3H1LD

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1lD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1lD02
1NTKD 2LIRA 3H1HD 3ZOOA 5CIHB 2JWAA 1B7VA 2LITA 5KKZB 2V07A 1OAEA 1CRGA 1E2RA 1CNOA 1HZVA 2IBZD 1R0QA 1CSWA 1C6SA 1C6RA 1CRIA 4WQEA 1GQ1A 4Y5RA 1FI3A 1SQPD 1K3GA 3H1JD 2RMZA 2ZZS1 4UB6V 1CRHA 3WFCC 3O0RC 2N18B 2QJYB 4FA9A 1QYZA 2V08A 1KYOW 1HH7A 1FI7A 3FWLA 1CC5A 1L0ND 2N9YB 1CO6A 1RZ5A 1KV9A 1YCCA 2CA4B 1QL3A 2ORLA 3VNWA 1YFCA 1YICA 1DIIC 2EXVA 4EDFA 3WFEC 2JTIB 351CA 1CTZA 1N90A 1U75B 3RN0A 4A7PA 1LS9A 1I8OA 4PD4D 2C1DB 1SQQD 4K3IA 3CYTI 1CCRA 3CX5W 1S6VB 3VRDA 1HJ5A 4N0KA 2CXBA 1W5CT 4FA4A 5DF5A 4L3GA 5B66V 2RN0A 2D0WA 3TYIA 5E79V 1VYDA 1C7MA 2FRCA 1CYJA 1CIFA 4KMGA 1FHBA 3WFDC 2C2CA 5KAFV 1CHJA 5CIBB 1C2RA 3MK7C 2DGEA 2L91A 1HJ4A 1KX2A 3PXSA 1J3SA 1KB9D 4WQAA 1CSVA 2KNCB 2BCCD 2ZBOA 1H9YA 1OCDA 1ZZHA 1MG3D 1CTJA 1I55A 3RN1A 2AXTV 4WQ9A 3GG2A 2ZONG 3H1ID 4V2KA 1KIBA 5EXQA 1H32B 1YEBA 4P4QB 4H0JA 1CORA 3BCCD 1CTYA 1H33B 2PCCB 3O5CA 1CYIA 3WFBC 2VHDA 2Q3EA 3SLEA 3ZIYA 1I5TA 3TF5A 3L75D 1YEAA 4H0KA 1H9XA 3HQ7A 5TISV 3TDKA 2B10B 4JCGA 1BCCD 1GU2A 3CP5A 3SXTA 1H33A 1N15A 1SQBD 1P84D 3O1YA 2FYNB 4XXLA 3GW6A 4AAMA 2BH5X 3SJLA 2OZ1B 1KYOD 1BL9A 3SWSA 4EIDA 2FWLA 3WC8A 1DW0A 5DJQC 2KS1A 1C6OA 1CXCA 3L4OA 2B11B 2BH4X 2YIUB 3PTZA 1A56A 1N9CA 2OZ1A 4QAOA 4L3HA 4FAVA 1FOCA 2MHMA 5IY51 2N9JA 3L71D 2I8FA 2JQRA 5TJHA 4XYDB 3H1LD 1KX7A 1COTA 1BE3D 1NNOA 2HV4A 1A2SA 1QN2A 4EIFA 1H1OA 2N9IA 1WVEC 1CSXA 5C9MA 3KZIV 1DIQC 3NWVA 4EIEA 3VYMA 1JDLA 2GC7D 1I6DA 2MTAC 2Y0EA 1I54A 4Q5PA 5DJQB 5AURA 2C1UA 1I8PA 1YIQA 3SVWA 3CXHW 1CHIA 1E29A 5B5EV 1C75A 3A0BV 3DMIA 4RJTA 1IRWA 1EZVD 4PW9B 1AOFA 3TGUD 3M97X 1GKSA 1DVVA 1LMSA 1CHHA 2C8SA 3PLNA 2GB8B 451CA 1IRVA 1GIWA 4U3FD 3L73D 3OCDA 1HCMA 4MU8A 1LC1A 3ZOXA 4GEDB 4FANA 2CA3B 1YNRA 2B0ZB 4WQCA 1FJ0A 3PXTA 5CYTR 5H2FV 2N3BA 3RLMA 4AALA 1M70A 1U74B 3L4MA 5GTIV 3ZBMA 4FA1A 1PP9D 3OCDB 1I6EA 3DR0A 2YK3A 1ETPA 3PXWA 2O3JA 2B12B 5CIDB 3L70D 4O1WA 1RAQA 2L4DA 2Y0CA 2BLFB 3A9FA 2BCNB 1E8EA 4WQBA 1L0LD 1W2LA 4PWAA 1CIGA 4D6TD 1M6ZA 4GYDA 2ZOOA 1DVHA 4EICA 1ZRTD 1HZUA 4DY9A 3NBSA 1L9BC 5CIFB 4AAOA 1LFMA 4UB8V 2CE0A 1IQCA 1FCDC 4FB1A 3ORVA 3X39A 5B6QA 1QL4A 5CIGB 1SQXD 1DW1A 1NU1D 3PHLA 1WEJF 2N18C 1DT1A 2XTSB 2QJKB 3PRJA 2GIWA 1H32A 2CE1A 2AI5A 2QJPB 3HQ8A 2PCBB 3ZOWA 3OA8B 2QG4A 1CYCA 1A8CA 1CRJA 1PPJD 3MK7B 2PACA 2YQBA 1AOQA 1CRCA 3PH2B 4J20A 1HROA 1CEDA 1SQVD 1CCHA 4WQDA 1GJQA 4L1QA 1C2NA 1CXAA 1CIHA 2GC4D 3KHUA 4YE1A 1F1FA 1GDVA 1BGYD 1RAPA 4PJ0V 3VMAA 3DP5A 2N3YA 3H1KD 3CX5D 3ITKA 1HRCA 4FA5A 1NIRA 1IO3A 3JBTB 1RZ6A 4O1QA 1MG2D 1IZL0 1QKSA 4LJIA 3CXHD 1H31B 1LC2A 2AIUA 3C2CA 5KLIB 4NFGB 2A06D 1MZ4A 3L74D 1L9JC 2BGVX 3ZOYA 2C1DA 5CICB 4IL6V 1S5LV 5KLVD 2BPBB 5C0ZA 2YCCA 1H31A 1DW2A 1CIEA 3A0HV 3ZCFA 1NTMD 5KAIV 1AYGA 4WQ8A 3CU4A 4WQ7A 2C1VA 2DVHA 2D0SA 2B4ZA 1FI9A 1NTZD 2Y0DA 1AKKA 1N50A 1DW3A 3CWBD 3HQ6A 1NMLA 1CSUA 1CRYA 3HQ9A 1F1CA 1M60A 5GTHV 1NMIA 3RMZA 4AX3A 2K9JB 4RSZA 3NBTA 1YTCA 1K3HA 2FYUD 5DFSA 5CIEB 3O20A 2C9XB 3L72D 1EB7A 1HJ3A 3WUIA 2ZXYA 3OA8A 4AANA 155CA 1KB0A 1C52A 3WU2V
chains in the Genus database with same CATH superfamily
3VP9A 1BDCA 4M3LA 3L72E 2PAJA 2WPSA 2Z4EA 3B5NB 1OAEA 1CRGA 3F5HA 5DJTB 1J1DC 1CSWA 3A0HH 1N8RQ 2H7HA 2AEMA 4L75A 3EQ2A 2OQQA 1FI3A 1IJDB 1SQPD 2ZXEB 2ZZS1 1KILE 5E79H 3A5TA 3O0RC 3KZIH 1M1KQ 3V2NA 2N18B 1K05A 1FI7A 3EFFK 2W6BA 2GUVA 5APTA 3Q2YA 2MKVA 1CO6A 2WSSH 1RZ5A 2CK3H 1X79B 1SFCA 2ORLA 1YFCA 2HPCA 1OVUA 3CI9A 5AVQB 1SQXJ 351CA 3L70G 2QA4P 1OMIA 3RN0A 3PH0A 1NAFA 3CPWO 2C1DB 2XDJA 4N3YB 1S6VB 4DOJA 4N0KA 2OYHA 2WWWA 1LJ2A 2CXBA 1W5CT 1ZV8A 2JKVA 2XV5A 5B66V 4C7RA 2RN0A 3R4YA 1URQD 2D0WA 2P67A 2WSCH 2POHA 3M9BA 5E79V 1C7MA 1BDDA 1IFMA 1SQXK 2H88C 4JBZA 4KMGA 2C2CA 2IPPA 1CHJA 1C2RA 1Q7YQ 3B71A 1PV3A 1SQVE 1R5SA 2NPSB 5CCHC 1HJ4A 3PXSA 5BVZA 2ZYGA 1CSVA 2FKWB 1QX8A 4YXWH 3VTPC 2OTKE 1ZZHA 1MG3D 1I55A 3RN1A 4GDOA 3II6A 3CC4P 5AVXB 4GT1A 4WQ9A 1VDFA 2YNYA 3EFGA 3H1ID 1EDIA 1J1DB 3TNUA 1SQPE 5EXQA 1PFIA 1H32B 1YEBA 2P7JA 1CORA 1H33B 1DEEG 1CYIA 3WFBC 3AEAC 1BGYG 3SWKA 1FJPA 1VQLP 1YEAA 1SQVJ 4PV1C 3O6QA 1JY2O 3CCEP 3F89A 1KN7A 3GW6A 4AAMA 3VMXA 2FYUE 2ZVNB 4EIDA 2R3SA 1HF9A 3A0BE 2HPCB 1NTMG 2KS1A 1CXCA 3L75J 2B11B 4WVZA 3MHVA 2BH4X 1JMMA 2JR8A 3AE4C 3AECC 3PTZA 1N9CA 3MGNA 1YTZI 2YXQB 5IY51 4U3FJ 1WMKA 2JQRA 2E76C 1JCCA 1KX7A 1BE3D 1URQB 2OGUA 1WVEC 2FXPA 2VRSA 3KZIV 3HE4A 3ZDMA 1GU5A 3KQGA 3RGUA 1VQPP 2FXMA 1KQFB 5CCGD 1M8OB 2O01J 3TGUE 2B87B 1S5LX 1MFZA 3JSVC 2GC7D 2K37A 1I6DA 1MZ9A 2MTAC 1KFNA 1NTMK 3KYQA 1NTKE 2OYIA 3SFEC 2C1UA 4OWFA 3CXHW 4NPDA 4O9BA 1E29A 5B5EV 1C75A 1LNQA 5AW5B 3TGUD 1GKSA 1M90Q 1IRVA 1GIWA 1H0TA 1LTBC 2O1JA 1FS0E 2WSEH 5KJ7A 1OW7A 1LC1A 4R4MA 4GEDB 1CW5A 2CA3B 4WBAA 1L0LK 1FJ0A 1FU1A 4CPGA 5CYTR 2KLUA 2I8DA 4WWIA 1GTWA 3MZWB 1M70A 1U74B 5GTIV 3ZBMA 2QJPC 1KD1Q 1PP9D 3OCDB 3DR0A 1FJKA 1LTAC 2CPBA 2O3JA 2B12B 1RAQA 2L4DA 4JPZB 1QL2A 2BCNB 2WITA 3USSA 4WQBA 3RK2C 2K1AA 3BCCG 5KJ7C 1DVHA 1XTCC 1P84E 4DY9A 4HH2A 1OIPA 1L9BC 4AAOA 1LFMA 1RQVA 3L36A 4EYYQ 3IAOA 3NMDA 5AVRB 4ZMDA 1FCDC 3CX5E 1NTKJ 3X39A 1W2BO 3VYIA 1KILC 2GM4A 3PHLA 2KOGA 2WSFJ 3IFMA 3B4SA 4NPFX 2QJKB 1AV1A 3H1IE 4W7ZA 2GIWA 2KZJA 1M1JB 2QE7H 2AI5A 2H8PD 3ZOWA 3P8CD 3OA8B 3S9OA 1CYCA 1A8CA 4TLFA 1CRJA 4H0LB 1AQTA 1ZR2A 3T97A 2IFNA 2E75D 1RF0A 2KB7P 2SPZA 3PH2B 3WUTA 1HROA 2HYNA 1CEDA 2XKMA 1SQVD 1PP9G 3HD7B 1GJQA 3CX5H 1KILA 3V6IA 2IZ0A 5APSA 1CIHA 3KHUA 1SQVG 1F1FA 3LIDA 1GDVA 3LIEA 1JUNA 3H1KD 1OZHA 1AA0A 5GTHE 1HRCA 2Q1KA 4FA5A 1NIRA 2JWDA 3S1KA 3RL0D 4DZOA 3CXHD 1H31B 3C2CA 2N1TD 2PRRA 3L74D 2IYPA 3HE4B 4U3FG 2Z5IA 2L5GB 4HYTB 4IL6V 5KLVD 1EDKA 2OYOA 3V4QA 4K35A 1LT1A 2OTJP 3ZCFA 1NTMD 4BWNA 1NGMB 4WQ7A 1AQ5A 5AW3B 2WSEJ 1N73A 2Q6QA 2E42A 2KK7A 1N50A 2ZT9D 5H2FE 1IFJA 1NTME 2FYZA 1R5LA 2QIWA 1CRYA 4GIFA 1YQ4C 5KLVE 4AX3A 1XTGB 3AE2C 4HKZH 3V2QA 4LLHA 2KSEA 2LKMA 2N1TA 3L72D 3CCUP 4I6MC 3OA8A 3H1HE 1LT9A 2E75B 1KB0A 4OH8B 3L75G 1HGVA 4H13D 1NTKD 2LIRA 2QM7A 5AW8B 2V07A 1E2RA 1S3JA 4N78E 1R8EA 3GF3A 1VQKP 5APXA 4Y5RA 4WY4C 1LWUB 1H8AA 5CJ4A 3H1JD 1RY3A 3WFCC 4YPCA 2QJYB 4U7JA 2E74B 2ZJSE 1RE4A 4KJMA 1HH7A 3I55P 3FWLA 1CC5A 3L71G 2ZAEB 1T2KD 3H6PA 3U1AA 1NAYA 1KB9E 2IX7C 3A7OA 2N1TB 3CD6P 3P8CE 2EXVA 2KS1B 2BEZF 2JTIB 1CTZA 2ZXXA 4WY4A 3KPEA 5CCGA 1LS9A 1M1JA 1JEKA 3WU2E 4PD4D 5APVA 1FDMA 3HE5B 1LTJC 1NH4A 1YTZT 1S2EA 3VRDA 1HJ5A 3SFDC 3WUVA 3G3ZA 4R4LA 3SWFA 2ZT9B 2KYVA 3L4FA 1KILB 2K3RA 1NU1K 2FRCA 1CYJA 1VQMP 1CIFA 2KI7B 2OYHB 1ZP0C 1FHBA 4ZKUA 5CIBB 1T2KC 2UWJE 2K88A 2DGEA 1T6AA 2KLVA 5BU5A 1PP9E 2KNCB 3M0DC 5C39A 2DW3A 4WY4D 4UB8H 3GG2A 4AQRD 2AXCA 1JTHA 1KQSO 1YJ9P 2WVRA 1RF1C 1KIBA 1DH3A 1DD3A 1N73C 4D6TG 3JC22 4D6TJ 2VHDA 1FZEA 1N2DC 2E74D 3PP5A 1YI2P 1H9XA 1URQC 2A45I 5TISV 3RK3E 4DCKA 1PL5A 1DD4A 4K3AA 3CP5A 2LR2A 2PP6A 1N7SB 1ZW0A 4PD4H 1KYOD 4Y99B 1NTMJ 1FOSF 2ZVOB 3WU2H 3Q1MA 1Y8AA 1NKNA 5APUA 3FX0A 3OAKA 1H89A 4FAVA 3AE8C 5TJHA 4XYDB 3H1LD 1PGJA 3H32B 2HG5D 1COTA 2E74C 5H2FH 4PV1B 4PJ0E 2HV4A 3H1KJ 1KILD 1GDTA 3O6QB 1QL1A 1HH0A 1VQ4P 4L73A 2FYNC 3QH9A 3D70A 1U7MA 4I7ZC 1DX7A 2QSIA 2WSFH 3P8MC 1AVOA 2A45G 3H25A 1I54A 4Q5PA 2WT7B 1OW6A 2R32A 4ZNCA 1H0TB 2B9BA 1I8PA 3SVWA 4ZKPA 1JO5A 1CHIA 3P7KA 3DMIA 1JY3N 2QM8A 4PW9B 3M97X 1K8AQ 1LMSA 4UB8E 3PLNA 2GB8B 1NVOA 1EXJA 3GHGB 1RF1B 3L73D 3OCDA 1HCMA 2J58A 1YNRA 2B0ZB 2J5UA 3H1LE 4WQCA 2E75C 3CL3D 1OW8A 1CSBA 2JEEA 3L4MA 4FA1A 4Y28J 1I6EA 1N7SD 2N1TC 1L0NK 3A2AA 5AVTB 3H1IG 1KORA 3A9FA 1L2PA 1DEBA 1L0LD 1LP1B 1W2LA 1CZQA 1CIGA 1RE3A 2ZOOA 2NPSC 2Q3IA 3SWYA 3M0AA 5EFWB 3RK3D 3HUSC 4B86A 5BU8B 1IQCA 3AE7C 3U59A 1DW1A 3BASA 1ZMEC 1BGYE 3MD0A 2M3BA 5M1BA 1NTZK 1H32A 1L4AA 1QEXA 3CXHI 1L0NJ 1OFCX 1JY2N 1U57A 2QG4A 1SP4A 3L70J 1RF0C 2YMYA 2H43A 3K5BA 1CRCA 3B5NC 1YBKA 1CCHA 4KHXA 4H13C 4WQDA 1NJIQ 2B89A 1C2NA 2D2CC 2GC4D 3M0DA 4BRYB 3W68A 2P58A 1RAPA 1IFDA 3MIWA 4PJ0V 1NU1E 3RL0g 3DP5A 1SQXE 1Q2NA 1VL2A 2R3CA 1TU3F 4BRYA 1GZLA 1GL2C 3VP8A 1IZL0 3CLQA 1LC2A 3TGUG 1J2JB 5KLIB 1LTGC 4PD4E 2A06D 1L9JC 1L0LE 4OGQC 2BGVX 3ZOYA 1PGPA 5CICB 2A06G 4IFFA 1S5LV 3RK2B 5AVSB 3L70E 1DW2A 1FZFA 1YIJP 5L8RJ 1PIXA 1L0NE 1AYGA 1JNMA 4WQ8A 1VPCA 3CCQP 2C1VA 3H1LJ 1VQ5P 3WMM0 2D0SA 2IFMA 3L72J 1BGYJ 2LXBA 1FDIA 5AW1B 1FAVA 4DT0A 2Y0DA 2G8YA 1NTKK 1OVVA 1LT9B 3CX5I 1CSUA 3HQ9A 2FYUJ 1NMIA 1RHZB 1YYCA 2K9JB 4RSZA 1EZVE 1YTCA 1K3HA 2FYUD 3I56P 5CIEB 3NFQA 1FZCC 2HODB 1S9KE 1EB7A 1HJ3A 2HR3A 1SQBE 2V4HA 3H1HD 5CIHB 3CCRP 2W90A 4AUWA 1FZAA 2JWAA 1B7VA 2LITA 3BRVB 3VMZA 1X22A 3H1HJ 1GK6A 3H1HG 3M06A 1N86A 5CBNA 1R0QA 1C6SA 1GD2E 3AE5C 3GHGC 5CJ0A 5KAIE 1HTLC 1GQ1A 3N7NA 2AXTH 1K3GA 2C0WA 2RMZA 3G71P 1CRHA 3EWKA 1QVFO 1CI6A 1G1IA 2GUSA 4FA9A 1QYZA 2V08A 1KYOW 1RQUA 1PGOA 2BCCJ 2BCCG 2JO1A 1KV9A 2YKOA 4IL6X 2E5YA 3CCMP 1QL3A 4C46A 5AVUB 3VNWA 1L0NG 3IR9A 3NXSA 4I7ZB 1YICA 3Q5PA 3WFEC 3GHGA 5KTBA 3B5NA 1N90A 1U75B 1EC5A 1GMJA 2OTLP 3RK2D 5DJUB 4A7PA 1I8OA 2FY8A 1LTJA 1SQQD 2AXTE 4HB1A 2KNCA 1SQPK 1PZQA 1FZGA 1BCCE 1PP9J 3BRTB 1RE3C 1VQNP 1UIXA 4FA4A 5DF5A 1SQBJ 4L3GA 1USDA 3H1KE 1ZRTE 1VYDA 1VF5B 1ZN5A 3M9HA 1PGQA 2P1JA 2IBZI 3CC2P 3WFDC 2NZ2A 5KAFV 3MK7C 2D2CD 2L91A 3D6YA 1EQ7A 1J3SA 2NRGA 1VQOP 1JTHB 2KIKA 1S5LE 4WQAA 4YXDC 5KLVK 1VQ7P 2BCCD 4L76A 1FBMA 2OYIC 2AXTV 1RF1A 2ZONG 2WPQA 4V2KA 1SQBK 1M56D 3O8ZA 4P4QB 4H0JA 3BCCD 1CTYA 3O5CA 4W80A 1LT9C 1LWUA 1OXZA 1X0TA 2Q3EA 3E7KA 1SQQG 3ZIYA 1I5TA 1SFCC 4BXLA 4GOEA 4H0KA 3TDKA 4JF7A 3TNUB 5CCHD 2B10B 1FDOA 2BASA 3V5BA 2NPSA 3SXTA 1KB9H 1EZVG 1H33A 1KMIZ 2ZYDA 4RO0A 3V2RA 1N15A 3Q3DA 1SQBD 1P84D 3O1YA 1FZBA 3GF7A 2BH5X 4LGDE 1S9KD 3SJLA 2N9BA 1VQ9P 1BL9A 2YO3A 1KB9I 2ZYAA 1K04A 3L74J 2G3AA 5DJQC 5KJ7D 1C6OA 2JJLA 4JYCA 2ZT9C 1RH5B 2FBWC 4QAOA 4L3HA 4RKUJ 1FOCA 3HE5A 1GW4A 3GMAA 2I8FA 1T3JA 1AFOA 3QWOC 1HBWA 3IF4A 1U7JA 1SFCD 5AW4B 3ABVC 1NNOA 4NPEA 1VF5D 2E5TA 1CSXA 4U3FE 4OGQB 1D7MA 1K9MQ 3NWVA 3MP7B 1KQGB 3CCVP 1IK9A 1X8YA 1JDLA 2C9LY 1NWQA 2NPSD 2E43A 3HD7C 4GKGA 1EZVI 4KT0J 1IRWA 1NU1G 1NTKG 2I1JA 1CHHA 2C8SA 1USEA 4H0LC 5KAIH 2P10A 2OYIB 4U3FD 5B66E 3LW5J 2WPRA 3CWBE 4MU8A 3ZOXA 1YITP 4FANA 3G6EP 1NTZE 3H1JJ 3PXTA 5H2FV 5KAFE 2N3BA 1MKMA 3RL0B 1S4XA 3L37A 2C9NY 2FXOA 5CIDB 4O1WA 2Y0CA 2BLFB 4IOIH 2Q7CA 1N7SA 3CWBJ 2W6AA 3BCCJ 3VMYA 1A02J 5CCHA 2XU6A 3TK1A 2GA1A 4GYDA 2W8ZA 2KXPB 4EICA 1CI6B 1S1CX 1NKZB 3I5CA 4Z1MH 2FYUK 1Q86Q 3C8VA 5GTHH 1IO4A 5KAFH 1RE4C 5B6QA 1FZCA 1NOHA 1SFCB 3BCCE 4UB6E 3OJAB 2JDIH 2N18C 2XTSB 4OGQD 4D6TE 1G2CA 3D6ZA 1WT6A 1JCDA 2ITAA 4RESB 2FFDA 2QJPB 1Q90D 1SQPG 1IFNA 2B87A 3MK7B 2PACA 1YQ3C 3MUDA 1M1JC 1AOQA 1S5LH 2AEJA 3BATA 5KKZC 1NTZJ 1JY2P 1NTZG 1QLED 1SLQA 4PD4I 3H1IJ 1MFTA 4OVNF 3L73E 4N6JA 3RK3C 3VMAA 2IBZE 1JM0A 1VQ8P 3KZIE 3CX5D 1G2CB 3Q5RA 3ITKA 1GL2A 3JBTB 1RZ6A 1MG2D 4LJIA 4H44D 2AIUA 1EXIA 3FXDA 1DIPA 2OYHC 4IFDK 1MZ4A 2O01N 1LGHB 1BSHA 4HJGH 5B5EE 2O1KA 3HD7A 2CPSA 2PFXA 2BPBB 3L35A 3UIAA 5C0ZA 3A0HV 3CXHH 3GLMA 1E5WA 3CU4A 2XZRA 2B4ZA 4XE5B 5AVVB 3L71E 1NTZD 1AVYA 2K9JA 5AW2B 2RKLA 1DW3A 3CWBD 3HQ6A 3JCUE 1F1CA 1M60A 2FYUG 5CMZA 3CMEP 3RMZA 1FOSE 1GW3A 2KSJA 2WSCJ 4H44C 3NBTA 1KYOE 4H0LD 1LTIC 2ZXYA 4AANA 155CA 3CXHE 2KUBA 4C7NB 2W27A 1NYHA 1KZUB 3ZOOA 5AVYB 3TGUJ 3H32A 3A3YB 3L75E 5KKZB 3HD7D 4IL6E 4WY4B 3E1IA 2M0BA 1CNOA 1HZVA 2IBZD 3C9IA 3A0HE 2BEQD 3PJSK 1FE6A 1C6RA 1CRIA 5TISH 4I2LC 1IK7A 3U1CA 4WQEA 2K9YA 5AVWB 4UB6V 2M3EA 3N4XA 3L73J 4EI2A 3M91A 2IYOA 1AJYA 4QMAA 1L0ND 2N9YB 4H44B 2FFDC 1YCCA 1FZCB 2CA4B 1ZXGA 2O01H 2OARA 2MJZA 3RBZA 5KLIC 1BE3G 1DIIC 4EDFA 2J59M 4I1LA 5CBOA 3AE9C 5B5EH 2A06E 4K3IA 3R2PA 1L0LG 4ASWA 3HUSB 1HWTC 3CYTI 1CCRA 5AW6B 1M7LA 3CX5W 1BCCG 3RL0C 3Q5SA 1LTJB 3RBXA 2QJYC 4PV1D 3TYIA 5APYA 2V7QH 3MTUE 1J1EB 5KLVJ 2IBZG 3W67A 1OVRA 4MN4C 2W6JH 1JY3O 3L73G 2BCCE 2M5AA 3HTKB 1P84H 1KX2A 1KB9D 1GL2B 1S72P 2I1KA 4H13B 1LTSC 1W2EA 1PPJE 3AEEC 2ZBOA 1H9YA 1Q81Q 1OCDA 3KXDA 2YXRB 1CTJA 1JOCA 2C0XA 4PJ0H 3H1JE 1WRGA 3M9QA 2WZ7A 1L0LJ 2PCCB 1SQQK 4YTPC 1YHQP 3L72G 3SLEA 4EOTA 1IZNB 1L4AC 3VOPA 3TF5A 3L75D 3CCSP 5CHXA 3E1RA 3HQ7A 1SQBG 1IFPA 4JCGA 3AE3C 1BCCD 4TT3H 1GU2A 4UB6H 4AYCA 4XXLA 2FYNB 5CCGC 2QJKC 2OZ1B 5GTIH 5KLVG 1N7LA 1A02F 3SWSA 2ZFCA 2FWLA 3WC8A 3AEFC 2WT7A 2WTYA 1DW0A 4L74A 3L4OA 2R44A 2Y9ZA 2YIUB 2QRXA 1A56A 4JYBA 3AEBC 2OZ1A 3D71A 2MHMA 1X9VA 2Z5HA 2N9JA 3L71D 5APQA 1HGZA 2PGDA 2YIUC 3AE1C 1EDLA 1A2SA 1QN2A 4EIFA 1H1OA 2N9IA 1LTTC 5C9MA 1L4AB 5GTIE 4IFMA 1DIQC 3CWBG 1NHLA 4EIEA 3VYMA 4EIJA 3OW2O 1KYOH 3L74E 5AW7B 2Y0EA 1W5CE 1JY3P 3KDPB 5DJQB 1T8ZA 1HUCA 2P2UA 1GL2D 3D0WA 5AURA 1BE3J 1MUUA 3HTKA 4JQ0D 1YIQA 4W7YA 3NTNA 3A0BV 1SQXG 1NU1J 4IL6H 4RJTA 3CC7P 1EZVD 1AOFA 1DVVA 2AEFA 2XNXA 451CA 3L74G 3CCLP 4GOFA 3L71J 1URQA 5AW0B 4DJGA 2XNDH 3VN0A 5E79E 1VF5C 1ZOYC 1J1EC 1QGKB 2YKQA 2E76D 2YKPA 1LP1A 1KC8Q 1Z56A 3RLMA 4AALA 1HJBA 2LXCB 2YK3A 1K73Q 1ETPA 3PXWA 3L70D 1N7SC 4ASVA 1OWAA 1E8EA 4PWAA 5APWA 4D6TD 1T3UA 1UIIA 2QVAA 1YJNP 4Y99C 1M6ZA 2R5DA 1KQLA 1M57D 1ZRTD 1HZUA 3NBSA 1JMBA 3BVHA 3WUUA 5CIFB 1N73B 4UB8V 2YO2A 2CE0A 3TSIA 1JB0J 3C1LA 1Y47A 2FFDB 4FB1A 3ORVA 2Y9YA 4GODA 1SQVK 1QL4A 5CIGB 2JP3A 1SQXD 5AW9B 2YMKA 1NU1D 5TISE 2RH0A 2KP8A 3T97B 3AEDC 1SQQE 1L4AD 1WEJF 1SQQJ 1DT1A 3PRJA 1ZLLA 2CE1A 3H1JG 3HQ8A 2PCBB 1SQPJ 4WB4A 1YJWP 1GU4A 1IC2A 2R5BA 3MUDC 4C7NA 1PPJD 2A45H 2YQBA 1EDJA 2WQYC 1KFMA 3H1LG 2HLOA 4J20A 1HJ0A 1PPJG 3AEGC 3FGAD 3V2PA 3B5ND 3LW5H 4L1QA 1BCCJ 1CXAA 4YE1A 2W83C 2V7QJ 4LC1A 1BGYD 1HVVA 1NO4A 3P32A 2N3YA 1E79H 3FWNA 1G1JA 2QEXP 3H1KG 1IO3A 2E76B 1P84I 4O1QA 1QKSA 1KTMA 2HFED 2H89C 1Y9BA 4NFGB 3G9RA 2M8RA 2WMMA 1SVFA 3S4RA 2HODA 2B88A 2C1DA 1VQ6P 3A0BH 1KYOI 3V4WA 1ZR4A 1IFIA 3HUSA 2YCCA 1H31A 1OX3A 3G4SP 3B8EB 2WPVB 3CMAP 1CIEA 4XFJA 5KAIV 1BE3E 1FC2C 2DVHA 3RK3B 1LWUC 1BSNA 2KZIA 1H88A 3CCJP 1FI9A 5K5GB 1GK4A 1KV4A 5AVZB 3IN6A 2Q9IA 1AKKA 3AE6C 1Q82Q 3HRNA 5B66H 1NMLA 1MV8A 3JCUH 5GTHV 2IDBA 4N78D 3TYYA 1QVGO 2Q5UA 2M5AB 5DFSA 2D2CB 3O20A 3FXEA 2C9XB 3WUIA 3SSUA 1SS1A 3OA7A 1C52A 4XA4A 2IZ1A 3WU2V
chains in the Genus database with same CATH topology
1NTKD 2LIRA 3H1HD 3ZOOA 5CIHB 2JWAA 1B7VA 2LITA 5KKZB 2V07A 1OAEA 1CRGA 1E2RA 1CNOA 1HZVA 2IBZD 1R0QA 1CSWA 1C6SA 1C6RA 1CRIA 4WQEA 1GQ1A 4Y5RA 1FI3A 1SQPD 1K3GA 3H1JD 2RMZA 2ZZS1 4UB6V 1CRHA 3WFCC 3O0RC 2N18B 2QJYB 4FA9A 1QYZA 2V08A 1KYOW 1HH7A 1FI7A 3FWLA 1CC5A 1L0ND 2N9YB 1CO6A 1RZ5A 1KV9A 1YCCA 2CA4B 1QL3A 2ORLA 3VNWA 1YFCA 1YICA 1DIIC 2EXVA 4EDFA 3WFEC 2JTIB 351CA 1CTZA 1N90A 1U75B 3RN0A 4A7PA 1LS9A 1I8OA 4PD4D 2C1DB 1SQQD 4K3IA 3CYTI 1CCRA 3CX5W 1S6VB 3VRDA 1HJ5A 4N0KA 2CXBA 1W5CT 4FA4A 5DF5A 4L3GA 5B66V 2RN0A 2D0WA 3TYIA 5E79V 1VYDA 1C7MA 2FRCA 1CYJA 1CIFA 4KMGA 1FHBA 3WFDC 2C2CA 5KAFV 1CHJA 5CIBB 1C2RA 3MK7C 2DGEA 2L91A 1HJ4A 1KX2A 3PXSA 1J3SA 1KB9D 4WQAA 1CSVA 2KNCB 2BCCD 2ZBOA 1H9YA 1OCDA 1ZZHA 1MG3D 1CTJA 1I55A 3RN1A 2AXTV 4WQ9A 3GG2A 2ZONG 3H1ID 4V2KA 1KIBA 5EXQA 1H32B 1YEBA 4P4QB 4H0JA 1CORA 3BCCD 1CTYA 1H33B 2PCCB 3O5CA 1CYIA 3WFBC 2VHDA 2Q3EA 3SLEA 3ZIYA 1I5TA 3TF5A 3L75D 1YEAA 4H0KA 1H9XA 3HQ7A 5TISV 3TDKA 2B10B 4JCGA 1BCCD 1GU2A 3CP5A 3SXTA 1H33A 1N15A 1SQBD 1P84D 3O1YA 2FYNB 4XXLA 3GW6A 4AAMA 2BH5X 3SJLA 2OZ1B 1KYOD 1BL9A 3SWSA 4EIDA 2FWLA 3WC8A 1DW0A 5DJQC 2KS1A 1C6OA 1CXCA 3L4OA 2B11B 2BH4X 2YIUB 3PTZA 1A56A 1N9CA 2OZ1A 4QAOA 4L3HA 4FAVA 1FOCA 2MHMA 5IY51 2N9JA 3L71D 2I8FA 2JQRA 5TJHA 4XYDB 3H1LD 1KX7A 1COTA 1BE3D 1NNOA 2HV4A 1A2SA 1QN2A 4EIFA 1H1OA 2N9IA 1WVEC 1CSXA 5C9MA 3KZIV 1DIQC 3NWVA 4EIEA 3VYMA 1JDLA 2GC7D 1I6DA 2MTAC 2Y0EA 1I54A 4Q5PA 5DJQB 5AURA 2C1UA 1I8PA 1YIQA 3SVWA 3CXHW 1CHIA 1E29A 5B5EV 1C75A 3A0BV 3DMIA 4RJTA 1IRWA 1EZVD 4PW9B 1AOFA 3TGUD 3M97X 1GKSA 1DVVA 1LMSA 1CHHA 2C8SA 3PLNA 2GB8B 451CA 1IRVA 1GIWA 4U3FD 3L73D 3OCDA 1HCMA 4MU8A 1LC1A 3ZOXA 4GEDB 4FANA 2CA3B 1YNRA 2B0ZB 4WQCA 1FJ0A 3PXTA 5CYTR 5H2FV 2N3BA 3RLMA 4AALA 1M70A 1U74B 3L4MA 5GTIV 3ZBMA 4FA1A 1PP9D 3OCDB 1I6EA 3DR0A 2YK3A 1ETPA 3PXWA 2O3JA 2B12B 5CIDB 3L70D 4O1WA 1RAQA 2L4DA 2Y0CA 2BLFB 3A9FA 2BCNB 1E8EA 4WQBA 1L0LD 1W2LA 4PWAA 1CIGA 4D6TD 1M6ZA 4GYDA 2ZOOA 1DVHA 4EICA 1ZRTD 1HZUA 4DY9A 3NBSA 1L9BC 5CIFB 4AAOA 1LFMA 4UB8V 2CE0A 1IQCA 1FCDC 4FB1A 3ORVA 3X39A 5B6QA 1QL4A 5CIGB 1SQXD 1DW1A 1NU1D 3PHLA 1WEJF 2N18C 1DT1A 2XTSB 2QJKB 3PRJA 2GIWA 1H32A 2CE1A 2AI5A 2QJPB 3HQ8A 2PCBB 3ZOWA 3OA8B 2QG4A 1CYCA 1A8CA 1CRJA 1PPJD 3MK7B 2PACA 2YQBA 1AOQA 1CRCA 3PH2B 4J20A 1HROA 1CEDA 1SQVD 1CCHA 4WQDA 1GJQA 4L1QA 1C2NA 1CXAA 1CIHA 2GC4D 3KHUA 4YE1A 1F1FA 1GDVA 1BGYD 1RAPA 4PJ0V 3VMAA 3DP5A 2N3YA 3H1KD 3CX5D 3ITKA 1HRCA 4FA5A 1NIRA 1IO3A 3JBTB 1RZ6A 4O1QA 1MG2D 1IZL0 1QKSA 4LJIA 3CXHD 1H31B 1LC2A 2AIUA 3C2CA 5KLIB 4NFGB 2A06D 1MZ4A 3L74D 1L9JC 2BGVX 3ZOYA 2C1DA 5CICB 4IL6V 1S5LV 5KLVD 2BPBB 5C0ZA 2YCCA 1H31A 1DW2A 1CIEA 3A0HV 3ZCFA 1NTMD 5KAIV 1AYGA 4WQ8A 3CU4A 4WQ7A 2C1VA 2DVHA 2D0SA 2B4ZA 1FI9A 1NTZD 2Y0DA 1AKKA 1N50A 1DW3A 3CWBD 3HQ6A 1NMLA 1CSUA 1CRYA 3HQ9A 1F1CA 1M60A 5GTHV 1NMIA 3RMZA 4AX3A 2K9JB 4RSZA 3NBTA 1YTCA 1K3HA 2FYUD 5DFSA 5CIEB 3O20A 2C9XB 3L72D 1EB7A 1HJ3A 3WUIA 2ZXYA 3OA8A 4AANA 155CA 1KB0A 1C52A 3WU2V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK D;  2LIR A;  3H1H D;  3ZOO A;  5CIH B;  2JWA A;  1B7V A;  2LIT A;  5KKZ B;  2V07 A;  1OAE A;  1CRG A;  1E2R A;  1CNO A;  1HZV A;  2IBZ D;  1R0Q A;  1CSW A;  1C6S A;  1C6R A;  1CRI A;  4WQE A;  1GQ1 A;  4Y5R A;  1FI3 A;  1SQP D;  1K3G A;  3H1J D;  2RMZ A;  2ZZS 1;  4UB6 V;  1CRH A;  3WFC C;  3O0R C;  2N18 B;  2QJY B;  4FA9 A;  1QYZ A;  2V08 A;  1KYO W;  1HH7 A;  1FI7 A;  3FWL A;  1CC5 A;  1L0N D;  2N9Y B;  1CO6 A;  1RZ5 A;  1KV9 A;  1YCC A;  2CA4 B;  1QL3 A;  2ORL A;  3VNW A;  1YFC A;  1YIC A;  1DII C;  2EXV A;  4EDF A;  3WFE C;  2JTI B;  351C A;  1CTZ A;  1N90 A;  1U75 B;  3RN0 A;  4A7P A;  1LS9 A;  1I8O A;  4PD4 D;  2C1D B;  1SQQ D;  4K3I A;  3CYT I;  1CCR A;  3CX5 W;  1S6V B;  3VRD A;  1HJ5 A;  4N0K A;  2CXB A;  1W5C T;  4FA4 A;  5DF5 A;  4L3G A;  5B66 V;  2RN0 A;  2D0W A;  3TYI A;  5E79 V;  1VYD A;  1C7M A;  2FRC A;  1CYJ A;  1CIF A;  4KMG A;  1FHB A;  3WFD C;  2C2C A;  5KAF V;  1CHJ A;  5CIB B;  1C2R A;  3MK7 C;  2DGE A;  2L91 A;  1HJ4 A;  1KX2 A;  3PXS A;  1J3S A;  1KB9 D;  4WQA A;  1CSV A;  2KNC B;  2BCC D;  2ZBO A;  1H9Y A;  1OCD A;  1ZZH A;  1MG3 D;  1CTJ A;  1I55 A;  3RN1 A;  2AXT V;  4WQ9 A;  3GG2 A;  2ZON G;  3H1I D;  4V2K A;  1KIB A;  5EXQ A;  1H32 B;  1YEB A;  4P4Q B;  4H0J A;  1COR A;  3BCC D;  1CTY A;  1H33 B;  2PCC B;  3O5C A;  1CYI A;  3WFB C;  2VHD A;  2Q3E A;  3SLE A;  3ZIY A;  1I5T A;  3TF5 A;  3L75 D;  1YEA A;  4H0K A;  1H9X A;  3HQ7 A;  5TIS V;  3TDK A;  2B10 B;  4JCG A;  1BCC D;  1GU2 A;  3CP5 A;  3SXT A;  1H33 A;  1N15 A;  1SQB D;  1P84 D;  3O1Y A;  2FYN B;  4XXL A;  3GW6 A;  4AAM A;  2BH5 X;  3SJL A;  2OZ1 B;  1KYO D;  1BL9 A;  3SWS A;  4EID A;  2FWL A;  3WC8 A;  1DW0 A;  5DJQ C;  2KS1 A;  1C6O A;  1CXC A;  3L4O A;  2B11 B;  2BH4 X;  2YIU B;  3PTZ A;  1A56 A;  1N9C A;  2OZ1 A;  4QAO A;  4L3H A;  4FAV A;  1FOC A;  2MHM A;  5IY5 1;  2N9J A;  3L71 D;  2I8F A;  2JQR A;  5TJH A;  4XYD B;  3H1L D;  1KX7 A;  1COT A;  1BE3 D;  1NNO A;  2HV4 A;  1A2S A;  1QN2 A;  4EIF A;  1H1O A;  2N9I A;  1WVE C;  1CSX A;  5C9M A;  3KZI V;  1DIQ C;  3NWV A;  4EIE A;  3VYM A;  1JDL A;  2GC7 D;  1I6D A;  2MTA C;  2Y0E A;  1I54 A;  4Q5P A;  5DJQ B;  5AUR A;  2C1U A;  1I8P A;  1YIQ A;  3SVW A;  3CXH W;  1CHI A;  1E29 A;  5B5E V;  1C75 A;  3A0B V;  3DMI A;  4RJT A;  1IRW A;  1EZV D;  4PW9 B;  1AOF A;  3TGU D;  3M97 X;  1GKS A;  1DVV A;  1LMS A;  1CHH A;  2C8S A;  3PLN A;  2GB8 B;  451C A;  1IRV A;  1GIW A;  4U3F D;  3L73 D;  3OCD A;  1HCM A;  4MU8 A;  1LC1 A;  3ZOX A;  4GED B;  4FAN A;  2CA3 B;  1YNR A;  2B0Z B;  4WQC A;  1FJ0 A;  3PXT A;  5CYT R;  5H2F V;  2N3B A;  3RLM A;  4AAL A;  1M70 A;  1U74 B;  3L4M A;  5GTI V;  3ZBM A;  4FA1 A;  1PP9 D;  3OCD B;  1I6E A;  3DR0 A;  2YK3 A;  1ETP A;  3PXW A;  2O3J A;  2B12 B;  5CID B;  3L70 D;  4O1W A;  1RAQ A;  2L4D A;  2Y0C A;  2BLF B;  3A9F A;  2BCN B;  1E8E A;  4WQB A;  1L0L D;  1W2L A;  4PWA A;  1CIG A;  4D6T D;  1M6Z A;  4GYD A;  2ZOO A;  1DVH A;  4EIC A;  1ZRT D;  1HZU A;  4DY9 A;  3NBS A;  1L9B C;  5CIF B;  4AAO A;  1LFM A;  4UB8 V;  2CE0 A;  1IQC A;  1FCD C;  4FB1 A;  3ORV A;  3X39 A;  5B6Q A;  1QL4 A;  5CIG B;  1SQX D;  1DW1 A;  1NU1 D;  3PHL A;  1WEJ F;  2N18 C;  1DT1 A;  2XTS B;  2QJK B;  3PRJ A;  2GIW A;  1H32 A;  2CE1 A;  2AI5 A;  2QJP B;  3HQ8 A;  2PCB B;  3ZOW A;  3OA8 B;  2QG4 A;  1CYC A;  1A8C A;  1CRJ A;  1PPJ D;  3MK7 B;  2PAC A;  2YQB A;  1AOQ A;  1CRC A;  3PH2 B;  4J20 A;  1HRO A;  1CED A;  1SQV D;  1CCH A;  4WQD A;  1GJQ A;  4L1Q A;  1C2N A;  1CXA A;  1CIH A;  2GC4 D;  3KHU A;  4YE1 A;  1F1F A;  1GDV A;  1BGY D;  1RAP A;  4PJ0 V;  3VMA A;  3DP5 A;  2N3Y A;  3H1K D;  3CX5 D;  3ITK A;  1HRC A;  4FA5 A;  1NIR A;  1IO3 A;  3JBT B;  1RZ6 A;  4O1Q A;  1MG2 D;  1IZL 0;  1QKS A;  4LJI A;  3CXH D;  1H31 B;  1LC2 A;  2AIU A;  3C2C A;  5KLI B;  4NFG B;  2A06 D;  1MZ4 A;  3L74 D;  1L9J C;  2BGV X;  3ZOY A;  2C1D A;  5CIC B;  4IL6 V;  1S5L V;  5KLV D;  2BPB B;  5C0Z A;  2YCC A;  1H31 A;  1DW2 A;  1CIE A;  3A0H V;  3ZCF A;  1NTM D;  5KAI V;  1AYG A;  4WQ8 A;  3CU4 A;  4WQ7 A;  2C1V A;  2DVH A;  2D0S A;  2B4Z A;  1FI9 A;  1NTZ D;  2Y0D A;  1AKK A;  1N50 A;  1DW3 A;  3CWB D;  3HQ6 A;  1NML A;  1CSU A;  1CRY A;  3HQ9 A;  1F1C A;  1M60 A;  5GTH V;  1NMI A;  3RMZ A;  4AX3 A;  2K9J B;  4RSZ A;  3NBT A;  1YTC A;  1K3H A;  2FYU D;  5DFS A;  5CIE B;  3O20 A;  2C9X B;  3L72 D;  1EB7 A;  1HJ3 A;  3WUI A;  2ZXY A;  3OA8 A;  4AAN A;  155C A;  1KB0 A;  1C52 A;  3WU2 V; 
#chains in the Genus database with same CATH topology
 3VP9 A;  1BDC A;  4M3L A;  3L72 E;  2PAJ A;  2WPS A;  2Z4E A;  3B5N B;  1OAE A;  1CRG A;  3F5H A;  5DJT B;  1J1D C;  1CSW A;  3A0H H;  1N8R Q;  2H7H A;  2AEM A;  4L75 A;  3EQ2 A;  2OQQ A;  1FI3 A;  1IJD B;  1SQP D;  2ZXE B;  2ZZS 1;  1KIL E;  5E79 H;  3A5T A;  3O0R C;  3KZI H;  1M1K Q;  3V2N A;  2N18 B;  1K05 A;  1FI7 A;  3EFF K;  2W6B A;  2GUV A;  5APT A;  3Q2Y A;  2MKV A;  1CO6 A;  2WSS H;  1RZ5 A;  2CK3 H;  1X79 B;  1SFC A;  2ORL A;  1YFC A;  2HPC A;  1OVU A;  3CI9 A;  5AVQ B;  1SQX J;  351C A;  3L70 G;  2QA4 P;  1OMI A;  3RN0 A;  3PH0 A;  1NAF A;  3CPW O;  2C1D B;  2XDJ A;  4N3Y B;  1S6V B;  4DOJ A;  4N0K A;  2OYH A;  2WWW A;  1LJ2 A;  2CXB A;  1W5C T;  1ZV8 A;  2JKV A;  2XV5 A;  5B66 V;  4C7R A;  2RN0 A;  3R4Y A;  1URQ D;  2D0W A;  2P67 A;  2WSC H;  2POH A;  3M9B A;  5E79 V;  1C7M A;  1BDD A;  1IFM A;  1SQX K;  2H88 C;  4JBZ A;  4KMG A;  2C2C A;  2IPP A;  1CHJ A;  1C2R A;  1Q7Y Q;  3B71 A;  1PV3 A;  1SQV E;  1R5S A;  2NPS B;  5CCH C;  1HJ4 A;  3PXS A;  5BVZ A;  2ZYG A;  1CSV A;  2FKW B;  1QX8 A;  4YXW H;  3VTP C;  2OTK E;  1ZZH A;  1MG3 D;  1I55 A;  3RN1 A;  4GDO A;  3II6 A;  3CC4 P;  5AVX B;  4GT1 A;  4WQ9 A;  1VDF A;  2YNY A;  3EFG A;  3H1I D;  1EDI A;  1J1D B;  3TNU A;  1SQP E;  5EXQ A;  1PFI A;  1H32 B;  1YEB A;  2P7J A;  1COR A;  1H33 B;  1DEE G;  1CYI A;  3WFB C;  3AEA C;  1BGY G;  3SWK A;  1FJP A;  1VQL P;  1YEA A;  1SQV J;  4PV1 C;  3O6Q A;  1JY2 O;  3CCE P;  3F89 A;  1KN7 A;  3GW6 A;  4AAM A;  3VMX A;  2FYU E;  2ZVN B;  4EID A;  2R3S A;  1HF9 A;  3A0B E;  2HPC B;  1NTM G;  2KS1 A;  1CXC A;  3L75 J;  2B11 B;  4WVZ A;  3MHV A;  2BH4 X;  1JMM A;  2JR8 A;  3AE4 C;  3AEC C;  3PTZ A;  1N9C A;  3MGN A;  1YTZ I;  2YXQ B;  5IY5 1;  4U3F J;  1WMK A;  2JQR A;  2E76 C;  1JCC A;  1KX7 A;  1BE3 D;  1URQ B;  2OGU A;  1WVE C;  2FXP A;  2VRS A;  3KZI V;  3HE4 A;  3ZDM A;  1GU5 A;  3KQG A;  3RGU A;  1VQP P;  2FXM A;  1KQF B;  5CCG D;  1M8O B;  2O01 J;  3TGU E;  2B87 B;  1S5L X;  1MFZ A;  3JSV C;  2GC7 D;  2K37 A;  1I6D A;  1MZ9 A;  2MTA C;  1KFN A;  1NTM K;  3KYQ A;  1NTK E;  2OYI A;  3SFE C;  2C1U A;  4OWF A;  3CXH W;  4NPD A;  4O9B A;  1E29 A;  5B5E V;  1C75 A;  1LNQ A;  5AW5 B;  3TGU D;  1GKS A;  1M90 Q;  1IRV A;  1GIW A;  1H0T A;  1LTB C;  2O1J A;  1FS0 E;  2WSE H;  5KJ7 A;  1OW7 A;  1LC1 A;  4R4M A;  4GED B;  1CW5 A;  2CA3 B;  4WBA A;  1L0L K;  1FJ0 A;  1FU1 A;  4CPG A;  5CYT R;  2KLU A;  2I8D A;  4WWI A;  1GTW A;  3MZW B;  1M70 A;  1U74 B;  5GTI V;  3ZBM A;  2QJP C;  1KD1 Q;  1PP9 D;  3OCD B;  3DR0 A;  1FJK A;  1LTA C;  2CPB A;  2O3J A;  2B12 B;  1RAQ A;  2L4D A;  4JPZ B;  1QL2 A;  2BCN B;  2WIT A;  3USS A;  4WQB A;  3RK2 C;  2K1A A;  3BCC G;  5KJ7 C;  1DVH A;  1XTC C;  1P84 E;  4DY9 A;  4HH2 A;  1OIP A;  1L9B C;  4AAO A;  1LFM A;  1RQV A;  3L36 A;  4EYY Q;  3IAO A;  3NMD A;  5AVR B;  4ZMD A;  1FCD C;  3CX5 E;  1NTK J;  3X39 A;  1W2B O;  3VYI A;  1KIL C;  2GM4 A;  3PHL A;  2KOG A;  2WSF J;  3IFM A;  3B4S A;  4NPF X;  2QJK B;  1AV1 A;  3H1I E;  4W7Z A;  2GIW A;  2KZJ A;  1M1J B;  2QE7 H;  2AI5 A;  2H8P D;  3ZOW A;  3P8C D;  3OA8 B;  3S9O A;  1CYC A;  1A8C A;  4TLF A;  1CRJ A;  4H0L B;  1AQT A;  1ZR2 A;  3T97 A;  2IFN A;  2E75 D;  1RF0 A;  2KB7 P;  2SPZ A;  3PH2 B;  3WUT A;  1HRO A;  2HYN A;  1CED A;  2XKM A;  1SQV D;  1PP9 G;  3HD7 B;  1GJQ A;  3CX5 H;  1KIL A;  3V6I A;  2IZ0 A;  5APS A;  1CIH A;  3KHU A;  1SQV G;  1F1F A;  3LID A;  1GDV A;  3LIE A;  1JUN A;  3H1K D;  1OZH A;  1AA0 A;  5GTH E;  1HRC A;  2Q1K A;  4FA5 A;  1NIR A;  2JWD A;  3S1K A;  3RL0 D;  4DZO A;  3CXH D;  1H31 B;  3C2C A;  2N1T D;  2PRR A;  3L74 D;  2IYP A;  3HE4 B;  4U3F G;  2Z5I A;  2L5G B;  4HYT B;  4IL6 V;  5KLV D;  1EDK A;  2OYO A;  3V4Q A;  4K35 A;  1LT1 A;  2OTJ P;  3ZCF A;  1NTM D;  4BWN A;  1NGM B;  4WQ7 A;  1AQ5 A;  5AW3 B;  2WSE J;  1N73 A;  2Q6Q A;  2E42 A;  2KK7 A;  1N50 A;  2ZT9 D;  5H2F E;  1IFJ A;  1NTM E;  2FYZ A;  1R5L A;  2QIW A;  1CRY A;  4GIF A;  1YQ4 C;  5KLV E;  4AX3 A;  1XTG B;  3AE2 C;  4HKZ H;  3V2Q A;  4LLH A;  2KSE A;  2LKM A;  2N1T A;  3L72 D;  3CCU P;  4I6M C;  3OA8 A;  3H1H E;  1LT9 A;  2E75 B;  1KB0 A;  4OH8 B;  3L75 G;  1HGV A;  4H13 D;  1NTK D;  2LIR A;  2QM7 A;  5AW8 B;  2V07 A;  1E2R A;  1S3J A;  4N78 E;  1R8E A;  3GF3 A;  1VQK P;  5APX A;  4Y5R A;  4WY4 C;  1LWU B;  1H8A A;  5CJ4 A;  3H1J D;  1RY3 A;  3WFC C;  4YPC A;  2QJY B;  4U7J A;  2E74 B;  2ZJS E;  1RE4 A;  4KJM A;  1HH7 A;  3I55 P;  3FWL A;  1CC5 A;  3L71 G;  2ZAE B;  1T2K D;  3H6P A;  3U1A A;  1NAY A;  1KB9 E;  2IX7 C;  3A7O A;  2N1T B;  3CD6 P;  3P8C E;  2EXV A;  2KS1 B;  2BEZ F;  2JTI B;  1CTZ A;  2ZXX A;  4WY4 A;  3KPE A;  5CCG A;  1LS9 A;  1M1J A;  1JEK A;  3WU2 E;  4PD4 D;  5APV A;  1FDM A;  3HE5 B;  1LTJ C;  1NH4 A;  1YTZ T;  1S2E A;  3VRD A;  1HJ5 A;  3SFD C;  3WUV A;  3G3Z A;  4R4L A;  3SWF A;  2ZT9 B;  2KYV A;  3L4F A;  1KIL B;  2K3R A;  1NU1 K;  2FRC A;  1CYJ A;  1VQM P;  1CIF A;  2KI7 B;  2OYH B;  1ZP0 C;  1FHB A;  4ZKU A;  5CIB B;  1T2K C;  2UWJ E;  2K88 A;  2DGE A;  1T6A A;  2KLV A;  5BU5 A;  1PP9 E;  2KNC B;  3M0D C;  5C39 A;  2DW3 A;  4WY4 D;  4UB8 H;  3GG2 A;  4AQR D;  2AXC A;  1JTH A;  1KQS O;  1YJ9 P;  2WVR A;  1RF1 C;  1KIB A;  1DH3 A;  1DD3 A;  1N73 C;  4D6T G;  3JC2 2;  4D6T J;  2VHD A;  1FZE A;  1N2D C;  2E74 D;  3PP5 A;  1YI2 P;  1H9X A;  1URQ C;  2A45 I;  5TIS V;  3RK3 E;  4DCK A;  1PL5 A;  1DD4 A;  4K3A A;  3CP5 A;  2LR2 A;  2PP6 A;  1N7S B;  1ZW0 A;  4PD4 H;  1KYO D;  4Y99 B;  1NTM J;  1FOS F;  2ZVO B;  3WU2 H;  3Q1M A;  1Y8A A;  1NKN A;  5APU A;  3FX0 A;  3OAK A;  1H89 A;  4FAV A;  3AE8 C;  5TJH A;  4XYD B;  3H1L D;  1PGJ A;  3H32 B;  2HG5 D;  1COT A;  2E74 C;  5H2F H;  4PV1 B;  4PJ0 E;  2HV4 A;  3H1K J;  1KIL D;  1GDT A;  3O6Q B;  1QL1 A;  1HH0 A;  1VQ4 P;  4L73 A;  2FYN C;  3QH9 A;  3D70 A;  1U7M A;  4I7Z C;  1DX7 A;  2QSI A;  2WSF H;  3P8M C;  1AVO A;  2A45 G;  3H25 A;  1I54 A;  4Q5P A;  2WT7 B;  1OW6 A;  2R32 A;  4ZNC A;  1H0T B;  2B9B A;  1I8P A;  3SVW A;  4ZKP A;  1JO5 A;  1CHI A;  3P7K A;  3DMI A;  1JY3 N;  2QM8 A;  4PW9 B;  3M97 X;  1K8A Q;  1LMS A;  4UB8 E;  3PLN A;  2GB8 B;  1NVO A;  1EXJ A;  3GHG B;  1RF1 B;  3L73 D;  3OCD A;  1HCM A;  2J58 A;  1YNR A;  2B0Z B;  2J5U A;  3H1L E;  4WQC A;  2E75 C;  3CL3 D;  1OW8 A;  1CSB A;  2JEE A;  3L4M A;  4FA1 A;  4Y28 J;  1I6E A;  1N7S D;  2N1T C;  1L0N K;  3A2A A;  5AVT B;  3H1I G;  1KOR A;  3A9F A;  1L2P A;  1DEB A;  1L0L D;  1LP1 B;  1W2L A;  1CZQ A;  1CIG A;  1RE3 A;  2ZOO A;  2NPS C;  2Q3I A;  3SWY A;  3M0A A;  5EFW B;  3RK3 D;  3HUS C;  4B86 A;  5BU8 B;  1IQC A;  3AE7 C;  3U59 A;  1DW1 A;  3BAS A;  1ZME C;  1BGY E;  3MD0 A;  2M3B A;  5M1B A;  1NTZ K;  1H32 A;  1L4A A;  1QEX A;  3CXH I;  1L0N J;  1OFC X;  1JY2 N;  1U57 A;  2QG4 A;  1SP4 A;  3L70 J;  1RF0 C;  2YMY A;  2H43 A;  3K5B A;  1CRC A;  3B5N C;  1YBK A;  1CCH A;  4KHX A;  4H13 C;  4WQD A;  1NJI Q;  2B89 A;  1C2N A;  2D2C C;  2GC4 D;  3M0D A;  4BRY B;  3W68 A;  2P58 A;  1RAP A;  1IFD A;  3MIW A;  4PJ0 V;  1NU1 E;  3RL0 g;  3DP5 A;  1SQX E;  1Q2N A;  1VL2 A;  2R3C A;  1TU3 F;  4BRY A;  1GZL A;  1GL2 C;  3VP8 A;  1IZL 0;  3CLQ A;  1LC2 A;  3TGU G;  1J2J B;  5KLI B;  1LTG C;  4PD4 E;  2A06 D;  1L9J C;  1L0L E;  4OGQ C;  2BGV X;  3ZOY A;  1PGP A;  5CIC B;  2A06 G;  4IFF A;  1S5L V;  3RK2 B;  5AVS B;  3L70 E;  1DW2 A;  1FZF A;  1YIJ P;  5L8R J;  1PIX A;  1L0N E;  1AYG A;  1JNM A;  4WQ8 A;  1VPC A;  3CCQ P;  2C1V A;  3H1L J;  1VQ5 P;  3WMM 0;  2D0S A;  2IFM A;  3L72 J;  1BGY J;  2LXB A;  1FDI A;  5AW1 B;  1FAV A;  4DT0 A;  2Y0D A;  2G8Y A;  1NTK K;  1OVV A;  1LT9 B;  3CX5 I;  1CSU A;  3HQ9 A;  2FYU J;  1NMI A;  1RHZ B;  1YYC A;  2K9J B;  4RSZ A;  1EZV E;  1YTC A;  1K3H A;  2FYU D;  3I56 P;  5CIE B;  3NFQ A;  1FZC C;  2HOD B;  1S9K E;  1EB7 A;  1HJ3 A;  2HR3 A;  1SQB E;  2V4H A;  3H1H D;  5CIH B;  3CCR P;  2W90 A;  4AUW A;  1FZA A;  2JWA A;  1B7V A;  2LIT A;  3BRV B;  3VMZ A;  1X22 A;  3H1H J;  1GK6 A;  3H1H G;  3M06 A;  1N86 A;  5CBN A;  1R0Q A;  1C6S A;  1GD2 E;  3AE5 C;  3GHG C;  5CJ0 A;  5KAI E;  1HTL C;  1GQ1 A;  3N7N A;  2AXT H;  1K3G A;  2C0W A;  2RMZ A;  3G71 P;  1CRH A;  3EWK A;  1QVF O;  1CI6 A;  1G1I A;  2GUS A;  4FA9 A;  1QYZ A;  2V08 A;  1KYO W;  1RQU A;  1PGO A;  2BCC J;  2BCC G;  2JO1 A;  1KV9 A;  2YKO A;  4IL6 X;  2E5Y A;  3CCM P;  1QL3 A;  4C46 A;  5AVU B;  3VNW A;  1L0N G;  3IR9 A;  3NXS A;  4I7Z B;  1YIC A;  3Q5P A;  3WFE C;  3GHG A;  5KTB A;  3B5N A;  1N90 A;  1U75 B;  1EC5 A;  1GMJ A;  2OTL P;  3RK2 D;  5DJU B;  4A7P A;  1I8O A;  2FY8 A;  1LTJ A;  1SQQ D;  2AXT E;  4HB1 A;  2KNC A;  1SQP K;  1PZQ A;  1FZG A;  1BCC E;  1PP9 J;  3BRT B;  1RE3 C;  1VQN P;  1UIX A;  4FA4 A;  5DF5 A;  1SQB J;  4L3G A;  1USD A;  3H1K E;  1ZRT E;  1VYD A;  1VF5 B;  1ZN5 A;  3M9H A;  1PGQ A;  2P1J A;  2IBZ I;  3CC2 P;  3WFD C;  2NZ2 A;  5KAF V;  3MK7 C;  2D2C D;  2L91 A;  3D6Y A;  1EQ7 A;  1J3S A;  2NRG A;  1VQO P;  1JTH B;  2KIK A;  1S5L E;  4WQA A;  4YXD C;  5KLV K;  1VQ7 P;  2BCC D;  4L76 A;  1FBM A;  2OYI C;  2AXT V;  1RF1 A;  2ZON G;  2WPQ A;  4V2K A;  1SQB K;  1M56 D;  3O8Z A;  4P4Q B;  4H0J A;  3BCC D;  1CTY A;  3O5C A;  4W80 A;  1LT9 C;  1LWU A;  1OXZ A;  1X0T A;  2Q3E A;  3E7K A;  1SQQ G;  3ZIY A;  1I5T A;  1SFC C;  4BXL A;  4GOE A;  4H0K A;  3TDK A;  4JF7 A;  3TNU B;  5CCH D;  2B10 B;  1FDO A;  2BAS A;  3V5B A;  2NPS A;  3SXT A;  1KB9 H;  1EZV G;  1H33 A;  1KMI Z;  2ZYD A;  4RO0 A;  3V2R A;  1N15 A;  3Q3D A;  1SQB D;  1P84 D;  3O1Y A;  1FZB A;  3GF7 A;  2BH5 X;  4LGD E;  1S9K D;  3SJL A;  2N9B A;  1VQ9 P;  1BL9 A;  2YO3 A;  1KB9 I;  2ZYA A;  1K04 A;  3L74 J;  2G3A A;  5DJQ C;  5KJ7 D;  1C6O A;  2JJL A;  4JYC A;  2ZT9 C;  1RH5 B;  2FBW C;  4QAO A;  4L3H A;  4RKU J;  1FOC A;  3HE5 A;  1GW4 A;  3GMA A;  2I8F A;  1T3J A;  1AFO A;  3QWO C;  1HBW A;  3IF4 A;  1U7J A;  1SFC D;  5AW4 B;  3ABV C;  1NNO A;  4NPE A;  1VF5 D;  2E5T A;  1CSX A;  4U3F E;  4OGQ B;  1D7M A;  1K9M Q;  3NWV A;  3MP7 B;  1KQG B;  3CCV P;  1IK9 A;  1X8Y A;  1JDL A;  2C9L Y;  1NWQ A;  2NPS D;  2E43 A;  3HD7 C;  4GKG A;  1EZV I;  4KT0 J;  1IRW A;  1NU1 G;  1NTK G;  2I1J A;  1CHH A;  2C8S A;  1USE A;  4H0L C;  5KAI H;  2P10 A;  2OYI B;  4U3F D;  5B66 E;  3LW5 J;  2WPR A;  3CWB E;  4MU8 A;  3ZOX A;  1YIT P;  4FAN A;  3G6E P;  1NTZ E;  3H1J J;  3PXT A;  5H2F V;  5KAF E;  2N3B A;  1MKM A;  3RL0 B;  1S4X A;  3L37 A;  2C9N Y;  2FXO A;  5CID B;  4O1W A;  2Y0C A;  2BLF B;  4IOI H;  2Q7C A;  1N7S A;  3CWB J;  2W6A A;  3BCC J;  3VMY A;  1A02 J;  5CCH A;  2XU6 A;  3TK1 A;  2GA1 A;  4GYD A;  2W8Z A;  2KXP B;  4EIC A;  1CI6 B;  1S1C X;  1NKZ B;  3I5C A;  4Z1M H;  2FYU K;  1Q86 Q;  3C8V A;  5GTH H;  1IO4 A;  5KAF H;  1RE4 C;  5B6Q A;  1FZC A;  1NOH A;  1SFC B;  3BCC E;  4UB6 E;  3OJA B;  2JDI H;  2N18 C;  2XTS B;  4OGQ D;  4D6T E;  1G2C A;  3D6Z A;  1WT6 A;  1JCD A;  2ITA A;  4RES B;  2FFD A;  2QJP B;  1Q90 D;  1SQP G;  1IFN A;  2B87 A;  3MK7 B;  2PAC A;  1YQ3 C;  3MUD A;  1M1J C;  1AOQ A;  1S5L H;  2AEJ A;  3BAT A;  5KKZ C;  1NTZ J;  1JY2 P;  1NTZ G;  1QLE D;  1SLQ A;  4PD4 I;  3H1I J;  1MFT A;  4OVN F;  3L73 E;  4N6J A;  3RK3 C;  3VMA A;  2IBZ E;  1JM0 A;  1VQ8 P;  3KZI E;  3CX5 D;  1G2C B;  3Q5R A;  3ITK A;  1GL2 A;  3JBT B;  1RZ6 A;  1MG2 D;  4LJI A;  4H44 D;  2AIU A;  1EXI A;  3FXD A;  1DIP A;  2OYH C;  4IFD K;  1MZ4 A;  2O01 N;  1LGH B;  1BSH A;  4HJG H;  5B5E E;  2O1K A;  3HD7 A;  2CPS A;  2PFX A;  2BPB B;  3L35 A;  3UIA A;  5C0Z A;  3A0H V;  3CXH H;  3GLM A;  1E5W A;  3CU4 A;  2XZR A;  2B4Z A;  4XE5 B;  5AVV B;  3L71 E;  1NTZ D;  1AVY A;  2K9J A;  5AW2 B;  2RKL A;  1DW3 A;  3CWB D;  3HQ6 A;  3JCU E;  1F1C A;  1M60 A;  2FYU G;  5CMZ A;  3CME P;  3RMZ A;  1FOS E;  1GW3 A;  2KSJ A;  2WSC J;  4H44 C;  3NBT A;  1KYO E;  4H0L D;  1LTI C;  2ZXY A;  4AAN A;  155C A;  3CXH E;  2KUB A;  4C7N B;  2W27 A;  1NYH A;  1KZU B;  3ZOO A;  5AVY B;  3TGU J;  3H32 A;  3A3Y B;  3L75 E;  5KKZ B;  3HD7 D;  4IL6 E;  4WY4 B;  3E1I A;  2M0B A;  1CNO A;  1HZV A;  2IBZ D;  3C9I A;  3A0H E;  2BEQ D;  3PJS K;  1FE6 A;  1C6R A;  1CRI A;  5TIS H;  4I2L C;  1IK7 A;  3U1C A;  4WQE A;  2K9Y A;  5AVW B;  4UB6 V;  2M3E A;  3N4X A;  3L73 J;  4EI2 A;  3M91 A;  2IYO A;  1AJY A;  4QMA A;  1L0N D;  2N9Y B;  4H44 B;  2FFD C;  1YCC A;  1FZC B;  2CA4 B;  1ZXG A;  2O01 H;  2OAR A;  2MJZ A;  3RBZ A;  5KLI C;  1BE3 G;  1DII C;  4EDF A;  2J59 M;  4I1L A;  5CBO A;  3AE9 C;  5B5E H;  2A06 E;  4K3I A;  3R2P A;  1L0L G;  4ASW A;  3HUS B;  1HWT C;  3CYT I;  1CCR A;  5AW6 B;  1M7L A;  3CX5 W;  1BCC G;  3RL0 C;  3Q5S A;  1LTJ B;  3RBX A;  2QJY C;  4PV1 D;  3TYI A;  5APY A;  2V7Q H;  3MTU E;  1J1E B;  5KLV J;  2IBZ G;  3W67 A;  1OVR A;  4MN4 C;  2W6J H;  1JY3 O;  3L73 G;  2BCC E;  2M5A A;  3HTK B;  1P84 H;  1KX2 A;  1KB9 D;  1GL2 B;  1S72 P;  2I1K A;  4H13 B;  1LTS C;  1W2E A;  1PPJ E;  3AEE C;  2ZBO A;  1H9Y A;  1Q81 Q;  1OCD A;  3KXD A;  2YXR B;  1CTJ A;  1JOC A;  2C0X A;  4PJ0 H;  3H1J E;  1WRG A;  3M9Q A;  2WZ7 A;  1L0L J;  2PCC B;  1SQQ K;  4YTP C;  1YHQ P;  3L72 G;  3SLE A;  4EOT A;  1IZN B;  1L4A C;  3VOP A;  3TF5 A;  3L75 D;  3CCS P;  5CHX A;  3E1R A;  3HQ7 A;  1SQB G;  1IFP A;  4JCG A;  3AE3 C;  1BCC D;  4TT3 H;  1GU2 A;  4UB6 H;  4AYC A;  4XXL A;  2FYN B;  5CCG C;  2QJK C;  2OZ1 B;  5GTI H;  5KLV G;  1N7L A;  1A02 F;  3SWS A;  2ZFC A;  2FWL A;  3WC8 A;  3AEF C;  2WT7 A;  2WTY A;  1DW0 A;  4L74 A;  3L4O A;  2R44 A;  2Y9Z A;  2YIU B;  2QRX A;  1A56 A;  4JYB A;  3AEB C;  2OZ1 A;  3D71 A;  2MHM A;  1X9V A;  2Z5H A;  2N9J A;  3L71 D;  5APQ A;  1HGZ A;  2PGD A;  2YIU C;  3AE1 C;  1EDL A;  1A2S A;  1QN2 A;  4EIF A;  1H1O A;  2N9I A;  1LTT C;  5C9M A;  1L4A B;  5GTI E;  4IFM A;  1DIQ C;  3CWB G;  1NHL A;  4EIE A;  3VYM A;  4EIJ A;  3OW2 O;  1KYO H;  3L74 E;  5AW7 B;  2Y0E A;  1W5C E;  1JY3 P;  3KDP B;  5DJQ B;  1T8Z A;  1HUC A;  2P2U A;  1GL2 D;  3D0W A;  5AUR A;  1BE3 J;  1MUU A;  3HTK A;  4JQ0 D;  1YIQ A;  4W7Y A;  3NTN A;  3A0B V;  1SQX G;  1NU1 J;  4IL6 H;  4RJT A;  3CC7 P;  1EZV D;  1AOF A;  1DVV A;  2AEF A;  2XNX A;  451C A;  3L74 G;  3CCL P;  4GOF A;  3L71 J;  1URQ A;  5AW0 B;  4DJG A;  2XND H;  3VN0 A;  5E79 E;  1VF5 C;  1ZOY C;  1J1E C;  1QGK B;  2YKQ A;  2E76 D;  2YKP A;  1LP1 A;  1KC8 Q;  1Z56 A;  3RLM A;  4AAL A;  1HJB A;  2LXC B;  2YK3 A;  1K73 Q;  1ETP A;  3PXW A;  3L70 D;  1N7S C;  4ASV A;  1OWA A;  1E8E A;  4PWA A;  5APW A;  4D6T D;  1T3U A;  1UII A;  2QVA A;  1YJN P;  4Y99 C;  1M6Z A;  2R5D A;  1KQL A;  1M57 D;  1ZRT D;  1HZU A;  3NBS A;  1JMB A;  3BVH A;  3WUU A;  5CIF B;  1N73 B;  4UB8 V;  2YO2 A;  2CE0 A;  3TSI A;  1JB0 J;  3C1L A;  1Y47 A;  2FFD B;  4FB1 A;  3ORV A;  2Y9Y A;  4GOD A;  1SQV K;  1QL4 A;  5CIG B;  2JP3 A;  1SQX D;  5AW9 B;  2YMK A;  1NU1 D;  5TIS E;  2RH0 A;  2KP8 A;  3T97 B;  3AED C;  1SQQ E;  1L4A D;  1WEJ F;  1SQQ J;  1DT1 A;  3PRJ A;  1ZLL A;  2CE1 A;  3H1J G;  3HQ8 A;  2PCB B;  1SQP J;  4WB4 A;  1YJW P;  1GU4 A;  1IC2 A;  2R5B A;  3MUD C;  4C7N A;  1PPJ D;  2A45 H;  2YQB A;  1EDJ A;  2WQY C;  1KFM A;  3H1L G;  2HLO A;  4J20 A;  1HJ0 A;  1PPJ G;  3AEG C;  3FGA D;  3V2P A;  3B5N D;  3LW5 H;  4L1Q A;  1BCC J;  1CXA A;  4YE1 A;  2W83 C;  2V7Q J;  4LC1 A;  1BGY D;  1HVV A;  1NO4 A;  3P32 A;  2N3Y A;  1E79 H;  3FWN A;  1G1J A;  2QEX P;  3H1K G;  1IO3 A;  2E76 B;  1P84 I;  4O1Q A;  1QKS A;  1KTM A;  2HFE D;  2H89 C;  1Y9B A;  4NFG B;  3G9R A;  2M8R A;  2WMM A;  1SVF A;  3S4R A;  2HOD A;  2B88 A;  2C1D A;  1VQ6 P;  3A0B H;  1KYO I;  3V4W A;  1ZR4 A;  1IFI A;  3HUS A;  2YCC A;  1H31 A;  1OX3 A;  3G4S P;  3B8E B;  2WPV B;  3CMA P;  1CIE A;  4XFJ A;  5KAI V;  1BE3 E;  1FC2 C;  2DVH A;  3RK3 B;  1LWU C;  1BSN A;  2KZI A;  1H88 A;  3CCJ P;  1FI9 A;  5K5G B;  1GK4 A;  1KV4 A;  5AVZ B;  3IN6 A;  2Q9I A;  1AKK A;  3AE6 C;  1Q82 Q;  3HRN A;  5B66 H;  1NML A;  1MV8 A;  3JCU H;  5GTH V;  2IDB A;  4N78 D;  3TYY A;  1QVG O;  2Q5U A;  2M5A B;  5DFS A;  2D2C B;  3O20 A;  3FXE A;  2C9X B;  3WUI A;  3SSU A;  1SS1 A;  3OA7 A;  1C52 A;  4XA4 A;  2IZ1 A;  3WU2 V; 
#chains in the Genus database with same CATH homology
 1NTK D;  2LIR A;  3H1H D;  3ZOO A;  5CIH B;  2JWA A;  1B7V A;  2LIT A;  5KKZ B;  2V07 A;  1OAE A;  1CRG A;  1E2R A;  1CNO A;  1HZV A;  2IBZ D;  1R0Q A;  1CSW A;  1C6S A;  1C6R A;  1CRI A;  4WQE A;  1GQ1 A;  4Y5R A;  1FI3 A;  1SQP D;  1K3G A;  3H1J D;  2RMZ A;  2ZZS 1;  4UB6 V;  1CRH A;  3WFC C;  3O0R C;  2N18 B;  2QJY B;  4FA9 A;  1QYZ A;  2V08 A;  1KYO W;  1HH7 A;  1FI7 A;  3FWL A;  1CC5 A;  1L0N D;  2N9Y B;  1CO6 A;  1RZ5 A;  1KV9 A;  1YCC A;  2CA4 B;  1QL3 A;  2ORL A;  3VNW A;  1YFC A;  1YIC A;  1DII C;  2EXV A;  4EDF A;  3WFE C;  2JTI B;  351C A;  1CTZ A;  1N90 A;  1U75 B;  3RN0 A;  4A7P A;  1LS9 A;  1I8O A;  4PD4 D;  2C1D B;  1SQQ D;  4K3I A;  3CYT I;  1CCR A;  3CX5 W;  1S6V B;  3VRD A;  1HJ5 A;  4N0K A;  2CXB A;  1W5C T;  4FA4 A;  5DF5 A;  4L3G A;  5B66 V;  2RN0 A;  2D0W A;  3TYI A;  5E79 V;  1VYD A;  1C7M A;  2FRC A;  1CYJ A;  1CIF A;  4KMG A;  1FHB A;  3WFD C;  2C2C A;  5KAF V;  1CHJ A;  5CIB B;  1C2R A;  3MK7 C;  2DGE A;  2L91 A;  1HJ4 A;  1KX2 A;  3PXS A;  1J3S A;  1KB9 D;  4WQA A;  1CSV A;  2KNC B;  2BCC D;  2ZBO A;  1H9Y A;  1OCD A;  1ZZH A;  1MG3 D;  1CTJ A;  1I55 A;  3RN1 A;  2AXT V;  4WQ9 A;  3GG2 A;  2ZON G;  3H1I D;  4V2K A;  1KIB A;  5EXQ A;  1H32 B;  1YEB A;  4P4Q B;  4H0J A;  1COR A;  3BCC D;  1CTY A;  1H33 B;  2PCC B;  3O5C A;  1CYI A;  3WFB C;  2VHD A;  2Q3E A;  3SLE A;  3ZIY A;  1I5T A;  3TF5 A;  3L75 D;  1YEA A;  4H0K A;  1H9X A;  3HQ7 A;  5TIS V;  3TDK A;  2B10 B;  4JCG A;  1BCC D;  1GU2 A;  3CP5 A;  3SXT A;  1H33 A;  1N15 A;  1SQB D;  1P84 D;  3O1Y A;  2FYN B;  4XXL A;  3GW6 A;  4AAM A;  2BH5 X;  3SJL A;  2OZ1 B;  1KYO D;  1BL9 A;  3SWS A;  4EID A;  2FWL A;  3WC8 A;  1DW0 A;  5DJQ C;  2KS1 A;  1C6O A;  1CXC A;  3L4O A;  2B11 B;  2BH4 X;  2YIU B;  3PTZ A;  1A56 A;  1N9C A;  2OZ1 A;  4QAO A;  4L3H A;  4FAV A;  1FOC A;  2MHM A;  5IY5 1;  2N9J A;  3L71 D;  2I8F A;  2JQR A;  5TJH A;  4XYD B;  3H1L D;  1KX7 A;  1COT A;  1BE3 D;  1NNO A;  2HV4 A;  1A2S A;  1QN2 A;  4EIF A;  1H1O A;  2N9I A;  1WVE C;  1CSX A;  5C9M A;  3KZI V;  1DIQ C;  3NWV A;  4EIE A;  3VYM A;  1JDL A;  2GC7 D;  1I6D A;  2MTA C;  2Y0E A;  1I54 A;  4Q5P A;  5DJQ B;  5AUR A;  2C1U A;  1I8P A;  1YIQ A;  3SVW A;  3CXH W;  1CHI A;  1E29 A;  5B5E V;  1C75 A;  3A0B V;  3DMI A;  4RJT A;  1IRW A;  1EZV D;  4PW9 B;  1AOF A;  3TGU D;  3M97 X;  1GKS A;  1DVV A;  1LMS A;  1CHH A;  2C8S A;  3PLN A;  2GB8 B;  451C A;  1IRV A;  1GIW A;  4U3F D;  3L73 D;  3OCD A;  1HCM A;  4MU8 A;  1LC1 A;  3ZOX A;  4GED B;  4FAN A;  2CA3 B;  1YNR A;  2B0Z B;  4WQC A;  1FJ0 A;  3PXT A;  5CYT R;  5H2F V;  2N3B A;  3RLM A;  4AAL A;  1M70 A;  1U74 B;  3L4M A;  5GTI V;  3ZBM A;  4FA1 A;  1PP9 D;  3OCD B;  1I6E A;  3DR0 A;  2YK3 A;  1ETP A;  3PXW A;  2O3J A;  2B12 B;  5CID B;  3L70 D;  4O1W A;  1RAQ A;  2L4D A;  2Y0C A;  2BLF B;  3A9F A;  2BCN B;  1E8E A;  4WQB A;  1L0L D;  1W2L A;  4PWA A;  1CIG A;  4D6T D;  1M6Z A;  4GYD A;  2ZOO A;  1DVH A;  4EIC A;  1ZRT D;  1HZU A;  4DY9 A;  3NBS A;  1L9B C;  5CIF B;  4AAO A;  1LFM A;  4UB8 V;  2CE0 A;  1IQC A;  1FCD C;  4FB1 A;  3ORV A;  3X39 A;  5B6Q A;  1QL4 A;  5CIG B;  1SQX D;  1DW1 A;  1NU1 D;  3PHL A;  1WEJ F;  2N18 C;  1DT1 A;  2XTS B;  2QJK B;  3PRJ A;  2GIW A;  1H32 A;  2CE1 A;  2AI5 A;  2QJP B;  3HQ8 A;  2PCB B;  3ZOW A;  3OA8 B;  2QG4 A;  1CYC A;  1A8C A;  1CRJ A;  1PPJ D;  3MK7 B;  2PAC A;  2YQB A;  1AOQ A;  1CRC A;  3PH2 B;  4J20 A;  1HRO A;  1CED A;  1SQV D;  1CCH A;  4WQD A;  1GJQ A;  4L1Q A;  1C2N A;  1CXA A;  1CIH A;  2GC4 D;  3KHU A;  4YE1 A;  1F1F A;  1GDV A;  1BGY D;  1RAP A;  4PJ0 V;  3VMA A;  3DP5 A;  2N3Y A;  3H1K D;  3CX5 D;  3ITK A;  1HRC A;  4FA5 A;  1NIR A;  1IO3 A;  3JBT B;  1RZ6 A;  4O1Q A;  1MG2 D;  1IZL 0;  1QKS A;  4LJI A;  3CXH D;  1H31 B;  1LC2 A;  2AIU A;  3C2C A;  5KLI B;  4NFG B;  2A06 D;  1MZ4 A;  3L74 D;  1L9J C;  2BGV X;  3ZOY A;  2C1D A;  5CIC B;  4IL6 V;  1S5L V;  5KLV D;  2BPB B;  5C0Z A;  2YCC A;  1H31 A;  1DW2 A;  1CIE A;  3A0H V;  3ZCF A;  1NTM D;  5KAI V;  1AYG A;  4WQ8 A;  3CU4 A;  4WQ7 A;  2C1V A;  2DVH A;  2D0S A;  2B4Z A;  1FI9 A;  1NTZ D;  2Y0D A;  1AKK A;  1N50 A;  1DW3 A;  3CWB D;  3HQ6 A;  1NML A;  1CSU A;  1CRY A;  3HQ9 A;  1F1C A;  1M60 A;  5GTH V;  1NMI A;  3RMZ A;  4AX3 A;  2K9J B;  4RSZ A;  3NBT A;  1YTC A;  1K3H A;  2FYU D;  5DFS A;  5CIE B;  3O20 A;  2C9X B;  3L72 D;  1EB7 A;  1HJ3 A;  3WUI A;  2ZXY A;  3OA8 A;  4AAN A;  155C A;  1KB0 A;  1C52 A;  3WU2 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...