CX5 D;  3L72 D;  4WQ8 A;  4GYD A;  1C6S A;  1C7M A;  1I8O A;  3SXT A;  5KLI B;  1GJQ A;  2C1V A;  3DMI A;  1CC5 A;  3NBS A;  1QYZ A;  1DIQ C;  1C75 A;  1NNO A;  1B7V A;  2QJK B;  2V08 A;  1EZV D;  1QN2 A;  2CE0 A;  3RMZ A;  1DW1 A;  1H1O A;  1YEA A;  4XXL A;  4U3F D;  155C A;  4WQB A;  3O5C A;  1CCR A;  1I8P A;  5DJQ B;  1A8C A;  3ZOO A;  1NML A;  1CHH A;  1HRO A;  3HQ8 A;  1HRC A;  5EXQ A;  2ZOO A;  3A0B V;  1M60 A;  1OAE A;  4PJ0 V;  2N9Y B;  1CTY A;  1K3G A;  1CXA A;  2MHM A;  2MTA C;  2BCN B;  1I6D A;  2O3J A;  4GED B;  1YFC A;  1S6V B;  4AAL A;  1CYJ A;  5B5E V;  3CXH D;  1SQX D;  2YIU B;  5CIB B;  5CIE B;  5CIG B;  1KB9 D;  3SJL A;  2BH4 X;  4RSZ A;  1L0L D;  1I5T A;  1P84 D;  2K9J B;  2HV4 A;  1HCM A;  4PW9 B;  5C9M A;  3ZOW A;  2YQB A;  1CYI A;  3H1K D;  1JDL A;  5KAF V;  4WQC A;  4H0K A;  5CIC B;  1CRC A;  1KB0 A;  2BPB B;  3X39 A;  2GB8 B;  4NFG B;  3OCD B;  1CIG A;  3DR0 A;  3SLE A;  1FI9 A;  4LJI A;  2PCB B;  4QAO A;  2LIT A;  3ZIY A;  1FCD C;  2XTS B;  3JBT B;  1KX7 A;  1RAQ A;  2Q3E A;  1CHJ A;  5C0Z A;  1YCC A;  3A9F A;  1E29 A;  3ZOX A;  1CRJ A;  3H1J D;  5B6Q A;  1QL3 A;  3PXS A;  2BGV X;  4EID A;  1IRV A;  4YE1 A;  3OCD A;  1E2R A;  1CIH A;  1DW3 A;  3M97 X;  4Q5P A;  1L9B C;  4FAV A;  1LFM A;  2DVH A;  1I54 A;  2Y0C A;  3TYI A;  3L71 D;  4K3I A;  5KKZ B;  5DF5 A;  1SQB D;  3PRJ A;  2A06 D;  1AYG A;  5B66 V;  1GKS A;  1KYO D;  1M6Z A;  1W5C T;  1C2N A;  3CX5 W;  1NTK D;  4WQ9 A;  4P4Q B;  2VHD A;  4EDF A;  1YEB A;  4EIC A;  1H31 B;  4KMG A;  3ZCF A;  1NTM D;  3PXW A;  1N9C A;  5CIH B;  1KYO W;  1HJ4 A;  2C1D B;  3RN0 A;  2D0W A;  4A7P A;  2BH5 X;  2IBZ D;  5DJQ C;  1N90 A;  3O1Y A;  2OZ1 B;  2AIU A;  2PAC A;  1DW0 A;  3L4O A;  1GDV A;  4Y5R A;  1M70 A;  1I55 A;  1H31 A;  2GC4 D;  1KX2 A;  4UB6 V;  4FA5 A;  3FWL A;  3L75 D;  3TDK A;  4AAN A;  4RJT A;  2Y0D A;  1K3H A;  2C1U A;  3WUI A;  3H1H D;  1COR A;  1AKK A;  3H1I D;  3CU4 A;  2C8S A;  4O1W A;  3WC8 A;  2OZ1 A;  3CYT I;  2N3B A;  2N9J A;  2I8F A;  4FB1 A;  3BCC D;  4N0K A;  3A0H V;  4V2K A;  2QJY B;  2CA3 B;  1C6R A;  3GG2 A;  1COT A;  3PHL A;  2L91 A;  3ZOY A;  1CED A;  3ITK A;  1YIQ A;  3CXH W;  1NMI A;  1IZL 0;  2ZON G;  1AOQ A;  1W2L A;  3RN1 A;  1FOC A;  1BCC D;  4EIF A;  1CSU A;  1SQP D;  1ETP A;  2QG4 A;  3CP5 A;  2GC7 D;  1YTC A;  3TF5 A;  3HQ6 A;  3MK7 B;  1LC1 A;  1CRI A;  1N50 A;  5CYT R;  4IL6 V;  4AAM A;  3WFE C;  1A56 A;  4XYD B;  1CNO A;  1CCH A;  4L1Q A;  1FI3 A;  1CSV A;  2FYU D;  2FRC A;  1FI7 A;  2RMZ A;  4WQD A;  3WU2 V;  1CO6 A;  1F1F A;  1BE3 D;  3PTZ A;  5KLV D;  2ORL A;  3H1L D;  1NTZ D;  4O1Q A;  1MG3 D;  1LMS A;  3C2C A;  1H33 B;  1CRG A;  2EXV A;  2ZXY A;  1CTJ A;  1YIC A;  2AXT V;  2C2C A;  2L4D A;  1C6O A;  5DFS A;  1ZZH A;  3HQ9 A;  1CSX A;  4PD4 D;  1S5L V;  2V07 A;  1N15 A;  1CRY A;  3ZBM A;  4D6T D;  3VYM A;  3KZI V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...