3H1LD

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1lD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1lD02
1C2RA 3C2CA 3WFBC 4KMGA 1HCMA 1HJ4A 1A8CA 1GQ1A 2KNCB 2V07A 1C52A 2C1DB 3ZOOA 1DIIC 2FYUD 1HJ5A 5C9MA 1IRWA 2N9YB 2CA3B 1YCCA 1I6DA 3L72D 3L74D 3HQ7A 3NBSA 3ZOWA 1L9JC 1H32B 1DW1A 5H2FV 3L4OA 1N9CA 5CICB 3VYMA 4LJIA 3PXTA 1DW2A 1DT1A 4NFGB 1C75A 3ZOYA 1CNOA 1ZRTD 4GEDB 3L70D 1I6EA 1IRVA 1CIHA 2N18B 4Y5RA 4EDFA 1RZ5A 3PH2B 5KLIB 3O0RC 3ITKA 2PACA 2XTSB 3SWSA 1NTKD 1K3GA 4PJ0V 2Y0CA 1YFCA 1HRCA 2BLFB 1U74B 2ORLA 4V2KA 4XYDB 3DP5A 2BH4X 1FHBA 1P84D 3CX5W 2IBZD 3A0HV 2YCCA 1DW0A 4K3IA 4FANA 3KZIV 3WFDC 2BGVX 1N90A 5EXQA 2DGEA 1CO6A 3CU4A 1DIQC 1H33A 2L4DA 2ZZS1 1QL4A 1OAEA 2BCCD 1SQQD 2AXTV 3PXSA 1MG2D 2RN0A 2HV4A 4FA4A 1I5TA 1CRYA 2B12B 4P4QB 2KS1A 2QJKB 4EIDA 1E2RA 3L73D 3SJLA 2RMZA 3ORVA 3OCDA 1PPJD 3O20A 2CXBA 2CE0A 3NBTA 1U75B 1MZ4A 1YTCA 3H1JD 2A06D 5B66V 3PRJA 3CX5D 1YEBA 3O1YA 1S6VB 2YQBA 1AYGA 1CEDA 4RSZA 1LFMA 2EXVA 3VRDA 1K3HA 3DMIA 1L0LD 3PTZA 2N18C 1BL9A 4FAVA 1CYIA 3TDKA 1WVEC 4WQBA 1HZVA 2YK3A 1A56A 1KX2A 1GDVA 3M97X 1CTJA 2ZOOA 4U3FD 3PHLA 1CSUA 5CYTR 1AOFA 2D0SA 4EIEA 2GC7D 3L75D 2Q3EA 2GC4D 1ETPA 155CA 4AANA 2QJPB 1M60A 3JBTB 1NU1D 1FI7A 1VYDA 4JCGA 1CSWA 4J20A 3HQ6A 3O5CA 1AKKA 1CYCA 4N0KA 4FA5A 3HQ9A 4L3HA 4EICA 3A0BV 3CWBD 1COTA 4AAMA 1CRHA 2Y0EA 2PCBB 1GKSA 1PP9D 1DW3A 4MU8A 1M6ZA 5CIDB 1B7VA 5IY51 4WQEA 2CE1A 3H1KD 1H33B 3GW6A 1CIGA 1L9BC 1SQPD 1E8EA 4D6TD 1GU2A 2YIUB 2C1UA 1QKSA 1GIWA 1KYOD 1EB7A 3L4MA 2AI5A 3RLMA 2FRCA 1C6SA 4WQCA 3RN0A 1N15A 2B0ZB 2K9JB 1DVHA 3OCDB 1N50A 2LITA 1C6OA 1RAQA 1W5CT 5TISV 3TF5A 1LMSA 1CCRA 2PCCB 1YIQA 3CYTI 1LC1A 1H32A 1QYZA 1DVVA 1CORA 3GG2A 3SLEA 1E29A 5DFSA 4O1QA 2ZBOA 3HQ8A 351CA 4WQ7A 1KB9D 2JTIB 1IO3A 5CIEB 3CP5A 1SQXD 1HROA 1FI9A 2JWAA 1CCHA 1YEAA 3FWLA 4H0JA 1FOCA 4XXLA 2JQRA 3ZBMA 2CA4B 2N3BA 1YICA 1YNRA 3PXWA 1H1OA 3CXHD 4FA1A 1SQBD 1LC2A 1CC5A 2C2CA 1CXAA 1FCDC 1ZZHA 4Q5PA 4PWAA 1J3SA 1CIFA 5CIBB 2DVHA 5CIGB 5GTHV 5TJHA 1NMLA 2VHDA 4WQ9A 5B6QA 1H31A 1AOQA 5KAIV 3TYIA 3WC8A 1CRCA 3WFEC 3OA8A 2FWLA 5KLVD 1C7MA 2L91A 4UB6V 1KYOW 3WU2V 1KB0A 4AX3A 2D0WA 4PW9B 2B4ZA 1CRGA 3PLNA 3TGUD 1CRIA 1QL3A 3ZOXA 2B10B 5KKZB 2OZ1A 1I55A 4L3GA 2I8FA 5E79V 5CIHB 1NTMD 2ZONG 1QN2A 1H9XA 1I8PA 3H1ID 1C6RA 3WFCC 1EZVD 3H1LD 4RJTA 2V08A 1M70A 2BPBB 2N3YA 1WEJF 1CHHA 1KIBA 3SVWA 1OCDA 4FA9A 4QAOA 3DR0A 5B5EV 5DJQB 4GYDA 2O3JA 2MTAC 3MK7B 1S5LV 4AALA 4WQAA 2Y0DA 1I8OA 2MHMA 1CIEA 1CXCA 5CIFB 3X39A 5GTIV 2QJYB 3SXTA 2C1DA 3CXHW 2N9JA 1IZL0 1R0QA 2ZXYA 3KHUA 2C1VA 4A7PA 1CSXA 1CRJA 4WQ8A 1F1CA 1C2NA 1HZUA 4IL6V 5DF5A 1NMIA 3RMZA 4DY9A 1FI3A 2FYNB 3VNWA 2C8SA 4YE1A 3H1HD 1H9YA 1NTZD 1BE3D 1HJ3A 2QG4A 2GIWA 2B11B 3WUIA 5KAFV 1FJ0A 3VMAA 1H31B 4L1QA 4PD4D 2BH5X 1CTZA 1IQCA 3OA8B 1CHIA 3ZIYA 5C0ZA 1CYJA 3A9FA 1NIRA 1W2LA 2C9XB 3NWVA 1KX7A 1NNOA 4UB8V 1F1FA 4H0KA 2N9IA 1BGYD 3BCCD 5DJQC 1MG3D 2BCNB 2OZ1B 4O1WA 1GJQA 1CSVA 1KV9A 1HH7A 3MK7C 2AIUA 1SQVD 1A2SA 4EIFA 1BCCD 1JDLA 5AURA 451CA 2LIRA 4FB1A 2GB8B 1RZ6A 1I54A 4WQDA 1RAPA 1CTYA 1L0ND 1LS9A 3RN1A 4AAOA 1CHJA 3ZCFA 3L71D
chains in the Genus database with same CATH superfamily
1H0TB 3H1KJ 2FYZA 4KMGA 1HCMA 3B5NA 1HJ4A 2E74B 1A8CA 3H25A 1EZVE 2JJLA 2QE7H 2C1DB 2QRXA 1DIIC 1X9VA 2OTLP 2FYUD 2R3CA 1HJ5A 2N9YB 1N7LA 3D71A 3L72E 4GOEA 1YCCA 2C0XA 4KHXA 3L74D 4H44C 1L9JC 1H32B 4R4LA 3VOPA 3H1LG 1GL2A 1VQ5P 4LJIA 3W68A 2P1JA 3KXDA 3ZOYA 1HTLC 1CNOA 5CCGC 2WPVB 3JC22 1OZHA 1LP1B 2OTJP 5KLIB 3LIDA 1DX7A 1PIXA 1SQPG 2E75C 1HRCA 4EI2A 3JCUE 2BLFB 2ZYAA 3CC7P 1M1JB 3RL0D 1X79B 1H89A 1G2CB 5H2FE 4JPZB 3BASA 1VQ4P 3CX5W 2Z5IA 3H1HE 3A0HV 3AEBC 3KZIV 3WFDC 2PGDA 5GTIE 2QSIA 1CO6A 1SQPK 1VQ6P 1QL4A 1HVVA 1OAEA 5CJ4A 3CMAP 3PXSA 2RN0A 1L4AC 2ZYDA 1CRYA 3AE4C 1NTZG 1RE4A 4Y28J 3N4XA 1BE3G 2YKPA 1CI6B 2K9JA 4IFFA 3B5NB 2CXBA 5BU8B 3N7NA 1VDFA 1MZ4A 1JNMA 3C8VA 3PJSK 3D0WA 2B87A 3CX5E 2A06D 2LKMA 5KAFE 1CEDA 3G6EP 1PGJA 4EYYQ 1DEEG 1LFMA 3IF4A 1AQTA 3PTZA 1L0LD 5AW0B 5AW8B 2Z4EA 1NTZK 3CXHI 1SVFA 1HJ0A 1PPJE 1GL2B 1WVEC 3TDKA 2YK3A 1HJBA 3CCRP 1SQVG 1LWUC 3M97X 3L72J 2FYUE 2OYIA 2PFXA 4EIEA 1VF5C 1ETPA 1L0NG 3TGUG 2WZ7A 1NU1D 1FI7A 3L74E 4JCGA 3O5CA 1CYCA 1AFOA 1IFNA 1SQVK 4AAMA 2Y0EA 1GKSA 2XKMA 1M6ZA 5CIDB 3CCSP 2CE1A 5APTA 5CBOA 1L0NK 1CIGA 1L9BC 4BXLA 4OGQC 3H1HJ 2WSCH 3M06A 2W90A 2OYHA 4K35A 2JO1A 2N9BA 1GIWA 1EDIA 3L4MA 1C6SA 3L35A 4ZMDA 1KILD 5APXA 2K9JB 2KIKA 3CCMP 3CC2P 3CCUP 1C6OA 2W8ZA 5C39A 1RAQA 1EDKA 1LMSA 2B87B 3AEEC 1S3JA 1T3UA 1WRGA 1LGHB 1DVVA 1CORA 2WITA 1KB9E 2K1AA 3MHVA 5AW7B 351CA 1JOCA 2BEZF 2Q3IA 5CIEB 3CP5A 1HROA 5AW9B 1P84I 4XXLA 3ZBMA 1GTWA 1FDMA 1YICA 1KORA 3O6QA 2OYIB 1VQ7P 4M3LA 1SQBE 1KQFB 3V2RA 3CXHD 4UB6H 3M9HA 3RL0g 1L0LE 2AXTE 1FCDC 2E76B 4JYBA 2N1TC 1CIFA 1KMIZ 1SS1A 4JBZA 1RF1C 1SP4A 2FYUJ 5GTHV 4WB4A 1Q90D 1VQMP 2E5TA 1IFJA 1AOQA 5AW6B 1D7MA 1WT6A 3L74J 3Q3DA 3OA8A 1C7MA 3Q5SA 2L91A 5CCGA 3WU2V 3V4WA 1NU1E 2D0WA 1CRGA 3PLNA 5APYA 2B89A 1CRIA 1QL3A 1FDIA 1AVOA 3ZOXA 4HYTB 1GW4A 2OYHB 1S5LH 2I8FA 3HD7C 3GHGC 1NTMD 1QN2A 1HGVA 1C6RA 1M70A 3O8ZA 4I2LC 1CHHA 1KIBA 1OCDA 1SFCC 4FA9A 1K04A 4QAOA 1N73C 1T3JA 3GMAA 2QVAA 3AE5C 2GA1A 3CD6P 4WY4C 2MHMA 3X39A 3H1KG 3RK2B 4Y99B 1NTKG 3A0BE 2PRRA 1FZBA 3CXHW 4PV1B 2D2CD 3O6QB 4A7PA 2WWWA 1GZLA 1CSXA 2KOGA 1F1CA 3I55P 3OW2O 2LXCB 1JO5A 1JEKA 2IBZG 4DY9A 4YE1A 1U7JA 4W7YA 1NTKK 1SQBJ 4H44B 2GIWA 2B11B 4XA4A 3VMAA 1L0LJ 2BH5X 5AW4B 1CTZA 4H0LC 2O1JA 2HG5D 3OA8B 3ZIYA 2AEMA 5C0ZA 3A9FA 3CXHE 5AVQB 3OJAB 3QH9A 1QL2A 1K73Q 2IFNA 2V7QJ 1SQXG 3NWVA 1KX7A 2J58A 3MZWB 1NNOA 1T8ZA 1F1FA 2E75B 2KZIA 4IL6E 4BWNA 2N9IA 1BGYD 5DJQC 1FZFA 1K9MQ 1J1EC 3B8EB 3B5ND 2H8PD 3WUVA 2G3AA 3MK7C 1S5LX 1NU1J 3H6PA 3RK3C 2YMKA 3S4RA 1ZMEC 1JDLA 3PH0A 5AURA 451CA 4IFMA 1ZR4A 1GD2E 4WBAA 1W5CE 2ZVOB 2GB8B 1RZ6A 1I54A 1SQXK 3Q1MA 2QA4P 1RAPA 3L71E 2KLVA 1LS9A 3RN1A 4AAOA 2WT7A 1ZLLA 1CHJA 1C2RA 2Q1KA 3WFBC 5APVA 3KDPB 1BDCA 5KLVG 2V07A 2R5DA 4IL6X 3AEDC 4NPDA 4C7RA 5AVRB 5C9MA 1VQNP 1IRWA 5KAIE 4YPCA 2OTKE 2M8RA 1I6DA 3AEFC 3L72D 2K9YA 3ZOWA 3HQ7A 2KB7P 1DW1A 3H1IG 5CICB 3CWBG 1EZVG 3VYMA 4ASWA 1DT1A 1A02F 3L70E 1C75A 4GIFA 5KLVK 4GEDB 1LT9C 1IRVA 5E79E 4EDFA 1RZ5A 2P2UA 3O0RC 3KZIH 2PACA 2XTSB 3T97A 3SWSA 3V6IA 4GODA 2Y0CA 4IOIH 1R8EA 2W6JH 2FFDC 1LTSC 2ORLA 4V2KA 5CCHC 2IDBA 3SWKA 1P84E 1VF5B 2MKVA 1RQVA 3P8MC 5BU5A 1FHBA 1JM0A 3I56P 1M8OB 1GW3A 2JDIH 1DW0A 4K3IA 2WTYA 2ZT9C 1N90A 2N1TA 2W27A 1DIQC 1H33A 2L4DA 2R3SA 1JB0J 1MG2D 3AE9C 2Y9ZA 2XU6A 4HB1A 2NPSD 1G1IA 3H1HG 4P4QB 1FE6A 1MFTA 1VPCA 3SWYA 1BGYE 3L73E 2WT7B 4HKZH 1EQ7A 1YI2P 3AEAC 1FZCC 1DD3A 1CW5A 1QEXA 2O01H 3A0HE 4OGQB 4H13C 1U75B 2OYOA 1JTHA 1YTCA 3H1JD 2QIWA 3PRJA 3VP8A 1AA0A 3HD7A 3CX5D 3GHGA 3L71J 2QEXP 1GK6A 4LGDE 2YQBA 1AYGA 3MIWA 1MZ9A 2N18C 1JCDA 1SFCA 2IPPA 1N73A 4FAVA 2KSJA 1HZVA 1KC8Q 4UB8E 1BCCG 3OA7A 1GDVA 4WWIA 3RL0C 4JF7A 1CTJA 2ZOOA 4I7ZC 4WY4A 5CYTR 3L75D 2M3BA 2Q3EA 3T97B 2E42A 2MJZA 155CA 2AXCA 1X8YA 3JBTB 1PPJG 3L70J 4J20A 1AKKA 3IAOA 1EDJA 1OW7A 3A2AA 1EXJA 4L3HA 1ZOYC 1E5WA 4EICA 2FYUG 1PP9E 5CJ0A 1N7SD 1IJDB 1CRHA 5KJ7D 3E7KA 3U1CA 2HYNA 3VTPC 4MU8A 1LJ2A 2N1TB 2QJKC 1NAYA 1H33B 1IFDA 1SQPD 4D6TE 1IFIA 1GU2A 4ZKUA 3P32A 5KTBA 2C1UA 1QKSA 1EB7A 3RLMA 2FRCA 4C7NA 3RBZA 1N15A 1YYCA 1HUCA 1DVHA 1M56D 1JTHB 4KT0J 2CPBA 4PV1D 4DJGA 1CCRA 1NGMB 3IFMA 1RQUA 3HD7B 4GT1A 3GHGB 1BGYJ 3L73J 3SLEA 2KSEA 1KB9D 4ASVA 1SFCB 1FOSF 3SSUA 3R4YA 1IO3A 1N73B 2QJPC 3VP9A 5GTHH 1CCHA 2HPCA 1DIPA 3H1JE 1BDDA 4WY4B 3ABVC 3MGNA 3EQ2A 1SQBD 5CCGD 3TSIA 2C2CA 2W83C 3WU2H 4EIJA 3AE8C 2R5BA 3BCCG 1YITP 4PWAA 1FZAA 1RH5B 3A3YB 2A06G 3KPEA 2J59M 3I5CA 1H31A 3WC8A 3GF7A 3L75E 1L0LG 4I1LA 1NJIQ 2KXPB 2FWLA 1KILC 2IYPA 1LT9A 3P8CE 1LNQA 2B4ZA 1PP9J 3TGUD 3L37A 2NRGA 4H0LB 2FFDA 2OZ1A 3S1KA 5CIHB 4C7NB 1S9KD 1PZQA 3MD0A 3H1LE 4GDOA 3VMYA 5GTHE 4KJMA 5CCHA 3WFCC 4RJTA 3G71P 3LW5J 2BPBB 4D6TJ 1NU1G 1L0LK 3CCQP 4DZOA 5DJQB 2M5AA 1SQPE 2O1KA 2ZVNB 4GYDA 1J1EB 1L2PA 4IFDK 4L74A 2R32A 2ZJSE 2OARA 3NFQA 2QM7A 1YJNP 3MK7B 4WQAA 2NZ2A 3RK3B 1I8OA 1URQC 1ZXGA 1EC5A 5GTIV 4HH2A 2R44A 2HPCB 2KP8A 1NU1K 1OFCX 1S4XA 2YO2A 1R0QA 4I6MC 2E43A 4JYCA 1FZCA 2XDJA 1CRJA 5AVXB 5AW3B 2ZXEB 1KN7A 5DF5A 1Y47A 2B9BA 1FI3A 1HF9A 3H1JJ 1NTZE 1KYOI 1LTGC 1H9YA 3G3ZA 2GUSA 1RF0C 5KAFV 1H31B 4L1QA 2IBZI 1S2EA 3CCVP 5KKZC 2YKOA 4W80A 1LT9B 2C9NY 2K3RA 3BATA 1NKNA 3F89A 1KTMA 1JY2P 3HUSC 1W2BO 2BCNB 3L75J 2FFDB 2OZ1B 1GJQA 1KV9A 1HH7A 4OGQD 1U57A 3BVHA 1OW8A 1SQVE 1VQOP 4N78E 3AECC 4C46A 1IK7A 2M5AB 4FB1A 3AE3C 5KLIC 3FXEA 1L0NE 2ZT9B 4WQDA 2YO3A 3H1LJ 4ZNCA 3TGUE 1ZR2A 1CTYA 1YTZT 2D2CC 2LXBA 3ZCFA 3L71D 3CCEP 2SPZA 1S9KE 1Q86Q 1GU5A 5APQA 4U3FG 4AUWA 3GLMA 1C52A 2E74D 1SQPJ 3CPWO 3WUUA 3F5HA 1H88A 3D6YA 1JY3P 1VL2A 3M0AA 2P10A 3MP7B 2CA3B 5AW5B 2FYNC 1FZCB 2Q9IA 5CMZA 2B88A 4H13B 3NBSA 4UB6E 1NTMG 3CC4P 1NH4A 3L4OA 1N9CA 1ZRTE 2WSFH 1L4AA 3L70D 1OVRA 1I6EA 4GKGA 2N18B 4Y5RA 1YJWP 1IO4A 3GF3A 2FY8A 3V4QA 2N1TD 5TISH 1EZVI 3FGAD 4OH8B 1NTKD 1K3GA 4PJ0V 2IX7C 3KQGA 1NTZJ 1YQ4C 1NTMK 4I7ZB 1QVGO 1FAVA 1KD1Q 3AE6C 1S5LE 1JMBA 1P84D 2IBZD 1WMKA 5EFWB 1KFMA 4FANA 2BGVX 3RGUA 2DGEA 2ZZS1 3E1RA 2BCCD 2WSCJ 1SQQD 2AXTV 3HD7D 1JCCA 2HV4A 4BRYA 1LWUA 2P7JA 1OVVA 1I5TA 1LTJC 2POHA 2B12B 3PP5A 1SFCD 5K5GB 2QJKB 1SQVJ 1KILA 4EIDA 3MTUE 3L73D 1H8AA 3SJLA 3ORVA 4HJGH 1E79H 3NMDA 2CE0A 3NBTA 2H7HA 1PGPA 5B66V 1L0NJ 5AW1B 3TGUJ 3O1YA 1IC2A 1YIJP 1S6VB 2G8YA 4PD4I 5DJTB 1LTBC 1BGYG 3KYQA 3VRDA 3DMIA 1BL9A 1KYOH 4EOTA 1NVOA 2KK7A 2I8DA 1GL2D 1UIIA 2BEQD 1L4AB 2WVRA 1URQA 3U59A 1VQ9P 2WPSA 1VQPP 3V5BA 5B5EH 3AE2C 2QJPB 1FZEA 1AJYA 1VYDA 3HQ6A 4N0KA 1U7MA 2AEFA 4FA5A 2YMYA 3A0BV 3CWBD 2RH0A 2CK3H 2NPSC 2YXQB 1PP9D 3FWNA 3IR9A 3L72G 1NTKE 3WMM0 1FJPA 1IZNB 1J2JB 3RBXA 3VN0A 1E8EA 4DOJA 4BRYB 1Q2NA 1RF0A 1LWUB 4D6TD 1N8RQ 1JMMA 3RK3D 1GMJA 1MV8A 3RN0A 1KILB 2B0ZB 2IBZE 1LTTC 1IFPA 1N50A 3ZDMA 3M9QA 1W5CT 5TISV 3TF5A 3HUSA 2PCCB 1YIQA 2BCCE 1SQQE 1RF1A 1LC1A 1H32A 2FXPA 3GG2A 2WSFJ 1LTIC 5DFSA 2JP3A 4TT3H 5APUA 2ZBOA 3HQ8A 4WQ7A 1CZQA 2JTIB 1PL5A 1SQXE 1USDA 2JWAA 1FI9A 2WSEH 1YEAA 3II6A 3FWLA 4H0JA 5AVYB 3HE5A 2OQQA 1FOCA 2OYHC 3SFDC 2JQRA 1GDTA 2CA4B 2N3BA 1URQB 3KZIE 1YNRA 1ZW0A 1N7SC 5KJ7C 1H1OA 4FA1A 1CC5A 1CXAA 1JY2O 4Q5PA 4NPFX 1A02J 1PV3A 2E76D 2DVHA 5CIGB 1T2KD 3U1AA 1DD4A 1IK9A 1QLED 4WQ9A 1YBKA 1K8AQ 2VRSA 5KAIV 3TYIA 1NYHA 2YIUC 5KLVE 3WFEC 2GM4A 3JCUH 1RY3A 2L5GB 3EFFK 3P7KA 1KB0A 1XTCC 3P8CD 2Z5HA 4PV1C 5H2FH 4TLFA 5KKZB 3QWOC 1NWQA 2JWDA 1I55A 5E79V 3H1IE 3CWBE 1NTKJ 3L75G 1JY3O 1H9XA 1OIPA 2HODA 3H1LD 5GTIH 4XE5B 1Q81Q 2N3YA 4PD4H 1WEJF 3G4SP 4CPGA 4W7ZA 3SVWA 1N86A 3HUSB 3DR0A 5B5EV 3L74G 2C0WA 1QL1A 1RF1B 3L36A 1K05A 3S9OA 2O3JA 4H13D 1Y8AA 2MTAC 1EDLA 3RK3E 4L76A 4AALA 4U7JA 3EWKA 2Q5UA 3CMEP 2HFED 2WPRA 1FOSE 2DW3A 1LTJA 1CIEA 1CXCA 5CIFB 3EFGA 2FYUK 2KNCA 2BCCJ 1SQQJ 3RK2D 3CX5H 1J1DC 3HE5B 2D2CB 1IZL0 2ZXXA 5KAFH 2ZXYA 3KHUA 3TYYA 2XZRA 4WQ8A 2CPSA 1SQXJ 3HE4A 3C9IA 3L4FA 2A45G 3RMZA 2FXOA 2FYNB 2C8SA 1NTZD 2GUVA 3Q5PA 1BE3D 1HJ3A 2E5YA 4PD4E 4DCKA 3WUIA 1FJ0A 2LR2A 4H44D 1CHIA 2K88A 1CYJA 4ZKPA 5AVSB 1PFIA 1QVFO 1W2LA 2C9XB 4UB8V 1FZGA 3BCCD 2E75D 2IYOA 5KLVJ 4O1WA 1CSVA 1IFMA 1MUUA 2HODB 5APWA 3HTKA 2AIUA 1BCCE 1SQBG 1SQVD 4EIFA 2JKVA 2M3EA 4N78D 2NPSA 2QJYC 2RKLA 3H1IJ 3CWBJ 2PAJA 2XV5A 2WSEJ 3SFEC 2ZAEB 3SWFA 1L0ND 2O01J 2A45H 2KI7B 1OMIA 5BVZA 1AQ5A 3C2CA 5AVTB 2V4HA 4NPEA 1X0TA 1LTJB 1MFZA 1L4AD 2YNYA 1GQ1A 2KNCB 4RO0A 2P58A 2C9LY 3K5BA 3ZOOA 1SQBK 3Q2YA 2H43A 2ITAA 3JSVC 1RE3C 1ZN5A 4PJ0H 3HRNA 1KB9H 1QGKB 3HE4B 5H2FV 1NAFA 1RHZB 3H32A 3NTNA 3WU2E 1XTGB 3PXTA 1DW2A 4NFGB 2Y9YA 3R2PA 1Z56A 1ZRTD 1QX8A 1CIHA 3PH2B 4LC1A 3ITKA 2UWJE 3M0DC 1AVYA 2WQYC 1YFCA 2IFMA 1VQ8P 2JEEA 2H89C 2AXTH 1U74B 1OWAA 4XYDB 2KLUA 1UIXA 3TNUA 3DP5A 2BH4X 2PP6A 1N7SA 5KJ7A 1VF5D 2V7QH 4K3AA 4N6JA 2YCCA 1BE3E 1S72P 1R5SA 5EXQA 3V2QA 1KZUB 3HTKB 3G9RA 4OWFA 3USSA 3CU4A 5B66H 1BSHA 1YQ3C 2WSSH 4PJ0E 2BASA 4FA4A 2NPSB 2E74C 5AVUB 1OX3A 2KS1A 2IZ0A 1AV1A 1BCCJ 3BCCE 5AW2B 2ZYGA 1E2RA 2RMZA 3OCDA 1FC2C 1M7LA 3O20A 5AVVB 2YKQA 2KYVA 3V2PA 3CCJP 2A06E 2H88C 1URQD 1YEBA 2HLOA 1JY2N 2FKWB 4RSZA 5L8RJ 1USEA 1VQLP 2EXVA 1K3HA 1YJ9P 2WPQA 1GK4A 3A5TA 3H32B 4B86A 4Z1MH 1CYIA 1R5LA 4WQBA 3BRTB 2ZFCA 1A56A 1KX2A 3A0BH 4RKUJ 1M1JC 3MUDC 3OAKA 4U3FD 3PHLA 1CSUA 1AOFA 4O9BA 2D0SA 2GC7D 2GC4D 2XNDH 1NOHA 5B66E 3VMZA 4AANA 1X22A 1LTAC 2WMMA 1M60A 3L71G 3M9BA 3B4SA 1CSWA 3Q5RA 3TNUB 3HQ9A 1JY3N 1N7SB 1ZV8A 1COTA 3CI9A 2PCBB 1DW3A 3AE7C 1KQSO 1B7VA 5IY51 4WQEA 3H1KD 1MKMA 1KQLA 2I1JA 3GW6A 3CXHH 3M91A 1S1CX 1Y9BA 3B5NC 3RL0B 1BE3J 2YIUB 4IL6H 3L70G 1HBWA 1KYOD 2KS1B 2AI5A 2FBWC 1KILE 4WQCA 3TK1A 4XFJA 3OCDB 2LITA 4JQ0D 3CYTI 1GL2C 1KQGB 1TU3F 4AYCA 3AE1C 1QYZA 3BCCJ 1E29A 5M1BA 4O1QA 1W2EA 2IZ1A 1NO4A 3VMXA 2HR3A 4YXDC 1M1KQ 3C1LA 1Q82Q 1SQXD 2BCCG 1SQQG 2QM8A 4L75A 4YXWH 2Q6QA 2J5UA 5KAIH 1G1JA 5TISE 3PXWA 4WY4D 1FJKA 1LC2A 1ZZHA 1J1DB 3L73G 1HH0A 1M90Q 1FBMA 3UIAA 1J3SA 5CIBB 1RE3A 3LIEA 1FDOA 5TJHA 5AVZB 2YXRB 5E79H 1NMLA 2VHDA 1SQQK 2W6BA 5B6QA 4U3FE 1GU4A 1NKZB 4N3YB 1RE4C 3B71A 4MN4C 1CRCA 5KLVD 4UB6V 2XNXA 1KYOW 4AX3A 3CX5I 3CCLP 4PW9B 1PGQA 1P84H 3M0DA 2B10B 1T6AA 4R4MA 1NTME 1OW6A 4L3GA 1CSBA 4H0LD 1LT1A 2ZONG 1M57D 1I8PA 3H1ID 1EZVD 2V08A 3V2NA 3D70A 3H1KE 1BSNA 1OVUA 3AEGC 2O01N 1SLQA 2W6AA 4LLHA 1Q7YQ 1KV4A 1S5LV 2Q7CA 1DH3A 3CL3D 2Y0DA 3BRVB 2M0BA 1PP9G 1KYOE 1H0TA 2OYIC 3D6ZA 1FU1A 3A0HH 2QJYB 3SXTA 2AEJA 2C1DA 5CBNA 2N9JA 1NHLA 2E76C 3CLQA 4D6TG 1T2KC 2C1VA 3FX0A 3A7OA 3FXDA 4YTPC 4WVZA 5B5EE 2KUBA 3NXSA 1C2NA 1OXZA 1HZUA 4IL6V 1NMIA 4GOFA 5CHXA 4UB8H 1HGZA 3E1IA 3VNWA 3H1HD 1JUNA 2QG4A 1YHQP 1VQKP 1LP1A 3VYIA 2K37A 1KFNA 2A45I 4PD4D 1YTZI 1IQCA 3W67A 1EXIA 1M1JA 3MUDA 1NIRA 1G2CA 4DT0A 2FXMA 1FS0E 5APSA 3WUTA 4H0KA 4OVNF 4L73A 1DEBA 4QMAA 4U3FJ 5DJUB 1MG3D 1KB9I 2I1KA 3H1JG 3IN6A 1HWTC 1PGOA 5CCHD 1ZP0C 1A2SA 1BCCD 2OGUA 2KZJA 3LW5H 2P67A 2LIRA 1N2DC 1NTMJ 4RESB 3RK2C 5AVWB 4Y99C 2ZT9D 1CI6A 2JR8A 1PPJD 4AQRD
chains in the Genus database with same CATH topology
1C2RA 3C2CA 3WFBC 4KMGA 1HCMA 1HJ4A 1A8CA 1GQ1A 2KNCB 2V07A 1C52A 2C1DB 3ZOOA 1DIIC 2FYUD 1HJ5A 5C9MA 1IRWA 2N9YB 2CA3B 1YCCA 1I6DA 3L72D 3L74D 3HQ7A 3NBSA 3ZOWA 1L9JC 1H32B 1DW1A 5H2FV 3L4OA 1N9CA 5CICB 3VYMA 4LJIA 3PXTA 1DW2A 1DT1A 4NFGB 1C75A 3ZOYA 1CNOA 1ZRTD 4GEDB 3L70D 1I6EA 1IRVA 1CIHA 2N18B 4Y5RA 4EDFA 1RZ5A 3PH2B 5KLIB 3O0RC 3ITKA 2PACA 2XTSB 3SWSA 1NTKD 1K3GA 4PJ0V 2Y0CA 1YFCA 1HRCA 2BLFB 1U74B 2ORLA 4V2KA 4XYDB 3DP5A 2BH4X 1FHBA 1P84D 3CX5W 2IBZD 3A0HV 2YCCA 1DW0A 4K3IA 4FANA 3KZIV 3WFDC 2BGVX 1N90A 5EXQA 2DGEA 1CO6A 3CU4A 1DIQC 1H33A 2L4DA 2ZZS1 1QL4A 1OAEA 2BCCD 1SQQD 2AXTV 3PXSA 1MG2D 2RN0A 2HV4A 4FA4A 1I5TA 1CRYA 2B12B 4P4QB 2KS1A 2QJKB 4EIDA 1E2RA 3L73D 3SJLA 2RMZA 3ORVA 3OCDA 1PPJD 3O20A 2CXBA 2CE0A 3NBTA 1U75B 1MZ4A 1YTCA 3H1JD 2A06D 5B66V 3PRJA 3CX5D 1YEBA 3O1YA 1S6VB 2YQBA 1AYGA 1CEDA 4RSZA 1LFMA 2EXVA 3VRDA 1K3HA 3DMIA 1L0LD 3PTZA 2N18C 1BL9A 4FAVA 1CYIA 3TDKA 1WVEC 4WQBA 1HZVA 2YK3A 1A56A 1KX2A 1GDVA 3M97X 1CTJA 2ZOOA 4U3FD 3PHLA 1CSUA 5CYTR 1AOFA 2D0SA 4EIEA 2GC7D 3L75D 2Q3EA 2GC4D 1ETPA 155CA 4AANA 2QJPB 1M60A 3JBTB 1NU1D 1FI7A 1VYDA 4JCGA 1CSWA 4J20A 3HQ6A 3O5CA 1AKKA 1CYCA 4N0KA 4FA5A 3HQ9A 4L3HA 4EICA 3A0BV 3CWBD 1COTA 4AAMA 1CRHA 2Y0EA 2PCBB 1GKSA 1PP9D 1DW3A 4MU8A 1M6ZA 5CIDB 1B7VA 5IY51 4WQEA 2CE1A 3H1KD 1H33B 3GW6A 1CIGA 1L9BC 1SQPD 1E8EA 4D6TD 1GU2A 2YIUB 2C1UA 1QKSA 1GIWA 1KYOD 1EB7A 3L4MA 2AI5A 3RLMA 2FRCA 1C6SA 4WQCA 3RN0A 1N15A 2B0ZB 2K9JB 1DVHA 3OCDB 1N50A 2LITA 1C6OA 1RAQA 1W5CT 5TISV 3TF5A 1LMSA 1CCRA 2PCCB 1YIQA 3CYTI 1LC1A 1H32A 1QYZA 1DVVA 1CORA 3GG2A 3SLEA 1E29A 5DFSA 4O1QA 2ZBOA 3HQ8A 351CA 4WQ7A 1KB9D 2JTIB 1IO3A 5CIEB 3CP5A 1SQXD 1HROA 1FI9A 2JWAA 1CCHA 1YEAA 3FWLA 4H0JA 1FOCA 4XXLA 2JQRA 3ZBMA 2CA4B 2N3BA 1YICA 1YNRA 3PXWA 1H1OA 3CXHD 4FA1A 1SQBD 1LC2A 1CC5A 2C2CA 1CXAA 1FCDC 1ZZHA 4Q5PA 4PWAA 1J3SA 1CIFA 5CIBB 2DVHA 5CIGB 5GTHV 5TJHA 1NMLA 2VHDA 4WQ9A 5B6QA 1H31A 1AOQA 5KAIV 3TYIA 3WC8A 1CRCA 3WFEC 3OA8A 2FWLA 5KLVD 1C7MA 2L91A 4UB6V 1KYOW 3WU2V 1KB0A 4AX3A 2D0WA 4PW9B 2B4ZA 1CRGA 3PLNA 3TGUD 1CRIA 1QL3A 3ZOXA 2B10B 5KKZB 2OZ1A 1I55A 4L3GA 2I8FA 5E79V 5CIHB 1NTMD 2ZONG 1QN2A 1H9XA 1I8PA 3H1ID 1C6RA 3WFCC 1EZVD 3H1LD 4RJTA 2V08A 1M70A 2BPBB 2N3YA 1WEJF 1CHHA 1KIBA 3SVWA 1OCDA 4FA9A 4QAOA 3DR0A 5B5EV 5DJQB 4GYDA 2O3JA 2MTAC 3MK7B 1S5LV 4AALA 4WQAA 2Y0DA 1I8OA 2MHMA 1CIEA 1CXCA 5CIFB 3X39A 5GTIV 2QJYB 3SXTA 2C1DA 3CXHW 2N9JA 1IZL0 1R0QA 2ZXYA 3KHUA 2C1VA 4A7PA 1CSXA 1CRJA 4WQ8A 1F1CA 1C2NA 1HZUA 4IL6V 5DF5A 1NMIA 3RMZA 4DY9A 1FI3A 2FYNB 3VNWA 2C8SA 4YE1A 3H1HD 1H9YA 1NTZD 1BE3D 1HJ3A 2QG4A 2GIWA 2B11B 3WUIA 5KAFV 1FJ0A 3VMAA 1H31B 4L1QA 4PD4D 2BH5X 1CTZA 1IQCA 3OA8B 1CHIA 3ZIYA 5C0ZA 1CYJA 3A9FA 1NIRA 1W2LA 2C9XB 3NWVA 1KX7A 1NNOA 4UB8V 1F1FA 4H0KA 2N9IA 1BGYD 3BCCD 5DJQC 1MG3D 2BCNB 2OZ1B 4O1WA 1GJQA 1CSVA 1KV9A 1HH7A 3MK7C 2AIUA 1SQVD 1A2SA 4EIFA 1BCCD 1JDLA 5AURA 451CA 2LIRA 4FB1A 2GB8B 1RZ6A 1I54A 4WQDA 1RAPA 1CTYA 1L0ND 1LS9A 3RN1A 4AAOA 1CHJA 3ZCFA 3L71D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C2R A;  3C2C A;  3WFB C;  4KMG A;  1HCM A;  1HJ4 A;  1A8C A;  1GQ1 A;  2KNC B;  2V07 A;  1C52 A;  2C1D B;  3ZOO A;  1DII C;  2FYU D;  1HJ5 A;  5C9M A;  1IRW A;  2N9Y B;  2CA3 B;  1YCC A;  1I6D A;  3L72 D;  3L74 D;  3HQ7 A;  3NBS A;  3ZOW A;  1L9J C;  1H32 B;  1DW1 A;  5H2F V;  3L4O A;  1N9C A;  5CIC B;  3VYM A;  4LJI A;  3PXT A;  1DW2 A;  1DT1 A;  4NFG B;  1C75 A;  3ZOY A;  1CNO A;  1ZRT D;  4GED B;  3L70 D;  1I6E A;  1IRV A;  1CIH A;  2N18 B;  4Y5R A;  4EDF A;  1RZ5 A;  3PH2 B;  5KLI B;  3O0R C;  3ITK A;  2PAC A;  2XTS B;  3SWS A;  1NTK D;  1K3G A;  4PJ0 V;  2Y0C A;  1YFC A;  1HRC A;  2BLF B;  1U74 B;  2ORL A;  4V2K A;  4XYD B;  3DP5 A;  2BH4 X;  1FHB A;  1P84 D;  3CX5 W;  2IBZ D;  3A0H V;  2YCC A;  1DW0 A;  4K3I A;  4FAN A;  3KZI V;  3WFD C;  2BGV X;  1N90 A;  5EXQ A;  2DGE A;  1CO6 A;  3CU4 A;  1DIQ C;  1H33 A;  2L4D A;  2ZZS 1;  1QL4 A;  1OAE A;  2BCC D;  1SQQ D;  2AXT V;  3PXS A;  1MG2 D;  2RN0 A;  2HV4 A;  4FA4 A;  1I5T A;  1CRY A;  2B12 B;  4P4Q B;  2KS1 A;  2QJK B;  4EID A;  1E2R A;  3L73 D;  3SJL A;  2RMZ A;  3ORV A;  3OCD A;  1PPJ D;  3O20 A;  2CXB A;  2CE0 A;  3NBT A;  1U75 B;  1MZ4 A;  1YTC A;  3H1J D;  2A06 D;  5B66 V;  3PRJ A;  3CX5 D;  1YEB A;  3O1Y A;  1S6V B;  2YQB A;  1AYG A;  1CED A;  4RSZ A;  1LFM A;  2EXV A;  3VRD A;  1K3H A;  3DMI A;  1L0L D;  3PTZ A;  2N18 C;  1BL9 A;  4FAV A;  1CYI A;  3TDK A;  1WVE C;  4WQB A;  1HZV A;  2YK3 A;  1A56 A;  1KX2 A;  1GDV A;  3M97 X;  1CTJ A;  2ZOO A;  4U3F D;  3PHL A;  1CSU A;  5CYT R;  1AOF A;  2D0S A;  4EIE A;  2GC7 D;  3L75 D;  2Q3E A;  2GC4 D;  1ETP A;  155C A;  4AAN A;  2QJP B;  1M60 A;  3JBT B;  1NU1 D;  1FI7 A;  1VYD A;  4JCG A;  1CSW A;  4J20 A;  3HQ6 A;  3O5C A;  1AKK A;  1CYC A;  4N0K A;  4FA5 A;  3HQ9 A;  4L3H A;  4EIC A;  3A0B V;  3CWB D;  1COT A;  4AAM A;  1CRH A;  2Y0E A;  2PCB B;  1GKS A;  1PP9 D;  1DW3 A;  4MU8 A;  1M6Z A;  5CID B;  1B7V A;  5IY5 1;  4WQE A;  2CE1 A;  3H1K D;  1H33 B;  3GW6 A;  1CIG A;  1L9B C;  1SQP D;  1E8E A;  4D6T D;  1GU2 A;  2YIU B;  2C1U A;  1QKS A;  1GIW A;  1KYO D;  1EB7 A;  3L4M A;  2AI5 A;  3RLM A;  2FRC A;  1C6S A;  4WQC A;  3RN0 A;  1N15 A;  2B0Z B;  2K9J B;  1DVH A;  3OCD B;  1N50 A;  2LIT A;  1C6O A;  1RAQ A;  1W5C T;  5TIS V;  3TF5 A;  1LMS A;  1CCR A;  2PCC B;  1YIQ A;  3CYT I;  1LC1 A;  1H32 A;  1QYZ A;  1DVV A;  1COR A;  3GG2 A;  3SLE A;  1E29 A;  5DFS A;  4O1Q A;  2ZBO A;  3HQ8 A;  351C A;  4WQ7 A;  1KB9 D;  2JTI B;  1IO3 A;  5CIE B;  3CP5 A;  1SQX D;  1HRO A;  1FI9 A;  2JWA A;  1CCH A;  1YEA A;  3FWL A;  4H0J A;  1FOC A;  4XXL A;  2JQR A;  3ZBM A;  2CA4 B;  2N3B A;  1YIC A;  1YNR A;  3PXW A;  1H1O A;  3CXH D;  4FA1 A;  1SQB D;  1LC2 A;  1CC5 A;  2C2C A;  1CXA A;  1FCD C;  1ZZH A;  4Q5P A;  4PWA A;  1J3S A;  1CIF A;  5CIB B;  2DVH A;  5CIG B;  5GTH V;  5TJH A;  1NML A;  2VHD A;  4WQ9 A;  5B6Q A;  1H31 A;  1AOQ A;  5KAI V;  3TYI A;  3WC8 A;  1CRC A;  3WFE C;  3OA8 A;  2FWL A;  5KLV D;  1C7M A;  2L91 A;  4UB6 V;  1KYO W;  3WU2 V;  1KB0 A;  4AX3 A;  2D0W A;  4PW9 B;  2B4Z A;  1CRG A;  3PLN A;  3TGU D;  1CRI A;  1QL3 A;  3ZOX A;  2B10 B;  5KKZ B;  2OZ1 A;  1I55 A;  4L3G A;  2I8F A;  5E79 V;  5CIH B;  1NTM D;  2ZON G;  1QN2 A;  1H9X A;  1I8P A;  3H1I D;  1C6R A;  3WFC C;  1EZV D;  3H1L D;  4RJT A;  2V08 A;  1M70 A;  2BPB B;  2N3Y A;  1WEJ F;  1CHH A;  1KIB A;  3SVW A;  1OCD A;  4FA9 A;  4QAO A;  3DR0 A;  5B5E V;  5DJQ B;  4GYD A;  2O3J A;  2MTA C;  3MK7 B;  1S5L V;  4AAL A;  4WQA A;  2Y0D A;  1I8O A;  2MHM A;  1CIE A;  1CXC A;  5CIF B;  3X39 A;  5GTI V;  2QJY B;  3SXT A;  2C1D A;  3CXH W;  2N9J A;  1IZL 0;  1R0Q A;  2ZXY A;  3KHU A;  2C1V A;  4A7P A;  1CSX A;  1CRJ A;  4WQ8 A;  1F1C A;  1C2N A;  1HZU A;  4IL6 V;  5DF5 A;  1NMI A;  3RMZ A;  4DY9 A;  1FI3 A;  2FYN B;  3VNW A;  2C8S A;  4YE1 A;  3H1H D;  1H9Y A;  1NTZ D;  1BE3 D;  1HJ3 A;  2QG4 A;  2GIW A;  2B11 B;  3WUI A;  5KAF V;  1FJ0 A;  3VMA A;  1H31 B;  4L1Q A;  4PD4 D;  2BH5 X;  1CTZ A;  1IQC A;  3OA8 B;  1CHI A;  3ZIY A;  5C0Z A;  1CYJ A;  3A9F A;  1NIR A;  1W2L A;  2C9X B;  3NWV A;  1KX7 A;  1NNO A;  4UB8 V;  1F1F A;  4H0K A;  2N9I A;  1BGY D;  3BCC D;  5DJQ C;  1MG3 D;  2BCN B;  2OZ1 B;  4O1W A;  1GJQ A;  1CSV A;  1KV9 A;  1HH7 A;  3MK7 C;  2AIU A;  1SQV D;  1A2S A;  4EIF A;  1BCC D;  1JDL A;  5AUR A;  451C A;  2LIR A;  4FB1 A;  2GB8 B;  1RZ6 A;  1I54 A;  4WQD A;  1RAP A;  1CTY A;  1L0N D;  1LS9 A;  3RN1 A;  4AAO A;  1CHJ A;  3ZCF A;  3L71 D; 
#chains in the Genus database with same CATH topology
 1H0T B;  3H1K J;  2FYZ A;  4KMG A;  1HCM A;  3B5N A;  1HJ4 A;  2E74 B;  1A8C A;  3H25 A;  1EZV E;  2JJL A;  2QE7 H;  2C1D B;  2QRX A;  1DII C;  1X9V A;  2OTL P;  2FYU D;  2R3C A;  1HJ5 A;  2N9Y B;  1N7L A;  3D71 A;  3L72 E;  4GOE A;  1YCC A;  2C0X A;  4KHX A;  3L74 D;  4H44 C;  1L9J C;  1H32 B;  4R4L A;  3VOP A;  3H1L G;  1GL2 A;  1VQ5 P;  4LJI A;  3W68 A;  2P1J A;  3KXD A;  3ZOY A;  1HTL C;  1CNO A;  5CCG C;  2WPV B;  3JC2 2;  1OZH A;  1LP1 B;  2OTJ P;  5KLI B;  3LID A;  1DX7 A;  1PIX A;  1SQP G;  2E75 C;  1HRC A;  4EI2 A;  3JCU E;  2BLF B;  2ZYA A;  3CC7 P;  1M1J B;  3RL0 D;  1X79 B;  1H89 A;  1G2C B;  5H2F E;  4JPZ B;  3BAS A;  1VQ4 P;  3CX5 W;  2Z5I A;  3H1H E;  3A0H V;  3AEB C;  3KZI V;  3WFD C;  2PGD A;  5GTI E;  2QSI A;  1CO6 A;  1SQP K;  1VQ6 P;  1QL4 A;  1HVV A;  1OAE A;  5CJ4 A;  3CMA P;  3PXS A;  2RN0 A;  1L4A C;  2ZYD A;  1CRY A;  3AE4 C;  1NTZ G;  1RE4 A;  4Y28 J;  3N4X A;  1BE3 G;  2YKP A;  1CI6 B;  2K9J A;  4IFF A;  3B5N B;  2CXB A;  5BU8 B;  3N7N A;  1VDF A;  1MZ4 A;  1JNM A;  3C8V A;  3PJS K;  3D0W A;  2B87 A;  3CX5 E;  2A06 D;  2LKM A;  5KAF E;  1CED A;  3G6E P;  1PGJ A;  4EYY Q;  1DEE G;  1LFM A;  3IF4 A;  1AQT A;  3PTZ A;  1L0L D;  5AW0 B;  5AW8 B;  2Z4E A;  1NTZ K;  3CXH I;  1SVF A;  1HJ0 A;  1PPJ E;  1GL2 B;  1WVE C;  3TDK A;  2YK3 A;  1HJB A;  3CCR P;  1SQV G;  1LWU C;  3M97 X;  3L72 J;  2FYU E;  2OYI A;  2PFX A;  4EIE A;  1VF5 C;  1ETP A;  1L0N G;  3TGU G;  2WZ7 A;  1NU1 D;  1FI7 A;  3L74 E;  4JCG A;  3O5C A;  1CYC A;  1AFO A;  1IFN A;  1SQV K;  4AAM A;  2Y0E A;  1GKS A;  2XKM A;  1M6Z A;  5CID B;  3CCS P;  2CE1 A;  5APT A;  5CBO A;  1L0N K;  1CIG A;  1L9B C;  4BXL A;  4OGQ C;  3H1H J;  2WSC H;  3M06 A;  2W90 A;  2OYH A;  4K35 A;  2JO1 A;  2N9B A;  1GIW A;  1EDI A;  3L4M A;  1C6S A;  3L35 A;  4ZMD A;  1KIL D;  5APX A;  2K9J B;  2KIK A;  3CCM P;  3CC2 P;  3CCU P;  1C6O A;  2W8Z A;  5C39 A;  1RAQ A;  1EDK A;  1LMS A;  2B87 B;  3AEE C;  1S3J A;  1T3U A;  1WRG A;  1LGH B;  1DVV A;  1COR A;  2WIT A;  1KB9 E;  2K1A A;  3MHV A;  5AW7 B;  351C A;  1JOC A;  2BEZ F;  2Q3I A;  5CIE B;  3CP5 A;  1HRO A;  5AW9 B;  1P84 I;  4XXL A;  3ZBM A;  1GTW A;  1FDM A;  1YIC A;  1KOR A;  3O6Q A;  2OYI B;  1VQ7 P;  4M3L A;  1SQB E;  1KQF B;  3V2R A;  3CXH D;  4UB6 H;  3M9H A;  3RL0 g;  1L0L E;  2AXT E;  1FCD C;  2E76 B;  4JYB A;  2N1T C;  1CIF A;  1KMI Z;  1SS1 A;  4JBZ A;  1RF1 C;  1SP4 A;  2FYU J;  5GTH V;  4WB4 A;  1Q90 D;  1VQM P;  2E5T A;  1IFJ A;  1AOQ A;  5AW6 B;  1D7M A;  1WT6 A;  3L74 J;  3Q3D A;  3OA8 A;  1C7M A;  3Q5S A;  2L91 A;  5CCG A;  3WU2 V;  3V4W A;  1NU1 E;  2D0W A;  1CRG A;  3PLN A;  5APY A;  2B89 A;  1CRI A;  1QL3 A;  1FDI A;  1AVO A;  3ZOX A;  4HYT B;  1GW4 A;  2OYH B;  1S5L H;  2I8F A;  3HD7 C;  3GHG C;  1NTM D;  1QN2 A;  1HGV A;  1C6R A;  1M70 A;  3O8Z A;  4I2L C;  1CHH A;  1KIB A;  1OCD A;  1SFC C;  4FA9 A;  1K04 A;  4QAO A;  1N73 C;  1T3J A;  3GMA A;  2QVA A;  3AE5 C;  2GA1 A;  3CD6 P;  4WY4 C;  2MHM A;  3X39 A;  3H1K G;  3RK2 B;  4Y99 B;  1NTK G;  3A0B E;  2PRR A;  1FZB A;  3CXH W;  4PV1 B;  2D2C D;  3O6Q B;  4A7P A;  2WWW A;  1GZL A;  1CSX A;  2KOG A;  1F1C A;  3I55 P;  3OW2 O;  2LXC B;  1JO5 A;  1JEK A;  2IBZ G;  4DY9 A;  4YE1 A;  1U7J A;  4W7Y A;  1NTK K;  1SQB J;  4H44 B;  2GIW A;  2B11 B;  4XA4 A;  3VMA A;  1L0L J;  2BH5 X;  5AW4 B;  1CTZ A;  4H0L C;  2O1J A;  2HG5 D;  3OA8 B;  3ZIY A;  2AEM A;  5C0Z A;  3A9F A;  3CXH E;  5AVQ B;  3OJA B;  3QH9 A;  1QL2 A;  1K73 Q;  2IFN A;  2V7Q J;  1SQX G;  3NWV A;  1KX7 A;  2J58 A;  3MZW B;  1NNO A;  1T8Z A;  1F1F A;  2E75 B;  2KZI A;  4IL6 E;  4BWN A;  2N9I A;  1BGY D;  5DJQ C;  1FZF A;  1K9M Q;  1J1E C;  3B8E B;  3B5N D;  2H8P D;  3WUV A;  2G3A A;  3MK7 C;  1S5L X;  1NU1 J;  3H6P A;  3RK3 C;  2YMK A;  3S4R A;  1ZME C;  1JDL A;  3PH0 A;  5AUR A;  451C A;  4IFM A;  1ZR4 A;  1GD2 E;  4WBA A;  1W5C E;  2ZVO B;  2GB8 B;  1RZ6 A;  1I54 A;  1SQX K;  3Q1M A;  2QA4 P;  1RAP A;  3L71 E;  2KLV A;  1LS9 A;  3RN1 A;  4AAO A;  2WT7 A;  1ZLL A;  1CHJ A;  1C2R A;  2Q1K A;  3WFB C;  5APV A;  3KDP B;  1BDC A;  5KLV G;  2V07 A;  2R5D A;  4IL6 X;  3AED C;  4NPD A;  4C7R A;  5AVR B;  5C9M A;  1VQN P;  1IRW A;  5KAI E;  4YPC A;  2OTK E;  2M8R A;  1I6D A;  3AEF C;  3L72 D;  2K9Y A;  3ZOW A;  3HQ7 A;  2KB7 P;  1DW1 A;  3H1I G;  5CIC B;  3CWB G;  1EZV G;  3VYM A;  4ASW A;  1DT1 A;  1A02 F;  3L70 E;  1C75 A;  4GIF A;  5KLV K;  4GED B;  1LT9 C;  1IRV A;  5E79 E;  4EDF A;  1RZ5 A;  2P2U A;  3O0R C;  3KZI H;  2PAC A;  2XTS B;  3T97 A;  3SWS A;  3V6I A;  4GOD A;  2Y0C A;  4IOI H;  1R8E A;  2W6J H;  2FFD C;  1LTS C;  2ORL A;  4V2K A;  5CCH C;  2IDB A;  3SWK A;  1P84 E;  1VF5 B;  2MKV A;  1RQV A;  3P8M C;  5BU5 A;  1FHB A;  1JM0 A;  3I56 P;  1M8O B;  1GW3 A;  2JDI H;  1DW0 A;  4K3I A;  2WTY A;  2ZT9 C;  1N90 A;  2N1T A;  2W27 A;  1DIQ C;  1H33 A;  2L4D A;  2R3S A;  1JB0 J;  1MG2 D;  3AE9 C;  2Y9Z A;  2XU6 A;  4HB1 A;  2NPS D;  1G1I A;  3H1H G;  4P4Q B;  1FE6 A;  1MFT A;  1VPC A;  3SWY A;  1BGY E;  3L73 E;  2WT7 B;  4HKZ H;  1EQ7 A;  1YI2 P;  3AEA C;  1FZC C;  1DD3 A;  1CW5 A;  1QEX A;  2O01 H;  3A0H E;  4OGQ B;  4H13 C;  1U75 B;  2OYO A;  1JTH A;  1YTC A;  3H1J D;  2QIW A;  3PRJ A;  3VP8 A;  1AA0 A;  3HD7 A;  3CX5 D;  3GHG A;  3L71 J;  2QEX P;  1GK6 A;  4LGD E;  2YQB A;  1AYG A;  3MIW A;  1MZ9 A;  2N18 C;  1JCD A;  1SFC A;  2IPP A;  1N73 A;  4FAV A;  2KSJ A;  1HZV A;  1KC8 Q;  4UB8 E;  1BCC G;  3OA7 A;  1GDV A;  4WWI A;  3RL0 C;  4JF7 A;  1CTJ A;  2ZOO A;  4I7Z C;  4WY4 A;  5CYT R;  3L75 D;  2M3B A;  2Q3E A;  3T97 B;  2E42 A;  2MJZ A;  155C A;  2AXC A;  1X8Y A;  3JBT B;  1PPJ G;  3L70 J;  4J20 A;  1AKK A;  3IAO A;  1EDJ A;  1OW7 A;  3A2A A;  1EXJ A;  4L3H A;  1ZOY C;  1E5W A;  4EIC A;  2FYU G;  1PP9 E;  5CJ0 A;  1N7S D;  1IJD B;  1CRH A;  5KJ7 D;  3E7K A;  3U1C A;  2HYN A;  3VTP C;  4MU8 A;  1LJ2 A;  2N1T B;  2QJK C;  1NAY A;  1H33 B;  1IFD A;  1SQP D;  4D6T E;  1IFI A;  1GU2 A;  4ZKU A;  3P32 A;  5KTB A;  2C1U A;  1QKS A;  1EB7 A;  3RLM A;  2FRC A;  4C7N A;  3RBZ A;  1N15 A;  1YYC A;  1HUC A;  1DVH A;  1M56 D;  1JTH B;  4KT0 J;  2CPB A;  4PV1 D;  4DJG A;  1CCR A;  1NGM B;  3IFM A;  1RQU A;  3HD7 B;  4GT1 A;  3GHG B;  1BGY J;  3L73 J;  3SLE A;  2KSE A;  1KB9 D;  4ASV A;  1SFC B;  1FOS F;  3SSU A;  3R4Y A;  1IO3 A;  1N73 B;  2QJP C;  3VP9 A;  5GTH H;  1CCH A;  2HPC A;  1DIP A;  3H1J E;  1BDD A;  4WY4 B;  3ABV C;  3MGN A;  3EQ2 A;  1SQB D;  5CCG D;  3TSI A;  2C2C A;  2W83 C;  3WU2 H;  4EIJ A;  3AE8 C;  2R5B A;  3BCC G;  1YIT P;  4PWA A;  1FZA A;  1RH5 B;  3A3Y B;  2A06 G;  3KPE A;  2J59 M;  3I5C A;  1H31 A;  3WC8 A;  3GF7 A;  3L75 E;  1L0L G;  4I1L A;  1NJI Q;  2KXP B;  2FWL A;  1KIL C;  2IYP A;  1LT9 A;  3P8C E;  1LNQ A;  2B4Z A;  1PP9 J;  3TGU D;  3L37 A;  2NRG A;  4H0L B;  2FFD A;  2OZ1 A;  3S1K A;  5CIH B;  4C7N B;  1S9K D;  1PZQ A;  3MD0 A;  3H1L E;  4GDO A;  3VMY A;  5GTH E;  4KJM A;  5CCH A;  3WFC C;  4RJT A;  3G71 P;  3LW5 J;  2BPB B;  4D6T J;  1NU1 G;  1L0L K;  3CCQ P;  4DZO A;  5DJQ B;  2M5A A;  1SQP E;  2O1K A;  2ZVN B;  4GYD A;  1J1E B;  1L2P A;  4IFD K;  4L74 A;  2R32 A;  2ZJS E;  2OAR A;  3NFQ A;  2QM7 A;  1YJN P;  3MK7 B;  4WQA A;  2NZ2 A;  3RK3 B;  1I8O A;  1URQ C;  1ZXG A;  1EC5 A;  5GTI V;  4HH2 A;  2R44 A;  2HPC B;  2KP8 A;  1NU1 K;  1OFC X;  1S4X A;  2YO2 A;  1R0Q A;  4I6M C;  2E43 A;  4JYC A;  1FZC A;  2XDJ A;  1CRJ A;  5AVX B;  5AW3 B;  2ZXE B;  1KN7 A;  5DF5 A;  1Y47 A;  2B9B A;  1FI3 A;  1HF9 A;  3H1J J;  1NTZ E;  1KYO I;  1LTG C;  1H9Y A;  3G3Z A;  2GUS A;  1RF0 C;  5KAF V;  1H31 B;  4L1Q A;  2IBZ I;  1S2E A;  3CCV P;  5KKZ C;  2YKO A;  4W80 A;  1LT9 B;  2C9N Y;  2K3R A;  3BAT A;  1NKN A;  3F89 A;  1KTM A;  1JY2 P;  3HUS C;  1W2B O;  2BCN B;  3L75 J;  2FFD B;  2OZ1 B;  1GJQ A;  1KV9 A;  1HH7 A;  4OGQ D;  1U57 A;  3BVH A;  1OW8 A;  1SQV E;  1VQO P;  4N78 E;  3AEC C;  4C46 A;  1IK7 A;  2M5A B;  4FB1 A;  3AE3 C;  5KLI C;  3FXE A;  1L0N E;  2ZT9 B;  4WQD A;  2YO3 A;  3H1L J;  4ZNC A;  3TGU E;  1ZR2 A;  1CTY A;  1YTZ T;  2D2C C;  2LXB A;  3ZCF A;  3L71 D;  3CCE P;  2SPZ A;  1S9K E;  1Q86 Q;  1GU5 A;  5APQ A;  4U3F G;  4AUW A;  3GLM A;  1C52 A;  2E74 D;  1SQP J;  3CPW O;  3WUU A;  3F5H A;  1H88 A;  3D6Y A;  1JY3 P;  1VL2 A;  3M0A A;  2P10 A;  3MP7 B;  2CA3 B;  5AW5 B;  2FYN C;  1FZC B;  2Q9I A;  5CMZ A;  2B88 A;  4H13 B;  3NBS A;  4UB6 E;  1NTM G;  3CC4 P;  1NH4 A;  3L4O A;  1N9C A;  1ZRT E;  2WSF H;  1L4A A;  3L70 D;  1OVR A;  1I6E A;  4GKG A;  2N18 B;  4Y5R A;  1YJW P;  1IO4 A;  3GF3 A;  2FY8 A;  3V4Q A;  2N1T D;  5TIS H;  1EZV I;  3FGA D;  4OH8 B;  1NTK D;  1K3G A;  4PJ0 V;  2IX7 C;  3KQG A;  1NTZ J;  1YQ4 C;  1NTM K;  4I7Z B;  1QVG O;  1FAV A;  1KD1 Q;  3AE6 C;  1S5L E;  1JMB A;  1P84 D;  2IBZ D;  1WMK A;  5EFW B;  1KFM A;  4FAN A;  2BGV X;  3RGU A;  2DGE A;  2ZZS 1;  3E1R A;  2BCC D;  2WSC J;  1SQQ D;  2AXT V;  3HD7 D;  1JCC A;  2HV4 A;  4BRY A;  1LWU A;  2P7J A;  1OVV A;  1I5T A;  1LTJ C;  2POH A;  2B12 B;  3PP5 A;  1SFC D;  5K5G B;  2QJK B;  1SQV J;  1KIL A;  4EID A;  3MTU E;  3L73 D;  1H8A A;  3SJL A;  3ORV A;  4HJG H;  1E79 H;  3NMD A;  2CE0 A;  3NBT A;  2H7H A;  1PGP A;  5B66 V;  1L0N J;  5AW1 B;  3TGU J;  3O1Y A;  1IC2 A;  1YIJ P;  1S6V B;  2G8Y A;  4PD4 I;  5DJT B;  1LTB C;  1BGY G;  3KYQ A;  3VRD A;  3DMI A;  1BL9 A;  1KYO H;  4EOT A;  1NVO A;  2KK7 A;  2I8D A;  1GL2 D;  1UII A;  2BEQ D;  1L4A B;  2WVR A;  1URQ A;  3U59 A;  1VQ9 P;  2WPS A;  1VQP P;  3V5B A;  5B5E H;  3AE2 C;  2QJP B;  1FZE A;  1AJY A;  1VYD A;  3HQ6 A;  4N0K A;  1U7M A;  2AEF A;  4FA5 A;  2YMY A;  3A0B V;  3CWB D;  2RH0 A;  2CK3 H;  2NPS C;  2YXQ B;  1PP9 D;  3FWN A;  3IR9 A;  3L72 G;  1NTK E;  3WMM 0;  1FJP A;  1IZN B;  1J2J B;  3RBX A;  3VN0 A;  1E8E A;  4DOJ A;  4BRY B;  1Q2N A;  1RF0 A;  1LWU B;  4D6T D;  1N8R Q;  1JMM A;  3RK3 D;  1GMJ A;  1MV8 A;  3RN0 A;  1KIL B;  2B0Z B;  2IBZ E;  1LTT C;  1IFP A;  1N50 A;  3ZDM A;  3M9Q A;  1W5C T;  5TIS V;  3TF5 A;  3HUS A;  2PCC B;  1YIQ A;  2BCC E;  1SQQ E;  1RF1 A;  1LC1 A;  1H32 A;  2FXP A;  3GG2 A;  2WSF J;  1LTI C;  5DFS A;  2JP3 A;  4TT3 H;  5APU A;  2ZBO A;  3HQ8 A;  4WQ7 A;  1CZQ A;  2JTI B;  1PL5 A;  1SQX E;  1USD A;  2JWA A;  1FI9 A;  2WSE H;  1YEA A;  3II6 A;  3FWL A;  4H0J A;  5AVY B;  3HE5 A;  2OQQ A;  1FOC A;  2OYH C;  3SFD C;  2JQR A;  1GDT A;  2CA4 B;  2N3B A;  1URQ B;  3KZI E;  1YNR A;  1ZW0 A;  1N7S C;  5KJ7 C;  1H1O A;  4FA1 A;  1CC5 A;  1CXA A;  1JY2 O;  4Q5P A;  4NPF X;  1A02 J;  1PV3 A;  2E76 D;  2DVH A;  5CIG B;  1T2K D;  3U1A A;  1DD4 A;  1IK9 A;  1QLE D;  4WQ9 A;  1YBK A;  1K8A Q;  2VRS A;  5KAI V;  3TYI A;  1NYH A;  2YIU C;  5KLV E;  3WFE C;  2GM4 A;  3JCU H;  1RY3 A;  2L5G B;  3EFF K;  3P7K A;  1KB0 A;  1XTC C;  3P8C D;  2Z5H A;  4PV1 C;  5H2F H;  4TLF A;  5KKZ B;  3QWO C;  1NWQ A;  2JWD A;  1I55 A;  5E79 V;  3H1I E;  3CWB E;  1NTK J;  3L75 G;  1JY3 O;  1H9X A;  1OIP A;  2HOD A;  3H1L D;  5GTI H;  4XE5 B;  1Q81 Q;  2N3Y A;  4PD4 H;  1WEJ F;  3G4S P;  4CPG A;  4W7Z A;  3SVW A;  1N86 A;  3HUS B;  3DR0 A;  5B5E V;  3L74 G;  2C0W A;  1QL1 A;  1RF1 B;  3L36 A;  1K05 A;  3S9O A;  2O3J A;  4H13 D;  1Y8A A;  2MTA C;  1EDL A;  3RK3 E;  4L76 A;  4AAL A;  4U7J A;  3EWK A;  2Q5U A;  3CME P;  2HFE D;  2WPR A;  1FOS E;  2DW3 A;  1LTJ A;  1CIE A;  1CXC A;  5CIF B;  3EFG A;  2FYU K;  2KNC A;  2BCC J;  1SQQ J;  3RK2 D;  3CX5 H;  1J1D C;  3HE5 B;  2D2C B;  1IZL 0;  2ZXX A;  5KAF H;  2ZXY A;  3KHU A;  3TYY A;  2XZR A;  4WQ8 A;  2CPS A;  1SQX J;  3HE4 A;  3C9I A;  3L4F A;  2A45 G;  3RMZ A;  2FXO A;  2FYN B;  2C8S A;  1NTZ D;  2GUV A;  3Q5P A;  1BE3 D;  1HJ3 A;  2E5Y A;  4PD4 E;  4DCK A;  3WUI A;  1FJ0 A;  2LR2 A;  4H44 D;  1CHI A;  2K88 A;  1CYJ A;  4ZKP A;  5AVS B;  1PFI A;  1QVF O;  1W2L A;  2C9X B;  4UB8 V;  1FZG A;  3BCC D;  2E75 D;  2IYO A;  5KLV J;  4O1W A;  1CSV A;  1IFM A;  1MUU A;  2HOD B;  5APW A;  3HTK A;  2AIU A;  1BCC E;  1SQB G;  1SQV D;  4EIF A;  2JKV A;  2M3E A;  4N78 D;  2NPS A;  2QJY C;  2RKL A;  3H1I J;  3CWB J;  2PAJ A;  2XV5 A;  2WSE J;  3SFE C;  2ZAE B;  3SWF A;  1L0N D;  2O01 J;  2A45 H;  2KI7 B;  1OMI A;  5BVZ A;  1AQ5 A;  3C2C A;  5AVT B;  2V4H A;  4NPE A;  1X0T A;  1LTJ B;  1MFZ A;  1L4A D;  2YNY A;  1GQ1 A;  2KNC B;  4RO0 A;  2P58 A;  2C9L Y;  3K5B A;  3ZOO A;  1SQB K;  3Q2Y A;  2H43 A;  2ITA A;  3JSV C;  1RE3 C;  1ZN5 A;  4PJ0 H;  3HRN A;  1KB9 H;  1QGK B;  3HE4 B;  5H2F V;  1NAF A;  1RHZ B;  3H32 A;  3NTN A;  3WU2 E;  1XTG B;  3PXT A;  1DW2 A;  4NFG B;  2Y9Y A;  3R2P A;  1Z56 A;  1ZRT D;  1QX8 A;  1CIH A;  3PH2 B;  4LC1 A;  3ITK A;  2UWJ E;  3M0D C;  1AVY A;  2WQY C;  1YFC A;  2IFM A;  1VQ8 P;  2JEE A;  2H89 C;  2AXT H;  1U74 B;  1OWA A;  4XYD B;  2KLU A;  1UIX A;  3TNU A;  3DP5 A;  2BH4 X;  2PP6 A;  1N7S A;  5KJ7 A;  1VF5 D;  2V7Q H;  4K3A A;  4N6J A;  2YCC A;  1BE3 E;  1S72 P;  1R5S A;  5EXQ A;  3V2Q A;  1KZU B;  3HTK B;  3G9R A;  4OWF A;  3USS A;  3CU4 A;  5B66 H;  1BSH A;  1YQ3 C;  2WSS H;  4PJ0 E;  2BAS A;  4FA4 A;  2NPS B;  2E74 C;  5AVU B;  1OX3 A;  2KS1 A;  2IZ0 A;  1AV1 A;  1BCC J;  3BCC E;  5AW2 B;  2ZYG A;  1E2R A;  2RMZ A;  3OCD A;  1FC2 C;  1M7L A;  3O20 A;  5AVV B;  2YKQ A;  2KYV A;  3V2P A;  3CCJ P;  2A06 E;  2H88 C;  1URQ D;  1YEB A;  2HLO A;  1JY2 N;  2FKW B;  4RSZ A;  5L8R J;  1USE A;  1VQL P;  2EXV A;  1K3H A;  1YJ9 P;  2WPQ A;  1GK4 A;  3A5T A;  3H32 B;  4B86 A;  4Z1M H;  1CYI A;  1R5L A;  4WQB A;  3BRT B;  2ZFC A;  1A56 A;  1KX2 A;  3A0B H;  4RKU J;  1M1J C;  3MUD C;  3OAK A;  4U3F D;  3PHL A;  1CSU A;  1AOF A;  4O9B A;  2D0S A;  2GC7 D;  2GC4 D;  2XND H;  1NOH A;  5B66 E;  3VMZ A;  4AAN A;  1X22 A;  1LTA C;  2WMM A;  1M60 A;  3L71 G;  3M9B A;  3B4S A;  1CSW A;  3Q5R A;  3TNU B;  3HQ9 A;  1JY3 N;  1N7S B;  1ZV8 A;  1COT A;  3CI9 A;  2PCB B;  1DW3 A;  3AE7 C;  1KQS O;  1B7V A;  5IY5 1;  4WQE A;  3H1K D;  1MKM A;  1KQL A;  2I1J A;  3GW6 A;  3CXH H;  3M91 A;  1S1C X;  1Y9B A;  3B5N C;  3RL0 B;  1BE3 J;  2YIU B;  4IL6 H;  3L70 G;  1HBW A;  1KYO D;  2KS1 B;  2AI5 A;  2FBW C;  1KIL E;  4WQC A;  3TK1 A;  4XFJ A;  3OCD B;  2LIT A;  4JQ0 D;  3CYT I;  1GL2 C;  1KQG B;  1TU3 F;  4AYC A;  3AE1 C;  1QYZ A;  3BCC J;  1E29 A;  5M1B A;  4O1Q A;  1W2E A;  2IZ1 A;  1NO4 A;  3VMX A;  2HR3 A;  4YXD C;  1M1K Q;  3C1L A;  1Q82 Q;  1SQX D;  2BCC G;  1SQQ G;  2QM8 A;  4L75 A;  4YXW H;  2Q6Q A;  2J5U A;  5KAI H;  1G1J A;  5TIS E;  3PXW A;  4WY4 D;  1FJK A;  1LC2 A;  1ZZH A;  1J1D B;  3L73 G;  1HH0 A;  1M90 Q;  1FBM A;  3UIA A;  1J3S A;  5CIB B;  1RE3 A;  3LIE A;  1FDO A;  5TJH A;  5AVZ B;  2YXR B;  5E79 H;  1NML A;  2VHD A;  1SQQ K;  2W6B A;  5B6Q A;  4U3F E;  1GU4 A;  1NKZ B;  4N3Y B;  1RE4 C;  3B71 A;  4MN4 C;  1CRC A;  5KLV D;  4UB6 V;  2XNX A;  1KYO W;  4AX3 A;  3CX5 I;  3CCL P;  4PW9 B;  1PGQ A;  1P84 H;  3M0D A;  2B10 B;  1T6A A;  4R4M A;  1NTM E;  1OW6 A;  4L3G A;  1CSB A;  4H0L D;  1LT1 A;  2ZON G;  1M57 D;  1I8P A;  3H1I D;  1EZV D;  2V08 A;  3V2N A;  3D70 A;  3H1K E;  1BSN A;  1OVU A;  3AEG C;  2O01 N;  1SLQ A;  2W6A A;  4LLH A;  1Q7Y Q;  1KV4 A;  1S5L V;  2Q7C A;  1DH3 A;  3CL3 D;  2Y0D A;  3BRV B;  2M0B A;  1PP9 G;  1KYO E;  1H0T A;  2OYI C;  3D6Z A;  1FU1 A;  3A0H H;  2QJY B;  3SXT A;  2AEJ A;  2C1D A;  5CBN A;  2N9J A;  1NHL A;  2E76 C;  3CLQ A;  4D6T G;  1T2K C;  2C1V A;  3FX0 A;  3A7O A;  3FXD A;  4YTP C;  4WVZ A;  5B5E E;  2KUB A;  3NXS A;  1C2N A;  1OXZ A;  1HZU A;  4IL6 V;  1NMI A;  4GOF A;  5CHX A;  4UB8 H;  1HGZ A;  3E1I A;  3VNW A;  3H1H D;  1JUN A;  2QG4 A;  1YHQ P;  1VQK P;  1LP1 A;  3VYI A;  2K37 A;  1KFN A;  2A45 I;  4PD4 D;  1YTZ I;  1IQC A;  3W67 A;  1EXI A;  1M1J A;  3MUD A;  1NIR A;  1G2C A;  4DT0 A;  2FXM A;  1FS0 E;  5APS A;  3WUT A;  4H0K A;  4OVN F;  4L73 A;  1DEB A;  4QMA A;  4U3F J;  5DJU B;  1MG3 D;  1KB9 I;  2I1K A;  3H1J G;  3IN6 A;  1HWT C;  1PGO A;  5CCH D;  1ZP0 C;  1A2S A;  1BCC D;  2OGU A;  2KZJ A;  3LW5 H;  2P67 A;  2LIR A;  1N2D C;  1NTM J;  4RES B;  3RK2 C;  5AVW B;  4Y99 C;  2ZT9 D;  1CI6 A;  2JR8 A;  1PPJ D;  4AQR D; 
#chains in the Genus database with same CATH homology
 1C2R A;  3C2C A;  3WFB C;  4KMG A;  1HCM A;  1HJ4 A;  1A8C A;  1GQ1 A;  2KNC B;  2V07 A;  1C52 A;  2C1D B;  3ZOO A;  1DII C;  2FYU D;  1HJ5 A;  5C9M A;  1IRW A;  2N9Y B;  2CA3 B;  1YCC A;  1I6D A;  3L72 D;  3L74 D;  3HQ7 A;  3NBS A;  3ZOW A;  1L9J C;  1H32 B;  1DW1 A;  5H2F V;  3L4O A;  1N9C A;  5CIC B;  3VYM A;  4LJI A;  3PXT A;  1DW2 A;  1DT1 A;  4NFG B;  1C75 A;  3ZOY A;  1CNO A;  1ZRT D;  4GED B;  3L70 D;  1I6E A;  1IRV A;  1CIH A;  2N18 B;  4Y5R A;  4EDF A;  1RZ5 A;  3PH2 B;  5KLI B;  3O0R C;  3ITK A;  2PAC A;  2XTS B;  3SWS A;  1NTK D;  1K3G A;  4PJ0 V;  2Y0C A;  1YFC A;  1HRC A;  2BLF B;  1U74 B;  2ORL A;  4V2K A;  4XYD B;  3DP5 A;  2BH4 X;  1FHB A;  1P84 D;  3CX5 W;  2IBZ D;  3A0H V;  2YCC A;  1DW0 A;  4K3I A;  4FAN A;  3KZI V;  3WFD C;  2BGV X;  1N90 A;  5EXQ A;  2DGE A;  1CO6 A;  3CU4 A;  1DIQ C;  1H33 A;  2L4D A;  2ZZS 1;  1QL4 A;  1OAE A;  2BCC D;  1SQQ D;  2AXT V;  3PXS A;  1MG2 D;  2RN0 A;  2HV4 A;  4FA4 A;  1I5T A;  1CRY A;  2B12 B;  4P4Q B;  2KS1 A;  2QJK B;  4EID A;  1E2R A;  3L73 D;  3SJL A;  2RMZ A;  3ORV A;  3OCD A;  1PPJ D;  3O20 A;  2CXB A;  2CE0 A;  3NBT A;  1U75 B;  1MZ4 A;  1YTC A;  3H1J D;  2A06 D;  5B66 V;  3PRJ A;  3CX5 D;  1YEB A;  3O1Y A;  1S6V B;  2YQB A;  1AYG A;  1CED A;  4RSZ A;  1LFM A;  2EXV A;  3VRD A;  1K3H A;  3DMI A;  1L0L D;  3PTZ A;  2N18 C;  1BL9 A;  4FAV A;  1CYI A;  3TDK A;  1WVE C;  4WQB A;  1HZV A;  2YK3 A;  1A56 A;  1KX2 A;  1GDV A;  3M97 X;  1CTJ A;  2ZOO A;  4U3F D;  3PHL A;  1CSU A;  5CYT R;  1AOF A;  2D0S A;  4EIE A;  2GC7 D;  3L75 D;  2Q3E A;  2GC4 D;  1ETP A;  155C A;  4AAN A;  2QJP B;  1M60 A;  3JBT B;  1NU1 D;  1FI7 A;  1VYD A;  4JCG A;  1CSW A;  4J20 A;  3HQ6 A;  3O5C A;  1AKK A;  1CYC A;  4N0K A;  4FA5 A;  3HQ9 A;  4L3H A;  4EIC A;  3A0B V;  3CWB D;  1COT A;  4AAM A;  1CRH A;  2Y0E A;  2PCB B;  1GKS A;  1PP9 D;  1DW3 A;  4MU8 A;  1M6Z A;  5CID B;  1B7V A;  5IY5 1;  4WQE A;  2CE1 A;  3H1K D;  1H33 B;  3GW6 A;  1CIG A;  1L9B C;  1SQP D;  1E8E A;  4D6T D;  1GU2 A;  2YIU B;  2C1U A;  1QKS A;  1GIW A;  1KYO D;  1EB7 A;  3L4M A;  2AI5 A;  3RLM A;  2FRC A;  1C6S A;  4WQC A;  3RN0 A;  1N15 A;  2B0Z B;  2K9J B;  1DVH A;  3OCD B;  1N50 A;  2LIT A;  1C6O A;  1RAQ A;  1W5C T;  5TIS V;  3TF5 A;  1LMS A;  1CCR A;  2PCC B;  1YIQ A;  3CYT I;  1LC1 A;  1H32 A;  1QYZ A;  1DVV A;  1COR A;  3GG2 A;  3SLE A;  1E29 A;  5DFS A;  4O1Q A;  2ZBO A;  3HQ8 A;  351C A;  4WQ7 A;  1KB9 D;  2JTI B;  1IO3 A;  5CIE B;  3CP5 A;  1SQX D;  1HRO A;  1FI9 A;  2JWA A;  1CCH A;  1YEA A;  3FWL A;  4H0J A;  1FOC A;  4XXL A;  2JQR A;  3ZBM A;  2CA4 B;  2N3B A;  1YIC A;  1YNR A;  3PXW A;  1H1O A;  3CXH D;  4FA1 A;  1SQB D;  1LC2 A;  1CC5 A;  2C2C A;  1CXA A;  1FCD C;  1ZZH A;  4Q5P A;  4PWA A;  1J3S A;  1CIF A;  5CIB B;  2DVH A;  5CIG B;  5GTH V;  5TJH A;  1NML A;  2VHD A;  4WQ9 A;  5B6Q A;  1H31 A;  1AOQ A;  5KAI V;  3TYI A;  3WC8 A;  1CRC A;  3WFE C;  3OA8 A;  2FWL A;  5KLV D;  1C7M A;  2L91 A;  4UB6 V;  1KYO W;  3WU2 V;  1KB0 A;  4AX3 A;  2D0W A;  4PW9 B;  2B4Z A;  1CRG A;  3PLN A;  3TGU D;  1CRI A;  1QL3 A;  3ZOX A;  2B10 B;  5KKZ B;  2OZ1 A;  1I55 A;  4L3G A;  2I8F A;  5E79 V;  5CIH B;  1NTM D;  2ZON G;  1QN2 A;  1H9X A;  1I8P A;  3H1I D;  1C6R A;  3WFC C;  1EZV D;  3H1L D;  4RJT A;  2V08 A;  1M70 A;  2BPB B;  2N3Y A;  1WEJ F;  1CHH A;  1KIB A;  3SVW A;  1OCD A;  4FA9 A;  4QAO A;  3DR0 A;  5B5E V;  5DJQ B;  4GYD A;  2O3J A;  2MTA C;  3MK7 B;  1S5L V;  4AAL A;  4WQA A;  2Y0D A;  1I8O A;  2MHM A;  1CIE A;  1CXC A;  5CIF B;  3X39 A;  5GTI V;  2QJY B;  3SXT A;  2C1D A;  3CXH W;  2N9J A;  1IZL 0;  1R0Q A;  2ZXY A;  3KHU A;  2C1V A;  4A7P A;  1CSX A;  1CRJ A;  4WQ8 A;  1F1C A;  1C2N A;  1HZU A;  4IL6 V;  5DF5 A;  1NMI A;  3RMZ A;  4DY9 A;  1FI3 A;  2FYN B;  3VNW A;  2C8S A;  4YE1 A;  3H1H D;  1H9Y A;  1NTZ D;  1BE3 D;  1HJ3 A;  2QG4 A;  2GIW A;  2B11 B;  3WUI A;  5KAF V;  1FJ0 A;  3VMA A;  1H31 B;  4L1Q A;  4PD4 D;  2BH5 X;  1CTZ A;  1IQC A;  3OA8 B;  1CHI A;  3ZIY A;  5C0Z A;  1CYJ A;  3A9F A;  1NIR A;  1W2L A;  2C9X B;  3NWV A;  1KX7 A;  1NNO A;  4UB8 V;  1F1F A;  4H0K A;  2N9I A;  1BGY D;  3BCC D;  5DJQ C;  1MG3 D;  2BCN B;  2OZ1 B;  4O1W A;  1GJQ A;  1CSV A;  1KV9 A;  1HH7 A;  3MK7 C;  2AIU A;  1SQV D;  1A2S A;  4EIF A;  1BCC D;  1JDL A;  5AUR A;  451C A;  2LIR A;  4FB1 A;  2GB8 B;  1RZ6 A;  1I54 A;  4WQD A;  1RAP A;  1CTY A;  1L0N D;  1LS9 A;  3RN1 A;  4AAO A;  1CHJ A;  3ZCF A;  3L71 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...