1SQVD

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 48
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqvD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqvD02
3CWBD 5DFSA 1FI9A 1N15A 1L0ND 2B4ZA 1LS9A 1H31B 1CHIA 1C7MA 1PP9D 4H0KA 2FRCA 3A9FA 1S5LV 2BPBB 3MK7C 1L0LD 1DIQC 2B12B 4RJTA 1BE3D 2Y0DA 2ZBOA 3TDKA 3PLNA 2N3BA 3VRDA 4WQEA 3ZBMA 5GTHV 4EIDA 3KZIV 2CXBA 1C2NA 2PCBB 3O5CA 2O3JA 1SQQD 1H9XA 1MG2D 3C2CA 2B11B 2N3YA 3CX5W 1CIGA 1YTCA 1NIRA 2CE1A 3CYTI 2IBZD 3NWVA 2BCCD 4AAMA 1GJQA 1DVHA 5CIEB 4K3IA 5CIFB 2DGEA 1A56A 1NNOA 1CHHA 1C52A 3WFBC 3OA8A 1N90A 3TYIA 4WQBA 3ORVA 1NTMD 3L71D 1CORA 3ZIYA 2I8FA 1YEBA 2AIUA 1HJ5A 1LMSA 1I6EA 4AANA 3HQ9A 451CA 1BGYD 5E79V 1H1OA 3FWLA 1JDLA 1KB0A 2YCCA 1DIIC 1K3HA 1KV9A 3OCDA 1DVVA 1A2SA 3WU2V 4RSZA 2D0SA 4P4QB 3CU4A 1IZL0 1EB7A 4FAVA 1AOFA 1K3GA 2BGVX 1IQCA 5DF5A 1H31A 2B10B 1OAEA 3ZOOA 2B0ZB 1LC1A 3JBTB 2QJPB 2A06D 3VNWA 3ZOXA 4QAOA 1DW1A 3X39A 2Y0EA 2CA3B 3L73D 2GC4D 3DMIA 1DW0A 3A0BV 2L4DA 2Q3EA 4N0KA 3A0HV 1CIEA 5CIHB 1H32B 1I6DA 1AYGA 3TF5A 2VHDA 3H1ID 2MHMA 1QKSA 1IRWA 1MZ4A 2DVHA 3PXTA 5IY51 1HCMA 2GC7D 2ZXYA 4PD4D 4FANA 5CIDB 3ZOYA 1CSUA 5B66V 1M60A 2C1DB 2YK3A 1CXCA 1I55A 3O0RC 5DJQB 4EIFA 1CO6A 4MU8A 4WQ8A 4PW9B 1CC5A 4GYDA 4XXLA 2PACA 2N9JA 2C1VA 5CICB 4FB1A 1S6VB 4H0JA 1I8PA 5GTIV 1GU2A 1FOCA 5AURA 1COTA 1RAQA 1ZRTD 1ETPA 3RN0A 4L3HA 1CSVA 4UB8V 2GB8B 2YQBA 4FA9A 4DY9A 2CE0A 2HV4A 3PRJA 3RN1A 5KAIV 2BH4X 3PTZA 5KLVD 5EXQA 4GEDB 2N18B 2AXTV 3NBSA 1W5CT 2OZ1B 1FCDC 3BCCD 3PXSA 5B5EV 2C8SA 1YCCA 5CIBB 4AAOA 1GQ1A 2MTAC 1C6RA 2ZONG 1C75A 1NU1D 4UB6V 1CSXA 1NMIA 4D6TD 3CXHD 1W2LA 4Q5PA 1CTZA 1H32A 2LIRA 1NMLA 4FA1A 1KIBA 3CP5A 3WUIA 4V2KA 1L9BC 2LITA 3SJLA 3TGUD 2N9IA 2ZZS1 4PWAA 3DP5A 1RAPA 2BCNB 1QL4A 1CCHA 3O1YA 1N9CA 1CEDA 3SWSA 2QJKB 2C1UA 2C1DA 2V08A 1E2RA 1CYJA 1FI7A 1AKKA 1ZZHA 1H33B 1F1CA 1M70A 4NFGB 1MG3D 3HQ7A 3MK7B 1N50A 3PH2B 1CYCA 1OCDA 1AOQA 1KYOW 1CYIA 4A7PA 1YEAA 3SVWA 1KYOD 3VMAA 351CA 4WQ7A 4PJ0V 1HH7A 1SQVD 4IL6V 1GKSA 1CRHA 4WQ9A 2RMZA 5CYTR 4KMGA 1NTZD 1U74B 4O1QA 2JWAA 3L4MA 1CHJA 3PHLA 4EDFA 1CIHA 2C9XB 5CIGB 3SXTA 1L9JC 1SQBD 1WEJF 1E8EA 1U75B 1I8OA 2JQRA 1DW3A 4YE1A 1CRYA 4U3FD 2D0WA 2OZ1A 1YNRA 1CRJA 1HJ4A 3H1JD 2KNCB 2EXVA 1E29A 2RN0A 1HJ3A 1LC2A 1KB9D 2YIUB 1CTJA 1WVEC 3WFDC 5KAFV 1CTYA 1SQPD 1RZ5A 1GDVA 1J3SA 1QYZA 4L1QA 4AALA 1HROA 4AX3A 3GG2A 1QN2A 4WQCA 2GIWA 1RZ6A 2FWLA 2QG4A 1CRCA 3L75D 1H9YA 1C6SA 2XTSB 2ORLA 1HZVA 2FYNB 1QL3A 4FA5A 4O1WA 5KLIB 1H33A 1IRVA 1DT1A 3L4OA 4WQAA 2L91A 1B7VA 1I54A 3ZOWA 1BCCD 3CX5D 3WC8A 1YFCA 4EICA 1C2RA 2KS1A 5DJQC 1CXAA 3CXHW 1GIWA 2CA4B 3HQ8A 1CNOA 1FHBA 3ITKA 1LFMA 1SQXD 2PCCB 1HZUA 3O20A 3WFEC 2BLFB 4EIEA 3L70D 3M97X 3KHUA 4JCGA 1FI3A 3L72D 3DR0A 2ZOOA 1IO3A 1C6OA 5H2FV 1YICA 5B6QA 4L3GA 2QJYB 3NBTA 5C0ZA 1FJ0A 1YIQA 4WQDA 2C2CA 1BL9A 1PPJD 155CA 1VYDA 2AI5A 3ZCFA 2N9YB 2FYUD 4J20A 2K9JB 3RMZA 3H1LD 2N18C 2V07A 2JTIB 3RLMA 4FA4A 1HRCA 1CRIA 1KX2A 5TISV 2Y0CA 1I5TA 1CSWA 1M6ZA 3OA8B 4LJIA 3H1HD 3VYMA 3PXWA 1R0QA 1CIFA 2BH5X 3GW6A 3H1KD 5TJHA 1KX7A 4Y5RA 1CCRA 3WFCC 5C9MA 1CRGA 4XYDB 1EZVD 3SLEA 5KKZB 1F1FA 3OCDB 1A8CA 1P84D 3L74D 1NTKD 1DW2A 3HQ6A
chains in the Genus database with same CATH superfamily
3CWBD 1L4AB 3L4FA 1SQPG 1DIPA 2QE7H 1N15A 2B4ZA 1Q81Q 1LS9A 1CHIA 4UB6H 3A9FA 2BPBB 1VDFA 3C9IA 4WVZA 1DIQC 1BE3D 3H1HJ 3M9BA 3S4RA 4B86A 1OVVA 2W83C 2YKQA 3WU2H 1H89A 5GTHV 4BRYB 2WSFH 1SS1A 2WSCH 3U1AA 4DT0A 1EZVE 1VQ6P 2Z4EA 1C2NA 1OVUA 3O5CA 1AA0A 3V2PA 1MG2D 3C2CA 2WPVB 2KZIA 1EXIA 1BCCG 3B5NC 1NIRA 1NO4A 4KHXA 3CYTI 4D6TG 1DVHA 1L0NJ 4QMAA 3SFDC 1X9VA 1SQXG 4YPCA 1AFOA 1BE3E 1PP9J 3CLQA 5APXA 1CHHA 3WFBC 1NOHA 3N7NA 4WQBA 3ZIYA 1SQPK 2M8RA 1HJ5A 2ZT9B 1LMSA 2JKVA 4Y99B 3HQ9A 3RBXA 1SQQJ 3NXSA 5AW6B 1NWQA 3C1LA 2FYUG 2N9BA 1M1JB 4PV1B 4N78E 2YKPA 1MZ9A 5APSA 4GOEA 1IZL0 5KLVE 4FAVA 2PFXA 3A5TA 1AOFA 2WPRA 2BGVX 5GTIH 1ZOYC 1ZP0C 3CC7P 1OAEA 1LC1A 3ZOXA 4QAOA 1DW1A 1ZN5A 1FE6A 2Y0EA 3L71J 3L73D 1T3JA 2GC4D 3DMIA 4L76A 3I56P 1SQXK 4PJ0E 3A0BV 2Q3EA 4N0KA 3A0HV 4MN4C 1BGYJ 3CWBG 2KIKA 1HWTC 1G2CB 1GL2D 1RF1A 5B5EH 3V2QA 2DVHA 4K35A 5IY51 1HCMA 2ZXYA 2KSJA 5CIDB 3ZOYA 1CSUA 2C1DB 1BE3G 1I55A 2FYUK 3W68A 3L73E 4H0JA 2B87B 5KAFE 1GU2A 1FOCA 2P67A 1GL2C 1G1IA 3A2AA 3MGNA 2E75D 2FFDC 2J59M 1W2BO 2GB8B 1QVGO 1SQBE 3CI9A 3HTKB 1WRGA 1M57D 4BXLA 2A45I 2WSEH 3SWKA 2A45H 2MJZA 2AXTE 1EXJA 1HJ0A 1IFDA 1KD1Q 3BRVB 3BCCD 1IFIA 3PXSA 4I6MC 4U7JA 4AAOA 2OQQA 1RF0C 4GKGA 2ZYDA 1C6RA 1LGHB 1NU1D 1AVYA 1NH4A 1NMIA 1KQLA 1HGZA 1BSNA 4Q5PA 1FDMA 3B4SA 2KLUA 4GIFA 1NMLA 3LIDA 1H8AA 4FA1A 2IZ1A 2W6AA 3WUIA 5CBOA 1L9BC 2N9IA 1VQNP 2ZZS1 2BCNB 1IK9A 1QL4A 3A7OA 2C0XA 2WTYA 1N9CA 1CEDA 3SWSA 3BCCE 2ZFCA 2IPPA 3L73G 1VQPP 4HKZH 3HQ7A 1N50A 1NU1E 1CYCA 4PD4I 2E43A 5KLVK 1USEA 1LT9A 3VMAA 4WQ7A 4PJ0V 1SQVD 3MUDC 5APWA 1CRHA 2RMZA 1FOSF 3MP7B 2QM8A 1JY2O 4C7NB 1NTZD 4O1QA 2P1JA 3TGUJ 2C9XB 5CIGB 3SXTA 3B5NB 1T2KD 2WQYC 1E8EA 1S4XA 1VQ9P 4M3LA 1FZEA 2QRXA 1VF5D 1MFZA 1DW3A 4YE1A 3H32B 3P8MC 3D6ZA 2AEMA 1M7LA 1FZAA 2OZ1A 1YBKA 3D71A 3H1JD 3CCUP 3VMYA 2Q7CA 1SQVE 5C39A 1E29A 2G8YA 2QJPC 1WVEC 3WFDC 5KAFV 1S5LE 1NTZE 1KV4A 5H2FH 1RZ5A 1JOCA 1GDVA 4L1QA 2YMYA 1LWUC 3CCJP 1LP1A 1T2KC 1J1DC 3CX5H 3GG2A 4TT3H 1NYHA 1N7SD 3P8CE 1VF5C 1H9YA 1KQSO 1SQBJ 1C6SA 5AW8B 3BCCG 2ORLA 2FYNB 2FYZA 5TISH 3H1JE 1SLQA 3T97B 1EDJA 1SQBK 2OYIA 2L91A 4WY4A 3ZOWA 1URQD 1C2RA 1OWAA 3M06A 2KS1A 3M0DC 5DJQC 4DZOA 2CA4B 2OYHC 4RKUJ 1Q82Q 1N7SC 3KQGA 1H0TA 2N1TA 3FXEA 3L37A 5APVA 3JCUE 3UIAA 1KYOI 2YO3A 3DR0A 2A06G 1K9MQ 1T3UA 4L3GA 1URQC 1IJDB 1XTGB 2UWJE 2XDJA 4N3YB 2M3EA 5AW5B 4OGQD 1MUUA 4HJGH 2K9JB 3FX0A 1GK4A 3KZIH 1SQVG 5APQA 1RY3A 1PGJA 1N73C 2N18C 1AV1A 2V07A 2KP8A 2W90A 4RO0A 2M5AB 2FY8A 1KX2A 2Q9IA 1M6ZA 1GL2B 4W7ZA 3H1HD 2FFDB 1NU1K 4ZMDA 2HR3A 1KX7A 2K1AA 3WUUA 2OTLP 4H13D 1YJNP 3L72J 4W7YA 3WFCC 3TNUA 1CRGA 3NMDA 2SPZA 4OGQC 4XYDB 2LXCB 1L2PA 3H1JG 3ZDMA 1P84D 1M8OB 1VPCA 2KZJA 4BWNA 1DW2A 3M0AA 2WT7A 3HQ6A 5DFSA 1A02J 2P7JA 3IR9A 1L0ND 3CCEP 2QJYC 4H44B 3H1LJ 1H31B 1PP9D 4XE5B 4H0KA 1S5LV 4JBZA 5E79H 4H13C 5AW0B 2ZBOA 3PLNA 3VRDA 4EIDA 1SQVK 4XA4A 2FBWC 3H1KJ 1EC5A 2JWDA 5CCGD 2O01H 1NTZK 4L74A 2PCBB 1P84E 2E5TA 2IYOA 1SQQD 2B11B 1T8ZA 3CX5W 1L0NE 1NTKJ 1CIGA 1PP9E 2IBZD 1JEKA 4NPEA 1HTLC 5KAIE 2R3CA 2XKMA 1JTHB 5CIFB 2DGEA 1PV3A 2RH0A 1A56A 4PJ0H 1VQOP 1C52A 1X79B 1L0LJ 2HPCB 1N90A 3TYIA 1LTAC 5CCGC 3ORVA 3H6PA 1FZGA 3L71D 2Q6QA 4WB4A 2B9BA 2YIUC 1SQQE 2W6BA 2IDBA 1I6EA 2KB7P 1ZR4A 451CA 1BGYD 2LKMA 1UIIA 3CCVP 3FWLA 1JDLA 2IBZE 3AE4C 2H43A 1DIIC 1YIJP 1RE4C 3OCDA 3MHVA 1A2SA 4L73A 1AVOA 5CCHD 3D70A 4OVNF 4XFJA 1OVRA 1L4AA 1EB7A 2BCCJ 1IQCA 3H1HG 2HODB 1BDCA 5KAFH 4AYCA 3ZOOA 2YNYA 3L71E 2IFMA 2QJPB 3R2PA 3AEEC 2D2CD 1SFCD 4OWFA 2IZ0A 1LTJC 1BGYE 1LWUB 3A0BE 1J1DB 2FKWB 2L4DA 1VF5B 1YITP 5CIHB 5CCHC 1IFJA 3AE5C 1JM0A 1J1EC 1AYGA 3QWOC 4HB1A 1EDIA 2MHMA 2AXTH 2QIWA 1PP9G 1IRWA 2P2UA 1BDDA 5DJQB 4EIFA 1SFCC 4WQ8A 3RBZA 3G71P 4PW9B 1CC5A 5KTBA 2OYHB 1KQFB 2W8ZA 4NPFX 1N7SB 4KJMA 3PJSK 2IYPA 1SQQG 5KJ7D 4Y28J 5AURA 1RAQA 1ZRTD 1ETPA 3RN0A 1LTSC 4L3HA 2P58A 1K8AQ 1GDTA 5AVTB 4JYBA 1YYCA 1YTZT 1URQB 1M1JA 3WUTA 1CZQA 2GUSA 1RQUA 4DY9A 2NPSD 2CE0A 3PRJA 4N78D 1GD2E 1KMIZ 1DX7A 5KAIV 2BH4X 5KLVD 1N73B 2N18B 3L71G 5KJ7C 1S5LX 3NBSA 1L0NK 1PZQA 1QX8A 1GMJA 3KYQA 1Y9BA 1OW6A 1RE3C 1ZRTE 2K37A 2ZONG 1K73Q 4GOFA 2M3BA 3CXHD 1W2LA 2NPSC 4JPZB 2LIRA 4ZNCA 3LW5J 1S72P 1N7LA 1G2CA 4V2KA 3TGUD 1SQQK 1FDOA 3Q5PA 3DP5A 1TU3F 1RAPA 1FOSE 3AEGC 3U1CA 5AVVB 3AEAC 4Z1MH 3PH0A 1M90Q 2C1UA 3GHGC 2C1DA 2V08A 1Y8AA 1S5LH 1CYJA 1FI7A 1H33B 3RL0D 2G3AA 4NFGB 2E42A 1MG3D 3CXHE 5CJ4A 2B87A 1EZVG 2ZYAA 1U7JA 1GK6A 3SVWA 2V7QH 3VP9A 4ASVA 1YHQP 2YXRB 1OMIA 4D6TJ 1HH7A 3CPWO 1JCDA 3TGUE 2V4HA 1HBWA 3L70E 1U74B 2JWAA 3L4MA 3PHLA 2I8DA 2O01N 4EDFA 1FAVA 2E76D 4C7RA 3HTKA 3RL0C 2BEQD 1L9JC 1SQBD 4DJGA 1FZCC 1JY3N 1I8OA 2JQRA 3NFQA 3CL3D 1YNRA 2FXMA 2Y9YA 1HJ4A 2EXVA 1HJ3A 1KB9D 2YIUB 1CTYA 1IFNA 1MV8A 1VQKP 1J3SA 1QYZA 3RK3D 1PFIA 2E76C 4AALA 3IFMA 1RH5B 3HE5B 2GA1A 4WQCA 2FWLA 5KLVG 2QG4A 1CRCA 3RK2D 3HUSC 4O9BA 3L74E 1HZVA 4TLFA 4FA5A 1GU4A 5BU8B 3VOPA 2WWWA 1ZW0A 5AW1B 3E7KA 1KB9E 2E75C 1YFCA 2OARA 3RK3C 1GIWA 3RK3E 1JUNA 1LTJB 2KK7A 2JJLA 3HQ8A 1OW8A 1E79H 1Q2NA 5APTA 2C9NY 5CMZA 2PCCB 2HG5D 2YMKA 3Q5SA 4C7NA 3O20A 1J1EB 2BLFB 3L35A 4IFDK 3KHUA 4JCGA 3N4XA 3L72D 3L75J 3B5NA 3GMAA 1YICA 5CBNA 2KYVA 3NBTA 1FJ0A 2IX7C 2C2CA 1SFCB 3H32A 1PPJD 2B89A 155CA 1KZUB 1YQ3C 2AI5A 3ZCFA 1CI6B 3VMZA 1FBMA 5GTHH 3RGUA 3H1LD 1QLED 1HRCA 2AXCA 1NTME 1HF9A 1BSHA 3OA8B 1P84H 1LTIC 4LJIA 3VYMA 3PXWA 1R0QA 3L72E 5APYA 1SQBG 3GW6A 1UIXA 3H1KD 1NKZB 3II6A 3L70J 5AW7B 2HFED 3Q2YA 3P32A 4EOTA 3P8CD 1PPJE 3GF7A 3TSIA 2ZXXA 1XTCC 1SVFA 2LXBA 1NTKD 3H1LE 3T97A 3KXDA 3EWKA 1ZMEC 3ABVC 1KILD 1X22A 1FI9A 1DEEG 1JO5A 3HD7D 2QJKC 2XU6A 5B66E 3OAKA 2FXOA 3AE6C 2FRCA 4C46A 3Q1MA 1L0LD 3H1KE 2B12B 1VQ5P 2Y0DA 3CX5I 4WQEA 3M9HA 3ZBMA 5AVRB 5GTIE 3HE4B 1R8EA 1Q90D 3AEBC 4R4LA 1HGVA 1NTKE 1H9XA 1KILC 1KILE 1S2EA 3HD7C 3CCSP 2N3YA 3GHGB 1YI2P 3L74J 1NU1G 4EI2A 2CE1A 2BCCD 2K9JA 3CC2P 5CIEB 1AQTA 4K3IA 1JCCA 1L0LE 3A0BH 3A0HH 1IFMA 2M5AA 5B5EE 1GL2A 1N8RQ 3L72G 2ZJSE 2FFDA 1CORA 1HVVA 1OW7A 2J5UA 3WMM0 2C9LY 4HH2A 2AIUA 1H88A 1KFMA 1Z56A 3RL0B 1H1OA 1KB0A 3B8EB 1DD3A 2BCCE 1FZCB 2H89C 3WU2V 1EDKA 4RSZA 1U7MA 1K3GA 3V6IA 2WSFJ 5DF5A 1YQ4C 2WSCJ 1H31A 1HH0A 1NTZG 1EZVI 2ZT9D 5KLIC 1RF0A 1LTTC 5CJ0A 4JQ0D 3JBTB 3AE3C 3H1KG 4PV1D 1NTMJ 2J58A 2E76B 1KORA 3CCQP 1DW0A 2MKVA 4OH8B 4IL6E 1NTMK 4R4MA 1H32B 2ZVOB 1I6DA 1YTZI 5M1BA 3HUSB 1KQGB 2VHDA 3USSA 2QEXP 3SWYA 2R44A 5L8RJ 1MZ4A 3PXTA 2GC7D 4PD4D 1AJYA 3IF4A 2E75B 1L0LG 2FXPA 5B66V 2ZYGA 1M60A 2NZ2A 2YK3A 1CXCA 1JTHA 1CO6A 4PV1C 3SFEC 4XXLA 2PACA 2HPCA 3MUDA 4FB1A 1CSBA 1S6VB 1IO4A 1I8PA 5GTIV 1S3JA 1DH3A 1N86A 2KUBA 2YQBA 4PD4E 3H1IJ 1QEXA 4ZKUA 4FA9A 2HV4A 2E74D 1FJKA 3CXHH 4GT1A 5BVZA 5KKZC 1NTKK 3PTZA 2HODA 1SP4A 1W5CT 1FJPA 1DD4A 5B5EV 2C8SA 5AVYB 1YCCA 5CIBB 2I1KA 1LWUA 1C75A 1L0LK 1CSXA 1W5CE 4D6TD 2E74C 2JDIH 1KIBA 3CP5A 4AQRD 5H2FE 2BEZF 4DOJA 3O1YA 2OGUA 2QJKB 3I5CA 1RF1C 1E2RA 2O1KA 3M0DA 1BCCE 3AE9C 2PGDA 3O8ZA 1GU5A 2OYHA 3CCLP 1N7SA 4D6TE 3IN6A 1Q86Q 1KYOW 4A7PA 1KYOD 3RL0g 5TISE 3B71A 1R5SA 3A3YB 4IL6V 2WSEJ 1GKSA 4WQ9A 2QM7A 1LTBC 4KMGA 1L0NG 3HD7B 1URQA 2HYNA 2C0WA 3S9OA 2PAJA 1KB9H 5APUA 1WEJF 1VQMP 1U75B 1Y47A 2D2CC 3S1KA 3AEDC 1NVOA 1N73A 1CRYA 2R3SA 1CRJA 1JY2N 1KYOE 2KNCB 3L36A 2RN0A 3SSUA 1LC2A 1X0TA 3B5ND 2ZAEB 4EYYQ 3BRTB 1FS0E 3JC22 2IBZG 1HROA 3KZIE 3CCRP 3IAOA 3C8VA 5AVUB 3L75D 3FXDA 1NKNA 2E5YA 3H25A 3KPEA 5DJTB 3CWBE 3CC4P 1MKMA 5KLIB 3MIWA 1H33A 4U3FJ 1IRVA 3L4OA 4WQAA 4I2LC 1B7VA 1I54A 1NAYA 1BGYG 1CXAA 3CXHW 2O1JA 3VTPC 2WPSA 3F89A 2L5GB 3AEFC 1SQPJ 1FHBA 3HRNA 3MD0A 3G6EP 3I55P 3VP8A 1LTGC 2QSIA 4OGQB 1HZUA 1JY3P 3L75E 5AW2B 3WFEC 3K5BA 2W27A 1KN7A 1LT9C 4EIEA 3L70D 2B88A 3EFGA 2ZOOA 1VQ4P 1C6OA 3Q3DA 5H2FV 5E79E 5B66H 5B6QA 2QJYB 5C0ZA 1YIQA 4WQDA 2OYOA 1BL9A 3MZWB 3D6YA 1FU1A 4H13B 3V4WA 1BCCJ 3RMZA 1U57A 1AQ5A 5CCGA 2JTIB 2FYNC 5AW9B 5TISV 2Y0CA 1I5TA 1CSWA 1KFNA 3M9QA 1SQXJ 2GUVA 1HUCA 3AECC 4WY4D 4W80A 3HE5A 5TJHA 1QL2A 1DEBA 1RE4A 1M1KQ 2KOGA 5C9MA 2POHA 1J2JB 3MTUE 3AE2C 3BATA 4N6JA 5EFWB 5KKZB 2WZ7A 1JB0J 1F1FA 3V2RA 1OX3A 3L74D 1PL5A 2N1TD 1JNMA 2FYUJ 3VYIA 1GW3A 1S9KD 3JCUH 1C7MA 1LNQA 3CMAP 3AE1C 1LTJA 1GTWA 2OYIC 3CD6P 4WY4C 2XZRA 3MK7C 1PGQA 4LLHA 2WPQA 2W6JH 1IC2A 4IFFA 4RJTA 1IK7A 3M91A 4IL6X 3TDKA 2N3BA 3L75G 5CCHA 2E74B 3KZIV 3CMEP 4GDOA 5AVSB 1QGKB 2RKLA 2CXBA 1ZXGA 2N1TC 2O3JA 4H44D 4UB8E 5AW3B 2R5DA 1RF1B 2OTKE 1SFCA 1S9KE 1YTCA 4AAMA 3NWVA 1CI6A 2KI7B 3CWBJ 2KSEA 1VL2A 1GJQA 4I7ZC 3D0WA 1N2DC 4ASWA 1QVFO 1NNOA 3TGUG 3BASA 4IL6H 2Z5HA 3L70G 3OA8A 3RK2C 1BE3J 2AEFA 4CPGA 1NTMD 3VMXA 1GW4A 4H44C 3AE8C 2I8FA 1YEBA 4UB6E 2JP3A 1OFCX 4AANA 1E5WA 1YJ9P 4RESB 3EFFK 5E79V 3WU2E 2YCCA 2D2CB 1K3HA 3FGAD 1KV9A 1DVVA 2D0SA 4P4QB 3CU4A 5KJ7A 2CK3H 1T6AA 4KT0J 3GF3A 4LC1A 1RE3A 2B10B 1ZLLA 2O01J 5KLVJ 2B0ZB 3E1IA 4YXDC 1P84I 2A06D 3VNWA 1MFTA 3X39A 2NPSA 3G4SP 4PD4H 5AVQB 2CA3B 1FC2C 3HE4A 1M56D 3OJAB 3VN0A 1CIEA 3L74G 5KAIH 2H7HA 3TF5A 3H1ID 2JR8A 4I1LA 3GHGA 1QKSA 1NJIQ 4FANA 2AEJA 2HLOA 2XV5A 2A06E 3O0RC 4GODA 4MU8A 4EIJA 3E1RA 3LW5H 4GYDA 3TK1A 2N9JA 2C1VA 2NPSB 5CICB 2YO2A 2IBZI 2XNXA 3V2NA 2IFNA 1PGOA 2I1JA 4AUWA 4H0LD 3L73J 1L4AD 3PP5A 1IZNB 1LT9B 2K9YA 1COTA 3H1IE 1CSVA 2WSSH 4UB8V 2OTJP 1WT6A 2QA4P 1YJWP 1FZCA 4NPDA 1PIXA 3RN1A 3BVHA 2M0BA 2YKOA 2CPBA 2DW3A 5EXQA 1NTMG 1VQ7P 4GEDB 2GM4A 4H0LC 2AXTV 2KLVA 2CPSA 1L4AC 2OZ1B 1FCDC 1OZHA 1PGPA 4YTPC 1FDIA 1GQ1A 1EDLA 2MTAC 3LIEA 4HYTB 3O6QA 4UB6V 2JEEA 4DCKA 3G3ZA 1PPJG 3F5HA 2P10A 1CTZA 2R5BA 1H32A 2ITAA 1R5LA 4K3AA 3SWFA 1RHZB 1LP1B 3HUSA 3U59A 2ZXEB 3H1LG 4ZKPA 3SJLA 2LITA 4PWAA 1RQVA 1KYOH 1CCHA 1CW5A 4YXWH 2H88C 1AKKA 1ZZHA 4L75A 1F1CA 1M70A 2OYIB 4WY4B 2KXPB 3MK7B 3BCCJ 3PH2B 3Q5RA 1OCDA 2XNDH 2KS1B 1AOQA 3O6QB 1KTMA 1CYIA 1JY3O 2R32A 1YEAA 3AE7C 1NU1J 3H1IG 351CA 1NTKG 2QVAA 1H0TB 2N1TB 5CYTR 1W2EA 2NRGA 4JYCA 2ZT9C 1CHJA 3W67A 4Y99C 1LT1A 4WBAA 5K5GB 1CIHA 1HJBA 1M1JC 2JO1A 3RK3B 5AVZB 4I7ZB 1JMBA 3V5BA 4U3FD 1K04A 1X8YA 2D0WA 2Y9ZA 3RK2B 5AVXB 2WITA 3H1HE 2WMMA 1CTJA 1SQPD 1VQLP 2Q5UA 1SQVJ 2Q3IA 2BCCG 3V4QA 5GTHE 1NTZJ 4AX3A 3OA7A 1QN2A 3KDPB 3GLMA 2GIWA 1WMKA 1RZ6A 1A02F 2K3RA 5CHXA 3TNUB 3CXHI 4U3FE 3NTNA 1QL1A 2V7QJ 1IFPA 2XTSB 3EQ2A 2PP6A 1QL3A 4JF7A 4O1WA 1S1CX 2WT7B 1DT1A 1BCCD 3CX5D 3WC8A 4EICA 1SQPE 3H1JJ 1Q7YQ 2BASA 2Z5IA 2A45G 1GZLA 4IOIH 3JSVC 4WWIA 2WVRA 1ZR2A 1CNOA 3ITKA 1LFMA 1SQXD 1NAFA 1KILA 4IFMA 2PRRA 3HD7A 3M97X 1FI3A 5DJUB 5AW4B 1IO3A 1D7MA 1JY2P 2YXQB 3CX5E 3P7KA 3OW2O 5BU5A 1VYDA 3R4YA 2N9YB 2ZVNB 1NHLA 2FYUD 4J20A 1K05A 2KNCA 5AVWB 3RLMA 1SQXE 4FA4A 3WUVA 3TYYA 1CRIA 1NGMB 2VRSA 1USDA 1OXZA 4UB8H 1JMMA 1OIPA 2LR2A 1KILB 3QH9A 1CIFA 3CCMP 2BH5X 4LGDE 1VQ8P 1FZFA 2K88A 1G1JA 4BRYA 4Y5RA 1CCRA 1FZBA 1KB9I 3A0HE 2Q1KA 1KC8Q 4U3FG 2H8PD 3FWNA 3G9RA 1EQ7A 1EZVD 3SLEA 3OCDB 1LJ2A 2FYUE 1A8CA 1ZV8A 4H0LB
chains in the Genus database with same CATH topology
3CWBD 5DFSA 1FI9A 1N15A 1L0ND 2B4ZA 1LS9A 1H31B 1CHIA 1C7MA 1PP9D 4H0KA 2FRCA 3A9FA 1S5LV 2BPBB 3MK7C 1L0LD 1DIQC 2B12B 4RJTA 1BE3D 2Y0DA 2ZBOA 3TDKA 3PLNA 2N3BA 3VRDA 4WQEA 3ZBMA 5GTHV 4EIDA 3KZIV 2CXBA 1C2NA 2PCBB 3O5CA 2O3JA 1SQQD 1H9XA 1MG2D 3C2CA 2B11B 2N3YA 3CX5W 1CIGA 1YTCA 1NIRA 2CE1A 3CYTI 2IBZD 3NWVA 2BCCD 4AAMA 1GJQA 1DVHA 5CIEB 4K3IA 5CIFB 2DGEA 1A56A 1NNOA 1CHHA 1C52A 3WFBC 3OA8A 1N90A 3TYIA 4WQBA 3ORVA 1NTMD 3L71D 1CORA 3ZIYA 2I8FA 1YEBA 2AIUA 1HJ5A 1LMSA 1I6EA 4AANA 3HQ9A 451CA 1BGYD 5E79V 1H1OA 3FWLA 1JDLA 1KB0A 2YCCA 1DIIC 1K3HA 1KV9A 3OCDA 1DVVA 1A2SA 3WU2V 4RSZA 2D0SA 4P4QB 3CU4A 1IZL0 1EB7A 4FAVA 1AOFA 1K3GA 2BGVX 1IQCA 5DF5A 1H31A 2B10B 1OAEA 3ZOOA 2B0ZB 1LC1A 3JBTB 2QJPB 2A06D 3VNWA 3ZOXA 4QAOA 1DW1A 3X39A 2Y0EA 2CA3B 3L73D 2GC4D 3DMIA 1DW0A 3A0BV 2L4DA 2Q3EA 4N0KA 3A0HV 1CIEA 5CIHB 1H32B 1I6DA 1AYGA 3TF5A 2VHDA 3H1ID 2MHMA 1QKSA 1IRWA 1MZ4A 2DVHA 3PXTA 5IY51 1HCMA 2GC7D 2ZXYA 4PD4D 4FANA 5CIDB 3ZOYA 1CSUA 5B66V 1M60A 2C1DB 2YK3A 1CXCA 1I55A 3O0RC 5DJQB 4EIFA 1CO6A 4MU8A 4WQ8A 4PW9B 1CC5A 4GYDA 4XXLA 2PACA 2N9JA 2C1VA 5CICB 4FB1A 1S6VB 4H0JA 1I8PA 5GTIV 1GU2A 1FOCA 5AURA 1COTA 1RAQA 1ZRTD 1ETPA 3RN0A 4L3HA 1CSVA 4UB8V 2GB8B 2YQBA 4FA9A 4DY9A 2CE0A 2HV4A 3PRJA 3RN1A 5KAIV 2BH4X 3PTZA 5KLVD 5EXQA 4GEDB 2N18B 2AXTV 3NBSA 1W5CT 2OZ1B 1FCDC 3BCCD 3PXSA 5B5EV 2C8SA 1YCCA 5CIBB 4AAOA 1GQ1A 2MTAC 1C6RA 2ZONG 1C75A 1NU1D 4UB6V 1CSXA 1NMIA 4D6TD 3CXHD 1W2LA 4Q5PA 1CTZA 1H32A 2LIRA 1NMLA 4FA1A 1KIBA 3CP5A 3WUIA 4V2KA 1L9BC 2LITA 3SJLA 3TGUD 2N9IA 2ZZS1 4PWAA 3DP5A 1RAPA 2BCNB 1QL4A 1CCHA 3O1YA 1N9CA 1CEDA 3SWSA 2QJKB 2C1UA 2C1DA 2V08A 1E2RA 1CYJA 1FI7A 1AKKA 1ZZHA 1H33B 1F1CA 1M70A 4NFGB 1MG3D 3HQ7A 3MK7B 1N50A 3PH2B 1CYCA 1OCDA 1AOQA 1KYOW 1CYIA 4A7PA 1YEAA 3SVWA 1KYOD 3VMAA 351CA 4WQ7A 4PJ0V 1HH7A 1SQVD 4IL6V 1GKSA 1CRHA 4WQ9A 2RMZA 5CYTR 4KMGA 1NTZD 1U74B 4O1QA 2JWAA 3L4MA 1CHJA 3PHLA 4EDFA 1CIHA 2C9XB 5CIGB 3SXTA 1L9JC 1SQBD 1WEJF 1E8EA 1U75B 1I8OA 2JQRA 1DW3A 4YE1A 1CRYA 4U3FD 2D0WA 2OZ1A 1YNRA 1CRJA 1HJ4A 3H1JD 2KNCB 2EXVA 1E29A 2RN0A 1HJ3A 1LC2A 1KB9D 2YIUB 1CTJA 1WVEC 3WFDC 5KAFV 1CTYA 1SQPD 1RZ5A 1GDVA 1J3SA 1QYZA 4L1QA 4AALA 1HROA 4AX3A 3GG2A 1QN2A 4WQCA 2GIWA 1RZ6A 2FWLA 2QG4A 1CRCA 3L75D 1H9YA 1C6SA 2XTSB 2ORLA 1HZVA 2FYNB 1QL3A 4FA5A 4O1WA 5KLIB 1H33A 1IRVA 1DT1A 3L4OA 4WQAA 2L91A 1B7VA 1I54A 3ZOWA 1BCCD 3CX5D 3WC8A 1YFCA 4EICA 1C2RA 2KS1A 5DJQC 1CXAA 3CXHW 1GIWA 2CA4B 3HQ8A 1CNOA 1FHBA 3ITKA 1LFMA 1SQXD 2PCCB 1HZUA 3O20A 3WFEC 2BLFB 4EIEA 3L70D 3M97X 3KHUA 4JCGA 1FI3A 3L72D 3DR0A 2ZOOA 1IO3A 1C6OA 5H2FV 1YICA 5B6QA 4L3GA 2QJYB 3NBTA 5C0ZA 1FJ0A 1YIQA 4WQDA 2C2CA 1BL9A 1PPJD 155CA 1VYDA 2AI5A 3ZCFA 2N9YB 2FYUD 4J20A 2K9JB 3RMZA 3H1LD 2N18C 2V07A 2JTIB 3RLMA 4FA4A 1HRCA 1CRIA 1KX2A 5TISV 2Y0CA 1I5TA 1CSWA 1M6ZA 3OA8B 4LJIA 3H1HD 3VYMA 3PXWA 1R0QA 1CIFA 2BH5X 3GW6A 3H1KD 5TJHA 1KX7A 4Y5RA 1CCRA 3WFCC 5C9MA 1CRGA 4XYDB 1EZVD 3SLEA 5KKZB 1F1FA 3OCDB 1A8CA 1P84D 3L74D 1NTKD 1DW2A 3HQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB D;  5DFS A;  1FI9 A;  1N15 A;  1L0N D;  2B4Z A;  1LS9 A;  1H31 B;  1CHI A;  1C7M A;  1PP9 D;  4H0K A;  2FRC A;  3A9F A;  1S5L V;  2BPB B;  3MK7 C;  1L0L D;  1DIQ C;  2B12 B;  4RJT A;  1BE3 D;  2Y0D A;  2ZBO A;  3TDK A;  3PLN A;  2N3B A;  3VRD A;  4WQE A;  3ZBM A;  5GTH V;  4EID A;  3KZI V;  2CXB A;  1C2N A;  2PCB B;  3O5C A;  2O3J A;  1SQQ D;  1H9X A;  1MG2 D;  3C2C A;  2B11 B;  2N3Y A;  3CX5 W;  1CIG A;  1YTC A;  1NIR A;  2CE1 A;  3CYT I;  2IBZ D;  3NWV A;  2BCC D;  4AAM A;  1GJQ A;  1DVH A;  5CIE B;  4K3I A;  5CIF B;  2DGE A;  1A56 A;  1NNO A;  1CHH A;  1C52 A;  3WFB C;  3OA8 A;  1N90 A;  3TYI A;  4WQB A;  3ORV A;  1NTM D;  3L71 D;  1COR A;  3ZIY A;  2I8F A;  1YEB A;  2AIU A;  1HJ5 A;  1LMS A;  1I6E A;  4AAN A;  3HQ9 A;  451C A;  1BGY D;  5E79 V;  1H1O A;  3FWL A;  1JDL A;  1KB0 A;  2YCC A;  1DII C;  1K3H A;  1KV9 A;  3OCD A;  1DVV A;  1A2S A;  3WU2 V;  4RSZ A;  2D0S A;  4P4Q B;  3CU4 A;  1IZL 0;  1EB7 A;  4FAV A;  1AOF A;  1K3G A;  2BGV X;  1IQC A;  5DF5 A;  1H31 A;  2B10 B;  1OAE A;  3ZOO A;  2B0Z B;  1LC1 A;  3JBT B;  2QJP B;  2A06 D;  3VNW A;  3ZOX A;  4QAO A;  1DW1 A;  3X39 A;  2Y0E A;  2CA3 B;  3L73 D;  2GC4 D;  3DMI A;  1DW0 A;  3A0B V;  2L4D A;  2Q3E A;  4N0K A;  3A0H V;  1CIE A;  5CIH B;  1H32 B;  1I6D A;  1AYG A;  3TF5 A;  2VHD A;  3H1I D;  2MHM A;  1QKS A;  1IRW A;  1MZ4 A;  2DVH A;  3PXT A;  5IY5 1;  1HCM A;  2GC7 D;  2ZXY A;  4PD4 D;  4FAN A;  5CID B;  3ZOY A;  1CSU A;  5B66 V;  1M60 A;  2C1D B;  2YK3 A;  1CXC A;  1I55 A;  3O0R C;  5DJQ B;  4EIF A;  1CO6 A;  4MU8 A;  4WQ8 A;  4PW9 B;  1CC5 A;  4GYD A;  4XXL A;  2PAC A;  2N9J A;  2C1V A;  5CIC B;  4FB1 A;  1S6V B;  4H0J A;  1I8P A;  5GTI V;  1GU2 A;  1FOC A;  5AUR A;  1COT A;  1RAQ A;  1ZRT D;  1ETP A;  3RN0 A;  4L3H A;  1CSV A;  4UB8 V;  2GB8 B;  2YQB A;  4FA9 A;  4DY9 A;  2CE0 A;  2HV4 A;  3PRJ A;  3RN1 A;  5KAI V;  2BH4 X;  3PTZ A;  5KLV D;  5EXQ A;  4GED B;  2N18 B;  2AXT V;  3NBS A;  1W5C T;  2OZ1 B;  1FCD C;  3BCC D;  3PXS A;  5B5E V;  2C8S A;  1YCC A;  5CIB B;  4AAO A;  1GQ1 A;  2MTA C;  1C6R A;  2ZON G;  1C75 A;  1NU1 D;  4UB6 V;  1CSX A;  1NMI A;  4D6T D;  3CXH D;  1W2L A;  4Q5P A;  1CTZ A;  1H32 A;  2LIR A;  1NML A;  4FA1 A;  1KIB A;  3CP5 A;  3WUI A;  4V2K A;  1L9B C;  2LIT A;  3SJL A;  3TGU D;  2N9I A;  2ZZS 1;  4PWA A;  3DP5 A;  1RAP A;  2BCN B;  1QL4 A;  1CCH A;  3O1Y A;  1N9C A;  1CED A;  3SWS A;  2QJK B;  2C1U A;  2C1D A;  2V08 A;  1E2R A;  1CYJ A;  1FI7 A;  1AKK A;  1ZZH A;  1H33 B;  1F1C A;  1M70 A;  4NFG B;  1MG3 D;  3HQ7 A;  3MK7 B;  1N50 A;  3PH2 B;  1CYC A;  1OCD A;  1AOQ A;  1KYO W;  1CYI A;  4A7P A;  1YEA A;  3SVW A;  1KYO D;  3VMA A;  351C A;  4WQ7 A;  4PJ0 V;  1HH7 A;  1SQV D;  4IL6 V;  1GKS A;  1CRH A;  4WQ9 A;  2RMZ A;  5CYT R;  4KMG A;  1NTZ D;  1U74 B;  4O1Q A;  2JWA A;  3L4M A;  1CHJ A;  3PHL A;  4EDF A;  1CIH A;  2C9X B;  5CIG B;  3SXT A;  1L9J C;  1SQB D;  1WEJ F;  1E8E A;  1U75 B;  1I8O A;  2JQR A;  1DW3 A;  4YE1 A;  1CRY A;  4U3F D;  2D0W A;  2OZ1 A;  1YNR A;  1CRJ A;  1HJ4 A;  3H1J D;  2KNC B;  2EXV A;  1E29 A;  2RN0 A;  1HJ3 A;  1LC2 A;  1KB9 D;  2YIU B;  1CTJ A;  1WVE C;  3WFD C;  5KAF V;  1CTY A;  1SQP D;  1RZ5 A;  1GDV A;  1J3S A;  1QYZ A;  4L1Q A;  4AAL A;  1HRO A;  4AX3 A;  3GG2 A;  1QN2 A;  4WQC A;  2GIW A;  1RZ6 A;  2FWL A;  2QG4 A;  1CRC A;  3L75 D;  1H9Y A;  1C6S A;  2XTS B;  2ORL A;  1HZV A;  2FYN B;  1QL3 A;  4FA5 A;  4O1W A;  5KLI B;  1H33 A;  1IRV A;  1DT1 A;  3L4O A;  4WQA A;  2L91 A;  1B7V A;  1I54 A;  3ZOW A;  1BCC D;  3CX5 D;  3WC8 A;  1YFC A;  4EIC A;  1C2R A;  2KS1 A;  5DJQ C;  1CXA A;  3CXH W;  1GIW A;  2CA4 B;  3HQ8 A;  1CNO A;  1FHB A;  3ITK A;  1LFM A;  1SQX D;  2PCC B;  1HZU A;  3O20 A;  3WFE C;  2BLF B;  4EIE A;  3L70 D;  3M97 X;  3KHU A;  4JCG A;  1FI3 A;  3L72 D;  3DR0 A;  2ZOO A;  1IO3 A;  1C6O A;  5H2F V;  1YIC A;  5B6Q A;  4L3G A;  2QJY B;  3NBT A;  5C0Z A;  1FJ0 A;  1YIQ A;  4WQD A;  2C2C A;  1BL9 A;  1PPJ D;  155C A;  1VYD A;  2AI5 A;  3ZCF A;  2N9Y B;  2FYU D;  4J20 A;  2K9J B;  3RMZ A;  3H1L D;  2N18 C;  2V07 A;  2JTI B;  3RLM A;  4FA4 A;  1HRC A;  1CRI A;  1KX2 A;  5TIS V;  2Y0C A;  1I5T A;  1CSW A;  1M6Z A;  3OA8 B;  4LJI A;  3H1H D;  3VYM A;  3PXW A;  1R0Q A;  1CIF A;  2BH5 X;  3GW6 A;  3H1K D;  5TJH A;  1KX7 A;  4Y5R A;  1CCR A;  3WFC C;  5C9M A;  1CRG A;  4XYD B;  1EZV D;  3SLE A;  5KKZ B;  1F1F A;  3OCD B;  1A8C A;  1P84 D;  3L74 D;  1NTK D;  1DW2 A;  3HQ6 A; 
#chains in the Genus database with same CATH topology
 3CWB D;  1L4A B;  3L4F A;  1SQP G;  1DIP A;  2QE7 H;  1N15 A;  2B4Z A;  1Q81 Q;  1LS9 A;  1CHI A;  4UB6 H;  3A9F A;  2BPB B;  1VDF A;  3C9I A;  4WVZ A;  1DIQ C;  1BE3 D;  3H1H J;  3M9B A;  3S4R A;  4B86 A;  1OVV A;  2W83 C;  2YKQ A;  3WU2 H;  1H89 A;  5GTH V;  4BRY B;  2WSF H;  1SS1 A;  2WSC H;  3U1A A;  4DT0 A;  1EZV E;  1VQ6 P;  2Z4E A;  1C2N A;  1OVU A;  3O5C A;  1AA0 A;  3V2P A;  1MG2 D;  3C2C A;  2WPV B;  2KZI A;  1EXI A;  1BCC G;  3B5N C;  1NIR A;  1NO4 A;  4KHX A;  3CYT I;  4D6T G;  1DVH A;  1L0N J;  4QMA A;  3SFD C;  1X9V A;  1SQX G;  4YPC A;  1AFO A;  1BE3 E;  1PP9 J;  3CLQ A;  5APX A;  1CHH A;  3WFB C;  1NOH A;  3N7N A;  4WQB A;  3ZIY A;  1SQP K;  2M8R A;  1HJ5 A;  2ZT9 B;  1LMS A;  2JKV A;  4Y99 B;  3HQ9 A;  3RBX A;  1SQQ J;  3NXS A;  5AW6 B;  1NWQ A;  3C1L A;  2FYU G;  2N9B A;  1M1J B;  4PV1 B;  4N78 E;  2YKP A;  1MZ9 A;  5APS A;  4GOE A;  1IZL 0;  5KLV E;  4FAV A;  2PFX A;  3A5T A;  1AOF A;  2WPR A;  2BGV X;  5GTI H;  1ZOY C;  1ZP0 C;  3CC7 P;  1OAE A;  1LC1 A;  3ZOX A;  4QAO A;  1DW1 A;  1ZN5 A;  1FE6 A;  2Y0E A;  3L71 J;  3L73 D;  1T3J A;  2GC4 D;  3DMI A;  4L76 A;  3I56 P;  1SQX K;  4PJ0 E;  3A0B V;  2Q3E A;  4N0K A;  3A0H V;  4MN4 C;  1BGY J;  3CWB G;  2KIK A;  1HWT C;  1G2C B;  1GL2 D;  1RF1 A;  5B5E H;  3V2Q A;  2DVH A;  4K35 A;  5IY5 1;  1HCM A;  2ZXY A;  2KSJ A;  5CID B;  3ZOY A;  1CSU A;  2C1D B;  1BE3 G;  1I55 A;  2FYU K;  3W68 A;  3L73 E;  4H0J A;  2B87 B;  5KAF E;  1GU2 A;  1FOC A;  2P67 A;  1GL2 C;  1G1I A;  3A2A A;  3MGN A;  2E75 D;  2FFD C;  2J59 M;  1W2B O;  2GB8 B;  1QVG O;  1SQB E;  3CI9 A;  3HTK B;  1WRG A;  1M57 D;  4BXL A;  2A45 I;  2WSE H;  3SWK A;  2A45 H;  2MJZ A;  2AXT E;  1EXJ A;  1HJ0 A;  1IFD A;  1KD1 Q;  3BRV B;  3BCC D;  1IFI A;  3PXS A;  4I6M C;  4U7J A;  4AAO A;  2OQQ A;  1RF0 C;  4GKG A;  2ZYD A;  1C6R A;  1LGH B;  1NU1 D;  1AVY A;  1NH4 A;  1NMI A;  1KQL A;  1HGZ A;  1BSN A;  4Q5P A;  1FDM A;  3B4S A;  2KLU A;  4GIF A;  1NML A;  3LID A;  1H8A A;  4FA1 A;  2IZ1 A;  2W6A A;  3WUI A;  5CBO A;  1L9B C;  2N9I A;  1VQN P;  2ZZS 1;  2BCN B;  1IK9 A;  1QL4 A;  3A7O A;  2C0X A;  2WTY A;  1N9C A;  1CED A;  3SWS A;  3BCC E;  2ZFC A;  2IPP A;  3L73 G;  1VQP P;  4HKZ H;  3HQ7 A;  1N50 A;  1NU1 E;  1CYC A;  4PD4 I;  2E43 A;  5KLV K;  1USE A;  1LT9 A;  3VMA A;  4WQ7 A;  4PJ0 V;  1SQV D;  3MUD C;  5APW A;  1CRH A;  2RMZ A;  1FOS F;  3MP7 B;  2QM8 A;  1JY2 O;  4C7N B;  1NTZ D;  4O1Q A;  2P1J A;  3TGU J;  2C9X B;  5CIG B;  3SXT A;  3B5N B;  1T2K D;  2WQY C;  1E8E A;  1S4X A;  1VQ9 P;  4M3L A;  1FZE A;  2QRX A;  1VF5 D;  1MFZ A;  1DW3 A;  4YE1 A;  3H32 B;  3P8M C;  3D6Z A;  2AEM A;  1M7L A;  1FZA A;  2OZ1 A;  1YBK A;  3D71 A;  3H1J D;  3CCU P;  3VMY A;  2Q7C A;  1SQV E;  5C39 A;  1E29 A;  2G8Y A;  2QJP C;  1WVE C;  3WFD C;  5KAF V;  1S5L E;  1NTZ E;  1KV4 A;  5H2F H;  1RZ5 A;  1JOC A;  1GDV A;  4L1Q A;  2YMY A;  1LWU C;  3CCJ P;  1LP1 A;  1T2K C;  1J1D C;  3CX5 H;  3GG2 A;  4TT3 H;  1NYH A;  1N7S D;  3P8C E;  1VF5 C;  1H9Y A;  1KQS O;  1SQB J;  1C6S A;  5AW8 B;  3BCC G;  2ORL A;  2FYN B;  2FYZ A;  5TIS H;  3H1J E;  1SLQ A;  3T97 B;  1EDJ A;  1SQB K;  2OYI A;  2L91 A;  4WY4 A;  3ZOW A;  1URQ D;  1C2R A;  1OWA A;  3M06 A;  2KS1 A;  3M0D C;  5DJQ C;  4DZO A;  2CA4 B;  2OYH C;  4RKU J;  1Q82 Q;  1N7S C;  3KQG A;  1H0T A;  2N1T A;  3FXE A;  3L37 A;  5APV A;  3JCU E;  3UIA A;  1KYO I;  2YO3 A;  3DR0 A;  2A06 G;  1K9M Q;  1T3U A;  4L3G A;  1URQ C;  1IJD B;  1XTG B;  2UWJ E;  2XDJ A;  4N3Y B;  2M3E A;  5AW5 B;  4OGQ D;  1MUU A;  4HJG H;  2K9J B;  3FX0 A;  1GK4 A;  3KZI H;  1SQV G;  5APQ A;  1RY3 A;  1PGJ A;  1N73 C;  2N18 C;  1AV1 A;  2V07 A;  2KP8 A;  2W90 A;  4RO0 A;  2M5A B;  2FY8 A;  1KX2 A;  2Q9I A;  1M6Z A;  1GL2 B;  4W7Z A;  3H1H D;  2FFD B;  1NU1 K;  4ZMD A;  2HR3 A;  1KX7 A;  2K1A A;  3WUU A;  2OTL P;  4H13 D;  1YJN P;  3L72 J;  4W7Y A;  3WFC C;  3TNU A;  1CRG A;  3NMD A;  2SPZ A;  4OGQ C;  4XYD B;  2LXC B;  1L2P A;  3H1J G;  3ZDM A;  1P84 D;  1M8O B;  1VPC A;  2KZJ A;  4BWN A;  1DW2 A;  3M0A A;  2WT7 A;  3HQ6 A;  5DFS A;  1A02 J;  2P7J A;  3IR9 A;  1L0N D;  3CCE P;  2QJY C;  4H44 B;  3H1L J;  1H31 B;  1PP9 D;  4XE5 B;  4H0K A;  1S5L V;  4JBZ A;  5E79 H;  4H13 C;  5AW0 B;  2ZBO A;  3PLN A;  3VRD A;  4EID A;  1SQV K;  4XA4 A;  2FBW C;  3H1K J;  1EC5 A;  2JWD A;  5CCG D;  2O01 H;  1NTZ K;  4L74 A;  2PCB B;  1P84 E;  2E5T A;  2IYO A;  1SQQ D;  2B11 B;  1T8Z A;  3CX5 W;  1L0N E;  1NTK J;  1CIG A;  1PP9 E;  2IBZ D;  1JEK A;  4NPE A;  1HTL C;  5KAI E;  2R3C A;  2XKM A;  1JTH B;  5CIF B;  2DGE A;  1PV3 A;  2RH0 A;  1A56 A;  4PJ0 H;  1VQO P;  1C52 A;  1X79 B;  1L0L J;  2HPC B;  1N90 A;  3TYI A;  1LTA C;  5CCG C;  3ORV A;  3H6P A;  1FZG A;  3L71 D;  2Q6Q A;  4WB4 A;  2B9B A;  2YIU C;  1SQQ E;  2W6B A;  2IDB A;  1I6E A;  2KB7 P;  1ZR4 A;  451C A;  1BGY D;  2LKM A;  1UII A;  3CCV P;  3FWL A;  1JDL A;  2IBZ E;  3AE4 C;  2H43 A;  1DII C;  1YIJ P;  1RE4 C;  3OCD A;  3MHV A;  1A2S A;  4L73 A;  1AVO A;  5CCH D;  3D70 A;  4OVN F;  4XFJ A;  1OVR A;  1L4A A;  1EB7 A;  2BCC J;  1IQC A;  3H1H G;  2HOD B;  1BDC A;  5KAF H;  4AYC A;  3ZOO A;  2YNY A;  3L71 E;  2IFM A;  2QJP B;  3R2P A;  3AEE C;  2D2C D;  1SFC D;  4OWF A;  2IZ0 A;  1LTJ C;  1BGY E;  1LWU B;  3A0B E;  1J1D B;  2FKW B;  2L4D A;  1VF5 B;  1YIT P;  5CIH B;  5CCH C;  1IFJ A;  3AE5 C;  1JM0 A;  1J1E C;  1AYG A;  3QWO C;  4HB1 A;  1EDI A;  2MHM A;  2AXT H;  2QIW A;  1PP9 G;  1IRW A;  2P2U A;  1BDD A;  5DJQ B;  4EIF A;  1SFC C;  4WQ8 A;  3RBZ A;  3G71 P;  4PW9 B;  1CC5 A;  5KTB A;  2OYH B;  1KQF B;  2W8Z A;  4NPF X;  1N7S B;  4KJM A;  3PJS K;  2IYP A;  1SQQ G;  5KJ7 D;  4Y28 J;  5AUR A;  1RAQ A;  1ZRT D;  1ETP A;  3RN0 A;  1LTS C;  4L3H A;  2P58 A;  1K8A Q;  1GDT A;  5AVT B;  4JYB A;  1YYC A;  1YTZ T;  1URQ B;  1M1J A;  3WUT A;  1CZQ A;  2GUS A;  1RQU A;  4DY9 A;  2NPS D;  2CE0 A;  3PRJ A;  4N78 D;  1GD2 E;  1KMI Z;  1DX7 A;  5KAI V;  2BH4 X;  5KLV D;  1N73 B;  2N18 B;  3L71 G;  5KJ7 C;  1S5L X;  3NBS A;  1L0N K;  1PZQ A;  1QX8 A;  1GMJ A;  3KYQ A;  1Y9B A;  1OW6 A;  1RE3 C;  1ZRT E;  2K37 A;  2ZON G;  1K73 Q;  4GOF A;  2M3B A;  3CXH D;  1W2L A;  2NPS C;  4JPZ B;  2LIR A;  4ZNC A;  3LW5 J;  1S72 P;  1N7L A;  1G2C A;  4V2K A;  3TGU D;  1SQQ K;  1FDO A;  3Q5P A;  3DP5 A;  1TU3 F;  1RAP A;  1FOS E;  3AEG C;  3U1C A;  5AVV B;  3AEA C;  4Z1M H;  3PH0 A;  1M90 Q;  2C1U A;  3GHG C;  2C1D A;  2V08 A;  1Y8A A;  1S5L H;  1CYJ A;  1FI7 A;  1H33 B;  3RL0 D;  2G3A A;  4NFG B;  2E42 A;  1MG3 D;  3CXH E;  5CJ4 A;  2B87 A;  1EZV G;  2ZYA A;  1U7J A;  1GK6 A;  3SVW A;  2V7Q H;  3VP9 A;  4ASV A;  1YHQ P;  2YXR B;  1OMI A;  4D6T J;  1HH7 A;  3CPW O;  1JCD A;  3TGU E;  2V4H A;  1HBW A;  3L70 E;  1U74 B;  2JWA A;  3L4M A;  3PHL A;  2I8D A;  2O01 N;  4EDF A;  1FAV A;  2E76 D;  4C7R A;  3HTK A;  3RL0 C;  2BEQ D;  1L9J C;  1SQB D;  4DJG A;  1FZC C;  1JY3 N;  1I8O A;  2JQR A;  3NFQ A;  3CL3 D;  1YNR A;  2FXM A;  2Y9Y A;  1HJ4 A;  2EXV A;  1HJ3 A;  1KB9 D;  2YIU B;  1CTY A;  1IFN A;  1MV8 A;  1VQK P;  1J3S A;  1QYZ A;  3RK3 D;  1PFI A;  2E76 C;  4AAL A;  3IFM A;  1RH5 B;  3HE5 B;  2GA1 A;  4WQC A;  2FWL A;  5KLV G;  2QG4 A;  1CRC A;  3RK2 D;  3HUS C;  4O9B A;  3L74 E;  1HZV A;  4TLF A;  4FA5 A;  1GU4 A;  5BU8 B;  3VOP A;  2WWW A;  1ZW0 A;  5AW1 B;  3E7K A;  1KB9 E;  2E75 C;  1YFC A;  2OAR A;  3RK3 C;  1GIW A;  3RK3 E;  1JUN A;  1LTJ B;  2KK7 A;  2JJL A;  3HQ8 A;  1OW8 A;  1E79 H;  1Q2N A;  5APT A;  2C9N Y;  5CMZ A;  2PCC B;  2HG5 D;  2YMK A;  3Q5S A;  4C7N A;  3O20 A;  1J1E B;  2BLF B;  3L35 A;  4IFD K;  3KHU A;  4JCG A;  3N4X A;  3L72 D;  3L75 J;  3B5N A;  3GMA A;  1YIC A;  5CBN A;  2KYV A;  3NBT A;  1FJ0 A;  2IX7 C;  2C2C A;  1SFC B;  3H32 A;  1PPJ D;  2B89 A;  155C A;  1KZU B;  1YQ3 C;  2AI5 A;  3ZCF A;  1CI6 B;  3VMZ A;  1FBM A;  5GTH H;  3RGU A;  3H1L D;  1QLE D;  1HRC A;  2AXC A;  1NTM E;  1HF9 A;  1BSH A;  3OA8 B;  1P84 H;  1LTI C;  4LJI A;  3VYM A;  3PXW A;  1R0Q A;  3L72 E;  5APY A;  1SQB G;  3GW6 A;  1UIX A;  3H1K D;  1NKZ B;  3II6 A;  3L70 J;  5AW7 B;  2HFE D;  3Q2Y A;  3P32 A;  4EOT A;  3P8C D;  1PPJ E;  3GF7 A;  3TSI A;  2ZXX A;  1XTC C;  1SVF A;  2LXB A;  1NTK D;  3H1L E;  3T97 A;  3KXD A;  3EWK A;  1ZME C;  3ABV C;  1KIL D;  1X22 A;  1FI9 A;  1DEE G;  1JO5 A;  3HD7 D;  2QJK C;  2XU6 A;  5B66 E;  3OAK A;  2FXO A;  3AE6 C;  2FRC A;  4C46 A;  3Q1M A;  1L0L D;  3H1K E;  2B12 B;  1VQ5 P;  2Y0D A;  3CX5 I;  4WQE A;  3M9H A;  3ZBM A;  5AVR B;  5GTI E;  3HE4 B;  1R8E A;  1Q90 D;  3AEB C;  4R4L A;  1HGV A;  1NTK E;  1H9X A;  1KIL C;  1KIL E;  1S2E A;  3HD7 C;  3CCS P;  2N3Y A;  3GHG B;  1YI2 P;  3L74 J;  1NU1 G;  4EI2 A;  2CE1 A;  2BCC D;  2K9J A;  3CC2 P;  5CIE B;  1AQT A;  4K3I A;  1JCC A;  1L0L E;  3A0B H;  3A0H H;  1IFM A;  2M5A A;  5B5E E;  1GL2 A;  1N8R Q;  3L72 G;  2ZJS E;  2FFD A;  1COR A;  1HVV A;  1OW7 A;  2J5U A;  3WMM 0;  2C9L Y;  4HH2 A;  2AIU A;  1H88 A;  1KFM A;  1Z56 A;  3RL0 B;  1H1O A;  1KB0 A;  3B8E B;  1DD3 A;  2BCC E;  1FZC B;  2H89 C;  3WU2 V;  1EDK A;  4RSZ A;  1U7M A;  1K3G A;  3V6I A;  2WSF J;  5DF5 A;  1YQ4 C;  2WSC J;  1H31 A;  1HH0 A;  1NTZ G;  1EZV I;  2ZT9 D;  5KLI C;  1RF0 A;  1LTT C;  5CJ0 A;  4JQ0 D;  3JBT B;  3AE3 C;  3H1K G;  4PV1 D;  1NTM J;  2J58 A;  2E76 B;  1KOR A;  3CCQ P;  1DW0 A;  2MKV A;  4OH8 B;  4IL6 E;  1NTM K;  4R4M A;  1H32 B;  2ZVO B;  1I6D A;  1YTZ I;  5M1B A;  3HUS B;  1KQG B;  2VHD A;  3USS A;  2QEX P;  3SWY A;  2R44 A;  5L8R J;  1MZ4 A;  3PXT A;  2GC7 D;  4PD4 D;  1AJY A;  3IF4 A;  2E75 B;  1L0L G;  2FXP A;  5B66 V;  2ZYG A;  1M60 A;  2NZ2 A;  2YK3 A;  1CXC A;  1JTH A;  1CO6 A;  4PV1 C;  3SFE C;  4XXL A;  2PAC A;  2HPC A;  3MUD A;  4FB1 A;  1CSB A;  1S6V B;  1IO4 A;  1I8P A;  5GTI V;  1S3J A;  1DH3 A;  1N86 A;  2KUB A;  2YQB A;  4PD4 E;  3H1I J;  1QEX A;  4ZKU A;  4FA9 A;  2HV4 A;  2E74 D;  1FJK A;  3CXH H;  4GT1 A;  5BVZ A;  5KKZ C;  1NTK K;  3PTZ A;  2HOD A;  1SP4 A;  1W5C T;  1FJP A;  1DD4 A;  5B5E V;  2C8S A;  5AVY B;  1YCC A;  5CIB B;  2I1K A;  1LWU A;  1C75 A;  1L0L K;  1CSX A;  1W5C E;  4D6T D;  2E74 C;  2JDI H;  1KIB A;  3CP5 A;  4AQR D;  5H2F E;  2BEZ F;  4DOJ A;  3O1Y A;  2OGU A;  2QJK B;  3I5C A;  1RF1 C;  1E2R A;  2O1K A;  3M0D A;  1BCC E;  3AE9 C;  2PGD A;  3O8Z A;  1GU5 A;  2OYH A;  3CCL P;  1N7S A;  4D6T E;  3IN6 A;  1Q86 Q;  1KYO W;  4A7P A;  1KYO D;  3RL0 g;  5TIS E;  3B71 A;  1R5S A;  3A3Y B;  4IL6 V;  2WSE J;  1GKS A;  4WQ9 A;  2QM7 A;  1LTB C;  4KMG A;  1L0N G;  3HD7 B;  1URQ A;  2HYN A;  2C0W A;  3S9O A;  2PAJ A;  1KB9 H;  5APU A;  1WEJ F;  1VQM P;  1U75 B;  1Y47 A;  2D2C C;  3S1K A;  3AED C;  1NVO A;  1N73 A;  1CRY A;  2R3S A;  1CRJ A;  1JY2 N;  1KYO E;  2KNC B;  3L36 A;  2RN0 A;  3SSU A;  1LC2 A;  1X0T A;  3B5N D;  2ZAE B;  4EYY Q;  3BRT B;  1FS0 E;  3JC2 2;  2IBZ G;  1HRO A;  3KZI E;  3CCR P;  3IAO A;  3C8V A;  5AVU B;  3L75 D;  3FXD A;  1NKN A;  2E5Y A;  3H25 A;  3KPE A;  5DJT B;  3CWB E;  3CC4 P;  1MKM A;  5KLI B;  3MIW A;  1H33 A;  4U3F J;  1IRV A;  3L4O A;  4WQA A;  4I2L C;  1B7V A;  1I54 A;  1NAY A;  1BGY G;  1CXA A;  3CXH W;  2O1J A;  3VTP C;  2WPS A;  3F89 A;  2L5G B;  3AEF C;  1SQP J;  1FHB A;  3HRN A;  3MD0 A;  3G6E P;  3I55 P;  3VP8 A;  1LTG C;  2QSI A;  4OGQ B;  1HZU A;  1JY3 P;  3L75 E;  5AW2 B;  3WFE C;  3K5B A;  2W27 A;  1KN7 A;  1LT9 C;  4EIE A;  3L70 D;  2B88 A;  3EFG A;  2ZOO A;  1VQ4 P;  1C6O A;  3Q3D A;  5H2F V;  5E79 E;  5B66 H;  5B6Q A;  2QJY B;  5C0Z A;  1YIQ A;  4WQD A;  2OYO A;  1BL9 A;  3MZW B;  3D6Y A;  1FU1 A;  4H13 B;  3V4W A;  1BCC J;  3RMZ A;  1U57 A;  1AQ5 A;  5CCG A;  2JTI B;  2FYN C;  5AW9 B;  5TIS V;  2Y0C A;  1I5T A;  1CSW A;  1KFN A;  3M9Q A;  1SQX J;  2GUV A;  1HUC A;  3AEC C;  4WY4 D;  4W80 A;  3HE5 A;  5TJH A;  1QL2 A;  1DEB A;  1RE4 A;  1M1K Q;  2KOG A;  5C9M A;  2POH A;  1J2J B;  3MTU E;  3AE2 C;  3BAT A;  4N6J A;  5EFW B;  5KKZ B;  2WZ7 A;  1JB0 J;  1F1F A;  3V2R A;  1OX3 A;  3L74 D;  1PL5 A;  2N1T D;  1JNM A;  2FYU J;  3VYI A;  1GW3 A;  1S9K D;  3JCU H;  1C7M A;  1LNQ A;  3CMA P;  3AE1 C;  1LTJ A;  1GTW A;  2OYI C;  3CD6 P;  4WY4 C;  2XZR A;  3MK7 C;  1PGQ A;  4LLH A;  2WPQ A;  2W6J H;  1IC2 A;  4IFF A;  4RJT A;  1IK7 A;  3M91 A;  4IL6 X;  3TDK A;  2N3B A;  3L75 G;  5CCH A;  2E74 B;  3KZI V;  3CME P;  4GDO A;  5AVS B;  1QGK B;  2RKL A;  2CXB A;  1ZXG A;  2N1T C;  2O3J A;  4H44 D;  4UB8 E;  5AW3 B;  2R5D A;  1RF1 B;  2OTK E;  1SFC A;  1S9K E;  1YTC A;  4AAM A;  3NWV A;  1CI6 A;  2KI7 B;  3CWB J;  2KSE A;  1VL2 A;  1GJQ A;  4I7Z C;  3D0W A;  1N2D C;  4ASW A;  1QVF O;  1NNO A;  3TGU G;  3BAS A;  4IL6 H;  2Z5H A;  3L70 G;  3OA8 A;  3RK2 C;  1BE3 J;  2AEF A;  4CPG A;  1NTM D;  3VMX A;  1GW4 A;  4H44 C;  3AE8 C;  2I8F A;  1YEB A;  4UB6 E;  2JP3 A;  1OFC X;  4AAN A;  1E5W A;  1YJ9 P;  4RES B;  3EFF K;  5E79 V;  3WU2 E;  2YCC A;  2D2C B;  1K3H A;  3FGA D;  1KV9 A;  1DVV A;  2D0S A;  4P4Q B;  3CU4 A;  5KJ7 A;  2CK3 H;  1T6A A;  4KT0 J;  3GF3 A;  4LC1 A;  1RE3 A;  2B10 B;  1ZLL A;  2O01 J;  5KLV J;  2B0Z B;  3E1I A;  4YXD C;  1P84 I;  2A06 D;  3VNW A;  1MFT A;  3X39 A;  2NPS A;  3G4S P;  4PD4 H;  5AVQ B;  2CA3 B;  1FC2 C;  3HE4 A;  1M56 D;  3OJA B;  3VN0 A;  1CIE A;  3L74 G;  5KAI H;  2H7H A;  3TF5 A;  3H1I D;  2JR8 A;  4I1L A;  3GHG A;  1QKS A;  1NJI Q;  4FAN A;  2AEJ A;  2HLO A;  2XV5 A;  2A06 E;  3O0R C;  4GOD A;  4MU8 A;  4EIJ A;  3E1R A;  3LW5 H;  4GYD A;  3TK1 A;  2N9J A;  2C1V A;  2NPS B;  5CIC B;  2YO2 A;  2IBZ I;  2XNX A;  3V2N A;  2IFN A;  1PGO A;  2I1J A;  4AUW A;  4H0L D;  3L73 J;  1L4A D;  3PP5 A;  1IZN B;  1LT9 B;  2K9Y A;  1COT A;  3H1I E;  1CSV A;  2WSS H;  4UB8 V;  2OTJ P;  1WT6 A;  2QA4 P;  1YJW P;  1FZC A;  4NPD A;  1PIX A;  3RN1 A;  3BVH A;  2M0B A;  2YKO A;  2CPB A;  2DW3 A;  5EXQ A;  1NTM G;  1VQ7 P;  4GED B;  2GM4 A;  4H0L C;  2AXT V;  2KLV A;  2CPS A;  1L4A C;  2OZ1 B;  1FCD C;  1OZH A;  1PGP A;  4YTP C;  1FDI A;  1GQ1 A;  1EDL A;  2MTA C;  3LIE A;  4HYT B;  3O6Q A;  4UB6 V;  2JEE A;  4DCK A;  3G3Z A;  1PPJ G;  3F5H A;  2P10 A;  1CTZ A;  2R5B A;  1H32 A;  2ITA A;  1R5L A;  4K3A A;  3SWF A;  1RHZ B;  1LP1 B;  3HUS A;  3U59 A;  2ZXE B;  3H1L G;  4ZKP A;  3SJL A;  2LIT A;  4PWA A;  1RQV A;  1KYO H;  1CCH A;  1CW5 A;  4YXW H;  2H88 C;  1AKK A;  1ZZH A;  4L75 A;  1F1C A;  1M70 A;  2OYI B;  4WY4 B;  2KXP B;  3MK7 B;  3BCC J;  3PH2 B;  3Q5R A;  1OCD A;  2XND H;  2KS1 B;  1AOQ A;  3O6Q B;  1KTM A;  1CYI A;  1JY3 O;  2R32 A;  1YEA A;  3AE7 C;  1NU1 J;  3H1I G;  351C A;  1NTK G;  2QVA A;  1H0T B;  2N1T B;  5CYT R;  1W2E A;  2NRG A;  4JYC A;  2ZT9 C;  1CHJ A;  3W67 A;  4Y99 C;  1LT1 A;  4WBA A;  5K5G B;  1CIH A;  1HJB A;  1M1J C;  2JO1 A;  3RK3 B;  5AVZ B;  4I7Z B;  1JMB A;  3V5B A;  4U3F D;  1K04 A;  1X8Y A;  2D0W A;  2Y9Z A;  3RK2 B;  5AVX B;  2WIT A;  3H1H E;  2WMM A;  1CTJ A;  1SQP D;  1VQL P;  2Q5U A;  1SQV J;  2Q3I A;  2BCC G;  3V4Q A;  5GTH E;  1NTZ J;  4AX3 A;  3OA7 A;  1QN2 A;  3KDP B;  3GLM A;  2GIW A;  1WMK A;  1RZ6 A;  1A02 F;  2K3R A;  5CHX A;  3TNU B;  3CXH I;  4U3F E;  3NTN A;  1QL1 A;  2V7Q J;  1IFP A;  2XTS B;  3EQ2 A;  2PP6 A;  1QL3 A;  4JF7 A;  4O1W A;  1S1C X;  2WT7 B;  1DT1 A;  1BCC D;  3CX5 D;  3WC8 A;  4EIC A;  1SQP E;  3H1J J;  1Q7Y Q;  2BAS A;  2Z5I A;  2A45 G;  1GZL A;  4IOI H;  3JSV C;  4WWI A;  2WVR A;  1ZR2 A;  1CNO A;  3ITK A;  1LFM A;  1SQX D;  1NAF A;  1KIL A;  4IFM A;  2PRR A;  3HD7 A;  3M97 X;  1FI3 A;  5DJU B;  5AW4 B;  1IO3 A;  1D7M A;  1JY2 P;  2YXQ B;  3CX5 E;  3P7K A;  3OW2 O;  5BU5 A;  1VYD A;  3R4Y A;  2N9Y B;  2ZVN B;  1NHL A;  2FYU D;  4J20 A;  1K05 A;  2KNC A;  5AVW B;  3RLM A;  1SQX E;  4FA4 A;  3WUV A;  3TYY A;  1CRI A;  1NGM B;  2VRS A;  1USD A;  1OXZ A;  4UB8 H;  1JMM A;  1OIP A;  2LR2 A;  1KIL B;  3QH9 A;  1CIF A;  3CCM P;  2BH5 X;  4LGD E;  1VQ8 P;  1FZF A;  2K88 A;  1G1J A;  4BRY A;  4Y5R A;  1CCR A;  1FZB A;  1KB9 I;  3A0H E;  2Q1K A;  1KC8 Q;  4U3F G;  2H8P D;  3FWN A;  3G9R A;  1EQ7 A;  1EZV D;  3SLE A;  3OCD B;  1LJ2 A;  2FYU E;  1A8C A;  1ZV8 A;  4H0L B; 
#chains in the Genus database with same CATH homology
 3CWB D;  5DFS A;  1FI9 A;  1N15 A;  1L0N D;  2B4Z A;  1LS9 A;  1H31 B;  1CHI A;  1C7M A;  1PP9 D;  4H0K A;  2FRC A;  3A9F A;  1S5L V;  2BPB B;  3MK7 C;  1L0L D;  1DIQ C;  2B12 B;  4RJT A;  1BE3 D;  2Y0D A;  2ZBO A;  3TDK A;  3PLN A;  2N3B A;  3VRD A;  4WQE A;  3ZBM A;  5GTH V;  4EID A;  3KZI V;  2CXB A;  1C2N A;  2PCB B;  3O5C A;  2O3J A;  1SQQ D;  1H9X A;  1MG2 D;  3C2C A;  2B11 B;  2N3Y A;  3CX5 W;  1CIG A;  1YTC A;  1NIR A;  2CE1 A;  3CYT I;  2IBZ D;  3NWV A;  2BCC D;  4AAM A;  1GJQ A;  1DVH A;  5CIE B;  4K3I A;  5CIF B;  2DGE A;  1A56 A;  1NNO A;  1CHH A;  1C52 A;  3WFB C;  3OA8 A;  1N90 A;  3TYI A;  4WQB A;  3ORV A;  1NTM D;  3L71 D;  1COR A;  3ZIY A;  2I8F A;  1YEB A;  2AIU A;  1HJ5 A;  1LMS A;  1I6E A;  4AAN A;  3HQ9 A;  451C A;  1BGY D;  5E79 V;  1H1O A;  3FWL A;  1JDL A;  1KB0 A;  2YCC A;  1DII C;  1K3H A;  1KV9 A;  3OCD A;  1DVV A;  1A2S A;  3WU2 V;  4RSZ A;  2D0S A;  4P4Q B;  3CU4 A;  1IZL 0;  1EB7 A;  4FAV A;  1AOF A;  1K3G A;  2BGV X;  1IQC A;  5DF5 A;  1H31 A;  2B10 B;  1OAE A;  3ZOO A;  2B0Z B;  1LC1 A;  3JBT B;  2QJP B;  2A06 D;  3VNW A;  3ZOX A;  4QAO A;  1DW1 A;  3X39 A;  2Y0E A;  2CA3 B;  3L73 D;  2GC4 D;  3DMI A;  1DW0 A;  3A0B V;  2L4D A;  2Q3E A;  4N0K A;  3A0H V;  1CIE A;  5CIH B;  1H32 B;  1I6D A;  1AYG A;  3TF5 A;  2VHD A;  3H1I D;  2MHM A;  1QKS A;  1IRW A;  1MZ4 A;  2DVH A;  3PXT A;  5IY5 1;  1HCM A;  2GC7 D;  2ZXY A;  4PD4 D;  4FAN A;  5CID B;  3ZOY A;  1CSU A;  5B66 V;  1M60 A;  2C1D B;  2YK3 A;  1CXC A;  1I55 A;  3O0R C;  5DJQ B;  4EIF A;  1CO6 A;  4MU8 A;  4WQ8 A;  4PW9 B;  1CC5 A;  4GYD A;  4XXL A;  2PAC A;  2N9J A;  2C1V A;  5CIC B;  4FB1 A;  1S6V B;  4H0J A;  1I8P A;  5GTI V;  1GU2 A;  1FOC A;  5AUR A;  1COT A;  1RAQ A;  1ZRT D;  1ETP A;  3RN0 A;  4L3H A;  1CSV A;  4UB8 V;  2GB8 B;  2YQB A;  4FA9 A;  4DY9 A;  2CE0 A;  2HV4 A;  3PRJ A;  3RN1 A;  5KAI V;  2BH4 X;  3PTZ A;  5KLV D;  5EXQ A;  4GED B;  2N18 B;  2AXT V;  3NBS A;  1W5C T;  2OZ1 B;  1FCD C;  3BCC D;  3PXS A;  5B5E V;  2C8S A;  1YCC A;  5CIB B;  4AAO A;  1GQ1 A;  2MTA C;  1C6R A;  2ZON G;  1C75 A;  1NU1 D;  4UB6 V;  1CSX A;  1NMI A;  4D6T D;  3CXH D;  1W2L A;  4Q5P A;  1CTZ A;  1H32 A;  2LIR A;  1NML A;  4FA1 A;  1KIB A;  3CP5 A;  3WUI A;  4V2K A;  1L9B C;  2LIT A;  3SJL A;  3TGU D;  2N9I A;  2ZZS 1;  4PWA A;  3DP5 A;  1RAP A;  2BCN B;  1QL4 A;  1CCH A;  3O1Y A;  1N9C A;  1CED A;  3SWS A;  2QJK B;  2C1U A;  2C1D A;  2V08 A;  1E2R A;  1CYJ A;  1FI7 A;  1AKK A;  1ZZH A;  1H33 B;  1F1C A;  1M70 A;  4NFG B;  1MG3 D;  3HQ7 A;  3MK7 B;  1N50 A;  3PH2 B;  1CYC A;  1OCD A;  1AOQ A;  1KYO W;  1CYI A;  4A7P A;  1YEA A;  3SVW A;  1KYO D;  3VMA A;  351C A;  4WQ7 A;  4PJ0 V;  1HH7 A;  1SQV D;  4IL6 V;  1GKS A;  1CRH A;  4WQ9 A;  2RMZ A;  5CYT R;  4KMG A;  1NTZ D;  1U74 B;  4O1Q A;  2JWA A;  3L4M A;  1CHJ A;  3PHL A;  4EDF A;  1CIH A;  2C9X B;  5CIG B;  3SXT A;  1L9J C;  1SQB D;  1WEJ F;  1E8E A;  1U75 B;  1I8O A;  2JQR A;  1DW3 A;  4YE1 A;  1CRY A;  4U3F D;  2D0W A;  2OZ1 A;  1YNR A;  1CRJ A;  1HJ4 A;  3H1J D;  2KNC B;  2EXV A;  1E29 A;  2RN0 A;  1HJ3 A;  1LC2 A;  1KB9 D;  2YIU B;  1CTJ A;  1WVE C;  3WFD C;  5KAF V;  1CTY A;  1SQP D;  1RZ5 A;  1GDV A;  1J3S A;  1QYZ A;  4L1Q A;  4AAL A;  1HRO A;  4AX3 A;  3GG2 A;  1QN2 A;  4WQC A;  2GIW A;  1RZ6 A;  2FWL A;  2QG4 A;  1CRC A;  3L75 D;  1H9Y A;  1C6S A;  2XTS B;  2ORL A;  1HZV A;  2FYN B;  1QL3 A;  4FA5 A;  4O1W A;  5KLI B;  1H33 A;  1IRV A;  1DT1 A;  3L4O A;  4WQA A;  2L91 A;  1B7V A;  1I54 A;  3ZOW A;  1BCC D;  3CX5 D;  3WC8 A;  1YFC A;  4EIC A;  1C2R A;  2KS1 A;  5DJQ C;  1CXA A;  3CXH W;  1GIW A;  2CA4 B;  3HQ8 A;  1CNO A;  1FHB A;  3ITK A;  1LFM A;  1SQX D;  2PCC B;  1HZU A;  3O20 A;  3WFE C;  2BLF B;  4EIE A;  3L70 D;  3M97 X;  3KHU A;  4JCG A;  1FI3 A;  3L72 D;  3DR0 A;  2ZOO A;  1IO3 A;  1C6O A;  5H2F V;  1YIC A;  5B6Q A;  4L3G A;  2QJY B;  3NBT A;  5C0Z A;  1FJ0 A;  1YIQ A;  4WQD A;  2C2C A;  1BL9 A;  1PPJ D;  155C A;  1VYD A;  2AI5 A;  3ZCF A;  2N9Y B;  2FYU D;  4J20 A;  2K9J B;  3RMZ A;  3H1L D;  2N18 C;  2V07 A;  2JTI B;  3RLM A;  4FA4 A;  1HRC A;  1CRI A;  1KX2 A;  5TIS V;  2Y0C A;  1I5T A;  1CSW A;  1M6Z A;  3OA8 B;  4LJI A;  3H1H D;  3VYM A;  3PXW A;  1R0Q A;  1CIF A;  2BH5 X;  3GW6 A;  3H1K D;  5TJH A;  1KX7 A;  4Y5R A;  1CCR A;  3WFC C;  5C9M A;  1CRG A;  4XYD B;  1EZV D;  3SLE A;  5KKZ B;  1F1F A;  3OCD B;  1A8C A;  1P84 D;  3L74 D;  1NTK D;  1DW2 A;  3HQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...