3H1LD

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1lD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1lD02
3WFBC 1CRCA 3CX5D 3WUIA 2ZZS1 3ZIYA 1DW0A 1F1CA 1QL4A 2B11B 3ZOWA 4Y5RA 1I54A 3RMZA 3RN1A 1FI7A 5B66V 1C52A 4AAMA 1LFMA 3VMAA 2V07A 2Y0DA 3O1YA 4GYDA 1C2RA 4EIEA 1C7MA 4WQCA 4WQ9A 1AYGA 1CYCA 2O3JA 3PLNA 1C6RA 2Y0CA 1RZ5A 1DW1A 2PACA 3A9FA 2EXVA 1KYOD 1RAPA 5CIFB 1OAEA 4FANA 1NTMD 3TF5A 1ZRTD 1LS9A 4EICA 2FWLA 3MK7C 1BGYD 3SJLA 1IZL0 1IRWA 4H0JA 1NU1D 4QAOA 1N15A 4AANA 3GG2A 4AX3A 1OCDA 2C8SA 1YNRA 2KS1A 4WQ8A 1F1FA 1HJ3A 1BE3D 2BCCD 3H1KD 2N9JA 1BL9A 3L75D 3WU2V 1GKSA 1I6DA 5DFSA 1CSVA 1QL3A 2CXBA 1NTZD 1PP9D 2LITA 2Y0EA 3DP5A 2C2CA 2CA3B 2CE1A 3CYTI 3DR0A 1CTZA 2YK3A 5CICB 2PCCB 1GQ1A 3NBSA 1NMIA 2N18B 1I5TA 1HH7A 3HQ8A 1R0QA 3L74D 2JWAA 1H9XA 1A8CA 4AAOA 3HQ6A 3ZBMA 2HV4A 1WEJF 2IBZD 3NWVA 1DVHA 1MZ4A 1N9CA 3L72D 2FYNB 5EXQA 4WQBA 4FA1A 2B10B 2ORLA 4EIDA 1CYJA 5KAIV 1BCCD 2A06D 4IL6V 4O1WA 3KHUA 1QYZA 4V2KA 5CYTR 5KLVD 5TJHA 2D0WA 1L9BC 1M70A 2DVHA 1E29A 1N50A 3VYMA 1LMSA 2C1UA 1KB0A 1W2LA 5CIEB 4L3HA 1YFCA 1I55A 2KNCB 1FI3A 5C0ZA 3CX5W 1DT1A 3A0BV 2BGVX 3NBTA 4J20A 1ETPA 1KB9D 3WC8A 3SVWA 1YEBA 1I6EA 2GIWA 3MK7B 3WFDC 1IQCA 3PXSA 1SQVD 4EDFA 2AI5A 2GC4D 5TISV 2B0ZB 2MHMA 1H1OA 3O20A 5GTIV 3RN0A 4UB8V 1CRHA 5CIGB 1FI9A 1B7VA 1YTCA 4RJTA 1CIGA 3ZOXA 4N0KA 2V08A 1CORA 4FAVA 3SLEA 155CA 2RMZA 2ZBOA 1NIRA 2ZXYA 1U75B 1CIEA 1KYOW 4U3FD 1AOFA 351CA 3L70D 4JCGA 2B4ZA 1HJ5A 4XXLA 3O5CA 1SQQD 3TDKA 1K3HA 4MU8A 1JDLA 1KX2A 4PWAA 1NNOA 1MG3D 1FHBA 3H1ID 4Q5PA 1HZVA 3L4OA 2BLFB 2BH4X 2FRCA 5E79V 1YEAA 1DW3A 1CHJA 4FA9A 2VHDA 5DJQB 3VNWA 2C9XB 2D0SA 2N3BA 4H0KA 1H33B 1H31B 1I8OA 5H2FV 3X39A 4UB6V 1CNOA 4XYDB 2C1DB 1CHHA 4L1QA 1C2NA 2QG4A 1CRJA 2BCNB 4KMGA 1SQPD 2YIUB 5AURA 1VYDA 2ZOOA 3ZCFA 4FA4A 1CRGA 3PTZA 3PXTA 4AALA 1H32B 3GW6A 1RZ6A 4A7PA 1CHIA 3FWLA 3CWBD 2N9IA 1GDVA 3DMIA 1H33A 2JQRA 1H31A 3JBTB 4P4QB 2K9JB 1YICA 2GB8B 3H1LD 5DF5A 2C1DA 1S5LV 3C2CA 2FYUD 4EIFA 1IRVA 1QKSA 1FOCA 2LIRA 2N9YB 1NTKD 1A2SA 2XTSB 1FCDC 1CIFA 1GU2A 2OZ1A 3CXHD 4WQAA 5GTHV 2YQBA 1MG2D 2CE0A 1H32A 3CXHW 1L9JC 1AOQA 2N18C 2AXTV 4FA5A 1P84D 4NFGB 3O0RC 1E2RA 1IO3A 3RLMA 1CTYA 1DIQC 3SWSA 2I8FA 4RSZA 1CSXA 1CC5A 1AKKA 1FJ0A 3PRJA 4FB1A 1CYIA 3ITKA 4LJIA 1DW2A 2QJYB 3L4MA 2Q3EA 1N90A 1YCCA 1M6ZA 1CCHA 1COTA 1E8EA 451CA 1L0LD 1ZZHA 1SQBD 3OA8A 1LC1A 4WQEA 3KZIV 3TGUD 5B5EV 4GEDB 1EZVD 2MTAC 3HQ7A 5CIBB 1KIBA 1CCRA 2QJKB 2RN0A 3WFEC 2ZONG 1M60A 2YCCA 1C75A 5KLIB 1HRCA 2JTIB 4K3IA 3L73D 3PH2B 3VRDA 1GIWA 3ZOYA 2L91A 3CP5A 1WVEC 1S6VB 1CEDA 2DGEA 2PCBB 3M97X 3TYIA 5KAFV 4D6TD 1HROA 1CSUA 1HJ4A 2B12B 1QN2A 4O1QA 5C9MA 1U74B 1CXCA 1CRYA 3CU4A 5IY51 2OZ1B 4WQ7A 1KX7A 3HQ9A 1CRIA 4DY9A 2GC7D 1I8PA 3OCDB 1NMLA 4PD4D 1J3SA 1KV9A 3PHLA 2L4DA 1LC2A 1SQXD 1YIQA 3ORVA 1CXAA 3ZOOA 1HCMA 3H1JD 3L71D 2BPBB 3BCCD 1CO6A 4YE1A 5DJQC 2N3YA 3H1HD 1CTJA 2QJPB 2AIUA 1A56A 3A0HV 1CIHA 1HZUA 1C6OA 1K3GA 5CIHB 1DIIC 1EB7A 1L0ND 4PJ0V 1DVVA 5B6QA 2C1VA 4PW9B 1C6SA 1PPJD 4L3GA 3WFCC 5KKZB 1W5CT 1H9YA 3PXWA 5CIDB 2CA4B 3OCDA 1RAQA 3OA8B 3SXTA 2BH5X 4WQDA 1CSWA 1GJQA
chains in the Genus database with same CATH superfamily
2IBZG 2LXBA 3JCUE 2AXCA 2IPPA 4HJGH 1DW0A 1QL4A 3AE8C 2IFNA 2H89C 2A06G 4IFFA 3VP9A 3HUSC 2R3SA 5CCGD 2E74B 1NTZJ 1CSBA 3HE4A 1R5SA 4PJ0E 1LGHB 1C52A 1YTZT 3VMAA 1T3JA 1SFCB 2PAJA 3CMAP 1RF1C 4GYDA 3NMDA 4EIEA 5DJUB 1P84E 3CLQA 2O3JA 5KJ7A 3PLNA 1C6RA 2IX7C 4OWFA 3V5BA 2Y0CA 1RZ5A 3W67A 3A9FA 2EXVA 4FANA 2FWLA 3L35A 2WSFH 1T8ZA 3MHVA 3MK7C 3SJLA 2Q1KA 1NAYA 1JY2P 3GHGA 4IOIH 4H0JA 4PD4I 2GA1A 2PFXA 2FKWB 1YNRA 4WQ8A 1URQC 4K3AA 3Q5RA 1L0LE 1SFCA 2IFMA 2ZXXA 1BE3D 4OGQD 2WSEH 1PGOA 2N9JA 3TSIA 1JMMA 1CSVA 2E76C 2PGDA 1EDLA 3TGUE 1EZVE 2P1JA 3AE1C 2OQQA 5TISH 1HUCA 3DP5A 1S4XA 1MFZA 2C2CA 2CA3B 3KYQA 2CE1A 3DR0A 2I1KA 1GQ1A 4ZMDA 2N18B 1HH7A 1IFNA 1R0QA 1JM0A 2Q5UA 2NPSC 2JWAA 1H9XA 1A8CA 4AAOA 3EWKA 2I8DA 3MUDC 1WEJF 3EFFK 2JDIH 3NWVA 1DVHA 1D7MA 1N9CA 3E1RA 4H44C 4WQBA 4EIDA 1M90Q 1BCCD 4IL6V 3RK3E 4V2KA 1EDJA 5AVTB 3BRVB 5KLVD 2Z5HA 1KFMA 5CMZA 2DVHA 4GOEA 4W80A 1E29A 2VRSA 3TGUJ 5H2FH 5CIEB 3CX5W 1SQXG 1TU3F 4I1LA 3NBTA 1HF9A 1ETPA 3GF3A 3M0DA 3WC8A 1KYOI 1IFDA 1YEBA 2FYUG 2M5AA 1I6EA 1LWUC 3D6YA 2GIWA 4IFDK 3PXSA 1AVOA 4BWNA 1FZAA 2AI5A 1L0NG 1YHQP 2LR2A 2B0ZB 2QJPC 4IL6X 4UB8V 4K35A 1Y47A 4IL6H 2ZT9B 1HBWA 1USEA 4D6TG 4KT0J 2NZ2A 4M3LA 5KKZC 155CA 2C9LY 4C7RA 1Z56A 2PRRA 1U75B 1UIXA 4U3FD 1AOFA 1NTKK 2MJZA 2QM7A 1KILC 2B4ZA 1HJ5A 3AE7C 1DD4A 4DOJA 3O5CA 1SQQD 2Y9YA 1M1JB 2N1TA 1DX7A 3C9IA 1K3HA 4PWAA 1HH0A 4I2LC 1NNOA 1M7LA 1FHBA 5TISE 3L4OA 3TK1A 2BH4X 1KB9H 2FRCA 3V4WA 4N78E 2H43A 4FA9A 2VHDA 4JYCA 2D0SA 2N3BA 2E43A 3HD7B 1H31B 2RKLA 4UB6V 1CNOA 1ZRTE 2QG4A 3FGAD 2O1JA 2P58A 2WSFJ 1FDOA 3OJAB 1NGMB 3FXEA 1W2EA 3ZCFA 3M9QA 1T2KC 1FZEA 1RE4A 3V2QA 1SLQA 1LTIC 2AEMA 2WPRA 2BCCE 2WSEJ 2Q9IA 3GW6A 1RZ6A 1EXJA 1KV4A 1RF0C 3EFGA 3DMIA 1HJ0A 1BE3G 2W6AA 1NTMK 1PGJA 1H31A 1ZMEC 3NFQA 1PP9E 3KQGA 2OARA 1FJPA 5M1BA 3C2CA 1RF1B 1NAFA 3AE6C 1PFIA 1IRVA 2QA4P 1FOCA 2LIRA 4H13D 1N73C 1VQNP 3B5NC 3V2RA 1N7SD 2OZ1A 4I6MC 5APQA 5BU5A 4WQAA 5GTHV 4N3YB 3L73J 3BCCG 1Q90D 2QM8A 3VTPC 2E5TA 2AXTV 1YQ4C 1NYHA 4FA5A 4IL6E 1P84D 4NFGB 5AW2B 2BCCJ 1K04A 3SWSA 3WUUA 1BCCG 1URQB 3VMYA 2JKVA 1CZQA 2H8PD 5KLVG 2FFDB 1AKKA 1PP9J 4LGDE 3SFEC 3ITKA 1DW2A 3L4MA 2Q3EA 1VQLP 1X0TA 2GM4A 1J1EB 2OYOA 1COTA 1KB9E 2AEJA 3D6ZA 3Q3DA 451CA 1L0LD 3A0HH 1M57D 5KJ7C 5AVVB 1ZZHA 3VP8A 1VL2A 1VQOP 5C39A 3CXHH 5L8RJ 3TGUD 3MTUE 1EZVD 1JB0J 4QMAA 1SP4A 2NPSB 2E74C 3GMAA 2ZONG 3GHGC 2FFDA 3A5TA 3S4RA 3W68A 1GIWA 1SFCC 1FZCB 1GTWA 1S6VB 3TYIA 5KAFV 3JSVC 1K9MQ 1SVFA 4U7JA 5B66H 2FXPA 1CSUA 4U3FG 1QN2A 4O1QA 2HR3A 1CRYA 3CU4A 2ITAA 1BGYG 1YBKA 1VQKP 1SQQG 3HQ9A 3RK3D 3PHLA 3K5BA 3TNUB 1LC2A 1ZN5A 3H1KG 5APTA 4UB6E 3O6QA 1CXAA 2A45G 3V4QA 2B87A 1FZCA 1NTZG 4YE1A 1LJ2A 1CTJA 2QJPB 2AIUA 2WPVB 2KIKA 1OVVA 1QX8A 1DVVA 4PJ0V 1M56D 2C1VA 3H32B 1NVOA 4JYBA 5AW0B 5KAFH 1H88A 5KKZB 2OYIA 1H9YA 1BSNA 1PIXA 1QGKB 2BH5X 5BVZA 3TNUA 4KMGA 3WFBC 1KILB 1CRCA 2ZZS1 3ZIYA 3FXDA 2WZ7A 1LTGC 4BXLA 3RBZA 2ZVNB 1F1CA 2B11B 4R4LA 4PD4H 1WT6A 2M8RA 3M0DC 1I54A 1FU1A 3A0HE 2C9NY 3BASA 3RN1A 3L4FA 3A7OA 1NTKE 1IFJA 1NJIQ 2N9BA 4AAMA 3CXHE 5GTHE 1R8EA 3H32A 5CJ4A 3RBXA 1C2RA 1C7MA 4N78D 1LTSC 2OGUA 1HVVA 1IZNB 4WQ9A 1ZR2A 2W8ZA 1CYCA 3FX0A 3CCUP 2W83C 2ZYAA 1L4AB 3AE2C 4C7NB 1M1KQ 4LC1A 1RAPA 5CIFB 3TF5A 1ZRTD 4HH2A 4GIFA 2N1TC 5B66E 1IRWA 1OMIA 2ZAEB 3B8EB 4YXDC 1JCCA 1N15A 1OCDA 1RHZB 1F1FA 2R5DA 2BCCD 1NTKJ 1GD2E 1SQBE 1BL9A 3WU2V 2ZT9C 2IZ1A 1N73B 2C0XA 1R5LA 4R4MA 1L4AA 1PP9D 5APSA 2Y0EA 4NPFX 4PV1C 1NH4A 3TGUG 1E79H 1EZVG 3CYTI 1HWTC 2YK3A 3FWNA 1RE4C 3AE4C 1T3UA 2E75D 3HQ8A 3HE5B 1KYOH 1VF5D 3M9BA 1JY3N 1AVYA 2JWDA 3CX5I 4EI2A 2WTYA 5KAFE 2OTLP 2HV4A 1MZ4A 3HE4B 2FYNB 5EXQA 1CYJA 1EQ7A 1VQPP 4O1WA 2BEQD 1QYZA 4PD4E 1SQBJ 2D0WA 4NPDA 2C1UA 1S1CX 1KB0A 1YYCA 1YFCA 3BVHA 3CWBG 5C0ZA 3L71E 2K1AA 1MV8A 3HE5A 5AW1B 4J20A 2IDBA 3H1HE 3P8CE 2FXOA 1KB9D 3SVWA 2KSEA 3F89A 3GHGB 4KHXA 3CCEP 1KILE 1LTTC 1PPJE 3O8ZA 2ZVOB 4EDFA 4WWIA 5TISV 1SQXK 2KLUA 1GDTA 2MHMA 3O20A 1QL1A 1BSHA 2ZJSE 4ZKUA 1FI9A 1B7VA 4RJTA 1BDCA 2FYUK 2IYOA 2SPZA 3H25A 3SLEA 3TYYA 2A45I 1RQUA 1L0NK 3G6EP 4JCGA 3L71J 1JNMA 1VQ6P 1KX2A 3HD7D 5CJ0A 3H1HJ 3G9RA 4H0LB 1IK9A 4RKUJ 1YEAA 1CW5A 1DW3A 2FFDC 2OYHB 3KPEA 3LIEA 2BASA 5H2FV 2MKVA 3X39A 1GL2B 2CPBA 3IR9A 1KYOE 1J1EC 1MUUA 3N7NA 4WBAA 1CHHA 1C2NA 5AW6B 4L76A 2FYZA 3BRTB 2W27A 4HKZH 1VYDA 1NU1E 4FA4A 1CRGA 4WB4A 3PTZA 3CCLP 3L73G 2WT7B 4A7PA 4CPGA 3ABVC 3WU2E 2M5AB 3AECC 2OYHA 3M0AA 2XU6A 2JP3A 4WVZA 1FAVA 3OA7A 2BCCG 1YIJP 2JQRA 3VMZA 1KORA 1FZCC 1L0LJ 1GL2A 1OW8A 1YICA 1PP9G 4BRYB 1QVFO 2LKMA 2O01H 3PH0A 2FXMA 1NTKD 1A2SA 1FCDC 3RL0B 3MD0A 1AV1A 2OYIC 2K37A 1DEEG 3CXHD 2HPCA 2HLOA 2IBZE 2V7QJ 3L72E 2WT7A 3CXHW 1NU1J 1VQMP 1URQD 1EDKA 1LTJB 2N1TB 5AVXB 1DD3A 4DZOA 5AW3B 2A06E 2QIWA 3SWFA 1E2RA 1JY3P 2E76D 3OW2O 2WSCJ 1HJBA 3SWKA 2HFED 1Q81Q 1FJ0A 4BRYA 1QLED 4RO0A 4LJIA 2QJYB 1N90A 1S9KE 1CCHA 3IFMA 3AEEC 4PV1B 1KTMA 3AE9C 1IFPA 3CC4P 2NPSD 3C8VA 1SQBD 3U59A 2YXQB 1XTCC 5KLVK 1LTJA 2FY8A 1FE6A 4H44D 5B5EV 2MTAC 3L72J 3HQ7A 1AQ5A 1CCRA 4GT1A 2RN0A 3N4XA 3WFEC 2XNXA 2K3RA 3LW5H 3CMEP 2D2CC 2IBZI 3PH2B 3VRDA 3CP5A 1KMIZ 1Q7YQ 2KI7B 3UIAA 3L70E 5AVZB 1Q2NA 2HG5D 2PCBB 3HTKB 5CCGA 3M97X 3A3YB 3L37A 1L4AC 2OZ1B 4WQ7A 1M8OB 3OCDB 4PD4D 1J3SA 2L4DA 5H2FE 2JR8A 5B5EH 4OVNF 3ZOOA 1HCMA 1OWAA 3L71D 2YO3A 1SQQK 2UWJE 3HTKA 2N3YA 3H1HD 3P8CD 4AYCA 3A0HV 3USSA 1EB7A 3LIDA 1KILD 1C6SA 3L70J 1PPJD 4L3GA 1FOSF 2YIUC 3OCDA 1NTZK 1RAQA 1GJQA 1DIPA 2J58A 3S9OA 1LTAC 2YMYA 3H1LE 4Y5RA 2FYUE 2ZXEB 4AQRD 1PV3A 2FYNC 2O01J 3S1KA 3Q2YA 1FI7A 5B66V 1L0NE 1K73Q 1LFMA 1T2KD 2V07A 1KQFB 1FZFA 1KZUB 1PGQA 4JF7A 4WQCA 1QVGO 3G4SP 4YTPC 2NRGA 1Y8AA 1DW1A 2PACA 1KYOD 1OAEA 3AEGC 1LS9A 1OZHA 3SWYA 3CX5H 1LP1B 3L36A 3O6QB 3H1LJ 1NU1D 4EIJA 3A0BH 5APYA 2CPSA 4AANA 3GG2A 2B87B 5CCHA 3B5ND 2CK3H 3G71P 1HJ3A 1NO4A 1S2EA 1SQVK 1FOSE 5AW7B 2YKOA 5B5EE 2CXBA 1SQBG 2WWWA 4MN4C 2LITA 2OYIB 5DJTB 1VQ7P 1H89A 1CTZA 2Q3IA 3WUVA 2QE7H 1LP1A 5APVA 3NBSA 1WRGA 1LT9B 3CCSP 1RY3A 3P7KA 5APUA 4ZNCA 4H0LC 3Q5PA 3VN0A 2P7JA 2QJKC 3HQ6A 2OYHC 2P67A 4Z1MH 3CC2P 2IBZD 5AVUB 3L72D 3D70A 4FA1A 2B10B 2JO1A 5KLIC 1GL2C 5KAIV 5KJ7D 2A06D 5E79H 3I55P 5CYTR 1N2DC 3CD6P 1PGPA 5TJHA 3AEDC 4WY4B 2A45H 1LMSA 3F5HA 3MIWA 3D71A 4L3HA 2E74D 1I55A 3HRNA 2H88C 1FI3A 3H1JE 1LT9A 1SQPK 2B88A 3ZDMA 1DT1A 3BCCE 1G2CB 1S9KD 4XE5B 1SFCD 3L71G 3SXTA 1XTGB 1VQ5P 3RK2C 2W6BA 1N7SB 3H1HG 1IQCA 2D2CB 4L74A 4WY4A 1PPJG 4OH8B 5GTIV 4TLFA 1DH3A 1NWQA 3RN0A 4DT0A 3CX5E 1CRHA 5KAIH 5CIGB 2HYNA 1YTCA 3IAOA 1CIGA 1S5LX 3RL0C 1IFMA 3JCUH 3ZOXA 3M9HA 3A0BE 3D0WA 1CORA 1S5LH 2WPSA 2HODA 2RMZA 1NIRA 1G2CA 4H0LD 4JQ0D 3L70D 1LTJC 3H1JJ 1VQ8P 4XXLA 1N7SA 1FDIA 1GMJA 1JDLA 3GLMA 1X79B 4Q5PA 1JEKA 1YTZI 2BLFB 2Z5IA 3VNWA 4DCKA 1GU4A 1L0LG 4H0KA 1H33B 3R2PA 3BATA 2QJYC 2E42A 1GW3A 4XYDB 1NTME 2B89A 5CCGC 1CRJA 5GTIH 1IC2A 1IFIA 1AJYA 2YIUB 1BGYE 5AVRB 1OXZA 2L5GB 5AVQB 2ZOOA 1W5CE 1GW4A 3SFDC 1KQGB 1E5WA 1A02F 5E79E 1NU1G 1HGZA 3H1KE 1JY3O 2GUSA 3L75E 1OFCX 2N9IA 2E5YA 3KZIH 2M3BA 1H33A 1NTZE 5KTBA 2K9JB 1K05A 2GB8B 1CI6B 3H1LD 1JUNA 4Y99C 1PZQA 2FYUD 4EIFA 1H0TB 2N9YB 1NTMJ 2XTSB 2N1TD 3L74E 1BDDA 4XA4A 3B4SA 1GU2A 2GUVA 2IZ0A 3CCMP 1MG2D 1BGYJ 1L9JC 1FS0E 4I7ZB 5KAIE 2Q7CA 3L72G 3O0RC 3RLMA 1CTYA 2ZT9D 3H1KJ 1DIQC 1S5LE 2K9JA 2I8FA 3L75J 1CI6A 1JOCA 2JEEA 5CBNA 2Q6QA 3KXDA 1H0TA 4PV1D 4DJGA 1L2PA 1CYIA 3Q5SA 1OW6A 1YCCA 1M6ZA 5K5GB 2KP8A 3Q1MA 3CI9A 1ZV8A 1MFTA 3OA8A 3L74J 5AW5B 4TT3H 1LC1A 4WQEA 1SQVE 1RQVA 4GEDB 1KIBA 5GTIE 2QJKB 2R5BA 5KLIB 5CCHC 3MP7B 2YKQA 1ZW0A 2L91A 1WVEC 1ZOYC 1CEDA 3AEFC 2DGEA 2JJLA 2Z4EA 2P10A 3L70G 2B12B 3KZIE 5C9MA 3H1IE 2HPCB 1A02J 1CRIA 1RE3A 1NMLA 1KV9A 5APWA 1SQVJ 1YIQA 3RK2B 1YITP 1K8AQ 3H1JD 3I5CA 2BPBB 3GF7A 2PP6A 3BCCD 1SQPE 1P84I 2KXPB 1CO6A 1LT1A 5DJQC 3CCRP 2E75B 4GODA 1FC2C 1YJ9P 1LNQA 2V4HA 2XZRA 1CIHA 1VF5B 1C6OA 1K3GA 5CIHB 2YNYA 4GKGA 1VQ4P 5B6QA 4PW9B 3U1AA 3WFCC 2QSIA 1W5CT 1HGVA 5CIDB 1JO5A 3CWBE 3G3ZA 4WQDA 1LT9C 3CX5D 3WUIA 3H1IJ 2QEXP 2ZYDA 1IO4A 1N8RQ 2YXRB 3AEAC 3ZOWA 3JC22 5CCHD 3SSUA 3MZWB 3U1CA 4JPZB 3RMZA 3H1LG 1EZVI 3NXSA 1U7JA 3EQ2A 1SQPJ 2KS1B 2YKPA 4WY4C 3E7KA 2Y0DA 3O1YA 3V6IA 3CCQP 1AQTA 2FBWC 1AA0A 3B71A 4RESB 1AYGA 2XV5A 3IN6A 3CL3D 4ZKPA 1KC8Q 2O1KA 3CWBJ 1NTMD 4H13C 4EICA 2KZIA 1SS1A 1BGYD 1N7SC 1KD1Q 3T97B 1IZL0 4QAOA 4AX3A 1N7LA 2C8SA 3M91A 3R4YA 2KS1A 2M0BA 4Y99B 3H1KD 1J1DC 3L75D 1VDFA 1GKSA 1I6DA 5DFSA 2R3CA 1QL3A 1NTZD 1RH5B 2OTKE 3I56P 1GK4A 2P2UA 4OGQB 2ZYGA 4UB8H 1DEBA 5CICB 2PCCB 2YO2A 1JTHB 1NMIA 2IYPA 3L73E 1I5TA 3T97A 2KSJA 1M1JA 4JBZA 5EFWB 2B9BA 1NHLA 1H8AA 3L74D 1SQBK 2Y9ZA 3ZBMA 2POHA 1NOHA 3CC7P 4WY4D 2R32A 3HUSB 2ORLA 3PJSK 2M3EA 1G1JA 3E1IA 2KLVA 3HD7A 4W7YA 3KHUA 1KQLA 1L9BC 1M70A 5CBOA 1N50A 3VYMA 1N86A 1SQXE 5AVWB 4B86A 4HB1A 1W2LA 2KNCB 2WITA 1JTHA 4UB6H 2QVAA 2XKMA 1W2BO 3A0BV 2D2CD 2BGVX 1LTBC 5AW8B 1VQ9P 3H1JG 1FBMA 1HTLC 3VYIA 5APXA 3HUSA 1YQ3C 5CHXA 3MK7B 3IF4A 1AFOA 3WFDC 3II6A 3RK3C 1SQVD 2LXCB 1NTKG 1L4AD 2GC4D 1H1OA 4D6TE 1RF1A 1IJDB 4N6JA 1FZBA 5AVYB 2KNCA 2E76B 4N0KA 2V08A 1X22A 4FAVA 1PL5A 2ZBOA 2ZXYA 4L73A 2AEFA 1CIEA 1KYOW 1SQXJ 351CA 1MZ9A 4I7ZC 1VPCA 2ZFCA 2R44A 2J5UA 3TDKA 2FYUJ 4MU8A 4EOTA 5GTHH 1MG3D 2C0WA 4XFJA 2DW3A 4KJMA 3H1ID 4YPCA 1HZVA 1GZLA 2K9YA 5E79V 1YJWP 2W90A 1MKMA 1CHJA 4UB8E 1L0NJ 1URQA 1EXIA 1S72P 5DJQB 2AXTH 2YMKA 1KQSO 1YI2P 4H44B 2C9XB 1I8OA 2C1DB 4D6TJ 4L1QA 2BCNB 3H6PA 3LW5J 3KDPB 1SQPD 5AURA 1ZLLA 3RL0g 3A2AA 3V2PA 1NTMG 5AW9B 1X8YA 1L0LK 1RE3C 3PXTA 4AALA 1OVRA 1H32B 1BE3E 2NPSA 1CHIA 1OVUA 3FWLA 3MUDA 3CWBD 1GDVA 1U57A 1YJNP 3MGNA 1LWUB 1KB9I 3L75G 1X9VA 3M06A 3JBTB 4L75A 4P4QB 5DF5A 1JMBA 2C1DA 1S5LV 3WUTA 3QH9A 1NU1K 4EYYQ 3AE5C 4IFMA 1QKSA 3CPWO 4GDOA 3CCVP 2HODB 1CIFA 1UIIA 3OAKA 2YQBA 1GK6A 2I1JA 2CE0A 1H32A 4H13B 3L74G 1FJKA 2J59M 1AOQA 4Y28J 2N18C 4ASVA 1JY2N 1BCCE 3VMXA 3NTNA 1ZXGA 1LWUA 1IO3A 1BE3J 3CCJP 5KLVE 1USDA 1EC5A 1JY2O 1ZP0C 4RSZA 2E75C 2WMMA 1CSXA 1CC5A 2H7HA 2WQYC 4AUWA 1VF5C 1J1DB 3PRJA 4FB1A 2BEZF 1JCDA 1S3JA 2WSSH 2RH0A 1EDIA 4C46A 1NKZB 3VOPA 1E8EA 2QRXA 3AEBC 4ASWA 2AXTE 4PJ0H 4GOFA 2O01N 3BCCJ 1KILA 1FDMA 3KZIV 1Y9BA 1GL2D 3PP5A 5CIBB 1GU5A 2OTJP 2KK7A 5AVSB 1SQVG 1T6AA 4YXWH 1BCCJ 4O9BA 1M60A 1P84H 2YCCA 1C75A 1OIPA 1HRCA 1IK7A 3V2NA 5KLVJ 2JTIB 1KN7A 4K3IA 3L73D 2G8YA 3ZOYA 1QEXA 4U3FE 3P8MC 2WPQA 2K88A 1HROA 1SQQE 1ZR4A 1HJ4A 2W6JH 2WVRA 3P32A 2G3AA 1U74B 1CXCA 5IY51 3B5NB 3RK2D 1KX7A 1KFNA 4DY9A 4C7NA 2GC7D 1I8PA 1WMKA 3QWOC 3H1IG 2XNDH 2XDJA 3CXHI 1M1JC 1SQXD 1RF0A 3ORVA 3RK3B 1Q86Q 3RL0D 1OX3A 1J2JB 2KOGA 2KYVA 3AE3C 2V7QH 1A56A 5BU8B 3HD7C 1HZUA 1SQPG 1FZGA 1DIIC 1L0ND 1N73A 4U3FJ 1Q82Q 1G1IA 2KUBA 3B5NA 4NPEA 4OGQC 4LLHA 1U7MA 3C1LA 4HYTB 3RGUA 1QL2A 3PXWA 1NKNA 1OW7A 2KB7P 3WMM0 1SQQJ 4W7ZA 2WSCH 3WU2H 2CA4B 3OA8B 4D6TD 5AW4B 2KZJA 1CSWA
chains in the Genus database with same CATH topology
3WFBC 1CRCA 3CX5D 3WUIA 2ZZS1 3ZIYA 1DW0A 1F1CA 1QL4A 2B11B 3ZOWA 4Y5RA 1I54A 3RMZA 3RN1A 1FI7A 5B66V 1C52A 4AAMA 1LFMA 3VMAA 2V07A 2Y0DA 3O1YA 4GYDA 1C2RA 4EIEA 1C7MA 4WQCA 4WQ9A 1AYGA 1CYCA 2O3JA 3PLNA 1C6RA 2Y0CA 1RZ5A 1DW1A 2PACA 3A9FA 2EXVA 1KYOD 1RAPA 5CIFB 1OAEA 4FANA 1NTMD 3TF5A 1ZRTD 1LS9A 4EICA 2FWLA 3MK7C 1BGYD 3SJLA 1IZL0 1IRWA 4H0JA 1NU1D 4QAOA 1N15A 4AANA 3GG2A 4AX3A 1OCDA 2C8SA 1YNRA 2KS1A 4WQ8A 1F1FA 1HJ3A 1BE3D 2BCCD 3H1KD 2N9JA 1BL9A 3L75D 3WU2V 1GKSA 1I6DA 5DFSA 1CSVA 1QL3A 2CXBA 1NTZD 1PP9D 2LITA 2Y0EA 3DP5A 2C2CA 2CA3B 2CE1A 3CYTI 3DR0A 1CTZA 2YK3A 5CICB 2PCCB 1GQ1A 3NBSA 1NMIA 2N18B 1I5TA 1HH7A 3HQ8A 1R0QA 3L74D 2JWAA 1H9XA 1A8CA 4AAOA 3HQ6A 3ZBMA 2HV4A 1WEJF 2IBZD 3NWVA 1DVHA 1MZ4A 1N9CA 3L72D 2FYNB 5EXQA 4WQBA 4FA1A 2B10B 2ORLA 4EIDA 1CYJA 5KAIV 1BCCD 2A06D 4IL6V 4O1WA 3KHUA 1QYZA 4V2KA 5CYTR 5KLVD 5TJHA 2D0WA 1L9BC 1M70A 2DVHA 1E29A 1N50A 3VYMA 1LMSA 2C1UA 1KB0A 1W2LA 5CIEB 4L3HA 1YFCA 1I55A 2KNCB 1FI3A 5C0ZA 3CX5W 1DT1A 3A0BV 2BGVX 3NBTA 4J20A 1ETPA 1KB9D 3WC8A 3SVWA 1YEBA 1I6EA 2GIWA 3MK7B 3WFDC 1IQCA 3PXSA 1SQVD 4EDFA 2AI5A 2GC4D 5TISV 2B0ZB 2MHMA 1H1OA 3O20A 5GTIV 3RN0A 4UB8V 1CRHA 5CIGB 1FI9A 1B7VA 1YTCA 4RJTA 1CIGA 3ZOXA 4N0KA 2V08A 1CORA 4FAVA 3SLEA 155CA 2RMZA 2ZBOA 1NIRA 2ZXYA 1U75B 1CIEA 1KYOW 4U3FD 1AOFA 351CA 3L70D 4JCGA 2B4ZA 1HJ5A 4XXLA 3O5CA 1SQQD 3TDKA 1K3HA 4MU8A 1JDLA 1KX2A 4PWAA 1NNOA 1MG3D 1FHBA 3H1ID 4Q5PA 1HZVA 3L4OA 2BLFB 2BH4X 2FRCA 5E79V 1YEAA 1DW3A 1CHJA 4FA9A 2VHDA 5DJQB 3VNWA 2C9XB 2D0SA 2N3BA 4H0KA 1H33B 1H31B 1I8OA 5H2FV 3X39A 4UB6V 1CNOA 4XYDB 2C1DB 1CHHA 4L1QA 1C2NA 2QG4A 1CRJA 2BCNB 4KMGA 1SQPD 2YIUB 5AURA 1VYDA 2ZOOA 3ZCFA 4FA4A 1CRGA 3PTZA 3PXTA 4AALA 1H32B 3GW6A 1RZ6A 4A7PA 1CHIA 3FWLA 3CWBD 2N9IA 1GDVA 3DMIA 1H33A 2JQRA 1H31A 3JBTB 4P4QB 2K9JB 1YICA 2GB8B 3H1LD 5DF5A 2C1DA 1S5LV 3C2CA 2FYUD 4EIFA 1IRVA 1QKSA 1FOCA 2LIRA 2N9YB 1NTKD 1A2SA 2XTSB 1FCDC 1CIFA 1GU2A 2OZ1A 3CXHD 4WQAA 5GTHV 2YQBA 1MG2D 2CE0A 1H32A 3CXHW 1L9JC 1AOQA 2N18C 2AXTV 4FA5A 1P84D 4NFGB 3O0RC 1E2RA 1IO3A 3RLMA 1CTYA 1DIQC 3SWSA 2I8FA 4RSZA 1CSXA 1CC5A 1AKKA 1FJ0A 3PRJA 4FB1A 1CYIA 3ITKA 4LJIA 1DW2A 2QJYB 3L4MA 2Q3EA 1N90A 1YCCA 1M6ZA 1CCHA 1COTA 1E8EA 451CA 1L0LD 1ZZHA 1SQBD 3OA8A 1LC1A 4WQEA 3KZIV 3TGUD 5B5EV 4GEDB 1EZVD 2MTAC 3HQ7A 5CIBB 1KIBA 1CCRA 2QJKB 2RN0A 3WFEC 2ZONG 1M60A 2YCCA 1C75A 5KLIB 1HRCA 2JTIB 4K3IA 3L73D 3PH2B 3VRDA 1GIWA 3ZOYA 2L91A 3CP5A 1WVEC 1S6VB 1CEDA 2DGEA 2PCBB 3M97X 3TYIA 5KAFV 4D6TD 1HROA 1CSUA 1HJ4A 2B12B 1QN2A 4O1QA 5C9MA 1U74B 1CXCA 1CRYA 3CU4A 5IY51 2OZ1B 4WQ7A 1KX7A 3HQ9A 1CRIA 4DY9A 2GC7D 1I8PA 3OCDB 1NMLA 4PD4D 1J3SA 1KV9A 3PHLA 2L4DA 1LC2A 1SQXD 1YIQA 3ORVA 1CXAA 3ZOOA 1HCMA 3H1JD 3L71D 2BPBB 3BCCD 1CO6A 4YE1A 5DJQC 2N3YA 3H1HD 1CTJA 2QJPB 2AIUA 1A56A 3A0HV 1CIHA 1HZUA 1C6OA 1K3GA 5CIHB 1DIIC 1EB7A 1L0ND 4PJ0V 1DVVA 5B6QA 2C1VA 4PW9B 1C6SA 1PPJD 4L3GA 3WFCC 5KKZB 1W5CT 1H9YA 3PXWA 5CIDB 2CA4B 3OCDA 1RAQA 3OA8B 3SXTA 2BH5X 4WQDA 1CSWA 1GJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WFB C;  1CRC A;  3CX5 D;  3WUI A;  2ZZS 1;  3ZIY A;  1DW0 A;  1F1C A;  1QL4 A;  2B11 B;  3ZOW A;  4Y5R A;  1I54 A;  3RMZ A;  3RN1 A;  1FI7 A;  5B66 V;  1C52 A;  4AAM A;  1LFM A;  3VMA A;  2V07 A;  2Y0D A;  3O1Y A;  4GYD A;  1C2R A;  4EIE A;  1C7M A;  4WQC A;  4WQ9 A;  1AYG A;  1CYC A;  2O3J A;  3PLN A;  1C6R A;  2Y0C A;  1RZ5 A;  1DW1 A;  2PAC A;  3A9F A;  2EXV A;  1KYO D;  1RAP A;  5CIF B;  1OAE A;  4FAN A;  1NTM D;  3TF5 A;  1ZRT D;  1LS9 A;  4EIC A;  2FWL A;  3MK7 C;  1BGY D;  3SJL A;  1IZL 0;  1IRW A;  4H0J A;  1NU1 D;  4QAO A;  1N15 A;  4AAN A;  3GG2 A;  4AX3 A;  1OCD A;  2C8S A;  1YNR A;  2KS1 A;  4WQ8 A;  1F1F A;  1HJ3 A;  1BE3 D;  2BCC D;  3H1K D;  2N9J A;  1BL9 A;  3L75 D;  3WU2 V;  1GKS A;  1I6D A;  5DFS A;  1CSV A;  1QL3 A;  2CXB A;  1NTZ D;  1PP9 D;  2LIT A;  2Y0E A;  3DP5 A;  2C2C A;  2CA3 B;  2CE1 A;  3CYT I;  3DR0 A;  1CTZ A;  2YK3 A;  5CIC B;  2PCC B;  1GQ1 A;  3NBS A;  1NMI A;  2N18 B;  1I5T A;  1HH7 A;  3HQ8 A;  1R0Q A;  3L74 D;  2JWA A;  1H9X A;  1A8C A;  4AAO A;  3HQ6 A;  3ZBM A;  2HV4 A;  1WEJ F;  2IBZ D;  3NWV A;  1DVH A;  1MZ4 A;  1N9C A;  3L72 D;  2FYN B;  5EXQ A;  4WQB A;  4FA1 A;  2B10 B;  2ORL A;  4EID A;  1CYJ A;  5KAI V;  1BCC D;  2A06 D;  4IL6 V;  4O1W A;  3KHU A;  1QYZ A;  4V2K A;  5CYT R;  5KLV D;  5TJH A;  2D0W A;  1L9B C;  1M70 A;  2DVH A;  1E29 A;  1N50 A;  3VYM A;  1LMS A;  2C1U A;  1KB0 A;  1W2L A;  5CIE B;  4L3H A;  1YFC A;  1I55 A;  2KNC B;  1FI3 A;  5C0Z A;  3CX5 W;  1DT1 A;  3A0B V;  2BGV X;  3NBT A;  4J20 A;  1ETP A;  1KB9 D;  3WC8 A;  3SVW A;  1YEB A;  1I6E A;  2GIW A;  3MK7 B;  3WFD C;  1IQC A;  3PXS A;  1SQV D;  4EDF A;  2AI5 A;  2GC4 D;  5TIS V;  2B0Z B;  2MHM A;  1H1O A;  3O20 A;  5GTI V;  3RN0 A;  4UB8 V;  1CRH A;  5CIG B;  1FI9 A;  1B7V A;  1YTC A;  4RJT A;  1CIG A;  3ZOX A;  4N0K A;  2V08 A;  1COR A;  4FAV A;  3SLE A;  155C A;  2RMZ A;  2ZBO A;  1NIR A;  2ZXY A;  1U75 B;  1CIE A;  1KYO W;  4U3F D;  1AOF A;  351C A;  3L70 D;  4JCG A;  2B4Z A;  1HJ5 A;  4XXL A;  3O5C A;  1SQQ D;  3TDK A;  1K3H A;  4MU8 A;  1JDL A;  1KX2 A;  4PWA A;  1NNO A;  1MG3 D;  1FHB A;  3H1I D;  4Q5P A;  1HZV A;  3L4O A;  2BLF B;  2BH4 X;  2FRC A;  5E79 V;  1YEA A;  1DW3 A;  1CHJ A;  4FA9 A;  2VHD A;  5DJQ B;  3VNW A;  2C9X B;  2D0S A;  2N3B A;  4H0K A;  1H33 B;  1H31 B;  1I8O A;  5H2F V;  3X39 A;  4UB6 V;  1CNO A;  4XYD B;  2C1D B;  1CHH A;  4L1Q A;  1C2N A;  2QG4 A;  1CRJ A;  2BCN B;  4KMG A;  1SQP D;  2YIU B;  5AUR A;  1VYD A;  2ZOO A;  3ZCF A;  4FA4 A;  1CRG A;  3PTZ A;  3PXT A;  4AAL A;  1H32 B;  3GW6 A;  1RZ6 A;  4A7P A;  1CHI A;  3FWL A;  3CWB D;  2N9I A;  1GDV A;  3DMI A;  1H33 A;  2JQR A;  1H31 A;  3JBT B;  4P4Q B;  2K9J B;  1YIC A;  2GB8 B;  3H1L D;  5DF5 A;  2C1D A;  1S5L V;  3C2C A;  2FYU D;  4EIF A;  1IRV A;  1QKS A;  1FOC A;  2LIR A;  2N9Y B;  1NTK D;  1A2S A;  2XTS B;  1FCD C;  1CIF A;  1GU2 A;  2OZ1 A;  3CXH D;  4WQA A;  5GTH V;  2YQB A;  1MG2 D;  2CE0 A;  1H32 A;  3CXH W;  1L9J C;  1AOQ A;  2N18 C;  2AXT V;  4FA5 A;  1P84 D;  4NFG B;  3O0R C;  1E2R A;  1IO3 A;  3RLM A;  1CTY A;  1DIQ C;  3SWS A;  2I8F A;  4RSZ A;  1CSX A;  1CC5 A;  1AKK A;  1FJ0 A;  3PRJ A;  4FB1 A;  1CYI A;  3ITK A;  4LJI A;  1DW2 A;  2QJY B;  3L4M A;  2Q3E A;  1N90 A;  1YCC A;  1M6Z A;  1CCH A;  1COT A;  1E8E A;  451C A;  1L0L D;  1ZZH A;  1SQB D;  3OA8 A;  1LC1 A;  4WQE A;  3KZI V;  3TGU D;  5B5E V;  4GED B;  1EZV D;  2MTA C;  3HQ7 A;  5CIB B;  1KIB A;  1CCR A;  2QJK B;  2RN0 A;  3WFE C;  2ZON G;  1M60 A;  2YCC A;  1C75 A;  5KLI B;  1HRC A;  2JTI B;  4K3I A;  3L73 D;  3PH2 B;  3VRD A;  1GIW A;  3ZOY A;  2L91 A;  3CP5 A;  1WVE C;  1S6V B;  1CED A;  2DGE A;  2PCB B;  3M97 X;  3TYI A;  5KAF V;  4D6T D;  1HRO A;  1CSU A;  1HJ4 A;  2B12 B;  1QN2 A;  4O1Q A;  5C9M A;  1U74 B;  1CXC A;  1CRY A;  3CU4 A;  5IY5 1;  2OZ1 B;  4WQ7 A;  1KX7 A;  3HQ9 A;  1CRI A;  4DY9 A;  2GC7 D;  1I8P A;  3OCD B;  1NML A;  4PD4 D;  1J3S A;  1KV9 A;  3PHL A;  2L4D A;  1LC2 A;  1SQX D;  1YIQ A;  3ORV A;  1CXA A;  3ZOO A;  1HCM A;  3H1J D;  3L71 D;  2BPB B;  3BCC D;  1CO6 A;  4YE1 A;  5DJQ C;  2N3Y A;  3H1H D;  1CTJ A;  2QJP B;  2AIU A;  1A56 A;  3A0H V;  1CIH A;  1HZU A;  1C6O A;  1K3G A;  5CIH B;  1DII C;  1EB7 A;  1L0N D;  4PJ0 V;  1DVV A;  5B6Q A;  2C1V A;  4PW9 B;  1C6S A;  1PPJ D;  4L3G A;  3WFC C;  5KKZ B;  1W5C T;  1H9Y A;  3PXW A;  5CID B;  2CA4 B;  3OCD A;  1RAQ A;  3OA8 B;  3SXT A;  2BH5 X;  4WQD A;  1CSW A;  1GJQ A; 
#chains in the Genus database with same CATH topology
 2IBZ G;  2LXB A;  3JCU E;  2AXC A;  2IPP A;  4HJG H;  1DW0 A;  1QL4 A;  3AE8 C;  2IFN A;  2H89 C;  2A06 G;  4IFF A;  3VP9 A;  3HUS C;  2R3S A;  5CCG D;  2E74 B;  1NTZ J;  1CSB A;  3HE4 A;  1R5S A;  4PJ0 E;  1LGH B;  1C52 A;  1YTZ T;  3VMA A;  1T3J A;  1SFC B;  2PAJ A;  3CMA P;  1RF1 C;  4GYD A;  3NMD A;  4EIE A;  5DJU B;  1P84 E;  3CLQ A;  2O3J A;  5KJ7 A;  3PLN A;  1C6R A;  2IX7 C;  4OWF A;  3V5B A;  2Y0C A;  1RZ5 A;  3W67 A;  3A9F A;  2EXV A;  4FAN A;  2FWL A;  3L35 A;  2WSF H;  1T8Z A;  3MHV A;  3MK7 C;  3SJL A;  2Q1K A;  1NAY A;  1JY2 P;  3GHG A;  4IOI H;  4H0J A;  4PD4 I;  2GA1 A;  2PFX A;  2FKW B;  1YNR A;  4WQ8 A;  1URQ C;  4K3A A;  3Q5R A;  1L0L E;  1SFC A;  2IFM A;  2ZXX A;  1BE3 D;  4OGQ D;  2WSE H;  1PGO A;  2N9J A;  3TSI A;  1JMM A;  1CSV A;  2E76 C;  2PGD A;  1EDL A;  3TGU E;  1EZV E;  2P1J A;  3AE1 C;  2OQQ A;  5TIS H;  1HUC A;  3DP5 A;  1S4X A;  1MFZ A;  2C2C A;  2CA3 B;  3KYQ A;  2CE1 A;  3DR0 A;  2I1K A;  1GQ1 A;  4ZMD A;  2N18 B;  1HH7 A;  1IFN A;  1R0Q A;  1JM0 A;  2Q5U A;  2NPS C;  2JWA A;  1H9X A;  1A8C A;  4AAO A;  3EWK A;  2I8D A;  3MUD C;  1WEJ F;  3EFF K;  2JDI H;  3NWV A;  1DVH A;  1D7M A;  1N9C A;  3E1R A;  4H44 C;  4WQB A;  4EID A;  1M90 Q;  1BCC D;  4IL6 V;  3RK3 E;  4V2K A;  1EDJ A;  5AVT B;  3BRV B;  5KLV D;  2Z5H A;  1KFM A;  5CMZ A;  2DVH A;  4GOE A;  4W80 A;  1E29 A;  2VRS A;  3TGU J;  5H2F H;  5CIE B;  3CX5 W;  1SQX G;  1TU3 F;  4I1L A;  3NBT A;  1HF9 A;  1ETP A;  3GF3 A;  3M0D A;  3WC8 A;  1KYO I;  1IFD A;  1YEB A;  2FYU G;  2M5A A;  1I6E A;  1LWU C;  3D6Y A;  2GIW A;  4IFD K;  3PXS A;  1AVO A;  4BWN A;  1FZA A;  2AI5 A;  1L0N G;  1YHQ P;  2LR2 A;  2B0Z B;  2QJP C;  4IL6 X;  4UB8 V;  4K35 A;  1Y47 A;  4IL6 H;  2ZT9 B;  1HBW A;  1USE A;  4D6T G;  4KT0 J;  2NZ2 A;  4M3L A;  5KKZ C;  155C A;  2C9L Y;  4C7R A;  1Z56 A;  2PRR A;  1U75 B;  1UIX A;  4U3F D;  1AOF A;  1NTK K;  2MJZ A;  2QM7 A;  1KIL C;  2B4Z A;  1HJ5 A;  3AE7 C;  1DD4 A;  4DOJ A;  3O5C A;  1SQQ D;  2Y9Y A;  1M1J B;  2N1T A;  1DX7 A;  3C9I A;  1K3H A;  4PWA A;  1HH0 A;  4I2L C;  1NNO A;  1M7L A;  1FHB A;  5TIS E;  3L4O A;  3TK1 A;  2BH4 X;  1KB9 H;  2FRC A;  3V4W A;  4N78 E;  2H43 A;  4FA9 A;  2VHD A;  4JYC A;  2D0S A;  2N3B A;  2E43 A;  3HD7 B;  1H31 B;  2RKL A;  4UB6 V;  1CNO A;  1ZRT E;  2QG4 A;  3FGA D;  2O1J A;  2P58 A;  2WSF J;  1FDO A;  3OJA B;  1NGM B;  3FXE A;  1W2E A;  3ZCF A;  3M9Q A;  1T2K C;  1FZE A;  1RE4 A;  3V2Q A;  1SLQ A;  1LTI C;  2AEM A;  2WPR A;  2BCC E;  2WSE J;  2Q9I A;  3GW6 A;  1RZ6 A;  1EXJ A;  1KV4 A;  1RF0 C;  3EFG A;  3DMI A;  1HJ0 A;  1BE3 G;  2W6A A;  1NTM K;  1PGJ A;  1H31 A;  1ZME C;  3NFQ A;  1PP9 E;  3KQG A;  2OAR A;  1FJP A;  5M1B A;  3C2C A;  1RF1 B;  1NAF A;  3AE6 C;  1PFI A;  1IRV A;  2QA4 P;  1FOC A;  2LIR A;  4H13 D;  1N73 C;  1VQN P;  3B5N C;  3V2R A;  1N7S D;  2OZ1 A;  4I6M C;  5APQ A;  5BU5 A;  4WQA A;  5GTH V;  4N3Y B;  3L73 J;  3BCC G;  1Q90 D;  2QM8 A;  3VTP C;  2E5T A;  2AXT V;  1YQ4 C;  1NYH A;  4FA5 A;  4IL6 E;  1P84 D;  4NFG B;  5AW2 B;  2BCC J;  1K04 A;  3SWS A;  3WUU A;  1BCC G;  1URQ B;  3VMY A;  2JKV A;  1CZQ A;  2H8P D;  5KLV G;  2FFD B;  1AKK A;  1PP9 J;  4LGD E;  3SFE C;  3ITK A;  1DW2 A;  3L4M A;  2Q3E A;  1VQL P;  1X0T A;  2GM4 A;  1J1E B;  2OYO A;  1COT A;  1KB9 E;  2AEJ A;  3D6Z A;  3Q3D A;  451C A;  1L0L D;  3A0H H;  1M57 D;  5KJ7 C;  5AVV B;  1ZZH A;  3VP8 A;  1VL2 A;  1VQO P;  5C39 A;  3CXH H;  5L8R J;  3TGU D;  3MTU E;  1EZV D;  1JB0 J;  4QMA A;  1SP4 A;  2NPS B;  2E74 C;  3GMA A;  2ZON G;  3GHG C;  2FFD A;  3A5T A;  3S4R A;  3W68 A;  1GIW A;  1SFC C;  1FZC B;  1GTW A;  1S6V B;  3TYI A;  5KAF V;  3JSV C;  1K9M Q;  1SVF A;  4U7J A;  5B66 H;  2FXP A;  1CSU A;  4U3F G;  1QN2 A;  4O1Q A;  2HR3 A;  1CRY A;  3CU4 A;  2ITA A;  1BGY G;  1YBK A;  1VQK P;  1SQQ G;  3HQ9 A;  3RK3 D;  3PHL A;  3K5B A;  3TNU B;  1LC2 A;  1ZN5 A;  3H1K G;  5APT A;  4UB6 E;  3O6Q A;  1CXA A;  2A45 G;  3V4Q A;  2B87 A;  1FZC A;  1NTZ G;  4YE1 A;  1LJ2 A;  1CTJ A;  2QJP B;  2AIU A;  2WPV B;  2KIK A;  1OVV A;  1QX8 A;  1DVV A;  4PJ0 V;  1M56 D;  2C1V A;  3H32 B;  1NVO A;  4JYB A;  5AW0 B;  5KAF H;  1H88 A;  5KKZ B;  2OYI A;  1H9Y A;  1BSN A;  1PIX A;  1QGK B;  2BH5 X;  5BVZ A;  3TNU A;  4KMG A;  3WFB C;  1KIL B;  1CRC A;  2ZZS 1;  3ZIY A;  3FXD A;  2WZ7 A;  1LTG C;  4BXL A;  3RBZ A;  2ZVN B;  1F1C A;  2B11 B;  4R4L A;  4PD4 H;  1WT6 A;  2M8R A;  3M0D C;  1I54 A;  1FU1 A;  3A0H E;  2C9N Y;  3BAS A;  3RN1 A;  3L4F A;  3A7O A;  1NTK E;  1IFJ A;  1NJI Q;  2N9B A;  4AAM A;  3CXH E;  5GTH E;  1R8E A;  3H32 A;  5CJ4 A;  3RBX A;  1C2R A;  1C7M A;  4N78 D;  1LTS C;  2OGU A;  1HVV A;  1IZN B;  4WQ9 A;  1ZR2 A;  2W8Z A;  1CYC A;  3FX0 A;  3CCU P;  2W83 C;  2ZYA A;  1L4A B;  3AE2 C;  4C7N B;  1M1K Q;  4LC1 A;  1RAP A;  5CIF B;  3TF5 A;  1ZRT D;  4HH2 A;  4GIF A;  2N1T C;  5B66 E;  1IRW A;  1OMI A;  2ZAE B;  3B8E B;  4YXD C;  1JCC A;  1N15 A;  1OCD A;  1RHZ B;  1F1F A;  2R5D A;  2BCC D;  1NTK J;  1GD2 E;  1SQB E;  1BL9 A;  3WU2 V;  2ZT9 C;  2IZ1 A;  1N73 B;  2C0X A;  1R5L A;  4R4M A;  1L4A A;  1PP9 D;  5APS A;  2Y0E A;  4NPF X;  4PV1 C;  1NH4 A;  3TGU G;  1E79 H;  1EZV G;  3CYT I;  1HWT C;  2YK3 A;  3FWN A;  1RE4 C;  3AE4 C;  1T3U A;  2E75 D;  3HQ8 A;  3HE5 B;  1KYO H;  1VF5 D;  3M9B A;  1JY3 N;  1AVY A;  2JWD A;  3CX5 I;  4EI2 A;  2WTY A;  5KAF E;  2OTL P;  2HV4 A;  1MZ4 A;  3HE4 B;  2FYN B;  5EXQ A;  1CYJ A;  1EQ7 A;  1VQP P;  4O1W A;  2BEQ D;  1QYZ A;  4PD4 E;  1SQB J;  2D0W A;  4NPD A;  2C1U A;  1S1C X;  1KB0 A;  1YYC A;  1YFC A;  3BVH A;  3CWB G;  5C0Z A;  3L71 E;  2K1A A;  1MV8 A;  3HE5 A;  5AW1 B;  4J20 A;  2IDB A;  3H1H E;  3P8C E;  2FXO A;  1KB9 D;  3SVW A;  2KSE A;  3F89 A;  3GHG B;  4KHX A;  3CCE P;  1KIL E;  1LTT C;  1PPJ E;  3O8Z A;  2ZVO B;  4EDF A;  4WWI A;  5TIS V;  1SQX K;  2KLU A;  1GDT A;  2MHM A;  3O20 A;  1QL1 A;  1BSH A;  2ZJS E;  4ZKU A;  1FI9 A;  1B7V A;  4RJT A;  1BDC A;  2FYU K;  2IYO A;  2SPZ A;  3H25 A;  3SLE A;  3TYY A;  2A45 I;  1RQU A;  1L0N K;  3G6E P;  4JCG A;  3L71 J;  1JNM A;  1VQ6 P;  1KX2 A;  3HD7 D;  5CJ0 A;  3H1H J;  3G9R A;  4H0L B;  1IK9 A;  4RKU J;  1YEA A;  1CW5 A;  1DW3 A;  2FFD C;  2OYH B;  3KPE A;  3LIE A;  2BAS A;  5H2F V;  2MKV A;  3X39 A;  1GL2 B;  2CPB A;  3IR9 A;  1KYO E;  1J1E C;  1MUU A;  3N7N A;  4WBA A;  1CHH A;  1C2N A;  5AW6 B;  4L76 A;  2FYZ A;  3BRT B;  2W27 A;  4HKZ H;  1VYD A;  1NU1 E;  4FA4 A;  1CRG A;  4WB4 A;  3PTZ A;  3CCL P;  3L73 G;  2WT7 B;  4A7P A;  4CPG A;  3ABV C;  3WU2 E;  2M5A B;  3AEC C;  2OYH A;  3M0A A;  2XU6 A;  2JP3 A;  4WVZ A;  1FAV A;  3OA7 A;  2BCC G;  1YIJ P;  2JQR A;  3VMZ A;  1KOR A;  1FZC C;  1L0L J;  1GL2 A;  1OW8 A;  1YIC A;  1PP9 G;  4BRY B;  1QVF O;  2LKM A;  2O01 H;  3PH0 A;  2FXM A;  1NTK D;  1A2S A;  1FCD C;  3RL0 B;  3MD0 A;  1AV1 A;  2OYI C;  2K37 A;  1DEE G;  3CXH D;  2HPC A;  2HLO A;  2IBZ E;  2V7Q J;  3L72 E;  2WT7 A;  3CXH W;  1NU1 J;  1VQM P;  1URQ D;  1EDK A;  1LTJ B;  2N1T B;  5AVX B;  1DD3 A;  4DZO A;  5AW3 B;  2A06 E;  2QIW A;  3SWF A;  1E2R A;  1JY3 P;  2E76 D;  3OW2 O;  2WSC J;  1HJB A;  3SWK A;  2HFE D;  1Q81 Q;  1FJ0 A;  4BRY A;  1QLE D;  4RO0 A;  4LJI A;  2QJY B;  1N90 A;  1S9K E;  1CCH A;  3IFM A;  3AEE C;  4PV1 B;  1KTM A;  3AE9 C;  1IFP A;  3CC4 P;  2NPS D;  3C8V A;  1SQB D;  3U59 A;  2YXQ B;  1XTC C;  5KLV K;  1LTJ A;  2FY8 A;  1FE6 A;  4H44 D;  5B5E V;  2MTA C;  3L72 J;  3HQ7 A;  1AQ5 A;  1CCR A;  4GT1 A;  2RN0 A;  3N4X A;  3WFE C;  2XNX A;  2K3R A;  3LW5 H;  3CME P;  2D2C C;  2IBZ I;  3PH2 B;  3VRD A;  3CP5 A;  1KMI Z;  1Q7Y Q;  2KI7 B;  3UIA A;  3L70 E;  5AVZ B;  1Q2N A;  2HG5 D;  2PCB B;  3HTK B;  5CCG A;  3M97 X;  3A3Y B;  3L37 A;  1L4A C;  2OZ1 B;  4WQ7 A;  1M8O B;  3OCD B;  4PD4 D;  1J3S A;  2L4D A;  5H2F E;  2JR8 A;  5B5E H;  4OVN F;  3ZOO A;  1HCM A;  1OWA A;  3L71 D;  2YO3 A;  1SQQ K;  2UWJ E;  3HTK A;  2N3Y A;  3H1H D;  3P8C D;  4AYC A;  3A0H V;  3USS A;  1EB7 A;  3LID A;  1KIL D;  1C6S A;  3L70 J;  1PPJ D;  4L3G A;  1FOS F;  2YIU C;  3OCD A;  1NTZ K;  1RAQ A;  1GJQ A;  1DIP A;  2J58 A;  3S9O A;  1LTA C;  2YMY A;  3H1L E;  4Y5R A;  2FYU E;  2ZXE B;  4AQR D;  1PV3 A;  2FYN C;  2O01 J;  3S1K A;  3Q2Y A;  1FI7 A;  5B66 V;  1L0N E;  1K73 Q;  1LFM A;  1T2K D;  2V07 A;  1KQF B;  1FZF A;  1KZU B;  1PGQ A;  4JF7 A;  4WQC A;  1QVG O;  3G4S P;  4YTP C;  2NRG A;  1Y8A A;  1DW1 A;  2PAC A;  1KYO D;  1OAE A;  3AEG C;  1LS9 A;  1OZH A;  3SWY A;  3CX5 H;  1LP1 B;  3L36 A;  3O6Q B;  3H1L J;  1NU1 D;  4EIJ A;  3A0B H;  5APY A;  2CPS A;  4AAN A;  3GG2 A;  2B87 B;  5CCH A;  3B5N D;  2CK3 H;  3G71 P;  1HJ3 A;  1NO4 A;  1S2E A;  1SQV K;  1FOS E;  5AW7 B;  2YKO A;  5B5E E;  2CXB A;  1SQB G;  2WWW A;  4MN4 C;  2LIT A;  2OYI B;  5DJT B;  1VQ7 P;  1H89 A;  1CTZ A;  2Q3I A;  3WUV A;  2QE7 H;  1LP1 A;  5APV A;  3NBS A;  1WRG A;  1LT9 B;  3CCS P;  1RY3 A;  3P7K A;  5APU A;  4ZNC A;  4H0L C;  3Q5P A;  3VN0 A;  2P7J A;  2QJK C;  3HQ6 A;  2OYH C;  2P67 A;  4Z1M H;  3CC2 P;  2IBZ D;  5AVU B;  3L72 D;  3D70 A;  4FA1 A;  2B10 B;  2JO1 A;  5KLI C;  1GL2 C;  5KAI V;  5KJ7 D;  2A06 D;  5E79 H;  3I55 P;  5CYT R;  1N2D C;  3CD6 P;  1PGP A;  5TJH A;  3AED C;  4WY4 B;  2A45 H;  1LMS A;  3F5H A;  3MIW A;  3D71 A;  4L3H A;  2E74 D;  1I55 A;  3HRN A;  2H88 C;  1FI3 A;  3H1J E;  1LT9 A;  1SQP K;  2B88 A;  3ZDM A;  1DT1 A;  3BCC E;  1G2C B;  1S9K D;  4XE5 B;  1SFC D;  3L71 G;  3SXT A;  1XTG B;  1VQ5 P;  3RK2 C;  2W6B A;  1N7S B;  3H1H G;  1IQC A;  2D2C B;  4L74 A;  4WY4 A;  1PPJ G;  4OH8 B;  5GTI V;  4TLF A;  1DH3 A;  1NWQ A;  3RN0 A;  4DT0 A;  3CX5 E;  1CRH A;  5KAI H;  5CIG B;  2HYN A;  1YTC A;  3IAO A;  1CIG A;  1S5L X;  3RL0 C;  1IFM A;  3JCU H;  3ZOX A;  3M9H A;  3A0B E;  3D0W A;  1COR A;  1S5L H;  2WPS A;  2HOD A;  2RMZ A;  1NIR A;  1G2C A;  4H0L D;  4JQ0 D;  3L70 D;  1LTJ C;  3H1J J;  1VQ8 P;  4XXL A;  1N7S A;  1FDI A;  1GMJ A;  1JDL A;  3GLM A;  1X79 B;  4Q5P A;  1JEK A;  1YTZ I;  2BLF B;  2Z5I A;  3VNW A;  4DCK A;  1GU4 A;  1L0L G;  4H0K A;  1H33 B;  3R2P A;  3BAT A;  2QJY C;  2E42 A;  1GW3 A;  4XYD B;  1NTM E;  2B89 A;  5CCG C;  1CRJ A;  5GTI H;  1IC2 A;  1IFI A;  1AJY A;  2YIU B;  1BGY E;  5AVR B;  1OXZ A;  2L5G B;  5AVQ B;  2ZOO A;  1W5C E;  1GW4 A;  3SFD C;  1KQG B;  1E5W A;  1A02 F;  5E79 E;  1NU1 G;  1HGZ A;  3H1K E;  1JY3 O;  2GUS A;  3L75 E;  1OFC X;  2N9I A;  2E5Y A;  3KZI H;  2M3B A;  1H33 A;  1NTZ E;  5KTB A;  2K9J B;  1K05 A;  2GB8 B;  1CI6 B;  3H1L D;  1JUN A;  4Y99 C;  1PZQ A;  2FYU D;  4EIF A;  1H0T B;  2N9Y B;  1NTM J;  2XTS B;  2N1T D;  3L74 E;  1BDD A;  4XA4 A;  3B4S A;  1GU2 A;  2GUV A;  2IZ0 A;  3CCM P;  1MG2 D;  1BGY J;  1L9J C;  1FS0 E;  4I7Z B;  5KAI E;  2Q7C A;  3L72 G;  3O0R C;  3RLM A;  1CTY A;  2ZT9 D;  3H1K J;  1DIQ C;  1S5L E;  2K9J A;  2I8F A;  3L75 J;  1CI6 A;  1JOC A;  2JEE A;  5CBN A;  2Q6Q A;  3KXD A;  1H0T A;  4PV1 D;  4DJG A;  1L2P A;  1CYI A;  3Q5S A;  1OW6 A;  1YCC A;  1M6Z A;  5K5G B;  2KP8 A;  3Q1M A;  3CI9 A;  1ZV8 A;  1MFT A;  3OA8 A;  3L74 J;  5AW5 B;  4TT3 H;  1LC1 A;  4WQE A;  1SQV E;  1RQV A;  4GED B;  1KIB A;  5GTI E;  2QJK B;  2R5B A;  5KLI B;  5CCH C;  3MP7 B;  2YKQ A;  1ZW0 A;  2L91 A;  1WVE C;  1ZOY C;  1CED A;  3AEF C;  2DGE A;  2JJL A;  2Z4E A;  2P10 A;  3L70 G;  2B12 B;  3KZI E;  5C9M A;  3H1I E;  2HPC B;  1A02 J;  1CRI A;  1RE3 A;  1NML A;  1KV9 A;  5APW A;  1SQV J;  1YIQ A;  3RK2 B;  1YIT P;  1K8A Q;  3H1J D;  3I5C A;  2BPB B;  3GF7 A;  2PP6 A;  3BCC D;  1SQP E;  1P84 I;  2KXP B;  1CO6 A;  1LT1 A;  5DJQ C;  3CCR P;  2E75 B;  4GOD A;  1FC2 C;  1YJ9 P;  1LNQ A;  2V4H A;  2XZR A;  1CIH A;  1VF5 B;  1C6O A;  1K3G A;  5CIH B;  2YNY A;  4GKG A;  1VQ4 P;  5B6Q A;  4PW9 B;  3U1A A;  3WFC C;  2QSI A;  1W5C T;  1HGV A;  5CID B;  1JO5 A;  3CWB E;  3G3Z A;  4WQD A;  1LT9 C;  3CX5 D;  3WUI A;  3H1I J;  2QEX P;  2ZYD A;  1IO4 A;  1N8R Q;  2YXR B;  3AEA C;  3ZOW A;  3JC2 2;  5CCH D;  3SSU A;  3MZW B;  3U1C A;  4JPZ B;  3RMZ A;  3H1L G;  1EZV I;  3NXS A;  1U7J A;  3EQ2 A;  1SQP J;  2KS1 B;  2YKP A;  4WY4 C;  3E7K A;  2Y0D A;  3O1Y A;  3V6I A;  3CCQ P;  1AQT A;  2FBW C;  1AA0 A;  3B71 A;  4RES B;  1AYG A;  2XV5 A;  3IN6 A;  3CL3 D;  4ZKP A;  1KC8 Q;  2O1K A;  3CWB J;  1NTM D;  4H13 C;  4EIC A;  2KZI A;  1SS1 A;  1BGY D;  1N7S C;  1KD1 Q;  3T97 B;  1IZL 0;  4QAO A;  4AX3 A;  1N7L A;  2C8S A;  3M91 A;  3R4Y A;  2KS1 A;  2M0B A;  4Y99 B;  3H1K D;  1J1D C;  3L75 D;  1VDF A;  1GKS A;  1I6D A;  5DFS A;  2R3C A;  1QL3 A;  1NTZ D;  1RH5 B;  2OTK E;  3I56 P;  1GK4 A;  2P2U A;  4OGQ B;  2ZYG A;  4UB8 H;  1DEB A;  5CIC B;  2PCC B;  2YO2 A;  1JTH B;  1NMI A;  2IYP A;  3L73 E;  1I5T A;  3T97 A;  2KSJ A;  1M1J A;  4JBZ A;  5EFW B;  2B9B A;  1NHL A;  1H8A A;  3L74 D;  1SQB K;  2Y9Z A;  3ZBM A;  2POH A;  1NOH A;  3CC7 P;  4WY4 D;  2R32 A;  3HUS B;  2ORL A;  3PJS K;  2M3E A;  1G1J A;  3E1I A;  2KLV A;  3HD7 A;  4W7Y A;  3KHU A;  1KQL A;  1L9B C;  1M70 A;  5CBO A;  1N50 A;  3VYM A;  1N86 A;  1SQX E;  5AVW B;  4B86 A;  4HB1 A;  1W2L A;  2KNC B;  2WIT A;  1JTH A;  4UB6 H;  2QVA A;  2XKM A;  1W2B O;  3A0B V;  2D2C D;  2BGV X;  1LTB C;  5AW8 B;  1VQ9 P;  3H1J G;  1FBM A;  1HTL C;  3VYI A;  5APX A;  3HUS A;  1YQ3 C;  5CHX A;  3MK7 B;  3IF4 A;  1AFO A;  3WFD C;  3II6 A;  3RK3 C;  1SQV D;  2LXC B;  1NTK G;  1L4A D;  2GC4 D;  1H1O A;  4D6T E;  1RF1 A;  1IJD B;  4N6J A;  1FZB A;  5AVY B;  2KNC A;  2E76 B;  4N0K A;  2V08 A;  1X22 A;  4FAV A;  1PL5 A;  2ZBO A;  2ZXY A;  4L73 A;  2AEF A;  1CIE A;  1KYO W;  1SQX J;  351C A;  1MZ9 A;  4I7Z C;  1VPC A;  2ZFC A;  2R44 A;  2J5U A;  3TDK A;  2FYU J;  4MU8 A;  4EOT A;  5GTH H;  1MG3 D;  2C0W A;  4XFJ A;  2DW3 A;  4KJM A;  3H1I D;  4YPC A;  1HZV A;  1GZL A;  2K9Y A;  5E79 V;  1YJW P;  2W90 A;  1MKM A;  1CHJ A;  4UB8 E;  1L0N J;  1URQ A;  1EXI A;  1S72 P;  5DJQ B;  2AXT H;  2YMK A;  1KQS O;  1YI2 P;  4H44 B;  2C9X B;  1I8O A;  2C1D B;  4D6T J;  4L1Q A;  2BCN B;  3H6P A;  3LW5 J;  3KDP B;  1SQP D;  5AUR A;  1ZLL A;  3RL0 g;  3A2A A;  3V2P A;  1NTM G;  5AW9 B;  1X8Y A;  1L0L K;  1RE3 C;  3PXT A;  4AAL A;  1OVR A;  1H32 B;  1BE3 E;  2NPS A;  1CHI A;  1OVU A;  3FWL A;  3MUD A;  3CWB D;  1GDV A;  1U57 A;  1YJN P;  3MGN A;  1LWU B;  1KB9 I;  3L75 G;  1X9V A;  3M06 A;  3JBT B;  4L75 A;  4P4Q B;  5DF5 A;  1JMB A;  2C1D A;  1S5L V;  3WUT A;  3QH9 A;  1NU1 K;  4EYY Q;  3AE5 C;  4IFM A;  1QKS A;  3CPW O;  4GDO A;  3CCV P;  2HOD B;  1CIF A;  1UII A;  3OAK A;  2YQB A;  1GK6 A;  2I1J A;  2CE0 A;  1H32 A;  4H13 B;  3L74 G;  1FJK A;  2J59 M;  1AOQ A;  4Y28 J;  2N18 C;  4ASV A;  1JY2 N;  1BCC E;  3VMX A;  3NTN A;  1ZXG A;  1LWU A;  1IO3 A;  1BE3 J;  3CCJ P;  5KLV E;  1USD A;  1EC5 A;  1JY2 O;  1ZP0 C;  4RSZ A;  2E75 C;  2WMM A;  1CSX A;  1CC5 A;  2H7H A;  2WQY C;  4AUW A;  1VF5 C;  1J1D B;  3PRJ A;  4FB1 A;  2BEZ F;  1JCD A;  1S3J A;  2WSS H;  2RH0 A;  1EDI A;  4C46 A;  1NKZ B;  3VOP A;  1E8E A;  2QRX A;  3AEB C;  4ASW A;  2AXT E;  4PJ0 H;  4GOF A;  2O01 N;  3BCC J;  1KIL A;  1FDM A;  3KZI V;  1Y9B A;  1GL2 D;  3PP5 A;  5CIB B;  1GU5 A;  2OTJ P;  2KK7 A;  5AVS B;  1SQV G;  1T6A A;  4YXW H;  1BCC J;  4O9B A;  1M60 A;  1P84 H;  2YCC A;  1C75 A;  1OIP A;  1HRC A;  1IK7 A;  3V2N A;  5KLV J;  2JTI B;  1KN7 A;  4K3I A;  3L73 D;  2G8Y A;  3ZOY A;  1QEX A;  4U3F E;  3P8M C;  2WPQ A;  2K88 A;  1HRO A;  1SQQ E;  1ZR4 A;  1HJ4 A;  2W6J H;  2WVR A;  3P32 A;  2G3A A;  1U74 B;  1CXC A;  5IY5 1;  3B5N B;  3RK2 D;  1KX7 A;  1KFN A;  4DY9 A;  4C7N A;  2GC7 D;  1I8P A;  1WMK A;  3QWO C;  3H1I G;  2XND H;  2XDJ A;  3CXH I;  1M1J C;  1SQX D;  1RF0 A;  3ORV A;  3RK3 B;  1Q86 Q;  3RL0 D;  1OX3 A;  1J2J B;  2KOG A;  2KYV A;  3AE3 C;  2V7Q H;  1A56 A;  5BU8 B;  3HD7 C;  1HZU A;  1SQP G;  1FZG A;  1DII C;  1L0N D;  1N73 A;  4U3F J;  1Q82 Q;  1G1I A;  2KUB A;  3B5N A;  4NPE A;  4OGQ C;  4LLH A;  1U7M A;  3C1L A;  4HYT B;  3RGU A;  1QL2 A;  3PXW A;  1NKN A;  1OW7 A;  2KB7 P;  3WMM 0;  1SQQ J;  4W7Z A;  2WSC H;  3WU2 H;  2CA4 B;  3OA8 B;  4D6T D;  5AW4 B;  2KZJ A;  1CSW A; 
#chains in the Genus database with same CATH homology
 3WFB C;  1CRC A;  3CX5 D;  3WUI A;  2ZZS 1;  3ZIY A;  1DW0 A;  1F1C A;  1QL4 A;  2B11 B;  3ZOW A;  4Y5R A;  1I54 A;  3RMZ A;  3RN1 A;  1FI7 A;  5B66 V;  1C52 A;  4AAM A;  1LFM A;  3VMA A;  2V07 A;  2Y0D A;  3O1Y A;  4GYD A;  1C2R A;  4EIE A;  1C7M A;  4WQC A;  4WQ9 A;  1AYG A;  1CYC A;  2O3J A;  3PLN A;  1C6R A;  2Y0C A;  1RZ5 A;  1DW1 A;  2PAC A;  3A9F A;  2EXV A;  1KYO D;  1RAP A;  5CIF B;  1OAE A;  4FAN A;  1NTM D;  3TF5 A;  1ZRT D;  1LS9 A;  4EIC A;  2FWL A;  3MK7 C;  1BGY D;  3SJL A;  1IZL 0;  1IRW A;  4H0J A;  1NU1 D;  4QAO A;  1N15 A;  4AAN A;  3GG2 A;  4AX3 A;  1OCD A;  2C8S A;  1YNR A;  2KS1 A;  4WQ8 A;  1F1F A;  1HJ3 A;  1BE3 D;  2BCC D;  3H1K D;  2N9J A;  1BL9 A;  3L75 D;  3WU2 V;  1GKS A;  1I6D A;  5DFS A;  1CSV A;  1QL3 A;  2CXB A;  1NTZ D;  1PP9 D;  2LIT A;  2Y0E A;  3DP5 A;  2C2C A;  2CA3 B;  2CE1 A;  3CYT I;  3DR0 A;  1CTZ A;  2YK3 A;  5CIC B;  2PCC B;  1GQ1 A;  3NBS A;  1NMI A;  2N18 B;  1I5T A;  1HH7 A;  3HQ8 A;  1R0Q A;  3L74 D;  2JWA A;  1H9X A;  1A8C A;  4AAO A;  3HQ6 A;  3ZBM A;  2HV4 A;  1WEJ F;  2IBZ D;  3NWV A;  1DVH A;  1MZ4 A;  1N9C A;  3L72 D;  2FYN B;  5EXQ A;  4WQB A;  4FA1 A;  2B10 B;  2ORL A;  4EID A;  1CYJ A;  5KAI V;  1BCC D;  2A06 D;  4IL6 V;  4O1W A;  3KHU A;  1QYZ A;  4V2K A;  5CYT R;  5KLV D;  5TJH A;  2D0W A;  1L9B C;  1M70 A;  2DVH A;  1E29 A;  1N50 A;  3VYM A;  1LMS A;  2C1U A;  1KB0 A;  1W2L A;  5CIE B;  4L3H A;  1YFC A;  1I55 A;  2KNC B;  1FI3 A;  5C0Z A;  3CX5 W;  1DT1 A;  3A0B V;  2BGV X;  3NBT A;  4J20 A;  1ETP A;  1KB9 D;  3WC8 A;  3SVW A;  1YEB A;  1I6E A;  2GIW A;  3MK7 B;  3WFD C;  1IQC A;  3PXS A;  1SQV D;  4EDF A;  2AI5 A;  2GC4 D;  5TIS V;  2B0Z B;  2MHM A;  1H1O A;  3O20 A;  5GTI V;  3RN0 A;  4UB8 V;  1CRH A;  5CIG B;  1FI9 A;  1B7V A;  1YTC A;  4RJT A;  1CIG A;  3ZOX A;  4N0K A;  2V08 A;  1COR A;  4FAV A;  3SLE A;  155C A;  2RMZ A;  2ZBO A;  1NIR A;  2ZXY A;  1U75 B;  1CIE A;  1KYO W;  4U3F D;  1AOF A;  351C A;  3L70 D;  4JCG A;  2B4Z A;  1HJ5 A;  4XXL A;  3O5C A;  1SQQ D;  3TDK A;  1K3H A;  4MU8 A;  1JDL A;  1KX2 A;  4PWA A;  1NNO A;  1MG3 D;  1FHB A;  3H1I D;  4Q5P A;  1HZV A;  3L4O A;  2BLF B;  2BH4 X;  2FRC A;  5E79 V;  1YEA A;  1DW3 A;  1CHJ A;  4FA9 A;  2VHD A;  5DJQ B;  3VNW A;  2C9X B;  2D0S A;  2N3B A;  4H0K A;  1H33 B;  1H31 B;  1I8O A;  5H2F V;  3X39 A;  4UB6 V;  1CNO A;  4XYD B;  2C1D B;  1CHH A;  4L1Q A;  1C2N A;  2QG4 A;  1CRJ A;  2BCN B;  4KMG A;  1SQP D;  2YIU B;  5AUR A;  1VYD A;  2ZOO A;  3ZCF A;  4FA4 A;  1CRG A;  3PTZ A;  3PXT A;  4AAL A;  1H32 B;  3GW6 A;  1RZ6 A;  4A7P A;  1CHI A;  3FWL A;  3CWB D;  2N9I A;  1GDV A;  3DMI A;  1H33 A;  2JQR A;  1H31 A;  3JBT B;  4P4Q B;  2K9J B;  1YIC A;  2GB8 B;  3H1L D;  5DF5 A;  2C1D A;  1S5L V;  3C2C A;  2FYU D;  4EIF A;  1IRV A;  1QKS A;  1FOC A;  2LIR A;  2N9Y B;  1NTK D;  1A2S A;  2XTS B;  1FCD C;  1CIF A;  1GU2 A;  2OZ1 A;  3CXH D;  4WQA A;  5GTH V;  2YQB A;  1MG2 D;  2CE0 A;  1H32 A;  3CXH W;  1L9J C;  1AOQ A;  2N18 C;  2AXT V;  4FA5 A;  1P84 D;  4NFG B;  3O0R C;  1E2R A;  1IO3 A;  3RLM A;  1CTY A;  1DIQ C;  3SWS A;  2I8F A;  4RSZ A;  1CSX A;  1CC5 A;  1AKK A;  1FJ0 A;  3PRJ A;  4FB1 A;  1CYI A;  3ITK A;  4LJI A;  1DW2 A;  2QJY B;  3L4M A;  2Q3E A;  1N90 A;  1YCC A;  1M6Z A;  1CCH A;  1COT A;  1E8E A;  451C A;  1L0L D;  1ZZH A;  1SQB D;  3OA8 A;  1LC1 A;  4WQE A;  3KZI V;  3TGU D;  5B5E V;  4GED B;  1EZV D;  2MTA C;  3HQ7 A;  5CIB B;  1KIB A;  1CCR A;  2QJK B;  2RN0 A;  3WFE C;  2ZON G;  1M60 A;  2YCC A;  1C75 A;  5KLI B;  1HRC A;  2JTI B;  4K3I A;  3L73 D;  3PH2 B;  3VRD A;  1GIW A;  3ZOY A;  2L91 A;  3CP5 A;  1WVE C;  1S6V B;  1CED A;  2DGE A;  2PCB B;  3M97 X;  3TYI A;  5KAF V;  4D6T D;  1HRO A;  1CSU A;  1HJ4 A;  2B12 B;  1QN2 A;  4O1Q A;  5C9M A;  1U74 B;  1CXC A;  1CRY A;  3CU4 A;  5IY5 1;  2OZ1 B;  4WQ7 A;  1KX7 A;  3HQ9 A;  1CRI A;  4DY9 A;  2GC7 D;  1I8P A;  3OCD B;  1NML A;  4PD4 D;  1J3S A;  1KV9 A;  3PHL A;  2L4D A;  1LC2 A;  1SQX D;  1YIQ A;  3ORV A;  1CXA A;  3ZOO A;  1HCM A;  3H1J D;  3L71 D;  2BPB B;  3BCC D;  1CO6 A;  4YE1 A;  5DJQ C;  2N3Y A;  3H1H D;  1CTJ A;  2QJP B;  2AIU A;  1A56 A;  3A0H V;  1CIH A;  1HZU A;  1C6O A;  1K3G A;  5CIH B;  1DII C;  1EB7 A;  1L0N D;  4PJ0 V;  1DVV A;  5B6Q A;  2C1V A;  4PW9 B;  1C6S A;  1PPJ D;  4L3G A;  3WFC C;  5KKZ B;  1W5C T;  1H9Y A;  3PXW A;  5CID B;  2CA4 B;  3OCD A;  1RAQ A;  3OA8 B;  3SXT A;  2BH5 X;  4WQD A;  1CSW A;  1GJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...