3H1LD

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1lD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1lD02
3H1ID 1E29A 4QAOA 4IL6V 1M6ZA 1I8OA 1WVEC 1N9CA 4EIDA 2YIUB 3VRDA 1FJ0A 3A0HV 4UB6V 4YE1A 2GC7D 4H0JA 2FRCA 3ZCFA 1KIBA 1NMIA 1BGYD 2BPBB 3DMIA 1FI3A 4FA9A 3RN0A 3L4OA 4WQ8A 1CTJA 1YICA 2GC4D 3ZOWA 3PLNA 1AYGA 4MU8A 5KKZB 1LS9A 1CO6A 4XXLA 4JCGA 3A0BV 3CP5A 3VYMA 4K3IA 3L71D 4FA5A 3TDKA 4U3FD 5CIEB 1GDVA 1CYIA 1I6EA 2QJPB 3WFDC 2RN0A 1MG2D 4WQ7A 1DVVA 2BH4X 4WQ9A 2LITA 1L0ND 5IY51 2EXVA 1IRVA 1CIHA 1FOCA 4H0KA 2B0ZB 1RAQA 1GQ1A 2I8FA 4Q5PA 3TGUD 2PCBB 1CRCA 1BCCD 3O1YA 1IRWA 3PXWA 1B7VA 4WQBA 4A7PA 1GIWA 1H32A 1KB9D 3MK7C 3OA8B 3PH2B 1CCHA 1CEDA 3H1JD 4FA4A 1CRYA 3GG2A 2Y0CA 1FI7A 1H33B 5AURA 1OAEA 4L3HA 2XTSB 2QJKB 2CA3B 155CA 5B66V 1NTZD 3SLEA 1S5LV 2PCCB 1CRHA 3CU4A 5H2FV 2V08A 1I54A 1CSUA 1HCMA 1H32B 4KMGA 3VMAA 1C6SA 2N9YB 1HH7A 2D0WA 1RZ6A 5CICB 1KX2A 1J3SA 1NNOA 2JWAA 1AOQA 4RJTA 4WQEA 1HJ5A 5CIGB 1IZL0 4FB1A 3FWLA 5GTIV 5DFSA 4O1QA 3A9FA 4PW9B 1HZVA 3HQ6A 1M70A 2K9JB 1CIGA 2Y0EA 3CX5W 1CRIA 351CA 3ZOOA 1HJ3A 2AI5A 2N18C 3ZOYA 4WQAA 5B6QA 3WFCC 451CA 4J20A 3DR0A 2BCNB 1YFCA 1SQXD 3L72D 5KLVD 1R0QA 1F1FA 2C2CA 5KAIV 2ZOOA 2N18B 2ZONG 5DJQC 2B4ZA 1W2LA 3WC8A 3CYTI 3SWSA 3KHUA 3O5CA 3PRJA 1A2SA 4FANA 4PJ0V 1C2RA 4AALA 4D6TD 3WFBC 1H9XA 2B12B 1DIQC 2JQRA 1ZRTD 4UB8V 2MTAC 3SXTA 2PACA 3PXSA 1CSWA 1DIIC 4AAOA 1ETPA 2B11B 3OA8A 1E2RA 3SJLA 1NIRA 1DW2A 1HJ4A 3H1LD 5CIHB 1CHHA 1LFMA 3SVWA 3M97X 4EDFA 4DY9A 1H33A 5CIFB 5E79V 1KV9A 4RSZA 1L9JC 3PXTA 2N3BA 2AIUA 2CE0A 1W5CT 2BH5X 2D0SA 3KZIV 1CXAA 3NBTA 2AXTV 1AOFA 2YK3A 1CTZA 3H1HD 2Y0DA 3ITKA 2C8SA 4N0KA 1DW3A 1KYOW 1I8PA 1SQPD 1NU1D 1GU2A 4GEDB 1FI9A 3CX5D 4AAMA 2CXBA 1QYZA 1RAPA 1ZZHA 1DT1A 1C6OA 3JBTB 3MK7B 1EZVD 1I5TA 4P4QB 2YQBA 1CIEA 1U74B 1NTKD 1C75A 1YEBA 4AX3A 5GTHV 1YEAA 4FA1A 1A56A 1KX7A 1KB0A 1SQQD 3ZBMA 1OCDA 1QL4A 1C7MA 1DW1A 3H1KD 1K3GA 2OZ1B 3GW6A 5B5EV 1DVHA 4EICA 5EXQA 4Y5RA 2CA4B 4NFGB 3BCCD 2BLFB 1LC1A 3RLMA 1I6DA 4O1WA 4L3GA 3ORVA 2CE1A 1I55A 2JTIB 2N9IA 4EIFA 2QJYB 2ZBOA 4LJIA 5KLIB 1K3HA 3L4MA 2L4DA 1MZ4A 2MHMA 1CSXA 1NTMD 2O3JA 3L74D 1DW0A 2L91A 2FWLA 1KYOD 3WUIA 4PWAA 5CIDB 1N15A 3ZIYA 1N50A 2YCCA 1QL3A 1A8CA 3C2CA 3CXHW 4XYDB 4EIEA 2C1UA 1NMLA 1YCCA 1SQBD 1CHJA 3RN1A 2B10B 3NBSA 1C6RA 1GJQA 5CIBB 5DJQB 2N3YA 2BCCD 2VHDA 1FCDC 2RMZA 1S6VB 1H9YA 3PHLA 1MG3D 2QG4A 2C1DA 1EB7A 2KS1A 2KNCB 2ZXYA 3HQ7A 3WU2V 5C0ZA 3RMZA 2IBZD 2V07A 4AANA 1CXCA 1M60A 5TISV 4WQDA 3ZOXA 1GKSA 3L75D 1C2NA 1H31A 1QN2A 1CSVA 1HRCA 4WQCA 1N90A 1U75B 2C9XB 2OZ1A 1PP9D 4PD4D 1L0LD 2ORLA 2FYUD 1L9BC 2C1DB 1BL9A 3O20A 1YIQA 3HQ9A 2LIRA 3L70D 1LC2A 3NWVA 3DP5A 1VYDA 4GYDA 1IQCA 1JDLA 3OCDA 3WFEC 2C1VA 2BGVX 1FHBA 1LMSA 5TJHA 3CWBD 2A06D 4V2KA 2ZZS1 1HZUA 3CXHD 1CYCA 3TF5A 1SQVD 4FAVA 3O0RC 1F1CA 1H31B 1CHIA 1AKKA 1CIFA 2GB8B 2Q3EA 1IO3A 1PPJD 3VNWA 1H1OA 1P84D 1E8EA 1CRJA 2DGEA 1YNRA 1BE3D 3PTZA 1YTCA 1RZ5A 2HV4A 1CYJA 3TYIA 2FYNB 1HROA 1CC5A 5CYTR 3X39A 3OCDB 1CCRA 5KAFV 1CORA 3HQ8A 5DF5A 1QKSA 4L1QA 3L73D 1CNOA 1CRGA 2DVHA 2GIWA 1COTA 1C52A 1CTYA 5C9MA 2N9JA 1WEJF
chains in the Genus database with same CATH superfamily
2SPZA 3H32B 1L4AD 2P2UA 2OYHB 3CCSP 4PD4H 1WVEC 3TYYA 1MFZA 1GK6A 4R4MA 4EIDA 2YIUB 1DH3A 3A0HV 4UB6V 1VF5D 3B5ND 3LIEA 2GC7D 4PD4E 1L0LE 3NTNA 1FI3A 4FA9A 2WSFJ 1A02J 1CTJA 1YICA 5CJ4A 3CCJP 1AYGA 1L0NJ 3O6QA 2QJPC 5KKZB 2H89C 1NH4A 4L73A 4UB8H 4GODA 1Q7YQ 3A0BV 3VYMA 1WRGA 5CIEB 1GDVA 3Q5SA 4UB8E 1J1DB 1I6EA 2ZT9C 3WFDC 1JCDA 3SWYA 2RN0A 1JB0J 1HJBA 3IR9A 1IRVA 1JY3O 3HD7A 2B0ZB 2YMYA 1GQ1A 2I8FA 1L0LK 3FX0A 1GW4A 4Q5PA 4BWNA 1L0LG 2AXTH 3TGUD 1SFCB 2KK7A 1CRCA 3L70G 4H0LC 4H44C 1DD3A 2JWDA 2AXTE 3PJSK 2IYOA 3RGUA 1GIWA 1X79B 1HF9A 1JY3P 1CZQA 1OW8A 2BASA 3H1JD 4FA4A 2IFMA 3N4XA 5KJ7A 4DZOA 4RO0A 5AURA 2XTSB 4Y99C 2QJKB 5GTHH 1NTZD 3L72E 1HWTC 1S9KD 3CC4P 1CRHA 5GTHE 4KMGA 4BRYA 2Q6QA 1C6SA 2KSEA 4D6TE 3QWOC 1EXJA 1RE3C 4EI2A 5KLVJ 4ZKPA 1U57A 3A9FA 2C0WA 1JUNA 3H1LE 2OQQA 1CIGA 2FFDB 2N18C 1PFIA 3VOPA 2GUVA 3V2PA 1AA0A 1YFCA 3I5CA 1SQXD 1IJDB 1F1FA 5KAIV 1YIJP 3USSA 3SWSA 3CYTI 3FWNA 1XTGB 3O5CA 4PV1D 1T3UA 2KXPB 2B12B 3C8VA 4HJGH 1DIQC 2JQRA 4UB8V 1DIIC 3AE1C 2O01N 2B11B 1KQGB 4OWFA 5CHXA 5CIHB 2E75C 1NTKE 3H1HJ 1FZAA 3AE3C 2IPPA 3TSIA 1NU1J 1Y9BA 2KUBA 1U7JA 2J59M 3PH0A 3PXTA 1RY3A 4AQRD 2N3BA 4HH2A 3NBTA 1CXAA 2AXTV 2Y0DA 2Q7CA 1MUUA 4N0KA 1L4AA 1KYOW 1GU2A 5AW4B 1QGKB 4H44B 4H0LB 1RAPA 1SQQJ 2WSCJ 3H1KJ 2E76D 3JBTB 3M9HA 1EZVD 3E1IA 1LWUC 1NTKK 1CIEA 1U74B 2R3CA 4OH8B 3CCVP 1YEBA 3P7KA 4AX3A 2IZ1A 3L74E 5GTHV 1RE3A 3G6EP 3L37A 1KX7A 1AQ5A 4Y99B 5AVTB 1T8ZA 3L36A 2ZXXA 2W8ZA 3OA7A 1MKMA 1JY3N 1ZRTE 1S5LH 4Y5RA 1JM0A 2CA4B 2BLFB 2WITA 5KLIC 2I1KA 5KTBA 3I55P 2OTKE 3ORVA 2JTIB 3MTUE 1NOHA 2KIKA 2QJYB 3V2QA 3W68A 5CMZA 1FZBA 1KILD 3N7NA 1Q90D 2D2CC 2L4DA 3AE5C 1RE4A 2PGDA 1VL2A 1Y47A 3WUIA 3L74G 1N15A 1URQD 4XYDB 5AVRB 3WMM0 1SQPE 1N7SC 1YCCA 1SQBK 3M0AA 2KYVA 2VRSA 5AW2B 1QVFO 1HBWA 3EWKA 2M0BA 3PHLA 1MG3D 2KS1A 2V7QJ 4O9BA 5CCGC 1HJ0A 3RMZA 3R2PA 3G71P 2ITAA 4JF7A 5AVQB 1L0LJ 1M60A 2I8DA 1JTHA 3L70J 2E75B 3L75D 1BE3E 1HRCA 1U75B 1LWUA 1K73Q 1SQPK 2OZ1A 1IK9A 2E5TA 3CC2P 2YMKA 4ZKUA 1VQ5P 1KORA 1SQPG 1QVGO 2H43A 2NRGA 1YIQA 3LIDA 2LIRA 1LC2A 3NWVA 1VYDA 4GYDA 2IBZI 2ZYAA 3OCDA 4EYYQ 1CW5A 2YO3A 2KI7B 3FGAD 4KHXA 5L8RJ 2A06D 1HZUA 4N78E 1CYCA 2KB7P 3TF5A 3B4SA 4RKUJ 1AKKA 2GB8B 4W80A 1HUCA 2O1JA 2YO2A 1LWUB 1ZLLA 3GF7A 1CRJA 3PTZA 4N3YB 5K5GB 1YTCA 2FYNB 1HROA 3R4YA 4IL6X 4JYCA 3AE7C 2Q9IA 3OCDB 1CCRA 3F89A 2JDIH 1YQ3C 1K04A 1KMIZ 2K1AA 3HD7D 5DF5A 1YJWP 1AJYA 2OYHC 4TLFA 1CRGA 3E7KA 2GIWA 5C9MA 3TNUA 3H1ID 2WPVB 1NTMG 3OW2O 4QAOA 5APVA 1M6ZA 1I8OA 1N9CA 1OW7A 1RHZB 1RH5B 2P1JA 2K9YA 3P8MC 1PP9E 3A7OA 2FRCA 3KYQA 4EIJA 2WSEJ 3TGUE 2BPBB 1JEKA 3DMIA 2WSSH 2QA4P 4WQ8A 1N7SB 3AEGC 3CWBE 2QM7A 1ZMEC 2CPSA 1SQVE 3H1JE 3AEDC 4K3IA 2QIWA 1PV3A 3L71D 1JCCA 1CYIA 1PPJE 1IC2A 4KJMA 4DT0A 2E5YA 1L0ND 1SFCC 1OVRA 2EXVA 2FXPA 3KXDA 1FOCA 1YJNP 1RAQA 5BVZA 2KLUA 1PP9G 2JP3A 1R5LA 2Z4EA 3VMYA 3V2NA 1KILA 1YJ9P 3H6PA 2PCBB 3TGUG 4Z1MH 3PXWA 2LXBA 3D0WA 5AW9B 1OMIA 1YTZI 1H32A 1KB9D 2ZT9D 3MK7C 3OA8B 3PH2B 3BRVB 3CWBG 1SQVK 3T97A 5CCHC 1ZN5A 5CJ0A 1LP1A 3C9IA 1SQVG 1RF0C 2YNYA 1PGPA 1FZCC 1IO4A 1H33B 1OAEA 1PIXA 1PPJG 2OYHA 2CA3B 155CA 3G4SP 3SLEA 4H44D 4H0LD 1BGYE 2PAJA 2M3BA 3CU4A 1H32B 2KP8A 4XFJA 4TT3H 2AEFA 3M0DC 1HH7A 3T97B 1OXZA 3M06A 1AV1A 1KX2A 3L73G 2FFDC 1LTAC 1WT6A 4U3FE 2W90A 1IFDA 4WQEA 4FB1A 3L74J 1K9MQ 3HQ6A 4I2LC 2XNDH 351CA 3ZOOA 1BDCA 1USEA 1HJ3A 2YKOA 3QH9A 3ZOYA 3G9RA 451CA 4J20A 1LNQA 3CD6P 3BATA 3MP7B 5APSA 2GA1A 3IF4A 5KLVD 1EDJA 1DX7A 1BCCE 4GT1A 2ZOOA 1BGYG 4NPEA 4LLHA 1GD2E 3MHVA 2B4ZA 3WC8A 3KQGA 3HE4A 1SFCA 2YKPA 3M9QA 3WFBC 1YYCA 2B89A 3IN6A 4U3FG 2FBWC 1GK4A 5APXA 3M91A 1EZVE 3WU2H 5DJTB 3RK3C 3M97X 2B87B 3F5HA 3A2AA 1SQPJ 1BSHA 5TISH 3WU2E 3BVHA 1NKNA 1KV9A 4RSZA 3JCUH 2A45H 2AIUA 2IX7C 5TISE 3HE4B 1G1IA 1RF0A 3CL3D 3JCUE 1BCCG 1CTZA 3H1HD 2XKMA 1J2JB 2AEMA 4RESB 3AE9C 1NU1D 1YITP 3CX5D 4L75A 4LC1A 4DJGA 2E75D 2K37A 1R5SA 3SFDC 1FJPA 1ZZHA 2LKMA 2KSJA 2Q1KA 2K88A 3MK7B 1QLED 1OZHA 3NMDA 4HB1A 1EZVG 2FFDA 1YEAA 2KLVA 3MGNA 1FZCB 2O1KA 2P7JA 2R32A 2WPSA 1SQQD 1M56D 3NXSA 1QL4A 3H1KD 1AVOA 2BEZF 3U1CA 2ZFCA 2KZJA 3GW6A 1UIXA 1DVHA 2QJYC 4EICA 4OGQB 3V4QA 2A45G 2W6JH 1H0TA 1NTMJ 2KOGA 4MN4C 1M90Q 1EZVI 1JY2N 1I55A 2N9IA 4OVNF 3Q5RA 3L4MA 4QMAA 3HUSC 1MZ4A 1CSXA 2BCCJ 4IL6H 1S2EA 2FWLA 3L72G 2A45I 3ZIYA 1N50A 1QL3A 4YXDC 1YI2P 2NPSB 2HG5D 2C1UA 4IL6E 1H0TB 2QE7H 1LTJC 3FXEA 1SP4A 3P8CE 3NBSA 4D6TG 1C6RA 2O01J 2WZ7A 4WVZA 3GHGC 1FCDC 2D2CD 1S6VB 1H9YA 1CI6B 2QG4A 1EDIA 4PJ0H 1EB7A 2R5DA 2A06E 3H1LG 3WU2V 5C0ZA 1NGMB 2HFED 1BDDA 3AE8C 5APTA 1PP9J 3B71A 2B88A 3D6YA 4WWIA 2OTLP 1CXCA 5TISV 4WQDA 3SSUA 1N7SD 3JSVC 3TGUJ 1M1JC 2ZVOB 3RK3B 3AEEC 1FBMA 1C2NA 1FDIA 1H31A 1QN2A 1CSVA 2E74B 2C9XB 1VQ9P 3CWBJ 3BCCE 1OVUA 1SQVJ 4PD4D 1FOSE 1L0LD 2FYUD 5APQA 2ZVNB 1L9BC 3HE5B 5CCGD 1FC2C 3L70D 4IFMA 4ASWA 1JDLA 2C1VA 2H7HA 1LT9C 4V2KA 2J5UA 2KZIA 3CXHD 1NTKG 1AFOA 1GU5A 3O0RC 1F1CA 2FYNC 1H31B 1IZNB 1CIFA 2Q3EA 2V4HA 3VNWA 1P84D 1E8EA 1S3JA 1G1JA 1LTTC 2J58A 3L73J 1SQBE 1QL1A 1RZ5A 1CYJA 3TYIA 2OGUA 5EFWB 2XU6A 1MZ9A 3BCCG 1PL5A 1CORA 1S5LE 4EOTA 3HQ8A 3OAKA 1CNOA 2IBZE 1C52A 1CTYA 3L71E 1VF5B 3B5NB 3RL0C 1KD1Q 3RBXA 3GHGA 1AVYA 1BGYJ 3CC7P 3FXDA 4IL6V 2QVAA 2DW3A 1FS0E 1FJ0A 3HUSB 5AW6B 1SQBG 1KIBA 4U3FJ 1NMIA 2R44A 3RN0A 3L4OA 1RQUA 4XA4A 2GC4D 2FYZA 2G8YA 1LTJB 4AUWA 3V5BA 4KT0J 3GHGB 4JCGA 4FA5A 1NO4A 2IBZG 3TDKA 2MJZA 1T2KC 3L71G 2BEQD 2N9BA 2YXQB 1BCCJ 3VTPC 1DVVA 2BH4X 5APWA 1LT9A 1FOSF 5E79H 1M1JB 2N1TB 5E79E 3O1YA 1N73B 2QSIA 4JPZB 1B7VA 4A7PA 2Q5UA 5APYA 1YBKA 1M8OB 3V4WA 1SFCD 1UIIA 3GG2A 3CLQA 1LT9B 1GL2C 2P10A 1FI7A 4L76A 5AVUB 4H13C 1USDA 1BE3G 1IFJA 5AW0B 1S5LV 2PCCB 3AEAC 2R5BA 1OFCX 1CSUA 1ZV8A 1HCMA 2GM4A 3VMXA 5CCHD 1SVFA 1VPCA 2D0WA 1FZEA 1RZ6A 3CMEP 2OYIC 1N7SA 1QX8A 1PGJA 4GDOA 1J3SA 3CCLP 2Z5HA 1NNOA 2JWAA 1A02F 1W2BO 3L72J 1IZL0 4ASVA 4O1QA 1QEXA 4PW9B 1VQLP 1HZVA 1M70A 1Y8AA 2K9JB 2Y0EA 1FU1A 1CRIA 1KFMA 2AI5A 4GKGA 3RL0B 4D6TJ 1N7LA 1LTIC 5CCGA 3DR0A 3L35A 5KLVK 1R0QA 2C2CA 2LR2A 3S4RA 3CX5H 1W2LA 3KHUA 4UB6H 3H1LJ 1N8RQ 1C2RA 4AALA 3II6A 1PGOA 2PP6A 1E79H 1ZRTD 2MTAC 2Y9YA 3PXSA 1CSWA 2E43A 1ETPA 4WBAA 3VMZA 1GZLA 1VQOP 2WT7B 3OA8A 3C1LA 1E2RA 3SJLA 1NIRA 1LFMA 1NTZE 2WSCH 3OJAB 4L74A 5BU8B 3SFEC 3BASA 1S9KE 2R3SA 1OIPA 4EDFA 1H33A 5CIFB 5E79V 2H8PD 4AYCA 1L9JC 2HYNA 3H1KE 1W5CT 2BH5X 1GL2A 2D0SA 3D71A 4K35A 2E76B 3ITKA 4NPDA 1NTKJ 1DW3A 1NU1K 3MZWB 1SQPD 2POHA 1FI9A 2OYOA 3PP5A 3RK3D 4AAMA 1QYZA 1IFMA 3H1JG 1SS1A 2AEJA 4DCKA 3ABVC 1C6OA 3L4FA 2AXCA 2YQBA 1NTZK 1SQXE 3BCCJ 4IFFA 1NTZG 1GL2B 4YTPC 4FA1A 4OGQC 5AVSB 1KB0A 1C7MA 4H13B 3K5BA 4YPCA 1K3GA 3CX5I 1FAVA 1X8YA 2W83C 2WMMA 5APUA 1KFNA 1I6DA 1YQ4C 3IAOA 1K8AQ 3LW5H 2CE1A 5KJ7C 2OYIB 2WPQA 3HRNA 3VYIA 3D70A 4LJIA 1SQBJ 2NPSC 1DD4A 1ZOYC 1KZUB 2B87A 1SQXK 1NTMD 2L5GB 2JKVA 3WUVA 1KC8Q 2O3JA 1DW0A 1SQXG 1KYOD 4PWAA 5CIDB 1A8CA 3C2CA 1EC5A 1R8EA 1EQ7A 1MV8A 2FKWB 4EIEA 2M5AB 5AW8B 1NMLA 3CCUP 1CHJA 1LT1A 2C0XA 2FYUE 2B10B 4N6JA 4XE5B 3L71J 5CIBB 5KAIH 3L70E 3NFQA 2BCCD 3MIWA 2RMZA 3EFFK 3CXHH 4WY4C 1N2DC 2C1DA 1LGHB 5KAIE 1FE6A 2OARA 4JYBA 3CXHE 2RKLA 4K3AA 1KN7A 2ZYGA 2E74C 2V07A 1P84H 2QRXA 2ZAEB 5CCHA 3ZOXA 2I1JA 3AE4C 1P84E 1ZXGA 1M1KQ 1FZCA 4R4LA 2IZ0A 4WQCA 3CI9A 3M9BA 1PP9D 4Y28J 3CCQP 2FYUK 2C1DB 1BL9A 2FYUG 3HQ9A 2P67A 3O6QB 3AEFC 1KILE 4U7JA 1JMMA 3WFEC 1IFNA 1BE3J 3M0DA 3RK2C 1FHBA 1TU3F 2W27A 3CWBD 2N1TD 1SQVD 4FAVA 1X0TA 1Q82Q 1DIPA 1U7MA 1IO3A 3A5TA 1ZW0A 1PPJD 1JOCA 1H1OA 4PD4I 3HD7B 2HPCA 2DGEA 1YNRA 5B66H 3HTKA 1L4AC 2NPSA 1OX3A 1Q81Q 5CYTR 1HVVA 5H2FH 5B66E 3X39A 1VF5C 3B5NC 3O8ZA 3VP8A 2WSEH 3CXHI 5H2FE 1W2EA 2K3RA 4L1QA 3L73D 1M7LA 1QL2A 2DVHA 1CI6A 1NWQA 5AW3B 1OWAA 3V6IA 1FZGA 2XZRA 4W7ZA 2OTJP 4HKZH 5GTIH 2IFNA 1P84I 3KPEA 1MFTA 1WEJF 3L75E 2P58A 2JR8A 2CPBA 2ZXEB 2HPCB 1NYHA 4WY4A 1E29A 3HTKB 5GTIE 1KTMA 2E42A 4I7ZB 3VP9A 1H8AA 3Q1MA 3VRDA 4YE1A 1ZR2A 4H0JA 3ZCFA 3U1AA 1BGYD 4BRYB 3B8EB 1GMJA 1J1EC 2ZJSE 3HE5A 3ZOWA 2W6AA 3PLNA 3RL0D 1NJIQ 4MU8A 3VN0A 1LS9A 1CO6A 4XXLA 1RE4C 4PJ0E 3CP5A 4WY4B 1S4XA 1PGQA 4HYTB 5CBOA 4U3FD 1IK7A 2QJPB 2WVRA 1MG2D 4WQ7A 3L75G 2N1TC 4WQ9A 2LITA 3CPWO 5IY51 1M57D 1N73C 1NVOA 1CIHA 4H0KA 1T3JA 1OW6A 3EQ2A 3H1JJ 3S1KA 2ZT9B 1LTBC 3MD0A 1H89A 3KZIH 1E5WA 1BCCD 1IRWA 4M3LA 3KZIE 1PZQA 1T2KD 4WQBA 1NTZJ 3UIAA 4B86A 5DJUB 4DOJA 1KQLA 2A06G 3H1IE 1FDMA 1CCHA 1CEDA 5AVYB 1CRYA 3SWKA 2FY8A 3BRTB 3B5NA 1VQPP 4C7RA 2Y0CA 1S72P 3RK2B 2WPRA 2ZYDA 4W7YA 1RQVA 4L3HA 1RF1C 1VQNP 5B66V 2M3EA 3HUSA 4GOEA 1AQTA 5H2FV 2V08A 1I54A 1L4AB 3VMAA 4CPGA 5B5EH 2N9YB 2XDJA 1D7MA 5AVVB 5CICB 2WSFH 1GL2D 1LTJA 2WWWA 5B5EE 1VQ8P 3TK1A 1FZFA 1AOQA 4C46A 4RJTA 1VQKP 1SQXJ 1HJ5A 5CIGB 2LXCB 3FWLA 2UWJE 4H13D 5GTIV 4PV1C 5DFSA 3E1RA 3H1IG 1L0NE 3CX5W 1GW3A 4WQAA 5B6QA 3WFCC 2C9NY 4GIFA 1G2CA 3AE2C 2BCNB 3L72D 2HR3A 1KB9H 1N86A 2N18B 1JMBA 1M1JA 2ZONG 3KDPB 5DJQC 1DEEG 2N1TA 3PRJA 1KB9E 1A2SA 4FANA 3U59A 4PJ0V 1XTCC 3LW5J 4D6TD 1N73A 1H9XA 3RL0g 3RK3E 1KQSO 1NAFA 1J1EB 3SXTA 2PACA 3MUDC 4AAOA 1YHQP 5CBNA 1DW2A 1G2CB 3GMAA 5AW7B 1HJ4A 3H1LD 1OVVA 2MKVA 1CHHA 3SVWA 1L0NK 1VQ7P 2HLOA 1VDFA 2M8RA 1L0NG 4DY9A 2E76C 1VQ4P 2FYUJ 1LTGC 5C39A 2JO1A 2CE0A 3KZIV 3ZDMA 1AOFA 2YK3A 2QEXP 1LTSC 5AVXB 3H25A 1EDLA 2C8SA 1K05A 3EFGA 1RF1A 1I8PA 1Q2NA 2B9BA 4GEDB 2YKQA 3P8CD 3CMAP 4I1LA 1S1CX 2CXBA 2KS1B 1BSNA 1X22A 1HTLC 1DT1A 2FXOA 5M1BA 2Q3IA 2JEEA 1KYOH 1I5TA 4P4QB 1NTKD 2K9JA 3I56P 1NTME 1JTHB 1C75A 5KLVE 1EXIA 5AW1B 3Q3DA 1A56A 1KYOE 2IDBA 3JC22 1KILC 1Q86Q 3ZBMA 1OCDA 4ZNCA 1KB9I 3D6ZA 1DW1A 1RF1B 2OZ1B 2H88C 3V2RA 1T6AA 2IYPA 2JJLA 5B5EV 1NAYA 4GOFA 4LGDE 1URQC 5EXQA 3WUUA 1X9VA 4NFGB 3BCCD 3RLMA 1LC1A 4O1WA 2BCCE 2G3AA 5KAFH 2FXMA 4L3GA 4IFDK 1SLQA 2O01H 4EIFA 5KAFE 4ZMDA 1CSBA 4OGQD 2ZBOA 2WT7A 5KLIB 1K3HA 1GU4A 3P32A 2HODA 2KNCA 4PV1B 2YIUC 1NKZB 3A3YB 2MHMA 3S9OA 1NTMK 1JO5A 3MUDA 3L74D 2L91A 4C7NA 5KLVG 2YCCA 1WMKA 3CXHW 5BU5A 3SWFA 4I6MC 3H1HE 3A0HH 2D2CB 1KQFB 1W5CE 1NU1E 3CX5E 1SQBD 3RN1A 1IFPA 3A0HE 4IOIH 4UB6E 5KJ7D 1GJQA 5KKZC 1FJKA 1LJ2A 5DJQB 1EDKA 3Q5PA 2N3YA 2VHDA 3AECC 2NPSD 3L75J 1KV4A 2BCCG 1HH0A 3WUTA 1J1DC 2HODB 2KNCB 1ZP0C 2ZXYA 3HQ7A 3AEBC 4NPFX 2WTYA 3A0BH 3TNUB 1YTZT 1KYOI 3Q2YA 1VQ6P 2IBZD 1GTWA 4AANA 4C7NB 1HGZA 1FDOA 1SQQE 3A0BE 4JBZA 1GKSA 2Z5IA 3IFMA 4JQ0D 4WB4A 2XNXA 2XV5A 1N90A 1DEBA 4WY4D 3H1HG 3RBZA 2PRRA 2W6BA 2WQYC 1NU1G 2ORLA 5AW5B 3O20A 1JY2O 2C9LY 2E74D 3DP5A 3L73E 1IQCA 1IFIA 3GLMA 1S5LX 1ZR4A 2BGVX 4YXWH 3CCEP 1LMSA 2OYIA 3CCRP 5TJHA 2GUSA 2ZZS1 1URQA 3HD7C 2QJKC 1HGVA 1CHIA 1SQQK 2Y9ZA 2CK3H 1NHLA 5AVWB 1JY2P 1SQQG 3H32A 2QM8A 3H1KG 1BE3D 2NZ2A 2PFXA 3W67A 2RH0A 2HV4A 1KILB 3GF3A 3CCMP 1CC5A 2M5AA 3G3ZA 3H1IJ 3RK2D 5KAFV 1L2PA 5AVZB 1Z56A 1QKSA 1URQB 2YXRB 1VQMP 1COTA 4I7ZC 1JNMA 1LP1B 3AE6C 1H88A 2N9JA 2V7QH 1GDTA 4BXLA 4N78D
chains in the Genus database with same CATH topology
3H1ID 1E29A 4QAOA 4IL6V 1M6ZA 1I8OA 1WVEC 1N9CA 4EIDA 2YIUB 3VRDA 1FJ0A 3A0HV 4UB6V 4YE1A 2GC7D 4H0JA 2FRCA 3ZCFA 1KIBA 1NMIA 1BGYD 2BPBB 3DMIA 1FI3A 4FA9A 3RN0A 3L4OA 4WQ8A 1CTJA 1YICA 2GC4D 3ZOWA 3PLNA 1AYGA 4MU8A 5KKZB 1LS9A 1CO6A 4XXLA 4JCGA 3A0BV 3CP5A 3VYMA 4K3IA 3L71D 4FA5A 3TDKA 4U3FD 5CIEB 1GDVA 1CYIA 1I6EA 2QJPB 3WFDC 2RN0A 1MG2D 4WQ7A 1DVVA 2BH4X 4WQ9A 2LITA 1L0ND 5IY51 2EXVA 1IRVA 1CIHA 1FOCA 4H0KA 2B0ZB 1RAQA 1GQ1A 2I8FA 4Q5PA 3TGUD 2PCBB 1CRCA 1BCCD 3O1YA 1IRWA 3PXWA 1B7VA 4WQBA 4A7PA 1GIWA 1H32A 1KB9D 3MK7C 3OA8B 3PH2B 1CCHA 1CEDA 3H1JD 4FA4A 1CRYA 3GG2A 2Y0CA 1FI7A 1H33B 5AURA 1OAEA 4L3HA 2XTSB 2QJKB 2CA3B 155CA 5B66V 1NTZD 3SLEA 1S5LV 2PCCB 1CRHA 3CU4A 5H2FV 2V08A 1I54A 1CSUA 1HCMA 1H32B 4KMGA 3VMAA 1C6SA 2N9YB 1HH7A 2D0WA 1RZ6A 5CICB 1KX2A 1J3SA 1NNOA 2JWAA 1AOQA 4RJTA 4WQEA 1HJ5A 5CIGB 1IZL0 4FB1A 3FWLA 5GTIV 5DFSA 4O1QA 3A9FA 4PW9B 1HZVA 3HQ6A 1M70A 2K9JB 1CIGA 2Y0EA 3CX5W 1CRIA 351CA 3ZOOA 1HJ3A 2AI5A 2N18C 3ZOYA 4WQAA 5B6QA 3WFCC 451CA 4J20A 3DR0A 2BCNB 1YFCA 1SQXD 3L72D 5KLVD 1R0QA 1F1FA 2C2CA 5KAIV 2ZOOA 2N18B 2ZONG 5DJQC 2B4ZA 1W2LA 3WC8A 3CYTI 3SWSA 3KHUA 3O5CA 3PRJA 1A2SA 4FANA 4PJ0V 1C2RA 4AALA 4D6TD 3WFBC 1H9XA 2B12B 1DIQC 2JQRA 1ZRTD 4UB8V 2MTAC 3SXTA 2PACA 3PXSA 1CSWA 1DIIC 4AAOA 1ETPA 2B11B 3OA8A 1E2RA 3SJLA 1NIRA 1DW2A 1HJ4A 3H1LD 5CIHB 1CHHA 1LFMA 3SVWA 3M97X 4EDFA 4DY9A 1H33A 5CIFB 5E79V 1KV9A 4RSZA 1L9JC 3PXTA 2N3BA 2AIUA 2CE0A 1W5CT 2BH5X 2D0SA 3KZIV 1CXAA 3NBTA 2AXTV 1AOFA 2YK3A 1CTZA 3H1HD 2Y0DA 3ITKA 2C8SA 4N0KA 1DW3A 1KYOW 1I8PA 1SQPD 1NU1D 1GU2A 4GEDB 1FI9A 3CX5D 4AAMA 2CXBA 1QYZA 1RAPA 1ZZHA 1DT1A 1C6OA 3JBTB 3MK7B 1EZVD 1I5TA 4P4QB 2YQBA 1CIEA 1U74B 1NTKD 1C75A 1YEBA 4AX3A 5GTHV 1YEAA 4FA1A 1A56A 1KX7A 1KB0A 1SQQD 3ZBMA 1OCDA 1QL4A 1C7MA 1DW1A 3H1KD 1K3GA 2OZ1B 3GW6A 5B5EV 1DVHA 4EICA 5EXQA 4Y5RA 2CA4B 4NFGB 3BCCD 2BLFB 1LC1A 3RLMA 1I6DA 4O1WA 4L3GA 3ORVA 2CE1A 1I55A 2JTIB 2N9IA 4EIFA 2QJYB 2ZBOA 4LJIA 5KLIB 1K3HA 3L4MA 2L4DA 1MZ4A 2MHMA 1CSXA 1NTMD 2O3JA 3L74D 1DW0A 2L91A 2FWLA 1KYOD 3WUIA 4PWAA 5CIDB 1N15A 3ZIYA 1N50A 2YCCA 1QL3A 1A8CA 3C2CA 3CXHW 4XYDB 4EIEA 2C1UA 1NMLA 1YCCA 1SQBD 1CHJA 3RN1A 2B10B 3NBSA 1C6RA 1GJQA 5CIBB 5DJQB 2N3YA 2BCCD 2VHDA 1FCDC 2RMZA 1S6VB 1H9YA 3PHLA 1MG3D 2QG4A 2C1DA 1EB7A 2KS1A 2KNCB 2ZXYA 3HQ7A 3WU2V 5C0ZA 3RMZA 2IBZD 2V07A 4AANA 1CXCA 1M60A 5TISV 4WQDA 3ZOXA 1GKSA 3L75D 1C2NA 1H31A 1QN2A 1CSVA 1HRCA 4WQCA 1N90A 1U75B 2C9XB 2OZ1A 1PP9D 4PD4D 1L0LD 2ORLA 2FYUD 1L9BC 2C1DB 1BL9A 3O20A 1YIQA 3HQ9A 2LIRA 3L70D 1LC2A 3NWVA 3DP5A 1VYDA 4GYDA 1IQCA 1JDLA 3OCDA 3WFEC 2C1VA 2BGVX 1FHBA 1LMSA 5TJHA 3CWBD 2A06D 4V2KA 2ZZS1 1HZUA 3CXHD 1CYCA 3TF5A 1SQVD 4FAVA 3O0RC 1F1CA 1H31B 1CHIA 1AKKA 1CIFA 2GB8B 2Q3EA 1IO3A 1PPJD 3VNWA 1H1OA 1P84D 1E8EA 1CRJA 2DGEA 1YNRA 1BE3D 3PTZA 1YTCA 1RZ5A 2HV4A 1CYJA 3TYIA 2FYNB 1HROA 1CC5A 5CYTR 3X39A 3OCDB 1CCRA 5KAFV 1CORA 3HQ8A 5DF5A 1QKSA 4L1QA 3L73D 1CNOA 1CRGA 2DVHA 2GIWA 1COTA 1C52A 1CTYA 5C9MA 2N9JA 1WEJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1I D;  1E29 A;  4QAO A;  4IL6 V;  1M6Z A;  1I8O A;  1WVE C;  1N9C A;  4EID A;  2YIU B;  3VRD A;  1FJ0 A;  3A0H V;  4UB6 V;  4YE1 A;  2GC7 D;  4H0J A;  2FRC A;  3ZCF A;  1KIB A;  1NMI A;  1BGY D;  2BPB B;  3DMI A;  1FI3 A;  4FA9 A;  3RN0 A;  3L4O A;  4WQ8 A;  1CTJ A;  1YIC A;  2GC4 D;  3ZOW A;  3PLN A;  1AYG A;  4MU8 A;  5KKZ B;  1LS9 A;  1CO6 A;  4XXL A;  4JCG A;  3A0B V;  3CP5 A;  3VYM A;  4K3I A;  3L71 D;  4FA5 A;  3TDK A;  4U3F D;  5CIE B;  1GDV A;  1CYI A;  1I6E A;  2QJP B;  3WFD C;  2RN0 A;  1MG2 D;  4WQ7 A;  1DVV A;  2BH4 X;  4WQ9 A;  2LIT A;  1L0N D;  5IY5 1;  2EXV A;  1IRV A;  1CIH A;  1FOC A;  4H0K A;  2B0Z B;  1RAQ A;  1GQ1 A;  2I8F A;  4Q5P A;  3TGU D;  2PCB B;  1CRC A;  1BCC D;  3O1Y A;  1IRW A;  3PXW A;  1B7V A;  4WQB A;  4A7P A;  1GIW A;  1H32 A;  1KB9 D;  3MK7 C;  3OA8 B;  3PH2 B;  1CCH A;  1CED A;  3H1J D;  4FA4 A;  1CRY A;  3GG2 A;  2Y0C A;  1FI7 A;  1H33 B;  5AUR A;  1OAE A;  4L3H A;  2XTS B;  2QJK B;  2CA3 B;  155C A;  5B66 V;  1NTZ D;  3SLE A;  1S5L V;  2PCC B;  1CRH A;  3CU4 A;  5H2F V;  2V08 A;  1I54 A;  1CSU A;  1HCM A;  1H32 B;  4KMG A;  3VMA A;  1C6S A;  2N9Y B;  1HH7 A;  2D0W A;  1RZ6 A;  5CIC B;  1KX2 A;  1J3S A;  1NNO A;  2JWA A;  1AOQ A;  4RJT A;  4WQE A;  1HJ5 A;  5CIG B;  1IZL 0;  4FB1 A;  3FWL A;  5GTI V;  5DFS A;  4O1Q A;  3A9F A;  4PW9 B;  1HZV A;  3HQ6 A;  1M70 A;  2K9J B;  1CIG A;  2Y0E A;  3CX5 W;  1CRI A;  351C A;  3ZOO A;  1HJ3 A;  2AI5 A;  2N18 C;  3ZOY A;  4WQA A;  5B6Q A;  3WFC C;  451C A;  4J20 A;  3DR0 A;  2BCN B;  1YFC A;  1SQX D;  3L72 D;  5KLV D;  1R0Q A;  1F1F A;  2C2C A;  5KAI V;  2ZOO A;  2N18 B;  2ZON G;  5DJQ C;  2B4Z A;  1W2L A;  3WC8 A;  3CYT I;  3SWS A;  3KHU A;  3O5C A;  3PRJ A;  1A2S A;  4FAN A;  4PJ0 V;  1C2R A;  4AAL A;  4D6T D;  3WFB C;  1H9X A;  2B12 B;  1DIQ C;  2JQR A;  1ZRT D;  4UB8 V;  2MTA C;  3SXT A;  2PAC A;  3PXS A;  1CSW A;  1DII C;  4AAO A;  1ETP A;  2B11 B;  3OA8 A;  1E2R A;  3SJL A;  1NIR A;  1DW2 A;  1HJ4 A;  3H1L D;  5CIH B;  1CHH A;  1LFM A;  3SVW A;  3M97 X;  4EDF A;  4DY9 A;  1H33 A;  5CIF B;  5E79 V;  1KV9 A;  4RSZ A;  1L9J C;  3PXT A;  2N3B A;  2AIU A;  2CE0 A;  1W5C T;  2BH5 X;  2D0S A;  3KZI V;  1CXA A;  3NBT A;  2AXT V;  1AOF A;  2YK3 A;  1CTZ A;  3H1H D;  2Y0D A;  3ITK A;  2C8S A;  4N0K A;  1DW3 A;  1KYO W;  1I8P A;  1SQP D;  1NU1 D;  1GU2 A;  4GED B;  1FI9 A;  3CX5 D;  4AAM A;  2CXB A;  1QYZ A;  1RAP A;  1ZZH A;  1DT1 A;  1C6O A;  3JBT B;  3MK7 B;  1EZV D;  1I5T A;  4P4Q B;  2YQB A;  1CIE A;  1U74 B;  1NTK D;  1C75 A;  1YEB A;  4AX3 A;  5GTH V;  1YEA A;  4FA1 A;  1A56 A;  1KX7 A;  1KB0 A;  1SQQ D;  3ZBM A;  1OCD A;  1QL4 A;  1C7M A;  1DW1 A;  3H1K D;  1K3G A;  2OZ1 B;  3GW6 A;  5B5E V;  1DVH A;  4EIC A;  5EXQ A;  4Y5R A;  2CA4 B;  4NFG B;  3BCC D;  2BLF B;  1LC1 A;  3RLM A;  1I6D A;  4O1W A;  4L3G A;  3ORV A;  2CE1 A;  1I55 A;  2JTI B;  2N9I A;  4EIF A;  2QJY B;  2ZBO A;  4LJI A;  5KLI B;  1K3H A;  3L4M A;  2L4D A;  1MZ4 A;  2MHM A;  1CSX A;  1NTM D;  2O3J A;  3L74 D;  1DW0 A;  2L91 A;  2FWL A;  1KYO D;  3WUI A;  4PWA A;  5CID B;  1N15 A;  3ZIY A;  1N50 A;  2YCC A;  1QL3 A;  1A8C A;  3C2C A;  3CXH W;  4XYD B;  4EIE A;  2C1U A;  1NML A;  1YCC A;  1SQB D;  1CHJ A;  3RN1 A;  2B10 B;  3NBS A;  1C6R A;  1GJQ A;  5CIB B;  5DJQ B;  2N3Y A;  2BCC D;  2VHD A;  1FCD C;  2RMZ A;  1S6V B;  1H9Y A;  3PHL A;  1MG3 D;  2QG4 A;  2C1D A;  1EB7 A;  2KS1 A;  2KNC B;  2ZXY A;  3HQ7 A;  3WU2 V;  5C0Z A;  3RMZ A;  2IBZ D;  2V07 A;  4AAN A;  1CXC A;  1M60 A;  5TIS V;  4WQD A;  3ZOX A;  1GKS A;  3L75 D;  1C2N A;  1H31 A;  1QN2 A;  1CSV A;  1HRC A;  4WQC A;  1N90 A;  1U75 B;  2C9X B;  2OZ1 A;  1PP9 D;  4PD4 D;  1L0L D;  2ORL A;  2FYU D;  1L9B C;  2C1D B;  1BL9 A;  3O20 A;  1YIQ A;  3HQ9 A;  2LIR A;  3L70 D;  1LC2 A;  3NWV A;  3DP5 A;  1VYD A;  4GYD A;  1IQC A;  1JDL A;  3OCD A;  3WFE C;  2C1V A;  2BGV X;  1FHB A;  1LMS A;  5TJH A;  3CWB D;  2A06 D;  4V2K A;  2ZZS 1;  1HZU A;  3CXH D;  1CYC A;  3TF5 A;  1SQV D;  4FAV A;  3O0R C;  1F1C A;  1H31 B;  1CHI A;  1AKK A;  1CIF A;  2GB8 B;  2Q3E A;  1IO3 A;  1PPJ D;  3VNW A;  1H1O A;  1P84 D;  1E8E A;  1CRJ A;  2DGE A;  1YNR A;  1BE3 D;  3PTZ A;  1YTC A;  1RZ5 A;  2HV4 A;  1CYJ A;  3TYI A;  2FYN B;  1HRO A;  1CC5 A;  5CYT R;  3X39 A;  3OCD B;  1CCR A;  5KAF V;  1COR A;  3HQ8 A;  5DF5 A;  1QKS A;  4L1Q A;  3L73 D;  1CNO A;  1CRG A;  2DVH A;  2GIW A;  1COT A;  1C52 A;  1CTY A;  5C9M A;  2N9J A;  1WEJ F; 
#chains in the Genus database with same CATH topology
 2SPZ A;  3H32 B;  1L4A D;  2P2U A;  2OYH B;  3CCS P;  4PD4 H;  1WVE C;  3TYY A;  1MFZ A;  1GK6 A;  4R4M A;  4EID A;  2YIU B;  1DH3 A;  3A0H V;  4UB6 V;  1VF5 D;  3B5N D;  3LIE A;  2GC7 D;  4PD4 E;  1L0L E;  3NTN A;  1FI3 A;  4FA9 A;  2WSF J;  1A02 J;  1CTJ A;  1YIC A;  5CJ4 A;  3CCJ P;  1AYG A;  1L0N J;  3O6Q A;  2QJP C;  5KKZ B;  2H89 C;  1NH4 A;  4L73 A;  4UB8 H;  4GOD A;  1Q7Y Q;  3A0B V;  3VYM A;  1WRG A;  5CIE B;  1GDV A;  3Q5S A;  4UB8 E;  1J1D B;  1I6E A;  2ZT9 C;  3WFD C;  1JCD A;  3SWY A;  2RN0 A;  1JB0 J;  1HJB A;  3IR9 A;  1IRV A;  1JY3 O;  3HD7 A;  2B0Z B;  2YMY A;  1GQ1 A;  2I8F A;  1L0L K;  3FX0 A;  1GW4 A;  4Q5P A;  4BWN A;  1L0L G;  2AXT H;  3TGU D;  1SFC B;  2KK7 A;  1CRC A;  3L70 G;  4H0L C;  4H44 C;  1DD3 A;  2JWD A;  2AXT E;  3PJS K;  2IYO A;  3RGU A;  1GIW A;  1X79 B;  1HF9 A;  1JY3 P;  1CZQ A;  1OW8 A;  2BAS A;  3H1J D;  4FA4 A;  2IFM A;  3N4X A;  5KJ7 A;  4DZO A;  4RO0 A;  5AUR A;  2XTS B;  4Y99 C;  2QJK B;  5GTH H;  1NTZ D;  3L72 E;  1HWT C;  1S9K D;  3CC4 P;  1CRH A;  5GTH E;  4KMG A;  4BRY A;  2Q6Q A;  1C6S A;  2KSE A;  4D6T E;  3QWO C;  1EXJ A;  1RE3 C;  4EI2 A;  5KLV J;  4ZKP A;  1U57 A;  3A9F A;  2C0W A;  1JUN A;  3H1L E;  2OQQ A;  1CIG A;  2FFD B;  2N18 C;  1PFI A;  3VOP A;  2GUV A;  3V2P A;  1AA0 A;  1YFC A;  3I5C A;  1SQX D;  1IJD B;  1F1F A;  5KAI V;  1YIJ P;  3USS A;  3SWS A;  3CYT I;  3FWN A;  1XTG B;  3O5C A;  4PV1 D;  1T3U A;  2KXP B;  2B12 B;  3C8V A;  4HJG H;  1DIQ C;  2JQR A;  4UB8 V;  1DII C;  3AE1 C;  2O01 N;  2B11 B;  1KQG B;  4OWF A;  5CHX A;  5CIH B;  2E75 C;  1NTK E;  3H1H J;  1FZA A;  3AE3 C;  2IPP A;  3TSI A;  1NU1 J;  1Y9B A;  2KUB A;  1U7J A;  2J59 M;  3PH0 A;  3PXT A;  1RY3 A;  4AQR D;  2N3B A;  4HH2 A;  3NBT A;  1CXA A;  2AXT V;  2Y0D A;  2Q7C A;  1MUU A;  4N0K A;  1L4A A;  1KYO W;  1GU2 A;  5AW4 B;  1QGK B;  4H44 B;  4H0L B;  1RAP A;  1SQQ J;  2WSC J;  3H1K J;  2E76 D;  3JBT B;  3M9H A;  1EZV D;  3E1I A;  1LWU C;  1NTK K;  1CIE A;  1U74 B;  2R3C A;  4OH8 B;  3CCV P;  1YEB A;  3P7K A;  4AX3 A;  2IZ1 A;  3L74 E;  5GTH V;  1RE3 A;  3G6E P;  3L37 A;  1KX7 A;  1AQ5 A;  4Y99 B;  5AVT B;  1T8Z A;  3L36 A;  2ZXX A;  2W8Z A;  3OA7 A;  1MKM A;  1JY3 N;  1ZRT E;  1S5L H;  4Y5R A;  1JM0 A;  2CA4 B;  2BLF B;  2WIT A;  5KLI C;  2I1K A;  5KTB A;  3I55 P;  2OTK E;  3ORV A;  2JTI B;  3MTU E;  1NOH A;  2KIK A;  2QJY B;  3V2Q A;  3W68 A;  5CMZ A;  1FZB A;  1KIL D;  3N7N A;  1Q90 D;  2D2C C;  2L4D A;  3AE5 C;  1RE4 A;  2PGD A;  1VL2 A;  1Y47 A;  3WUI A;  3L74 G;  1N15 A;  1URQ D;  4XYD B;  5AVR B;  3WMM 0;  1SQP E;  1N7S C;  1YCC A;  1SQB K;  3M0A A;  2KYV A;  2VRS A;  5AW2 B;  1QVF O;  1HBW A;  3EWK A;  2M0B A;  3PHL A;  1MG3 D;  2KS1 A;  2V7Q J;  4O9B A;  5CCG C;  1HJ0 A;  3RMZ A;  3R2P A;  3G71 P;  2ITA A;  4JF7 A;  5AVQ B;  1L0L J;  1M60 A;  2I8D A;  1JTH A;  3L70 J;  2E75 B;  3L75 D;  1BE3 E;  1HRC A;  1U75 B;  1LWU A;  1K73 Q;  1SQP K;  2OZ1 A;  1IK9 A;  2E5T A;  3CC2 P;  2YMK A;  4ZKU A;  1VQ5 P;  1KOR A;  1SQP G;  1QVG O;  2H43 A;  2NRG A;  1YIQ A;  3LID A;  2LIR A;  1LC2 A;  3NWV A;  1VYD A;  4GYD A;  2IBZ I;  2ZYA A;  3OCD A;  4EYY Q;  1CW5 A;  2YO3 A;  2KI7 B;  3FGA D;  4KHX A;  5L8R J;  2A06 D;  1HZU A;  4N78 E;  1CYC A;  2KB7 P;  3TF5 A;  3B4S A;  4RKU J;  1AKK A;  2GB8 B;  4W80 A;  1HUC A;  2O1J A;  2YO2 A;  1LWU B;  1ZLL A;  3GF7 A;  1CRJ A;  3PTZ A;  4N3Y B;  5K5G B;  1YTC A;  2FYN B;  1HRO A;  3R4Y A;  4IL6 X;  4JYC A;  3AE7 C;  2Q9I A;  3OCD B;  1CCR A;  3F89 A;  2JDI H;  1YQ3 C;  1K04 A;  1KMI Z;  2K1A A;  3HD7 D;  5DF5 A;  1YJW P;  1AJY A;  2OYH C;  4TLF A;  1CRG A;  3E7K A;  2GIW A;  5C9M A;  3TNU A;  3H1I D;  2WPV B;  1NTM G;  3OW2 O;  4QAO A;  5APV A;  1M6Z A;  1I8O A;  1N9C A;  1OW7 A;  1RHZ B;  1RH5 B;  2P1J A;  2K9Y A;  3P8M C;  1PP9 E;  3A7O A;  2FRC A;  3KYQ A;  4EIJ A;  2WSE J;  3TGU E;  2BPB B;  1JEK A;  3DMI A;  2WSS H;  2QA4 P;  4WQ8 A;  1N7S B;  3AEG C;  3CWB E;  2QM7 A;  1ZME C;  2CPS A;  1SQV E;  3H1J E;  3AED C;  4K3I A;  2QIW A;  1PV3 A;  3L71 D;  1JCC A;  1CYI A;  1PPJ E;  1IC2 A;  4KJM A;  4DT0 A;  2E5Y A;  1L0N D;  1SFC C;  1OVR A;  2EXV A;  2FXP A;  3KXD A;  1FOC A;  1YJN P;  1RAQ A;  5BVZ A;  2KLU A;  1PP9 G;  2JP3 A;  1R5L A;  2Z4E A;  3VMY A;  3V2N A;  1KIL A;  1YJ9 P;  3H6P A;  2PCB B;  3TGU G;  4Z1M H;  3PXW A;  2LXB A;  3D0W A;  5AW9 B;  1OMI A;  1YTZ I;  1H32 A;  1KB9 D;  2ZT9 D;  3MK7 C;  3OA8 B;  3PH2 B;  3BRV B;  3CWB G;  1SQV K;  3T97 A;  5CCH C;  1ZN5 A;  5CJ0 A;  1LP1 A;  3C9I A;  1SQV G;  1RF0 C;  2YNY A;  1PGP A;  1FZC C;  1IO4 A;  1H33 B;  1OAE A;  1PIX A;  1PPJ G;  2OYH A;  2CA3 B;  155C A;  3G4S P;  3SLE A;  4H44 D;  4H0L D;  1BGY E;  2PAJ A;  2M3B A;  3CU4 A;  1H32 B;  2KP8 A;  4XFJ A;  4TT3 H;  2AEF A;  3M0D C;  1HH7 A;  3T97 B;  1OXZ A;  3M06 A;  1AV1 A;  1KX2 A;  3L73 G;  2FFD C;  1LTA C;  1WT6 A;  4U3F E;  2W90 A;  1IFD A;  4WQE A;  4FB1 A;  3L74 J;  1K9M Q;  3HQ6 A;  4I2L C;  2XND H;  351C A;  3ZOO A;  1BDC A;  1USE A;  1HJ3 A;  2YKO A;  3QH9 A;  3ZOY A;  3G9R A;  451C A;  4J20 A;  1LNQ A;  3CD6 P;  3BAT A;  3MP7 B;  5APS A;  2GA1 A;  3IF4 A;  5KLV D;  1EDJ A;  1DX7 A;  1BCC E;  4GT1 A;  2ZOO A;  1BGY G;  4NPE A;  4LLH A;  1GD2 E;  3MHV A;  2B4Z A;  3WC8 A;  3KQG A;  3HE4 A;  1SFC A;  2YKP A;  3M9Q A;  3WFB C;  1YYC A;  2B89 A;  3IN6 A;  4U3F G;  2FBW C;  1GK4 A;  5APX A;  3M91 A;  1EZV E;  3WU2 H;  5DJT B;  3RK3 C;  3M97 X;  2B87 B;  3F5H A;  3A2A A;  1SQP J;  1BSH A;  5TIS H;  3WU2 E;  3BVH A;  1NKN A;  1KV9 A;  4RSZ A;  3JCU H;  2A45 H;  2AIU A;  2IX7 C;  5TIS E;  3HE4 B;  1G1I A;  1RF0 A;  3CL3 D;  3JCU E;  1BCC G;  1CTZ A;  3H1H D;  2XKM A;  1J2J B;  2AEM A;  4RES B;  3AE9 C;  1NU1 D;  1YIT P;  3CX5 D;  4L75 A;  4LC1 A;  4DJG A;  2E75 D;  2K37 A;  1R5S A;  3SFD C;  1FJP A;  1ZZH A;  2LKM A;  2KSJ A;  2Q1K A;  2K88 A;  3MK7 B;  1QLE D;  1OZH A;  3NMD A;  4HB1 A;  1EZV G;  2FFD A;  1YEA A;  2KLV A;  3MGN A;  1FZC B;  2O1K A;  2P7J A;  2R32 A;  2WPS A;  1SQQ D;  1M56 D;  3NXS A;  1QL4 A;  3H1K D;  1AVO A;  2BEZ F;  3U1C A;  2ZFC A;  2KZJ A;  3GW6 A;  1UIX A;  1DVH A;  2QJY C;  4EIC A;  4OGQ B;  3V4Q A;  2A45 G;  2W6J H;  1H0T A;  1NTM J;  2KOG A;  4MN4 C;  1M90 Q;  1EZV I;  1JY2 N;  1I55 A;  2N9I A;  4OVN F;  3Q5R A;  3L4M A;  4QMA A;  3HUS C;  1MZ4 A;  1CSX A;  2BCC J;  4IL6 H;  1S2E A;  2FWL A;  3L72 G;  2A45 I;  3ZIY A;  1N50 A;  1QL3 A;  4YXD C;  1YI2 P;  2NPS B;  2HG5 D;  2C1U A;  4IL6 E;  1H0T B;  2QE7 H;  1LTJ C;  3FXE A;  1SP4 A;  3P8C E;  3NBS A;  4D6T G;  1C6R A;  2O01 J;  2WZ7 A;  4WVZ A;  3GHG C;  1FCD C;  2D2C D;  1S6V B;  1H9Y A;  1CI6 B;  2QG4 A;  1EDI A;  4PJ0 H;  1EB7 A;  2R5D A;  2A06 E;  3H1L G;  3WU2 V;  5C0Z A;  1NGM B;  2HFE D;  1BDD A;  3AE8 C;  5APT A;  1PP9 J;  3B71 A;  2B88 A;  3D6Y A;  4WWI A;  2OTL P;  1CXC A;  5TIS V;  4WQD A;  3SSU A;  1N7S D;  3JSV C;  3TGU J;  1M1J C;  2ZVO B;  3RK3 B;  3AEE C;  1FBM A;  1C2N A;  1FDI A;  1H31 A;  1QN2 A;  1CSV A;  2E74 B;  2C9X B;  1VQ9 P;  3CWB J;  3BCC E;  1OVU A;  1SQV J;  4PD4 D;  1FOS E;  1L0L D;  2FYU D;  5APQ A;  2ZVN B;  1L9B C;  3HE5 B;  5CCG D;  1FC2 C;  3L70 D;  4IFM A;  4ASW A;  1JDL A;  2C1V A;  2H7H A;  1LT9 C;  4V2K A;  2J5U A;  2KZI A;  3CXH D;  1NTK G;  1AFO A;  1GU5 A;  3O0R C;  1F1C A;  2FYN C;  1H31 B;  1IZN B;  1CIF A;  2Q3E A;  2V4H A;  3VNW A;  1P84 D;  1E8E A;  1S3J A;  1G1J A;  1LTT C;  2J58 A;  3L73 J;  1SQB E;  1QL1 A;  1RZ5 A;  1CYJ A;  3TYI A;  2OGU A;  5EFW B;  2XU6 A;  1MZ9 A;  3BCC G;  1PL5 A;  1COR A;  1S5L E;  4EOT A;  3HQ8 A;  3OAK A;  1CNO A;  2IBZ E;  1C52 A;  1CTY A;  3L71 E;  1VF5 B;  3B5N B;  3RL0 C;  1KD1 Q;  3RBX A;  3GHG A;  1AVY A;  1BGY J;  3CC7 P;  3FXD A;  4IL6 V;  2QVA A;  2DW3 A;  1FS0 E;  1FJ0 A;  3HUS B;  5AW6 B;  1SQB G;  1KIB A;  4U3F J;  1NMI A;  2R44 A;  3RN0 A;  3L4O A;  1RQU A;  4XA4 A;  2GC4 D;  2FYZ A;  2G8Y A;  1LTJ B;  4AUW A;  3V5B A;  4KT0 J;  3GHG B;  4JCG A;  4FA5 A;  1NO4 A;  2IBZ G;  3TDK A;  2MJZ A;  1T2K C;  3L71 G;  2BEQ D;  2N9B A;  2YXQ B;  1BCC J;  3VTP C;  1DVV A;  2BH4 X;  5APW A;  1LT9 A;  1FOS F;  5E79 H;  1M1J B;  2N1T B;  5E79 E;  3O1Y A;  1N73 B;  2QSI A;  4JPZ B;  1B7V A;  4A7P A;  2Q5U A;  5APY A;  1YBK A;  1M8O B;  3V4W A;  1SFC D;  1UII A;  3GG2 A;  3CLQ A;  1LT9 B;  1GL2 C;  2P10 A;  1FI7 A;  4L76 A;  5AVU B;  4H13 C;  1USD A;  1BE3 G;  1IFJ A;  5AW0 B;  1S5L V;  2PCC B;  3AEA C;  2R5B A;  1OFC X;  1CSU A;  1ZV8 A;  1HCM A;  2GM4 A;  3VMX A;  5CCH D;  1SVF A;  1VPC A;  2D0W A;  1FZE A;  1RZ6 A;  3CME P;  2OYI C;  1N7S A;  1QX8 A;  1PGJ A;  4GDO A;  1J3S A;  3CCL P;  2Z5H A;  1NNO A;  2JWA A;  1A02 F;  1W2B O;  3L72 J;  1IZL 0;  4ASV A;  4O1Q A;  1QEX A;  4PW9 B;  1VQL P;  1HZV A;  1M70 A;  1Y8A A;  2K9J B;  2Y0E A;  1FU1 A;  1CRI A;  1KFM A;  2AI5 A;  4GKG A;  3RL0 B;  4D6T J;  1N7L A;  1LTI C;  5CCG A;  3DR0 A;  3L35 A;  5KLV K;  1R0Q A;  2C2C A;  2LR2 A;  3S4R A;  3CX5 H;  1W2L A;  3KHU A;  4UB6 H;  3H1L J;  1N8R Q;  1C2R A;  4AAL A;  3II6 A;  1PGO A;  2PP6 A;  1E79 H;  1ZRT D;  2MTA C;  2Y9Y A;  3PXS A;  1CSW A;  2E43 A;  1ETP A;  4WBA A;  3VMZ A;  1GZL A;  1VQO P;  2WT7 B;  3OA8 A;  3C1L A;  1E2R A;  3SJL A;  1NIR A;  1LFM A;  1NTZ E;  2WSC H;  3OJA B;  4L74 A;  5BU8 B;  3SFE C;  3BAS A;  1S9K E;  2R3S A;  1OIP A;  4EDF A;  1H33 A;  5CIF B;  5E79 V;  2H8P D;  4AYC A;  1L9J C;  2HYN A;  3H1K E;  1W5C T;  2BH5 X;  1GL2 A;  2D0S A;  3D71 A;  4K35 A;  2E76 B;  3ITK A;  4NPD A;  1NTK J;  1DW3 A;  1NU1 K;  3MZW B;  1SQP D;  2POH A;  1FI9 A;  2OYO A;  3PP5 A;  3RK3 D;  4AAM A;  1QYZ A;  1IFM A;  3H1J G;  1SS1 A;  2AEJ A;  4DCK A;  3ABV C;  1C6O A;  3L4F A;  2AXC A;  2YQB A;  1NTZ K;  1SQX E;  3BCC J;  4IFF A;  1NTZ G;  1GL2 B;  4YTP C;  4FA1 A;  4OGQ C;  5AVS B;  1KB0 A;  1C7M A;  4H13 B;  3K5B A;  4YPC A;  1K3G A;  3CX5 I;  1FAV A;  1X8Y A;  2W83 C;  2WMM A;  5APU A;  1KFN A;  1I6D A;  1YQ4 C;  3IAO A;  1K8A Q;  3LW5 H;  2CE1 A;  5KJ7 C;  2OYI B;  2WPQ A;  3HRN A;  3VYI A;  3D70 A;  4LJI A;  1SQB J;  2NPS C;  1DD4 A;  1ZOY C;  1KZU B;  2B87 A;  1SQX K;  1NTM D;  2L5G B;  2JKV A;  3WUV A;  1KC8 Q;  2O3J A;  1DW0 A;  1SQX G;  1KYO D;  4PWA A;  5CID B;  1A8C A;  3C2C A;  1EC5 A;  1R8E A;  1EQ7 A;  1MV8 A;  2FKW B;  4EIE A;  2M5A B;  5AW8 B;  1NML A;  3CCU P;  1CHJ A;  1LT1 A;  2C0X A;  2FYU E;  2B10 B;  4N6J A;  4XE5 B;  3L71 J;  5CIB B;  5KAI H;  3L70 E;  3NFQ A;  2BCC D;  3MIW A;  2RMZ A;  3EFF K;  3CXH H;  4WY4 C;  1N2D C;  2C1D A;  1LGH B;  5KAI E;  1FE6 A;  2OAR A;  4JYB A;  3CXH E;  2RKL A;  4K3A A;  1KN7 A;  2ZYG A;  2E74 C;  2V07 A;  1P84 H;  2QRX A;  2ZAE B;  5CCH A;  3ZOX A;  2I1J A;  3AE4 C;  1P84 E;  1ZXG A;  1M1K Q;  1FZC A;  4R4L A;  2IZ0 A;  4WQC A;  3CI9 A;  3M9B A;  1PP9 D;  4Y28 J;  3CCQ P;  2FYU K;  2C1D B;  1BL9 A;  2FYU G;  3HQ9 A;  2P67 A;  3O6Q B;  3AEF C;  1KIL E;  4U7J A;  1JMM A;  3WFE C;  1IFN A;  1BE3 J;  3M0D A;  3RK2 C;  1FHB A;  1TU3 F;  2W27 A;  3CWB D;  2N1T D;  1SQV D;  4FAV A;  1X0T A;  1Q82 Q;  1DIP A;  1U7M A;  1IO3 A;  3A5T A;  1ZW0 A;  1PPJ D;  1JOC A;  1H1O A;  4PD4 I;  3HD7 B;  2HPC A;  2DGE A;  1YNR A;  5B66 H;  3HTK A;  1L4A C;  2NPS A;  1OX3 A;  1Q81 Q;  5CYT R;  1HVV A;  5H2F H;  5B66 E;  3X39 A;  1VF5 C;  3B5N C;  3O8Z A;  3VP8 A;  2WSE H;  3CXH I;  5H2F E;  1W2E A;  2K3R A;  4L1Q A;  3L73 D;  1M7L A;  1QL2 A;  2DVH A;  1CI6 A;  1NWQ A;  5AW3 B;  1OWA A;  3V6I A;  1FZG A;  2XZR A;  4W7Z A;  2OTJ P;  4HKZ H;  5GTI H;  2IFN A;  1P84 I;  3KPE A;  1MFT A;  1WEJ F;  3L75 E;  2P58 A;  2JR8 A;  2CPB A;  2ZXE B;  2HPC B;  1NYH A;  4WY4 A;  1E29 A;  3HTK B;  5GTI E;  1KTM A;  2E42 A;  4I7Z B;  3VP9 A;  1H8A A;  3Q1M A;  3VRD A;  4YE1 A;  1ZR2 A;  4H0J A;  3ZCF A;  3U1A A;  1BGY D;  4BRY B;  3B8E B;  1GMJ A;  1J1E C;  2ZJS E;  3HE5 A;  3ZOW A;  2W6A A;  3PLN A;  3RL0 D;  1NJI Q;  4MU8 A;  3VN0 A;  1LS9 A;  1CO6 A;  4XXL A;  1RE4 C;  4PJ0 E;  3CP5 A;  4WY4 B;  1S4X A;  1PGQ A;  4HYT B;  5CBO A;  4U3F D;  1IK7 A;  2QJP B;  2WVR A;  1MG2 D;  4WQ7 A;  3L75 G;  2N1T C;  4WQ9 A;  2LIT A;  3CPW O;  5IY5 1;  1M57 D;  1N73 C;  1NVO A;  1CIH A;  4H0K A;  1T3J A;  1OW6 A;  3EQ2 A;  3H1J J;  3S1K A;  2ZT9 B;  1LTB C;  3MD0 A;  1H89 A;  3KZI H;  1E5W A;  1BCC D;  1IRW A;  4M3L A;  3KZI E;  1PZQ A;  1T2K D;  4WQB A;  1NTZ J;  3UIA A;  4B86 A;  5DJU B;  4DOJ A;  1KQL A;  2A06 G;  3H1I E;  1FDM A;  1CCH A;  1CED A;  5AVY B;  1CRY A;  3SWK A;  2FY8 A;  3BRT B;  3B5N A;  1VQP P;  4C7R A;  2Y0C A;  1S72 P;  3RK2 B;  2WPR A;  2ZYD A;  4W7Y A;  1RQV A;  4L3H A;  1RF1 C;  1VQN P;  5B66 V;  2M3E A;  3HUS A;  4GOE A;  1AQT A;  5H2F V;  2V08 A;  1I54 A;  1L4A B;  3VMA A;  4CPG A;  5B5E H;  2N9Y B;  2XDJ A;  1D7M A;  5AVV B;  5CIC B;  2WSF H;  1GL2 D;  1LTJ A;  2WWW A;  5B5E E;  1VQ8 P;  3TK1 A;  1FZF A;  1AOQ A;  4C46 A;  4RJT A;  1VQK P;  1SQX J;  1HJ5 A;  5CIG B;  2LXC B;  3FWL A;  2UWJ E;  4H13 D;  5GTI V;  4PV1 C;  5DFS A;  3E1R A;  3H1I G;  1L0N E;  3CX5 W;  1GW3 A;  4WQA A;  5B6Q A;  3WFC C;  2C9N Y;  4GIF A;  1G2C A;  3AE2 C;  2BCN B;  3L72 D;  2HR3 A;  1KB9 H;  1N86 A;  2N18 B;  1JMB A;  1M1J A;  2ZON G;  3KDP B;  5DJQ C;  1DEE G;  2N1T A;  3PRJ A;  1KB9 E;  1A2S A;  4FAN A;  3U59 A;  4PJ0 V;  1XTC C;  3LW5 J;  4D6T D;  1N73 A;  1H9X A;  3RL0 g;  3RK3 E;  1KQS O;  1NAF A;  1J1E B;  3SXT A;  2PAC A;  3MUD C;  4AAO A;  1YHQ P;  5CBN A;  1DW2 A;  1G2C B;  3GMA A;  5AW7 B;  1HJ4 A;  3H1L D;  1OVV A;  2MKV A;  1CHH A;  3SVW A;  1L0N K;  1VQ7 P;  2HLO A;  1VDF A;  2M8R A;  1L0N G;  4DY9 A;  2E76 C;  1VQ4 P;  2FYU J;  1LTG C;  5C39 A;  2JO1 A;  2CE0 A;  3KZI V;  3ZDM A;  1AOF A;  2YK3 A;  2QEX P;  1LTS C;  5AVX B;  3H25 A;  1EDL A;  2C8S A;  1K05 A;  3EFG A;  1RF1 A;  1I8P A;  1Q2N A;  2B9B A;  4GED B;  2YKQ A;  3P8C D;  3CMA P;  4I1L A;  1S1C X;  2CXB A;  2KS1 B;  1BSN A;  1X22 A;  1HTL C;  1DT1 A;  2FXO A;  5M1B A;  2Q3I A;  2JEE A;  1KYO H;  1I5T A;  4P4Q B;  1NTK D;  2K9J A;  3I56 P;  1NTM E;  1JTH B;  1C75 A;  5KLV E;  1EXI A;  5AW1 B;  3Q3D A;  1A56 A;  1KYO E;  2IDB A;  3JC2 2;  1KIL C;  1Q86 Q;  3ZBM A;  1OCD A;  4ZNC A;  1KB9 I;  3D6Z A;  1DW1 A;  1RF1 B;  2OZ1 B;  2H88 C;  3V2R A;  1T6A A;  2IYP A;  2JJL A;  5B5E V;  1NAY A;  4GOF A;  4LGD E;  1URQ C;  5EXQ A;  3WUU A;  1X9V A;  4NFG B;  3BCC D;  3RLM A;  1LC1 A;  4O1W A;  2BCC E;  2G3A A;  5KAF H;  2FXM A;  4L3G A;  4IFD K;  1SLQ A;  2O01 H;  4EIF A;  5KAF E;  4ZMD A;  1CSB A;  4OGQ D;  2ZBO A;  2WT7 A;  5KLI B;  1K3H A;  1GU4 A;  3P32 A;  2HOD A;  2KNC A;  4PV1 B;  2YIU C;  1NKZ B;  3A3Y B;  2MHM A;  3S9O A;  1NTM K;  1JO5 A;  3MUD A;  3L74 D;  2L91 A;  4C7N A;  5KLV G;  2YCC A;  1WMK A;  3CXH W;  5BU5 A;  3SWF A;  4I6M C;  3H1H E;  3A0H H;  2D2C B;  1KQF B;  1W5C E;  1NU1 E;  3CX5 E;  1SQB D;  3RN1 A;  1IFP A;  3A0H E;  4IOI H;  4UB6 E;  5KJ7 D;  1GJQ A;  5KKZ C;  1FJK A;  1LJ2 A;  5DJQ B;  1EDK A;  3Q5P A;  2N3Y A;  2VHD A;  3AEC C;  2NPS D;  3L75 J;  1KV4 A;  2BCC G;  1HH0 A;  3WUT A;  1J1D C;  2HOD B;  2KNC B;  1ZP0 C;  2ZXY A;  3HQ7 A;  3AEB C;  4NPF X;  2WTY A;  3A0B H;  3TNU B;  1YTZ T;  1KYO I;  3Q2Y A;  1VQ6 P;  2IBZ D;  1GTW A;  4AAN A;  4C7N B;  1HGZ A;  1FDO A;  1SQQ E;  3A0B E;  4JBZ A;  1GKS A;  2Z5I A;  3IFM A;  4JQ0 D;  4WB4 A;  2XNX A;  2XV5 A;  1N90 A;  1DEB A;  4WY4 D;  3H1H G;  3RBZ A;  2PRR A;  2W6B A;  2WQY C;  1NU1 G;  2ORL A;  5AW5 B;  3O20 A;  1JY2 O;  2C9L Y;  2E74 D;  3DP5 A;  3L73 E;  1IQC A;  1IFI A;  3GLM A;  1S5L X;  1ZR4 A;  2BGV X;  4YXW H;  3CCE P;  1LMS A;  2OYI A;  3CCR P;  5TJH A;  2GUS A;  2ZZS 1;  1URQ A;  3HD7 C;  2QJK C;  1HGV A;  1CHI A;  1SQQ K;  2Y9Z A;  2CK3 H;  1NHL A;  5AVW B;  1JY2 P;  1SQQ G;  3H32 A;  2QM8 A;  3H1K G;  1BE3 D;  2NZ2 A;  2PFX A;  3W67 A;  2RH0 A;  2HV4 A;  1KIL B;  3GF3 A;  3CCM P;  1CC5 A;  2M5A A;  3G3Z A;  3H1I J;  3RK2 D;  5KAF V;  1L2P A;  5AVZ B;  1Z56 A;  1QKS A;  1URQ B;  2YXR B;  1VQM P;  1COT A;  4I7Z C;  1JNM A;  1LP1 B;  3AE6 C;  1H88 A;  2N9J A;  2V7Q H;  1GDT A;  4BXL A;  4N78 D; 
#chains in the Genus database with same CATH homology
 3H1I D;  1E29 A;  4QAO A;  4IL6 V;  1M6Z A;  1I8O A;  1WVE C;  1N9C A;  4EID A;  2YIU B;  3VRD A;  1FJ0 A;  3A0H V;  4UB6 V;  4YE1 A;  2GC7 D;  4H0J A;  2FRC A;  3ZCF A;  1KIB A;  1NMI A;  1BGY D;  2BPB B;  3DMI A;  1FI3 A;  4FA9 A;  3RN0 A;  3L4O A;  4WQ8 A;  1CTJ A;  1YIC A;  2GC4 D;  3ZOW A;  3PLN A;  1AYG A;  4MU8 A;  5KKZ B;  1LS9 A;  1CO6 A;  4XXL A;  4JCG A;  3A0B V;  3CP5 A;  3VYM A;  4K3I A;  3L71 D;  4FA5 A;  3TDK A;  4U3F D;  5CIE B;  1GDV A;  1CYI A;  1I6E A;  2QJP B;  3WFD C;  2RN0 A;  1MG2 D;  4WQ7 A;  1DVV A;  2BH4 X;  4WQ9 A;  2LIT A;  1L0N D;  5IY5 1;  2EXV A;  1IRV A;  1CIH A;  1FOC A;  4H0K A;  2B0Z B;  1RAQ A;  1GQ1 A;  2I8F A;  4Q5P A;  3TGU D;  2PCB B;  1CRC A;  1BCC D;  3O1Y A;  1IRW A;  3PXW A;  1B7V A;  4WQB A;  4A7P A;  1GIW A;  1H32 A;  1KB9 D;  3MK7 C;  3OA8 B;  3PH2 B;  1CCH A;  1CED A;  3H1J D;  4FA4 A;  1CRY A;  3GG2 A;  2Y0C A;  1FI7 A;  1H33 B;  5AUR A;  1OAE A;  4L3H A;  2XTS B;  2QJK B;  2CA3 B;  155C A;  5B66 V;  1NTZ D;  3SLE A;  1S5L V;  2PCC B;  1CRH A;  3CU4 A;  5H2F V;  2V08 A;  1I54 A;  1CSU A;  1HCM A;  1H32 B;  4KMG A;  3VMA A;  1C6S A;  2N9Y B;  1HH7 A;  2D0W A;  1RZ6 A;  5CIC B;  1KX2 A;  1J3S A;  1NNO A;  2JWA A;  1AOQ A;  4RJT A;  4WQE A;  1HJ5 A;  5CIG B;  1IZL 0;  4FB1 A;  3FWL A;  5GTI V;  5DFS A;  4O1Q A;  3A9F A;  4PW9 B;  1HZV A;  3HQ6 A;  1M70 A;  2K9J B;  1CIG A;  2Y0E A;  3CX5 W;  1CRI A;  351C A;  3ZOO A;  1HJ3 A;  2AI5 A;  2N18 C;  3ZOY A;  4WQA A;  5B6Q A;  3WFC C;  451C A;  4J20 A;  3DR0 A;  2BCN B;  1YFC A;  1SQX D;  3L72 D;  5KLV D;  1R0Q A;  1F1F A;  2C2C A;  5KAI V;  2ZOO A;  2N18 B;  2ZON G;  5DJQ C;  2B4Z A;  1W2L A;  3WC8 A;  3CYT I;  3SWS A;  3KHU A;  3O5C A;  3PRJ A;  1A2S A;  4FAN A;  4PJ0 V;  1C2R A;  4AAL A;  4D6T D;  3WFB C;  1H9X A;  2B12 B;  1DIQ C;  2JQR A;  1ZRT D;  4UB8 V;  2MTA C;  3SXT A;  2PAC A;  3PXS A;  1CSW A;  1DII C;  4AAO A;  1ETP A;  2B11 B;  3OA8 A;  1E2R A;  3SJL A;  1NIR A;  1DW2 A;  1HJ4 A;  3H1L D;  5CIH B;  1CHH A;  1LFM A;  3SVW A;  3M97 X;  4EDF A;  4DY9 A;  1H33 A;  5CIF B;  5E79 V;  1KV9 A;  4RSZ A;  1L9J C;  3PXT A;  2N3B A;  2AIU A;  2CE0 A;  1W5C T;  2BH5 X;  2D0S A;  3KZI V;  1CXA A;  3NBT A;  2AXT V;  1AOF A;  2YK3 A;  1CTZ A;  3H1H D;  2Y0D A;  3ITK A;  2C8S A;  4N0K A;  1DW3 A;  1KYO W;  1I8P A;  1SQP D;  1NU1 D;  1GU2 A;  4GED B;  1FI9 A;  3CX5 D;  4AAM A;  2CXB A;  1QYZ A;  1RAP A;  1ZZH A;  1DT1 A;  1C6O A;  3JBT B;  3MK7 B;  1EZV D;  1I5T A;  4P4Q B;  2YQB A;  1CIE A;  1U74 B;  1NTK D;  1C75 A;  1YEB A;  4AX3 A;  5GTH V;  1YEA A;  4FA1 A;  1A56 A;  1KX7 A;  1KB0 A;  1SQQ D;  3ZBM A;  1OCD A;  1QL4 A;  1C7M A;  1DW1 A;  3H1K D;  1K3G A;  2OZ1 B;  3GW6 A;  5B5E V;  1DVH A;  4EIC A;  5EXQ A;  4Y5R A;  2CA4 B;  4NFG B;  3BCC D;  2BLF B;  1LC1 A;  3RLM A;  1I6D A;  4O1W A;  4L3G A;  3ORV A;  2CE1 A;  1I55 A;  2JTI B;  2N9I A;  4EIF A;  2QJY B;  2ZBO A;  4LJI A;  5KLI B;  1K3H A;  3L4M A;  2L4D A;  1MZ4 A;  2MHM A;  1CSX A;  1NTM D;  2O3J A;  3L74 D;  1DW0 A;  2L91 A;  2FWL A;  1KYO D;  3WUI A;  4PWA A;  5CID B;  1N15 A;  3ZIY A;  1N50 A;  2YCC A;  1QL3 A;  1A8C A;  3C2C A;  3CXH W;  4XYD B;  4EIE A;  2C1U A;  1NML A;  1YCC A;  1SQB D;  1CHJ A;  3RN1 A;  2B10 B;  3NBS A;  1C6R A;  1GJQ A;  5CIB B;  5DJQ B;  2N3Y A;  2BCC D;  2VHD A;  1FCD C;  2RMZ A;  1S6V B;  1H9Y A;  3PHL A;  1MG3 D;  2QG4 A;  2C1D A;  1EB7 A;  2KS1 A;  2KNC B;  2ZXY A;  3HQ7 A;  3WU2 V;  5C0Z A;  3RMZ A;  2IBZ D;  2V07 A;  4AAN A;  1CXC A;  1M60 A;  5TIS V;  4WQD A;  3ZOX A;  1GKS A;  3L75 D;  1C2N A;  1H31 A;  1QN2 A;  1CSV A;  1HRC A;  4WQC A;  1N90 A;  1U75 B;  2C9X B;  2OZ1 A;  1PP9 D;  4PD4 D;  1L0L D;  2ORL A;  2FYU D;  1L9B C;  2C1D B;  1BL9 A;  3O20 A;  1YIQ A;  3HQ9 A;  2LIR A;  3L70 D;  1LC2 A;  3NWV A;  3DP5 A;  1VYD A;  4GYD A;  1IQC A;  1JDL A;  3OCD A;  3WFE C;  2C1V A;  2BGV X;  1FHB A;  1LMS A;  5TJH A;  3CWB D;  2A06 D;  4V2K A;  2ZZS 1;  1HZU A;  3CXH D;  1CYC A;  3TF5 A;  1SQV D;  4FAV A;  3O0R C;  1F1C A;  1H31 B;  1CHI A;  1AKK A;  1CIF A;  2GB8 B;  2Q3E A;  1IO3 A;  1PPJ D;  3VNW A;  1H1O A;  1P84 D;  1E8E A;  1CRJ A;  2DGE A;  1YNR A;  1BE3 D;  3PTZ A;  1YTC A;  1RZ5 A;  2HV4 A;  1CYJ A;  3TYI A;  2FYN B;  1HRO A;  1CC5 A;  5CYT R;  3X39 A;  3OCD B;  1CCR A;  5KAF V;  1COR A;  3HQ8 A;  5DF5 A;  1QKS A;  4L1Q A;  3L73 D;  1CNO A;  1CRG A;  2DVH A;  2GIW A;  1COT A;  1C52 A;  1CTY A;  5C9M A;  2N9J A;  1WEJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...