2BCCD

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGPLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSVREGLYFNPYFPGQAIGMAPPIYNDVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLVPLVYYMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
total genus 65
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2bccD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2bccD01
2MHMA 3O0RC 1HJ3A 1IRVA 5KKZB 3WUIA 1A56A 1N50A 3SJLA 4UB8V 3OA8B 3OA8A 3TGUD 1FI7A 4XXLA 5E79V 1KV9A 1LC1A 2DVHA 3A9FA 3L72D 5CIEB 3WFDC 1CRCA 1SQBD 2FWLA 1RZ5A 2QJYB 4PWAA 4WQ9A 3L75D 5CIDB 1VYDA 1MG2D 4Q5PA 4V2KA 3ZCFA 1KX2A 3O1YA 3CXHW 1GJQA 3RN0A 4FA5A 1GU2A 3ORVA 3L71D 2Y0CA 1H9XA 4AAOA 1I8OA 1RZ6A 1FI3A 4JCGA 1OCDA 3KZIV 2IBZD 4PW9B 1KYOW 4RSZA 2YCCA 4J20A 1L9JC 2N18C 3PRJA 1BCCD 1N15A 5GTHV 4AAMA 1H9YA 1P84D 1QKSA 3PLNA 1CYCA 2PCCB 4QAOA 4WQ8A 4YE1A 1GIWA 4WQCA 5CYTR 1CXAA 3H1KD 5C9MA 3M97X 2BCCD 4FA9A 3L70D 3ZOXA 1U75B 2C1UA 2QG4A 1ETPA 2CE1A 3WU2V 1H1OA 2FYUD 4L1QA 1YCCA 1BL9A 2N3YA 1GKSA 4AX3A 2JWAA 2B12B 1AKKA 2GC4D 4AANA 3CU4A 1CIEA 3ZOOA 1F1FA 1RAPA 3VRDA 1IO3A 3MK7C 2CA4B 4LJIA 3SLEA 1I8PA 3BCCD 5DFSA 1CSVA 3O5CA 1E29A 2B4ZA 2LITA 1HROA 1CXCA 1CORA 3H1ID 5DJQB 4DY9A 1YEAA 1FI9A 2CA3B 2Y0EA 1S6VB 3HQ7A 1YICA 4A7PA 1CEDA 1YIQA 3H1HD 2YQBA 1CSXA 3DR0A 1CHHA 3ZBMA 3SWSA 3PHLA 1A8CA 1CRIA 1CHJA 4EIEA 1QL3A 1HJ4A 1YEBA 3HQ6A 2C9XB 1HZUA 1CIGA 2PCBB 1NMLA 3PTZA 2KS1A 1ZRTD 4Y5RA 2Y0DA 5KLVD 2JTIB 3X39A 351CA 2ZONG 3CWBD 1CO6A 4L3GA 4EIDA 2CE0A 3WFBC 2YK3A 3PH2B 2I8FA 4WQ7A 2FYNB 1NNOA 1R0QA 1I55A 4MU8A 1IQCA 2YIUB 4EIFA 4O1WA 4NFGB 4PD4D 4WQDA 3SVWA 1LS9A 3PXTA 2AIUA 2CXBA 4WQEA 1M70A 5KAFV 2C1VA 1C6SA 2RMZA 4WQBA 1QYZA 1I5TA 3L74D 2RN0A 1CTYA 1N9CA 1NTKD 1QN2A 3GG2A 1JDLA 1DW3A 3SXTA 3NBTA 2GB8B 3GW6A 5TISV 3L73D 1AYGA 1C7MA 1HJ5A 1H31B 1H31A 4GYDA 3CP5A 5CICB 2GIWA 1CRGA 1NMIA 3PXSA 2OZ1A 5KAIV 2A06D 3FWLA 4U3FD 1FJ0A 1I54A 4FB1A 1HH7A 1WEJF 2K9JB 1E2RA 1COTA 1KB0A 2ZBOA 1LC2A 2BH4X 3A0BV 3WC8A 5B5EV 5CIHB 4GEDB 5IY51 1CIFA 1KX7A 4L3HA 1KIBA 4FANA 2V07A 2HV4A 1HCMA 2FRCA 1W2LA 1PPJD 2BCNB 2D0WA 4H0KA 1PP9D 2QJPB 2BH5X 4H0JA 3RMZA 4D6TD 4P4QB 1GQ1A 1DIQC 3NBSA 2V08A 3VMAA 1HZVA 1C2RA 1FHBA 1CCHA 3JBTB 1CRJA 1J3SA 3RLMA 2N9YB 3H1LD 1S5LV 3KHUA 1LMSA 5B6QA 2EXVA 3C2CA 1CC5A 2KNCB 1L9BC 3ITKA 5DF5A 3VYMA 1EZVD 4UB6V 4EICA 3CX5D 1SQVD 1NU1D 1WVEC 3PXWA 1MG3D 2N18B 1CHIA 3TYIA 1LFMA 2N9IA 1L0LD 3DP5A 155CA 1DVVA 3VNWA 5C0ZA 1F1CA 3H1JD 2LIRA 3HQ8A 2C8SA 1CYJA 5EXQA 2GC7D 4PJ0V 5CIFB 3L4MA 1C2NA 2AXTV 2BLFB 3ZIYA 1E8EA 1IRWA 1C6RA 3RN1A 1K3GA 1B7VA 5DJQC 1FOCA 1YFCA 1RAQA 3DMIA 1L0ND 3O20A 3CXHD 2N3BA 3A0HV 3ZOWA 451CA 3MK7B 2B10B 2B0ZB 1KB9D 1K3HA 4KMGA 2ZZS1 1C75A 1AOFA 4N0KA 2BPBB 3CYTI 1YNRA 1SQPD 5CIGB 1DW2A 1FCDC 1HRCA 1M60A 3WFCC 2OZ1B 5GTIV 1KYOD 1EB7A 2C1DB 1DIIC 2C1DA 1C6OA 4O1QA 2D0SA 1MZ4A 2JQRA 1U74B 1CSUA 1CNOA 2VHDA 1DW1A 4AALA 4FA4A 5B66V 1DT1A 2DGEA 1SQQD 4FAVA 2Q3EA 1CRYA 1M6ZA 1BGYD 1YTCA 1A2SA 1ZZHA 1GDVA 4WQAA 1BE3D 2L91A 1NTZD 1H33B 1H33A 4FA1A 4IL6V 3ZOYA 1N90A 1CCRA 2QJKB 3NWVA 5H2FV 2PACA 1CYIA 1DW0A 4EDFA 2AI5A 4RJTA 1C52A 5AURA 1CRHA 5KLIB 1OAEA 1I6DA 2ORLA 5TJHA 3TDKA 1CTJA 2C2CA 3HQ9A 4K3IA 1IZL0 4XYDB 1NTMD 1I6EA 1CTZA 2ZXYA 1CIHA 1QL4A 1NIRA 2MTAC 1CSWA 2N9JA 5CIBB 3WFEC 1AOQA 1SQXD 3CX5W 3L4OA 2B11B 2ZOOA 2XTSB 2L4DA 1DVHA 3TF5A 3OCDB 3OCDA 2BGVX 2O3JA 1W5CT 1H32B 1H32A
chains in the Genus database with same CATH superfamily
1HJ3A 1L0NG 1NU1J 3V2RA 3SJLA 3L35A 4UB8V 2HFED 5GTHH 2HODA 2E5YA 3F5HA 1L0LJ 1FI7A 2QJPC 5AVYB 3ABVC 1T8ZA 3GF3A 2NZ2A 1SQPG 1SQBD 2FWLA 1W5CE 3L75D 5CIDB 1EZVE 1HBWA 1FZCA 1ZN5A 3O1YA 3RN0A 4FA5A 5KLVE 3S1KA 3ORVA 2IYOA 2Y0CA 3T97A 5AW6B 1I8OA 1LWUA 5AW9B 4IFFA 5H2FH 3AEGC 5AVSB 3H1JE 3KZIV 4N78D 2WITA 4PW9B 1CW5A 1LTAC 4J20A 3C9IA 4U7JA 1VQ4P 1Q86Q 3Q5PA 2ZXEB 2E76C 1HF9A 3AEDC 4L75A 4WQCA 3V6IA 4AUWA 4C7NB 3H1KD 3M97X 1DIPA 2SPZA 3L37A 2C1UA 1ETPA 1BCCJ 2N1TA 1WRGA 1SQPE 4W80A 2RKLA 4WB4A 1AKKA 3M9BA 3VP9A 4I2LC 2K88A 4U3FE 1CIEA 1GL2D 1F1FA 1FZCC 1IO3A 2H43A 3MK7C 5DFSA 2FYUJ 2B4ZA 4PD4I 1OXZA 4KJMA 1HROA 1CXCA 1M1JB 4EOTA 1GL2A 5APTA 4A7PA 2ZAEB 2MKVA 3BCCJ 2OYIB 1S2EA 2XKMA 2R5BA 2WZ7A 1AQ5A 2NPSA 2QIWA 5APWA 1RQUA 3V2NA 1FZAA 3H1IJ 3L72G 4LGDE 1OVRA 3RL0D 5KAFH 1HJ4A 3V5BA 3HQ6A 4JBZA 2WSEJ 3HUSC 1CIGA 2PCBB 1QVFO 1NMLA 1H0TB 2KS1B 1OW7A 5KLVD 1U7MA 1G2CA 5CBNA 2ZONG 4AYCA 1CO6A 4L3GA 2CPSA 1YBKA 1OWAA 4EIDA 2CE0A 3HE4B 3PH2B 3RK3E 4WQ7A 2IBZG 1SQBK 5AW5B 2YXQB 5KLIC 1AJYA 2FYNB 1IFNA 3M9QA 1FDOA 2KXPB 3W67A 4NFGB 3CCRP 1J1DC 2JDIH 2C1VA 2RMZA 3SWKA 1FDIA 3G6EP 1UIIA 2E75C 1YITP 1OVVA 1C7MA 3II6A 3CCVP 3RK2B 1H31B 2P2UA 4B86A 3W68A 1SFCA 1CRGA 1EC5A 1SQQK 3SFEC 1FDMA 3AECC 1EZVI 4U3FD 3CXHE 1I54A 5KKZC 1N7SC 2AXCA 1JMMA 1WEJF 2K9JB 3L73J 4ASVA 4YXWH 5TISE 1KB0A 1S4XA 2ZBOA 2BH4X 3A0BV 1KYOE 2WPSA 5KAIE 1FZEA 3KDPB 4L3HA 4OGQD 4WVZA 2JO1A 2LKMA 3BRVB 2PAJA 2FYZA 3H1HG 3MHVA 2QJPB 4I7ZC 4H0JA 1JY2N 4L76A 4P4QB 1Y9BA 5B5EE 1MUUA 3IFMA 1BGYE 1WT6A 2E74B 2M3BA 3JC22 4XFJA 2K9YA 1CCHA 4BRYA 1PIXA 1J3SA 1SP4A 2YKPA 1K73Q 1LMSA 5AVTB 2QSIA 5B6QA 2MJZA 2WPQA 1LJ2A 4W7ZA 1GU4A 3RK3D 2K37A 1IFJA 1Q90D 3I5CA 3EWKA 3A0HH 1NKZB 1S5LE 1RF1C 1CHIA 5TISH 3GHGB 1NTME 5KLVK 3DP5A 1NVOA 1F1CA 1KYOH 5KAIH 2LIRA 1N73C 4KT0J 3NMDA 2C8SA 2P1JA 5EXQA 4UB6E 5EFWB 1S72P 4PJ0V 4C7RA 4ASWA 5CIFB 4WY4A 1Z56A 3D6ZA 3KQGA 1E8EA 2I8DA 2YXRB 3NTNA 5DJQC 1FOCA 1NKNA 1RAQA 2XV5A 2A06G 2XZRA 3CXHD 5DJTB 1AVOA 2QE7H 3ZOWA 3MK7B 3C1LA 2B10B 2B0ZB 1YI2P 4KMGA 3MZWB 1HGZA 1AOFA 2C0XA 3CYTI 1XTGB 1FC2C 3WFCC 2OZ1B 1KYOD 1EB7A 4GIFA 1WMKA 1SLQA 3MUDC 2BASA 2HPCB 2JJLA 1OIPA 1S5LH 3M0AA 2R3CA 1PP9G 4AALA 3RBZA 4FAVA 1NAYA 1BGYD 3QH9A 1UIXA 1IFMA 1GDVA 3OW2O 4WQAA 3HUSB 1BDCA 2L91A 4UB6H 4CPGA 1OMIA 3BRTB 3CCMP 5CMZA 3Q3DA 4IL6V 1JCDA 1L4AB 4OVNF 2FBWC 5B66E 1CCRA 1RE3C 3R4YA 3Q2YA 2PACA 3Q5SA 1DW0A 3AEBC 4EDFA 2BCCE 3L70E 5KLIB 2HG5D 2KK7A 1I6DA 1SQVG 4UB8H 1S9KD 5APSA 2I1JA 1JB0J 3IR9A 4XYDB 1NTMD 1I6EA 1CTZA 1GMJA 1J1DB 1R5LA 4TT3H 3QWOC 3C8VA 2IBZI 2YNYA 3GLMA 5CCGC 1YHQP 4HYTB 2N9JA 2O01N 1VL2A 2E75B 1PP9E 3EQ2A 2YKQA 5KJ7D 1N8RQ 1DVHA 1X9VA 4H44C 3AEAC 1LP1B 2GUSA 1H32A 4IL6X 2MHMA 3WUTA 2Y9ZA 1IRVA 5KKZB 3WUIA 1N7SB 3L74G 1A56A 1ZP0C 1NJIQ 3OA8A 1HUCA 2OYOA 2JR8A 3TGUD 2HLOA 1KV9A 2QVAA 2Q7CA 5CIEB 5B66H 3AE8C 1CRCA 1H89A 1KX2A 1NOHA 3CX5E 1M8OB 3B8EB 3MGNA 3CXHW 2YO2A 1M90Q 1GJQA 1GU2A 3TYYA 1J2JB 5E79E 2YKOA 2V7QJ 4AAOA 1MV8A 1SQBJ 3RK2D 3L75J 1KYOW 1NTZG 3LW5J 1N15A 1E79H 1YQ4C 4YPCA 4PD4E 4AAMA 2IPPA 3RL0g 2PCCB 1CI6B 2BCCD 2KYVA 1R8EA 4FA9A 3L74E 3L70D 3VMXA 1NTKE 2ZT9D 1K04A 2CE1A 4EIJA 1RF0A 3WU2V 5GTHE 1RF1B 4RESB 4L1QA 1SQQJ 4L73A 2N3YA 1GKSA 2D2CB 1VQNP 2JWAA 2B12B 3H1KJ 1LGHB 2E74D 1JY3O 3ZOOA 1NTZJ 2B88A 3SWFA 3CX5H 1JY3N 1KQLA 2J58A 1GW4A 3MIWA 1I8PA 2V4HA 2HYNA 4L74A 1E29A 1ZXGA 2IFNA 5E79H 5H2FE 1NTMK 5DJQB 1EDIA 1YEAA 4DCKA 1FI9A 4JQ0D 2CA3B 1S6VB 1PV3A 5L8RJ 1CEDA 1YIQA 2O01H 3GF7A 3CC7P 4TLFA 4D6TE 1CHHA 1CRIA 2L5GB 3AE2C 2M5AA 1KILA 1EQ7A 1URQA 1T3UA 1E5WA 3VP8A 3LW5H 2B89A 3L71G 2B87A 1LT9C 2JTIB 3GHGA 1RE4A 351CA 2ITAA 2QJKC 2YK3A 1XTCC 3IAOA 4XA4A 3V4WA 3MD0A 4R4LA 1NU1E 5KLVJ 2WSFH 3FXEA 1VQMP 1BCCG 2YIUB 2FKWB 4O1WA 4PD4D 1L0LE 3SVWA 3HD7C 3A0BH 1M1KQ 4WQEA 1HJ0A 1M70A 1LTJC 4W7YA 2A45G 3L74D 2RN0A 4GDOA 1N9CA 1NTKD 1QN2A 4N3YB 3L71J 3D0WA 3B5NC 3NBTA 3GW6A 1AYGA 2FYUG 1VQ5P 4GYDA 3TNUA 2XNXA 2LR2A 1HTLC 5KAFE 1NMIA 3CMEP 2OZ1A 3UIAA 1L0NE 1KILC 3CX5I 3PJSK 1U7JA 1FZGA 1IC2A 3A7OA 3BCCG 2JEEA 1L4AD 1GD2E 4H44B 5CIHB 4GEDB 1CIFA 1Q7YQ 3H1IG 4U3FJ 1FOSE 1PGQA 1KIBA 4FANA 1KFNA 2HV4A 5AW2B 2WMMA 3IN6A 4JYBA 3G4SP 1BCCE 1PPJD 1L4AA 3RMZA 4D6TD 1LWUC 1SS1A 1GQ1A 2PP6A 2V08A 2FFDB 4M3LA 2QEXP 1FHBA 3V2QA 3NXSA 3JBTB 2OARA 3USSA 5BVZA 3OJAB 1A02F 3CPWO 3RLMA 3N7NA 1FE6A 2WQYC 5K5GB 3E1IA 3KHUA 1SQXK 2VRSA 1M56D 2R3SA 4N6JA 5DJUB 3C2CA 1CC5A 3VMYA 2KNCA 2FXMA 3ITKA 5DF5A 2K3RA 3V2PA 1EZVD 1W2BO 1YJ9P 1W2EA 2N1TC 1N7SD 1NU1D 2KUBA 1M7LA 2E5TA 1JCCA 4PV1C 3TYIA 2N9IA 1L0LD 155CA 1EXJA 4HKZH 1LTTC 4EYYQ 2E42A 1LP1A 3H1JD 3HQ8A 2GC7D 1HJBA 2KSJA 3CWBJ 1QX8A 3L73G 1CSBA 3LIEA 4HB1A 2H7HA 1YFCA 1GL2C 1GU5A 1R5SA 1L0ND 2A45H 3O8ZA 1X22A 3O20A 1X0TA 2N3BA 2OQQA 3D6YA 1NTKK 4IL6H 2NPSC 1JO5A 1VPCA 5APVA 4GT1A 2AXTE 3L72E 1ZMEC 3CCLP 1SQPD 3HRNA 1K8AQ 1FCDC 5GTIV 1AQTA 2OTKE 3JCUH 1DIIC 2C1DA 1C6OA 1JTHA 3A0HE 4O1QA 1Y47A 1MZ4A 2JQRA 4NPDA 4H13B 1OW8A 1JNMA 2VHDA 2KOGA 1DT1A 2DGEA 3RL0C 2D2CD 5KTBA 2IBZE 1IJDB 5AW8B 2WSEH 5AVZB 1N7LA 3I56P 1H33B 4FA1A 1JY2O 3H1LG 3L73E 1LT9B 2Z5IA 2QJKB 1BGYJ 3NWVA 5H2FV 1VQ7P 3AE7C 2KLVA 3H32A 3HE5B 5AURA 1VQ9P 3TDKA 4JF7A 1N86A 2C2CA 3FXDA 2AXTH 3HD7B 3HTKA 1SFCC 1CSWA 1LNQA 1LTIC 3CI9A 4HH2A 2QA4P 2WSCJ 1A02J 4R4MA 2WT7A 3H1LJ 3CCSP 3L4OA 3B5NB 1DX7A 2KIKA 1NU1K 1NTMJ 4GOEA 2OYHA 2XTSB 1NWQA 2E76B 2Q5UA 2JWDA 3H25A 2L4DA 1VF5C 3OCDA 1L0LK 3WFDC 1VQ8P 3O0RC 2A45I 3CLQA 3P8CE 2Q3IA 3V4QA 4ZKUA 4DJGA 2AEJA 3AE4C 1OVUA 3CL3D 3H1HE 2HODB 3FGAD 5CCHD 2FXOA 5APXA 3A9FA 3L72D 2Q6QA 3VTPC 1MG2D 4Q5PA 1FZCB 4V2KA 3ZCFA 1L0NK 4UB8E 3TGUJ 1NH4A 3WU2H 5CCHA 3T97B 1GK4A 1LWUB 1ZLLA 1RZ6A 4JYCA 2YMYA 1FI3A 4HJGH 3U1AA 1G1IA 1SQPK 2IBZD 5CCGD 4RSZA 2QM7A 5APQA 3VYIA 2N18C 1RHZB 3PRJA 1QEXA 1JM0A 4LLHA 1H9YA 5C39A 1HH0A 1QKSA 3PLNA 4WQ8A 4H44D 1GIWA 1NYHA 1U57A 3KZIE 5CYTR 4C7NA 1IFIA 1U75B 2N1TB 1DH3A 4WY4C 4PV1B 1H1OA 4KHXA 4WBAA 1AVYA 2GC4D 2BCCJ 2A06E 1BE3J 4IFMA 3CU4A 3CC4P 1EDJA 3VRDA 3E1RA 3SSUA 1T2KD 2IDBA 2NRGA 1S1CX 2W90A 2P10A 1CORA 2FFDA 1M1JA 2WSSH 1KV4A 2Y0EA 1YICA 1KQGB 4H0LC 3P8CD 3VMZA 2WWWA 2OYIA 3SWYA 3H1HD 2YQBA 2NPSB 3ZBMA 2G3AA 3M06A 4OH8B 1A8CA 2GA1A 2O1JA 2AEMA 1CHJA 4K3AA 1SQBG 1JEKA 1YIJP 3KZIH 1YEBA 2JKVA 2C9XB 3L75G 3PTZA 1SQXJ 1H0TA 2KS1A 4GOFA 1KB9H 2Y0DA 5KJ7A 2IYPA 1G2CB 3X39A 2ZXXA 3HE4A 3BATA 3U59A 2I8FA 3M0DA 5AVWB 1SQVE 1KMIZ 1FJKA 1R0QA 1LTBC 4MU8A 1HVVA 3S4RA 4EI2A 4I7ZB 1KZUB 1SQQG 1C6SA 5CBOA 1Q81Q 1QYZA 3H1KG 4ZNCA 2IFMA 1I5TA 3SXTA 2GB8B 5TISV 1H31A 1QVGO 3O6QB 2M8RA 3CP5A 4H13D 5CICB 1SQBE 1SFCB 1YQ3C 3L75E 5KAIV 1JOCA 1FOSF 2A06D 1FS0E 2BEQD 3RK3B 2E43A 3B71A 5APYA 2K9JA 2KZIA 3D71A 1LC2A 5B5EV 1VF5B 5IY51 1NGMB 1KX7A 1M57D 2QJYC 5AVRB 1N73B 2O1KA 2IZ1A 2V07A 2WPRA 1DEEG 3WMM0 1PP9D 1QGKB 3BVHA 2BH5X 2ZVNB 3A0BE 1SQQE 2H88C 3MTUE 3KYQA 3G9RA 3HD7D 3NBSA 2KSEA 1HZVA 2M0BA 1C2RA 3CMAP 1KTMA 2KB7P 1NTZE 1CRJA 4BRYB 1KB9I 2YMKA 1S5LV 1MFZA 5KLVG 3B5ND 4D6TJ 3WUUA 1FAVA 2Q9IA 2EXVA 2V7QH 1LTSC 2E76D 5AVXB 1J1EC 4DT0A 1L9BC 2XU6A 3OAKA 1KD1Q 1VDFA 4UB6V 1K9MQ 3CX5D 3CCQP 1SQVD 1WVEC 3PXWA 1RF0C 1MG3D 2N18B 2ZYGA 1DVVA 1AV1A 4BWNA 4Y28J 5GTIH 5CHXA 4ZKPA 2ZT9C 1CYJA 3IF4A 2KLUA 4WY4B 3L4MA 1G1JA 1TU3F 1C2NA 1RH5B 2BLFB 1C6RA 1K05A 3H1JJ 3RN1A 2E74C 1S5LX 3VN0A 3DMIA 1QLED 4U3FG 5APUA 4NPEA 4PJ0E 2M3EA 4NPFX 1K3HA 2CK3H 3F89A 2ZZS1 4N0KA 2BPBB 1LT1A 5CIGB 1JY3P 1DW2A 1HRCA 1M60A 1L0NJ 2POHA 4LC1A 2N9BA 1SVFA 3R2PA 1URQC 4H0LB 4IFDK 3AE6C 4IOIH 3A3YB 3EFFK 2HPCA 2N1TD 2ZYAA 3L71E 4PV1D 1U74B 1CSUA 3GHGC 1RE4C 1RY3A 3A2AA 1SQPJ 1DW1A 4FA4A 5B66V 2QM8A 4K35A 1SQQD 2Q3EA 1M6ZA 3HUSA 2W83C 3E7KA 1NTZD 2R44A 3AEEC 2GM4A 2GUVA 3ZOYA 3K5BA 2XNDH 1P84E 2IX7C 4QMAA 1BSNA 1ZR2A 1CYIA 2AI5A 3AE1C 4RJTA 1MFTA 3JSVC 2W8ZA 2P7JA 4PJ0H 1FJPA 2ORLA 5TJHA 1FZFA 4Z1MH 3P7KA 1KN7A 4IL6E 2E75D 3HQ9A 4K3IA 2FYUE 3MP7B 2NPSD 3CWBG 1QL2A 3RGUA 1OX3A 3JCUE 2MTAC 3BASA 1PZQA 5CIBB 3WFEC 2K1AA 1FZBA 5AW0B 1AOQA 3CX5W 3BCCE 3LIDA 1SQVK 2ZOOA 1IFPA 2Z5HA 3TF5A 3H1IE 2BGVX 2O3JA 1W5CT 1H32B 1GK6A 1KQFB 1N7SA 3AEFC 2OTLP 1N50A 1IZNB 5CJ4A 2H89C 1EXIA 3OA8B 1QL1A 1L4AC 4XXLA 5E79V 3CCEP 2Z4EA 4RO0A 1LC1A 2DVHA 1P84H 1T6AA 3SFDC 1PGJA 2QJYB 1RZ5A 4WQ9A 4PWAA 1GZLA 1VYDA 3RBXA 1OW6A 1ZRTE 1S3JA 3L71D 1IO4A 1H9XA 3L72J 3CWBE 1FBMA 2AEFA 1BGYG 4JCGA 1OCDA 1SFCD 3N4XA 1JUNA 2OGUA 4XE5B 2YCCA 1FU1A 1L9JC 4GODA 5BU5A 4I6MC 1BCCD 5GTHV 4DZOA 1MKMA 3S9OA 2LXCB 2P58A 1ZV8A 1P84D 3O6QA 1CYCA 4QAOA 1J1EB 1CI6A 4YE1A 1VF5D 2UWJE 1CXAA 5C9MA 2IZ0A 1USEA 3ZOXA 3PH0A 2QG4A 1NAFA 1NTZK 1RF1A 1IK9A 3G3ZA 4AQRD 2FYUD 1YCCA 1BL9A 1NTMG 2I1KA 3L36A 4AX3A 2H8PD 1N73A 4AANA 5BU8B 2ZT9B 1RAPA 2CA4B 4LJIA 3SLEA 3WU2E 1ZOYC 3BCCD 1CSVA 3O5CA 1OZHA 2LITA 1PGPA 3H1ID 4DY9A 1KC8Q 1DD4A 1LTJB 2R32A 3AE3C 3P8MC 3HQ7A 1ZR4A 3ZDMA 1YJNP 1VQPP 2CPBA 2KP8A 1EDKA 1CSXA 3TGUG 3DR0A 1P84I 1X79B 4Y99C 3SWSA 3PHLA 4YXDC 1GW3A 4EIEA 1QL3A 2M5AB 1KILB 1HZUA 2KI7B 1URQB 3CXHH 3MUDA 1ZRTD 3H1LE 4Y5RA 3H1HJ 1S9KE 4WY4D 3NFQA 2B87B 1AA0A 2ZFCA 5AW4B 3CWBD 2D2CC 2Q1KA 3WFBC 1ZW0A 4OGQC 3B4SA 2HR3A 2C9NY 2PFXA 2R5DA 1NNOA 1I55A 1IQCA 3AE5C 4EIFA 4WQDA 4O9BA 1LS9A 3PXTA 1RE3A 5B5EH 2AIUA 2CXBA 4MN4C 5KAFV 4RKUJ 4WQBA 2BCCG 1BE3G 1IFDA 2WVRA 3L70G 1CTYA 2PRRA 2QRXA 1JY2P 4H0LD 3GG2A 1JDLA 1DW3A 3TGUE 3L73D 2OYHC 1PFIA 1L2PA 1HJ5A 3U1CA 1DD3A 3TNUB 2GIWA 3CCUP 3RK3C 3PXSA 1YTZT 5AW7B 5CCGA 1YYCA 3FWLA 2G8YA 1FJ0A 4WWIA 4FB1A 1HH7A 1LTGC 2WSCH 3TSIA 1DEBA 1NHLA 3PP5A 1KB9E 1E2RA 1COTA 1KFMA 1NO4A 2ZYDA 2OTJP 1Q2NA 3WC8A 2FYUK 3TK1A 3CCJP 3I55P 3L70J 1AFOA 2KZJA 1HCMA 2FRCA 1W2LA 1SQXG 3OA7A 5CCHC 2BCNB 2D0WA 4H0KA 2YIUC 2C9LY 2J59M 2W6AA 5AVQB 1Q82Q 2LXBA 1DIQC 3VMAA 1GL2B 5AVUB 1BE3E 2W27A 3CXHI 1PGOA 2FY8A 2PGDA 2N9YB 3H1LD 3D70A 1PP9J 5AW1B 2DW3A 2BEZF 3Q1MA 3GMAA 2KNCB 1KYOI 1MZ9A 1N2DC 3Q5RA 1YTZI 3AE9C 4JPZB 3VYMA 4EICA 2B9BA 5AVVB 3WUVA 4C46A 1LFMA 2J5UA 1BDDA 3VNWA 3M91A 3RL0B 5C0ZA 3KXDA 1HWTC 1X8YA 2JP3A 1KILE 1SQVJ 2C0WA 1GTWA 1NTKG 1T3JA 1SQXE 1KORA 1PL5A 2AXTV 3VOPA 3ZIYA 1IRWA 1K3GA 1B7VA 2FFDC 1M1JC 2Y9YA 3A5TA 3M9HA 4DOJA 3CC2P 3A0HV 1USDA 451CA 1T2KC 2OYIC 2O01J 1KB9D 1VQOP 4GKGA 3P32A 1EDLA 1C75A 4ZMDA 3KPEA 1YNRA 1Y8AA 1BSHA 3L74J 2C1DB 1RQVA 1NTKJ 1IK7A 1JTHB 1VQKP 2D0SA 5KJ7C 1PPJG 1CNOA 2YO3A 4D6TG 4Y99B 1YJWP 4OWFA 1CRYA 1YTCA 4N78E 5GTIE 1OFCX 1A2SA 1ZZHA 3M0DC 1BE3D 2WPVB 1D7MA 3EFGA 1GDTA 2WSFJ 2FYNC 1H33A 1VQLP 1LT9A 1JMBA 2W6JH 1N90A 1HGVA 2ZVOB 4OGQB 1CZQA 3H1KE 5M1BA 2P67A 3H32B 1C52A 3HE5A 1CRHA 1EZVG 1OAEA 1NU1G 4YTPC 3FX0A 1CTJA 4BXLA 2WTYA 1H88A 1IZL0 2FXPA 3RK2C 1H8AA 3HD7A 1L0LG 2ZXYA 3HTKB 1CIHA 2XDJA 1QL4A 1NIRA 1LTJA 2RH0A 3H1JG 3G71P 2W6BA 3FWNA 3CD6P 1KILD 2WT7B 3H6PA 1URQD 5AW3B 1SQXD 1KQSO 1VQ6P 3B5NA 1PPJE 2B11B 3L4FA 2OYHB 4PD4H 4H13C 2ZJSE 5CJ0A 3OCDB 4I1LA
chains in the Genus database with same CATH topology
2MHMA 3O0RC 1HJ3A 1IRVA 5KKZB 3WUIA 1A56A 1N50A 3SJLA 4UB8V 3OA8B 3OA8A 3TGUD 1FI7A 4XXLA 5E79V 1KV9A 1LC1A 2DVHA 3A9FA 3L72D 5CIEB 3WFDC 1CRCA 1SQBD 2FWLA 1RZ5A 2QJYB 4PWAA 4WQ9A 3L75D 5CIDB 1VYDA 1MG2D 4Q5PA 4V2KA 3ZCFA 1KX2A 3O1YA 3CXHW 1GJQA 3RN0A 4FA5A 1GU2A 3ORVA 3L71D 2Y0CA 1H9XA 4AAOA 1I8OA 1RZ6A 1FI3A 4JCGA 1OCDA 3KZIV 2IBZD 4PW9B 1KYOW 4RSZA 2YCCA 4J20A 1L9JC 2N18C 3PRJA 1BCCD 1N15A 5GTHV 4AAMA 1H9YA 1P84D 1QKSA 3PLNA 1CYCA 2PCCB 4QAOA 4WQ8A 4YE1A 1GIWA 4WQCA 5CYTR 1CXAA 3H1KD 5C9MA 3M97X 2BCCD 4FA9A 3L70D 3ZOXA 1U75B 2C1UA 2QG4A 1ETPA 2CE1A 3WU2V 1H1OA 2FYUD 4L1QA 1YCCA 1BL9A 2N3YA 1GKSA 4AX3A 2JWAA 2B12B 1AKKA 2GC4D 4AANA 3CU4A 1CIEA 3ZOOA 1F1FA 1RAPA 3VRDA 1IO3A 3MK7C 2CA4B 4LJIA 3SLEA 1I8PA 3BCCD 5DFSA 1CSVA 3O5CA 1E29A 2B4ZA 2LITA 1HROA 1CXCA 1CORA 3H1ID 5DJQB 4DY9A 1YEAA 1FI9A 2CA3B 2Y0EA 1S6VB 3HQ7A 1YICA 4A7PA 1CEDA 1YIQA 3H1HD 2YQBA 1CSXA 3DR0A 1CHHA 3ZBMA 3SWSA 3PHLA 1A8CA 1CRIA 1CHJA 4EIEA 1QL3A 1HJ4A 1YEBA 3HQ6A 2C9XB 1HZUA 1CIGA 2PCBB 1NMLA 3PTZA 2KS1A 1ZRTD 4Y5RA 2Y0DA 5KLVD 2JTIB 3X39A 351CA 2ZONG 3CWBD 1CO6A 4L3GA 4EIDA 2CE0A 3WFBC 2YK3A 3PH2B 2I8FA 4WQ7A 2FYNB 1NNOA 1R0QA 1I55A 4MU8A 1IQCA 2YIUB 4EIFA 4O1WA 4NFGB 4PD4D 4WQDA 3SVWA 1LS9A 3PXTA 2AIUA 2CXBA 4WQEA 1M70A 5KAFV 2C1VA 1C6SA 2RMZA 4WQBA 1QYZA 1I5TA 3L74D 2RN0A 1CTYA 1N9CA 1NTKD 1QN2A 3GG2A 1JDLA 1DW3A 3SXTA 3NBTA 2GB8B 3GW6A 5TISV 3L73D 1AYGA 1C7MA 1HJ5A 1H31B 1H31A 4GYDA 3CP5A 5CICB 2GIWA 1CRGA 1NMIA 3PXSA 2OZ1A 5KAIV 2A06D 3FWLA 4U3FD 1FJ0A 1I54A 4FB1A 1HH7A 1WEJF 2K9JB 1E2RA 1COTA 1KB0A 2ZBOA 1LC2A 2BH4X 3A0BV 3WC8A 5B5EV 5CIHB 4GEDB 5IY51 1CIFA 1KX7A 4L3HA 1KIBA 4FANA 2V07A 2HV4A 1HCMA 2FRCA 1W2LA 1PPJD 2BCNB 2D0WA 4H0KA 1PP9D 2QJPB 2BH5X 4H0JA 3RMZA 4D6TD 4P4QB 1GQ1A 1DIQC 3NBSA 2V08A 3VMAA 1HZVA 1C2RA 1FHBA 1CCHA 3JBTB 1CRJA 1J3SA 3RLMA 2N9YB 3H1LD 1S5LV 3KHUA 1LMSA 5B6QA 2EXVA 3C2CA 1CC5A 2KNCB 1L9BC 3ITKA 5DF5A 3VYMA 1EZVD 4UB6V 4EICA 3CX5D 1SQVD 1NU1D 1WVEC 3PXWA 1MG3D 2N18B 1CHIA 3TYIA 1LFMA 2N9IA 1L0LD 3DP5A 155CA 1DVVA 3VNWA 5C0ZA 1F1CA 3H1JD 2LIRA 3HQ8A 2C8SA 1CYJA 5EXQA 2GC7D 4PJ0V 5CIFB 3L4MA 1C2NA 2AXTV 2BLFB 3ZIYA 1E8EA 1IRWA 1C6RA 3RN1A 1K3GA 1B7VA 5DJQC 1FOCA 1YFCA 1RAQA 3DMIA 1L0ND 3O20A 3CXHD 2N3BA 3A0HV 3ZOWA 451CA 3MK7B 2B10B 2B0ZB 1KB9D 1K3HA 4KMGA 2ZZS1 1C75A 1AOFA 4N0KA 2BPBB 3CYTI 1YNRA 1SQPD 5CIGB 1DW2A 1FCDC 1HRCA 1M60A 3WFCC 2OZ1B 5GTIV 1KYOD 1EB7A 2C1DB 1DIIC 2C1DA 1C6OA 4O1QA 2D0SA 1MZ4A 2JQRA 1U74B 1CSUA 1CNOA 2VHDA 1DW1A 4AALA 4FA4A 5B66V 1DT1A 2DGEA 1SQQD 4FAVA 2Q3EA 1CRYA 1M6ZA 1BGYD 1YTCA 1A2SA 1ZZHA 1GDVA 4WQAA 1BE3D 2L91A 1NTZD 1H33B 1H33A 4FA1A 4IL6V 3ZOYA 1N90A 1CCRA 2QJKB 3NWVA 5H2FV 2PACA 1CYIA 1DW0A 4EDFA 2AI5A 4RJTA 1C52A 5AURA 1CRHA 5KLIB 1OAEA 1I6DA 2ORLA 5TJHA 3TDKA 1CTJA 2C2CA 3HQ9A 4K3IA 1IZL0 4XYDB 1NTMD 1I6EA 1CTZA 2ZXYA 1CIHA 1QL4A 1NIRA 2MTAC 1CSWA 2N9JA 5CIBB 3WFEC 1AOQA 1SQXD 3CX5W 3L4OA 2B11B 2ZOOA 2XTSB 2L4DA 1DVHA 3TF5A 3OCDB 3OCDA 2BGVX 2O3JA 1W5CT 1H32B 1H32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHM A;  3O0R C;  1HJ3 A;  1IRV A;  5KKZ B;  3WUI A;  1A56 A;  1N50 A;  3SJL A;  4UB8 V;  3OA8 B;  3OA8 A;  3TGU D;  1FI7 A;  4XXL A;  5E79 V;  1KV9 A;  1LC1 A;  2DVH A;  3A9F A;  3L72 D;  5CIE B;  3WFD C;  1CRC A;  1SQB D;  2FWL A;  1RZ5 A;  2QJY B;  4PWA A;  4WQ9 A;  3L75 D;  5CID B;  1VYD A;  1MG2 D;  4Q5P A;  4V2K A;  3ZCF A;  1KX2 A;  3O1Y A;  3CXH W;  1GJQ A;  3RN0 A;  4FA5 A;  1GU2 A;  3ORV A;  3L71 D;  2Y0C A;  1H9X A;  4AAO A;  1I8O A;  1RZ6 A;  1FI3 A;  4JCG A;  1OCD A;  3KZI V;  2IBZ D;  4PW9 B;  1KYO W;  4RSZ A;  2YCC A;  4J20 A;  1L9J C;  2N18 C;  3PRJ A;  1BCC D;  1N15 A;  5GTH V;  4AAM A;  1H9Y A;  1P84 D;  1QKS A;  3PLN A;  1CYC A;  2PCC B;  4QAO A;  4WQ8 A;  4YE1 A;  1GIW A;  4WQC A;  5CYT R;  1CXA A;  3H1K D;  5C9M A;  3M97 X;  2BCC D;  4FA9 A;  3L70 D;  3ZOX A;  1U75 B;  2C1U A;  2QG4 A;  1ETP A;  2CE1 A;  3WU2 V;  1H1O A;  2FYU D;  4L1Q A;  1YCC A;  1BL9 A;  2N3Y A;  1GKS A;  4AX3 A;  2JWA A;  2B12 B;  1AKK A;  2GC4 D;  4AAN A;  3CU4 A;  1CIE A;  3ZOO A;  1F1F A;  1RAP A;  3VRD A;  1IO3 A;  3MK7 C;  2CA4 B;  4LJI A;  3SLE A;  1I8P A;  3BCC D;  5DFS A;  1CSV A;  3O5C A;  1E29 A;  2B4Z A;  2LIT A;  1HRO A;  1CXC A;  1COR A;  3H1I D;  5DJQ B;  4DY9 A;  1YEA A;  1FI9 A;  2CA3 B;  2Y0E A;  1S6V B;  3HQ7 A;  1YIC A;  4A7P A;  1CED A;  1YIQ A;  3H1H D;  2YQB A;  1CSX A;  3DR0 A;  1CHH A;  3ZBM A;  3SWS A;  3PHL A;  1A8C A;  1CRI A;  1CHJ A;  4EIE A;  1QL3 A;  1HJ4 A;  1YEB A;  3HQ6 A;  2C9X B;  1HZU A;  1CIG A;  2PCB B;  1NML A;  3PTZ A;  2KS1 A;  1ZRT D;  4Y5R A;  2Y0D A;  5KLV D;  2JTI B;  3X39 A;  351C A;  2ZON G;  3CWB D;  1CO6 A;  4L3G A;  4EID A;  2CE0 A;  3WFB C;  2YK3 A;  3PH2 B;  2I8F A;  4WQ7 A;  2FYN B;  1NNO A;  1R0Q A;  1I55 A;  4MU8 A;  1IQC A;  2YIU B;  4EIF A;  4O1W A;  4NFG B;  4PD4 D;  4WQD A;  3SVW A;  1LS9 A;  3PXT A;  2AIU A;  2CXB A;  4WQE A;  1M70 A;  5KAF V;  2C1V A;  1C6S A;  2RMZ A;  4WQB A;  1QYZ A;  1I5T A;  3L74 D;  2RN0 A;  1CTY A;  1N9C A;  1NTK D;  1QN2 A;  3GG2 A;  1JDL A;  1DW3 A;  3SXT A;  3NBT A;  2GB8 B;  3GW6 A;  5TIS V;  3L73 D;  1AYG A;  1C7M A;  1HJ5 A;  1H31 B;  1H31 A;  4GYD A;  3CP5 A;  5CIC B;  2GIW A;  1CRG A;  1NMI A;  3PXS A;  2OZ1 A;  5KAI V;  2A06 D;  3FWL A;  4U3F D;  1FJ0 A;  1I54 A;  4FB1 A;  1HH7 A;  1WEJ F;  2K9J B;  1E2R A;  1COT A;  1KB0 A;  2ZBO A;  1LC2 A;  2BH4 X;  3A0B V;  3WC8 A;  5B5E V;  5CIH B;  4GED B;  5IY5 1;  1CIF A;  1KX7 A;  4L3H A;  1KIB A;  4FAN A;  2V07 A;  2HV4 A;  1HCM A;  2FRC A;  1W2L A;  1PPJ D;  2BCN B;  2D0W A;  4H0K A;  1PP9 D;  2QJP B;  2BH5 X;  4H0J A;  3RMZ A;  4D6T D;  4P4Q B;  1GQ1 A;  1DIQ C;  3NBS A;  2V08 A;  3VMA A;  1HZV A;  1C2R A;  1FHB A;  1CCH A;  3JBT B;  1CRJ A;  1J3S A;  3RLM A;  2N9Y B;  3H1L D;  1S5L V;  3KHU A;  1LMS A;  5B6Q A;  2EXV A;  3C2C A;  1CC5 A;  2KNC B;  1L9B C;  3ITK A;  5DF5 A;  3VYM A;  1EZV D;  4UB6 V;  4EIC A;  3CX5 D;  1SQV D;  1NU1 D;  1WVE C;  3PXW A;  1MG3 D;  2N18 B;  1CHI A;  3TYI A;  1LFM A;  2N9I A;  1L0L D;  3DP5 A;  155C A;  1DVV A;  3VNW A;  5C0Z A;  1F1C A;  3H1J D;  2LIR A;  3HQ8 A;  2C8S A;  1CYJ A;  5EXQ A;  2GC7 D;  4PJ0 V;  5CIF B;  3L4M A;  1C2N A;  2AXT V;  2BLF B;  3ZIY A;  1E8E A;  1IRW A;  1C6R A;  3RN1 A;  1K3G A;  1B7V A;  5DJQ C;  1FOC A;  1YFC A;  1RAQ A;  3DMI A;  1L0N D;  3O20 A;  3CXH D;  2N3B A;  3A0H V;  3ZOW A;  451C A;  3MK7 B;  2B10 B;  2B0Z B;  1KB9 D;  1K3H A;  4KMG A;  2ZZS 1;  1C75 A;  1AOF A;  4N0K A;  2BPB B;  3CYT I;  1YNR A;  1SQP D;  5CIG B;  1DW2 A;  1FCD C;  1HRC A;  1M60 A;  3WFC C;  2OZ1 B;  5GTI V;  1KYO D;  1EB7 A;  2C1D B;  1DII C;  2C1D A;  1C6O A;  4O1Q A;  2D0S A;  1MZ4 A;  2JQR A;  1U74 B;  1CSU A;  1CNO A;  2VHD A;  1DW1 A;  4AAL A;  4FA4 A;  5B66 V;  1DT1 A;  2DGE A;  1SQQ D;  4FAV A;  2Q3E A;  1CRY A;  1M6Z A;  1BGY D;  1YTC A;  1A2S A;  1ZZH A;  1GDV A;  4WQA A;  1BE3 D;  2L91 A;  1NTZ D;  1H33 B;  1H33 A;  4FA1 A;  4IL6 V;  3ZOY A;  1N90 A;  1CCR A;  2QJK B;  3NWV A;  5H2F V;  2PAC A;  1CYI A;  1DW0 A;  4EDF A;  2AI5 A;  4RJT A;  1C52 A;  5AUR A;  1CRH A;  5KLI B;  1OAE A;  1I6D A;  2ORL A;  5TJH A;  3TDK A;  1CTJ A;  2C2C A;  3HQ9 A;  4K3I A;  1IZL 0;  4XYD B;  1NTM D;  1I6E A;  1CTZ A;  2ZXY A;  1CIH A;  1QL4 A;  1NIR A;  2MTA C;  1CSW A;  2N9J A;  5CIB B;  3WFE C;  1AOQ A;  1SQX D;  3CX5 W;  3L4O A;  2B11 B;  2ZOO A;  2XTS B;  2L4D A;  1DVH A;  3TF5 A;  3OCD B;  3OCD A;  2BGV X;  2O3J A;  1W5C T;  1H32 B;  1H32 A; 
#chains in the Genus database with same CATH topology
 1HJ3 A;  1L0N G;  1NU1 J;  3V2R A;  3SJL A;  3L35 A;  4UB8 V;  2HFE D;  5GTH H;  2HOD A;  2E5Y A;  3F5H A;  1L0L J;  1FI7 A;  2QJP C;  5AVY B;  3ABV C;  1T8Z A;  3GF3 A;  2NZ2 A;  1SQP G;  1SQB D;  2FWL A;  1W5C E;  3L75 D;  5CID B;  1EZV E;  1HBW A;  1FZC A;  1ZN5 A;  3O1Y A;  3RN0 A;  4FA5 A;  5KLV E;  3S1K A;  3ORV A;  2IYO A;  2Y0C A;  3T97 A;  5AW6 B;  1I8O A;  1LWU A;  5AW9 B;  4IFF A;  5H2F H;  3AEG C;  5AVS B;  3H1J E;  3KZI V;  4N78 D;  2WIT A;  4PW9 B;  1CW5 A;  1LTA C;  4J20 A;  3C9I A;  4U7J A;  1VQ4 P;  1Q86 Q;  3Q5P A;  2ZXE B;  2E76 C;  1HF9 A;  3AED C;  4L75 A;  4WQC A;  3V6I A;  4AUW A;  4C7N B;  3H1K D;  3M97 X;  1DIP A;  2SPZ A;  3L37 A;  2C1U A;  1ETP A;  1BCC J;  2N1T A;  1WRG A;  1SQP E;  4W80 A;  2RKL A;  4WB4 A;  1AKK A;  3M9B A;  3VP9 A;  4I2L C;  2K88 A;  4U3F E;  1CIE A;  1GL2 D;  1F1F A;  1FZC C;  1IO3 A;  2H43 A;  3MK7 C;  5DFS A;  2FYU J;  2B4Z A;  4PD4 I;  1OXZ A;  4KJM A;  1HRO A;  1CXC A;  1M1J B;  4EOT A;  1GL2 A;  5APT A;  4A7P A;  2ZAE B;  2MKV A;  3BCC J;  2OYI B;  1S2E A;  2XKM A;  2R5B A;  2WZ7 A;  1AQ5 A;  2NPS A;  2QIW A;  5APW A;  1RQU A;  3V2N A;  1FZA A;  3H1I J;  3L72 G;  4LGD E;  1OVR A;  3RL0 D;  5KAF H;  1HJ4 A;  3V5B A;  3HQ6 A;  4JBZ A;  2WSE J;  3HUS C;  1CIG A;  2PCB B;  1QVF O;  1NML A;  1H0T B;  2KS1 B;  1OW7 A;  5KLV D;  1U7M A;  1G2C A;  5CBN A;  2ZON G;  4AYC A;  1CO6 A;  4L3G A;  2CPS A;  1YBK A;  1OWA A;  4EID A;  2CE0 A;  3HE4 B;  3PH2 B;  3RK3 E;  4WQ7 A;  2IBZ G;  1SQB K;  5AW5 B;  2YXQ B;  5KLI C;  1AJY A;  2FYN B;  1IFN A;  3M9Q A;  1FDO A;  2KXP B;  3W67 A;  4NFG B;  3CCR P;  1J1D C;  2JDI H;  2C1V A;  2RMZ A;  3SWK A;  1FDI A;  3G6E P;  1UII A;  2E75 C;  1YIT P;  1OVV A;  1C7M A;  3II6 A;  3CCV P;  3RK2 B;  1H31 B;  2P2U A;  4B86 A;  3W68 A;  1SFC A;  1CRG A;  1EC5 A;  1SQQ K;  3SFE C;  1FDM A;  3AEC C;  1EZV I;  4U3F D;  3CXH E;  1I54 A;  5KKZ C;  1N7S C;  2AXC A;  1JMM A;  1WEJ F;  2K9J B;  3L73 J;  4ASV A;  4YXW H;  5TIS E;  1KB0 A;  1S4X A;  2ZBO A;  2BH4 X;  3A0B V;  1KYO E;  2WPS A;  5KAI E;  1FZE A;  3KDP B;  4L3H A;  4OGQ D;  4WVZ A;  2JO1 A;  2LKM A;  3BRV B;  2PAJ A;  2FYZ A;  3H1H G;  3MHV A;  2QJP B;  4I7Z C;  4H0J A;  1JY2 N;  4L76 A;  4P4Q B;  1Y9B A;  5B5E E;  1MUU A;  3IFM A;  1BGY E;  1WT6 A;  2E74 B;  2M3B A;  3JC2 2;  4XFJ A;  2K9Y A;  1CCH A;  4BRY A;  1PIX A;  1J3S A;  1SP4 A;  2YKP A;  1K73 Q;  1LMS A;  5AVT B;  2QSI A;  5B6Q A;  2MJZ A;  2WPQ A;  1LJ2 A;  4W7Z A;  1GU4 A;  3RK3 D;  2K37 A;  1IFJ A;  1Q90 D;  3I5C A;  3EWK A;  3A0H H;  1NKZ B;  1S5L E;  1RF1 C;  1CHI A;  5TIS H;  3GHG B;  1NTM E;  5KLV K;  3DP5 A;  1NVO A;  1F1C A;  1KYO H;  5KAI H;  2LIR A;  1N73 C;  4KT0 J;  3NMD A;  2C8S A;  2P1J A;  5EXQ A;  4UB6 E;  5EFW B;  1S72 P;  4PJ0 V;  4C7R A;  4ASW A;  5CIF B;  4WY4 A;  1Z56 A;  3D6Z A;  3KQG A;  1E8E A;  2I8D A;  2YXR B;  3NTN A;  5DJQ C;  1FOC A;  1NKN A;  1RAQ A;  2XV5 A;  2A06 G;  2XZR A;  3CXH D;  5DJT B;  1AVO A;  2QE7 H;  3ZOW A;  3MK7 B;  3C1L A;  2B10 B;  2B0Z B;  1YI2 P;  4KMG A;  3MZW B;  1HGZ A;  1AOF A;  2C0X A;  3CYT I;  1XTG B;  1FC2 C;  3WFC C;  2OZ1 B;  1KYO D;  1EB7 A;  4GIF A;  1WMK A;  1SLQ A;  3MUD C;  2BAS A;  2HPC B;  2JJL A;  1OIP A;  1S5L H;  3M0A A;  2R3C A;  1PP9 G;  4AAL A;  3RBZ A;  4FAV A;  1NAY A;  1BGY D;  3QH9 A;  1UIX A;  1IFM A;  1GDV A;  3OW2 O;  4WQA A;  3HUS B;  1BDC A;  2L91 A;  4UB6 H;  4CPG A;  1OMI A;  3BRT B;  3CCM P;  5CMZ A;  3Q3D A;  4IL6 V;  1JCD A;  1L4A B;  4OVN F;  2FBW C;  5B66 E;  1CCR A;  1RE3 C;  3R4Y A;  3Q2Y A;  2PAC A;  3Q5S A;  1DW0 A;  3AEB C;  4EDF A;  2BCC E;  3L70 E;  5KLI B;  2HG5 D;  2KK7 A;  1I6D A;  1SQV G;  4UB8 H;  1S9K D;  5APS A;  2I1J A;  1JB0 J;  3IR9 A;  4XYD B;  1NTM D;  1I6E A;  1CTZ A;  1GMJ A;  1J1D B;  1R5L A;  4TT3 H;  3QWO C;  3C8V A;  2IBZ I;  2YNY A;  3GLM A;  5CCG C;  1YHQ P;  4HYT B;  2N9J A;  2O01 N;  1VL2 A;  2E75 B;  1PP9 E;  3EQ2 A;  2YKQ A;  5KJ7 D;  1N8R Q;  1DVH A;  1X9V A;  4H44 C;  3AEA C;  1LP1 B;  2GUS A;  1H32 A;  4IL6 X;  2MHM A;  3WUT A;  2Y9Z A;  1IRV A;  5KKZ B;  3WUI A;  1N7S B;  3L74 G;  1A56 A;  1ZP0 C;  1NJI Q;  3OA8 A;  1HUC A;  2OYO A;  2JR8 A;  3TGU D;  2HLO A;  1KV9 A;  2QVA A;  2Q7C A;  5CIE B;  5B66 H;  3AE8 C;  1CRC A;  1H89 A;  1KX2 A;  1NOH A;  3CX5 E;  1M8O B;  3B8E B;  3MGN A;  3CXH W;  2YO2 A;  1M90 Q;  1GJQ A;  1GU2 A;  3TYY A;  1J2J B;  5E79 E;  2YKO A;  2V7Q J;  4AAO A;  1MV8 A;  1SQB J;  3RK2 D;  3L75 J;  1KYO W;  1NTZ G;  3LW5 J;  1N15 A;  1E79 H;  1YQ4 C;  4YPC A;  4PD4 E;  4AAM A;  2IPP A;  3RL0 g;  2PCC B;  1CI6 B;  2BCC D;  2KYV A;  1R8E A;  4FA9 A;  3L74 E;  3L70 D;  3VMX A;  1NTK E;  2ZT9 D;  1K04 A;  2CE1 A;  4EIJ A;  1RF0 A;  3WU2 V;  5GTH E;  1RF1 B;  4RES B;  4L1Q A;  1SQQ J;  4L73 A;  2N3Y A;  1GKS A;  2D2C B;  1VQN P;  2JWA A;  2B12 B;  3H1K J;  1LGH B;  2E74 D;  1JY3 O;  3ZOO A;  1NTZ J;  2B88 A;  3SWF A;  3CX5 H;  1JY3 N;  1KQL A;  2J58 A;  1GW4 A;  3MIW A;  1I8P A;  2V4H A;  2HYN A;  4L74 A;  1E29 A;  1ZXG A;  2IFN A;  5E79 H;  5H2F E;  1NTM K;  5DJQ B;  1EDI A;  1YEA A;  4DCK A;  1FI9 A;  4JQ0 D;  2CA3 B;  1S6V B;  1PV3 A;  5L8R J;  1CED A;  1YIQ A;  2O01 H;  3GF7 A;  3CC7 P;  4TLF A;  4D6T E;  1CHH A;  1CRI A;  2L5G B;  3AE2 C;  2M5A A;  1KIL A;  1EQ7 A;  1URQ A;  1T3U A;  1E5W A;  3VP8 A;  3LW5 H;  2B89 A;  3L71 G;  2B87 A;  1LT9 C;  2JTI B;  3GHG A;  1RE4 A;  351C A;  2ITA A;  2QJK C;  2YK3 A;  1XTC C;  3IAO A;  4XA4 A;  3V4W A;  3MD0 A;  4R4L A;  1NU1 E;  5KLV J;  2WSF H;  3FXE A;  1VQM P;  1BCC G;  2YIU B;  2FKW B;  4O1W A;  4PD4 D;  1L0L E;  3SVW A;  3HD7 C;  3A0B H;  1M1K Q;  4WQE A;  1HJ0 A;  1M70 A;  1LTJ C;  4W7Y A;  2A45 G;  3L74 D;  2RN0 A;  4GDO A;  1N9C A;  1NTK D;  1QN2 A;  4N3Y B;  3L71 J;  3D0W A;  3B5N C;  3NBT A;  3GW6 A;  1AYG A;  2FYU G;  1VQ5 P;  4GYD A;  3TNU A;  2XNX A;  2LR2 A;  1HTL C;  5KAF E;  1NMI A;  3CME P;  2OZ1 A;  3UIA A;  1L0N E;  1KIL C;  3CX5 I;  3PJS K;  1U7J A;  1FZG A;  1IC2 A;  3A7O A;  3BCC G;  2JEE A;  1L4A D;  1GD2 E;  4H44 B;  5CIH B;  4GED B;  1CIF A;  1Q7Y Q;  3H1I G;  4U3F J;  1FOS E;  1PGQ A;  1KIB A;  4FAN A;  1KFN A;  2HV4 A;  5AW2 B;  2WMM A;  3IN6 A;  4JYB A;  3G4S P;  1BCC E;  1PPJ D;  1L4A A;  3RMZ A;  4D6T D;  1LWU C;  1SS1 A;  1GQ1 A;  2PP6 A;  2V08 A;  2FFD B;  4M3L A;  2QEX P;  1FHB A;  3V2Q A;  3NXS A;  3JBT B;  2OAR A;  3USS A;  5BVZ A;  3OJA B;  1A02 F;  3CPW O;  3RLM A;  3N7N A;  1FE6 A;  2WQY C;  5K5G B;  3E1I A;  3KHU A;  1SQX K;  2VRS A;  1M56 D;  2R3S A;  4N6J A;  5DJU B;  3C2C A;  1CC5 A;  3VMY A;  2KNC A;  2FXM A;  3ITK A;  5DF5 A;  2K3R A;  3V2P A;  1EZV D;  1W2B O;  1YJ9 P;  1W2E A;  2N1T C;  1N7S D;  1NU1 D;  2KUB A;  1M7L A;  2E5T A;  1JCC A;  4PV1 C;  3TYI A;  2N9I A;  1L0L D;  155C A;  1EXJ A;  4HKZ H;  1LTT C;  4EYY Q;  2E42 A;  1LP1 A;  3H1J D;  3HQ8 A;  2GC7 D;  1HJB A;  2KSJ A;  3CWB J;  1QX8 A;  3L73 G;  1CSB A;  3LIE A;  4HB1 A;  2H7H A;  1YFC A;  1GL2 C;  1GU5 A;  1R5S A;  1L0N D;  2A45 H;  3O8Z A;  1X22 A;  3O20 A;  1X0T A;  2N3B A;  2OQQ A;  3D6Y A;  1NTK K;  4IL6 H;  2NPS C;  1JO5 A;  1VPC A;  5APV A;  4GT1 A;  2AXT E;  3L72 E;  1ZME C;  3CCL P;  1SQP D;  3HRN A;  1K8A Q;  1FCD C;  5GTI V;  1AQT A;  2OTK E;  3JCU H;  1DII C;  2C1D A;  1C6O A;  1JTH A;  3A0H E;  4O1Q A;  1Y47 A;  1MZ4 A;  2JQR A;  4NPD A;  4H13 B;  1OW8 A;  1JNM A;  2VHD A;  2KOG A;  1DT1 A;  2DGE A;  3RL0 C;  2D2C D;  5KTB A;  2IBZ E;  1IJD B;  5AW8 B;  2WSE H;  5AVZ B;  1N7L A;  3I56 P;  1H33 B;  4FA1 A;  1JY2 O;  3H1L G;  3L73 E;  1LT9 B;  2Z5I A;  2QJK B;  1BGY J;  3NWV A;  5H2F V;  1VQ7 P;  3AE7 C;  2KLV A;  3H32 A;  3HE5 B;  5AUR A;  1VQ9 P;  3TDK A;  4JF7 A;  1N86 A;  2C2C A;  3FXD A;  2AXT H;  3HD7 B;  3HTK A;  1SFC C;  1CSW A;  1LNQ A;  1LTI C;  3CI9 A;  4HH2 A;  2QA4 P;  2WSC J;  1A02 J;  4R4M A;  2WT7 A;  3H1L J;  3CCS P;  3L4O A;  3B5N B;  1DX7 A;  2KIK A;  1NU1 K;  1NTM J;  4GOE A;  2OYH A;  2XTS B;  1NWQ A;  2E76 B;  2Q5U A;  2JWD A;  3H25 A;  2L4D A;  1VF5 C;  3OCD A;  1L0L K;  3WFD C;  1VQ8 P;  3O0R C;  2A45 I;  3CLQ A;  3P8C E;  2Q3I A;  3V4Q A;  4ZKU A;  4DJG A;  2AEJ A;  3AE4 C;  1OVU A;  3CL3 D;  3H1H E;  2HOD B;  3FGA D;  5CCH D;  2FXO A;  5APX A;  3A9F A;  3L72 D;  2Q6Q A;  3VTP C;  1MG2 D;  4Q5P A;  1FZC B;  4V2K A;  3ZCF A;  1L0N K;  4UB8 E;  3TGU J;  1NH4 A;  3WU2 H;  5CCH A;  3T97 B;  1GK4 A;  1LWU B;  1ZLL A;  1RZ6 A;  4JYC A;  2YMY A;  1FI3 A;  4HJG H;  3U1A A;  1G1I A;  1SQP K;  2IBZ D;  5CCG D;  4RSZ A;  2QM7 A;  5APQ A;  3VYI A;  2N18 C;  1RHZ B;  3PRJ A;  1QEX A;  1JM0 A;  4LLH A;  1H9Y A;  5C39 A;  1HH0 A;  1QKS A;  3PLN A;  4WQ8 A;  4H44 D;  1GIW A;  1NYH A;  1U57 A;  3KZI E;  5CYT R;  4C7N A;  1IFI A;  1U75 B;  2N1T B;  1DH3 A;  4WY4 C;  4PV1 B;  1H1O A;  4KHX A;  4WBA A;  1AVY A;  2GC4 D;  2BCC J;  2A06 E;  1BE3 J;  4IFM A;  3CU4 A;  3CC4 P;  1EDJ A;  3VRD A;  3E1R A;  3SSU A;  1T2K D;  2IDB A;  2NRG A;  1S1C X;  2W90 A;  2P10 A;  1COR A;  2FFD A;  1M1J A;  2WSS H;  1KV4 A;  2Y0E A;  1YIC A;  1KQG B;  4H0L C;  3P8C D;  3VMZ A;  2WWW A;  2OYI A;  3SWY A;  3H1H D;  2YQB A;  2NPS B;  3ZBM A;  2G3A A;  3M06 A;  4OH8 B;  1A8C A;  2GA1 A;  2O1J A;  2AEM A;  1CHJ A;  4K3A A;  1SQB G;  1JEK A;  1YIJ P;  3KZI H;  1YEB A;  2JKV A;  2C9X B;  3L75 G;  3PTZ A;  1SQX J;  1H0T A;  2KS1 A;  4GOF A;  1KB9 H;  2Y0D A;  5KJ7 A;  2IYP A;  1G2C B;  3X39 A;  2ZXX A;  3HE4 A;  3BAT A;  3U59 A;  2I8F A;  3M0D A;  5AVW B;  1SQV E;  1KMI Z;  1FJK A;  1R0Q A;  1LTB C;  4MU8 A;  1HVV A;  3S4R A;  4EI2 A;  4I7Z B;  1KZU B;  1SQQ G;  1C6S A;  5CBO A;  1Q81 Q;  1QYZ A;  3H1K G;  4ZNC A;  2IFM A;  1I5T A;  3SXT A;  2GB8 B;  5TIS V;  1H31 A;  1QVG O;  3O6Q B;  2M8R A;  3CP5 A;  4H13 D;  5CIC B;  1SQB E;  1SFC B;  1YQ3 C;  3L75 E;  5KAI V;  1JOC A;  1FOS F;  2A06 D;  1FS0 E;  2BEQ D;  3RK3 B;  2E43 A;  3B71 A;  5APY A;  2K9J A;  2KZI A;  3D71 A;  1LC2 A;  5B5E V;  1VF5 B;  5IY5 1;  1NGM B;  1KX7 A;  1M57 D;  2QJY C;  5AVR B;  1N73 B;  2O1K A;  2IZ1 A;  2V07 A;  2WPR A;  1DEE G;  3WMM 0;  1PP9 D;  1QGK B;  3BVH A;  2BH5 X;  2ZVN B;  3A0B E;  1SQQ E;  2H88 C;  3MTU E;  3KYQ A;  3G9R A;  3HD7 D;  3NBS A;  2KSE A;  1HZV A;  2M0B A;  1C2R A;  3CMA P;  1KTM A;  2KB7 P;  1NTZ E;  1CRJ A;  4BRY B;  1KB9 I;  2YMK A;  1S5L V;  1MFZ A;  5KLV G;  3B5N D;  4D6T J;  3WUU A;  1FAV A;  2Q9I A;  2EXV A;  2V7Q H;  1LTS C;  2E76 D;  5AVX B;  1J1E C;  4DT0 A;  1L9B C;  2XU6 A;  3OAK A;  1KD1 Q;  1VDF A;  4UB6 V;  1K9M Q;  3CX5 D;  3CCQ P;  1SQV D;  1WVE C;  3PXW A;  1RF0 C;  1MG3 D;  2N18 B;  2ZYG A;  1DVV A;  1AV1 A;  4BWN A;  4Y28 J;  5GTI H;  5CHX A;  4ZKP A;  2ZT9 C;  1CYJ A;  3IF4 A;  2KLU A;  4WY4 B;  3L4M A;  1G1J A;  1TU3 F;  1C2N A;  1RH5 B;  2BLF B;  1C6R A;  1K05 A;  3H1J J;  3RN1 A;  2E74 C;  1S5L X;  3VN0 A;  3DMI A;  1QLE D;  4U3F G;  5APU A;  4NPE A;  4PJ0 E;  2M3E A;  4NPF X;  1K3H A;  2CK3 H;  3F89 A;  2ZZS 1;  4N0K A;  2BPB B;  1LT1 A;  5CIG B;  1JY3 P;  1DW2 A;  1HRC A;  1M60 A;  1L0N J;  2POH A;  4LC1 A;  2N9B A;  1SVF A;  3R2P A;  1URQ C;  4H0L B;  4IFD K;  3AE6 C;  4IOI H;  3A3Y B;  3EFF K;  2HPC A;  2N1T D;  2ZYA A;  3L71 E;  4PV1 D;  1U74 B;  1CSU A;  3GHG C;  1RE4 C;  1RY3 A;  3A2A A;  1SQP J;  1DW1 A;  4FA4 A;  5B66 V;  2QM8 A;  4K35 A;  1SQQ D;  2Q3E A;  1M6Z A;  3HUS A;  2W83 C;  3E7K A;  1NTZ D;  2R44 A;  3AEE C;  2GM4 A;  2GUV A;  3ZOY A;  3K5B A;  2XND H;  1P84 E;  2IX7 C;  4QMA A;  1BSN A;  1ZR2 A;  1CYI A;  2AI5 A;  3AE1 C;  4RJT A;  1MFT A;  3JSV C;  2W8Z A;  2P7J A;  4PJ0 H;  1FJP A;  2ORL A;  5TJH A;  1FZF A;  4Z1M H;  3P7K A;  1KN7 A;  4IL6 E;  2E75 D;  3HQ9 A;  4K3I A;  2FYU E;  3MP7 B;  2NPS D;  3CWB G;  1QL2 A;  3RGU A;  1OX3 A;  3JCU E;  2MTA C;  3BAS A;  1PZQ A;  5CIB B;  3WFE C;  2K1A A;  1FZB A;  5AW0 B;  1AOQ A;  3CX5 W;  3BCC E;  3LID A;  1SQV K;  2ZOO A;  1IFP A;  2Z5H A;  3TF5 A;  3H1I E;  2BGV X;  2O3J A;  1W5C T;  1H32 B;  1GK6 A;  1KQF B;  1N7S A;  3AEF C;  2OTL P;  1N50 A;  1IZN B;  5CJ4 A;  2H89 C;  1EXI A;  3OA8 B;  1QL1 A;  1L4A C;  4XXL A;  5E79 V;  3CCE P;  2Z4E A;  4RO0 A;  1LC1 A;  2DVH A;  1P84 H;  1T6A A;  3SFD C;  1PGJ A;  2QJY B;  1RZ5 A;  4WQ9 A;  4PWA A;  1GZL A;  1VYD A;  3RBX A;  1OW6 A;  1ZRT E;  1S3J A;  3L71 D;  1IO4 A;  1H9X A;  3L72 J;  3CWB E;  1FBM A;  2AEF A;  1BGY G;  4JCG A;  1OCD A;  1SFC D;  3N4X A;  1JUN A;  2OGU A;  4XE5 B;  2YCC A;  1FU1 A;  1L9J C;  4GOD A;  5BU5 A;  4I6M C;  1BCC D;  5GTH V;  4DZO A;  1MKM A;  3S9O A;  2LXC B;  2P58 A;  1ZV8 A;  1P84 D;  3O6Q A;  1CYC A;  4QAO A;  1J1E B;  1CI6 A;  4YE1 A;  1VF5 D;  2UWJ E;  1CXA A;  5C9M A;  2IZ0 A;  1USE A;  3ZOX A;  3PH0 A;  2QG4 A;  1NAF A;  1NTZ K;  1RF1 A;  1IK9 A;  3G3Z A;  4AQR D;  2FYU D;  1YCC A;  1BL9 A;  1NTM G;  2I1K A;  3L36 A;  4AX3 A;  2H8P D;  1N73 A;  4AAN A;  5BU8 B;  2ZT9 B;  1RAP A;  2CA4 B;  4LJI A;  3SLE A;  3WU2 E;  1ZOY C;  3BCC D;  1CSV A;  3O5C A;  1OZH A;  2LIT A;  1PGP A;  3H1I D;  4DY9 A;  1KC8 Q;  1DD4 A;  1LTJ B;  2R32 A;  3AE3 C;  3P8M C;  3HQ7 A;  1ZR4 A;  3ZDM A;  1YJN P;  1VQP P;  2CPB A;  2KP8 A;  1EDK A;  1CSX A;  3TGU G;  3DR0 A;  1P84 I;  1X79 B;  4Y99 C;  3SWS A;  3PHL A;  4YXD C;  1GW3 A;  4EIE A;  1QL3 A;  2M5A B;  1KIL B;  1HZU A;  2KI7 B;  1URQ B;  3CXH H;  3MUD A;  1ZRT D;  3H1L E;  4Y5R A;  3H1H J;  1S9K E;  4WY4 D;  3NFQ A;  2B87 B;  1AA0 A;  2ZFC A;  5AW4 B;  3CWB D;  2D2C C;  2Q1K A;  3WFB C;  1ZW0 A;  4OGQ C;  3B4S A;  2HR3 A;  2C9N Y;  2PFX A;  2R5D A;  1NNO A;  1I55 A;  1IQC A;  3AE5 C;  4EIF A;  4WQD A;  4O9B A;  1LS9 A;  3PXT A;  1RE3 A;  5B5E H;  2AIU A;  2CXB A;  4MN4 C;  5KAF V;  4RKU J;  4WQB A;  2BCC G;  1BE3 G;  1IFD A;  2WVR A;  3L70 G;  1CTY A;  2PRR A;  2QRX A;  1JY2 P;  4H0L D;  3GG2 A;  1JDL A;  1DW3 A;  3TGU E;  3L73 D;  2OYH C;  1PFI A;  1L2P A;  1HJ5 A;  3U1C A;  1DD3 A;  3TNU B;  2GIW A;  3CCU P;  3RK3 C;  3PXS A;  1YTZ T;  5AW7 B;  5CCG A;  1YYC A;  3FWL A;  2G8Y A;  1FJ0 A;  4WWI A;  4FB1 A;  1HH7 A;  1LTG C;  2WSC H;  3TSI A;  1DEB A;  1NHL A;  3PP5 A;  1KB9 E;  1E2R A;  1COT A;  1KFM A;  1NO4 A;  2ZYD A;  2OTJ P;  1Q2N A;  3WC8 A;  2FYU K;  3TK1 A;  3CCJ P;  3I55 P;  3L70 J;  1AFO A;  2KZJ A;  1HCM A;  2FRC A;  1W2L A;  1SQX G;  3OA7 A;  5CCH C;  2BCN B;  2D0W A;  4H0K A;  2YIU C;  2C9L Y;  2J59 M;  2W6A A;  5AVQ B;  1Q82 Q;  2LXB A;  1DIQ C;  3VMA A;  1GL2 B;  5AVU B;  1BE3 E;  2W27 A;  3CXH I;  1PGO A;  2FY8 A;  2PGD A;  2N9Y B;  3H1L D;  3D70 A;  1PP9 J;  5AW1 B;  2DW3 A;  2BEZ F;  3Q1M A;  3GMA A;  2KNC B;  1KYO I;  1MZ9 A;  1N2D C;  3Q5R A;  1YTZ I;  3AE9 C;  4JPZ B;  3VYM A;  4EIC A;  2B9B A;  5AVV B;  3WUV A;  4C46 A;  1LFM A;  2J5U A;  1BDD A;  3VNW A;  3M91 A;  3RL0 B;  5C0Z A;  3KXD A;  1HWT C;  1X8Y A;  2JP3 A;  1KIL E;  1SQV J;  2C0W A;  1GTW A;  1NTK G;  1T3J A;  1SQX E;  1KOR A;  1PL5 A;  2AXT V;  3VOP A;  3ZIY A;  1IRW A;  1K3G A;  1B7V A;  2FFD C;  1M1J C;  2Y9Y A;  3A5T A;  3M9H A;  4DOJ A;  3CC2 P;  3A0H V;  1USD A;  451C A;  1T2K C;  2OYI C;  2O01 J;  1KB9 D;  1VQO P;  4GKG A;  3P32 A;  1EDL A;  1C75 A;  4ZMD A;  3KPE A;  1YNR A;  1Y8A A;  1BSH A;  3L74 J;  2C1D B;  1RQV A;  1NTK J;  1IK7 A;  1JTH B;  1VQK P;  2D0S A;  5KJ7 C;  1PPJ G;  1CNO A;  2YO3 A;  4D6T G;  4Y99 B;  1YJW P;  4OWF A;  1CRY A;  1YTC A;  4N78 E;  5GTI E;  1OFC X;  1A2S A;  1ZZH A;  3M0D C;  1BE3 D;  2WPV B;  1D7M A;  3EFG A;  1GDT A;  2WSF J;  2FYN C;  1H33 A;  1VQL P;  1LT9 A;  1JMB A;  2W6J H;  1N90 A;  1HGV A;  2ZVO B;  4OGQ B;  1CZQ A;  3H1K E;  5M1B A;  2P67 A;  3H32 B;  1C52 A;  3HE5 A;  1CRH A;  1EZV G;  1OAE A;  1NU1 G;  4YTP C;  3FX0 A;  1CTJ A;  4BXL A;  2WTY A;  1H88 A;  1IZL 0;  2FXP A;  3RK2 C;  1H8A A;  3HD7 A;  1L0L G;  2ZXY A;  3HTK B;  1CIH A;  2XDJ A;  1QL4 A;  1NIR A;  1LTJ A;  2RH0 A;  3H1J G;  3G71 P;  2W6B A;  3FWN A;  3CD6 P;  1KIL D;  2WT7 B;  3H6P A;  1URQ D;  5AW3 B;  1SQX D;  1KQS O;  1VQ6 P;  3B5N A;  1PPJ E;  2B11 B;  3L4F A;  2OYH B;  4PD4 H;  4H13 C;  2ZJS E;  5CJ0 A;  3OCD B;  4I1L A; 
#chains in the Genus database with same CATH homology
 2MHM A;  3O0R C;  1HJ3 A;  1IRV A;  5KKZ B;  3WUI A;  1A56 A;  1N50 A;  3SJL A;  4UB8 V;  3OA8 B;  3OA8 A;  3TGU D;  1FI7 A;  4XXL A;  5E79 V;  1KV9 A;  1LC1 A;  2DVH A;  3A9F A;  3L72 D;  5CIE B;  3WFD C;  1CRC A;  1SQB D;  2FWL A;  1RZ5 A;  2QJY B;  4PWA A;  4WQ9 A;  3L75 D;  5CID B;  1VYD A;  1MG2 D;  4Q5P A;  4V2K A;  3ZCF A;  1KX2 A;  3O1Y A;  3CXH W;  1GJQ A;  3RN0 A;  4FA5 A;  1GU2 A;  3ORV A;  3L71 D;  2Y0C A;  1H9X A;  4AAO A;  1I8O A;  1RZ6 A;  1FI3 A;  4JCG A;  1OCD A;  3KZI V;  2IBZ D;  4PW9 B;  1KYO W;  4RSZ A;  2YCC A;  4J20 A;  1L9J C;  2N18 C;  3PRJ A;  1BCC D;  1N15 A;  5GTH V;  4AAM A;  1H9Y A;  1P84 D;  1QKS A;  3PLN A;  1CYC A;  2PCC B;  4QAO A;  4WQ8 A;  4YE1 A;  1GIW A;  4WQC A;  5CYT R;  1CXA A;  3H1K D;  5C9M A;  3M97 X;  2BCC D;  4FA9 A;  3L70 D;  3ZOX A;  1U75 B;  2C1U A;  2QG4 A;  1ETP A;  2CE1 A;  3WU2 V;  1H1O A;  2FYU D;  4L1Q A;  1YCC A;  1BL9 A;  2N3Y A;  1GKS A;  4AX3 A;  2JWA A;  2B12 B;  1AKK A;  2GC4 D;  4AAN A;  3CU4 A;  1CIE A;  3ZOO A;  1F1F A;  1RAP A;  3VRD A;  1IO3 A;  3MK7 C;  2CA4 B;  4LJI A;  3SLE A;  1I8P A;  3BCC D;  5DFS A;  1CSV A;  3O5C A;  1E29 A;  2B4Z A;  2LIT A;  1HRO A;  1CXC A;  1COR A;  3H1I D;  5DJQ B;  4DY9 A;  1YEA A;  1FI9 A;  2CA3 B;  2Y0E A;  1S6V B;  3HQ7 A;  1YIC A;  4A7P A;  1CED A;  1YIQ A;  3H1H D;  2YQB A;  1CSX A;  3DR0 A;  1CHH A;  3ZBM A;  3SWS A;  3PHL A;  1A8C A;  1CRI A;  1CHJ A;  4EIE A;  1QL3 A;  1HJ4 A;  1YEB A;  3HQ6 A;  2C9X B;  1HZU A;  1CIG A;  2PCB B;  1NML A;  3PTZ A;  2KS1 A;  1ZRT D;  4Y5R A;  2Y0D A;  5KLV D;  2JTI B;  3X39 A;  351C A;  2ZON G;  3CWB D;  1CO6 A;  4L3G A;  4EID A;  2CE0 A;  3WFB C;  2YK3 A;  3PH2 B;  2I8F A;  4WQ7 A;  2FYN B;  1NNO A;  1R0Q A;  1I55 A;  4MU8 A;  1IQC A;  2YIU B;  4EIF A;  4O1W A;  4NFG B;  4PD4 D;  4WQD A;  3SVW A;  1LS9 A;  3PXT A;  2AIU A;  2CXB A;  4WQE A;  1M70 A;  5KAF V;  2C1V A;  1C6S A;  2RMZ A;  4WQB A;  1QYZ A;  1I5T A;  3L74 D;  2RN0 A;  1CTY A;  1N9C A;  1NTK D;  1QN2 A;  3GG2 A;  1JDL A;  1DW3 A;  3SXT A;  3NBT A;  2GB8 B;  3GW6 A;  5TIS V;  3L73 D;  1AYG A;  1C7M A;  1HJ5 A;  1H31 B;  1H31 A;  4GYD A;  3CP5 A;  5CIC B;  2GIW A;  1CRG A;  1NMI A;  3PXS A;  2OZ1 A;  5KAI V;  2A06 D;  3FWL A;  4U3F D;  1FJ0 A;  1I54 A;  4FB1 A;  1HH7 A;  1WEJ F;  2K9J B;  1E2R A;  1COT A;  1KB0 A;  2ZBO A;  1LC2 A;  2BH4 X;  3A0B V;  3WC8 A;  5B5E V;  5CIH B;  4GED B;  5IY5 1;  1CIF A;  1KX7 A;  4L3H A;  1KIB A;  4FAN A;  2V07 A;  2HV4 A;  1HCM A;  2FRC A;  1W2L A;  1PPJ D;  2BCN B;  2D0W A;  4H0K A;  1PP9 D;  2QJP B;  2BH5 X;  4H0J A;  3RMZ A;  4D6T D;  4P4Q B;  1GQ1 A;  1DIQ C;  3NBS A;  2V08 A;  3VMA A;  1HZV A;  1C2R A;  1FHB A;  1CCH A;  3JBT B;  1CRJ A;  1J3S A;  3RLM A;  2N9Y B;  3H1L D;  1S5L V;  3KHU A;  1LMS A;  5B6Q A;  2EXV A;  3C2C A;  1CC5 A;  2KNC B;  1L9B C;  3ITK A;  5DF5 A;  3VYM A;  1EZV D;  4UB6 V;  4EIC A;  3CX5 D;  1SQV D;  1NU1 D;  1WVE C;  3PXW A;  1MG3 D;  2N18 B;  1CHI A;  3TYI A;  1LFM A;  2N9I A;  1L0L D;  3DP5 A;  155C A;  1DVV A;  3VNW A;  5C0Z A;  1F1C A;  3H1J D;  2LIR A;  3HQ8 A;  2C8S A;  1CYJ A;  5EXQ A;  2GC7 D;  4PJ0 V;  5CIF B;  3L4M A;  1C2N A;  2AXT V;  2BLF B;  3ZIY A;  1E8E A;  1IRW A;  1C6R A;  3RN1 A;  1K3G A;  1B7V A;  5DJQ C;  1FOC A;  1YFC A;  1RAQ A;  3DMI A;  1L0N D;  3O20 A;  3CXH D;  2N3B A;  3A0H V;  3ZOW A;  451C A;  3MK7 B;  2B10 B;  2B0Z B;  1KB9 D;  1K3H A;  4KMG A;  2ZZS 1;  1C75 A;  1AOF A;  4N0K A;  2BPB B;  3CYT I;  1YNR A;  1SQP D;  5CIG B;  1DW2 A;  1FCD C;  1HRC A;  1M60 A;  3WFC C;  2OZ1 B;  5GTI V;  1KYO D;  1EB7 A;  2C1D B;  1DII C;  2C1D A;  1C6O A;  4O1Q A;  2D0S A;  1MZ4 A;  2JQR A;  1U74 B;  1CSU A;  1CNO A;  2VHD A;  1DW1 A;  4AAL A;  4FA4 A;  5B66 V;  1DT1 A;  2DGE A;  1SQQ D;  4FAV A;  2Q3E A;  1CRY A;  1M6Z A;  1BGY D;  1YTC A;  1A2S A;  1ZZH A;  1GDV A;  4WQA A;  1BE3 D;  2L91 A;  1NTZ D;  1H33 B;  1H33 A;  4FA1 A;  4IL6 V;  3ZOY A;  1N90 A;  1CCR A;  2QJK B;  3NWV A;  5H2F V;  2PAC A;  1CYI A;  1DW0 A;  4EDF A;  2AI5 A;  4RJT A;  1C52 A;  5AUR A;  1CRH A;  5KLI B;  1OAE A;  1I6D A;  2ORL A;  5TJH A;  3TDK A;  1CTJ A;  2C2C A;  3HQ9 A;  4K3I A;  1IZL 0;  4XYD B;  1NTM D;  1I6E A;  1CTZ A;  2ZXY A;  1CIH A;  1QL4 A;  1NIR A;  2MTA C;  1CSW A;  2N9J A;  5CIB B;  3WFE C;  1AOQ A;  1SQX D;  3CX5 W;  3L4O A;  2B11 B;  2ZOO A;  2XTS B;  2L4D A;  1DVH A;  3TF5 A;  3OCD B;  3OCD A;  2BGV X;  2O3J A;  1W5C T;  1H32 B;  1H32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...