1SQVD

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqvD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqvD02
3RMZA 1HROA 1CYCA 1RZ5A 3CU4A 3L74D 5TJHA 2OZ1A 2ORLA 1YEBA 1BCCD 2CE1A 2C9XB 3TDKA 3JBTB 3CP5A 1CIHA 1K3GA 3ZIYA 5B5EV 1C2NA 155CA 1BE3D 1I6DA 1CYIA 2C1VA 1A8CA 1KX7A 1IRVA 4RSZA 1RZ6A 2C2CA 5CIDB 1YCCA 2O3JA 4UB8V 3O1YA 1CSWA 1H31B 1BL9A 1EB7A 3SXTA 4PD4D 5DF5A 1AYGA 2PACA 2JWAA 2PCBB 1IZL0 3C2CA 2B12B 4UB6V 1CEDA 3ZOYA 3L73D 2N18C 1H33A 3H1LD 1I8PA 5DJQB 3PLNA 1QKSA 1HJ4A 2YCCA 4O1WA 4FA5A 3PXTA 4L3HA 1RAQA 1I54A 3A0BV 3PH2B 1YICA 3WC8A 2FYUD 1NIRA 4FA1A 1BGYD 1N90A 4GEDB 3NBSA 2RN0A 4WQBA 5CIHB 3BCCD 1A2SA 1CXAA 2BGVX 2YK3A 2D0WA 1LC2A 1WEJF 3PXWA 2L4DA 1DT1A 2VHDA 1CTYA 3OCDA 2PCCB 4JCGA 3NBTA 5EXQA 5CIBB 3WU2V 1L0LD 4AX3A 1H32A 2KNCB 3OA8A 1AKKA 1DIIC 5B6QA 1CIGA 2B11B 1CYJA 3H1ID 1I8OA 3NWVA 3O5CA 2V08A 3PXSA 2MTAC 1HZVA 1P84D 1SQPD 3WFBC 4K3IA 3SWSA 3L4MA 1CSVA 3TGUD 4L1QA 2N9IA 1I55A 3WUIA 1C7MA 1J3SA 1W2LA 1KB0A 1KYOD 1NTKD 3RN0A 3ITKA 5KLVD 1C52A 1GU2A 4IL6V 4EIEA 1CXCA 2IBZD 3L71D 1DIQC 1F1FA 1FI9A 4WQCA 1CRJA 1L0ND 1HRCA 1HH7A 1M70A 2B4ZA 3ORVA 2Y0EA 4N0KA 2CE0A 2GC7D 2FRCA 1DW1A 5IY51 1GIWA 1YNRA 1KX2A 2BCCD 1E29A 1LFMA 3VNWA 1CSXA 3TYIA 1DVHA 1FCDC 5GTHV 1QYZA 2JTIB 1C6SA 2Y0CA 1A56A 4XXLA 3M97X 4QAOA 2QG4A 3SJLA 2CA3B 2N3YA 2C1DA 4O1QA 4D6TD 2DGEA 1AOQA 2C8SA 3H1KD 3O0RC 2ZZS1 5DFSA 1SQBD 2LITA 2OZ1B 1L9JC 5CIFB 2YIUB 1M6ZA 1CHHA 1DVVA 3L70D 1N50A 1K3HA 3TF5A 1N15A 2ZONG 1CHJA 2AXTV 3VRDA 4A7PA 1DW3A 1WVEC 2GIWA 5H2FV 5AURA 2B0ZB 4H0KA 3A9FA 1CTZA 1LC1A 1FJ0A 4WQ8A 1C6OA 1CHIA 5KLIB 2C1DB 3H1JD 4DY9A 4V2KA 3RLMA 1EZVD 4FA9A 3HQ9A 3VMAA 4P4QB 3RN1A 1YFCA 1OAEA 2A06D 1FI7A 3H1HD 1IO3A 2BLFB 1IRWA 1FHBA 4YE1A 1MZ4A 5DJQC 4PWAA 1HZUA 1H33B 3DP5A 5B66V 1E2RA 5CIEB 1LS9A 1FOCA 1CIFA 5CICB 1U74B 5KAFV 3L4OA 3VYMA 2N9JA 2CXBA 4FAVA 3L72D 1YTCA 1LMSA 1H9YA 1CRGA 3MK7B 3HQ8A 1JDLA 3KZIV 1U75B 3L75D 1H1OA 1B7VA 1NMIA 4EICA 2Y0DA 2K9JB 1NU1D 2DVHA 1YEAA 2RMZA 2CA4B 3ZOOA 2QJPB 3A0HV 4AAOA 4AALA 3OCDB 4U3FD 2GC4D 3PTZA 3PHLA 3GG2A 4GYDA 4Q5PA 1H32B 1PPJD 3OA8B 1NTMD 2LIRA 1HJ3A 1I6EA 3CX5D 1CIEA 5TISV 4WQEA 1CRYA 2FYNB 3HQ7A 2GB8B 4FB1A 1CORA 2N3BA 1HJ5A 4WQ7A 3DMIA 1SQVD 4PW9B 1SQQD 1MG3D 1DW0A 1MG2D 5KAIV 2V07A 4XYDB 1KV9A 1CRCA 4AAMA 4WQAA 2JQRA 3CXHD 1NTZD 2FWLA 4EIFA 3CWBD 1L9BC 5C0ZA 3PRJA 1KYOW 1ZRTD 4LJIA 2ZXYA 3KHUA 2YQBA 4WQDA 3ZCFA 2BH5X 4WQ9A 2MHMA 2B10B 2N18B 3ZOXA 1C2RA 1PP9D 3DR0A 4KMGA 1QN2A 4L3GA 3CX5W 3ZOWA 1GKSA 1S6VB 4NFGB 351CA 1CTJA 1NMLA 1OCDA 1CC5A 1QL4A 1IQCA 2C1UA 1C75A 2EXVA 3O20A 5KKZB 3WFEC 1CSUA 1ETPA 2N9YB 451CA 1CNOA 2QJKB 2D0SA 1GQ1A 2ZBOA 2I8FA 5CIGB 2AI5A 3X39A 1N9CA 1AOFA 3CXHW 4EDFA 3SLEA 3GW6A 3HQ6A 4FA4A 1GJQA 1R0QA 3WFCC 1S5LV 1NNOA 1KB9D 1FI3A 3FWLA 4AANA 1COTA 3WFDC 1DW2A 4J20A 5E79V 1GDVA 1HCMA 1I5TA 5GTIV 1CCHA 4PJ0V 3ZBMA 1CRIA 1E8EA 1QL3A 3MK7C 4MU8A 1M60A 5C9MA 1RAPA 1W5CT 3CYTI 1CO6A 4Y5RA 2KS1A 2QJYB 1SQXD 5CYTR 2ZOOA 2Q3EA 2BCNB 1CRHA 4EIDA 1CCRA 1YIQA 4RJTA 4FANA 2L91A 4H0JA 2AIUA 1C6RA 1F1CA 1H9XA 2HV4A 3SVWA 2XTSB 1ZZHA 2BPBB 1VYDA 1KIBA 1H31A 2BH4X
chains in the Genus database with same CATH superfamily
1NU1G 1CYCA 3N7NA 2KLVA 1T2KC 1IO4A 3BVHA 5TJHA 3V2PA 3RL0C 2AXCA 3U1AA 1YHQP 3S4RA 1CIHA 2Z5HA 1KB9I 2UWJE 1K3GA 3AE8C 3ZIYA 1C2NA 4RESB 1BE3D 3MUDA 1CYIA 2C1VA 4XE5B 3IAOA 1RZ6A 4YPCA 1NTZK 1XTCC 3O1YA 1YJNP 1CSWA 1H31B 1Q90D 1BL9A 5CJ0A 1NTZE 3T97A 3HUSA 1AYGA 3V5BA 1H8AA 1ZRTE 1IZL0 3BRTB 3RK3D 3S1KA 5CCHA 2OARA 2ZT9B 1SQQG 1CEDA 3O6QB 1OFCX 2ZVOB 1PZQA 1JY3P 1I8PA 3FWNA 2G3AA 1HJ4A 3M0AA 2Q1KA 1I54A 1DIPA 1EDIA 4IFMA 1NIRA 3AEAC 5AVYB 5CIHB 3BCCD 1A2SA 3RK2D 2BGVX 1LC2A 2A06E 1PP9G 3H1HJ 4JBZA 5E79H 2QJKC 2FFDC 4H44B 1Y9BA 1CTYA 1VQ4P 3I55P 2R5BA 1AKKA 2B11B 3H1ID 1KZUB 4PJ0E 1KFMA 3CCVP 1I55A 1C7MA 2IYPA 3LW5H 1LTJA 1JCCA 4H13B 3I56P 1JY2O 1GU2A 2N9BA 4IL6V 2G8YA 3B5ND 3CCQP 2WITA 5BVZA 1PPJE 3CMAP 1NTME 1YQ4C 3EFFK 5APTA 1FU1A 1NTMJ 2B4ZA 2HODB 1FZCC 2FRCA 3M06A 3JC22 1LFMA 5B5EH 2WSFH 2B88A 3TYIA 3CXHH 1FCDC 5GTHV 5CCHD 2QIWA 1RF1A 1YITP 4UB8H 2QEXP 1PV3A 2CA3B 1N73A 1SLQA 3WMM0 2ZVNB 1MFZA 4HYTB 3H1KD 3O0RC 1SQBD 2LITA 2OZ1B 1SFCA 2B9BA 1M6ZA 1CHHA 1KYOI 1UIIA 1CHJA 3VRDA 5H2FV 1YBKA 1LT1A 4H0KA 5L8RJ 1LC1A 2BASA 1BCCG 3OJAB 3H1JD 3KXDA 4V2KA 2XNDH 4P4QB 1KORA 4YTPC 1JMBA 4Y99B 2M0BA 2SPZA 5K5GB 2BLFB 5AW9B 3S9OA 3MTUE 1FHBA 5DJQC 3WU2H 1IJDB 4PWAA 4OGQB 1H33B 1E2RA 5AVTB 1FOCA 5AW3B 1M1JB 1Y8AA 1S9KE 4FAVA 1MFTA 1GTWA 4BRYB 1CSBA 1LMSA 2P7JA 3HD7C 4N3YB 3L73G 3GF7A 3H1LG 1U75B 4WY4A 1H1OA 1R5LA 4EI2A 2KZIA 3PP5A 1LNQA 3VMYA 1K73Q 1WMKA 2ZT9D 3PHLA 1SQPK 3B71A 2LIRA 2IYOA 3BRVB 3A0HE 3CCUP 1EZVI 1Z56A 2OYOA 5KLVK 2KOGA 2XZRA 1JY2P 2N1TD 5KLVE 1L0LG 3HQ7A 2IDBA 4I2LC 2HLOA 3L71E 1FBMA 2K1AA 1LP1B 3Q5PA 3CMEP 1N7SD 1FDIA 2OTLP 1MG2D 1CRCA 2E74C 2WSSH 3C9IA 4AAMA 5KJ7C 1NTKG 1NTZD 2JP3A 5C0ZA 4L73A 1ZRTD 2ZXYA 1T6AA 3KHUA 2D2CB 2B87A 4PD4H 3HTKB 2YQBA 3II6A 4WQDA 1L0NG 2ZYGA 1BE3J 4ZMDA 4WQ9A 1J1EC 2NPSA 1C2RA 1LT9C 3IR9A 4D6TE 1VQ5P 3B8EB 1R5SA 2OYIA 3ZOWA 3CX5I 3AE6C 4GKGA 5KKZB 3MUDC 1USEA 5B66H 4L74A 4C7RA 1N7LA 5AW2B 1VL2A 2IFNA 1LTAC 4GDOA 3RL0D 4W80A 1N9CA 4JQ0D 3CXHW 1FDMA 3HUSC 3WUUA 5APVA 2ZAEB 3BCCE 1SP4A 2XNXA 5CCHC 3WFCC 3BCCJ 4GIFA 4AANA 2JR8A 3WFDC 1I5TA 5AVUB 3Q3DA 1CCHA 4PJ0V 1EZVG 4YXWH 2VRSA 5C39A 1E8EA 2RKLA 4H0LC 3L37A 2A06G 5E79E 3H1HG 3H1IJ 3RK3B 4Y5RA 2KS1A 1EXIA 2GUSA 1QEXA 1IFJA 1DD3A 2QJPC 2E5TA 1JCDA 3G9RA 4EIDA 2M5AB 2IFMA 1CCRA 1YIQA 4U3FE 4YXDC 4RJTA 1FZFA 2ITAA 4U3FJ 1OVRA 1C6RA 1NJIQ 1T3JA 1JTHB 1NHLA 5KAIH 5AVRB 3D71A 3TYYA 2XTSB 2BPBB 1BDCA 2PP6A 1AQ5A 3VP8A 1S72P 1RZ5A 1SS1A 3QH9A 3C8VA 2FYNC 1LTJC 1KTMA 1SQVK 4JYCA 4ZNCA 4WBAA 3NFQA 155CA 1PPJG 1NTMG 1U57A 2PFXA 1KX7A 2AXTH 1IRVA 4RSZA 1VDFA 3AE9C 5CBNA 3WUTA 1J1EB 3CLQA 3CXHE 1E79H 1VQLP 1JNMA 3H1KE 4ZKPA 2PACA 3H1KJ 4UB8E 1SQBJ 2KB7P 3IN6A 3GHGA 3ZOYA 1IFNA 4RKUJ 1RF1C 2PGDA 2J5UA 1KILA 3PLNA 5KAFH 4O1WA 4FA5A 1N73C 4L3HA 4KHXA 2WT7A 2A45H 3FXEA 3JSVC 3H1JJ 1S9KD 4FA1A 3T97B 1BGYD 3HUSB 2E75C 4GODA 4WQBA 2C0WA 1S5LH 3U59A 1SFCC 1CXAA 2YK3A 1AFOA 1QGKB 1OW6A 1VPCA 2O01J 1JMMA 3CCJP 2L4DA 2QSIA 1DT1A 1IC2A 4I7ZC 1VQ6P 1G2CA 4JCGA 3NTNA 5EXQA 5CIBB 5APSA 1KV4A 4DJGA 1H32A 2KNCB 3OA8A 2E5YA 2O1KA 2YXQB 3NWVA 3O5CA 1M7LA 1FC2C 4H0LB 3V4WA 3PXSA 1P84D 1EDJA 3AECC 1SQPD 3W68A 1CSVA 1H0TA 4L1QA 2N9IA 2AEFA 3WUIA 3P7KA 3H32B 5KLVD 3VMZA 4DOJA 4W7ZA 2W27A 4EIEA 3L71D 3VYIA 3A5TA 2Q6QA 4WQCA 1CRJA 1HRCA 2FKWB 1HH7A 5AVZB 1H89A 5AVXB 1SQXE 4WY4C 2GC7D 2HG5D 1DW1A 5IY51 1UIXA 1YNRA 1E29A 3VNWA 1LTJB 3IFMA 1DVHA 2ZYAA 3CC7P 1W2BO 1C6SA 3HD7D 2QM7A 1A56A 4QAOA 2QG4A 1LTGC 1VF5C 4GOEA 1URQA 1J1DC 4O1QA 4D6TD 3L74E 1L2PA 1AOQA 1U7JA 2LKMA 5DFSA 1NTZJ 1DH3A 2ZJSE 3TNUB 3CC4P 2AEJA 1DVVA 2V7QJ 3L70D 1MV8A 1K3HA 1M8OB 3TF5A 3WUVA 1N15A 4A7PA 1WVEC 5AURA 2B0ZB 3MP7B 4C7NB 4WQ8A 1OVVA 3AEEC 4M3LA 1C6OA 1L4AA 4O9BA 1N73B 1CHIA 1YIJP 4DY9A 1GL2A 1J2JB 3RLMA 2N1TB 1BSHA 1KD1Q 1NVOA 3D6ZA 1BE3G 2E75B 1YFCA 5CCGA 3RL0g 2E74D 5KJ7D 1N7SB 1FZGA 5M1BA 3MIWA 2NPSC 3CC2P 3DP5A 2HYNA 2FYUK 4I7ZB 1KB9H 4WWIA 5CICB 2OYIC 3CCRP 2OYHB 3VYMA 2FYUE 5APXA 5B66E 1H9YA 1CRGA 3MK7B 3VOPA 1Q2NA 3HQ8A 1NMIA 1KQGB 2WSCH 2K9JB 1HJ0A 3CCEP 2DVHA 1YEAA 3ZOOA 4IL6H 4AALA 1IK9A 3OCDB 4U3FD 1QLED 2H43A 2Z4EA 3RBXA 3BCCG 4GYDA 3AE1C 3KQGA 3PH0A 2QJYC 1URQD 3D6YA 5TISV 3EWKA 4MN4C 1HTLC 4WQEA 2WPRA 5GTHH 2W90A 4KJMA 1M1KQ 4FB1A 1CORA 3RL0B 2H7HA 1JUNA 5AW4B 3H1IG 2IBZE 1HJ5A 1RE3A 2POHA 1SQVD 4PW9B 3AEGC 2BEZF 4GT1A 1MG3D 4JF7A 2BEQD 3G71P 3KYQA 1KV9A 4WQAA 3CXHD 1FJPA 2FWLA 4U3FG 1GL2D 1LTSC 3M91A 4H0LD 5KAIE 3O6QA 4UB6H 3FX0A 3AE3C 4CPGA 2PRRA 5H2FH 3E1RA 3IF4A 3CCSP 1HF9A 2JO1A 2B10B 3ZOXA 1JO5A 4KMGA 3A0BH 3MHVA 1KMIZ 2WSEJ 3Q5RA 3Q1MA 1S6VB 1IZNB 3F5HA 1NOHA 2YIUC 2AXTE 2P1JA 1GW3A 1OCDA 4DCKA 2ZFCA 3LIEA 2EXVA 3O20A 3WFEC 2Q7CA 1M90Q 5DJUB 2FFDB 2QJKB 3EQ2A 5KLIC 2ZBOA 1X0TA 2I8FA 5CIGB 3H1KG 1RQVA 1CW5A 2W83C 1SQBG 3AE2C 2OYIB 2L5GB 1IK7A 1H88A 3SLEA 1BGYE 4FA4A 1GJQA 1BGYJ 4LGDE 1R0QA 2H8PD 1ZXGA 3GHGC 5KAFE 3JCUH 4ASVA 1AV1A 1COTA 2YKPA 2Q3IA 1DW2A 3OW2O 1YJ9P 4AQRD 1KILC 3P32A 3H1JG 1ZLLA 5GTIV 2JWDA 3KZIE 1KYOH 3M9HA 2CPBA 1BSNA 1OWAA 1S4XA 2HODA 1P84E 1RAPA 1NU1K 1SQPE 1CO6A 4HJGH 2KI7B 2Z5IA 1K05A 2QJYB 1SQPJ 2XV5A 1SQXD 1ZP0C 2ZOOA 2Q3EA 2BCNB 1FZCB 1EQ7A 1ZV8A 1NAFA 3VP9A 2E75D 5KLVJ 1SFCD 2HFED 3M9QA 5DJTB 2H88C 2AIUA 2E43A 1H9XA 3SVWA 3L71J 1HGVA 4N6JA 3RMZA 3CU4A 4AUWA 3L74D 4N78E 2OZ1A 1NWQA 2C9XB 2J58A 3JBTB 2ZYDA 2XU6A 3CP5A 1SQQK 1AJYA 3VTPC 1Q7YQ 3HE4B 4EIJA 5EFWB 2C2CA 2K37A 5CIDB 1YCCA 3D0WA 2O3JA 1KILE 3V6IA 2O01N 1EB7A 3SXTA 1N8RQ 4D6TJ 2LXBA 4IL6X 3V2QA 4PD4D 3CI9A 1AVYA 2JWAA 1HBWA 2PCBB 1LWUA 1S2EA 2B12B 1Q86Q 3L70E 1T3UA 2N18C 1H33A 3L70J 4WY4D 1CI6A 1PP9E 1M1JA 2HPCA 5DJQB 1URQC 1QKSA 1NTZG 3PXTA 5AW1B 3A7OA 1YJWP 4BRYA 3L36A 4L75A 1YICA 2FYUD 4PV1C 3MZWB 1N90A 2R5DA 3NBSA 3AE4C 1VF5D 2D0WA 4NPDA 1NYHA 3HD7B 3F89A 2M3BA 3GHGB 5APYA 3PXWA 1TU3F 2VHDA 1NAYA 2PCCB 4PJ0H 2FBWC 1L4AC 4AX3A 5B6QA 1CIGA 1GL2C 1CYJA 1I8OA 1K04A 1PGPA 2YMYA 2Y9ZA 2KSJA 3SWSA 5CCGC 1JY3N 1KB9E 1GU4A 3AEDC 1J3SA 2P2UA 2W6BA 3ITKA 3CX5H 4BWNA 1C52A 1G2CB 2YXRB 2IBZD 1F1FA 1FI9A 2KLUA 3M9BA 1ZW0A 1M70A 2NPSD 3PJSK 1EXJA 1LTIC 1Y47A 2K88A 2Y0EA 4N0KA 2CE0A 3LW5J 4TLFA 3U1CA 4EOTA 2E74B 1GIWA 3CCMP 2BCCD 2NRGA 4HH2A 1JOCA 1HVVA 1HWTC 1CSXA 2E76D 1ZR2A 2ZXEB 1QYZA 2Y0CA 1GK6A 2CPSA 3M0DA 1SQVE 4XXLA 1DEBA 1SQVJ 1LJ2A 2YKOA 1MZ9A 2Q9IA 2WTYA 2R3SA 3KPEA 2C1DA 5B5EE 1LT9B 1EDKA 1BCCE 2C8SA 1P84I 2WSFJ 3HE5B 2ZZS1 2LR2A 4KT0J 1GZLA 2NZ2A 1QVGO 1HH0A 2WPSA 2WVRA 1RE3C 2ZONG 1RF0A 3LIDA 2WMMA 2AXTV 2GIWA 1SQBK 1CTZA 1FJ0A 5APWA 1USDA 4RO0A 1KQLA 1URQB 4UB6E 3GF3A 1OW8A 5H2FE 3HQ9A 3L4FA 4IOIH 3RN1A 1OAEA 3A0BE 3H1LE 1E5WA 5KTBA 3NMDA 1RE4A 1MZ4A 2JEEA 1HZUA 5BU8B 5CIEB 1CIFA 5KAFV 3L4OA 1L4AB 3L72D 1GL2B 3ZDMA 1VQ7P 4B86A 1VQ8P 3VMXA 5AVWB 2WQYC 1X9VA 3WU2E 3KZIV 1G1IA 3L75D 4H44C 1B7VA 3QWOC 1L0LK 2K3RA 1NU1D 2M5AA 3KDPB 2QJPB 3A0HV 2P10A 2JJLA 3V2RA 1JTHA 2M3EA 2GC4D 1BGYG 2KUBA 3CCLP 4ASWA 4Q5PA 1VQ9P 2LXCB 2W8ZA 3I5CA 1JB0J 1M57D 1NTKK 3TGUE 2W6JH 3P8CE 4I1LA 3TGUJ 3ABVC 4H13C 4N78D 2WPVB 1SQXJ 1CRYA 2FYNB 4XFJA 2GB8B 1QVFO 2N3BA 5AW6B 1L0NK 1FJKA 4WQ7A 1WT6A 3O8ZA 1SQQD 1SQPG 2MJZA 1L0NE 4BXLA 4IFFA 1HJBA 3B4SA 3Q5SA 1KILD 4DT0A 4HKZH 2JQRA 5KLVG 2C0XA 3UIAA 2M8RA 3L74J 4Y28J 4K35A 1AA0A 3D70A 3L71G 2V4HA 2KZJA 3B5NA 3ZCFA 1DD4A 2BH5X 1OMIA 4GOFA 1RF1B 1PP9D 3DR0A 1JY2N 1QN2A 3CX5W 3Q2YA 1OX3A 4PD4E 4C46A 1NMLA 5CBOA 1CC5A 2IX7C 2WWWA 1SFCB 1RH5B 2W6AA 1ETPA 4D6TG 3MD0A 1CNOA 2KNCA 1GQ1A 1GDTA 1FAVA 3NXSA 1ZMEC 3X39A 2YKQA 1S3JA 4R4LA 1EZVE 3HQ6A 2FYUJ 4Y99C 3CXHI 3L70G 1LWUC 2E76C 3CD6P 3H1HE 1CZQA 3USSA 4OGQC 1KB9D 3H32A 1FI3A 1X8YA 1ZN5A 1M1JC 5E79V 3VN0A 2KXPB 3ZBMA 1GU5A 1CRIA 2WPQA 5AW8B 2I8DA 5C9MA 1VQKP 5AW0B 3AE7C 1IFIA 4DZOA 5TISH 3H6PA 3E1IA 5CYTR 2E42A 4WY4B 1WRGA 1CRHA 2OQQA 4PV1D 1PGQA 1KQSO 2JDIH 2K9YA 1NTMK 5CMZA 4H0JA 1S5LX 2FY8A 1Q81Q 1ZZHA 1YTZT 1VYDA 1OIPA 1KIBA 1VF5B 1H31A 2BH4X 1MKMA 3CX5E 1HROA 1J1DB 2ORLA 1YEBA 1BCCD 1L4AD 3GMAA 2CE1A 2YNYA 3TDKA 2BCCE 3TNUA 4LC1A 2BCCJ 4OVNF 4Z1MH 5B5EV 1I6DA 5CCGD 1A8CA 2GUVA 4C7NA 4L76A 1FZBA 4UB8V 1LTBC 2YMKA 2I1KA 2N1TA 3EFGA 3CWBE 1XTGB 5DF5A 3CWBJ 2D2CC 1SQVG 3C2CA 1AQTA 4UB6V 1FE6A 1N7SA 1YTZI 3L73D 4NPFX 3M0DC 2B87B 3H1LD 2O01H 2OYHA 1IFPA 2QA4P 2NPSB 2YCCA 1Q82Q 1DEEG 1RAQA 3A0BV 1PFIA 3PH2B 3WC8A 1FZAA 2WZ7A 4GEDB 1HUCA 2RN0A 1QX8A 5KKZC 1NKZB 1LWUB 2E76B 1WEJF 2K9JA 1RF0C 5GTIH 1AVOA 3OCDA 1CI6B 3NBTA 1KFNA 3WU2V 1PGOA 2HPCB 1L0LD 1OZHA 1S5LE 3CL3D 1DIIC 3BASA 3L72E 2V08A 1YI2P 3L72J 2MTAC 1HZVA 3FXDA 2FXMA 3WFBC 4EYYQ 4PD4I 4K3IA 3L4MA 3TGUD 1VQPP 3L75E 1FOSF 4WB4A 3V2NA 3P8CD 1ZOYC 1W2LA 3L75J 3OA7A 1NU1E 1RE4C 1KB0A 1VQNP 3AE5C 1KYOD 1NTKD 3RN0A 3GLMA 1NU1J 1RQUA 3G3ZA 2CK3H 1JM0A 2GM4A 3SWYA 2KSEA 3SSUA 1CXCA 3SWFA 2P58A 1DIQC 3RK3C 3V4QA 2I1JA 1L0ND 1RHZB 3ORVA 2Y9YA 1U7MA 3FGAD 2R3CA 2Q5UA 2KS1B 3R4YA 1KX2A 2GA1A 1FOSE 3OAKA 2JTIB 1W2EA 3MGNA 3M97X 1FZEA 1IFDA 4H44D 1SQQE 2V7QH 3P8MC 3RK2C 3SWKA 3SJLA 3TGUG 3HRNA 1SQQJ 1A02F 1SQXG 2N3YA 2FXPA 2DGEA 1OVUA 1VQOP 1YQ3C 3N4XA 2MKVA 1L9JC 5CIFB 1NO4A 2YIUB 5AVQB 1BE3E 3SFDC 1X22A 1PL5A 2QVAA 1R8EA 2FYZA 1N50A 2FFDA 3H25A 4JPZB 1DW3A 4H13D 1EDLA 3A9FA 2IBZI 3L74G 1PP9J 4NPEA 5KLIB 4AYCA 2C1DB 1VQMP 1EZVD 4FA9A 5APUA 1A02J 4HB1A 3RK3E 3VMAA 2A06D 1FDOA 1FI7A 3B5NC 3H1HD 1N2DC 2FXOA 1IFMA 1IO3A 1T2KD 1IRWA 3CPWO 4YE1A 1QL1A 2AEMA 5B66V 2C9LY 1LS9A 3G6EP 1U74B 1KILB 2N9JA 1OXZA 2CXBA 1YTCA 2JKVA 3A2AA 2WT7B 3A3YB 2XDJA 2QM8A 1JDLA 2RH0A 3RGUA 1FZCA 1FS0E 4EICA 3C1LA 2Y0DA 2J59M 1M56D 2RMZA 2CA4B 4AAOA 1G1JA 4ZKUA 2FYUG 1W5CE 1LP1A 3PTZA 2QE7H 4K3AA 3GG2A 1EC5A 4R4MA 1QL2A 3H1IE 1H32B 3TSIA 2C9NY 1PPJD 3OA8B 1NTMD 1HJ3A 1I6EA 1RY3A 1S1CX 2WSCJ 2H89C 3CX5D 1CIEA 4IL6E 3L35A 2XKMA 1H0TB 4I6MC 1HGZA 2R32A 3HE4A 3HTKA 2A45I 5TISE 3RBZA 3DMIA 3E7KA 4JYBA 1KQFB 4OGQD 1DW0A 3RK2B 4TT3H 5KAIV 2V07A 2QRXA 4XYDB 5GTHE 2IZ1A 2OTKE 2WSEH 4EIFA 2KK7A 3CWBD 2IPPA 1BCCJ 1LGHB 4LLHA 1L9BC 3PRJA 2P67A 1KYOW 4LJIA 2IBZG 2DW3A 2PAJA 3W67A 1OW7A 2ZXXA 2MHMA 1ZR4A 2N18B 5APQA 1D7MA 5AVVB 1KN7A 4L3GA 4OWFA 1JY3O 2HR3A 2BCCG 1GKSA 2KIKA 2OTJP 1SQBE 4NFGB 351CA 4WVZA 1CTJA 3HD7A 4PV1B 1QL4A 2ZT9C 1PGJA 1IQCA 1PIXA 4IFDK 2C1UA 2R44A 1DX7A 1C75A 2OGUA 3B5NB 1CSUA 3L73E 3L73J 1MUUA 2N9YB 5CJ4A 451CA 3H1LJ 2D0SA 2B89A 2AI5A 3CWBG 1GW4A 3H1JE 2N1TC 4W7YA 2IZ0A 2KYVA 3TK1A 1AOFA 4OH8B 4EDFA 3BATA 2O1JA 3GW6A 5AW7B 1T8ZA 3KZIH 1LTTC 1JEKA 3AEFC 1S5LV 1N7SC 1NNOA 1P84H 3FWLA 3A0HH 4J20A 2OYHC 1N86A 1GDVA 1HCMA 1GD2E 3R2PA 1GMJA 2D2CD 1L0LE 1L0LJ 1QL3A 3MK7C 4MU8A 1M60A 1NKNA 1YYCA 5CHXA 5GTIE 1W5CT 3JCUE 1KC8Q 2YO3A 3CYTI 5KJ7A 2A45G 5BU5A 1NGMB 1GK4A 1KYOE 1NTKE 5AW5B 1K9MQ 2YO2A 3SFEC 1BDDA 1NTKJ 4FANA 3L72G 2L91A 4U7JA 4XA4A 3AEBC 1F1CA 2KP8A 1SVFA 2HV4A 1SQXK 3K5BA 3G4SP 4QMAA 1X79B 1K8AQ 1LT9A 5AVSB 1NH4A 3L75G 3HE5A 1L0NJ
chains in the Genus database with same CATH topology
3RMZA 1HROA 1CYCA 1RZ5A 3CU4A 3L74D 5TJHA 2OZ1A 2ORLA 1YEBA 1BCCD 2CE1A 2C9XB 3TDKA 3JBTB 3CP5A 1CIHA 1K3GA 3ZIYA 5B5EV 1C2NA 155CA 1BE3D 1I6DA 1CYIA 2C1VA 1A8CA 1KX7A 1IRVA 4RSZA 1RZ6A 2C2CA 5CIDB 1YCCA 2O3JA 4UB8V 3O1YA 1CSWA 1H31B 1BL9A 1EB7A 3SXTA 4PD4D 5DF5A 1AYGA 2PACA 2JWAA 2PCBB 1IZL0 3C2CA 2B12B 4UB6V 1CEDA 3ZOYA 3L73D 2N18C 1H33A 3H1LD 1I8PA 5DJQB 3PLNA 1QKSA 1HJ4A 2YCCA 4O1WA 4FA5A 3PXTA 4L3HA 1RAQA 1I54A 3A0BV 3PH2B 1YICA 3WC8A 2FYUD 1NIRA 4FA1A 1BGYD 1N90A 4GEDB 3NBSA 2RN0A 4WQBA 5CIHB 3BCCD 1A2SA 1CXAA 2BGVX 2YK3A 2D0WA 1LC2A 1WEJF 3PXWA 2L4DA 1DT1A 2VHDA 1CTYA 3OCDA 2PCCB 4JCGA 3NBTA 5EXQA 5CIBB 3WU2V 1L0LD 4AX3A 1H32A 2KNCB 3OA8A 1AKKA 1DIIC 5B6QA 1CIGA 2B11B 1CYJA 3H1ID 1I8OA 3NWVA 3O5CA 2V08A 3PXSA 2MTAC 1HZVA 1P84D 1SQPD 3WFBC 4K3IA 3SWSA 3L4MA 1CSVA 3TGUD 4L1QA 2N9IA 1I55A 3WUIA 1C7MA 1J3SA 1W2LA 1KB0A 1KYOD 1NTKD 3RN0A 3ITKA 5KLVD 1C52A 1GU2A 4IL6V 4EIEA 1CXCA 2IBZD 3L71D 1DIQC 1F1FA 1FI9A 4WQCA 1CRJA 1L0ND 1HRCA 1HH7A 1M70A 2B4ZA 3ORVA 2Y0EA 4N0KA 2CE0A 2GC7D 2FRCA 1DW1A 5IY51 1GIWA 1YNRA 1KX2A 2BCCD 1E29A 1LFMA 3VNWA 1CSXA 3TYIA 1DVHA 1FCDC 5GTHV 1QYZA 2JTIB 1C6SA 2Y0CA 1A56A 4XXLA 3M97X 4QAOA 2QG4A 3SJLA 2CA3B 2N3YA 2C1DA 4O1QA 4D6TD 2DGEA 1AOQA 2C8SA 3H1KD 3O0RC 2ZZS1 5DFSA 1SQBD 2LITA 2OZ1B 1L9JC 5CIFB 2YIUB 1M6ZA 1CHHA 1DVVA 3L70D 1N50A 1K3HA 3TF5A 1N15A 2ZONG 1CHJA 2AXTV 3VRDA 4A7PA 1DW3A 1WVEC 2GIWA 5H2FV 5AURA 2B0ZB 4H0KA 3A9FA 1CTZA 1LC1A 1FJ0A 4WQ8A 1C6OA 1CHIA 5KLIB 2C1DB 3H1JD 4DY9A 4V2KA 3RLMA 1EZVD 4FA9A 3HQ9A 3VMAA 4P4QB 3RN1A 1YFCA 1OAEA 2A06D 1FI7A 3H1HD 1IO3A 2BLFB 1IRWA 1FHBA 4YE1A 1MZ4A 5DJQC 4PWAA 1HZUA 1H33B 3DP5A 5B66V 1E2RA 5CIEB 1LS9A 1FOCA 1CIFA 5CICB 1U74B 5KAFV 3L4OA 3VYMA 2N9JA 2CXBA 4FAVA 3L72D 1YTCA 1LMSA 1H9YA 1CRGA 3MK7B 3HQ8A 1JDLA 3KZIV 1U75B 3L75D 1H1OA 1B7VA 1NMIA 4EICA 2Y0DA 2K9JB 1NU1D 2DVHA 1YEAA 2RMZA 2CA4B 3ZOOA 2QJPB 3A0HV 4AAOA 4AALA 3OCDB 4U3FD 2GC4D 3PTZA 3PHLA 3GG2A 4GYDA 4Q5PA 1H32B 1PPJD 3OA8B 1NTMD 2LIRA 1HJ3A 1I6EA 3CX5D 1CIEA 5TISV 4WQEA 1CRYA 2FYNB 3HQ7A 2GB8B 4FB1A 1CORA 2N3BA 1HJ5A 4WQ7A 3DMIA 1SQVD 4PW9B 1SQQD 1MG3D 1DW0A 1MG2D 5KAIV 2V07A 4XYDB 1KV9A 1CRCA 4AAMA 4WQAA 2JQRA 3CXHD 1NTZD 2FWLA 4EIFA 3CWBD 1L9BC 5C0ZA 3PRJA 1KYOW 1ZRTD 4LJIA 2ZXYA 3KHUA 2YQBA 4WQDA 3ZCFA 2BH5X 4WQ9A 2MHMA 2B10B 2N18B 3ZOXA 1C2RA 1PP9D 3DR0A 4KMGA 1QN2A 4L3GA 3CX5W 3ZOWA 1GKSA 1S6VB 4NFGB 351CA 1CTJA 1NMLA 1OCDA 1CC5A 1QL4A 1IQCA 2C1UA 1C75A 2EXVA 3O20A 5KKZB 3WFEC 1CSUA 1ETPA 2N9YB 451CA 1CNOA 2QJKB 2D0SA 1GQ1A 2ZBOA 2I8FA 5CIGB 2AI5A 3X39A 1N9CA 1AOFA 3CXHW 4EDFA 3SLEA 3GW6A 3HQ6A 4FA4A 1GJQA 1R0QA 3WFCC 1S5LV 1NNOA 1KB9D 1FI3A 3FWLA 4AANA 1COTA 3WFDC 1DW2A 4J20A 5E79V 1GDVA 1HCMA 1I5TA 5GTIV 1CCHA 4PJ0V 3ZBMA 1CRIA 1E8EA 1QL3A 3MK7C 4MU8A 1M60A 5C9MA 1RAPA 1W5CT 3CYTI 1CO6A 4Y5RA 2KS1A 2QJYB 1SQXD 5CYTR 2ZOOA 2Q3EA 2BCNB 1CRHA 4EIDA 1CCRA 1YIQA 4RJTA 4FANA 2L91A 4H0JA 2AIUA 1C6RA 1F1CA 1H9XA 2HV4A 3SVWA 2XTSB 1ZZHA 2BPBB 1VYDA 1KIBA 1H31A 2BH4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMZ A;  1HRO A;  1CYC A;  1RZ5 A;  3CU4 A;  3L74 D;  5TJH A;  2OZ1 A;  2ORL A;  1YEB A;  1BCC D;  2CE1 A;  2C9X B;  3TDK A;  3JBT B;  3CP5 A;  1CIH A;  1K3G A;  3ZIY A;  5B5E V;  1C2N A;  155C A;  1BE3 D;  1I6D A;  1CYI A;  2C1V A;  1A8C A;  1KX7 A;  1IRV A;  4RSZ A;  1RZ6 A;  2C2C A;  5CID B;  1YCC A;  2O3J A;  4UB8 V;  3O1Y A;  1CSW A;  1H31 B;  1BL9 A;  1EB7 A;  3SXT A;  4PD4 D;  5DF5 A;  1AYG A;  2PAC A;  2JWA A;  2PCB B;  1IZL 0;  3C2C A;  2B12 B;  4UB6 V;  1CED A;  3ZOY A;  3L73 D;  2N18 C;  1H33 A;  3H1L D;  1I8P A;  5DJQ B;  3PLN A;  1QKS A;  1HJ4 A;  2YCC A;  4O1W A;  4FA5 A;  3PXT A;  4L3H A;  1RAQ A;  1I54 A;  3A0B V;  3PH2 B;  1YIC A;  3WC8 A;  2FYU D;  1NIR A;  4FA1 A;  1BGY D;  1N90 A;  4GED B;  3NBS A;  2RN0 A;  4WQB A;  5CIH B;  3BCC D;  1A2S A;  1CXA A;  2BGV X;  2YK3 A;  2D0W A;  1LC2 A;  1WEJ F;  3PXW A;  2L4D A;  1DT1 A;  2VHD A;  1CTY A;  3OCD A;  2PCC B;  4JCG A;  3NBT A;  5EXQ A;  5CIB B;  3WU2 V;  1L0L D;  4AX3 A;  1H32 A;  2KNC B;  3OA8 A;  1AKK A;  1DII C;  5B6Q A;  1CIG A;  2B11 B;  1CYJ A;  3H1I D;  1I8O A;  3NWV A;  3O5C A;  2V08 A;  3PXS A;  2MTA C;  1HZV A;  1P84 D;  1SQP D;  3WFB C;  4K3I A;  3SWS A;  3L4M A;  1CSV A;  3TGU D;  4L1Q A;  2N9I A;  1I55 A;  3WUI A;  1C7M A;  1J3S A;  1W2L A;  1KB0 A;  1KYO D;  1NTK D;  3RN0 A;  3ITK A;  5KLV D;  1C52 A;  1GU2 A;  4IL6 V;  4EIE A;  1CXC A;  2IBZ D;  3L71 D;  1DIQ C;  1F1F A;  1FI9 A;  4WQC A;  1CRJ A;  1L0N D;  1HRC A;  1HH7 A;  1M70 A;  2B4Z A;  3ORV A;  2Y0E A;  4N0K A;  2CE0 A;  2GC7 D;  2FRC A;  1DW1 A;  5IY5 1;  1GIW A;  1YNR A;  1KX2 A;  2BCC D;  1E29 A;  1LFM A;  3VNW A;  1CSX A;  3TYI A;  1DVH A;  1FCD C;  5GTH V;  1QYZ A;  2JTI B;  1C6S A;  2Y0C A;  1A56 A;  4XXL A;  3M97 X;  4QAO A;  2QG4 A;  3SJL A;  2CA3 B;  2N3Y A;  2C1D A;  4O1Q A;  4D6T D;  2DGE A;  1AOQ A;  2C8S A;  3H1K D;  3O0R C;  2ZZS 1;  5DFS A;  1SQB D;  2LIT A;  2OZ1 B;  1L9J C;  5CIF B;  2YIU B;  1M6Z A;  1CHH A;  1DVV A;  3L70 D;  1N50 A;  1K3H A;  3TF5 A;  1N15 A;  2ZON G;  1CHJ A;  2AXT V;  3VRD A;  4A7P A;  1DW3 A;  1WVE C;  2GIW A;  5H2F V;  5AUR A;  2B0Z B;  4H0K A;  3A9F A;  1CTZ A;  1LC1 A;  1FJ0 A;  4WQ8 A;  1C6O A;  1CHI A;  5KLI B;  2C1D B;  3H1J D;  4DY9 A;  4V2K A;  3RLM A;  1EZV D;  4FA9 A;  3HQ9 A;  3VMA A;  4P4Q B;  3RN1 A;  1YFC A;  1OAE A;  2A06 D;  1FI7 A;  3H1H D;  1IO3 A;  2BLF B;  1IRW A;  1FHB A;  4YE1 A;  1MZ4 A;  5DJQ C;  4PWA A;  1HZU A;  1H33 B;  3DP5 A;  5B66 V;  1E2R A;  5CIE B;  1LS9 A;  1FOC A;  1CIF A;  5CIC B;  1U74 B;  5KAF V;  3L4O A;  3VYM A;  2N9J A;  2CXB A;  4FAV A;  3L72 D;  1YTC A;  1LMS A;  1H9Y A;  1CRG A;  3MK7 B;  3HQ8 A;  1JDL A;  3KZI V;  1U75 B;  3L75 D;  1H1O A;  1B7V A;  1NMI A;  4EIC A;  2Y0D A;  2K9J B;  1NU1 D;  2DVH A;  1YEA A;  2RMZ A;  2CA4 B;  3ZOO A;  2QJP B;  3A0H V;  4AAO A;  4AAL A;  3OCD B;  4U3F D;  2GC4 D;  3PTZ A;  3PHL A;  3GG2 A;  4GYD A;  4Q5P A;  1H32 B;  1PPJ D;  3OA8 B;  1NTM D;  2LIR A;  1HJ3 A;  1I6E A;  3CX5 D;  1CIE A;  5TIS V;  4WQE A;  1CRY A;  2FYN B;  3HQ7 A;  2GB8 B;  4FB1 A;  1COR A;  2N3B A;  1HJ5 A;  4WQ7 A;  3DMI A;  1SQV D;  4PW9 B;  1SQQ D;  1MG3 D;  1DW0 A;  1MG2 D;  5KAI V;  2V07 A;  4XYD B;  1KV9 A;  1CRC A;  4AAM A;  4WQA A;  2JQR A;  3CXH D;  1NTZ D;  2FWL A;  4EIF A;  3CWB D;  1L9B C;  5C0Z A;  3PRJ A;  1KYO W;  1ZRT D;  4LJI A;  2ZXY A;  3KHU A;  2YQB A;  4WQD A;  3ZCF A;  2BH5 X;  4WQ9 A;  2MHM A;  2B10 B;  2N18 B;  3ZOX A;  1C2R A;  1PP9 D;  3DR0 A;  4KMG A;  1QN2 A;  4L3G A;  3CX5 W;  3ZOW A;  1GKS A;  1S6V B;  4NFG B;  351C A;  1CTJ A;  1NML A;  1OCD A;  1CC5 A;  1QL4 A;  1IQC A;  2C1U A;  1C75 A;  2EXV A;  3O20 A;  5KKZ B;  3WFE C;  1CSU A;  1ETP A;  2N9Y B;  451C A;  1CNO A;  2QJK B;  2D0S A;  1GQ1 A;  2ZBO A;  2I8F A;  5CIG B;  2AI5 A;  3X39 A;  1N9C A;  1AOF A;  3CXH W;  4EDF A;  3SLE A;  3GW6 A;  3HQ6 A;  4FA4 A;  1GJQ A;  1R0Q A;  3WFC C;  1S5L V;  1NNO A;  1KB9 D;  1FI3 A;  3FWL A;  4AAN A;  1COT A;  3WFD C;  1DW2 A;  4J20 A;  5E79 V;  1GDV A;  1HCM A;  1I5T A;  5GTI V;  1CCH A;  4PJ0 V;  3ZBM A;  1CRI A;  1E8E A;  1QL3 A;  3MK7 C;  4MU8 A;  1M60 A;  5C9M A;  1RAP A;  1W5C T;  3CYT I;  1CO6 A;  4Y5R A;  2KS1 A;  2QJY B;  1SQX D;  5CYT R;  2ZOO A;  2Q3E A;  2BCN B;  1CRH A;  4EID A;  1CCR A;  1YIQ A;  4RJT A;  4FAN A;  2L91 A;  4H0J A;  2AIU A;  1C6R A;  1F1C A;  1H9X A;  2HV4 A;  3SVW A;  2XTS B;  1ZZH A;  2BPB B;  1VYD A;  1KIB A;  1H31 A;  2BH4 X; 
#chains in the Genus database with same CATH topology
 1NU1 G;  1CYC A;  3N7N A;  2KLV A;  1T2K C;  1IO4 A;  3BVH A;  5TJH A;  3V2P A;  3RL0 C;  2AXC A;  3U1A A;  1YHQ P;  3S4R A;  1CIH A;  2Z5H A;  1KB9 I;  2UWJ E;  1K3G A;  3AE8 C;  3ZIY A;  1C2N A;  4RES B;  1BE3 D;  3MUD A;  1CYI A;  2C1V A;  4XE5 B;  3IAO A;  1RZ6 A;  4YPC A;  1NTZ K;  1XTC C;  3O1Y A;  1YJN P;  1CSW A;  1H31 B;  1Q90 D;  1BL9 A;  5CJ0 A;  1NTZ E;  3T97 A;  3HUS A;  1AYG A;  3V5B A;  1H8A A;  1ZRT E;  1IZL 0;  3BRT B;  3RK3 D;  3S1K A;  5CCH A;  2OAR A;  2ZT9 B;  1SQQ G;  1CED A;  3O6Q B;  1OFC X;  2ZVO B;  1PZQ A;  1JY3 P;  1I8P A;  3FWN A;  2G3A A;  1HJ4 A;  3M0A A;  2Q1K A;  1I54 A;  1DIP A;  1EDI A;  4IFM A;  1NIR A;  3AEA C;  5AVY B;  5CIH B;  3BCC D;  1A2S A;  3RK2 D;  2BGV X;  1LC2 A;  2A06 E;  1PP9 G;  3H1H J;  4JBZ A;  5E79 H;  2QJK C;  2FFD C;  4H44 B;  1Y9B A;  1CTY A;  1VQ4 P;  3I55 P;  2R5B A;  1AKK A;  2B11 B;  3H1I D;  1KZU B;  4PJ0 E;  1KFM A;  3CCV P;  1I55 A;  1C7M A;  2IYP A;  3LW5 H;  1LTJ A;  1JCC A;  4H13 B;  3I56 P;  1JY2 O;  1GU2 A;  2N9B A;  4IL6 V;  2G8Y A;  3B5N D;  3CCQ P;  2WIT A;  5BVZ A;  1PPJ E;  3CMA P;  1NTM E;  1YQ4 C;  3EFF K;  5APT A;  1FU1 A;  1NTM J;  2B4Z A;  2HOD B;  1FZC C;  2FRC A;  3M06 A;  3JC2 2;  1LFM A;  5B5E H;  2WSF H;  2B88 A;  3TYI A;  3CXH H;  1FCD C;  5GTH V;  5CCH D;  2QIW A;  1RF1 A;  1YIT P;  4UB8 H;  2QEX P;  1PV3 A;  2CA3 B;  1N73 A;  1SLQ A;  3WMM 0;  2ZVN B;  1MFZ A;  4HYT B;  3H1K D;  3O0R C;  1SQB D;  2LIT A;  2OZ1 B;  1SFC A;  2B9B A;  1M6Z A;  1CHH A;  1KYO I;  1UII A;  1CHJ A;  3VRD A;  5H2F V;  1YBK A;  1LT1 A;  4H0K A;  5L8R J;  1LC1 A;  2BAS A;  1BCC G;  3OJA B;  3H1J D;  3KXD A;  4V2K A;  2XND H;  4P4Q B;  1KOR A;  4YTP C;  1JMB A;  4Y99 B;  2M0B A;  2SPZ A;  5K5G B;  2BLF B;  5AW9 B;  3S9O A;  3MTU E;  1FHB A;  5DJQ C;  3WU2 H;  1IJD B;  4PWA A;  4OGQ B;  1H33 B;  1E2R A;  5AVT B;  1FOC A;  5AW3 B;  1M1J B;  1Y8A A;  1S9K E;  4FAV A;  1MFT A;  1GTW A;  4BRY B;  1CSB A;  1LMS A;  2P7J A;  3HD7 C;  4N3Y B;  3L73 G;  3GF7 A;  3H1L G;  1U75 B;  4WY4 A;  1H1O A;  1R5L A;  4EI2 A;  2KZI A;  3PP5 A;  1LNQ A;  3VMY A;  1K73 Q;  1WMK A;  2ZT9 D;  3PHL A;  1SQP K;  3B71 A;  2LIR A;  2IYO A;  3BRV B;  3A0H E;  3CCU P;  1EZV I;  1Z56 A;  2OYO A;  5KLV K;  2KOG A;  2XZR A;  1JY2 P;  2N1T D;  5KLV E;  1L0L G;  3HQ7 A;  2IDB A;  4I2L C;  2HLO A;  3L71 E;  1FBM A;  2K1A A;  1LP1 B;  3Q5P A;  3CME P;  1N7S D;  1FDI A;  2OTL P;  1MG2 D;  1CRC A;  2E74 C;  2WSS H;  3C9I A;  4AAM A;  5KJ7 C;  1NTK G;  1NTZ D;  2JP3 A;  5C0Z A;  4L73 A;  1ZRT D;  2ZXY A;  1T6A A;  3KHU A;  2D2C B;  2B87 A;  4PD4 H;  3HTK B;  2YQB A;  3II6 A;  4WQD A;  1L0N G;  2ZYG A;  1BE3 J;  4ZMD A;  4WQ9 A;  1J1E C;  2NPS A;  1C2R A;  1LT9 C;  3IR9 A;  4D6T E;  1VQ5 P;  3B8E B;  1R5S A;  2OYI A;  3ZOW A;  3CX5 I;  3AE6 C;  4GKG A;  5KKZ B;  3MUD C;  1USE A;  5B66 H;  4L74 A;  4C7R A;  1N7L A;  5AW2 B;  1VL2 A;  2IFN A;  1LTA C;  4GDO A;  3RL0 D;  4W80 A;  1N9C A;  4JQ0 D;  3CXH W;  1FDM A;  3HUS C;  3WUU A;  5APV A;  2ZAE B;  3BCC E;  1SP4 A;  2XNX A;  5CCH C;  3WFC C;  3BCC J;  4GIF A;  4AAN A;  2JR8 A;  3WFD C;  1I5T A;  5AVU B;  3Q3D A;  1CCH A;  4PJ0 V;  1EZV G;  4YXW H;  2VRS A;  5C39 A;  1E8E A;  2RKL A;  4H0L C;  3L37 A;  2A06 G;  5E79 E;  3H1H G;  3H1I J;  3RK3 B;  4Y5R A;  2KS1 A;  1EXI A;  2GUS A;  1QEX A;  1IFJ A;  1DD3 A;  2QJP C;  2E5T A;  1JCD A;  3G9R A;  4EID A;  2M5A B;  2IFM A;  1CCR A;  1YIQ A;  4U3F E;  4YXD C;  4RJT A;  1FZF A;  2ITA A;  4U3F J;  1OVR A;  1C6R A;  1NJI Q;  1T3J A;  1JTH B;  1NHL A;  5KAI H;  5AVR B;  3D71 A;  3TYY A;  2XTS B;  2BPB B;  1BDC A;  2PP6 A;  1AQ5 A;  3VP8 A;  1S72 P;  1RZ5 A;  1SS1 A;  3QH9 A;  3C8V A;  2FYN C;  1LTJ C;  1KTM A;  1SQV K;  4JYC A;  4ZNC A;  4WBA A;  3NFQ A;  155C A;  1PPJ G;  1NTM G;  1U57 A;  2PFX A;  1KX7 A;  2AXT H;  1IRV A;  4RSZ A;  1VDF A;  3AE9 C;  5CBN A;  3WUT A;  1J1E B;  3CLQ A;  3CXH E;  1E79 H;  1VQL P;  1JNM A;  3H1K E;  4ZKP A;  2PAC A;  3H1K J;  4UB8 E;  1SQB J;  2KB7 P;  3IN6 A;  3GHG A;  3ZOY A;  1IFN A;  4RKU J;  1RF1 C;  2PGD A;  2J5U A;  1KIL A;  3PLN A;  5KAF H;  4O1W A;  4FA5 A;  1N73 C;  4L3H A;  4KHX A;  2WT7 A;  2A45 H;  3FXE A;  3JSV C;  3H1J J;  1S9K D;  4FA1 A;  3T97 B;  1BGY D;  3HUS B;  2E75 C;  4GOD A;  4WQB A;  2C0W A;  1S5L H;  3U59 A;  1SFC C;  1CXA A;  2YK3 A;  1AFO A;  1QGK B;  1OW6 A;  1VPC A;  2O01 J;  1JMM A;  3CCJ P;  2L4D A;  2QSI A;  1DT1 A;  1IC2 A;  4I7Z C;  1VQ6 P;  1G2C A;  4JCG A;  3NTN A;  5EXQ A;  5CIB B;  5APS A;  1KV4 A;  4DJG A;  1H32 A;  2KNC B;  3OA8 A;  2E5Y A;  2O1K A;  2YXQ B;  3NWV A;  3O5C A;  1M7L A;  1FC2 C;  4H0L B;  3V4W A;  3PXS A;  1P84 D;  1EDJ A;  3AEC C;  1SQP D;  3W68 A;  1CSV A;  1H0T A;  4L1Q A;  2N9I A;  2AEF A;  3WUI A;  3P7K A;  3H32 B;  5KLV D;  3VMZ A;  4DOJ A;  4W7Z A;  2W27 A;  4EIE A;  3L71 D;  3VYI A;  3A5T A;  2Q6Q A;  4WQC A;  1CRJ A;  1HRC A;  2FKW B;  1HH7 A;  5AVZ B;  1H89 A;  5AVX B;  1SQX E;  4WY4 C;  2GC7 D;  2HG5 D;  1DW1 A;  5IY5 1;  1UIX A;  1YNR A;  1E29 A;  3VNW A;  1LTJ B;  3IFM A;  1DVH A;  2ZYA A;  3CC7 P;  1W2B O;  1C6S A;  3HD7 D;  2QM7 A;  1A56 A;  4QAO A;  2QG4 A;  1LTG C;  1VF5 C;  4GOE A;  1URQ A;  1J1D C;  4O1Q A;  4D6T D;  3L74 E;  1L2P A;  1AOQ A;  1U7J A;  2LKM A;  5DFS A;  1NTZ J;  1DH3 A;  2ZJS E;  3TNU B;  3CC4 P;  2AEJ A;  1DVV A;  2V7Q J;  3L70 D;  1MV8 A;  1K3H A;  1M8O B;  3TF5 A;  3WUV A;  1N15 A;  4A7P A;  1WVE C;  5AUR A;  2B0Z B;  3MP7 B;  4C7N B;  4WQ8 A;  1OVV A;  3AEE C;  4M3L A;  1C6O A;  1L4A A;  4O9B A;  1N73 B;  1CHI A;  1YIJ P;  4DY9 A;  1GL2 A;  1J2J B;  3RLM A;  2N1T B;  1BSH A;  1KD1 Q;  1NVO A;  3D6Z A;  1BE3 G;  2E75 B;  1YFC A;  5CCG A;  3RL0 g;  2E74 D;  5KJ7 D;  1N7S B;  1FZG A;  5M1B A;  3MIW A;  2NPS C;  3CC2 P;  3DP5 A;  2HYN A;  2FYU K;  4I7Z B;  1KB9 H;  4WWI A;  5CIC B;  2OYI C;  3CCR P;  2OYH B;  3VYM A;  2FYU E;  5APX A;  5B66 E;  1H9Y A;  1CRG A;  3MK7 B;  3VOP A;  1Q2N A;  3HQ8 A;  1NMI A;  1KQG B;  2WSC H;  2K9J B;  1HJ0 A;  3CCE P;  2DVH A;  1YEA A;  3ZOO A;  4IL6 H;  4AAL A;  1IK9 A;  3OCD B;  4U3F D;  1QLE D;  2H43 A;  2Z4E A;  3RBX A;  3BCC G;  4GYD A;  3AE1 C;  3KQG A;  3PH0 A;  2QJY C;  1URQ D;  3D6Y A;  5TIS V;  3EWK A;  4MN4 C;  1HTL C;  4WQE A;  2WPR A;  5GTH H;  2W90 A;  4KJM A;  1M1K Q;  4FB1 A;  1COR A;  3RL0 B;  2H7H A;  1JUN A;  5AW4 B;  3H1I G;  2IBZ E;  1HJ5 A;  1RE3 A;  2POH A;  1SQV D;  4PW9 B;  3AEG C;  2BEZ F;  4GT1 A;  1MG3 D;  4JF7 A;  2BEQ D;  3G71 P;  3KYQ A;  1KV9 A;  4WQA A;  3CXH D;  1FJP A;  2FWL A;  4U3F G;  1GL2 D;  1LTS C;  3M91 A;  4H0L D;  5KAI E;  3O6Q A;  4UB6 H;  3FX0 A;  3AE3 C;  4CPG A;  2PRR A;  5H2F H;  3E1R A;  3IF4 A;  3CCS P;  1HF9 A;  2JO1 A;  2B10 B;  3ZOX A;  1JO5 A;  4KMG A;  3A0B H;  3MHV A;  1KMI Z;  2WSE J;  3Q5R A;  3Q1M A;  1S6V B;  1IZN B;  3F5H A;  1NOH A;  2YIU C;  2AXT E;  2P1J A;  1GW3 A;  1OCD A;  4DCK A;  2ZFC A;  3LIE A;  2EXV A;  3O20 A;  3WFE C;  2Q7C A;  1M90 Q;  5DJU B;  2FFD B;  2QJK B;  3EQ2 A;  5KLI C;  2ZBO A;  1X0T A;  2I8F A;  5CIG B;  3H1K G;  1RQV A;  1CW5 A;  2W83 C;  1SQB G;  3AE2 C;  2OYI B;  2L5G B;  1IK7 A;  1H88 A;  3SLE A;  1BGY E;  4FA4 A;  1GJQ A;  1BGY J;  4LGD E;  1R0Q A;  2H8P D;  1ZXG A;  3GHG C;  5KAF E;  3JCU H;  4ASV A;  1AV1 A;  1COT A;  2YKP A;  2Q3I A;  1DW2 A;  3OW2 O;  1YJ9 P;  4AQR D;  1KIL C;  3P32 A;  3H1J G;  1ZLL A;  5GTI V;  2JWD A;  3KZI E;  1KYO H;  3M9H A;  2CPB A;  1BSN A;  1OWA A;  1S4X A;  2HOD A;  1P84 E;  1RAP A;  1NU1 K;  1SQP E;  1CO6 A;  4HJG H;  2KI7 B;  2Z5I A;  1K05 A;  2QJY B;  1SQP J;  2XV5 A;  1SQX D;  1ZP0 C;  2ZOO A;  2Q3E A;  2BCN B;  1FZC B;  1EQ7 A;  1ZV8 A;  1NAF A;  3VP9 A;  2E75 D;  5KLV J;  1SFC D;  2HFE D;  3M9Q A;  5DJT B;  2H88 C;  2AIU A;  2E43 A;  1H9X A;  3SVW A;  3L71 J;  1HGV A;  4N6J A;  3RMZ A;  3CU4 A;  4AUW A;  3L74 D;  4N78 E;  2OZ1 A;  1NWQ A;  2C9X B;  2J58 A;  3JBT B;  2ZYD A;  2XU6 A;  3CP5 A;  1SQQ K;  1AJY A;  3VTP C;  1Q7Y Q;  3HE4 B;  4EIJ A;  5EFW B;  2C2C A;  2K37 A;  5CID B;  1YCC A;  3D0W A;  2O3J A;  1KIL E;  3V6I A;  2O01 N;  1EB7 A;  3SXT A;  1N8R Q;  4D6T J;  2LXB A;  4IL6 X;  3V2Q A;  4PD4 D;  3CI9 A;  1AVY A;  2JWA A;  1HBW A;  2PCB B;  1LWU A;  1S2E A;  2B12 B;  1Q86 Q;  3L70 E;  1T3U A;  2N18 C;  1H33 A;  3L70 J;  4WY4 D;  1CI6 A;  1PP9 E;  1M1J A;  2HPC A;  5DJQ B;  1URQ C;  1QKS A;  1NTZ G;  3PXT A;  5AW1 B;  3A7O A;  1YJW P;  4BRY A;  3L36 A;  4L75 A;  1YIC A;  2FYU D;  4PV1 C;  3MZW B;  1N90 A;  2R5D A;  3NBS A;  3AE4 C;  1VF5 D;  2D0W A;  4NPD A;  1NYH A;  3HD7 B;  3F89 A;  2M3B A;  3GHG B;  5APY A;  3PXW A;  1TU3 F;  2VHD A;  1NAY A;  2PCC B;  4PJ0 H;  2FBW C;  1L4A C;  4AX3 A;  5B6Q A;  1CIG A;  1GL2 C;  1CYJ A;  1I8O A;  1K04 A;  1PGP A;  2YMY A;  2Y9Z A;  2KSJ A;  3SWS A;  5CCG C;  1JY3 N;  1KB9 E;  1GU4 A;  3AED C;  1J3S A;  2P2U A;  2W6B A;  3ITK A;  3CX5 H;  4BWN A;  1C52 A;  1G2C B;  2YXR B;  2IBZ D;  1F1F A;  1FI9 A;  2KLU A;  3M9B A;  1ZW0 A;  1M70 A;  2NPS D;  3PJS K;  1EXJ A;  1LTI C;  1Y47 A;  2K88 A;  2Y0E A;  4N0K A;  2CE0 A;  3LW5 J;  4TLF A;  3U1C A;  4EOT A;  2E74 B;  1GIW A;  3CCM P;  2BCC D;  2NRG A;  4HH2 A;  1JOC A;  1HVV A;  1HWT C;  1CSX A;  2E76 D;  1ZR2 A;  2ZXE B;  1QYZ A;  2Y0C A;  1GK6 A;  2CPS A;  3M0D A;  1SQV E;  4XXL A;  1DEB A;  1SQV J;  1LJ2 A;  2YKO A;  1MZ9 A;  2Q9I A;  2WTY A;  2R3S A;  3KPE A;  2C1D A;  5B5E E;  1LT9 B;  1EDK A;  1BCC E;  2C8S A;  1P84 I;  2WSF J;  3HE5 B;  2ZZS 1;  2LR2 A;  4KT0 J;  1GZL A;  2NZ2 A;  1QVG O;  1HH0 A;  2WPS A;  2WVR A;  1RE3 C;  2ZON G;  1RF0 A;  3LID A;  2WMM A;  2AXT V;  2GIW A;  1SQB K;  1CTZ A;  1FJ0 A;  5APW A;  1USD A;  4RO0 A;  1KQL A;  1URQ B;  4UB6 E;  3GF3 A;  1OW8 A;  5H2F E;  3HQ9 A;  3L4F A;  4IOI H;  3RN1 A;  1OAE A;  3A0B E;  3H1L E;  1E5W A;  5KTB A;  3NMD A;  1RE4 A;  1MZ4 A;  2JEE A;  1HZU A;  5BU8 B;  5CIE B;  1CIF A;  5KAF V;  3L4O A;  1L4A B;  3L72 D;  1GL2 B;  3ZDM A;  1VQ7 P;  4B86 A;  1VQ8 P;  3VMX A;  5AVW B;  2WQY C;  1X9V A;  3WU2 E;  3KZI V;  1G1I A;  3L75 D;  4H44 C;  1B7V A;  3QWO C;  1L0L K;  2K3R A;  1NU1 D;  2M5A A;  3KDP B;  2QJP B;  3A0H V;  2P10 A;  2JJL A;  3V2R A;  1JTH A;  2M3E A;  2GC4 D;  1BGY G;  2KUB A;  3CCL P;  4ASW A;  4Q5P A;  1VQ9 P;  2LXC B;  2W8Z A;  3I5C A;  1JB0 J;  1M57 D;  1NTK K;  3TGU E;  2W6J H;  3P8C E;  4I1L A;  3TGU J;  3ABV C;  4H13 C;  4N78 D;  2WPV B;  1SQX J;  1CRY A;  2FYN B;  4XFJ A;  2GB8 B;  1QVF O;  2N3B A;  5AW6 B;  1L0N K;  1FJK A;  4WQ7 A;  1WT6 A;  3O8Z A;  1SQQ D;  1SQP G;  2MJZ A;  1L0N E;  4BXL A;  4IFF A;  1HJB A;  3B4S A;  3Q5S A;  1KIL D;  4DT0 A;  4HKZ H;  2JQR A;  5KLV G;  2C0X A;  3UIA A;  2M8R A;  3L74 J;  4Y28 J;  4K35 A;  1AA0 A;  3D70 A;  3L71 G;  2V4H A;  2KZJ A;  3B5N A;  3ZCF A;  1DD4 A;  2BH5 X;  1OMI A;  4GOF A;  1RF1 B;  1PP9 D;  3DR0 A;  1JY2 N;  1QN2 A;  3CX5 W;  3Q2Y A;  1OX3 A;  4PD4 E;  4C46 A;  1NML A;  5CBO A;  1CC5 A;  2IX7 C;  2WWW A;  1SFC B;  1RH5 B;  2W6A A;  1ETP A;  4D6T G;  3MD0 A;  1CNO A;  2KNC A;  1GQ1 A;  1GDT A;  1FAV A;  3NXS A;  1ZME C;  3X39 A;  2YKQ A;  1S3J A;  4R4L A;  1EZV E;  3HQ6 A;  2FYU J;  4Y99 C;  3CXH I;  3L70 G;  1LWU C;  2E76 C;  3CD6 P;  3H1H E;  1CZQ A;  3USS A;  4OGQ C;  1KB9 D;  3H32 A;  1FI3 A;  1X8Y A;  1ZN5 A;  1M1J C;  5E79 V;  3VN0 A;  2KXP B;  3ZBM A;  1GU5 A;  1CRI A;  2WPQ A;  5AW8 B;  2I8D A;  5C9M A;  1VQK P;  5AW0 B;  3AE7 C;  1IFI A;  4DZO A;  5TIS H;  3H6P A;  3E1I A;  5CYT R;  2E42 A;  4WY4 B;  1WRG A;  1CRH A;  2OQQ A;  4PV1 D;  1PGQ A;  1KQS O;  2JDI H;  2K9Y A;  1NTM K;  5CMZ A;  4H0J A;  1S5L X;  2FY8 A;  1Q81 Q;  1ZZH A;  1YTZ T;  1VYD A;  1OIP A;  1KIB A;  1VF5 B;  1H31 A;  2BH4 X;  1MKM A;  3CX5 E;  1HRO A;  1J1D B;  2ORL A;  1YEB A;  1BCC D;  1L4A D;  3GMA A;  2CE1 A;  2YNY A;  3TDK A;  2BCC E;  3TNU A;  4LC1 A;  2BCC J;  4OVN F;  4Z1M H;  5B5E V;  1I6D A;  5CCG D;  1A8C A;  2GUV A;  4C7N A;  4L76 A;  1FZB A;  4UB8 V;  1LTB C;  2YMK A;  2I1K A;  2N1T A;  3EFG A;  3CWB E;  1XTG B;  5DF5 A;  3CWB J;  2D2C C;  1SQV G;  3C2C A;  1AQT A;  4UB6 V;  1FE6 A;  1N7S A;  1YTZ I;  3L73 D;  4NPF X;  3M0D C;  2B87 B;  3H1L D;  2O01 H;  2OYH A;  1IFP A;  2QA4 P;  2NPS B;  2YCC A;  1Q82 Q;  1DEE G;  1RAQ A;  3A0B V;  1PFI A;  3PH2 B;  3WC8 A;  1FZA A;  2WZ7 A;  4GED B;  1HUC A;  2RN0 A;  1QX8 A;  5KKZ C;  1NKZ B;  1LWU B;  2E76 B;  1WEJ F;  2K9J A;  1RF0 C;  5GTI H;  1AVO A;  3OCD A;  1CI6 B;  3NBT A;  1KFN A;  3WU2 V;  1PGO A;  2HPC B;  1L0L D;  1OZH A;  1S5L E;  3CL3 D;  1DII C;  3BAS A;  3L72 E;  2V08 A;  1YI2 P;  3L72 J;  2MTA C;  1HZV A;  3FXD A;  2FXM A;  3WFB C;  4EYY Q;  4PD4 I;  4K3I A;  3L4M A;  3TGU D;  1VQP P;  3L75 E;  1FOS F;  4WB4 A;  3V2N A;  3P8C D;  1ZOY C;  1W2L A;  3L75 J;  3OA7 A;  1NU1 E;  1RE4 C;  1KB0 A;  1VQN P;  3AE5 C;  1KYO D;  1NTK D;  3RN0 A;  3GLM A;  1NU1 J;  1RQU A;  3G3Z A;  2CK3 H;  1JM0 A;  2GM4 A;  3SWY A;  2KSE A;  3SSU A;  1CXC A;  3SWF A;  2P58 A;  1DIQ C;  3RK3 C;  3V4Q A;  2I1J A;  1L0N D;  1RHZ B;  3ORV A;  2Y9Y A;  1U7M A;  3FGA D;  2R3C A;  2Q5U A;  2KS1 B;  3R4Y A;  1KX2 A;  2GA1 A;  1FOS E;  3OAK A;  2JTI B;  1W2E A;  3MGN A;  3M97 X;  1FZE A;  1IFD A;  4H44 D;  1SQQ E;  2V7Q H;  3P8M C;  3RK2 C;  3SWK A;  3SJL A;  3TGU G;  3HRN A;  1SQQ J;  1A02 F;  1SQX G;  2N3Y A;  2FXP A;  2DGE A;  1OVU A;  1VQO P;  1YQ3 C;  3N4X A;  2MKV A;  1L9J C;  5CIF B;  1NO4 A;  2YIU B;  5AVQ B;  1BE3 E;  3SFD C;  1X22 A;  1PL5 A;  2QVA A;  1R8E A;  2FYZ A;  1N50 A;  2FFD A;  3H25 A;  4JPZ B;  1DW3 A;  4H13 D;  1EDL A;  3A9F A;  2IBZ I;  3L74 G;  1PP9 J;  4NPE A;  5KLI B;  4AYC A;  2C1D B;  1VQM P;  1EZV D;  4FA9 A;  5APU A;  1A02 J;  4HB1 A;  3RK3 E;  3VMA A;  2A06 D;  1FDO A;  1FI7 A;  3B5N C;  3H1H D;  1N2D C;  2FXO A;  1IFM A;  1IO3 A;  1T2K D;  1IRW A;  3CPW O;  4YE1 A;  1QL1 A;  2AEM A;  5B66 V;  2C9L Y;  1LS9 A;  3G6E P;  1U74 B;  1KIL B;  2N9J A;  1OXZ A;  2CXB A;  1YTC A;  2JKV A;  3A2A A;  2WT7 B;  3A3Y B;  2XDJ A;  2QM8 A;  1JDL A;  2RH0 A;  3RGU A;  1FZC A;  1FS0 E;  4EIC A;  3C1L A;  2Y0D A;  2J59 M;  1M56 D;  2RMZ A;  2CA4 B;  4AAO A;  1G1J A;  4ZKU A;  2FYU G;  1W5C E;  1LP1 A;  3PTZ A;  2QE7 H;  4K3A A;  3GG2 A;  1EC5 A;  4R4M A;  1QL2 A;  3H1I E;  1H32 B;  3TSI A;  2C9N Y;  1PPJ D;  3OA8 B;  1NTM D;  1HJ3 A;  1I6E A;  1RY3 A;  1S1C X;  2WSC J;  2H89 C;  3CX5 D;  1CIE A;  4IL6 E;  3L35 A;  2XKM A;  1H0T B;  4I6M C;  1HGZ A;  2R32 A;  3HE4 A;  3HTK A;  2A45 I;  5TIS E;  3RBZ A;  3DMI A;  3E7K A;  4JYB A;  1KQF B;  4OGQ D;  1DW0 A;  3RK2 B;  4TT3 H;  5KAI V;  2V07 A;  2QRX A;  4XYD B;  5GTH E;  2IZ1 A;  2OTK E;  2WSE H;  4EIF A;  2KK7 A;  3CWB D;  2IPP A;  1BCC J;  1LGH B;  4LLH A;  1L9B C;  3PRJ A;  2P67 A;  1KYO W;  4LJI A;  2IBZ G;  2DW3 A;  2PAJ A;  3W67 A;  1OW7 A;  2ZXX A;  2MHM A;  1ZR4 A;  2N18 B;  5APQ A;  1D7M A;  5AVV B;  1KN7 A;  4L3G A;  4OWF A;  1JY3 O;  2HR3 A;  2BCC G;  1GKS A;  2KIK A;  2OTJ P;  1SQB E;  4NFG B;  351C A;  4WVZ A;  1CTJ A;  3HD7 A;  4PV1 B;  1QL4 A;  2ZT9 C;  1PGJ A;  1IQC A;  1PIX A;  4IFD K;  2C1U A;  2R44 A;  1DX7 A;  1C75 A;  2OGU A;  3B5N B;  1CSU A;  3L73 E;  3L73 J;  1MUU A;  2N9Y B;  5CJ4 A;  451C A;  3H1L J;  2D0S A;  2B89 A;  2AI5 A;  3CWB G;  1GW4 A;  3H1J E;  2N1T C;  4W7Y A;  2IZ0 A;  2KYV A;  3TK1 A;  1AOF A;  4OH8 B;  4EDF A;  3BAT A;  2O1J A;  3GW6 A;  5AW7 B;  1T8Z A;  3KZI H;  1LTT C;  1JEK A;  3AEF C;  1S5L V;  1N7S C;  1NNO A;  1P84 H;  3FWL A;  3A0H H;  4J20 A;  2OYH C;  1N86 A;  1GDV A;  1HCM A;  1GD2 E;  3R2P A;  1GMJ A;  2D2C D;  1L0L E;  1L0L J;  1QL3 A;  3MK7 C;  4MU8 A;  1M60 A;  1NKN A;  1YYC A;  5CHX A;  5GTI E;  1W5C T;  3JCU E;  1KC8 Q;  2YO3 A;  3CYT I;  5KJ7 A;  2A45 G;  5BU5 A;  1NGM B;  1GK4 A;  1KYO E;  1NTK E;  5AW5 B;  1K9M Q;  2YO2 A;  3SFE C;  1BDD A;  1NTK J;  4FAN A;  3L72 G;  2L91 A;  4U7J A;  4XA4 A;  3AEB C;  1F1C A;  2KP8 A;  1SVF A;  2HV4 A;  1SQX K;  3K5B A;  3G4S P;  4QMA A;  1X79 B;  1K8A Q;  1LT9 A;  5AVS B;  1NH4 A;  3L75 G;  3HE5 A;  1L0N J; 
#chains in the Genus database with same CATH homology
 3RMZ A;  1HRO A;  1CYC A;  1RZ5 A;  3CU4 A;  3L74 D;  5TJH A;  2OZ1 A;  2ORL A;  1YEB A;  1BCC D;  2CE1 A;  2C9X B;  3TDK A;  3JBT B;  3CP5 A;  1CIH A;  1K3G A;  3ZIY A;  5B5E V;  1C2N A;  155C A;  1BE3 D;  1I6D A;  1CYI A;  2C1V A;  1A8C A;  1KX7 A;  1IRV A;  4RSZ A;  1RZ6 A;  2C2C A;  5CID B;  1YCC A;  2O3J A;  4UB8 V;  3O1Y A;  1CSW A;  1H31 B;  1BL9 A;  1EB7 A;  3SXT A;  4PD4 D;  5DF5 A;  1AYG A;  2PAC A;  2JWA A;  2PCB B;  1IZL 0;  3C2C A;  2B12 B;  4UB6 V;  1CED A;  3ZOY A;  3L73 D;  2N18 C;  1H33 A;  3H1L D;  1I8P A;  5DJQ B;  3PLN A;  1QKS A;  1HJ4 A;  2YCC A;  4O1W A;  4FA5 A;  3PXT A;  4L3H A;  1RAQ A;  1I54 A;  3A0B V;  3PH2 B;  1YIC A;  3WC8 A;  2FYU D;  1NIR A;  4FA1 A;  1BGY D;  1N90 A;  4GED B;  3NBS A;  2RN0 A;  4WQB A;  5CIH B;  3BCC D;  1A2S A;  1CXA A;  2BGV X;  2YK3 A;  2D0W A;  1LC2 A;  1WEJ F;  3PXW A;  2L4D A;  1DT1 A;  2VHD A;  1CTY A;  3OCD A;  2PCC B;  4JCG A;  3NBT A;  5EXQ A;  5CIB B;  3WU2 V;  1L0L D;  4AX3 A;  1H32 A;  2KNC B;  3OA8 A;  1AKK A;  1DII C;  5B6Q A;  1CIG A;  2B11 B;  1CYJ A;  3H1I D;  1I8O A;  3NWV A;  3O5C A;  2V08 A;  3PXS A;  2MTA C;  1HZV A;  1P84 D;  1SQP D;  3WFB C;  4K3I A;  3SWS A;  3L4M A;  1CSV A;  3TGU D;  4L1Q A;  2N9I A;  1I55 A;  3WUI A;  1C7M A;  1J3S A;  1W2L A;  1KB0 A;  1KYO D;  1NTK D;  3RN0 A;  3ITK A;  5KLV D;  1C52 A;  1GU2 A;  4IL6 V;  4EIE A;  1CXC A;  2IBZ D;  3L71 D;  1DIQ C;  1F1F A;  1FI9 A;  4WQC A;  1CRJ A;  1L0N D;  1HRC A;  1HH7 A;  1M70 A;  2B4Z A;  3ORV A;  2Y0E A;  4N0K A;  2CE0 A;  2GC7 D;  2FRC A;  1DW1 A;  5IY5 1;  1GIW A;  1YNR A;  1KX2 A;  2BCC D;  1E29 A;  1LFM A;  3VNW A;  1CSX A;  3TYI A;  1DVH A;  1FCD C;  5GTH V;  1QYZ A;  2JTI B;  1C6S A;  2Y0C A;  1A56 A;  4XXL A;  3M97 X;  4QAO A;  2QG4 A;  3SJL A;  2CA3 B;  2N3Y A;  2C1D A;  4O1Q A;  4D6T D;  2DGE A;  1AOQ A;  2C8S A;  3H1K D;  3O0R C;  2ZZS 1;  5DFS A;  1SQB D;  2LIT A;  2OZ1 B;  1L9J C;  5CIF B;  2YIU B;  1M6Z A;  1CHH A;  1DVV A;  3L70 D;  1N50 A;  1K3H A;  3TF5 A;  1N15 A;  2ZON G;  1CHJ A;  2AXT V;  3VRD A;  4A7P A;  1DW3 A;  1WVE C;  2GIW A;  5H2F V;  5AUR A;  2B0Z B;  4H0K A;  3A9F A;  1CTZ A;  1LC1 A;  1FJ0 A;  4WQ8 A;  1C6O A;  1CHI A;  5KLI B;  2C1D B;  3H1J D;  4DY9 A;  4V2K A;  3RLM A;  1EZV D;  4FA9 A;  3HQ9 A;  3VMA A;  4P4Q B;  3RN1 A;  1YFC A;  1OAE A;  2A06 D;  1FI7 A;  3H1H D;  1IO3 A;  2BLF B;  1IRW A;  1FHB A;  4YE1 A;  1MZ4 A;  5DJQ C;  4PWA A;  1HZU A;  1H33 B;  3DP5 A;  5B66 V;  1E2R A;  5CIE B;  1LS9 A;  1FOC A;  1CIF A;  5CIC B;  1U74 B;  5KAF V;  3L4O A;  3VYM A;  2N9J A;  2CXB A;  4FAV A;  3L72 D;  1YTC A;  1LMS A;  1H9Y A;  1CRG A;  3MK7 B;  3HQ8 A;  1JDL A;  3KZI V;  1U75 B;  3L75 D;  1H1O A;  1B7V A;  1NMI A;  4EIC A;  2Y0D A;  2K9J B;  1NU1 D;  2DVH A;  1YEA A;  2RMZ A;  2CA4 B;  3ZOO A;  2QJP B;  3A0H V;  4AAO A;  4AAL A;  3OCD B;  4U3F D;  2GC4 D;  3PTZ A;  3PHL A;  3GG2 A;  4GYD A;  4Q5P A;  1H32 B;  1PPJ D;  3OA8 B;  1NTM D;  2LIR A;  1HJ3 A;  1I6E A;  3CX5 D;  1CIE A;  5TIS V;  4WQE A;  1CRY A;  2FYN B;  3HQ7 A;  2GB8 B;  4FB1 A;  1COR A;  2N3B A;  1HJ5 A;  4WQ7 A;  3DMI A;  1SQV D;  4PW9 B;  1SQQ D;  1MG3 D;  1DW0 A;  1MG2 D;  5KAI V;  2V07 A;  4XYD B;  1KV9 A;  1CRC A;  4AAM A;  4WQA A;  2JQR A;  3CXH D;  1NTZ D;  2FWL A;  4EIF A;  3CWB D;  1L9B C;  5C0Z A;  3PRJ A;  1KYO W;  1ZRT D;  4LJI A;  2ZXY A;  3KHU A;  2YQB A;  4WQD A;  3ZCF A;  2BH5 X;  4WQ9 A;  2MHM A;  2B10 B;  2N18 B;  3ZOX A;  1C2R A;  1PP9 D;  3DR0 A;  4KMG A;  1QN2 A;  4L3G A;  3CX5 W;  3ZOW A;  1GKS A;  1S6V B;  4NFG B;  351C A;  1CTJ A;  1NML A;  1OCD A;  1CC5 A;  1QL4 A;  1IQC A;  2C1U A;  1C75 A;  2EXV A;  3O20 A;  5KKZ B;  3WFE C;  1CSU A;  1ETP A;  2N9Y B;  451C A;  1CNO A;  2QJK B;  2D0S A;  1GQ1 A;  2ZBO A;  2I8F A;  5CIG B;  2AI5 A;  3X39 A;  1N9C A;  1AOF A;  3CXH W;  4EDF A;  3SLE A;  3GW6 A;  3HQ6 A;  4FA4 A;  1GJQ A;  1R0Q A;  3WFC C;  1S5L V;  1NNO A;  1KB9 D;  1FI3 A;  3FWL A;  4AAN A;  1COT A;  3WFD C;  1DW2 A;  4J20 A;  5E79 V;  1GDV A;  1HCM A;  1I5T A;  5GTI V;  1CCH A;  4PJ0 V;  3ZBM A;  1CRI A;  1E8E A;  1QL3 A;  3MK7 C;  4MU8 A;  1M60 A;  5C9M A;  1RAP A;  1W5C T;  3CYT I;  1CO6 A;  4Y5R A;  2KS1 A;  2QJY B;  1SQX D;  5CYT R;  2ZOO A;  2Q3E A;  2BCN B;  1CRH A;  4EID A;  1CCR A;  1YIQ A;  4RJT A;  4FAN A;  2L91 A;  4H0J A;  2AIU A;  1C6R A;  1F1C A;  1H9X A;  2HV4 A;  3SVW A;  2XTS B;  1ZZH A;  2BPB B;  1VYD A;  1KIB A;  1H31 A;  2BH4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...