1SQVD

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
total genus 48
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqvD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqvD02
2N18C 3O20A 4U3FD 1I6DA 3A0BV 1CRCA 1CIEA 1IRWA 1ZRTD 3CX5W 1QYZA 1NIRA 1L0LD 1NNOA 1U74B 2LITA 1HJ3A 1A56A 1LMSA 1HROA 1CEDA 3PXSA 1DW1A 4FA1A 3SJLA 1YEBA 1CIFA 2C2CA 5IY51 5CIDB 4L1QA 1GQ1A 1I54A 1KIBA 1YICA 3MK7C 3WFDC 1KYOW 1EZVD 3HQ9A 4K3IA 4RJTA 1DIIC 3ZOWA 1OAEA 3FWLA 1FJ0A 1I55A 3CU4A 2DGEA 3A9FA 3DP5A 1KYOD 3DMIA 1A8CA 2PCCB 4FANA 2ORLA 3TDKA 3WFBC 1M6ZA 2MTAC 5KAIV 5TJHA 4WQCA 1IRVA 1NTMD 2AXTV 2JQRA 451CA 1CNOA 5TISV 5H2FV 1CXAA 5B6QA 1MG2D 1F1CA 5CIFB 1QN2A 1CTYA 1FHBA 3SXTA 5AURA 2CXBA 1HRCA 1EB7A 5C0ZA 1PP9D 1QL3A 3WFEC 4AX3A 3PXWA 1CSUA 1NU1D 1COTA 4L3GA 3RN0A 2Y0CA 1CYIA 3PHLA 4EIDA 3HQ7A 2V07A 3GW6A 2KS1A 3WUIA 1H31A 3GG2A 2RMZA 3OA8B 4YE1A 4EICA 1LC2A 2C1DA 1DIQC 3RN1A 1IO3A 2O3JA 1YCCA 1H33A 2QG4A 2A06D 2B12B 1H33B 1I5TA 1J3SA 3WU2V 1YTCA 1HZUA 1C6RA 4PWAA 1BCCD 1NTKD 3L73D 4MU8A 2GIWA 1YEAA 2PACA 1GIWA 3CYTI 5DJQC 1N90A 3H1ID 1C2NA 3A0HV 5E79V 1DW0A 4PD4D 1SQQD 5CIBB 2ZOOA 4WQDA 5C9MA 5CICB 1CO6A 3O0RC 3RMZA 3CWBD 3ITKA 1NTZD 3HQ8A 1MG3D 1YIQA 4EIEA 1M60A 1KX7A 1KV9A 1FOCA 2N18B 3L74D 3SLEA 4FA5A 3PXTA 3VRDA 3L71D 4NFGB 3TGUD 1AOQA 1DVVA 1H32B 2YQBA 1L9BC 3PH2B 4AAOA 5CYTR 2CA3B 2ZZS1 3CX5D 3L4OA 1M70A 1WVEC 1C7MA 2BH5X 1H9YA 4AAMA 1AOFA 4FA4A 2L4DA 1E8EA 4AANA 1JDLA 1CRYA 1CRGA 1N50A 3VNWA 3PTZA 1U75B 5DFSA 1N15A 2EXVA 3OCDB 4WQ8A 4JCGA 1FI9A 4O1WA 1S6VB 2N9IA 4GYDA 1GKSA 2IBZD 1LC1A 2N9YB 2CE1A 1CRHA 5B66V 1GDVA 1DW3A 2QJKB 4XYDB 1I6EA 5KLVD 3KHUA 1HCMA 1WEJF 3CP5A 2OZ1B 1BGYD 2YIUB 1CIGA 3NBSA 1CSXA 1B7VA 2QJYB 1W5CT 3OCDA 1F1FA 1CHIA 155CA 1QKSA 3NWVA 2HV4A 2CE0A 1SQBD 4L3HA 2DVHA 4PJ0V 4EIFA 2D0SA 3L75D 4LJIA 4EDFA 2BCNB 1E29A 1CYCA 3WFCC 4IL6V 3L4MA 1AKKA 1R0QA 2YCCA 1RZ6A 1N9CA 3BCCD 1CORA 1L0ND 2B11B 2BH4X 3KZIV 2JTIB 4FB1A 2C9XB 1H32A 1CRIA 3SVWA 2MHMA 4O1QA 2CA4B 4D6TD 2FYUD 1OCDA 4FAVA 1IQCA 1NMIA 3H1LD 1LFMA 1VYDA 1RAPA 3SWSA 4V2KA 3M97X 1GU2A 2ZBOA 2N3YA 2N9JA 1LS9A 1K3GA 3NBTA 1A2SA 1RAQA 1I8PA 3RLMA 1DVHA 4XXLA 1C6SA 1L9JC 1KB9D 1CCHA 1I8OA 5B5EV 3C2CA 3O5CA 1CTZA 2LIRA 3ZOOA 2Q3EA 1DW2A 1FI7A 2BGVX 3VYMA 3H1JD 1K3HA 5KLIB 4WQBA 3ZOXA 3H1KD 2B10B 1DT1A 2AI5A 4P4QB 3MK7B 2ZONG 3CXHW 3PRJA 5CIGB 2I8FA 1IZL0 1AYGA 4WQ9A 2GC7D 2B4ZA 4WQ7A 3TYIA 1KX2A 1C2RA 1CSWA 2BCCD 1PPJD 1C52A 1HJ4A 1YFCA 2N3BA 1CHJA 5GTHV 2GC4D 4H0KA 2BLFB 2L91A 4Y5RA 4H0JA 4UB8V 1SQVD 5DF5A 5KAFV 1C75A 2Y0EA 2RN0A 1CC5A 2B0ZB 3X39A 2GB8B 4PW9B 1BE3D 4GEDB 1HZVA 3L72D 4N0KA 3VMAA 3HQ6A 4WQEA 2OZ1A 2AIUA 3ZOYA 1H9XA 1C6OA 1RZ5A 1E2RA 5KKZB 3ZBMA 3ZCFA 5CIEB 3L70D 5DJQB 1ZZHA 2VHDA 2D0WA 4DY9A 1YNRA 3PLNA 1HH7A 2FYNB 3H1HD 5GTIV 2BPBB 2K9JB 1CCRA 2KNCB 2C1DB 3TF5A 2ZXYA 351CA 3OA8A 1H31B 1NMLA 1SQXD 2C8SA 1HJ5A 1CIHA 1MZ4A 3ZIYA 1CSVA 2JWAA 1H1OA 1W2LA 3O1YA 4A7PA 4QAOA 4WQAA 4FA9A 1CRJA 2FWLA 2YK3A 4Q5PA 2Y0DA 2C1UA 2QJPB 3DR0A 1CXCA 1FI3A 2V08A 1KB0A 1FCDC 1CHHA 1S5LV 2FRCA 4KMGA 1P84D 3JBTB 2XTSB 1ETPA 4UB6V 4AALA 1CYJA 4RSZA 1QL4A 5EXQA 1GJQA 4J20A 3WC8A 5CIHB 3CXHD 1CTJA 2C1VA 1SQPD 1BL9A 2PCBB 3ORVA
chains in the Genus database with same CATH superfamily
2N18C 2QJYC 1I6DA 1CRCA 2R44A 1ZRTD 1U74B 3CWBG 3E7KA 2ZXXA 1A56A 1NOHA 1VQ9P 4PV1D 3HD7C 3CCEP 1YEBA 2P7JA 2C2CA 1SQBK 5IY51 1DX7A 1NYHA 2ZXEB 4JPZB 2ZT9B 3TGUE 2E76B 3L70J 3JCUE 4EI2A 3WFDC 1KYOW 2H43A 3UIAA 3CX5E 2XV5A 4I1LA 1HTLC 3A9FA 1KILA 1DD4A 2WSCJ 1A02F 3L70E 2PCCB 1X22A 2YXRB 1RE4A 3CCVP 4PD4H 4EIJA 1SQVG 2D2CB 3WFBC 2OGUA 1LT9A 2MTAC 5KAIV 5AW2B 1MV8A 4GKGA 3AE7C 3L36A 2AXTV 5BVZA 1CNOA 5GTHE 1JY3N 3V2QA 5KLVE 4HKZH 4UB6H 5C0ZA 3WFEC 5CHXA 1CSUA 1PGJA 3USSA 3LW5H 2IYPA 4L75A 1FZAA 3RN0A 3WU2H 1NTKJ 1CYIA 1GK4A 1OZHA 3HE4A 3PHLA 1KQSO 4H13D 3GW6A 3AECC 3FXEA 3GG2A 3VOPA 2RMZA 1VQOP 2C1DA 1KYOE 3V5BA 1H33A 3OW2O 3ZDMA 2B12B 1OW6A 1DH3A 3H32B 3L73D 4I6MC 1ZLLA 4OGQB 1YEAA 3AE1C 1DW0A 3TGUJ 4WQDA 5C9MA 5AVVB 1CW5A 3MIWA 1CO6A 2W6AA 3O0RC 3RMZA 1L0LE 2G3AA 3ITKA 2YMYA 1MG3D 1YIQA 2ZJSE 1FOCA 1MKMA 4FA5A 1RE4C 2YO3A 1AOQA 1DVVA 1H32B 2AXCA 1LJ2A 3SWKA 2P67A 3T97A 1KILC 2ZZS1 4HJGH 3OJAB 3L4OA 1WVEC 1LT9B 3JSVC 2BH5X 1H9YA 1KTMA 2A06E 1AOFA 3HUSB 3L75E 1KC8Q 5CCHC 1EXIA 2L4DA 4OGQD 1JDLA 2KI7B 4N78E 1ZN5A 1U75B 3P8MC 1N15A 5GTIE 1YITP 1Q81Q 3OCDB 4WQ8A 4JCGA 3CCMP 1FI9A 4O1WA 2WITA 1MFTA 1S6VB 1FE6A 2C0XA 2OTJP 2N9YB 1CRHA 3CX5H 1GDVA 3A0HE 1N2DC 2QJKB 4XYDB 1JOCA 2KSJA 3CP5A 2OZ1B 3I55P 4IOIH 2CPSA 1B7VA 2QJYB 3WMM0 4PV1C 1L4AB 2GA1A 5CJ4A 4PJ0V 2D0SA 2FXMA 2N1TB 4EDFA 3RL0B 5CBNA 5APVA 1CORA 3VMYA 4W7ZA 1N86A 1ZRTE 3SVWA 1NVOA 2FYUD 3TNUB 1OX3A 4FAVA 2W83C 3H1IE 1SQXK 3KPEA 2WVRA 3R4YA 3S9OA 3A0BE 2A45I 3C9IA 2E43A 3V2PA 3L73J 5AW1B 3P7KA 2KK7A 3V2NA 2KLVA 1SQBJ 1I8PA 1AVOA 5AW4B 2Q9IA 1CCHA 3FX0A 5CCHD 2A06G 2MJZA 3ZOOA 3D0WA 2Q3EA 2KZIA 1SQBG 4RO0A 1LWUA 1N7SD 3H1KD 3CXHI 1FJKA 1VQKP 3C8VA 1DT1A 5CCGD 1VQ8P 4P4QB 1K04A 1KFNA 2ZONG 3CXHW 1IZNB 3HE4B 2WT7A 1FZEA 4M3LA 1AYGA 1FOSF 4DT0A 1KX2A 1CSWA 1PPJD 1OFCX 1SQVK 1ZR4A 1FDOA 1YFCA 2N3BA 1LP1B 3HE5A 4HYTB 2OTLP 3F5HA 2GC4D 1USEA 3N7NA 1IFNA 2M3EA 3SSUA 2L91A 1SQPE 1RHZB 1YTZI 1N7SC 4UB8V 3AEFC 3GHGA 5KTBA 5KAFV 2Y0EA 3IAOA 3L74G 1GDTA 2B89A 2SPZA 3H1KG 1QGKB 4PW9B 3TK1A 2IX7C 3KZIE 4N3YB 1QLED 3H1KJ 2A45H 3L72D 2FYNC 4Z1MH 3RBZA 2OZ1A 1PIXA 3ZOYA 3CPWO 1H9XA 1C6OA 1NKNA 3JC22 3HD7B 4H13B 5KKZB 4AYCA 2J5UA 3G6EP 3BATA 2VHDA 4JQ0D 3PLNA 1FZCA 3H1HD 2K9JB 4W7YA 1SQPJ 1CCRA 1GL2B 1VF5D 3H6PA 3M0DC 4ZMDA 2ZXYA 3OA8A 1H31B 3AE9C 4TT3H 5B66E 1JY3P 4RKUJ 2OYIB 2QJKC 2HODA 4H44C 4GODA 3AE4C 3KXDA 3ZIYA 4C7NB 1CSVA 1EDKA 4A7PA 1Q86Q 1G2CB 2FYUJ 2ZFCA 1VQ6P 4L76A 4Y99B 2OYOA 4PV1B 1PPJG 1YBKA 1AA0A 3DR0A 1EZVE 3L71J 1S5LV 2M5AB 3CMEP 4KMGA 1BDCA 2QRXA 3RL0C 2XTSB 1IFDA 4AALA 1IFJA 1GZLA 3MP7B 2QSIA 1URQC 1FAVA 3BCCJ 1M1KQ 1NJIQ 4GDOA 3KDPB 1OXZA 2N1TC 3ORVA 1S5LH 3A2AA 3O20A 4U3FD 3A0BV 2O1KA 3CX5W 1NIRA 3M0DA 5EFWB 1U7MA 1HJ3A 4PD4I 1KORA 1LMSA 1LGHB 3L4FA 1CEDA 4H44B 3PXSA 3II6A 1DW1A 4U3FJ 1CIFA 1L2PA 1NU1J 4L1QA 1GQ1A 3OA7A 1KIBA 2R3CA 4YTPC 4YPCA 3MK7C 4I7ZC 3HQ9A 3TGUG 4AUWA 4RJTA 3ZOWA 1XTCC 3A0HH 2YKPA 4R4MA 2JDIH 1KB9E 1OWAA 3DMIA 2HPCA 4BRYB 2ORLA 3V2RA 1PV3A 5DJUB 1LT9C 1M6ZA 3GHGB 3Q3DA 5AVXB 1GU4A 5TISV 4BRYA 1R8EA 5AVWB 1SQVJ 5H2FV 1CXAA 2LXCB 1CTYA 5AW9B 2O01J 1FHBA 1LWUC 2BCCG 3M0AA 3EFGA 1EB7A 1G2CA 4H0LD 2IZ1A 1COTA 5TISE 4N6JA 3G9RA 3RK2B 2BCCJ 1IK9A 1SFCC 1HWTC 5BU5A 2O1JA 2Z5IA 2FXOA 1OIPA 2KS1A 3WUIA 3H1JJ 3L72E 3OA8B 4EICA 1SP4A 2IZ0A 1DIQC 1IO3A 2Q1KA 1N73A 1GL2A 2FYZA 1AJYA 1H33B 1M1JA 1T8ZA 1HZUA 1NU1K 1CZQA 1BCCD 1NTKD 1UIIA 4MU8A 2QE7H 3TSIA 3SFEC 3AE8C 3H1ID 3HTKB 5CIBB 2ZOOA 1MUUA 5AVRB 3BASA 4YXDC 4AQRD 1KX7A 1NTZJ 1FBMA 4XA4A 3PXTA 2KYVA 3VRDA 1KD1Q 1NTMG 1KQLA 5C39A 1H0TA 2MKVA 3PH2B 3PH0A 3AE2C 4AAOA 3D71A 2POHA 1T3UA 3AE6C 1NTMJ 2E76D 3L73G 4OGQC 2L5GB 3H1KE 1IFMA 1E8EA 2B9BA 3AEGC 3M9HA 1CRYA 1NTKE 4IL6X 1KILB 3CLQA 2BEQD 1N50A 1LP1A 4BWNA 2JJLA 3RL0D 2EXVA 3RK3C 1NTKK 5AVSB 2XNDH 2N9IA 3HD7D 3CCQP 1GKSA 3IFMA 1SQQE 1KZUB 2KP8A 1GU5A 1PPJE 1DW3A 1VQLP 1NGMB 1I6EA 1CI6A 1PL5A 3HD7A 2WSEH 1BE3E 3Q5SA 2R3SA 1CIGA 1F1FA 155CA 1QKSA 3NWVA 4OH8B 5B5EE 2HV4A 5APWA 1IO4A 1SQBD 2N9BA 3WU2E 3AEEC 4EIFA 5CJ0A 3L75D 4LJIA 3M9BA 1E29A 3WFCC 4IL6V 1AKKA 2YCCA 1N9CA 1OW8A 2M8RA 2B11B 3T97B 3W68A 2O01N 1H32A 3RK3B 4O1QA 1VQNP 2CA4B 4D6TD 5KAFH 4DOJA 3H1LD 3H1LG 1LFMA 1Q2NA 1X0TA 3CXHH 3NXSA 1SQQG 2A45G 3CXHE 3SWSA 1PZQA 4I7ZB 1WT6A 2ZBOA 2XU6A 5KKZC 2XKMA 1HGZA 1LS9A 1A2SA 4ZKPA 1SQQJ 3RLMA 4O9BA 4XXLA 1L9JC 5DJTB 1KB9D 2KNCA 3CC2P 5B5EV 3O5CA 1CTZA 1LWUB 2FFDC 3G3ZA 2YKQA 1FI7A 5B66H 1K3HA 1KN7A 1VL2A 5KLIB 1LNQA 2K3RA 1KFMA 2NPSD 3VMZA 2B10B 2V7QJ 2WTYA 2GM4A 4JF7A 1KYOH 2E5TA 2I8FA 2YKOA 1S9KE 2GC7D 3IN6A 2B4ZA 4WQ7A 1XTGB 1Y9BA 4XFJA 1JY2N 1JEKA 2FYUG 3FWNA 4KT0J 1NH4A 2LR2A 3KZIH 1N7SA 5E79E 2J59M 1PP9J 2KXPB 1A02J 3R2PA 2RN0A 1E5WA 1YTZT 3RL0g 3D6ZA 1RE3A 2M3BA 3L75J 1BE3D 1JCCA 2JWDA 2PFXA 1HUCA 1JTHA 2D2CD 1L0NE 3L37A 2HR3A 2E75B 1EDLA 1RF0C 2BCCE 5KLVG 5DJQB 2ZYDA 1ZMEC 2KUBA 1NU1G 1YNRA 1LTTC 1IC2A 2WZ7A 2FYNB 3L73E 2AEJA 4U7JA 2C0WA 2ZT9D 2K1AA 2BEZF 2KNCB 1MZ9A 351CA 2AEFA 2GUSA 1WRGA 1NMLA 4GOEA 2YNYA 5AVYB 3HUSA 1NTZE 1CSBA 1SFCA 2PAJA 1KYOI 4WB4A 1NTMK 1S5LE 1U57A 3O1YA 4WQAA 3L35A 4FA9A 3SFDC 4DCKA 2FWLA 2YK3A 2E42A 4Q5PA 4UB8H 4IFDK 2QJPB 5TISH 1FI3A 2V08A 2OQQA 1FCDC 1CHHA 1HJBA 4PD4E 1P84D 1ETPA 3RK2C 3GMAA 4BXLA 1KQGB 3WC8A 1URQA 4XE5B 1NTKG 1FDMA 3CXHD 1CTJA 2C1VA 2E5YA 1VQ7P 2OTKE 1L4AA 5AW3B 1M1JB 4GIFA 1SQXE 2K9JA 2FBWC 4Y99C 5AVQB 1QYZA 4KJMA 1FZCB 1L0LD 1NNOA 1TU3F 3KQGA 4W80A 4OWFA 1HROA 5KJ7C 1CI6B 2OYHA 5GTIH 5CIDB 3VP8A 1SQPK 1T6AA 2YXQB 2P58A 1W2BO 1EZVD 2IBZG 1ZOYC 1DIIC 3S4RA 2QJPC 1WMKA 2J58A 4H0LC 4KHXA 1RE3C 2P2UA 2WPQA 1KMIZ 4QMAA 5APQA 3DP5A 1YJ9P 2W27A 4NPEA 5CBOA 1KYOD 4WVZA 5CMZA 1HH0A 1LTBC 3TDKA 2D2CC 3CCRP 3I5CA 4WQCA 1RQUA 3V6IA 1J1DB 1RF0A 1N7SB 2I8DA 3A3YB 1SQQK 2Y9YA 5M1BA 1MG2D 4EOTA 4ASVA 2NRGA 1F1CA 1KILE 5CIFB 1QN2A 2R5BA 3SXTA 1FU1A 5AURA 1BGYE 2CXBA 1FZGA 1PP9D 2N1TD 4AX3A 3PXWA 2AXTH 3O6QB 1EZVG 3B5NB 3A5TA 2JEEA 1ZR2A 3EWKA 2OYHB 4EIDA 2V07A 1USDA 1H31A 3GHGC 2H89C 4YE1A 1LC2A 1GL2C 3CC7P 1YCCA 2HG5D 2QG4A 2Z4EA 3WU2V 1PFIA 1YTCA 3H1JG 4K35A 3H1HG 1C6RA 1LTJC 3B8EB 2YIUC 2GIWA 4IL6E 2FYUK 4WY4A 1GIWA 3KYQA 5DJQC 3A0HV 2ZYAA 4PD4D 1SQQD 5KAFE 1OVUA 3QWOC 5CICB 1HGVA 1NTZD 1M60A 2WWWA 1DEBA 1KV9A 2N18B 3SLEA 3L71D 4RESB 2E74C 1IK7A 3Q1MA 2R32A 3H1LJ 3RK3D 3CWBE 3M9QA 3PP5A 2CA3B 3MHVA 1M70A 4GOFA 1K9MQ 1KV4A 4AAMA 4LC1A 1YJNP 2WMMA 1BSNA 1URQD 1Q82Q 1BCCE 3VTPC 3VNWA 3PTZA 5KLVK 2FFDB 2KOGA 2AEMA 4GYDA 1IFPA 2IFMA 1GK6A 2CE1A 3MUDA 5B66V 4I2LC 3MGNA 2K9YA 1VQ4P 3TYYA 1EDIA 3H1IG 1YQ4C 3MTUE 5KLVD 4PJ0H 2ITAA 3KHUA 2IFNA 1BGYD 2YIUB 2JKVA 1Q7YQ 3NBSA 3BVHA 2KSEA 3OCDA 1NWQA 2I1KA 2WPSA 2WSFJ 4L3HA 1L0LK 3VYIA 2Q5UA 1OW7A 1GMJA 1E79H 2QIWA 1J1EB 3N4XA 3NFQA 1DIPA 1FZBA 1Z56A 1SQBE 3L4MA 1EQ7A 1YJWP 1PP9G 2BH4X 3KZIV 4HH2A 2JTIB 2NPSB 2WQYC 1RF1C 3G4SP 5APYA 1L0NJ 2W8ZA 1VYDA 1RAPA 1M57D 1FZFA 3RGUA 4WY4D 1VQ5P 2ZVOB 1GU2A 2Q7CA 5KAIE 3H1LE 2N3YA 2HYNA 5BU8B 1N8RQ 1K3GA 2WT7B 1Y47A 1K8AQ 1G1JA 3U1AA 5KJ7D 1C6SA 5CCGA 2R5DA 1YYCA 3RK3E 3WUVA 3VYMA 1FDIA 5L8RJ 1OVRA 1K05A 1SQPG 1FC2C 2W6BA 2ZT9C 3IR9A 2XZRA 4MN4C 4DJGA 2GUVA 5KJ7A 1GL2D 1NHLA 1VF5B 3PRJA 1LTGC 3Q2YA 3BRTB 4WQ9A 4EYYQ 3TYIA 1NAFA 2XDJA 1JTHB 1GTWA 1L4AD 1BE3G 1GW4A 2BCCD 1C52A 2FFDA 1HJ4A 5APUA 1CHJA 1ZV8A 1GW3A 2QM7A 2IPPA 3TNUA 1DD3A 3E1RA 2NPSA 1BE3J 4U3FE 4Y5RA 3W67A 4H0JA 1YQ3C 3PJSK 1SQVD 3H25A 5APSA 1CC5A 1L0NK 1S2EA 1M8OB 1QL1A 3CCUP 3X39A 3NTNA 2GB8B 2CPBA 3K5BA 3MZWB 2P10A 1OMIA 2WSEJ 4GEDB 1LTJA 3CL3D 1MFZA 4N0KA 2AIUA 1IJDB 4H13C 1AQTA 3MD0A 3I56P 4IFMA 3ZCFA 2W6JH 3FXDA 2B88A 4HB1A 2E74B 1S72P 2IYOA 5AW8B 5AVZB 4H44D 1H8AA 2KZJA 3NMDA 3CCJP 3RBXA 5GTIV 2BPBB 3CCLP 1SVFA 3P32A 2FXPA 4L74A 1LTSC 2KS1B 1SQXD 2C8SA 1HJ5A 3P8CD 5K5GB 1KILD 1CIHA 1JY3O 1PGOA 2E75C 5GTHH 3ABVC 1MZ4A 2G8YA 2M5AA 3SWYA 1W2LA 2YO2A 4TLFA 5KAIH 2XNXA 2Y0DA 1VQPP 1ZW0A 2WPVB 2FRCA 2K88A 3HUSC 4C7NA 3JBTB 3A0BH 3AEBC 3B5NC 4UB6V 3HTKA 5CCHA 1M90Q 3QH9A 1VDFA 4WY4B 1QL4A 1T2KC 3BRVB 1EDJA 2QM8A 2V7QH 2PCBB 5KLIC 1S4XA 1VQMP 2FKWB 4ZNCA 1QVFO 4JYCA 1BGYJ 5AVTB 1CIEA 3B71A 1IRWA 2LITA 1JNMA 1RY3A 3M06A 3L70G 3H1HJ 3M91A 1DEEG 4FA1A 1BGYG 3SJLA 1L0LG 5AW7B 1I54A 1YICA 3JCUH 1FZCC 1P84I 4K3IA 2Z5HA 2HLOA 1OAEA 3FWLA 1FJ0A 2M0BA 1I55A 3CU4A 1NO4A 2DGEA 2H88C 1QVGO 1L0LJ 4LGDE 2AXTE 1NTZG 1M1JC 2W90A 5H2FH 1A8CA 4UB6E 4FANA 3H1JE 3L72J 4OVNF 1JCDA 1VF5C 1OVVA 3OAKA 3VN0A 2WSFH 3AE3C 5TJHA 2IBZE 1IRVA 4GT1A 1UIXA 5CCGC 3GF7A 1NTMD 2JQRA 451CA 1H89A 2BASA 3L72G 2HPCB 3AEDC 2YMKA 5B6QA 2IBZI 3CX5I 3E1IA 1FOSE 1AVYA 3L71G 1HRCA 2QVAA 1QL3A 2P1JA 1J1DC 1NU1D 1JB0J 3U1CA 3BCCE 1KB9H 4L3GA 4C46A 1SQXJ 1SFCB 2Y0CA 3L71E 3F89A 5AW0B 1J2JB 3B5ND 3HQ7A 3H32A 3H1IJ 1H88A 5AW5B 2H8PD 3RN1A 2PP6A 2O3JA 2NZ2A 3A7OA 2A06D 1I5TA 1J3SA 3Q5PA 1N73B 1QEXA 4IFFA 3GF3A 1S9KD 4PWAA 4JYBA 4U3FG 1PGQA 1VPCA 1EZVI 3HRNA 3O8ZA 1J1EC 2PACA 3CYTI 4WWIA 1N90A 1C2NA 1EC5A 5E79V 3B5NA 1LTJB 1NU1E 3CWBD 2ZAEB 3HQ8A 4EIEA 1W2EA 1G1IA 1FJPA 3L74D 4NFGB 1R5SA 4NPFX 3TGUD 5E79H 1L0NG 3G71P 1R5LA 2YQBA 1L9BC 5CYTR 1N7LA 2E76C 2VRSA 5APTA 2V4HA 3CC4P 3CX5D 4N78D 1EXJA 1KQFB 3D70A 1C7MA 1ZXGA 2RH0A 1X9VA 2OYIA 4FA4A 2HFED 1U7JA 1BSHA 4AANA 1FS0E 3C1LA 1CRGA 1L4AC 5DFSA 3LIDA 3P8CE 1HF9A 1HBWA 1JMMA 2IBZD 1LC1A 1KB9I 1JY2P 2QA4P 1JUNA 4C7RA 2C9NY 1D7MA 2IDBA 1HCMA 1WEJF 3V4WA 4LLHA 3SWFA 2C9LY 1CSXA 1W5CT 1CHIA 2CE0A 4K3AA 3RK2D 1YI2P 4WBAA 4Y28J 2DVHA 2UWJE 3D6YA 2LKMA 3EFFK 2BCNB 4CPGA 1CYCA 2B87A 1YIJP 2FYUE 1R0QA 1RZ6A 2OARA 3BCCD 1L0ND 2OYIC 4FB1A 2C9XB 1CRIA 1QX8A 1AQ5A 2MHMA 1OCDA 4D6TG 2KIKA 3CI9A 3U59A 1T3JA 1IQCA 3LW5J 1NMIA 1S3JA 3HE5B 1X79B 4IL6H 1AV1A 1RQVA 2RKLA 4V2KA 2WPRA 4D6TJ 1W5CE 3M97X 2HODB 4DZOA 3WUTA 1NAYA 2B87B 1Q90D 2N9JA 3NBTA 2ZYGA 1LTIC 2N1TA 1RAQA 1GD2E 1DVHA 3L74E 5KLVJ 1YHQP 2E75D 1I8OA 1LT1A 3C2CA 2LIRA 2NPSC 1DW2A 1M7LA 2BGVX 3H1JD 4WQBA 3ZOXA 3VP9A 3FGAD 2I1JA 1PGPA 2AI5A 2KLUA 2Y9ZA 1NTME 3MK7B 3AE5C 4L73A 5B5EH 5CIGB 1NTZK 1IZL0 2PRRA 1K73Q 1HJ0A 1C2RA 1Y8AA 5GTHV 3S1KA 4H0KA 2JO1A 2BLFB 1SLQA 3AEAC 1AFOA 4R4LA 1JM0A 4YXWH 3GLMA 5DF5A 1C75A 1S5LX 4WY4C 1N73C 2B0ZB 4H0LB 3V4QA 1NKZB 1X8YA 2DW3A 2ZVNB 3EQ2A 2LXBA 1HZVA 5H2FE 3VMAA 2H7HA 3HQ6A 2Q6QA 4WQEA 1RZ5A 2JP3A 1E2RA 3ZBMA 3IF4A 4B86A 3CCSP 5CIEB 3L70D 1BCCG 4D6TE 1HVVA 1ZZHA 3MUDC 2D0WA 4ASWA 4DY9A 2PGDA 2WSCH 2Q3IA 1P84E 2FY8A 1HH7A 1PP9E 2E74D 3B4SA 5AW6B 4PJ0E 2O01H 3WUUA 1IFIA 1BCCJ 3LIEA 2WSSH 1JMBA 1SQVE 1S1CX 1ZP0C 2C1DB 3TF5A 5AVUB 1SFCD 3H1HE 2KB7P 1RH5B 1QL2A 1URQB 2OYHC 4JBZA 3O6QA 1JY2O 1JO5A 4ZKUA 1LTAC 2JWAA 1H1OA 1T2KD 1RF1A 1H0TB 4QAOA 2JR8A 1CRJA 5APXA 2C1UA 3CD6P 1CXCA 3CMAP 1KB0A 1BDDA 3BCCG 4NPDA 1RF1B 2K37A 3Q5RA 2CK3H 3VMXA 2QEXP 4UB8E 1CYJA 1SQXG 4RSZA 5EXQA 1GJQA 4J20A 1M56D 3L74J 5CIHB 1SQPD 1P84H 1BL9A 3CWBJ 1SS1A 3L75G
chains in the Genus database with same CATH topology
2N18C 3O20A 4U3FD 1I6DA 3A0BV 1CRCA 1CIEA 1IRWA 1ZRTD 3CX5W 1QYZA 1NIRA 1L0LD 1NNOA 1U74B 2LITA 1HJ3A 1A56A 1LMSA 1HROA 1CEDA 3PXSA 1DW1A 4FA1A 3SJLA 1YEBA 1CIFA 2C2CA 5IY51 5CIDB 4L1QA 1GQ1A 1I54A 1KIBA 1YICA 3MK7C 3WFDC 1KYOW 1EZVD 3HQ9A 4K3IA 4RJTA 1DIIC 3ZOWA 1OAEA 3FWLA 1FJ0A 1I55A 3CU4A 2DGEA 3A9FA 3DP5A 1KYOD 3DMIA 1A8CA 2PCCB 4FANA 2ORLA 3TDKA 3WFBC 1M6ZA 2MTAC 5KAIV 5TJHA 4WQCA 1IRVA 1NTMD 2AXTV 2JQRA 451CA 1CNOA 5TISV 5H2FV 1CXAA 5B6QA 1MG2D 1F1CA 5CIFB 1QN2A 1CTYA 1FHBA 3SXTA 5AURA 2CXBA 1HRCA 1EB7A 5C0ZA 1PP9D 1QL3A 3WFEC 4AX3A 3PXWA 1CSUA 1NU1D 1COTA 4L3GA 3RN0A 2Y0CA 1CYIA 3PHLA 4EIDA 3HQ7A 2V07A 3GW6A 2KS1A 3WUIA 1H31A 3GG2A 2RMZA 3OA8B 4YE1A 4EICA 1LC2A 2C1DA 1DIQC 3RN1A 1IO3A 2O3JA 1YCCA 1H33A 2QG4A 2A06D 2B12B 1H33B 1I5TA 1J3SA 3WU2V 1YTCA 1HZUA 1C6RA 4PWAA 1BCCD 1NTKD 3L73D 4MU8A 2GIWA 1YEAA 2PACA 1GIWA 3CYTI 5DJQC 1N90A 3H1ID 1C2NA 3A0HV 5E79V 1DW0A 4PD4D 1SQQD 5CIBB 2ZOOA 4WQDA 5C9MA 5CICB 1CO6A 3O0RC 3RMZA 3CWBD 3ITKA 1NTZD 3HQ8A 1MG3D 1YIQA 4EIEA 1M60A 1KX7A 1KV9A 1FOCA 2N18B 3L74D 3SLEA 4FA5A 3PXTA 3VRDA 3L71D 4NFGB 3TGUD 1AOQA 1DVVA 1H32B 2YQBA 1L9BC 3PH2B 4AAOA 5CYTR 2CA3B 2ZZS1 3CX5D 3L4OA 1M70A 1WVEC 1C7MA 2BH5X 1H9YA 4AAMA 1AOFA 4FA4A 2L4DA 1E8EA 4AANA 1JDLA 1CRYA 1CRGA 1N50A 3VNWA 3PTZA 1U75B 5DFSA 1N15A 2EXVA 3OCDB 4WQ8A 4JCGA 1FI9A 4O1WA 1S6VB 2N9IA 4GYDA 1GKSA 2IBZD 1LC1A 2N9YB 2CE1A 1CRHA 5B66V 1GDVA 1DW3A 2QJKB 4XYDB 1I6EA 5KLVD 3KHUA 1HCMA 1WEJF 3CP5A 2OZ1B 1BGYD 2YIUB 1CIGA 3NBSA 1CSXA 1B7VA 2QJYB 1W5CT 3OCDA 1F1FA 1CHIA 155CA 1QKSA 3NWVA 2HV4A 2CE0A 1SQBD 4L3HA 2DVHA 4PJ0V 4EIFA 2D0SA 3L75D 4LJIA 4EDFA 2BCNB 1E29A 1CYCA 3WFCC 4IL6V 3L4MA 1AKKA 1R0QA 2YCCA 1RZ6A 1N9CA 3BCCD 1CORA 1L0ND 2B11B 2BH4X 3KZIV 2JTIB 4FB1A 2C9XB 1H32A 1CRIA 3SVWA 2MHMA 4O1QA 2CA4B 4D6TD 2FYUD 1OCDA 4FAVA 1IQCA 1NMIA 3H1LD 1LFMA 1VYDA 1RAPA 3SWSA 4V2KA 3M97X 1GU2A 2ZBOA 2N3YA 2N9JA 1LS9A 1K3GA 3NBTA 1A2SA 1RAQA 1I8PA 3RLMA 1DVHA 4XXLA 1C6SA 1L9JC 1KB9D 1CCHA 1I8OA 5B5EV 3C2CA 3O5CA 1CTZA 2LIRA 3ZOOA 2Q3EA 1DW2A 1FI7A 2BGVX 3VYMA 3H1JD 1K3HA 5KLIB 4WQBA 3ZOXA 3H1KD 2B10B 1DT1A 2AI5A 4P4QB 3MK7B 2ZONG 3CXHW 3PRJA 5CIGB 2I8FA 1IZL0 1AYGA 4WQ9A 2GC7D 2B4ZA 4WQ7A 3TYIA 1KX2A 1C2RA 1CSWA 2BCCD 1PPJD 1C52A 1HJ4A 1YFCA 2N3BA 1CHJA 5GTHV 2GC4D 4H0KA 2BLFB 2L91A 4Y5RA 4H0JA 4UB8V 1SQVD 5DF5A 5KAFV 1C75A 2Y0EA 2RN0A 1CC5A 2B0ZB 3X39A 2GB8B 4PW9B 1BE3D 4GEDB 1HZVA 3L72D 4N0KA 3VMAA 3HQ6A 4WQEA 2OZ1A 2AIUA 3ZOYA 1H9XA 1C6OA 1RZ5A 1E2RA 5KKZB 3ZBMA 3ZCFA 5CIEB 3L70D 5DJQB 1ZZHA 2VHDA 2D0WA 4DY9A 1YNRA 3PLNA 1HH7A 2FYNB 3H1HD 5GTIV 2BPBB 2K9JB 1CCRA 2KNCB 2C1DB 3TF5A 2ZXYA 351CA 3OA8A 1H31B 1NMLA 1SQXD 2C8SA 1HJ5A 1CIHA 1MZ4A 3ZIYA 1CSVA 2JWAA 1H1OA 1W2LA 3O1YA 4A7PA 4QAOA 4WQAA 4FA9A 1CRJA 2FWLA 2YK3A 4Q5PA 2Y0DA 2C1UA 2QJPB 3DR0A 1CXCA 1FI3A 2V08A 1KB0A 1FCDC 1CHHA 1S5LV 2FRCA 4KMGA 1P84D 3JBTB 2XTSB 1ETPA 4UB6V 4AALA 1CYJA 4RSZA 1QL4A 5EXQA 1GJQA 4J20A 3WC8A 5CIHB 3CXHD 1CTJA 2C1VA 1SQPD 1BL9A 2PCBB 3ORVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N18 C;  3O20 A;  4U3F D;  1I6D A;  3A0B V;  1CRC A;  1CIE A;  1IRW A;  1ZRT D;  3CX5 W;  1QYZ A;  1NIR A;  1L0L D;  1NNO A;  1U74 B;  2LIT A;  1HJ3 A;  1A56 A;  1LMS A;  1HRO A;  1CED A;  3PXS A;  1DW1 A;  4FA1 A;  3SJL A;  1YEB A;  1CIF A;  2C2C A;  5IY5 1;  5CID B;  4L1Q A;  1GQ1 A;  1I54 A;  1KIB A;  1YIC A;  3MK7 C;  3WFD C;  1KYO W;  1EZV D;  3HQ9 A;  4K3I A;  4RJT A;  1DII C;  3ZOW A;  1OAE A;  3FWL A;  1FJ0 A;  1I55 A;  3CU4 A;  2DGE A;  3A9F A;  3DP5 A;  1KYO D;  3DMI A;  1A8C A;  2PCC B;  4FAN A;  2ORL A;  3TDK A;  3WFB C;  1M6Z A;  2MTA C;  5KAI V;  5TJH A;  4WQC A;  1IRV A;  1NTM D;  2AXT V;  2JQR A;  451C A;  1CNO A;  5TIS V;  5H2F V;  1CXA A;  5B6Q A;  1MG2 D;  1F1C A;  5CIF B;  1QN2 A;  1CTY A;  1FHB A;  3SXT A;  5AUR A;  2CXB A;  1HRC A;  1EB7 A;  5C0Z A;  1PP9 D;  1QL3 A;  3WFE C;  4AX3 A;  3PXW A;  1CSU A;  1NU1 D;  1COT A;  4L3G A;  3RN0 A;  2Y0C A;  1CYI A;  3PHL A;  4EID A;  3HQ7 A;  2V07 A;  3GW6 A;  2KS1 A;  3WUI A;  1H31 A;  3GG2 A;  2RMZ A;  3OA8 B;  4YE1 A;  4EIC A;  1LC2 A;  2C1D A;  1DIQ C;  3RN1 A;  1IO3 A;  2O3J A;  1YCC A;  1H33 A;  2QG4 A;  2A06 D;  2B12 B;  1H33 B;  1I5T A;  1J3S A;  3WU2 V;  1YTC A;  1HZU A;  1C6R A;  4PWA A;  1BCC D;  1NTK D;  3L73 D;  4MU8 A;  2GIW A;  1YEA A;  2PAC A;  1GIW A;  3CYT I;  5DJQ C;  1N90 A;  3H1I D;  1C2N A;  3A0H V;  5E79 V;  1DW0 A;  4PD4 D;  1SQQ D;  5CIB B;  2ZOO A;  4WQD A;  5C9M A;  5CIC B;  1CO6 A;  3O0R C;  3RMZ A;  3CWB D;  3ITK A;  1NTZ D;  3HQ8 A;  1MG3 D;  1YIQ A;  4EIE A;  1M60 A;  1KX7 A;  1KV9 A;  1FOC A;  2N18 B;  3L74 D;  3SLE A;  4FA5 A;  3PXT A;  3VRD A;  3L71 D;  4NFG B;  3TGU D;  1AOQ A;  1DVV A;  1H32 B;  2YQB A;  1L9B C;  3PH2 B;  4AAO A;  5CYT R;  2CA3 B;  2ZZS 1;  3CX5 D;  3L4O A;  1M70 A;  1WVE C;  1C7M A;  2BH5 X;  1H9Y A;  4AAM A;  1AOF A;  4FA4 A;  2L4D A;  1E8E A;  4AAN A;  1JDL A;  1CRY A;  1CRG A;  1N50 A;  3VNW A;  3PTZ A;  1U75 B;  5DFS A;  1N15 A;  2EXV A;  3OCD B;  4WQ8 A;  4JCG A;  1FI9 A;  4O1W A;  1S6V B;  2N9I A;  4GYD A;  1GKS A;  2IBZ D;  1LC1 A;  2N9Y B;  2CE1 A;  1CRH A;  5B66 V;  1GDV A;  1DW3 A;  2QJK B;  4XYD B;  1I6E A;  5KLV D;  3KHU A;  1HCM A;  1WEJ F;  3CP5 A;  2OZ1 B;  1BGY D;  2YIU B;  1CIG A;  3NBS A;  1CSX A;  1B7V A;  2QJY B;  1W5C T;  3OCD A;  1F1F A;  1CHI A;  155C A;  1QKS A;  3NWV A;  2HV4 A;  2CE0 A;  1SQB D;  4L3H A;  2DVH A;  4PJ0 V;  4EIF A;  2D0S A;  3L75 D;  4LJI A;  4EDF A;  2BCN B;  1E29 A;  1CYC A;  3WFC C;  4IL6 V;  3L4M A;  1AKK A;  1R0Q A;  2YCC A;  1RZ6 A;  1N9C A;  3BCC D;  1COR A;  1L0N D;  2B11 B;  2BH4 X;  3KZI V;  2JTI B;  4FB1 A;  2C9X B;  1H32 A;  1CRI A;  3SVW A;  2MHM A;  4O1Q A;  2CA4 B;  4D6T D;  2FYU D;  1OCD A;  4FAV A;  1IQC A;  1NMI A;  3H1L D;  1LFM A;  1VYD A;  1RAP A;  3SWS A;  4V2K A;  3M97 X;  1GU2 A;  2ZBO A;  2N3Y A;  2N9J A;  1LS9 A;  1K3G A;  3NBT A;  1A2S A;  1RAQ A;  1I8P A;  3RLM A;  1DVH A;  4XXL A;  1C6S A;  1L9J C;  1KB9 D;  1CCH A;  1I8O A;  5B5E V;  3C2C A;  3O5C A;  1CTZ A;  2LIR A;  3ZOO A;  2Q3E A;  1DW2 A;  1FI7 A;  2BGV X;  3VYM A;  3H1J D;  1K3H A;  5KLI B;  4WQB A;  3ZOX A;  3H1K D;  2B10 B;  1DT1 A;  2AI5 A;  4P4Q B;  3MK7 B;  2ZON G;  3CXH W;  3PRJ A;  5CIG B;  2I8F A;  1IZL 0;  1AYG A;  4WQ9 A;  2GC7 D;  2B4Z A;  4WQ7 A;  3TYI A;  1KX2 A;  1C2R A;  1CSW A;  2BCC D;  1PPJ D;  1C52 A;  1HJ4 A;  1YFC A;  2N3B A;  1CHJ A;  5GTH V;  2GC4 D;  4H0K A;  2BLF B;  2L91 A;  4Y5R A;  4H0J A;  4UB8 V;  1SQV D;  5DF5 A;  5KAF V;  1C75 A;  2Y0E A;  2RN0 A;  1CC5 A;  2B0Z B;  3X39 A;  2GB8 B;  4PW9 B;  1BE3 D;  4GED B;  1HZV A;  3L72 D;  4N0K A;  3VMA A;  3HQ6 A;  4WQE A;  2OZ1 A;  2AIU A;  3ZOY A;  1H9X A;  1C6O A;  1RZ5 A;  1E2R A;  5KKZ B;  3ZBM A;  3ZCF A;  5CIE B;  3L70 D;  5DJQ B;  1ZZH A;  2VHD A;  2D0W A;  4DY9 A;  1YNR A;  3PLN A;  1HH7 A;  2FYN B;  3H1H D;  5GTI V;  2BPB B;  2K9J B;  1CCR A;  2KNC B;  2C1D B;  3TF5 A;  2ZXY A;  351C A;  3OA8 A;  1H31 B;  1NML A;  1SQX D;  2C8S A;  1HJ5 A;  1CIH A;  1MZ4 A;  3ZIY A;  1CSV A;  2JWA A;  1H1O A;  1W2L A;  3O1Y A;  4A7P A;  4QAO A;  4WQA A;  4FA9 A;  1CRJ A;  2FWL A;  2YK3 A;  4Q5P A;  2Y0D A;  2C1U A;  2QJP B;  3DR0 A;  1CXC A;  1FI3 A;  2V08 A;  1KB0 A;  1FCD C;  1CHH A;  1S5L V;  2FRC A;  4KMG A;  1P84 D;  3JBT B;  2XTS B;  1ETP A;  4UB6 V;  4AAL A;  1CYJ A;  4RSZ A;  1QL4 A;  5EXQ A;  1GJQ A;  4J20 A;  3WC8 A;  5CIH B;  3CXH D;  1CTJ A;  2C1V A;  1SQP D;  1BL9 A;  2PCB B;  3ORV A; 
#chains in the Genus database with same CATH topology
 2N18 C;  2QJY C;  1I6D A;  1CRC A;  2R44 A;  1ZRT D;  1U74 B;  3CWB G;  3E7K A;  2ZXX A;  1A56 A;  1NOH A;  1VQ9 P;  4PV1 D;  3HD7 C;  3CCE P;  1YEB A;  2P7J A;  2C2C A;  1SQB K;  5IY5 1;  1DX7 A;  1NYH A;  2ZXE B;  4JPZ B;  2ZT9 B;  3TGU E;  2E76 B;  3L70 J;  3JCU E;  4EI2 A;  3WFD C;  1KYO W;  2H43 A;  3UIA A;  3CX5 E;  2XV5 A;  4I1L A;  1HTL C;  3A9F A;  1KIL A;  1DD4 A;  2WSC J;  1A02 F;  3L70 E;  2PCC B;  1X22 A;  2YXR B;  1RE4 A;  3CCV P;  4PD4 H;  4EIJ A;  1SQV G;  2D2C B;  3WFB C;  2OGU A;  1LT9 A;  2MTA C;  5KAI V;  5AW2 B;  1MV8 A;  4GKG A;  3AE7 C;  3L36 A;  2AXT V;  5BVZ A;  1CNO A;  5GTH E;  1JY3 N;  3V2Q A;  5KLV E;  4HKZ H;  4UB6 H;  5C0Z A;  3WFE C;  5CHX A;  1CSU A;  1PGJ A;  3USS A;  3LW5 H;  2IYP A;  4L75 A;  1FZA A;  3RN0 A;  3WU2 H;  1NTK J;  1CYI A;  1GK4 A;  1OZH A;  3HE4 A;  3PHL A;  1KQS O;  4H13 D;  3GW6 A;  3AEC C;  3FXE A;  3GG2 A;  3VOP A;  2RMZ A;  1VQO P;  2C1D A;  1KYO E;  3V5B A;  1H33 A;  3OW2 O;  3ZDM A;  2B12 B;  1OW6 A;  1DH3 A;  3H32 B;  3L73 D;  4I6M C;  1ZLL A;  4OGQ B;  1YEA A;  3AE1 C;  1DW0 A;  3TGU J;  4WQD A;  5C9M A;  5AVV B;  1CW5 A;  3MIW A;  1CO6 A;  2W6A A;  3O0R C;  3RMZ A;  1L0L E;  2G3A A;  3ITK A;  2YMY A;  1MG3 D;  1YIQ A;  2ZJS E;  1FOC A;  1MKM A;  4FA5 A;  1RE4 C;  2YO3 A;  1AOQ A;  1DVV A;  1H32 B;  2AXC A;  1LJ2 A;  3SWK A;  2P67 A;  3T97 A;  1KIL C;  2ZZS 1;  4HJG H;  3OJA B;  3L4O A;  1WVE C;  1LT9 B;  3JSV C;  2BH5 X;  1H9Y A;  1KTM A;  2A06 E;  1AOF A;  3HUS B;  3L75 E;  1KC8 Q;  5CCH C;  1EXI A;  2L4D A;  4OGQ D;  1JDL A;  2KI7 B;  4N78 E;  1ZN5 A;  1U75 B;  3P8M C;  1N15 A;  5GTI E;  1YIT P;  1Q81 Q;  3OCD B;  4WQ8 A;  4JCG A;  3CCM P;  1FI9 A;  4O1W A;  2WIT A;  1MFT A;  1S6V B;  1FE6 A;  2C0X A;  2OTJ P;  2N9Y B;  1CRH A;  3CX5 H;  1GDV A;  3A0H E;  1N2D C;  2QJK B;  4XYD B;  1JOC A;  2KSJ A;  3CP5 A;  2OZ1 B;  3I55 P;  4IOI H;  2CPS A;  1B7V A;  2QJY B;  3WMM 0;  4PV1 C;  1L4A B;  2GA1 A;  5CJ4 A;  4PJ0 V;  2D0S A;  2FXM A;  2N1T B;  4EDF A;  3RL0 B;  5CBN A;  5APV A;  1COR A;  3VMY A;  4W7Z A;  1N86 A;  1ZRT E;  3SVW A;  1NVO A;  2FYU D;  3TNU B;  1OX3 A;  4FAV A;  2W83 C;  3H1I E;  1SQX K;  3KPE A;  2WVR A;  3R4Y A;  3S9O A;  3A0B E;  2A45 I;  3C9I A;  2E43 A;  3V2P A;  3L73 J;  5AW1 B;  3P7K A;  2KK7 A;  3V2N A;  2KLV A;  1SQB J;  1I8P A;  1AVO A;  5AW4 B;  2Q9I A;  1CCH A;  3FX0 A;  5CCH D;  2A06 G;  2MJZ A;  3ZOO A;  3D0W A;  2Q3E A;  2KZI A;  1SQB G;  4RO0 A;  1LWU A;  1N7S D;  3H1K D;  3CXH I;  1FJK A;  1VQK P;  3C8V A;  1DT1 A;  5CCG D;  1VQ8 P;  4P4Q B;  1K04 A;  1KFN A;  2ZON G;  3CXH W;  1IZN B;  3HE4 B;  2WT7 A;  1FZE A;  4M3L A;  1AYG A;  1FOS F;  4DT0 A;  1KX2 A;  1CSW A;  1PPJ D;  1OFC X;  1SQV K;  1ZR4 A;  1FDO A;  1YFC A;  2N3B A;  1LP1 B;  3HE5 A;  4HYT B;  2OTL P;  3F5H A;  2GC4 D;  1USE A;  3N7N A;  1IFN A;  2M3E A;  3SSU A;  2L91 A;  1SQP E;  1RHZ B;  1YTZ I;  1N7S C;  4UB8 V;  3AEF C;  3GHG A;  5KTB A;  5KAF V;  2Y0E A;  3IAO A;  3L74 G;  1GDT A;  2B89 A;  2SPZ A;  3H1K G;  1QGK B;  4PW9 B;  3TK1 A;  2IX7 C;  3KZI E;  4N3Y B;  1QLE D;  3H1K J;  2A45 H;  3L72 D;  2FYN C;  4Z1M H;  3RBZ A;  2OZ1 A;  1PIX A;  3ZOY A;  3CPW O;  1H9X A;  1C6O A;  1NKN A;  3JC2 2;  3HD7 B;  4H13 B;  5KKZ B;  4AYC A;  2J5U A;  3G6E P;  3BAT A;  2VHD A;  4JQ0 D;  3PLN A;  1FZC A;  3H1H D;  2K9J B;  4W7Y A;  1SQP J;  1CCR A;  1GL2 B;  1VF5 D;  3H6P A;  3M0D C;  4ZMD A;  2ZXY A;  3OA8 A;  1H31 B;  3AE9 C;  4TT3 H;  5B66 E;  1JY3 P;  4RKU J;  2OYI B;  2QJK C;  2HOD A;  4H44 C;  4GOD A;  3AE4 C;  3KXD A;  3ZIY A;  4C7N B;  1CSV A;  1EDK A;  4A7P A;  1Q86 Q;  1G2C B;  2FYU J;  2ZFC A;  1VQ6 P;  4L76 A;  4Y99 B;  2OYO A;  4PV1 B;  1PPJ G;  1YBK A;  1AA0 A;  3DR0 A;  1EZV E;  3L71 J;  1S5L V;  2M5A B;  3CME P;  4KMG A;  1BDC A;  2QRX A;  3RL0 C;  2XTS B;  1IFD A;  4AAL A;  1IFJ A;  1GZL A;  3MP7 B;  2QSI A;  1URQ C;  1FAV A;  3BCC J;  1M1K Q;  1NJI Q;  4GDO A;  3KDP B;  1OXZ A;  2N1T C;  3ORV A;  1S5L H;  3A2A A;  3O20 A;  4U3F D;  3A0B V;  2O1K A;  3CX5 W;  1NIR A;  3M0D A;  5EFW B;  1U7M A;  1HJ3 A;  4PD4 I;  1KOR A;  1LMS A;  1LGH B;  3L4F A;  1CED A;  4H44 B;  3PXS A;  3II6 A;  1DW1 A;  4U3F J;  1CIF A;  1L2P A;  1NU1 J;  4L1Q A;  1GQ1 A;  3OA7 A;  1KIB A;  2R3C A;  4YTP C;  4YPC A;  3MK7 C;  4I7Z C;  3HQ9 A;  3TGU G;  4AUW A;  4RJT A;  3ZOW A;  1XTC C;  3A0H H;  2YKP A;  4R4M A;  2JDI H;  1KB9 E;  1OWA A;  3DMI A;  2HPC A;  4BRY B;  2ORL A;  3V2R A;  1PV3 A;  5DJU B;  1LT9 C;  1M6Z A;  3GHG B;  3Q3D A;  5AVX B;  1GU4 A;  5TIS V;  4BRY A;  1R8E A;  5AVW B;  1SQV J;  5H2F V;  1CXA A;  2LXC B;  1CTY A;  5AW9 B;  2O01 J;  1FHB A;  1LWU C;  2BCC G;  3M0A A;  3EFG A;  1EB7 A;  1G2C A;  4H0L D;  2IZ1 A;  1COT A;  5TIS E;  4N6J A;  3G9R A;  3RK2 B;  2BCC J;  1IK9 A;  1SFC C;  1HWT C;  5BU5 A;  2O1J A;  2Z5I A;  2FXO A;  1OIP A;  2KS1 A;  3WUI A;  3H1J J;  3L72 E;  3OA8 B;  4EIC A;  1SP4 A;  2IZ0 A;  1DIQ C;  1IO3 A;  2Q1K A;  1N73 A;  1GL2 A;  2FYZ A;  1AJY A;  1H33 B;  1M1J A;  1T8Z A;  1HZU A;  1NU1 K;  1CZQ A;  1BCC D;  1NTK D;  1UII A;  4MU8 A;  2QE7 H;  3TSI A;  3SFE C;  3AE8 C;  3H1I D;  3HTK B;  5CIB B;  2ZOO A;  1MUU A;  5AVR B;  3BAS A;  4YXD C;  4AQR D;  1KX7 A;  1NTZ J;  1FBM A;  4XA4 A;  3PXT A;  2KYV A;  3VRD A;  1KD1 Q;  1NTM G;  1KQL A;  5C39 A;  1H0T A;  2MKV A;  3PH2 B;  3PH0 A;  3AE2 C;  4AAO A;  3D71 A;  2POH A;  1T3U A;  3AE6 C;  1NTM J;  2E76 D;  3L73 G;  4OGQ C;  2L5G B;  3H1K E;  1IFM A;  1E8E A;  2B9B A;  3AEG C;  3M9H A;  1CRY A;  1NTK E;  4IL6 X;  1KIL B;  3CLQ A;  2BEQ D;  1N50 A;  1LP1 A;  4BWN A;  2JJL A;  3RL0 D;  2EXV A;  3RK3 C;  1NTK K;  5AVS B;  2XND H;  2N9I A;  3HD7 D;  3CCQ P;  1GKS A;  3IFM A;  1SQQ E;  1KZU B;  2KP8 A;  1GU5 A;  1PPJ E;  1DW3 A;  1VQL P;  1NGM B;  1I6E A;  1CI6 A;  1PL5 A;  3HD7 A;  2WSE H;  1BE3 E;  3Q5S A;  2R3S A;  1CIG A;  1F1F A;  155C A;  1QKS A;  3NWV A;  4OH8 B;  5B5E E;  2HV4 A;  5APW A;  1IO4 A;  1SQB D;  2N9B A;  3WU2 E;  3AEE C;  4EIF A;  5CJ0 A;  3L75 D;  4LJI A;  3M9B A;  1E29 A;  3WFC C;  4IL6 V;  1AKK A;  2YCC A;  1N9C A;  1OW8 A;  2M8R A;  2B11 B;  3T97 B;  3W68 A;  2O01 N;  1H32 A;  3RK3 B;  4O1Q A;  1VQN P;  2CA4 B;  4D6T D;  5KAF H;  4DOJ A;  3H1L D;  3H1L G;  1LFM A;  1Q2N A;  1X0T A;  3CXH H;  3NXS A;  1SQQ G;  2A45 G;  3CXH E;  3SWS A;  1PZQ A;  4I7Z B;  1WT6 A;  2ZBO A;  2XU6 A;  5KKZ C;  2XKM A;  1HGZ A;  1LS9 A;  1A2S A;  4ZKP A;  1SQQ J;  3RLM A;  4O9B A;  4XXL A;  1L9J C;  5DJT B;  1KB9 D;  2KNC A;  3CC2 P;  5B5E V;  3O5C A;  1CTZ A;  1LWU B;  2FFD C;  3G3Z A;  2YKQ A;  1FI7 A;  5B66 H;  1K3H A;  1KN7 A;  1VL2 A;  5KLI B;  1LNQ A;  2K3R A;  1KFM A;  2NPS D;  3VMZ A;  2B10 B;  2V7Q J;  2WTY A;  2GM4 A;  4JF7 A;  1KYO H;  2E5T A;  2I8F A;  2YKO A;  1S9K E;  2GC7 D;  3IN6 A;  2B4Z A;  4WQ7 A;  1XTG B;  1Y9B A;  4XFJ A;  1JY2 N;  1JEK A;  2FYU G;  3FWN A;  4KT0 J;  1NH4 A;  2LR2 A;  3KZI H;  1N7S A;  5E79 E;  2J59 M;  1PP9 J;  2KXP B;  1A02 J;  3R2P A;  2RN0 A;  1E5W A;  1YTZ T;  3RL0 g;  3D6Z A;  1RE3 A;  2M3B A;  3L75 J;  1BE3 D;  1JCC A;  2JWD A;  2PFX A;  1HUC A;  1JTH A;  2D2C D;  1L0N E;  3L37 A;  2HR3 A;  2E75 B;  1EDL A;  1RF0 C;  2BCC E;  5KLV G;  5DJQ B;  2ZYD A;  1ZME C;  2KUB A;  1NU1 G;  1YNR A;  1LTT C;  1IC2 A;  2WZ7 A;  2FYN B;  3L73 E;  2AEJ A;  4U7J A;  2C0W A;  2ZT9 D;  2K1A A;  2BEZ F;  2KNC B;  1MZ9 A;  351C A;  2AEF A;  2GUS A;  1WRG A;  1NML A;  4GOE A;  2YNY A;  5AVY B;  3HUS A;  1NTZ E;  1CSB A;  1SFC A;  2PAJ A;  1KYO I;  4WB4 A;  1NTM K;  1S5L E;  1U57 A;  3O1Y A;  4WQA A;  3L35 A;  4FA9 A;  3SFD C;  4DCK A;  2FWL A;  2YK3 A;  2E42 A;  4Q5P A;  4UB8 H;  4IFD K;  2QJP B;  5TIS H;  1FI3 A;  2V08 A;  2OQQ A;  1FCD C;  1CHH A;  1HJB A;  4PD4 E;  1P84 D;  1ETP A;  3RK2 C;  3GMA A;  4BXL A;  1KQG B;  3WC8 A;  1URQ A;  4XE5 B;  1NTK G;  1FDM A;  3CXH D;  1CTJ A;  2C1V A;  2E5Y A;  1VQ7 P;  2OTK E;  1L4A A;  5AW3 B;  1M1J B;  4GIF A;  1SQX E;  2K9J A;  2FBW C;  4Y99 C;  5AVQ B;  1QYZ A;  4KJM A;  1FZC B;  1L0L D;  1NNO A;  1TU3 F;  3KQG A;  4W80 A;  4OWF A;  1HRO A;  5KJ7 C;  1CI6 B;  2OYH A;  5GTI H;  5CID B;  3VP8 A;  1SQP K;  1T6A A;  2YXQ B;  2P58 A;  1W2B O;  1EZV D;  2IBZ G;  1ZOY C;  1DII C;  3S4R A;  2QJP C;  1WMK A;  2J58 A;  4H0L C;  4KHX A;  1RE3 C;  2P2U A;  2WPQ A;  1KMI Z;  4QMA A;  5APQ A;  3DP5 A;  1YJ9 P;  2W27 A;  4NPE A;  5CBO A;  1KYO D;  4WVZ A;  5CMZ A;  1HH0 A;  1LTB C;  3TDK A;  2D2C C;  3CCR P;  3I5C A;  4WQC A;  1RQU A;  3V6I A;  1J1D B;  1RF0 A;  1N7S B;  2I8D A;  3A3Y B;  1SQQ K;  2Y9Y A;  5M1B A;  1MG2 D;  4EOT A;  4ASV A;  2NRG A;  1F1C A;  1KIL E;  5CIF B;  1QN2 A;  2R5B A;  3SXT A;  1FU1 A;  5AUR A;  1BGY E;  2CXB A;  1FZG A;  1PP9 D;  2N1T D;  4AX3 A;  3PXW A;  2AXT H;  3O6Q B;  1EZV G;  3B5N B;  3A5T A;  2JEE A;  1ZR2 A;  3EWK A;  2OYH B;  4EID A;  2V07 A;  1USD A;  1H31 A;  3GHG C;  2H89 C;  4YE1 A;  1LC2 A;  1GL2 C;  3CC7 P;  1YCC A;  2HG5 D;  2QG4 A;  2Z4E A;  3WU2 V;  1PFI A;  1YTC A;  3H1J G;  4K35 A;  3H1H G;  1C6R A;  1LTJ C;  3B8E B;  2YIU C;  2GIW A;  4IL6 E;  2FYU K;  4WY4 A;  1GIW A;  3KYQ A;  5DJQ C;  3A0H V;  2ZYA A;  4PD4 D;  1SQQ D;  5KAF E;  1OVU A;  3QWO C;  5CIC B;  1HGV A;  1NTZ D;  1M60 A;  2WWW A;  1DEB A;  1KV9 A;  2N18 B;  3SLE A;  3L71 D;  4RES B;  2E74 C;  1IK7 A;  3Q1M A;  2R32 A;  3H1L J;  3RK3 D;  3CWB E;  3M9Q A;  3PP5 A;  2CA3 B;  3MHV A;  1M70 A;  4GOF A;  1K9M Q;  1KV4 A;  4AAM A;  4LC1 A;  1YJN P;  2WMM A;  1BSN A;  1URQ D;  1Q82 Q;  1BCC E;  3VTP C;  3VNW A;  3PTZ A;  5KLV K;  2FFD B;  2KOG A;  2AEM A;  4GYD A;  1IFP A;  2IFM A;  1GK6 A;  2CE1 A;  3MUD A;  5B66 V;  4I2L C;  3MGN A;  2K9Y A;  1VQ4 P;  3TYY A;  1EDI A;  3H1I G;  1YQ4 C;  3MTU E;  5KLV D;  4PJ0 H;  2ITA A;  3KHU A;  2IFN A;  1BGY D;  2YIU B;  2JKV A;  1Q7Y Q;  3NBS A;  3BVH A;  2KSE A;  3OCD A;  1NWQ A;  2I1K A;  2WPS A;  2WSF J;  4L3H A;  1L0L K;  3VYI A;  2Q5U A;  1OW7 A;  1GMJ A;  1E79 H;  2QIW A;  1J1E B;  3N4X A;  3NFQ A;  1DIP A;  1FZB A;  1Z56 A;  1SQB E;  3L4M A;  1EQ7 A;  1YJW P;  1PP9 G;  2BH4 X;  3KZI V;  4HH2 A;  2JTI B;  2NPS B;  2WQY C;  1RF1 C;  3G4S P;  5APY A;  1L0N J;  2W8Z A;  1VYD A;  1RAP A;  1M57 D;  1FZF A;  3RGU A;  4WY4 D;  1VQ5 P;  2ZVO B;  1GU2 A;  2Q7C A;  5KAI E;  3H1L E;  2N3Y A;  2HYN A;  5BU8 B;  1N8R Q;  1K3G A;  2WT7 B;  1Y47 A;  1K8A Q;  1G1J A;  3U1A A;  5KJ7 D;  1C6S A;  5CCG A;  2R5D A;  1YYC A;  3RK3 E;  3WUV A;  3VYM A;  1FDI A;  5L8R J;  1OVR A;  1K05 A;  1SQP G;  1FC2 C;  2W6B A;  2ZT9 C;  3IR9 A;  2XZR A;  4MN4 C;  4DJG A;  2GUV A;  5KJ7 A;  1GL2 D;  1NHL A;  1VF5 B;  3PRJ A;  1LTG C;  3Q2Y A;  3BRT B;  4WQ9 A;  4EYY Q;  3TYI A;  1NAF A;  2XDJ A;  1JTH B;  1GTW A;  1L4A D;  1BE3 G;  1GW4 A;  2BCC D;  1C52 A;  2FFD A;  1HJ4 A;  5APU A;  1CHJ A;  1ZV8 A;  1GW3 A;  2QM7 A;  2IPP A;  3TNU A;  1DD3 A;  3E1R A;  2NPS A;  1BE3 J;  4U3F E;  4Y5R A;  3W67 A;  4H0J A;  1YQ3 C;  3PJS K;  1SQV D;  3H25 A;  5APS A;  1CC5 A;  1L0N K;  1S2E A;  1M8O B;  1QL1 A;  3CCU P;  3X39 A;  3NTN A;  2GB8 B;  2CPB A;  3K5B A;  3MZW B;  2P10 A;  1OMI A;  2WSE J;  4GED B;  1LTJ A;  3CL3 D;  1MFZ A;  4N0K A;  2AIU A;  1IJD B;  4H13 C;  1AQT A;  3MD0 A;  3I56 P;  4IFM A;  3ZCF A;  2W6J H;  3FXD A;  2B88 A;  4HB1 A;  2E74 B;  1S72 P;  2IYO A;  5AW8 B;  5AVZ B;  4H44 D;  1H8A A;  2KZJ A;  3NMD A;  3CCJ P;  3RBX A;  5GTI V;  2BPB B;  3CCL P;  1SVF A;  3P32 A;  2FXP A;  4L74 A;  1LTS C;  2KS1 B;  1SQX D;  2C8S A;  1HJ5 A;  3P8C D;  5K5G B;  1KIL D;  1CIH A;  1JY3 O;  1PGO A;  2E75 C;  5GTH H;  3ABV C;  1MZ4 A;  2G8Y A;  2M5A A;  3SWY A;  1W2L A;  2YO2 A;  4TLF A;  5KAI H;  2XNX A;  2Y0D A;  1VQP P;  1ZW0 A;  2WPV B;  2FRC A;  2K88 A;  3HUS C;  4C7N A;  3JBT B;  3A0B H;  3AEB C;  3B5N C;  4UB6 V;  3HTK A;  5CCH A;  1M90 Q;  3QH9 A;  1VDF A;  4WY4 B;  1QL4 A;  1T2K C;  3BRV B;  1EDJ A;  2QM8 A;  2V7Q H;  2PCB B;  5KLI C;  1S4X A;  1VQM P;  2FKW B;  4ZNC A;  1QVF O;  4JYC A;  1BGY J;  5AVT B;  1CIE A;  3B71 A;  1IRW A;  2LIT A;  1JNM A;  1RY3 A;  3M06 A;  3L70 G;  3H1H J;  3M91 A;  1DEE G;  4FA1 A;  1BGY G;  3SJL A;  1L0L G;  5AW7 B;  1I54 A;  1YIC A;  3JCU H;  1FZC C;  1P84 I;  4K3I A;  2Z5H A;  2HLO A;  1OAE A;  3FWL A;  1FJ0 A;  2M0B A;  1I55 A;  3CU4 A;  1NO4 A;  2DGE A;  2H88 C;  1QVG O;  1L0L J;  4LGD E;  2AXT E;  1NTZ G;  1M1J C;  2W90 A;  5H2F H;  1A8C A;  4UB6 E;  4FAN A;  3H1J E;  3L72 J;  4OVN F;  1JCD A;  1VF5 C;  1OVV A;  3OAK A;  3VN0 A;  2WSF H;  3AE3 C;  5TJH A;  2IBZ E;  1IRV A;  4GT1 A;  1UIX A;  5CCG C;  3GF7 A;  1NTM D;  2JQR A;  451C A;  1H89 A;  2BAS A;  3L72 G;  2HPC B;  3AED C;  2YMK A;  5B6Q A;  2IBZ I;  3CX5 I;  3E1I A;  1FOS E;  1AVY A;  3L71 G;  1HRC A;  2QVA A;  1QL3 A;  2P1J A;  1J1D C;  1NU1 D;  1JB0 J;  3U1C A;  3BCC E;  1KB9 H;  4L3G A;  4C46 A;  1SQX J;  1SFC B;  2Y0C A;  3L71 E;  3F89 A;  5AW0 B;  1J2J B;  3B5N D;  3HQ7 A;  3H32 A;  3H1I J;  1H88 A;  5AW5 B;  2H8P D;  3RN1 A;  2PP6 A;  2O3J A;  2NZ2 A;  3A7O A;  2A06 D;  1I5T A;  1J3S A;  3Q5P A;  1N73 B;  1QEX A;  4IFF A;  3GF3 A;  1S9K D;  4PWA A;  4JYB A;  4U3F G;  1PGQ A;  1VPC A;  1EZV I;  3HRN A;  3O8Z A;  1J1E C;  2PAC A;  3CYT I;  4WWI A;  1N90 A;  1C2N A;  1EC5 A;  5E79 V;  3B5N A;  1LTJ B;  1NU1 E;  3CWB D;  2ZAE B;  3HQ8 A;  4EIE A;  1W2E A;  1G1I A;  1FJP A;  3L74 D;  4NFG B;  1R5S A;  4NPF X;  3TGU D;  5E79 H;  1L0N G;  3G71 P;  1R5L A;  2YQB A;  1L9B C;  5CYT R;  1N7L A;  2E76 C;  2VRS A;  5APT A;  2V4H A;  3CC4 P;  3CX5 D;  4N78 D;  1EXJ A;  1KQF B;  3D70 A;  1C7M A;  1ZXG A;  2RH0 A;  1X9V A;  2OYI A;  4FA4 A;  2HFE D;  1U7J A;  1BSH A;  4AAN A;  1FS0 E;  3C1L A;  1CRG A;  1L4A C;  5DFS A;  3LID A;  3P8C E;  1HF9 A;  1HBW A;  1JMM A;  2IBZ D;  1LC1 A;  1KB9 I;  1JY2 P;  2QA4 P;  1JUN A;  4C7R A;  2C9N Y;  1D7M A;  2IDB A;  1HCM A;  1WEJ F;  3V4W A;  4LLH A;  3SWF A;  2C9L Y;  1CSX A;  1W5C T;  1CHI A;  2CE0 A;  4K3A A;  3RK2 D;  1YI2 P;  4WBA A;  4Y28 J;  2DVH A;  2UWJ E;  3D6Y A;  2LKM A;  3EFF K;  2BCN B;  4CPG A;  1CYC A;  2B87 A;  1YIJ P;  2FYU E;  1R0Q A;  1RZ6 A;  2OAR A;  3BCC D;  1L0N D;  2OYI C;  4FB1 A;  2C9X B;  1CRI A;  1QX8 A;  1AQ5 A;  2MHM A;  1OCD A;  4D6T G;  2KIK A;  3CI9 A;  3U59 A;  1T3J A;  1IQC A;  3LW5 J;  1NMI A;  1S3J A;  3HE5 B;  1X79 B;  4IL6 H;  1AV1 A;  1RQV A;  2RKL A;  4V2K A;  2WPR A;  4D6T J;  1W5C E;  3M97 X;  2HOD B;  4DZO A;  3WUT A;  1NAY A;  2B87 B;  1Q90 D;  2N9J A;  3NBT A;  2ZYG A;  1LTI C;  2N1T A;  1RAQ A;  1GD2 E;  1DVH A;  3L74 E;  5KLV J;  1YHQ P;  2E75 D;  1I8O A;  1LT1 A;  3C2C A;  2LIR A;  2NPS C;  1DW2 A;  1M7L A;  2BGV X;  3H1J D;  4WQB A;  3ZOX A;  3VP9 A;  3FGA D;  2I1J A;  1PGP A;  2AI5 A;  2KLU A;  2Y9Z A;  1NTM E;  3MK7 B;  3AE5 C;  4L73 A;  5B5E H;  5CIG B;  1NTZ K;  1IZL 0;  2PRR A;  1K73 Q;  1HJ0 A;  1C2R A;  1Y8A A;  5GTH V;  3S1K A;  4H0K A;  2JO1 A;  2BLF B;  1SLQ A;  3AEA C;  1AFO A;  4R4L A;  1JM0 A;  4YXW H;  3GLM A;  5DF5 A;  1C75 A;  1S5L X;  4WY4 C;  1N73 C;  2B0Z B;  4H0L B;  3V4Q A;  1NKZ B;  1X8Y A;  2DW3 A;  2ZVN B;  3EQ2 A;  2LXB A;  1HZV A;  5H2F E;  3VMA A;  2H7H A;  3HQ6 A;  2Q6Q A;  4WQE A;  1RZ5 A;  2JP3 A;  1E2R A;  3ZBM A;  3IF4 A;  4B86 A;  3CCS P;  5CIE B;  3L70 D;  1BCC G;  4D6T E;  1HVV A;  1ZZH A;  3MUD C;  2D0W A;  4ASW A;  4DY9 A;  2PGD A;  2WSC H;  2Q3I A;  1P84 E;  2FY8 A;  1HH7 A;  1PP9 E;  2E74 D;  3B4S A;  5AW6 B;  4PJ0 E;  2O01 H;  3WUU A;  1IFI A;  1BCC J;  3LIE A;  2WSS H;  1JMB A;  1SQV E;  1S1C X;  1ZP0 C;  2C1D B;  3TF5 A;  5AVU B;  1SFC D;  3H1H E;  2KB7 P;  1RH5 B;  1QL2 A;  1URQ B;  2OYH C;  4JBZ A;  3O6Q A;  1JY2 O;  1JO5 A;  4ZKU A;  1LTA C;  2JWA A;  1H1O A;  1T2K D;  1RF1 A;  1H0T B;  4QAO A;  2JR8 A;  1CRJ A;  5APX A;  2C1U A;  3CD6 P;  1CXC A;  3CMA P;  1KB0 A;  1BDD A;  3BCC G;  4NPD A;  1RF1 B;  2K37 A;  3Q5R A;  2CK3 H;  3VMX A;  2QEX P;  4UB8 E;  1CYJ A;  1SQX G;  4RSZ A;  5EXQ A;  1GJQ A;  4J20 A;  1M56 D;  3L74 J;  5CIH B;  1SQP D;  1P84 H;  1BL9 A;  3CWB J;  1SS1 A;  3L75 G; 
#chains in the Genus database with same CATH homology
 2N18 C;  3O20 A;  4U3F D;  1I6D A;  3A0B V;  1CRC A;  1CIE A;  1IRW A;  1ZRT D;  3CX5 W;  1QYZ A;  1NIR A;  1L0L D;  1NNO A;  1U74 B;  2LIT A;  1HJ3 A;  1A56 A;  1LMS A;  1HRO A;  1CED A;  3PXS A;  1DW1 A;  4FA1 A;  3SJL A;  1YEB A;  1CIF A;  2C2C A;  5IY5 1;  5CID B;  4L1Q A;  1GQ1 A;  1I54 A;  1KIB A;  1YIC A;  3MK7 C;  3WFD C;  1KYO W;  1EZV D;  3HQ9 A;  4K3I A;  4RJT A;  1DII C;  3ZOW A;  1OAE A;  3FWL A;  1FJ0 A;  1I55 A;  3CU4 A;  2DGE A;  3A9F A;  3DP5 A;  1KYO D;  3DMI A;  1A8C A;  2PCC B;  4FAN A;  2ORL A;  3TDK A;  3WFB C;  1M6Z A;  2MTA C;  5KAI V;  5TJH A;  4WQC A;  1IRV A;  1NTM D;  2AXT V;  2JQR A;  451C A;  1CNO A;  5TIS V;  5H2F V;  1CXA A;  5B6Q A;  1MG2 D;  1F1C A;  5CIF B;  1QN2 A;  1CTY A;  1FHB A;  3SXT A;  5AUR A;  2CXB A;  1HRC A;  1EB7 A;  5C0Z A;  1PP9 D;  1QL3 A;  3WFE C;  4AX3 A;  3PXW A;  1CSU A;  1NU1 D;  1COT A;  4L3G A;  3RN0 A;  2Y0C A;  1CYI A;  3PHL A;  4EID A;  3HQ7 A;  2V07 A;  3GW6 A;  2KS1 A;  3WUI A;  1H31 A;  3GG2 A;  2RMZ A;  3OA8 B;  4YE1 A;  4EIC A;  1LC2 A;  2C1D A;  1DIQ C;  3RN1 A;  1IO3 A;  2O3J A;  1YCC A;  1H33 A;  2QG4 A;  2A06 D;  2B12 B;  1H33 B;  1I5T A;  1J3S A;  3WU2 V;  1YTC A;  1HZU A;  1C6R A;  4PWA A;  1BCC D;  1NTK D;  3L73 D;  4MU8 A;  2GIW A;  1YEA A;  2PAC A;  1GIW A;  3CYT I;  5DJQ C;  1N90 A;  3H1I D;  1C2N A;  3A0H V;  5E79 V;  1DW0 A;  4PD4 D;  1SQQ D;  5CIB B;  2ZOO A;  4WQD A;  5C9M A;  5CIC B;  1CO6 A;  3O0R C;  3RMZ A;  3CWB D;  3ITK A;  1NTZ D;  3HQ8 A;  1MG3 D;  1YIQ A;  4EIE A;  1M60 A;  1KX7 A;  1KV9 A;  1FOC A;  2N18 B;  3L74 D;  3SLE A;  4FA5 A;  3PXT A;  3VRD A;  3L71 D;  4NFG B;  3TGU D;  1AOQ A;  1DVV A;  1H32 B;  2YQB A;  1L9B C;  3PH2 B;  4AAO A;  5CYT R;  2CA3 B;  2ZZS 1;  3CX5 D;  3L4O A;  1M70 A;  1WVE C;  1C7M A;  2BH5 X;  1H9Y A;  4AAM A;  1AOF A;  4FA4 A;  2L4D A;  1E8E A;  4AAN A;  1JDL A;  1CRY A;  1CRG A;  1N50 A;  3VNW A;  3PTZ A;  1U75 B;  5DFS A;  1N15 A;  2EXV A;  3OCD B;  4WQ8 A;  4JCG A;  1FI9 A;  4O1W A;  1S6V B;  2N9I A;  4GYD A;  1GKS A;  2IBZ D;  1LC1 A;  2N9Y B;  2CE1 A;  1CRH A;  5B66 V;  1GDV A;  1DW3 A;  2QJK B;  4XYD B;  1I6E A;  5KLV D;  3KHU A;  1HCM A;  1WEJ F;  3CP5 A;  2OZ1 B;  1BGY D;  2YIU B;  1CIG A;  3NBS A;  1CSX A;  1B7V A;  2QJY B;  1W5C T;  3OCD A;  1F1F A;  1CHI A;  155C A;  1QKS A;  3NWV A;  2HV4 A;  2CE0 A;  1SQB D;  4L3H A;  2DVH A;  4PJ0 V;  4EIF A;  2D0S A;  3L75 D;  4LJI A;  4EDF A;  2BCN B;  1E29 A;  1CYC A;  3WFC C;  4IL6 V;  3L4M A;  1AKK A;  1R0Q A;  2YCC A;  1RZ6 A;  1N9C A;  3BCC D;  1COR A;  1L0N D;  2B11 B;  2BH4 X;  3KZI V;  2JTI B;  4FB1 A;  2C9X B;  1H32 A;  1CRI A;  3SVW A;  2MHM A;  4O1Q A;  2CA4 B;  4D6T D;  2FYU D;  1OCD A;  4FAV A;  1IQC A;  1NMI A;  3H1L D;  1LFM A;  1VYD A;  1RAP A;  3SWS A;  4V2K A;  3M97 X;  1GU2 A;  2ZBO A;  2N3Y A;  2N9J A;  1LS9 A;  1K3G A;  3NBT A;  1A2S A;  1RAQ A;  1I8P A;  3RLM A;  1DVH A;  4XXL A;  1C6S A;  1L9J C;  1KB9 D;  1CCH A;  1I8O A;  5B5E V;  3C2C A;  3O5C A;  1CTZ A;  2LIR A;  3ZOO A;  2Q3E A;  1DW2 A;  1FI7 A;  2BGV X;  3VYM A;  3H1J D;  1K3H A;  5KLI B;  4WQB A;  3ZOX A;  3H1K D;  2B10 B;  1DT1 A;  2AI5 A;  4P4Q B;  3MK7 B;  2ZON G;  3CXH W;  3PRJ A;  5CIG B;  2I8F A;  1IZL 0;  1AYG A;  4WQ9 A;  2GC7 D;  2B4Z A;  4WQ7 A;  3TYI A;  1KX2 A;  1C2R A;  1CSW A;  2BCC D;  1PPJ D;  1C52 A;  1HJ4 A;  1YFC A;  2N3B A;  1CHJ A;  5GTH V;  2GC4 D;  4H0K A;  2BLF B;  2L91 A;  4Y5R A;  4H0J A;  4UB8 V;  1SQV D;  5DF5 A;  5KAF V;  1C75 A;  2Y0E A;  2RN0 A;  1CC5 A;  2B0Z B;  3X39 A;  2GB8 B;  4PW9 B;  1BE3 D;  4GED B;  1HZV A;  3L72 D;  4N0K A;  3VMA A;  3HQ6 A;  4WQE A;  2OZ1 A;  2AIU A;  3ZOY A;  1H9X A;  1C6O A;  1RZ5 A;  1E2R A;  5KKZ B;  3ZBM A;  3ZCF A;  5CIE B;  3L70 D;  5DJQ B;  1ZZH A;  2VHD A;  2D0W A;  4DY9 A;  1YNR A;  3PLN A;  1HH7 A;  2FYN B;  3H1H D;  5GTI V;  2BPB B;  2K9J B;  1CCR A;  2KNC B;  2C1D B;  3TF5 A;  2ZXY A;  351C A;  3OA8 A;  1H31 B;  1NML A;  1SQX D;  2C8S A;  1HJ5 A;  1CIH A;  1MZ4 A;  3ZIY A;  1CSV A;  2JWA A;  1H1O A;  1W2L A;  3O1Y A;  4A7P A;  4QAO A;  4WQA A;  4FA9 A;  1CRJ A;  2FWL A;  2YK3 A;  4Q5P A;  2Y0D A;  2C1U A;  2QJP B;  3DR0 A;  1CXC A;  1FI3 A;  2V08 A;  1KB0 A;  1FCD C;  1CHH A;  1S5L V;  2FRC A;  4KMG A;  1P84 D;  3JBT B;  2XTS B;  1ETP A;  4UB6 V;  4AAL A;  1CYJ A;  4RSZ A;  1QL4 A;  5EXQ A;  1GJQ A;  4J20 A;  3WC8 A;  5CIH B;  3CXH D;  1CTJ A;  2C1V A;  1SQP D;  1BL9 A;  2PCB B;  3ORV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...