3H1LD

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
molecule tags Oxidoreductase
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1lD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1lD02
1CSWA 1FI9A 1E2RA 2DVHA 5DF5A 3TF5A 1OCDA 2MTAC 1NTZD 1FOCA 3HQ7A 1KYOW 1CTJA 1H31A 1SQBD 1H9XA 1P84D 2N18B 3TYIA 5EXQA 5TISV 1CHIA 1AOFA 4XXLA 3KHUA 3SJLA 1N50A 3SLEA 1F1CA 4L1QA 1CIGA 1M70A 1H31B 2B0ZB 1COTA 2B11B 1ETPA 5TJHA 1HJ3A 1IQCA 3ZIYA 1CORA 2AI5A 1C6OA 3HQ9A 1RZ6A 4EIFA 2BCNB 3RLMA 2Y0EA 4O1QA 1L9JC 4MU8A 1DW1A 2EXVA 3H1HD 1GKSA 1RZ5A 1A56A 5CIGB 2RN0A 2KS1A 1CYJA 2DGEA 1LS9A 3ZCFA 2A06D 1IRWA 2GC7D 3ZOWA 3ZOOA 1C75A 1DIQC 1QN2A 3CX5W 1H32A 3SWSA 1GJQA 4P4QB 4FA5A 5KLVD 3PTZA 1LC2A 3RMZA 1OAEA 1BE3D 1CIHA 1N15A 4FANA 3O20A 4AAOA 3L4MA 4YE1A 1CRJA 1MZ4A 3PLNA 1GDVA 1M60A 3L73D 3L71D 1SQVD 4FA1A 4K3IA 1CTYA 2QJKB 3A0BV 2GB8B 1E29A 3NBSA 1CSUA 2O3JA 4EIEA 4QAOA 1FI7A 2OZ1B 5H2FV 2BH5X 1QL4A 3HQ8A 2V08A 1CHHA 4L3GA 1I5TA 5KKZB 1CRIA 3CXHW 3WFCC 2BPBB 3DP5A 4N0KA 1CYCA 3CYTI 1SQPD 3SVWA 1BL9A 3PXWA 1QKSA 1AOQA 1C7MA 1LMSA 4J20A 1N90A 3C2CA 3H1KD 3WU2V 4WQAA 5DJQC 1I8PA 3L4OA 1KYOD 1KIBA 1HRCA 2PCCB 2B12B 4RSZA 3GG2A 2ZONG 1I6DA 1YNRA 1H33B 1C52A 1CNOA 4WQ7A 5DFSA 3CWBD 2D0WA 1FCDC 5B66V 2ORLA 2ZBOA 1YTCA 4UB6V 2PACA 1C2NA 1I8OA 1DIIC 1YEAA 2LITA 2YCCA 1SQXD 3NWVA 4UB8V 1FJ0A 1H32B 2CE0A 2Y0CA 2N3YA 4NFGB 2PCBB 2FWLA 1DW2A 2FRCA 1IRVA 1IZL0 1CIFA 1W5CT 2YK3A 2CA4B 2ZXYA 2C8SA 2N9IA 2FYUD 3A9FA 1HCMA 1YIQA 3H1JD 2BGVX 1A8CA 4AX3A 1U74B 3BCCD 5CIDB 3CU4A 2CE1A 4FA4A 1CSXA 1L9BC 2N18C 1BGYD 2JQRA 3JBTB 3O0RC 1RAQA 1L0ND 2YIUB 1C2RA 155CA 1GQ1A 1NMLA 3PHLA 3OA8B 1CCHA 2YQBA 2C2CA 1DT1A 2FYNB 3WUIA 1CRHA 3O1YA 2RMZA 1QL3A 4L3HA 2OZ1A 2Y0DA 1VYDA 3CX5D 4JCGA 2MHMA 2LIRA 2V07A 3OA8A 3O5CA 1HZVA 2VHDA 1CYIA 4EDFA 5CICB 1S6VB 1DVHA 4RJTA 5CIEB 1FI3A 3WFBC 3L75D 1C6SA 3A0HV 2C1VA 2N9JA 4FB1A 4H0JA 1GU2A 3PXTA 3GW6A 1U75B 3SXTA 5B6QA 1CCRA 1SQQD 3ZOXA 1CXCA 1WEJF 2C1DA 4WQBA 5CIBB 3HQ6A 2JWAA 1I54A 4FA9A 4WQDA 1M6ZA 4U3FD 4A7PA 1NU1D 1HJ4A 1IO3A 1NIRA 1NTMD 1A2SA 3H1LD 4D6TD 2JTIB 4DY9A 1J3SA 1H33A 1KX2A 4XYDB 2C1UA 1YEBA 2AIUA 2BLFB 4WQ8A 2IBZD 1PPJD 1MG2D 1YCCA 5KAIV 5KLIB 5E79V 4LJIA 1BCCD 1CRCA 3MK7C 1H9YA 4AANA 1HROA 3L70D 2N3BA 1KV9A 3CP5A 4IL6V 4FAVA 5CYTR 1E8EA 1PP9D 3ORVA 1AKKA 1JDLA 1R0QA 2CXBA 3DR0A 2QG4A 3PXSA 1FHBA 3PH2B 5DJQB 3VYMA 3X39A 4H0KA 451CA 2QJPB 2CA3B 1I6EA 3CXHD 1I55A 3FWLA 3DMIA 1L0LD 4Q5PA 1CXAA 2HV4A 2B4ZA 5C9MA 4PD4D 3TDKA 3PRJA 1W2LA 1K3HA 5GTIV 1KB9D 3NBTA 2ZZS1 4WQEA 1EB7A 1CC5A 2BCCD 2AXTV 1HJ5A 2B10B 1KX7A 1B7VA 4EIDA 1C6RA 1NNOA 3OCDB 1HZUA 2K9JB 2ZOOA 4PJ0V 4AAMA 1K3GA 1MG3D 1HH7A 1CO6A 2XTSB 1NMIA 5GTHV 1RAPA 4V2KA 3L72D 1EZVD 1CEDA 351CA 4EICA 1YICA 3KZIV 2BH4X 3OCDA 1KB0A 3WFEC 4PW9B 3ZBMA 3VNWA 3WC8A 2GIWA 2I8FA 3VMAA 5IY51 2N9YB 2C9XB 4PWAA 3M97X 2C1DB 2L91A 3L74D 4WQCA 5B5EV 3RN1A 3WFDC 2KNCB 2GC4D 5AURA 3H1ID 4GYDA 2QJYB 1CIEA 3ZOYA 4KMGA 1NTKD 1ZZHA 1S5LV 1CTZA 4GEDB 1H1OA 5CIFB 1DW0A 1CRYA 1N9CA 1GIWA 1ZRTD 4AALA 1QYZA 2L4DA 5CIHB 1LC1A 1DW3A 3RN0A 1CSVA 4Y5RA 1CHJA 5C0ZA 1AYGA 4WQ9A 1LFMA 3VRDA 1DVVA 2Q3EA 5KAFV 3TGUD 3ITKA 1WVEC 2D0SA 1CRGA 4O1WA 1YFCA 1F1FA 3MK7B
chains in the Genus database with same CATH superfamily
1DD3A 1GDTA 1CSWA 5APWA 1HGZA 3V2PA 2OYIB 1U57A 3VP8A 1VQMP 1KB9I 1KILB 5DF5A 3AECC 1OCDA 1HGVA 1IO4A 3HQ7A 2R3CA 1CTJA 1H31A 1OX3A 1YJNP 2E5YA 3RL0C 1P84D 1L0LE 1CHIA 1GL2C 3SJLA 1BE3J 3KHUA 2NPSC 5AW5B 1M70A 3CCRP 2B89A 1COTA 4L74A 4O9BA 2KK7A 4DJGA 3KPEA 3M91A 3HQ9A 1RZ6A 1GW3A 1ZV8A 4Y99C 1FU1A 1Q82Q 3II6A 1RZ5A 1YJ9P 4GOEA 2IX7C 1CYJA 2WPQA 3WUVA 2DGEA 2E43A 3CCVP 1L4AA 1SQXJ 1IRWA 3B71A 3ZOWA 1NTZJ 1J1EB 1HJ0A 1C75A 1QN2A 3SWSA 1X9VA 1T3JA 1PPJG 1U7MA 3HRNA 2O01H 2P58A 1SQBG 1OAEA 2M5AA 2YXRB 4H13D 2E74D 3IF4A 3HD7D 1CIHA 1N15A 4FANA 3L4MA 1FZAA 1BDCA 1NOHA 3L72E 1CRJA 1LP1B 1NTKE 1NTZK 3VMXA 2Q6QA 3GF7A 1IZNB 1PGJA 2I8DA 3PJSK 1CTYA 3TNUA 2GB8B 1L0LG 3VYIA 5CCGD 2FYUK 1FZCB 1CSUA 5CBOA 4EIEA 3H1KG 1FI7A 2NRGA 2BH5X 3B5NC 3HQ8A 3WFCC 4KHXA 1L0NG 3CX5E 1M1KQ 3DP5A 1CYCA 5APXA 2XNDH 2KB7P 1RQVA 1SQPD 1LJ2A 5APTA 3L75J 2Q9IA 1QKSA 1LT1A 2Z5IA 1N7SB 5KJ7C 4J20A 1N90A 2R5DA 3C2CA 4WQAA 1NWQA 3CMEP 1KIBA 1JY3P 2LXBA 5B66H 1HRCA 2PCCB 2R3SA 2B12B 1PPJE 3GG2A 1RE4A 3CD6P 1I6DA 1YNRA 2H8PD 2JDIH 1CNOA 2WPRA 4L75A 4WQ7A 1W2BO 3RL0B 2WSEH 1LWUA 2ZYGA 4XA4A 5B66V 1EZVE 2HYNA 1OW7A 2YMYA 2YKPA 3LIDA 3CWBJ 3L4FA 4UB8V 1FJ0A 2N3YA 2CK3H 2WWWA 2FRCA 2OTJP 1IZL0 1YHQP 4W7ZA 1S5LH 3L74J 2C8SA 2FYUD 4JPZB 1BGYJ 3E1IA 3P7KA 2P7JA 2BGVX 1KN7A 3I5CA 3L70E 3CU4A 2XDJA 1L9BC 1J1DB 3GMAA 2DW3A 5KJ7A 2JQRA 1SQPJ 2RH0A 2PFXA 1MFZA 1L0ND 2YIUB 2AXTE 2ZFCA 2Y9YA 3OA8B 4JQ0D 4CPGA 1HBWA 3WUIA 4NPFX 1OIPA 2O1KA 4DOJA 1PGOA 2E5TA 3T97A 3R4YA 2E76C 2LIRA 2ZAEB 1S6VB 1DVHA 1JY2P 4RJTA 5CIEB 1SQXG 1SQVJ 1KV4A 3RBZA 3L75D 4H44D 3HE5B 4PJ0E 1WRGA 1NTKG 4GODA 3B5NB 3SXTA 1CXCA 3V5BA 1KYOH 3HQ6A 2AXTH 1I54A 3KZIE 2Q7CA 1M6ZA 1VF5C 1HJ4A 1Y9BA 5DJTB 4IOIH 3UIAA 1KQSO 3H25A 1KX2A 4XYDB 2AIUA 3L37A 1SFCC 5E79V 1VL2A 1M1JA 3MK7C 4AANA 2UWJE 1NKNA 1KV9A 1FJKA 3PP5A 1N2DC 3L72G 2CPSA 3DR0A 2JO1A 1YI2P 3MD0A 3VYMA 3JCUH 1NU1E 451CA 2GM4A 1KMIZ 1MZ9A 3CCMP 1I6EA 3RK2B 4H44C 1KILE 5BU8B 4UB6H 2W6BA 4RESB 1L0LD 1P84E 4Q5PA 1S2EA 1CXAA 4H0LD 1L2PA 2G3AA 2QJYC 3B8EB 3TDKA 2H89C 1KYOI 1BSHA 3N4XA 4WQEA 1CC5A 3H1LE 1HJ5A 1C6RA 3SSUA 1G2CA 3RBXA 2ZOOA 4LC1A 4EYYQ 2QJKC 1LT9B 4B86A 1S4XA 1CO6A 1GU4A 1RAPA 3CX5H 351CA 1PGQA 3KZIV 1EQ7A 1VF5D 1A02F 1VQKP 3ZBMA 3WMM0 3VNWA 3VMAA 5IY51 2JKVA 2N1TD 4IL6E 5AVZB 3M0DC 1NTKJ 2L91A 5APVA 3A5TA 3AEEC 1SFCD 2GC4D 2KZJA 4YPCA 2PGDA 5AW9B 1FAVA 1MKMA 3ZOYA 4M3LA 1GK4A 2J59M 3CL3D 3RK3E 2MJZA 3HD7B 3L74G 1EXIA 3E1RA 1S5LV 2JEEA 2QE7H 5CIFB 2YMKA 1J1DC 1VF5B 1VQOP 1SQPK 1LC1A 4I7ZB 1DW3A 2Z5HA 5KAIE 3GHGA 3VN0A 3LW5J 3V6IA 3VRDA 5CJ4A 1XTCC 3TGUD 1SFCB 2D0SA 3B4SA 1CRGA 3G9RA 4O1WA 1YFCA 1FZCA 1F1FA 3MK7B 2KI7B 3W68A 1FI9A 1Q81Q 2KXPB 2FYUJ 1KB9E 2BEZF 1NTZD 2HFED 2B87B 1FDOA 1RF0A 1T6AA 2J58A 2N18B 4ZKUA 4H44B 2M3BA 5KAIH 1OVRA 1N50A 2A45I 2E75B 4OWFA 1CIGA 2FY8A 5M1BA 2P67A 1H31B 2B11B 5TJHA 3AEGC 3P8MC 1HJ3A 1IQCA 1ZRTE 2IFMA 3ZIYA 5GTHH 1LT9A 1C6OA 1FDIA 5K5GB 2BCNB 3L71G 1L4AB 3RLMA 2K9YA 1KILD 1K9MQ 1L9JC 1DW1A 2RKLA 2LXCB 1SQBK 1GKSA 3H1JJ 3A0BH 1PV3A 3W67A 2RN0A 2ZVNB 3AE3C 2KS1A 1OXZA 3AE6C 1LS9A 3ZCFA 1ZLLA 1SVFA 2FYNC 1DIQC 2PRRA 1SP4A 1GJQA 4P4QB 1OW8A 1VQNP 5KLVD 3Q2YA 2P10A 1LC2A 3RMZA 2E42A 1BE3D 1ZMEC 3M06A 5AVXB 5CCHA 2QM7A 2KZIA 1FOSE 1SQQG 2IYPA 3O20A 3AE8C 1T2KC 5C39A 2FYUE 3EFFK 3EWKA 4PV1C 1R5LA 2JP3A 1NO4A 1SQVD 4K3IA 3HTKA 2BEQD 3AEFC 2QJKB 3KYQA 1SQXE 2ZT9B 3CCEP 4GT1A 2W83C 4I7ZC 5BVZA 2K3RA 2V7QH 4I1LA 2HR3A 1PP9J 1S5LX 2WSSH 2XU6A 2WPSA 2ZJSE 1YQ4C 1QL4A 2V08A 3NXSA 1CHHA 3WUUA 2ZXXA 1CRIA 4WY4B 2OGUA 2P2UA 1KQFB 2GUSA 3LIEA 2WSEJ 2OARA 3HE5A 3CYTI 3SVWA 2W6AA 2QEXP 1KFNA 3QWOC 5AVTB 4C7NA 1C7MA 1IFPA 1KD1Q 3H1KD 1P84H 4NPDA 3WU2V 5DJQC 2POHA 2IBZG 3HD7C 1X0TA 1PP9G 4H13C 4HYTB 5TISH 3AE1C 4RSZA 2YO2A 2K1AA 5BU5A 1H33B 1OMIA 2IPPA 1URQC 1IJDB 3CWBD 1OZHA 4PV1D 1YITP 2WTYA 1FCDC 3TGUG 1K73Q 4RO0A 1JMBA 5E79E 3VMZA 1DD4A 5KTBA 3WU2H 1YTCA 2KSEA 4UB6V 1YEAA 2YCCA 1HTLC 1OVVA 2ITAA 2WVRA 2O1JA 1M1JB 1Q90D 3BCCE 4C46A 1E5WA 2BASA 2AEJA 2PCBB 3L36A 2FWLA 2M8RA 4IFMA 5APSA 2Q1KA 1JNMA 2YK3A 1NU1K 2CA4B 1RH5B 2NPSB 3P8CE 2ZXYA 1JY3N 3M0DA 4XE5B 2M5AB 1YIQA 4AX3A 5CIDB 3VTPC 2N18C 2FXPA 1BGYD 1GK6A 3O0RC 3JC22 3AE9C 1NU1J 4BXLA 1DT1A 1QGKB 3O1YA 3IN6A 2W8ZA 1U7JA 2OZ1A 2YNYA 1VYDA 2YO3A 5CBNA 1LTJA 1H0TB 2G8YA 2V07A 2E75D 1RE3A 3H1HJ 2A45G 2H43A 2B88A 3Q1MA 2WT7B 1R8EA 1MV8A 2C1VA 2N9JA 1ZXGA 4UB8E 4AYCA 3IAOA 1GU2A 3AE5C 1XTGB 5APQA 1U75B 1QX8A 3H1KJ 5B6QA 2WT7A 5GTHE 1WEJF 5CIBB 2JWAA 1AA0A 4FA9A 2KNCA 1H88A 4U3FD 4A7PA 1NTMD 1FZCC 1S9KD 2JTIB 4DY9A 2IZ1A 2KS1B 3L75G 1FZFA 1SQQK 2K37A 4GIFA 2OYOA 1YEBA 2BLFB 4K3AA 5CHXA 4WQ8A 1VQ9P 3L74E 4ZKPA 4H13B 1MG2D 1YCCA 2KYVA 4DCKA 5KLIB 3K5BA 1KB9H 3GHGB 1EC5A 3RK3C 1HROA 2N3BA 3M9BA 3CP5A 5CCGA 2HLOA 4IL6V 1YYCA 1EZVG 3S1KA 3ORVA 1N7SC 1JCDA 3MIWA 4QMAA 5AW0B 4PD4E 1SQPG 2NPSA 2GUVA 3PXSA 1FHBA 1GW4A 1L0LJ 2I1KA 3KQGA 3EFGA 1M1JC 3C9IA 3TNUB 2QJPB 1KORA 3V2RA 1IFMA 1BGYG 3C1LA 5KAFH 1JB0J 1IFIA 1K3HA 1KB9D 3NBTA 2ZZS1 3NFQA 2JWDA 2AXTV 1BE3E 2B10B 1SQBE 1L0NE 5AVWB 3HUSC 1URQB 2K9JB 1JY2O 2FFDC 3VMYA 1HH0A 2YKQA 2XTSB 4WB4A 1DIPA 1NMIA 5GTHV 4R4MA 1CEDA 5KLVJ 4EICA 1YICA 1N7SA 3OCDA 1KB0A 3Q5SA 3WFEC 1EZVI 1YIJP 3CLQA 4PW9B 2D2CB 4EI2A 4Z1MH 1CI6A 1NU1G 1WT6A 3O6QB 3WC8A 2GIWA 4I2LC 5B5EH 3L71E 4TLFA 3V2QA 3FX0A 2C1DB 2XKMA 3L74D 1OFCX 2KOGA 4GYDA 4R4LA 2YIUC 2SPZA 1HF9A 1CSBA 4C7RA 3D6YA 1URQD 3RK3D 3S4RA 1NTKD 3JCUE 1EDKA 3L70G 1SQXK 2QM8A 1IFNA 1CTZA 3AE2C 1AJYA 3CC4P 3TYYA 2NPSD 1IFDA 4BWNA 1WMKA 1N9CA 4HJGH 2L4DA 5CIHB 1NTMG 2N1TB 2GA1A 3L70J 5AW7B 4OH8B 3Q5PA 1AYGA 1AVYA 1LFMA 3WUTA 2HG5D 1OVUA 1SQVE 1KILA 1T2KD 2FXMA 2BCCG 4W80A 4WVZA 1E2RA 2K88A 2DVHA 3TF5A 2MTAC 1FOCA 5B5EE 1SQBD 1H9XA 3CXHE 1LGHB 1NJIQ 3ZDMA 5EXQA 1SQQE 2R44A 1ZW0A 4XXLA 4U7JA 3SLEA 4AUWA 2W6JH 3OW2O 5AVSB 2E76D 2B0ZB 2IBZI 3JSVC 3TGUJ 1N73A 1ETPA 2OYHB 1HUCA 5KJ7D 1CORA 2AI5A 3GF3A 3SWKA 5KLIC 4JYBA 2Y0EA 3B5NA 4O1QA 4MU8A 4LLHA 3HUSB 1QL2A 3H1HD 3Q3DA 5CIGB 5CCHC 5H2FH 1BCCE 5KLVG 3CMAP 1PL5A 4DT0A 3ZOOA 4BRYA 1H32A 3V4QA 4TT3H 2D2CC 1ZR2A 1H89A 5AW1B 4XFJA 1FZEA 2C0XA 1UIIA 3OJAB 1LTAC 2WQYC 1GL2B 1AV1A 4K35A 4U3FJ 3CWBG 4YE1A 1EDIA 1MZ4A 2KP8A 3L73D 2MKVA 1A02J 3CXHI 1LTSC 3MGNA 3SWFA 4GOFA 1PFIA 4JBZA 3A0BV 2V4HA 1USEA 5APUA 1E29A 4N78D 1SFCA 2J5UA 1W5CE 2OYIA 5H2FV 5AW6B 3GLMA 1LTJB 1H0TA 4L3GA 5KKZB 3CXHW 1GL2D 2BPBB 1RY3A 1Y47A 2KLVA 4GKGA 4UB8H 1AOQA 3O8ZA 2OTLP 1LMSA 2FXOA 2PP6A 3H1JG 2ZVOB 1YJWP 1KYOD 4YXWH 1P84I 1IK9A 3MHVA 1KQLA 1C52A 2D0WA 4HB1A 1ZR4A 1JM0A 2ZBOA 4N6JA 1BSNA 1C2NA 1I8OA 1DIIC 3G71P 2LITA 1SQXD 3R2PA 4U3FE 3TSIA 1H32B 4NFGB 1BGYE 4N3YB 1CIFA 1W5CT 1LTTC 1M56D 1LTIC 4IL6H 1R5SA 3A9FA 1W2EA 3A0BE 3CXHH 1KZUB 3H1JD 3G3ZA 1ZN5A 2M0BA 1CSXA 3AEBC 3D70A 5GTIE 3JBTB 2BCCE 3T97B 3LW5H 1C2RA 155CA 1H8AA 2QRXA 1NMLA 2R5BA 2YQBA 2KIKA 2FYNB 2NZ2A 2RMZA 5AVUB 5KLVK 2ZYDA 2HPCB 1FE6A 1NAFA 1URQA 1SQVG 3BCCG 2MHMA 3OA8A 2CPBA 1HZVA 3L35A 2Q5UA 1S72P 3M9HA 5CICB 4UB6E 1FI3A 3CC7P 1PGPA 2HPCA 4I6MC 3WFBC 1JOCA 3A0HV 4FB1A 2AEMA 4JYCA 3GW6A 1JUNA 1FDMA 5KKZC 1CCRA 3A0HH 4WQBA 1N7SD 2FYZA 4WQDA 1IK7A 2YXQB 1NU1D 1NIRA 1CZQA 1T3UA 5GTIH 2OYIC 2ZT9C 1VQ8P 2P1JA 1A2SA 4D6TD 3H1KE 1NYHA 1N8RQ 3BRTB 2C1UA 1KC8Q 1PZQA 1VQLP 5APYA 4BRYB 1PPJD 1EDLA 1NTMJ 1EDJA 1LTGC 3A2AA 3MTUE 4LJIA 1BCCD 1FBMA 1LT9C 2IZ0A 2W90A 2WSFJ 2Q3IA 1HVVA 1NAYA 2M3EA 3OAKA 1E8EA 1PP9D 1E79H 3A3YB 3CPWO 1AKKA 1Q86Q 1FJPA 1JDLA 1NTKK 3Q5RA 1M8OB 4ZNCA 3PH2B 5DJQB 1LTJC 3H1IG 3X39A 1S1CX 3H32B 3C8VA 2CA3B 2HV4A 2B4ZA 5C9MA 2FKWB 4WY4D 1K8AQ 2K9JA 1SQPE 3PRJA 5L8RJ 1W2LA 1EB7A 1BDDA 3CI9A 2BCCD 1DX7A 1S9KE 2QSIA 1B7VA 2R32A 4EIDA 3OCDB 4PJ0V 1K3GA 3CX5I 3CCLP 1HWTC 1MG3D 1HH7A 1KQGB 1EZVD 3BASA 2BH4X 1QVGO 2KUBA 3ABVC 4AQRD 2I8FA 1JMMA 4WBAA 2Y9ZA 1QVFO 3M97X 3RK2C 2VRSA 2WITA 1MUUA 4WQCA 5B5EV 3BVHA 3WFDC 3TGUE 5AURA 3NMDA 3H1ID 2WSCJ 3BATA 2A06E 2ZXEB 2QJYB 3RL0D 1RHZB 1KFMA 3E7KA 4GEDB 1AQ5A 1G1IA 1H1OA 1DW0A 1CRYA 1Q7YQ 1AQTA 2D2CD 3EQ2A 1GL2A 4YTPC 1SQBJ 1ZRTD 1QYZA 1NTZE 3HD7A 2XZRA 2E75C 1N86A 1RE3C 1M7LA 3FWNA 1JTHB 4EOTA 3RN0A 1FS0E 1CSVA 4Y5RA 1CHJA 5C0ZA 1JY2N 2C9NY 2IBZE 4PD4I 4L73A 1YTZT 3CCJP 1DVVA 2Q3EA 5KAFV 3ITKA 1WVEC 1RF1B 1KTMA 1EXJA 4GDOA 1K05A 1QL1A 5H2FE 1YQ3C 5DJUB 2JJLA 1VQ6P 1SQQJ 2AEFA 4D6TE 4WY4A 2HODA 1GZLA 1VQPP 2WSCH 3MP7B 1LNQA 2O01N 1KYOW 1RQUA 1VPCA 3G4SP 2IDBA 3TYIA 5TISV 2HODB 2LKMA 3TK1A 1AOFA 2WZ7A 4NPEA 1BCCG 1NTME 5KLVE 1F1CA 4L1QA 2ZYAA 1FOSF 1NTMK 2A06G 4PV1B 1OW6A 4YXDC 4EIFA 5CCGC 3L71J 2W27A 1JY3O 2V7QJ 1LWUB 4OGQB 1GTWA 1SLQA 2EXVA 3B5ND 3WU2E 1A56A 3L73E 1CI6B 1S5LE 3O6QA 2A06D 3H1IJ 2GC7D 3AE4C 5EFWB 4IFDK 3CX5W 3CC2P 1PP9E 2YKOA 4OVNF 3D6ZA 3U1AA 4WY4C 2B9BA 2L5GB 3FGAD 1NH4A 1L0NJ 4FA5A 4ASWA 2PAJA 2E76B 1NKZB 3PTZA 1IC2A 2FFDB 5CJ0A 1JEKA 3FXEA 1ZOYC 4AAOA 5AW8B 3M9QA 4OGQD 3PLNA 1SS1A 1M57D 1GDVA 1M60A 3L71D 4KJMA 3M0AA 4FA1A 1USDA 2N1TA 1L4AC 3F5HA 1VQ5P 3IR9A 2O01J 1G1JA 1D7MA 3L72J 3AEAC 3NBSA 2QA4P 1YBKA 2O3JA 4QAOA 4EIJA 1CW5A 1X8YA 3L75E 3HTKB 5AW2B 2OZ1B 2E74C 3H1IE 1I5TA 3V4WA 1RF1C 1BE3G 2IYOA 3VOPA 4HKZH 4N0KA 2A45H 4Y28J 1BL9A 3D71A 3PXWA 1PIXA 2JR8A 2WPVB 4DZOA 1IFJA 2N1TC 1I8PA 2WMMA 3L4OA 3QH9A 1NGMB 2ZONG 2BCCJ 5DFSA 2WSFH 3VP9A 2KSJA 2ORLA 3NTNA 1UIXA 1L4AD 2PACA 1OWAA 2IFNA 3NWVA 3A0HE 4N78E 3H1HE 5AW4B 1HJBA 2CE0A 2KLUA 2Y0CA 4PD4H 3D0WA 2QVAA 3U59A 4OGQC 2QIWA 1DW2A 5AVVB 1IRVA 3H32A 2Z4EA 2FFDA 3H1LJ 1RF0C 3G6EP 2N9IA 3AEDC 1HCMA 4W7YA 3H1JE 3KDPB 2OYHC 1RF1A 1A8CA 1GD2E 1LP1A 3S9OA 1U74B 3HE4A 3BCCD 5AW3B 2CE1A 1LTBC 1Q2NA 1SQVK 1N73C 4FA4A 3AE7C 1ZP0C 4RKUJ 1RAQA 1GQ1A 3PHLA 1CCHA 1T8ZA 3I56P 1QLED 3CWBE 1N7LA 2C2CA 1CRHA 1RE4C 1QL3A 4L3HA 3OA7A 2Y0DA 4IL6X 1G2CB 2ZT9D 3GHGC 1LWUC 1DH3A 5B66E 4LGDE 3CX5D 4JCGA 1VQ4P 1GU5A 3O5CA 2VHDA 1CYIA 4EDFA 1QEXA 1NVOA 3F89A 1C6SA 3U1CA 4H0JA 1YTZI 1KILC 2FYUG 3PXTA 2XNXA 1SQQD 2FBWC 3ZOXA 5AVQB 5CCHD 2C1DA 3I55P 3KXDA 2OQQA 3CCUP 3CCSP 1IO3A 1BCCJ 3H1LD 3RK2D 5KAFE 1J3SA 1H33A 3L73J 1Z56A 4ASVA 5CMZA 2IBZD 4U3FG 3H1LG 4L76A 3RL0g 3BCCJ 5KAIV 1JTHA 4H0LB 4Y99B 1CRCA 1H9YA 1FZBA 3L70D 3SFEC 4FAVA 5CYTR 1MFTA 1M90Q 1R0QA 4WWIA 2CXBA 4D6TG 2QG4A 2E74B 4H0KA 4JF7A 1FZGA 3SFDC 3CCQP 5E79H 3CXHD 1JCCA 4HH2A 1I55A 3FWLA 3DMIA 4D6TJ 3PH0A 4PD4D 2C0WA 2B87A 5TISE 5GTIV 4ZMDA 1AFOA 1KX7A 1NNOA 1N73B 1HZUA 4AAMA 4C7NB 3L73G 1L0NK 1NTZG 3RK3B 4IFFA 3BRVB 2AXCA 1K04A 4V2KA 3L72D 1X79B 3USSA 3MZWB 2OYHA 1GMJA 1J1EC 3V2NA 2H7HA 1S3JA 1X22A 2C9LY 2I1JA 3HUSA 2N9BA 2H88C 1L0LK 2QJPC 2N9YB 2C9XB 4PWAA 1NHLA 3RN1A 2KNCB 1Y8AA 3KZIH 3P8CD 1CIEA 1KYOE 3IFMA 1VDFA 1J2JB 3P32A 4KMGA 1TU3F 3H1HG 5AVRB 1ZZHA 2XV5A 4KT0J 3H6PA 3MUDA 3RGUA 4PJ0H 3A7OA 2OTKE 5AVYB 1GIWA 4AALA 1AVOA 1FC2C 3SWYA 1DEEG 1DEBA 3HE4B 4WQ9A 1VQ7P 3MUDC 2LR2A 4H0LC 1JO5A 4MN4C 3FXDA 3N7NA
chains in the Genus database with same CATH topology
1CSWA 1FI9A 1E2RA 2DVHA 5DF5A 3TF5A 1OCDA 2MTAC 1NTZD 1FOCA 3HQ7A 1KYOW 1CTJA 1H31A 1SQBD 1H9XA 1P84D 2N18B 3TYIA 5EXQA 5TISV 1CHIA 1AOFA 4XXLA 3KHUA 3SJLA 1N50A 3SLEA 1F1CA 4L1QA 1CIGA 1M70A 1H31B 2B0ZB 1COTA 2B11B 1ETPA 5TJHA 1HJ3A 1IQCA 3ZIYA 1CORA 2AI5A 1C6OA 3HQ9A 1RZ6A 4EIFA 2BCNB 3RLMA 2Y0EA 4O1QA 1L9JC 4MU8A 1DW1A 2EXVA 3H1HD 1GKSA 1RZ5A 1A56A 5CIGB 2RN0A 2KS1A 1CYJA 2DGEA 1LS9A 3ZCFA 2A06D 1IRWA 2GC7D 3ZOWA 3ZOOA 1C75A 1DIQC 1QN2A 3CX5W 1H32A 3SWSA 1GJQA 4P4QB 4FA5A 5KLVD 3PTZA 1LC2A 3RMZA 1OAEA 1BE3D 1CIHA 1N15A 4FANA 3O20A 4AAOA 3L4MA 4YE1A 1CRJA 1MZ4A 3PLNA 1GDVA 1M60A 3L73D 3L71D 1SQVD 4FA1A 4K3IA 1CTYA 2QJKB 3A0BV 2GB8B 1E29A 3NBSA 1CSUA 2O3JA 4EIEA 4QAOA 1FI7A 2OZ1B 5H2FV 2BH5X 1QL4A 3HQ8A 2V08A 1CHHA 4L3GA 1I5TA 5KKZB 1CRIA 3CXHW 3WFCC 2BPBB 3DP5A 4N0KA 1CYCA 3CYTI 1SQPD 3SVWA 1BL9A 3PXWA 1QKSA 1AOQA 1C7MA 1LMSA 4J20A 1N90A 3C2CA 3H1KD 3WU2V 4WQAA 5DJQC 1I8PA 3L4OA 1KYOD 1KIBA 1HRCA 2PCCB 2B12B 4RSZA 3GG2A 2ZONG 1I6DA 1YNRA 1H33B 1C52A 1CNOA 4WQ7A 5DFSA 3CWBD 2D0WA 1FCDC 5B66V 2ORLA 2ZBOA 1YTCA 4UB6V 2PACA 1C2NA 1I8OA 1DIIC 1YEAA 2LITA 2YCCA 1SQXD 3NWVA 4UB8V 1FJ0A 1H32B 2CE0A 2Y0CA 2N3YA 4NFGB 2PCBB 2FWLA 1DW2A 2FRCA 1IRVA 1IZL0 1CIFA 1W5CT 2YK3A 2CA4B 2ZXYA 2C8SA 2N9IA 2FYUD 3A9FA 1HCMA 1YIQA 3H1JD 2BGVX 1A8CA 4AX3A 1U74B 3BCCD 5CIDB 3CU4A 2CE1A 4FA4A 1CSXA 1L9BC 2N18C 1BGYD 2JQRA 3JBTB 3O0RC 1RAQA 1L0ND 2YIUB 1C2RA 155CA 1GQ1A 1NMLA 3PHLA 3OA8B 1CCHA 2YQBA 2C2CA 1DT1A 2FYNB 3WUIA 1CRHA 3O1YA 2RMZA 1QL3A 4L3HA 2OZ1A 2Y0DA 1VYDA 3CX5D 4JCGA 2MHMA 2LIRA 2V07A 3OA8A 3O5CA 1HZVA 2VHDA 1CYIA 4EDFA 5CICB 1S6VB 1DVHA 4RJTA 5CIEB 1FI3A 3WFBC 3L75D 1C6SA 3A0HV 2C1VA 2N9JA 4FB1A 4H0JA 1GU2A 3PXTA 3GW6A 1U75B 3SXTA 5B6QA 1CCRA 1SQQD 3ZOXA 1CXCA 1WEJF 2C1DA 4WQBA 5CIBB 3HQ6A 2JWAA 1I54A 4FA9A 4WQDA 1M6ZA 4U3FD 4A7PA 1NU1D 1HJ4A 1IO3A 1NIRA 1NTMD 1A2SA 3H1LD 4D6TD 2JTIB 4DY9A 1J3SA 1H33A 1KX2A 4XYDB 2C1UA 1YEBA 2AIUA 2BLFB 4WQ8A 2IBZD 1PPJD 1MG2D 1YCCA 5KAIV 5KLIB 5E79V 4LJIA 1BCCD 1CRCA 3MK7C 1H9YA 4AANA 1HROA 3L70D 2N3BA 1KV9A 3CP5A 4IL6V 4FAVA 5CYTR 1E8EA 1PP9D 3ORVA 1AKKA 1JDLA 1R0QA 2CXBA 3DR0A 2QG4A 3PXSA 1FHBA 3PH2B 5DJQB 3VYMA 3X39A 4H0KA 451CA 2QJPB 2CA3B 1I6EA 3CXHD 1I55A 3FWLA 3DMIA 1L0LD 4Q5PA 1CXAA 2HV4A 2B4ZA 5C9MA 4PD4D 3TDKA 3PRJA 1W2LA 1K3HA 5GTIV 1KB9D 3NBTA 2ZZS1 4WQEA 1EB7A 1CC5A 2BCCD 2AXTV 1HJ5A 2B10B 1KX7A 1B7VA 4EIDA 1C6RA 1NNOA 3OCDB 1HZUA 2K9JB 2ZOOA 4PJ0V 4AAMA 1K3GA 1MG3D 1HH7A 1CO6A 2XTSB 1NMIA 5GTHV 1RAPA 4V2KA 3L72D 1EZVD 1CEDA 351CA 4EICA 1YICA 3KZIV 2BH4X 3OCDA 1KB0A 3WFEC 4PW9B 3ZBMA 3VNWA 3WC8A 2GIWA 2I8FA 3VMAA 5IY51 2N9YB 2C9XB 4PWAA 3M97X 2C1DB 2L91A 3L74D 4WQCA 5B5EV 3RN1A 3WFDC 2KNCB 2GC4D 5AURA 3H1ID 4GYDA 2QJYB 1CIEA 3ZOYA 4KMGA 1NTKD 1ZZHA 1S5LV 1CTZA 4GEDB 1H1OA 5CIFB 1DW0A 1CRYA 1N9CA 1GIWA 1ZRTD 4AALA 1QYZA 2L4DA 5CIHB 1LC1A 1DW3A 3RN0A 1CSVA 4Y5RA 1CHJA 5C0ZA 1AYGA 4WQ9A 1LFMA 3VRDA 1DVVA 2Q3EA 5KAFV 3TGUD 3ITKA 1WVEC 2D0SA 1CRGA 4O1WA 1YFCA 1F1FA 3MK7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSW A;  1FI9 A;  1E2R A;  2DVH A;  5DF5 A;  3TF5 A;  1OCD A;  2MTA C;  1NTZ D;  1FOC A;  3HQ7 A;  1KYO W;  1CTJ A;  1H31 A;  1SQB D;  1H9X A;  1P84 D;  2N18 B;  3TYI A;  5EXQ A;  5TIS V;  1CHI A;  1AOF A;  4XXL A;  3KHU A;  3SJL A;  1N50 A;  3SLE A;  1F1C A;  4L1Q A;  1CIG A;  1M70 A;  1H31 B;  2B0Z B;  1COT A;  2B11 B;  1ETP A;  5TJH A;  1HJ3 A;  1IQC A;  3ZIY A;  1COR A;  2AI5 A;  1C6O A;  3HQ9 A;  1RZ6 A;  4EIF A;  2BCN B;  3RLM A;  2Y0E A;  4O1Q A;  1L9J C;  4MU8 A;  1DW1 A;  2EXV A;  3H1H D;  1GKS A;  1RZ5 A;  1A56 A;  5CIG B;  2RN0 A;  2KS1 A;  1CYJ A;  2DGE A;  1LS9 A;  3ZCF A;  2A06 D;  1IRW A;  2GC7 D;  3ZOW A;  3ZOO A;  1C75 A;  1DIQ C;  1QN2 A;  3CX5 W;  1H32 A;  3SWS A;  1GJQ A;  4P4Q B;  4FA5 A;  5KLV D;  3PTZ A;  1LC2 A;  3RMZ A;  1OAE A;  1BE3 D;  1CIH A;  1N15 A;  4FAN A;  3O20 A;  4AAO A;  3L4M A;  4YE1 A;  1CRJ A;  1MZ4 A;  3PLN A;  1GDV A;  1M60 A;  3L73 D;  3L71 D;  1SQV D;  4FA1 A;  4K3I A;  1CTY A;  2QJK B;  3A0B V;  2GB8 B;  1E29 A;  3NBS A;  1CSU A;  2O3J A;  4EIE A;  4QAO A;  1FI7 A;  2OZ1 B;  5H2F V;  2BH5 X;  1QL4 A;  3HQ8 A;  2V08 A;  1CHH A;  4L3G A;  1I5T A;  5KKZ B;  1CRI A;  3CXH W;  3WFC C;  2BPB B;  3DP5 A;  4N0K A;  1CYC A;  3CYT I;  1SQP D;  3SVW A;  1BL9 A;  3PXW A;  1QKS A;  1AOQ A;  1C7M A;  1LMS A;  4J20 A;  1N90 A;  3C2C A;  3H1K D;  3WU2 V;  4WQA A;  5DJQ C;  1I8P A;  3L4O A;  1KYO D;  1KIB A;  1HRC A;  2PCC B;  2B12 B;  4RSZ A;  3GG2 A;  2ZON G;  1I6D A;  1YNR A;  1H33 B;  1C52 A;  1CNO A;  4WQ7 A;  5DFS A;  3CWB D;  2D0W A;  1FCD C;  5B66 V;  2ORL A;  2ZBO A;  1YTC A;  4UB6 V;  2PAC A;  1C2N A;  1I8O A;  1DII C;  1YEA A;  2LIT A;  2YCC A;  1SQX D;  3NWV A;  4UB8 V;  1FJ0 A;  1H32 B;  2CE0 A;  2Y0C A;  2N3Y A;  4NFG B;  2PCB B;  2FWL A;  1DW2 A;  2FRC A;  1IRV A;  1IZL 0;  1CIF A;  1W5C T;  2YK3 A;  2CA4 B;  2ZXY A;  2C8S A;  2N9I A;  2FYU D;  3A9F A;  1HCM A;  1YIQ A;  3H1J D;  2BGV X;  1A8C A;  4AX3 A;  1U74 B;  3BCC D;  5CID B;  3CU4 A;  2CE1 A;  4FA4 A;  1CSX A;  1L9B C;  2N18 C;  1BGY D;  2JQR A;  3JBT B;  3O0R C;  1RAQ A;  1L0N D;  2YIU B;  1C2R A;  155C A;  1GQ1 A;  1NML A;  3PHL A;  3OA8 B;  1CCH A;  2YQB A;  2C2C A;  1DT1 A;  2FYN B;  3WUI A;  1CRH A;  3O1Y A;  2RMZ A;  1QL3 A;  4L3H A;  2OZ1 A;  2Y0D A;  1VYD A;  3CX5 D;  4JCG A;  2MHM A;  2LIR A;  2V07 A;  3OA8 A;  3O5C A;  1HZV A;  2VHD A;  1CYI A;  4EDF A;  5CIC B;  1S6V B;  1DVH A;  4RJT A;  5CIE B;  1FI3 A;  3WFB C;  3L75 D;  1C6S A;  3A0H V;  2C1V A;  2N9J A;  4FB1 A;  4H0J A;  1GU2 A;  3PXT A;  3GW6 A;  1U75 B;  3SXT A;  5B6Q A;  1CCR A;  1SQQ D;  3ZOX A;  1CXC A;  1WEJ F;  2C1D A;  4WQB A;  5CIB B;  3HQ6 A;  2JWA A;  1I54 A;  4FA9 A;  4WQD A;  1M6Z A;  4U3F D;  4A7P A;  1NU1 D;  1HJ4 A;  1IO3 A;  1NIR A;  1NTM D;  1A2S A;  3H1L D;  4D6T D;  2JTI B;  4DY9 A;  1J3S A;  1H33 A;  1KX2 A;  4XYD B;  2C1U A;  1YEB A;  2AIU A;  2BLF B;  4WQ8 A;  2IBZ D;  1PPJ D;  1MG2 D;  1YCC A;  5KAI V;  5KLI B;  5E79 V;  4LJI A;  1BCC D;  1CRC A;  3MK7 C;  1H9Y A;  4AAN A;  1HRO A;  3L70 D;  2N3B A;  1KV9 A;  3CP5 A;  4IL6 V;  4FAV A;  5CYT R;  1E8E A;  1PP9 D;  3ORV A;  1AKK A;  1JDL A;  1R0Q A;  2CXB A;  3DR0 A;  2QG4 A;  3PXS A;  1FHB A;  3PH2 B;  5DJQ B;  3VYM A;  3X39 A;  4H0K A;  451C A;  2QJP B;  2CA3 B;  1I6E A;  3CXH D;  1I55 A;  3FWL A;  3DMI A;  1L0L D;  4Q5P A;  1CXA A;  2HV4 A;  2B4Z A;  5C9M A;  4PD4 D;  3TDK A;  3PRJ A;  1W2L A;  1K3H A;  5GTI V;  1KB9 D;  3NBT A;  2ZZS 1;  4WQE A;  1EB7 A;  1CC5 A;  2BCC D;  2AXT V;  1HJ5 A;  2B10 B;  1KX7 A;  1B7V A;  4EID A;  1C6R A;  1NNO A;  3OCD B;  1HZU A;  2K9J B;  2ZOO A;  4PJ0 V;  4AAM A;  1K3G A;  1MG3 D;  1HH7 A;  1CO6 A;  2XTS B;  1NMI A;  5GTH V;  1RAP A;  4V2K A;  3L72 D;  1EZV D;  1CED A;  351C A;  4EIC A;  1YIC A;  3KZI V;  2BH4 X;  3OCD A;  1KB0 A;  3WFE C;  4PW9 B;  3ZBM A;  3VNW A;  3WC8 A;  2GIW A;  2I8F A;  3VMA A;  5IY5 1;  2N9Y B;  2C9X B;  4PWA A;  3M97 X;  2C1D B;  2L91 A;  3L74 D;  4WQC A;  5B5E V;  3RN1 A;  3WFD C;  2KNC B;  2GC4 D;  5AUR A;  3H1I D;  4GYD A;  2QJY B;  1CIE A;  3ZOY A;  4KMG A;  1NTK D;  1ZZH A;  1S5L V;  1CTZ A;  4GED B;  1H1O A;  5CIF B;  1DW0 A;  1CRY A;  1N9C A;  1GIW A;  1ZRT D;  4AAL A;  1QYZ A;  2L4D A;  5CIH B;  1LC1 A;  1DW3 A;  3RN0 A;  1CSV A;  4Y5R A;  1CHJ A;  5C0Z A;  1AYG A;  4WQ9 A;  1LFM A;  3VRD A;  1DVV A;  2Q3E A;  5KAF V;  3TGU D;  3ITK A;  1WVE C;  2D0S A;  1CRG A;  4O1W A;  1YFC A;  1F1F A;  3MK7 B; 
#chains in the Genus database with same CATH topology
 1DD3 A;  1GDT A;  1CSW A;  5APW A;  1HGZ A;  3V2P A;  2OYI B;  1U57 A;  3VP8 A;  1VQM P;  1KB9 I;  1KIL B;  5DF5 A;  3AEC C;  1OCD A;  1HGV A;  1IO4 A;  3HQ7 A;  2R3C A;  1CTJ A;  1H31 A;  1OX3 A;  1YJN P;  2E5Y A;  3RL0 C;  1P84 D;  1L0L E;  1CHI A;  1GL2 C;  3SJL A;  1BE3 J;  3KHU A;  2NPS C;  5AW5 B;  1M70 A;  3CCR P;  2B89 A;  1COT A;  4L74 A;  4O9B A;  2KK7 A;  4DJG A;  3KPE A;  3M91 A;  3HQ9 A;  1RZ6 A;  1GW3 A;  1ZV8 A;  4Y99 C;  1FU1 A;  1Q82 Q;  3II6 A;  1RZ5 A;  1YJ9 P;  4GOE A;  2IX7 C;  1CYJ A;  2WPQ A;  3WUV A;  2DGE A;  2E43 A;  3CCV P;  1L4A A;  1SQX J;  1IRW A;  3B71 A;  3ZOW A;  1NTZ J;  1J1E B;  1HJ0 A;  1C75 A;  1QN2 A;  3SWS A;  1X9V A;  1T3J A;  1PPJ G;  1U7M A;  3HRN A;  2O01 H;  2P58 A;  1SQB G;  1OAE A;  2M5A A;  2YXR B;  4H13 D;  2E74 D;  3IF4 A;  3HD7 D;  1CIH A;  1N15 A;  4FAN A;  3L4M A;  1FZA A;  1BDC A;  1NOH A;  3L72 E;  1CRJ A;  1LP1 B;  1NTK E;  1NTZ K;  3VMX A;  2Q6Q A;  3GF7 A;  1IZN B;  1PGJ A;  2I8D A;  3PJS K;  1CTY A;  3TNU A;  2GB8 B;  1L0L G;  3VYI A;  5CCG D;  2FYU K;  1FZC B;  1CSU A;  5CBO A;  4EIE A;  3H1K G;  1FI7 A;  2NRG A;  2BH5 X;  3B5N C;  3HQ8 A;  3WFC C;  4KHX A;  1L0N G;  3CX5 E;  1M1K Q;  3DP5 A;  1CYC A;  5APX A;  2XND H;  2KB7 P;  1RQV A;  1SQP D;  1LJ2 A;  5APT A;  3L75 J;  2Q9I A;  1QKS A;  1LT1 A;  2Z5I A;  1N7S B;  5KJ7 C;  4J20 A;  1N90 A;  2R5D A;  3C2C A;  4WQA A;  1NWQ A;  3CME P;  1KIB A;  1JY3 P;  2LXB A;  5B66 H;  1HRC A;  2PCC B;  2R3S A;  2B12 B;  1PPJ E;  3GG2 A;  1RE4 A;  3CD6 P;  1I6D A;  1YNR A;  2H8P D;  2JDI H;  1CNO A;  2WPR A;  4L75 A;  4WQ7 A;  1W2B O;  3RL0 B;  2WSE H;  1LWU A;  2ZYG A;  4XA4 A;  5B66 V;  1EZV E;  2HYN A;  1OW7 A;  2YMY A;  2YKP A;  3LID A;  3CWB J;  3L4F A;  4UB8 V;  1FJ0 A;  2N3Y A;  2CK3 H;  2WWW A;  2FRC A;  2OTJ P;  1IZL 0;  1YHQ P;  4W7Z A;  1S5L H;  3L74 J;  2C8S A;  2FYU D;  4JPZ B;  1BGY J;  3E1I A;  3P7K A;  2P7J A;  2BGV X;  1KN7 A;  3I5C A;  3L70 E;  3CU4 A;  2XDJ A;  1L9B C;  1J1D B;  3GMA A;  2DW3 A;  5KJ7 A;  2JQR A;  1SQP J;  2RH0 A;  2PFX A;  1MFZ A;  1L0N D;  2YIU B;  2AXT E;  2ZFC A;  2Y9Y A;  3OA8 B;  4JQ0 D;  4CPG A;  1HBW A;  3WUI A;  4NPF X;  1OIP A;  2O1K A;  4DOJ A;  1PGO A;  2E5T A;  3T97 A;  3R4Y A;  2E76 C;  2LIR A;  2ZAE B;  1S6V B;  1DVH A;  1JY2 P;  4RJT A;  5CIE B;  1SQX G;  1SQV J;  1KV4 A;  3RBZ A;  3L75 D;  4H44 D;  3HE5 B;  4PJ0 E;  1WRG A;  1NTK G;  4GOD A;  3B5N B;  3SXT A;  1CXC A;  3V5B A;  1KYO H;  3HQ6 A;  2AXT H;  1I54 A;  3KZI E;  2Q7C A;  1M6Z A;  1VF5 C;  1HJ4 A;  1Y9B A;  5DJT B;  4IOI H;  3UIA A;  1KQS O;  3H25 A;  1KX2 A;  4XYD B;  2AIU A;  3L37 A;  1SFC C;  5E79 V;  1VL2 A;  1M1J A;  3MK7 C;  4AAN A;  2UWJ E;  1NKN A;  1KV9 A;  1FJK A;  3PP5 A;  1N2D C;  3L72 G;  2CPS A;  3DR0 A;  2JO1 A;  1YI2 P;  3MD0 A;  3VYM A;  3JCU H;  1NU1 E;  451C A;  2GM4 A;  1KMI Z;  1MZ9 A;  3CCM P;  1I6E A;  3RK2 B;  4H44 C;  1KIL E;  5BU8 B;  4UB6 H;  2W6B A;  4RES B;  1L0L D;  1P84 E;  4Q5P A;  1S2E A;  1CXA A;  4H0L D;  1L2P A;  2G3A A;  2QJY C;  3B8E B;  3TDK A;  2H89 C;  1KYO I;  1BSH A;  3N4X A;  4WQE A;  1CC5 A;  3H1L E;  1HJ5 A;  1C6R A;  3SSU A;  1G2C A;  3RBX A;  2ZOO A;  4LC1 A;  4EYY Q;  2QJK C;  1LT9 B;  4B86 A;  1S4X A;  1CO6 A;  1GU4 A;  1RAP A;  3CX5 H;  351C A;  1PGQ A;  3KZI V;  1EQ7 A;  1VF5 D;  1A02 F;  1VQK P;  3ZBM A;  3WMM 0;  3VNW A;  3VMA A;  5IY5 1;  2JKV A;  2N1T D;  4IL6 E;  5AVZ B;  3M0D C;  1NTK J;  2L91 A;  5APV A;  3A5T A;  3AEE C;  1SFC D;  2GC4 D;  2KZJ A;  4YPC A;  2PGD A;  5AW9 B;  1FAV A;  1MKM A;  3ZOY A;  4M3L A;  1GK4 A;  2J59 M;  3CL3 D;  3RK3 E;  2MJZ A;  3HD7 B;  3L74 G;  1EXI A;  3E1R A;  1S5L V;  2JEE A;  2QE7 H;  5CIF B;  2YMK A;  1J1D C;  1VF5 B;  1VQO P;  1SQP K;  1LC1 A;  4I7Z B;  1DW3 A;  2Z5H A;  5KAI E;  3GHG A;  3VN0 A;  3LW5 J;  3V6I A;  3VRD A;  5CJ4 A;  1XTC C;  3TGU D;  1SFC B;  2D0S A;  3B4S A;  1CRG A;  3G9R A;  4O1W A;  1YFC A;  1FZC A;  1F1F A;  3MK7 B;  2KI7 B;  3W68 A;  1FI9 A;  1Q81 Q;  2KXP B;  2FYU J;  1KB9 E;  2BEZ F;  1NTZ D;  2HFE D;  2B87 B;  1FDO A;  1RF0 A;  1T6A A;  2J58 A;  2N18 B;  4ZKU A;  4H44 B;  2M3B A;  5KAI H;  1OVR A;  1N50 A;  2A45 I;  2E75 B;  4OWF A;  1CIG A;  2FY8 A;  5M1B A;  2P67 A;  1H31 B;  2B11 B;  5TJH A;  3AEG C;  3P8M C;  1HJ3 A;  1IQC A;  1ZRT E;  2IFM A;  3ZIY A;  5GTH H;  1LT9 A;  1C6O A;  1FDI A;  5K5G B;  2BCN B;  3L71 G;  1L4A B;  3RLM A;  2K9Y A;  1KIL D;  1K9M Q;  1L9J C;  1DW1 A;  2RKL A;  2LXC B;  1SQB K;  1GKS A;  3H1J J;  3A0B H;  1PV3 A;  3W67 A;  2RN0 A;  2ZVN B;  3AE3 C;  2KS1 A;  1OXZ A;  3AE6 C;  1LS9 A;  3ZCF A;  1ZLL A;  1SVF A;  2FYN C;  1DIQ C;  2PRR A;  1SP4 A;  1GJQ A;  4P4Q B;  1OW8 A;  1VQN P;  5KLV D;  3Q2Y A;  2P10 A;  1LC2 A;  3RMZ A;  2E42 A;  1BE3 D;  1ZME C;  3M06 A;  5AVX B;  5CCH A;  2QM7 A;  2KZI A;  1FOS E;  1SQQ G;  2IYP A;  3O20 A;  3AE8 C;  1T2K C;  5C39 A;  2FYU E;  3EFF K;  3EWK A;  4PV1 C;  1R5L A;  2JP3 A;  1NO4 A;  1SQV D;  4K3I A;  3HTK A;  2BEQ D;  3AEF C;  2QJK B;  3KYQ A;  1SQX E;  2ZT9 B;  3CCE P;  4GT1 A;  2W83 C;  4I7Z C;  5BVZ A;  2K3R A;  2V7Q H;  4I1L A;  2HR3 A;  1PP9 J;  1S5L X;  2WSS H;  2XU6 A;  2WPS A;  2ZJS E;  1YQ4 C;  1QL4 A;  2V08 A;  3NXS A;  1CHH A;  3WUU A;  2ZXX A;  1CRI A;  4WY4 B;  2OGU A;  2P2U A;  1KQF B;  2GUS A;  3LIE A;  2WSE J;  2OAR A;  3HE5 A;  3CYT I;  3SVW A;  2W6A A;  2QEX P;  1KFN A;  3QWO C;  5AVT B;  4C7N A;  1C7M A;  1IFP A;  1KD1 Q;  3H1K D;  1P84 H;  4NPD A;  3WU2 V;  5DJQ C;  2POH A;  2IBZ G;  3HD7 C;  1X0T A;  1PP9 G;  4H13 C;  4HYT B;  5TIS H;  3AE1 C;  4RSZ A;  2YO2 A;  2K1A A;  5BU5 A;  1H33 B;  1OMI A;  2IPP A;  1URQ C;  1IJD B;  3CWB D;  1OZH A;  4PV1 D;  1YIT P;  2WTY A;  1FCD C;  3TGU G;  1K73 Q;  4RO0 A;  1JMB A;  5E79 E;  3VMZ A;  1DD4 A;  5KTB A;  3WU2 H;  1YTC A;  2KSE A;  4UB6 V;  1YEA A;  2YCC A;  1HTL C;  1OVV A;  2ITA A;  2WVR A;  2O1J A;  1M1J B;  1Q90 D;  3BCC E;  4C46 A;  1E5W A;  2BAS A;  2AEJ A;  2PCB B;  3L36 A;  2FWL A;  2M8R A;  4IFM A;  5APS A;  2Q1K A;  1JNM A;  2YK3 A;  1NU1 K;  2CA4 B;  1RH5 B;  2NPS B;  3P8C E;  2ZXY A;  1JY3 N;  3M0D A;  4XE5 B;  2M5A B;  1YIQ A;  4AX3 A;  5CID B;  3VTP C;  2N18 C;  2FXP A;  1BGY D;  1GK6 A;  3O0R C;  3JC2 2;  3AE9 C;  1NU1 J;  4BXL A;  1DT1 A;  1QGK B;  3O1Y A;  3IN6 A;  2W8Z A;  1U7J A;  2OZ1 A;  2YNY A;  1VYD A;  2YO3 A;  5CBN A;  1LTJ A;  1H0T B;  2G8Y A;  2V07 A;  2E75 D;  1RE3 A;  3H1H J;  2A45 G;  2H43 A;  2B88 A;  3Q1M A;  2WT7 B;  1R8E A;  1MV8 A;  2C1V A;  2N9J A;  1ZXG A;  4UB8 E;  4AYC A;  3IAO A;  1GU2 A;  3AE5 C;  1XTG B;  5APQ A;  1U75 B;  1QX8 A;  3H1K J;  5B6Q A;  2WT7 A;  5GTH E;  1WEJ F;  5CIB B;  2JWA A;  1AA0 A;  4FA9 A;  2KNC A;  1H88 A;  4U3F D;  4A7P A;  1NTM D;  1FZC C;  1S9K D;  2JTI B;  4DY9 A;  2IZ1 A;  2KS1 B;  3L75 G;  1FZF A;  1SQQ K;  2K37 A;  4GIF A;  2OYO A;  1YEB A;  2BLF B;  4K3A A;  5CHX A;  4WQ8 A;  1VQ9 P;  3L74 E;  4ZKP A;  4H13 B;  1MG2 D;  1YCC A;  2KYV A;  4DCK A;  5KLI B;  3K5B A;  1KB9 H;  3GHG B;  1EC5 A;  3RK3 C;  1HRO A;  2N3B A;  3M9B A;  3CP5 A;  5CCG A;  2HLO A;  4IL6 V;  1YYC A;  1EZV G;  3S1K A;  3ORV A;  1N7S C;  1JCD A;  3MIW A;  4QMA A;  5AW0 B;  4PD4 E;  1SQP G;  2NPS A;  2GUV A;  3PXS A;  1FHB A;  1GW4 A;  1L0L J;  2I1K A;  3KQG A;  3EFG A;  1M1J C;  3C9I A;  3TNU B;  2QJP B;  1KOR A;  3V2R A;  1IFM A;  1BGY G;  3C1L A;  5KAF H;  1JB0 J;  1IFI A;  1K3H A;  1KB9 D;  3NBT A;  2ZZS 1;  3NFQ A;  2JWD A;  2AXT V;  1BE3 E;  2B10 B;  1SQB E;  1L0N E;  5AVW B;  3HUS C;  1URQ B;  2K9J B;  1JY2 O;  2FFD C;  3VMY A;  1HH0 A;  2YKQ A;  2XTS B;  4WB4 A;  1DIP A;  1NMI A;  5GTH V;  4R4M A;  1CED A;  5KLV J;  4EIC A;  1YIC A;  1N7S A;  3OCD A;  1KB0 A;  3Q5S A;  3WFE C;  1EZV I;  1YIJ P;  3CLQ A;  4PW9 B;  2D2C B;  4EI2 A;  4Z1M H;  1CI6 A;  1NU1 G;  1WT6 A;  3O6Q B;  3WC8 A;  2GIW A;  4I2L C;  5B5E H;  3L71 E;  4TLF A;  3V2Q A;  3FX0 A;  2C1D B;  2XKM A;  3L74 D;  1OFC X;  2KOG A;  4GYD A;  4R4L A;  2YIU C;  2SPZ A;  1HF9 A;  1CSB A;  4C7R A;  3D6Y A;  1URQ D;  3RK3 D;  3S4R A;  1NTK D;  3JCU E;  1EDK A;  3L70 G;  1SQX K;  2QM8 A;  1IFN A;  1CTZ A;  3AE2 C;  1AJY A;  3CC4 P;  3TYY A;  2NPS D;  1IFD A;  4BWN A;  1WMK A;  1N9C A;  4HJG H;  2L4D A;  5CIH B;  1NTM G;  2N1T B;  2GA1 A;  3L70 J;  5AW7 B;  4OH8 B;  3Q5P A;  1AYG A;  1AVY A;  1LFM A;  3WUT A;  2HG5 D;  1OVU A;  1SQV E;  1KIL A;  1T2K D;  2FXM A;  2BCC G;  4W80 A;  4WVZ A;  1E2R A;  2K88 A;  2DVH A;  3TF5 A;  2MTA C;  1FOC A;  5B5E E;  1SQB D;  1H9X A;  3CXH E;  1LGH B;  1NJI Q;  3ZDM A;  5EXQ A;  1SQQ E;  2R44 A;  1ZW0 A;  4XXL A;  4U7J A;  3SLE A;  4AUW A;  2W6J H;  3OW2 O;  5AVS B;  2E76 D;  2B0Z B;  2IBZ I;  3JSV C;  3TGU J;  1N73 A;  1ETP A;  2OYH B;  1HUC A;  5KJ7 D;  1COR A;  2AI5 A;  3GF3 A;  3SWK A;  5KLI C;  4JYB A;  2Y0E A;  3B5N A;  4O1Q A;  4MU8 A;  4LLH A;  3HUS B;  1QL2 A;  3H1H D;  3Q3D A;  5CIG B;  5CCH C;  5H2F H;  1BCC E;  5KLV G;  3CMA P;  1PL5 A;  4DT0 A;  3ZOO A;  4BRY A;  1H32 A;  3V4Q A;  4TT3 H;  2D2C C;  1ZR2 A;  1H89 A;  5AW1 B;  4XFJ A;  1FZE A;  2C0X A;  1UII A;  3OJA B;  1LTA C;  2WQY C;  1GL2 B;  1AV1 A;  4K35 A;  4U3F J;  3CWB G;  4YE1 A;  1EDI A;  1MZ4 A;  2KP8 A;  3L73 D;  2MKV A;  1A02 J;  3CXH I;  1LTS C;  3MGN A;  3SWF A;  4GOF A;  1PFI A;  4JBZ A;  3A0B V;  2V4H A;  1USE A;  5APU A;  1E29 A;  4N78 D;  1SFC A;  2J5U A;  1W5C E;  2OYI A;  5H2F V;  5AW6 B;  3GLM A;  1LTJ B;  1H0T A;  4L3G A;  5KKZ B;  3CXH W;  1GL2 D;  2BPB B;  1RY3 A;  1Y47 A;  2KLV A;  4GKG A;  4UB8 H;  1AOQ A;  3O8Z A;  2OTL P;  1LMS A;  2FXO A;  2PP6 A;  3H1J G;  2ZVO B;  1YJW P;  1KYO D;  4YXW H;  1P84 I;  1IK9 A;  3MHV A;  1KQL A;  1C52 A;  2D0W A;  4HB1 A;  1ZR4 A;  1JM0 A;  2ZBO A;  4N6J A;  1BSN A;  1C2N A;  1I8O A;  1DII C;  3G71 P;  2LIT A;  1SQX D;  3R2P A;  4U3F E;  3TSI A;  1H32 B;  4NFG B;  1BGY E;  4N3Y B;  1CIF A;  1W5C T;  1LTT C;  1M56 D;  1LTI C;  4IL6 H;  1R5S A;  3A9F A;  1W2E A;  3A0B E;  3CXH H;  1KZU B;  3H1J D;  3G3Z A;  1ZN5 A;  2M0B A;  1CSX A;  3AEB C;  3D70 A;  5GTI E;  3JBT B;  2BCC E;  3T97 B;  3LW5 H;  1C2R A;  155C A;  1H8A A;  2QRX A;  1NML A;  2R5B A;  2YQB A;  2KIK A;  2FYN B;  2NZ2 A;  2RMZ A;  5AVU B;  5KLV K;  2ZYD A;  2HPC B;  1FE6 A;  1NAF A;  1URQ A;  1SQV G;  3BCC G;  2MHM A;  3OA8 A;  2CPB A;  1HZV A;  3L35 A;  2Q5U A;  1S72 P;  3M9H A;  5CIC B;  4UB6 E;  1FI3 A;  3CC7 P;  1PGP A;  2HPC A;  4I6M C;  3WFB C;  1JOC A;  3A0H V;  4FB1 A;  2AEM A;  4JYC A;  3GW6 A;  1JUN A;  1FDM A;  5KKZ C;  1CCR A;  3A0H H;  4WQB A;  1N7S D;  2FYZ A;  4WQD A;  1IK7 A;  2YXQ B;  1NU1 D;  1NIR A;  1CZQ A;  1T3U A;  5GTI H;  2OYI C;  2ZT9 C;  1VQ8 P;  2P1J A;  1A2S A;  4D6T D;  3H1K E;  1NYH A;  1N8R Q;  3BRT B;  2C1U A;  1KC8 Q;  1PZQ A;  1VQL P;  5APY A;  4BRY B;  1PPJ D;  1EDL A;  1NTM J;  1EDJ A;  1LTG C;  3A2A A;  3MTU E;  4LJI A;  1BCC D;  1FBM A;  1LT9 C;  2IZ0 A;  2W90 A;  2WSF J;  2Q3I A;  1HVV A;  1NAY A;  2M3E A;  3OAK A;  1E8E A;  1PP9 D;  1E79 H;  3A3Y B;  3CPW O;  1AKK A;  1Q86 Q;  1FJP A;  1JDL A;  1NTK K;  3Q5R A;  1M8O B;  4ZNC A;  3PH2 B;  5DJQ B;  1LTJ C;  3H1I G;  3X39 A;  1S1C X;  3H32 B;  3C8V A;  2CA3 B;  2HV4 A;  2B4Z A;  5C9M A;  2FKW B;  4WY4 D;  1K8A Q;  2K9J A;  1SQP E;  3PRJ A;  5L8R J;  1W2L A;  1EB7 A;  1BDD A;  3CI9 A;  2BCC D;  1DX7 A;  1S9K E;  2QSI A;  1B7V A;  2R32 A;  4EID A;  3OCD B;  4PJ0 V;  1K3G A;  3CX5 I;  3CCL P;  1HWT C;  1MG3 D;  1HH7 A;  1KQG B;  1EZV D;  3BAS A;  2BH4 X;  1QVG O;  2KUB A;  3ABV C;  4AQR D;  2I8F A;  1JMM A;  4WBA A;  2Y9Z A;  1QVF O;  3M97 X;  3RK2 C;  2VRS A;  2WIT A;  1MUU A;  4WQC A;  5B5E V;  3BVH A;  3WFD C;  3TGU E;  5AUR A;  3NMD A;  3H1I D;  2WSC J;  3BAT A;  2A06 E;  2ZXE B;  2QJY B;  3RL0 D;  1RHZ B;  1KFM A;  3E7K A;  4GED B;  1AQ5 A;  1G1I A;  1H1O A;  1DW0 A;  1CRY A;  1Q7Y Q;  1AQT A;  2D2C D;  3EQ2 A;  1GL2 A;  4YTP C;  1SQB J;  1ZRT D;  1QYZ A;  1NTZ E;  3HD7 A;  2XZR A;  2E75 C;  1N86 A;  1RE3 C;  1M7L A;  3FWN A;  1JTH B;  4EOT A;  3RN0 A;  1FS0 E;  1CSV A;  4Y5R A;  1CHJ A;  5C0Z A;  1JY2 N;  2C9N Y;  2IBZ E;  4PD4 I;  4L73 A;  1YTZ T;  3CCJ P;  1DVV A;  2Q3E A;  5KAF V;  3ITK A;  1WVE C;  1RF1 B;  1KTM A;  1EXJ A;  4GDO A;  1K05 A;  1QL1 A;  5H2F E;  1YQ3 C;  5DJU B;  2JJL A;  1VQ6 P;  1SQQ J;  2AEF A;  4D6T E;  4WY4 A;  2HOD A;  1GZL A;  1VQP P;  2WSC H;  3MP7 B;  1LNQ A;  2O01 N;  1KYO W;  1RQU A;  1VPC A;  3G4S P;  2IDB A;  3TYI A;  5TIS V;  2HOD B;  2LKM A;  3TK1 A;  1AOF A;  2WZ7 A;  4NPE A;  1BCC G;  1NTM E;  5KLV E;  1F1C A;  4L1Q A;  2ZYA A;  1FOS F;  1NTM K;  2A06 G;  4PV1 B;  1OW6 A;  4YXD C;  4EIF A;  5CCG C;  3L71 J;  2W27 A;  1JY3 O;  2V7Q J;  1LWU B;  4OGQ B;  1GTW A;  1SLQ A;  2EXV A;  3B5N D;  3WU2 E;  1A56 A;  3L73 E;  1CI6 B;  1S5L E;  3O6Q A;  2A06 D;  3H1I J;  2GC7 D;  3AE4 C;  5EFW B;  4IFD K;  3CX5 W;  3CC2 P;  1PP9 E;  2YKO A;  4OVN F;  3D6Z A;  3U1A A;  4WY4 C;  2B9B A;  2L5G B;  3FGA D;  1NH4 A;  1L0N J;  4FA5 A;  4ASW A;  2PAJ A;  2E76 B;  1NKZ B;  3PTZ A;  1IC2 A;  2FFD B;  5CJ0 A;  1JEK A;  3FXE A;  1ZOY C;  4AAO A;  5AW8 B;  3M9Q A;  4OGQ D;  3PLN A;  1SS1 A;  1M57 D;  1GDV A;  1M60 A;  3L71 D;  4KJM A;  3M0A A;  4FA1 A;  1USD A;  2N1T A;  1L4A C;  3F5H A;  1VQ5 P;  3IR9 A;  2O01 J;  1G1J A;  1D7M A;  3L72 J;  3AEA C;  3NBS A;  2QA4 P;  1YBK A;  2O3J A;  4QAO A;  4EIJ A;  1CW5 A;  1X8Y A;  3L75 E;  3HTK B;  5AW2 B;  2OZ1 B;  2E74 C;  3H1I E;  1I5T A;  3V4W A;  1RF1 C;  1BE3 G;  2IYO A;  3VOP A;  4HKZ H;  4N0K A;  2A45 H;  4Y28 J;  1BL9 A;  3D71 A;  3PXW A;  1PIX A;  2JR8 A;  2WPV B;  4DZO A;  1IFJ A;  2N1T C;  1I8P A;  2WMM A;  3L4O A;  3QH9 A;  1NGM B;  2ZON G;  2BCC J;  5DFS A;  2WSF H;  3VP9 A;  2KSJ A;  2ORL A;  3NTN A;  1UIX A;  1L4A D;  2PAC A;  1OWA A;  2IFN A;  3NWV A;  3A0H E;  4N78 E;  3H1H E;  5AW4 B;  1HJB A;  2CE0 A;  2KLU A;  2Y0C A;  4PD4 H;  3D0W A;  2QVA A;  3U59 A;  4OGQ C;  2QIW A;  1DW2 A;  5AVV B;  1IRV A;  3H32 A;  2Z4E A;  2FFD A;  3H1L J;  1RF0 C;  3G6E P;  2N9I A;  3AED C;  1HCM A;  4W7Y A;  3H1J E;  3KDP B;  2OYH C;  1RF1 A;  1A8C A;  1GD2 E;  1LP1 A;  3S9O A;  1U74 B;  3HE4 A;  3BCC D;  5AW3 B;  2CE1 A;  1LTB C;  1Q2N A;  1SQV K;  1N73 C;  4FA4 A;  3AE7 C;  1ZP0 C;  4RKU J;  1RAQ A;  1GQ1 A;  3PHL A;  1CCH A;  1T8Z A;  3I56 P;  1QLE D;  3CWB E;  1N7L A;  2C2C A;  1CRH A;  1RE4 C;  1QL3 A;  4L3H A;  3OA7 A;  2Y0D A;  4IL6 X;  1G2C B;  2ZT9 D;  3GHG C;  1LWU C;  1DH3 A;  5B66 E;  4LGD E;  3CX5 D;  4JCG A;  1VQ4 P;  1GU5 A;  3O5C A;  2VHD A;  1CYI A;  4EDF A;  1QEX A;  1NVO A;  3F89 A;  1C6S A;  3U1C A;  4H0J A;  1YTZ I;  1KIL C;  2FYU G;  3PXT A;  2XNX A;  1SQQ D;  2FBW C;  3ZOX A;  5AVQ B;  5CCH D;  2C1D A;  3I55 P;  3KXD A;  2OQQ A;  3CCU P;  3CCS P;  1IO3 A;  1BCC J;  3H1L D;  3RK2 D;  5KAF E;  1J3S A;  1H33 A;  3L73 J;  1Z56 A;  4ASV A;  5CMZ A;  2IBZ D;  4U3F G;  3H1L G;  4L76 A;  3RL0 g;  3BCC J;  5KAI V;  1JTH A;  4H0L B;  4Y99 B;  1CRC A;  1H9Y A;  1FZB A;  3L70 D;  3SFE C;  4FAV A;  5CYT R;  1MFT A;  1M90 Q;  1R0Q A;  4WWI A;  2CXB A;  4D6T G;  2QG4 A;  2E74 B;  4H0K A;  4JF7 A;  1FZG A;  3SFD C;  3CCQ P;  5E79 H;  3CXH D;  1JCC A;  4HH2 A;  1I55 A;  3FWL A;  3DMI A;  4D6T J;  3PH0 A;  4PD4 D;  2C0W A;  2B87 A;  5TIS E;  5GTI V;  4ZMD A;  1AFO A;  1KX7 A;  1NNO A;  1N73 B;  1HZU A;  4AAM A;  4C7N B;  3L73 G;  1L0N K;  1NTZ G;  3RK3 B;  4IFF A;  3BRV B;  2AXC A;  1K04 A;  4V2K A;  3L72 D;  1X79 B;  3USS A;  3MZW B;  2OYH A;  1GMJ A;  1J1E C;  3V2N A;  2H7H A;  1S3J A;  1X22 A;  2C9L Y;  2I1J A;  3HUS A;  2N9B A;  2H88 C;  1L0L K;  2QJP C;  2N9Y B;  2C9X B;  4PWA A;  1NHL A;  3RN1 A;  2KNC B;  1Y8A A;  3KZI H;  3P8C D;  1CIE A;  1KYO E;  3IFM A;  1VDF A;  1J2J B;  3P32 A;  4KMG A;  1TU3 F;  3H1H G;  5AVR B;  1ZZH A;  2XV5 A;  4KT0 J;  3H6P A;  3MUD A;  3RGU A;  4PJ0 H;  3A7O A;  2OTK E;  5AVY B;  1GIW A;  4AAL A;  1AVO A;  1FC2 C;  3SWY A;  1DEE G;  1DEB A;  3HE4 B;  4WQ9 A;  1VQ7 P;  3MUD C;  2LR2 A;  4H0L C;  1JO5 A;  4MN4 C;  3FXD A;  3N7N A; 
#chains in the Genus database with same CATH homology
 1CSW A;  1FI9 A;  1E2R A;  2DVH A;  5DF5 A;  3TF5 A;  1OCD A;  2MTA C;  1NTZ D;  1FOC A;  3HQ7 A;  1KYO W;  1CTJ A;  1H31 A;  1SQB D;  1H9X A;  1P84 D;  2N18 B;  3TYI A;  5EXQ A;  5TIS V;  1CHI A;  1AOF A;  4XXL A;  3KHU A;  3SJL A;  1N50 A;  3SLE A;  1F1C A;  4L1Q A;  1CIG A;  1M70 A;  1H31 B;  2B0Z B;  1COT A;  2B11 B;  1ETP A;  5TJH A;  1HJ3 A;  1IQC A;  3ZIY A;  1COR A;  2AI5 A;  1C6O A;  3HQ9 A;  1RZ6 A;  4EIF A;  2BCN B;  3RLM A;  2Y0E A;  4O1Q A;  1L9J C;  4MU8 A;  1DW1 A;  2EXV A;  3H1H D;  1GKS A;  1RZ5 A;  1A56 A;  5CIG B;  2RN0 A;  2KS1 A;  1CYJ A;  2DGE A;  1LS9 A;  3ZCF A;  2A06 D;  1IRW A;  2GC7 D;  3ZOW A;  3ZOO A;  1C75 A;  1DIQ C;  1QN2 A;  3CX5 W;  1H32 A;  3SWS A;  1GJQ A;  4P4Q B;  4FA5 A;  5KLV D;  3PTZ A;  1LC2 A;  3RMZ A;  1OAE A;  1BE3 D;  1CIH A;  1N15 A;  4FAN A;  3O20 A;  4AAO A;  3L4M A;  4YE1 A;  1CRJ A;  1MZ4 A;  3PLN A;  1GDV A;  1M60 A;  3L73 D;  3L71 D;  1SQV D;  4FA1 A;  4K3I A;  1CTY A;  2QJK B;  3A0B V;  2GB8 B;  1E29 A;  3NBS A;  1CSU A;  2O3J A;  4EIE A;  4QAO A;  1FI7 A;  2OZ1 B;  5H2F V;  2BH5 X;  1QL4 A;  3HQ8 A;  2V08 A;  1CHH A;  4L3G A;  1I5T A;  5KKZ B;  1CRI A;  3CXH W;  3WFC C;  2BPB B;  3DP5 A;  4N0K A;  1CYC A;  3CYT I;  1SQP D;  3SVW A;  1BL9 A;  3PXW A;  1QKS A;  1AOQ A;  1C7M A;  1LMS A;  4J20 A;  1N90 A;  3C2C A;  3H1K D;  3WU2 V;  4WQA A;  5DJQ C;  1I8P A;  3L4O A;  1KYO D;  1KIB A;  1HRC A;  2PCC B;  2B12 B;  4RSZ A;  3GG2 A;  2ZON G;  1I6D A;  1YNR A;  1H33 B;  1C52 A;  1CNO A;  4WQ7 A;  5DFS A;  3CWB D;  2D0W A;  1FCD C;  5B66 V;  2ORL A;  2ZBO A;  1YTC A;  4UB6 V;  2PAC A;  1C2N A;  1I8O A;  1DII C;  1YEA A;  2LIT A;  2YCC A;  1SQX D;  3NWV A;  4UB8 V;  1FJ0 A;  1H32 B;  2CE0 A;  2Y0C A;  2N3Y A;  4NFG B;  2PCB B;  2FWL A;  1DW2 A;  2FRC A;  1IRV A;  1IZL 0;  1CIF A;  1W5C T;  2YK3 A;  2CA4 B;  2ZXY A;  2C8S A;  2N9I A;  2FYU D;  3A9F A;  1HCM A;  1YIQ A;  3H1J D;  2BGV X;  1A8C A;  4AX3 A;  1U74 B;  3BCC D;  5CID B;  3CU4 A;  2CE1 A;  4FA4 A;  1CSX A;  1L9B C;  2N18 C;  1BGY D;  2JQR A;  3JBT B;  3O0R C;  1RAQ A;  1L0N D;  2YIU B;  1C2R A;  155C A;  1GQ1 A;  1NML A;  3PHL A;  3OA8 B;  1CCH A;  2YQB A;  2C2C A;  1DT1 A;  2FYN B;  3WUI A;  1CRH A;  3O1Y A;  2RMZ A;  1QL3 A;  4L3H A;  2OZ1 A;  2Y0D A;  1VYD A;  3CX5 D;  4JCG A;  2MHM A;  2LIR A;  2V07 A;  3OA8 A;  3O5C A;  1HZV A;  2VHD A;  1CYI A;  4EDF A;  5CIC B;  1S6V B;  1DVH A;  4RJT A;  5CIE B;  1FI3 A;  3WFB C;  3L75 D;  1C6S A;  3A0H V;  2C1V A;  2N9J A;  4FB1 A;  4H0J A;  1GU2 A;  3PXT A;  3GW6 A;  1U75 B;  3SXT A;  5B6Q A;  1CCR A;  1SQQ D;  3ZOX A;  1CXC A;  1WEJ F;  2C1D A;  4WQB A;  5CIB B;  3HQ6 A;  2JWA A;  1I54 A;  4FA9 A;  4WQD A;  1M6Z A;  4U3F D;  4A7P A;  1NU1 D;  1HJ4 A;  1IO3 A;  1NIR A;  1NTM D;  1A2S A;  3H1L D;  4D6T D;  2JTI B;  4DY9 A;  1J3S A;  1H33 A;  1KX2 A;  4XYD B;  2C1U A;  1YEB A;  2AIU A;  2BLF B;  4WQ8 A;  2IBZ D;  1PPJ D;  1MG2 D;  1YCC A;  5KAI V;  5KLI B;  5E79 V;  4LJI A;  1BCC D;  1CRC A;  3MK7 C;  1H9Y A;  4AAN A;  1HRO A;  3L70 D;  2N3B A;  1KV9 A;  3CP5 A;  4IL6 V;  4FAV A;  5CYT R;  1E8E A;  1PP9 D;  3ORV A;  1AKK A;  1JDL A;  1R0Q A;  2CXB A;  3DR0 A;  2QG4 A;  3PXS A;  1FHB A;  3PH2 B;  5DJQ B;  3VYM A;  3X39 A;  4H0K A;  451C A;  2QJP B;  2CA3 B;  1I6E A;  3CXH D;  1I55 A;  3FWL A;  3DMI A;  1L0L D;  4Q5P A;  1CXA A;  2HV4 A;  2B4Z A;  5C9M A;  4PD4 D;  3TDK A;  3PRJ A;  1W2L A;  1K3H A;  5GTI V;  1KB9 D;  3NBT A;  2ZZS 1;  4WQE A;  1EB7 A;  1CC5 A;  2BCC D;  2AXT V;  1HJ5 A;  2B10 B;  1KX7 A;  1B7V A;  4EID A;  1C6R A;  1NNO A;  3OCD B;  1HZU A;  2K9J B;  2ZOO A;  4PJ0 V;  4AAM A;  1K3G A;  1MG3 D;  1HH7 A;  1CO6 A;  2XTS B;  1NMI A;  5GTH V;  1RAP A;  4V2K A;  3L72 D;  1EZV D;  1CED A;  351C A;  4EIC A;  1YIC A;  3KZI V;  2BH4 X;  3OCD A;  1KB0 A;  3WFE C;  4PW9 B;  3ZBM A;  3VNW A;  3WC8 A;  2GIW A;  2I8F A;  3VMA A;  5IY5 1;  2N9Y B;  2C9X B;  4PWA A;  3M97 X;  2C1D B;  2L91 A;  3L74 D;  4WQC A;  5B5E V;  3RN1 A;  3WFD C;  2KNC B;  2GC4 D;  5AUR A;  3H1I D;  4GYD A;  2QJY B;  1CIE A;  3ZOY A;  4KMG A;  1NTK D;  1ZZH A;  1S5L V;  1CTZ A;  4GED B;  1H1O A;  5CIF B;  1DW0 A;  1CRY A;  1N9C A;  1GIW A;  1ZRT D;  4AAL A;  1QYZ A;  2L4D A;  5CIH B;  1LC1 A;  1DW3 A;  3RN0 A;  1CSV A;  4Y5R A;  1CHJ A;  5C0Z A;  1AYG A;  4WQ9 A;  1LFM A;  3VRD A;  1DVV A;  2Q3E A;  5KAF V;  3TGU D;  3ITK A;  1WVE C;  2D0S A;  1CRG A;  4O1W A;  1YFC A;  1F1F A;  3MK7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...