1SQVD

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
total genus 48
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqvD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqvD02
5GTIV 1C6SA 1KB9D 1HZUA 3TYIA 3TDKA 1NNOA 4K3IA 1YEBA 1CEDA 2A06D 5EXQA 1YIQA 4J20A 1NIRA 1B7VA 3ZOOA 2PACA 5B5EV 3TGUD 3L72D 3SJLA 5TJHA 1JDLA 1L0LD 5CIDB 2EXVA 2L91A 3VNWA 3ORVA 2Y0DA 1RZ5A 1GQ1A 3PHLA 1C2NA 2QJPB 4PW9B 1GJQA 1H1OA 3L74D 4GEDB 4AALA 2IBZD 4EIFA 5B66V 4GYDA 2DVHA 4XYDB 3RLMA 3ZCFA 4JCGA 1M6ZA 2GC7D 2N9YB 3PH2B 1L9JC 3O5CA 2GB8B 1CXAA 1S5LV 1M60A 3H1KD 1L9BC 2YCCA 1C75A 1I8PA 4FA9A 1ZRTD 3DP5A 4IL6V 1CNOA 2Y0EA 1IO3A 2ZONG 1OAEA 1QN2A 1DT1A 1HJ4A 2FRCA 1KYOW 1A2SA 1LC1A 1FCDC 3OA8B 5DFSA 1RAPA 2C1DB 2YIUB 2D0SA 3SWSA 2B12B 4UB6V 3SXTA 4FB1A 1C6RA 3L4OA 1MZ4A 1MG2D 2C9XB 3KZIV 3SLEA 4AAOA 1KYOD 1E2RA 1H33B 1CORA 1VYDA 1LMSA 1CTYA 2QG4A 3RMZA 2GC4D 1KV9A 5KLIB 3GW6A 3WFEC 1SQVD 2BPBB 1CTZA 3KHUA 1W5CT 3C2CA 3OCDB 1CRGA 2C1UA 2ORLA 4RJTA 1C7MA 5KAFV 3PXSA 3NBSA 1BL9A 3ZOYA 1A8CA 4EIEA 2Y0CA 1NTKD 2C2CA 1L0ND 4QAOA 1H9YA 2JTIB 3M97X 2K9JB 2AXTV 1K3HA 1C6OA 2GIWA 5KLVD 1E8EA 3JBTB 1J3SA 1CSUA 1CCRA 4PWAA 4WQ7A 3CX5W 2DGEA 3H1JD 1IQCA 1ZZHA 1CRYA 1YICA 2N9IA 1NTZD 3L71D 2BCNB 3PTZA 2XTSB 3DMIA 4L3HA 351CA 1I6EA 2AI5A 3CP5A 2ZZS1 5CIHB 1CYCA 4PJ0V 4FANA 3FWLA 1E29A 3VYMA 1RZ6A 1DW0A 3CYTI 5GTHV 4EIDA 1GDVA 2N18C 4O1WA 1HCMA 3L4MA 1AOFA 1CC5A 4EDFA 4RSZA 1NMLA 4DY9A 3BCCD 4N0KA 2FYNB 3WFDC 1FI9A 5E79V 1DVVA 1AYGA 2YQBA 1SQXD 1LFMA 3MK7C 1QKSA 1YCCA 1FI3A 1SQQD 2KS1A 1RAQA 3HQ8A 2ZXYA 4EICA 1CYIA 5CYTR 4AAMA 2CXBA 1I55A 4Y5RA 1S6VB 451CA 1R0QA 2O3JA 1PP9D 4D6TD 4Q5PA 3L73D 3CWBD 1HJ5A 1CYJA 3CXHW 1DIIC 1KX7A 3A9FA 1H33A 1SQPD 1W2LA 2FYUD 2V08A 2BCCD 3NBTA 1MG3D 1I5TA 1AOQA 3RN1A 1F1CA 1M70A 3SVWA 2C1VA 5C0ZA 1H9XA 1U74B 2V07A 3ZOWA 3GG2A 1CSWA 3CXHD 5AURA 2BGVX 3OA8A 4FA1A 1F1FA 1AKKA 2RN0A 1CXCA 2D0WA 1H31B 2B4ZA 2CE1A 2CA3B 2FWLA 4UB8V 5KKZB 2ZOOA 3O0RC 3WFBC 2KNCB 4AANA 1BCCD 3WC8A 2JQRA 1KB0A 1GU2A 4WQCA 1CRCA 1ETPA 1N90A 3CU4A 1WEJF 4WQAA 3DR0A 2CE0A 3PXTA 1H32B 3OCDA 4L3GA 4NFGB 3L70D 1DVHA 1A56A 1CIEA 1QL3A 4YE1A 155CA 5C9MA 1K3GA 2HV4A 1IZL0 1CIFA 1WVEC 3X39A 5DJQC 1FOCA 1GKSA 3WU2V 4FA5A 2MHMA 1CIHA 1C2RA 2B11B 2ZBOA 4H0JA 1CRHA 1GIWA 1NTMD 3VMAA 4WQEA 2B10B 3ZBMA 1IRVA 4WQ8A 1BE3D 1KIBA 1CHHA 1DW1A 1HH7A 3A0BV 2PCCB 1I54A 3A0HV 1CHIA 3O1YA 1N50A 1LC2A 1P84D 2C1DA 1BGYD 1FI7A 2RMZA 3RN0A 1YEAA 2OZ1B 4WQ9A 1CSVA 3VRDA 1YNRA 1C52A 2BH4X 2YK3A 3H1LD 5B6QA 3HQ6A 2QJKB 5CIEB 1KX2A 2N3YA 2QJYB 5IY51 1FJ0A 4P4QB 3CX5D 3O20A 1CTJA 4WQBA 1NU1D 1COTA 1PPJD 3ITKA 2LITA 4A7PA 2N9JA 1CRJA 1IRWA 1EB7A 3L75D 3H1ID 4U3FD 3PLNA 1QYZA 1OCDA 1I6DA 1HJ3A 4LJIA 2PCBB 2N3BA 2BH5X 1CO6A 4MU8A 4PD4D 1U75B 4KMGA 4XXLA 1EZVD 4L1QA 2LIRA 3TF5A 5KAIV 1YTCA 1CCHA 1DW2A 2BLFB 1H31A 1LS9A 4O1QA 1N9CA 3WUIA 4FAVA 2B0ZB 1N15A 1I8OA 1CIGA 1HROA 1CRIA 1SQBD 3NWVA 2JWAA 3WFCC 3H1HD 4H0KA 3PXWA 1DIQC 1FHBA 5CIBB 1DW3A 2Q3EA 3PRJA 1HZVA 3MK7B 5DJQB 3HQ9A 1CSXA 5CIGB 2I8FA 4WQDA 5CIFB 2OZ1A 5CICB 1CHJA 1QL4A 1H32A 1HRCA 2AIUA 3ZOXA 3HQ7A 4FA4A 1NMIA 2MTAC 2L4DA 5TISV 5DF5A 4AX3A 2C8SA 4V2KA 2N18B 5H2FV 3ZIYA 2CA4B 1YFCA 2VHDA
chains in the Genus database with same CATH superfamily
1HZUA 3M0DC 1MUUA 1CEDA 2E75C 2LKMA 3BCCE 1NIRA 1VQMP 3TGUD 2MJZA 1A02J 1L0LD 1LTSC 2OQQA 2Y0DA 2WT7B 5KJ7D 2LXBA 5GTHH 2JR8A 1HTLC 1SQXE 1N2DC 1DD4A 5KLVJ 1FOSF 2DVHA 2ZT9D 3ZCFA 2GC7D 2GB8B 1CXAA 1PP9E 4I2LC 4D6TE 3RL0B 3H1KD 1C75A 4IFFA 3TGUG 1ZRTD 3DP5A 3RK3B 1N7SA 4PJ0H 3FXDA 4EOTA 2Y0EA 3HD7A 2R44A 1NTMK 1KYOW 2K37A 1FCDC 4M3LA 1FDOA 1J2JB 2YIUB 3BRVB 2P7JA 3AE3C 3CXHE 2CK3H 3H1IG 4U3FG 1GL2B 1S5LH 2Q5UA 5KAFH 1BDDA 3SLEA 3GLMA 1E2RA 1H33B 3L75J 4ZMDA 2AXCA 1CORA 1PGJA 3RMZA 3H1KG 3L73J 2AEFA 1G1JA 3H1IE 4U3FE 1NTKJ 3RK3C 5B66H 1CTZA 2ORLA 2N9BA 1C7MA 3V2PA 1NHLA 3NBSA 1QEXA 2N1TB 3Q2YA 1PGOA 2P67A 2IZ1A 2JTIB 1SQPG 2KNCA 5KAIE 1JEKA 1C6OA 1OZHA 5KLVD 3GHGA 2FBWC 3JBTB 1ZOYC 1J3SA 4ASVA 1CSUA 4PWAA 3TK1A 1QVGO 1HJ0A 5AW1B 3H1JE 1H0TB 1NTZD 2NZ2A 2XTSB 1VQ8P 2AI5A 3LW5J 3CP5A 1GK4A 3I56P 5CIHB 4FANA 1G1IA 1VQNP 1AA0A 1GL2D 3VP9A 1EZVI 3VYMA 3CYTI 1GU5A 1N7LA 4DCKA 1GDVA 3L4MA 1KILC 1AOFA 1G2CA 1U57A 3BCCG 5L8RJ 1CC5A 3RK3E 3H1JG 1ZMEC 4RSZA 3H25A 1AJYA 2JO1A 3H1LE 3A0BH 1Q81Q 2M5AA 2WSEJ 1DVVA 5TISE 3QH9A 3D6ZA 1K9MQ 1L0NG 1NU1E 2YQBA 1FJPA 1GW4A 1FE6A 1RF0A 1SQQE 1VQPP 3HUSC 1KYOH 1CYIA 4YXDC 1S6VB 1R0QA 1AQTA 1OX3A 4XFJA 5AW0B 1YQ4C 2LXCB 3AEDC 5KLIC 3CWBD 1CYJA 1DIIC 1RF1A 3NBTA 2E76D 1AOQA 1PV3A 2B87A 1UIIA 1J1EB 2A45G 4Z1MH 3KPEA 3ZOWA 3GG2A 1OFCX 4JYCA 2BGVX 1JOCA 1IO4A 1SQPK 1Y47A 1FZBA 1NKNA 4W7ZA 1AKKA 1CXCA 1W5CE 2JEEA 4AANA 4IFDK 1JY2N 1BCCD 3HTKA 5APTA 1NVOA 1IC2A 1KD1Q 2JQRA 1GU2A 1CRCA 1S72P 3CU4A 1WEJF 4K35A 2V7QJ 1EC5A 4PV1D 2E43A 4OGQC 1EDIA 2NPSA 4NPDA 1ZLLA 4HKZH 1K3GA 2HV4A 2OTLP 1IZL0 1CIFA 5AVZB 1FOCA 1IFNA 3A3YB 3WU2V 2SPZA 3B5NC 5KJ7A 4H0JA 1GIWA 3I5CA 1NTME 4WQEA 3OW2O 1LTJC 2YO2A 1S1CX 3MD0A 1JY2P 1BCCG 1GTWA 1L4AA 1VQ7P 3Q5RA 2GM4A 2RKLA 1BGYD 1FI7A 2RMZA 3RN0A 3E7KA 1YEAA 1NU1K 3IF4A 3G9RA 4BWNA 2K88A 1YHQP 1IFIA 1YJWP 2GUSA 2HYNA 4OVNF 3H32B 3Q5SA 5IY51 1FJ0A 1KYOE 5KTBA 3CX5E 2YXRB 1PPJD 2NPSD 3NXSA 2AEMA 3ITKA 1GK6A 3W67A 1USDA 1CRJA 3RL0C 1IRWA 5APQA 2J5UA 1EB7A 1WRGA 1NTKK 3PLNA 1QYZA 2KB7P 2BH5X 1RF0C 3A0BE 1A02F 2NPSC 4HJGH 1U75B 1EZVD 4L1QA 3H1HJ 1VQ9P 1DEEG 1BCCJ 1H31A 2FYUE 1LT9B 1W2BO 4FAVA 2FXOA 1N15A 4OGQB 2JWAA 2ZXEB 3V2NA 1BSNA 3CC4P 4I7ZB 1FZCA 1DIQC 2WTYA 1DW3A 3PRJA 2B87B 3MK7B 5DJQB 1NJIQ 5CIGB 2KOGA 2YMKA 1CHJA 2K9JA 1RE4A 1QL4A 4UB6E 2AIUA 2GUVA 5DF5A 4AX3A 4V2KA 5H2FV 3ZIYA 1KB9E 1YFCA 1FOSE 3TYIA 3BVHA 3AE9C 4K3IA 1JY2O 1N86A 1PGQA 2W6AA 4ZKUA 2OYIC 2BASA 4JF7A 3O6QB 3ZOOA 1NO4A 3L72D 5TJHA 2O1KA 3TGUE 1T8ZA 2L91A 3M9QA 1ZV8A 3ORVA 2E76B 1RZ5A 1GQ1A 5AW2B 4PW9B 2WMMA 1H1OA 5C39A 4AALA 1HVVA 2R5DA 1EXIA 2IBZD 4EIFA 5B66V 4GYDA 5E79E 1Q7YQ 4WY4B 3CWBJ 3AE5C 3JCUH 3O5CA 1K05A 4JQ0D 1M60A 1I8PA 4DZOA 4O9BA 4IL6V 1CNOA 1SQPE 1SVFA 4OH8B 1VQOP 1P84E 1K73Q 1ZRTE 2NRGA 4W7YA 2JP3A 1OAEA 2C9NY 2ZVNB 2R32A 2IPPA 5GTIE 4L73A 4AYCA 2HG5D 1OVRA 1OIPA 3MP7B 1VF5B 3OA8B 2C1DB 4L75A 1S2EA 4YTPC 2KK7A 2PGDA 1C6RA 2QE7H 1MZ4A 4I1LA 1IFMA 1R5SA 2V7QH 3N4XA 3C1LA 3R2PA 1QX8A 1KV9A 1L4AD 3GW6A 1QL1A 3WFEC 1IZNB 3K5BA 3OCDB 1GW3A 1LTGC 1CRGA 1SQVG 5AVTB 3H1HG 2KYVA 5K5GB 1A8CA 1YTZT 2C0WA 4DT0A 1L0NE 2J58A 3S9OA 1H9YA 1VQ5P 1MFTA 1KQSO 1EXJA 1E8EA 5KLVE 1BDCA 1FC2C 2E74D 5H2FH 3RK2C 4WVZA 3AEGC 3JC22 1JUNA 3IR9A 1N73B 1PP9J 4D6TJ 1N7SC 1PZQA 4AUWA 4L3HA 3DMIA 3CI9A 1VQKP 3CD6P 3O8ZA 5CJ4A 4UB8H 4PJ0V 2AEJA 1KB9I 2W8ZA 1YBKA 4C7RA 2ZT9B 1RZ6A 1DIPA 3WU2H 1KV4A 2N18C 4O1WA 1HCMA 3CCJP 3AEEC 3E1IA 1OVVA 1SQXG 1NMLA 3CX5H 4DY9A 3VMZA 1SQQK 4PV1C 2FYNB 1IK9A 1M1KQ 4H13C 2HPCA 1NTZJ 5CBNA 3AECC 3V4QA 2QA4P 1AYGA 1D7MA 2B9BA 1PGPA 1L0LK 3MK7C 3L74E 1QKSA 1YCCA 1EDLA 1FI3A 3ZDMA 3WU2E 1S9KD 2KS1A 4LGDE 1RAQA 2ZXYA 2IFNA 5EFWB 5CYTR 2G8YA 2CXBA 2R3CA 2YXQB 3CCLP 3H32A 5BVZA 2ZXXA 1T2KC 1PP9D 4D6TD 4PD4E 1SFCD 1E79H 4WWIA 2FXPA 2R5BA 2FYUG 3TNUB 3L73E 3HE4A 3A9FA 4IFMA 3TYYA 2V08A 3LW5H 1DX7A 2BCCD 1I5TA 1QLED 1F1CA 1M70A 3C8VA 4GIFA 3SVWA 3GF7A 5CCGD 5C0ZA 3SWFA 2V07A 2IYPA 2YKOA 3V5BA 3LIEA 1DD3A 2FY8A 3CXHD 1IFDA 1L0LJ 3VOPA 3LIDA 4IL6X 4FA1A 1F1FA 2D0WA 1H31B 1RQUA 1VQLP 2KNCB 2AXTH 2I1JA 1JTHA 2O01N 3CMEP 5APVA 3D6YA 3WC8A 4WQCA 1SP4A 4TLFA 1JM0A 4L74A 2D2CB 2C9LY 1FU1A 1N90A 1HUCA 2V4HA 4H44B 1YQ3C 3DR0A 2CE0A 3G4SP 2OYIB 3PXTA 1OW7A 2W6JH 1VF5C 3L71G 3FGAD 1FAVA 3OCDA 1USEA 4NFGB 3L70D 1OMIA 1QL3A 4YE1A 1RE3A 2WSSH 3KZIE 3OJAB 5C9MA 5GTIH 2FYUJ 1LTJA 4ZKPA 2OTJP 1JMMA 2WSFH 2XKMA 3U1CA 3AE8C 3SWYA 3H1LG 2XU6A 1JTHB 1RHZB 3CXHI 3G3ZA 1LJ2A 3L71E 2ZBOA 1T6AA 1CRHA 5B5EH 2ZYAA 1IK7A 3VMAA 1OXZA 3GF3A 1L2PA 1AQ5A 2B10B 1LTTC 1NU1G 1IRVA 1PL5A 1BE3D 4RO0A 1CHHA 2PCCB 3H1KE 3RBXA 1S3JA 1SQBJ 1LTBC 3M06A 2D2CC 3L4FA 3USSA 1FZGA 1XTGB 1GU4A 3VRDA 3V2QA 5CIEB 1KX2A 2N3YA 5AW3B 1BGYG 3HE5A 1NU1D 2HPCB 2KIKA 3HD7D 2Q1KA 3MZWB 1NH4A 2OYHC 3BRTB 1KB9H 5DJTB 3HRNA 1SFCA 2W83C 2IX7C 1I6DA 2YKPA 4CPGA 1SQVE 3CCUP 2PCBB 2MKVA 2IFMA 1KFNA 4UB6H 1HJBA 2PAJA 4KMGA 2FKWB 4HH2A 1K04A 5KAIV 1CCHA 2FYZA 2N1TD 2YIUC 4KHXA 5KJ7C 1N9CA 3D70A 2B0ZB 2L5GB 4LLHA 1CIGA 3H1HE 4HYTB 3NWVA 3WFCC 2YNYA 4H0KA 1X9VA 2KP8A 3HE4B 2C0XA 1SQBG 4MN4C 1X8YA 1FHBA 5CIBB 3L75G 2PP6A 3L72J 1CSXA 4RESB 3H1IJ 4U3FJ 2KLUA 4WQDA 5CIFB 4JPZB 3HD7C 2H7HA 4FA4A 3HQ7A 3KQGA 2I8DA 2L4DA 5TISV 2JKVA 1SQQJ 2CA4B 3JCUE 2O01J 3TDKA 3TGUJ 1YI2P 3M9BA 1M56D 1NNOA 5AVQB 1KILE 2A06E 1YEBA 1PFIA 1N73A 2ITAA 2M5AB 3PJSK 5AVXB 2KLVA 1B7VA 2PACA 2B88A 2QEXP 3SJLA 1S5LE 2XNDH 5CIDB 2EXVA 3R4YA 2H43A 2WITA 4KJMA 5AW8B 3VP8A 3G6EP 2M8RA 3PHLA 1C2NA 2QJPB 2BCCJ 2XV5A 1GJQA 3A0HH 2M3BA 3RBZA 3Q5PA 4RKUJ 2ZVOB 2OGUA 1HWTC 4XYDB 1LTJB 1M6ZA 2N9YB 3PH2B 1RF1B 2IDBA 5CCHA 2YCCA 2KZIA 1P84I 3M91A 1FZCC 3B4SA 1E5WA 4FA9A 1OW6A 2QRXA 1RY3A 1Z56A 4GOEA 1IO3A 2ZONG 1QN2A 5AVSB 3UIAA 1HJ4A 2FRCA 5CCHC 2G3AA 1HGZA 2FFDA 3KYQA 1A2SA 1LC1A 5DFSA 1YJ9P 1RAPA 1K8AQ 3L71J 4GDOA 2B12B 1JCCA 3A2AA 3L4OA 3U1AA 1CSBA 1MG2D 2C9XB 3KZIV 4AAOA 3A7OA 1KYOD 5KAIH 2PRRA 1EZVG 3SWKA 3T97A 1LMSA 3EQ2A 2QG4A 3CCQP 1URQB 1NU1J 2GA1A 2D2CD 1WT6A 3L75E 3U59A 3V2RA 3HD7B 5KLVK 2ZT9C 2BPBB 3EFGA 1W5CT 3C2CA 1FS0E 5B66E 1FZCB 2C1UA 3C9IA 2JWDA 5KAFV 3PXSA 1BL9A 4PD4I 2Y0CA 4GODA 1NTKD 2C2CA 4K3AA 1R8EA 3WMM0 2K9JB 3P8CD 1XTCC 2AXTV 1SQXJ 1K3HA 2ZAEB 2GIWA 4YPCA 5AVRB 1G2CB 1CCRA 3CX5W 1KQGB 1LNQA 2RH0A 1CRYA 1YICA 1URQD 2BCNB 3PTZA 1KYOI 351CA 5AW5B 1FDMA 4C7NA 1I6EA 1NOHA 1PP9G 4D6TG 4N78E 1CYCA 4H13D 1VPCA 3FWLA 1E29A 3L35A 3Q1MA 2ZFCA 2LR2A 2CPBA 3B8EB 1DW0A 5GTHV 1EDJA 3RK3D 1MKMA 2KI7B 2ZJSE 1KMIZ 2K1AA 2O1JA 2XNXA 3P32A 1KN7A 3AE1C 3P8MC 3BCCD 1NTZG 3RL0D 2WVRA 4N0KA 4YXWH 4BRYB 5APYA 3WFDC 1KORA 5M1BA 2H89C 1JMBA 1PPJE 1SQXD 1LFMA 2IYOA 2WT7A 2JDIH 3KDPB 4L76A 1RH5B 4EICA 3AE7C 1URQC 3HUSB 4KT0J 4N6JA 1GMJA 1SQBK 3B71A 2J59M 2O3JA 3PP5A 1PIXA 1BE3G 3CC2P 4Q5PA 1EZVE 1HJ5A 3B5NA 3VMYA 1SQPD 1GD2E 4NPFX 1M8OB 1MG3D 4BXLA 3RN1A 2BCCE 1SQBE 3AEBC 1N7SB 3RGUA 2WPSA 2WPQA 3CX5I 1CSWA 2FFDB 4AQRD 1L4AC 3TSIA 1ZN5A 2WQYC 1Q90D 1SQVJ 2CA3B 2FWLA 4UB8V 5KKZB 3WUTA 3CWBG 2M3EA 4GKGA 3A5TA 3O0RC 1AFOA 1Y9BA 3NMDA 1BCCE 3A0HE 4Y28J 4XA4A 2XZRA 3L70J 3AE6C 1RE3C 1VQ6P 2WPRA 2WZ7A 1NYHA 5AVWB 1SLQA 2QJKC 1OW8A 4XE5B 2P2UA 2A45I 4L3GA 1X0TA 5TISH 3FX0A 1DVHA 1NTZK 4OWFA 1CIEA 3B5ND 2N1TA 3D71A 1UIXA 2R3SA 3G71P 2YO3A 1S5LX 3HTKB 2B11B 1NTZE 1QL2A 5DJUB 3CMAP 1NTMD 3ZBMA 1VQ4P 5H2FE 4H0LB 1QGKB 1DW1A 1JB0J 2QSIA 3VYIA 1U7MA 1U7JA 1CHIA 3L70G 3O1YA 1N50A 2I1KA 2C1DA 3BATA 3S4RA 1N8RQ 3BASA 1CSVA 1HGVA 4JYBA 2FYNC 3IFMA 1YNRA 4Y99B 3H1LD 4Y99C 5B6QA 2A45H 3HQ6A 2QJKB 2QJYB 3WUUA 2E42A 1H89A 4P4QB 3ABVC 1YTZI 1Y8AA 3MUDC 1CTJA 4WQBA 3TNUA 1COTA 1LWUA 1CZQA 3KXDA 2OYIA 1S9KE 2N9JA 5KKZC 1CI6B 2E74C 3H1ID 4U3FD 1OCDA 2E74B 5APXA 1X79B 1HJ3A 4LJIA 4EI2A 2N3BA 1IFJA 5CMZA 1SS1A 4GOFA 4PD4D 4XXLA 1KQFB 2LIRA 3L36A 1YTCA 2QM7A 1DW2A 4O1QA 1P84H 2A06G 1I8OA 5KAFE 1FZFA 1HROA 1CRIA 2Q7CA 2HODB 3CXHH 4W80A 3H6PA 1HZVA 5B5EE 3HQ9A 4WB4A 1SQXK 2WSCJ 3M9HA 2OZ1A 5CICB 1NAYA 4PJ0E 2Q3IA 2JJLA 1KC8Q 5CJ0A 1H32A 1HRCA 1M1JC 1BSHA 3KZIH 3M0AA 2IZ0A 2MTAC 3CLQA 2N18B 2VHDA 3JSVC 5GTIV 1C6SA 2QIWA 1KB9D 1M1JA 2KSJA 1BE3J 3HE5B 1H88A 3IAOA 2A06D 1KILD 5EXQA 1YIQA 1Q86Q 1FZAA 4J20A 3FXEA 2ZYGA 4R4LA 1LWUC 5AVUB 5B5EV 1T3JA 1L0LE 1JDLA 2OYHA 5GTHE 3VNWA 1URQA 1N73C 2KUBA 3Q3DA 2DW3A 1T2KD 1ZW0A 2OYOA 4IL6H 2QJPC 3L74D 4GEDB 2K9YA 2POHA 1N7SD 2Z5IA 3AEAC 2AXTE 1W2EA 4DJGA 2IBZE 2KZJA 3MGNA 2IBZG 3CCEP 3RLMA 1NAFA 4JCGA 5BU5A 2BEZF 1L9JC 2WPVB 3MHVA 3CCRP 5KLVG 2IBZI 5CBOA 1WMKA 1S5LV 1L9BC 2E5YA 2OYHB 3CWBE 1ZP0C 3CCMP 2KXPB 1JNMA 1BGYE 1DT1A 2VRSA 1L0NK 1RE4C 1SFCB 4WBAA 4JBZA 1OVUA 1IFPA 1GDTA 2D0SA 1ZR2A 3SWSA 3CL3D 4UB6V 3SXTA 4FB1A 2KSEA 3B5NB 2HR3A 2E5TA 3PH0A 3L74G 2HLOA 1VYDA 1VL2A 1CTYA 1R5LA 5AW7B 5AW4B 2GC4D 5KLIB 3GMAA 3RL0g 1L0NJ 1SQVD 3KHUA 3OAKA 4RJTA 2WSCH 1EQ7A 3VTPC 5AW9B 3GHGC 4EIEA 3ZOYA 1L0ND 4QAOA 1NTKE 2WSFJ 5CHXA 3M97X 3H1JJ 4UB8E 2QVAA 1LT9C 1LTAC 4H44C 4WQ7A 3S1KA 1Q82Q 2DGEA 3H1JD 1IQCA 1ZZHA 2UWJE 2N9IA 3L71D 1VDFA 3D0WA 2HODA 1JCDA 3CPWO 4EYYQ 2ZZS1 1SQVK 2FFDC 1KQLA 2Y9YA 2Y9ZA 1JY3P 2KS1B 5APWA 2P10A 4EIDA 2Q6QA 5CCGC 4IOIH 2H88C 5CCHD 4EDFA 1DH3A 3AEFC 4ASWA 4B86A 2WWWA 2FYUK 4LC1A 1OWAA 3L72E 1KTMA 1FBMA 1ZR4A 1FI9A 1GL2C 3NFQA 5E79V 5AVYB 2BCCG 1FZEA 5AW6B 1ZXGA 1HBWA 1SQQD 3L73G 4H0LC 3H1KJ 3HQ8A 3II6A 4U7JA 3RK2D 4EIJA 4AAMA 4NPEA 2HFED 1I55A 4Y5RA 2PFXA 451CA 1RF1C 4R4MA 1KILB 1DEBA 2NPSB 3CCVP 3SFDC 1VF5D 2FXMA 3L73D 1EDKA 1HH0A 1SQQG 2CPSA 3CXHW 1MZ9A 4DOJA 1KX7A 1H33A 1W2LA 2FYUD 4C7NB 4TT3H 1JY3N 1CI6A 3RK2B 2C1VA 1MV8A 3F89A 4QMAA 2H8PD 1H9XA 4PV1B 1U74B 1LP1A 1LTIC 4H13B 1YITP 1QVFO 3BCCJ 2W27A 5AURA 3P7KA 1M57D 3OA8A 2RN0A 1KILA 2QJYC 4N3YB 2B4ZA 2CE1A 2BEQD 1NTKG 2ZOOA 5BU8B 3WFBC 2ZYDA 2K3RA 5E79H 4BRYA 1M7LA 1JO5A 3OA7A 1KB0A 1LT1A 5APSA 3MUDA 2N1TC 1LP1B 1ETPA 3EWKA 2YKQA 2WSEH 1IJDB 2W6BA 4WQAA 1LWUB 2E76C 3MTUE 1AV1A 1H32B 1SFCC 3HUSA 1HF9A 3L70E 3P8CE 1A56A 1SQPJ 3WUVA 155CA 1BGYJ 3VN0A 1M1JB 1WVEC 3X39A 5DJQC 2M0BA 2P1JA 1GKSA 2XDJA 4ZNCA 1NWQA 2YMYA 3SSUA 4C46A 3CCSP 4FA5A 2MHMA 3F5HA 1CIHA 3L72G 4I7ZC 1C2RA 2O01H 3O6QA 1LT9A 2P58A 1BE3E 1KZUB 4WQ8A 3EFFK 1KIBA 1KFMA 1HH7A 3A0BV 1H8AA 4N78D 1I54A 3A0HV 5AVVB 3L37A 1LC2A 1NGMB 1P84D 2Z4EA 1RQVA 4H44D 2QM8A 4IL6E 1GL2A 4HB1A 2OZ1B 4WQ9A 1FDIA 1JY3O 3I55P 1C52A 2BH4X 4H0LD 4PD4H 2YK3A 3N7NA 1GZLA 3NTNA 3T97B 1NKZB 2OTKE 3CC7P 3CX5D 3O20A 3IN6A 1J1EC 1MFZA 1TU3F 2LITA 1YYCA 4A7PA 3V6IA 1S4XA 1AVYA 1M90Q 3L75D 3AE2C 4OGQD 2W90A 4WY4C 1CO6A 4MU8A 4I6MC 3GHGB 2E75B 3TF5A 1FJKA 1NTMG 2BLFB 1LS9A 2Q9IA 5APUA 3WUIA 3V4WA 4WY4A 1H0TA 4WY4D 3SFEC 3W68A 1SQBD 3VMXA 3H1HD 3PXWA 1L0LG 2Q3EA 1L4AB 1NTMJ 1T3UA 1J1DC 1X22A 3H1LJ 1AVOA 2I8FA 1J1DB 3FWNA 1CW5A 3AE4C 2OARA 3M0DA 3ZOXA 1PPJG 3MIWA 5CCGA 1Q2NA 1NMIA 2B89A 3L74J 4GT1A 2Z5HA 1YIJP 2C8SA 2E75D 3QWOC 1YJNP 1LGHB 3E1RA
chains in the Genus database with same CATH topology
5GTIV 1C6SA 1KB9D 1HZUA 3TYIA 3TDKA 1NNOA 4K3IA 1YEBA 1CEDA 2A06D 5EXQA 1YIQA 4J20A 1NIRA 1B7VA 3ZOOA 2PACA 5B5EV 3TGUD 3L72D 3SJLA 5TJHA 1JDLA 1L0LD 5CIDB 2EXVA 2L91A 3VNWA 3ORVA 2Y0DA 1RZ5A 1GQ1A 3PHLA 1C2NA 2QJPB 4PW9B 1GJQA 1H1OA 3L74D 4GEDB 4AALA 2IBZD 4EIFA 5B66V 4GYDA 2DVHA 4XYDB 3RLMA 3ZCFA 4JCGA 1M6ZA 2GC7D 2N9YB 3PH2B 1L9JC 3O5CA 2GB8B 1CXAA 1S5LV 1M60A 3H1KD 1L9BC 2YCCA 1C75A 1I8PA 4FA9A 1ZRTD 3DP5A 4IL6V 1CNOA 2Y0EA 1IO3A 2ZONG 1OAEA 1QN2A 1DT1A 1HJ4A 2FRCA 1KYOW 1A2SA 1LC1A 1FCDC 3OA8B 5DFSA 1RAPA 2C1DB 2YIUB 2D0SA 3SWSA 2B12B 4UB6V 3SXTA 4FB1A 1C6RA 3L4OA 1MZ4A 1MG2D 2C9XB 3KZIV 3SLEA 4AAOA 1KYOD 1E2RA 1H33B 1CORA 1VYDA 1LMSA 1CTYA 2QG4A 3RMZA 2GC4D 1KV9A 5KLIB 3GW6A 3WFEC 1SQVD 2BPBB 1CTZA 3KHUA 1W5CT 3C2CA 3OCDB 1CRGA 2C1UA 2ORLA 4RJTA 1C7MA 5KAFV 3PXSA 3NBSA 1BL9A 3ZOYA 1A8CA 4EIEA 2Y0CA 1NTKD 2C2CA 1L0ND 4QAOA 1H9YA 2JTIB 3M97X 2K9JB 2AXTV 1K3HA 1C6OA 2GIWA 5KLVD 1E8EA 3JBTB 1J3SA 1CSUA 1CCRA 4PWAA 4WQ7A 3CX5W 2DGEA 3H1JD 1IQCA 1ZZHA 1CRYA 1YICA 2N9IA 1NTZD 3L71D 2BCNB 3PTZA 2XTSB 3DMIA 4L3HA 351CA 1I6EA 2AI5A 3CP5A 2ZZS1 5CIHB 1CYCA 4PJ0V 4FANA 3FWLA 1E29A 3VYMA 1RZ6A 1DW0A 3CYTI 5GTHV 4EIDA 1GDVA 2N18C 4O1WA 1HCMA 3L4MA 1AOFA 1CC5A 4EDFA 4RSZA 1NMLA 4DY9A 3BCCD 4N0KA 2FYNB 3WFDC 1FI9A 5E79V 1DVVA 1AYGA 2YQBA 1SQXD 1LFMA 3MK7C 1QKSA 1YCCA 1FI3A 1SQQD 2KS1A 1RAQA 3HQ8A 2ZXYA 4EICA 1CYIA 5CYTR 4AAMA 2CXBA 1I55A 4Y5RA 1S6VB 451CA 1R0QA 2O3JA 1PP9D 4D6TD 4Q5PA 3L73D 3CWBD 1HJ5A 1CYJA 3CXHW 1DIIC 1KX7A 3A9FA 1H33A 1SQPD 1W2LA 2FYUD 2V08A 2BCCD 3NBTA 1MG3D 1I5TA 1AOQA 3RN1A 1F1CA 1M70A 3SVWA 2C1VA 5C0ZA 1H9XA 1U74B 2V07A 3ZOWA 3GG2A 1CSWA 3CXHD 5AURA 2BGVX 3OA8A 4FA1A 1F1FA 1AKKA 2RN0A 1CXCA 2D0WA 1H31B 2B4ZA 2CE1A 2CA3B 2FWLA 4UB8V 5KKZB 2ZOOA 3O0RC 3WFBC 2KNCB 4AANA 1BCCD 3WC8A 2JQRA 1KB0A 1GU2A 4WQCA 1CRCA 1ETPA 1N90A 3CU4A 1WEJF 4WQAA 3DR0A 2CE0A 3PXTA 1H32B 3OCDA 4L3GA 4NFGB 3L70D 1DVHA 1A56A 1CIEA 1QL3A 4YE1A 155CA 5C9MA 1K3GA 2HV4A 1IZL0 1CIFA 1WVEC 3X39A 5DJQC 1FOCA 1GKSA 3WU2V 4FA5A 2MHMA 1CIHA 1C2RA 2B11B 2ZBOA 4H0JA 1CRHA 1GIWA 1NTMD 3VMAA 4WQEA 2B10B 3ZBMA 1IRVA 4WQ8A 1BE3D 1KIBA 1CHHA 1DW1A 1HH7A 3A0BV 2PCCB 1I54A 3A0HV 1CHIA 3O1YA 1N50A 1LC2A 1P84D 2C1DA 1BGYD 1FI7A 2RMZA 3RN0A 1YEAA 2OZ1B 4WQ9A 1CSVA 3VRDA 1YNRA 1C52A 2BH4X 2YK3A 3H1LD 5B6QA 3HQ6A 2QJKB 5CIEB 1KX2A 2N3YA 2QJYB 5IY51 1FJ0A 4P4QB 3CX5D 3O20A 1CTJA 4WQBA 1NU1D 1COTA 1PPJD 3ITKA 2LITA 4A7PA 2N9JA 1CRJA 1IRWA 1EB7A 3L75D 3H1ID 4U3FD 3PLNA 1QYZA 1OCDA 1I6DA 1HJ3A 4LJIA 2PCBB 2N3BA 2BH5X 1CO6A 4MU8A 4PD4D 1U75B 4KMGA 4XXLA 1EZVD 4L1QA 2LIRA 3TF5A 5KAIV 1YTCA 1CCHA 1DW2A 2BLFB 1H31A 1LS9A 4O1QA 1N9CA 3WUIA 4FAVA 2B0ZB 1N15A 1I8OA 1CIGA 1HROA 1CRIA 1SQBD 3NWVA 2JWAA 3WFCC 3H1HD 4H0KA 3PXWA 1DIQC 1FHBA 5CIBB 1DW3A 2Q3EA 3PRJA 1HZVA 3MK7B 5DJQB 3HQ9A 1CSXA 5CIGB 2I8FA 4WQDA 5CIFB 2OZ1A 5CICB 1CHJA 1QL4A 1H32A 1HRCA 2AIUA 3ZOXA 3HQ7A 4FA4A 1NMIA 2MTAC 2L4DA 5TISV 5DF5A 4AX3A 2C8SA 4V2KA 2N18B 5H2FV 3ZIYA 2CA4B 1YFCA 2VHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI V;  1C6S A;  1KB9 D;  1HZU A;  3TYI A;  3TDK A;  1NNO A;  4K3I A;  1YEB A;  1CED A;  2A06 D;  5EXQ A;  1YIQ A;  4J20 A;  1NIR A;  1B7V A;  3ZOO A;  2PAC A;  5B5E V;  3TGU D;  3L72 D;  3SJL A;  5TJH A;  1JDL A;  1L0L D;  5CID B;  2EXV A;  2L91 A;  3VNW A;  3ORV A;  2Y0D A;  1RZ5 A;  1GQ1 A;  3PHL A;  1C2N A;  2QJP B;  4PW9 B;  1GJQ A;  1H1O A;  3L74 D;  4GED B;  4AAL A;  2IBZ D;  4EIF A;  5B66 V;  4GYD A;  2DVH A;  4XYD B;  3RLM A;  3ZCF A;  4JCG A;  1M6Z A;  2GC7 D;  2N9Y B;  3PH2 B;  1L9J C;  3O5C A;  2GB8 B;  1CXA A;  1S5L V;  1M60 A;  3H1K D;  1L9B C;  2YCC A;  1C75 A;  1I8P A;  4FA9 A;  1ZRT D;  3DP5 A;  4IL6 V;  1CNO A;  2Y0E A;  1IO3 A;  2ZON G;  1OAE A;  1QN2 A;  1DT1 A;  1HJ4 A;  2FRC A;  1KYO W;  1A2S A;  1LC1 A;  1FCD C;  3OA8 B;  5DFS A;  1RAP A;  2C1D B;  2YIU B;  2D0S A;  3SWS A;  2B12 B;  4UB6 V;  3SXT A;  4FB1 A;  1C6R A;  3L4O A;  1MZ4 A;  1MG2 D;  2C9X B;  3KZI V;  3SLE A;  4AAO A;  1KYO D;  1E2R A;  1H33 B;  1COR A;  1VYD A;  1LMS A;  1CTY A;  2QG4 A;  3RMZ A;  2GC4 D;  1KV9 A;  5KLI B;  3GW6 A;  3WFE C;  1SQV D;  2BPB B;  1CTZ A;  3KHU A;  1W5C T;  3C2C A;  3OCD B;  1CRG A;  2C1U A;  2ORL A;  4RJT A;  1C7M A;  5KAF V;  3PXS A;  3NBS A;  1BL9 A;  3ZOY A;  1A8C A;  4EIE A;  2Y0C A;  1NTK D;  2C2C A;  1L0N D;  4QAO A;  1H9Y A;  2JTI B;  3M97 X;  2K9J B;  2AXT V;  1K3H A;  1C6O A;  2GIW A;  5KLV D;  1E8E A;  3JBT B;  1J3S A;  1CSU A;  1CCR A;  4PWA A;  4WQ7 A;  3CX5 W;  2DGE A;  3H1J D;  1IQC A;  1ZZH A;  1CRY A;  1YIC A;  2N9I A;  1NTZ D;  3L71 D;  2BCN B;  3PTZ A;  2XTS B;  3DMI A;  4L3H A;  351C A;  1I6E A;  2AI5 A;  3CP5 A;  2ZZS 1;  5CIH B;  1CYC A;  4PJ0 V;  4FAN A;  3FWL A;  1E29 A;  3VYM A;  1RZ6 A;  1DW0 A;  3CYT I;  5GTH V;  4EID A;  1GDV A;  2N18 C;  4O1W A;  1HCM A;  3L4M A;  1AOF A;  1CC5 A;  4EDF A;  4RSZ A;  1NML A;  4DY9 A;  3BCC D;  4N0K A;  2FYN B;  3WFD C;  1FI9 A;  5E79 V;  1DVV A;  1AYG A;  2YQB A;  1SQX D;  1LFM A;  3MK7 C;  1QKS A;  1YCC A;  1FI3 A;  1SQQ D;  2KS1 A;  1RAQ A;  3HQ8 A;  2ZXY A;  4EIC A;  1CYI A;  5CYT R;  4AAM A;  2CXB A;  1I55 A;  4Y5R A;  1S6V B;  451C A;  1R0Q A;  2O3J A;  1PP9 D;  4D6T D;  4Q5P A;  3L73 D;  3CWB D;  1HJ5 A;  1CYJ A;  3CXH W;  1DII C;  1KX7 A;  3A9F A;  1H33 A;  1SQP D;  1W2L A;  2FYU D;  2V08 A;  2BCC D;  3NBT A;  1MG3 D;  1I5T A;  1AOQ A;  3RN1 A;  1F1C A;  1M70 A;  3SVW A;  2C1V A;  5C0Z A;  1H9X A;  1U74 B;  2V07 A;  3ZOW A;  3GG2 A;  1CSW A;  3CXH D;  5AUR A;  2BGV X;  3OA8 A;  4FA1 A;  1F1F A;  1AKK A;  2RN0 A;  1CXC A;  2D0W A;  1H31 B;  2B4Z A;  2CE1 A;  2CA3 B;  2FWL A;  4UB8 V;  5KKZ B;  2ZOO A;  3O0R C;  3WFB C;  2KNC B;  4AAN A;  1BCC D;  3WC8 A;  2JQR A;  1KB0 A;  1GU2 A;  4WQC A;  1CRC A;  1ETP A;  1N90 A;  3CU4 A;  1WEJ F;  4WQA A;  3DR0 A;  2CE0 A;  3PXT A;  1H32 B;  3OCD A;  4L3G A;  4NFG B;  3L70 D;  1DVH A;  1A56 A;  1CIE A;  1QL3 A;  4YE1 A;  155C A;  5C9M A;  1K3G A;  2HV4 A;  1IZL 0;  1CIF A;  1WVE C;  3X39 A;  5DJQ C;  1FOC A;  1GKS A;  3WU2 V;  4FA5 A;  2MHM A;  1CIH A;  1C2R A;  2B11 B;  2ZBO A;  4H0J A;  1CRH A;  1GIW A;  1NTM D;  3VMA A;  4WQE A;  2B10 B;  3ZBM A;  1IRV A;  4WQ8 A;  1BE3 D;  1KIB A;  1CHH A;  1DW1 A;  1HH7 A;  3A0B V;  2PCC B;  1I54 A;  3A0H V;  1CHI A;  3O1Y A;  1N50 A;  1LC2 A;  1P84 D;  2C1D A;  1BGY D;  1FI7 A;  2RMZ A;  3RN0 A;  1YEA A;  2OZ1 B;  4WQ9 A;  1CSV A;  3VRD A;  1YNR A;  1C52 A;  2BH4 X;  2YK3 A;  3H1L D;  5B6Q A;  3HQ6 A;  2QJK B;  5CIE B;  1KX2 A;  2N3Y A;  2QJY B;  5IY5 1;  1FJ0 A;  4P4Q B;  3CX5 D;  3O20 A;  1CTJ A;  4WQB A;  1NU1 D;  1COT A;  1PPJ D;  3ITK A;  2LIT A;  4A7P A;  2N9J A;  1CRJ A;  1IRW A;  1EB7 A;  3L75 D;  3H1I D;  4U3F D;  3PLN A;  1QYZ A;  1OCD A;  1I6D A;  1HJ3 A;  4LJI A;  2PCB B;  2N3B A;  2BH5 X;  1CO6 A;  4MU8 A;  4PD4 D;  1U75 B;  4KMG A;  4XXL A;  1EZV D;  4L1Q A;  2LIR A;  3TF5 A;  5KAI V;  1YTC A;  1CCH A;  1DW2 A;  2BLF B;  1H31 A;  1LS9 A;  4O1Q A;  1N9C A;  3WUI A;  4FAV A;  2B0Z B;  1N15 A;  1I8O A;  1CIG A;  1HRO A;  1CRI A;  1SQB D;  3NWV A;  2JWA A;  3WFC C;  3H1H D;  4H0K A;  3PXW A;  1DIQ C;  1FHB A;  5CIB B;  1DW3 A;  2Q3E A;  3PRJ A;  1HZV A;  3MK7 B;  5DJQ B;  3HQ9 A;  1CSX A;  5CIG B;  2I8F A;  4WQD A;  5CIF B;  2OZ1 A;  5CIC B;  1CHJ A;  1QL4 A;  1H32 A;  1HRC A;  2AIU A;  3ZOX A;  3HQ7 A;  4FA4 A;  1NMI A;  2MTA C;  2L4D A;  5TIS V;  5DF5 A;  4AX3 A;  2C8S A;  4V2K A;  2N18 B;  5H2F V;  3ZIY A;  2CA4 B;  1YFC A;  2VHD A; 
#chains in the Genus database with same CATH topology
 1HZU A;  3M0D C;  1MUU A;  1CED A;  2E75 C;  2LKM A;  3BCC E;  1NIR A;  1VQM P;  3TGU D;  2MJZ A;  1A02 J;  1L0L D;  1LTS C;  2OQQ A;  2Y0D A;  2WT7 B;  5KJ7 D;  2LXB A;  5GTH H;  2JR8 A;  1HTL C;  1SQX E;  1N2D C;  1DD4 A;  5KLV J;  1FOS F;  2DVH A;  2ZT9 D;  3ZCF A;  2GC7 D;  2GB8 B;  1CXA A;  1PP9 E;  4I2L C;  4D6T E;  3RL0 B;  3H1K D;  1C75 A;  4IFF A;  3TGU G;  1ZRT D;  3DP5 A;  3RK3 B;  1N7S A;  4PJ0 H;  3FXD A;  4EOT A;  2Y0E A;  3HD7 A;  2R44 A;  1NTM K;  1KYO W;  2K37 A;  1FCD C;  4M3L A;  1FDO A;  1J2J B;  2YIU B;  3BRV B;  2P7J A;  3AE3 C;  3CXH E;  2CK3 H;  3H1I G;  4U3F G;  1GL2 B;  1S5L H;  2Q5U A;  5KAF H;  1BDD A;  3SLE A;  3GLM A;  1E2R A;  1H33 B;  3L75 J;  4ZMD A;  2AXC A;  1COR A;  1PGJ A;  3RMZ A;  3H1K G;  3L73 J;  2AEF A;  1G1J A;  3H1I E;  4U3F E;  1NTK J;  3RK3 C;  5B66 H;  1CTZ A;  2ORL A;  2N9B A;  1C7M A;  3V2P A;  1NHL A;  3NBS A;  1QEX A;  2N1T B;  3Q2Y A;  1PGO A;  2P67 A;  2IZ1 A;  2JTI B;  1SQP G;  2KNC A;  5KAI E;  1JEK A;  1C6O A;  1OZH A;  5KLV D;  3GHG A;  2FBW C;  3JBT B;  1ZOY C;  1J3S A;  4ASV A;  1CSU A;  4PWA A;  3TK1 A;  1QVG O;  1HJ0 A;  5AW1 B;  3H1J E;  1H0T B;  1NTZ D;  2NZ2 A;  2XTS B;  1VQ8 P;  2AI5 A;  3LW5 J;  3CP5 A;  1GK4 A;  3I56 P;  5CIH B;  4FAN A;  1G1I A;  1VQN P;  1AA0 A;  1GL2 D;  3VP9 A;  1EZV I;  3VYM A;  3CYT I;  1GU5 A;  1N7L A;  4DCK A;  1GDV A;  3L4M A;  1KIL C;  1AOF A;  1G2C A;  1U57 A;  3BCC G;  5L8R J;  1CC5 A;  3RK3 E;  3H1J G;  1ZME C;  4RSZ A;  3H25 A;  1AJY A;  2JO1 A;  3H1L E;  3A0B H;  1Q81 Q;  2M5A A;  2WSE J;  1DVV A;  5TIS E;  3QH9 A;  3D6Z A;  1K9M Q;  1L0N G;  1NU1 E;  2YQB A;  1FJP A;  1GW4 A;  1FE6 A;  1RF0 A;  1SQQ E;  1VQP P;  3HUS C;  1KYO H;  1CYI A;  4YXD C;  1S6V B;  1R0Q A;  1AQT A;  1OX3 A;  4XFJ A;  5AW0 B;  1YQ4 C;  2LXC B;  3AED C;  5KLI C;  3CWB D;  1CYJ A;  1DII C;  1RF1 A;  3NBT A;  2E76 D;  1AOQ A;  1PV3 A;  2B87 A;  1UII A;  1J1E B;  2A45 G;  4Z1M H;  3KPE A;  3ZOW A;  3GG2 A;  1OFC X;  4JYC A;  2BGV X;  1JOC A;  1IO4 A;  1SQP K;  1Y47 A;  1FZB A;  1NKN A;  4W7Z A;  1AKK A;  1CXC A;  1W5C E;  2JEE A;  4AAN A;  4IFD K;  1JY2 N;  1BCC D;  3HTK A;  5APT A;  1NVO A;  1IC2 A;  1KD1 Q;  2JQR A;  1GU2 A;  1CRC A;  1S72 P;  3CU4 A;  1WEJ F;  4K35 A;  2V7Q J;  1EC5 A;  4PV1 D;  2E43 A;  4OGQ C;  1EDI A;  2NPS A;  4NPD A;  1ZLL A;  4HKZ H;  1K3G A;  2HV4 A;  2OTL P;  1IZL 0;  1CIF A;  5AVZ B;  1FOC A;  1IFN A;  3A3Y B;  3WU2 V;  2SPZ A;  3B5N C;  5KJ7 A;  4H0J A;  1GIW A;  3I5C A;  1NTM E;  4WQE A;  3OW2 O;  1LTJ C;  2YO2 A;  1S1C X;  3MD0 A;  1JY2 P;  1BCC G;  1GTW A;  1L4A A;  1VQ7 P;  3Q5R A;  2GM4 A;  2RKL A;  1BGY D;  1FI7 A;  2RMZ A;  3RN0 A;  3E7K A;  1YEA A;  1NU1 K;  3IF4 A;  3G9R A;  4BWN A;  2K88 A;  1YHQ P;  1IFI A;  1YJW P;  2GUS A;  2HYN A;  4OVN F;  3H32 B;  3Q5S A;  5IY5 1;  1FJ0 A;  1KYO E;  5KTB A;  3CX5 E;  2YXR B;  1PPJ D;  2NPS D;  3NXS A;  2AEM A;  3ITK A;  1GK6 A;  3W67 A;  1USD A;  1CRJ A;  3RL0 C;  1IRW A;  5APQ A;  2J5U A;  1EB7 A;  1WRG A;  1NTK K;  3PLN A;  1QYZ A;  2KB7 P;  2BH5 X;  1RF0 C;  3A0B E;  1A02 F;  2NPS C;  4HJG H;  1U75 B;  1EZV D;  4L1Q A;  3H1H J;  1VQ9 P;  1DEE G;  1BCC J;  1H31 A;  2FYU E;  1LT9 B;  1W2B O;  4FAV A;  2FXO A;  1N15 A;  4OGQ B;  2JWA A;  2ZXE B;  3V2N A;  1BSN A;  3CC4 P;  4I7Z B;  1FZC A;  1DIQ C;  2WTY A;  1DW3 A;  3PRJ A;  2B87 B;  3MK7 B;  5DJQ B;  1NJI Q;  5CIG B;  2KOG A;  2YMK A;  1CHJ A;  2K9J A;  1RE4 A;  1QL4 A;  4UB6 E;  2AIU A;  2GUV A;  5DF5 A;  4AX3 A;  4V2K A;  5H2F V;  3ZIY A;  1KB9 E;  1YFC A;  1FOS E;  3TYI A;  3BVH A;  3AE9 C;  4K3I A;  1JY2 O;  1N86 A;  1PGQ A;  2W6A A;  4ZKU A;  2OYI C;  2BAS A;  4JF7 A;  3O6Q B;  3ZOO A;  1NO4 A;  3L72 D;  5TJH A;  2O1K A;  3TGU E;  1T8Z A;  2L91 A;  3M9Q A;  1ZV8 A;  3ORV A;  2E76 B;  1RZ5 A;  1GQ1 A;  5AW2 B;  4PW9 B;  2WMM A;  1H1O A;  5C39 A;  4AAL A;  1HVV A;  2R5D A;  1EXI A;  2IBZ D;  4EIF A;  5B66 V;  4GYD A;  5E79 E;  1Q7Y Q;  4WY4 B;  3CWB J;  3AE5 C;  3JCU H;  3O5C A;  1K05 A;  4JQ0 D;  1M60 A;  1I8P A;  4DZO A;  4O9B A;  4IL6 V;  1CNO A;  1SQP E;  1SVF A;  4OH8 B;  1VQO P;  1P84 E;  1K73 Q;  1ZRT E;  2NRG A;  4W7Y A;  2JP3 A;  1OAE A;  2C9N Y;  2ZVN B;  2R32 A;  2IPP A;  5GTI E;  4L73 A;  4AYC A;  2HG5 D;  1OVR A;  1OIP A;  3MP7 B;  1VF5 B;  3OA8 B;  2C1D B;  4L75 A;  1S2E A;  4YTP C;  2KK7 A;  2PGD A;  1C6R A;  2QE7 H;  1MZ4 A;  4I1L A;  1IFM A;  1R5S A;  2V7Q H;  3N4X A;  3C1L A;  3R2P A;  1QX8 A;  1KV9 A;  1L4A D;  3GW6 A;  1QL1 A;  3WFE C;  1IZN B;  3K5B A;  3OCD B;  1GW3 A;  1LTG C;  1CRG A;  1SQV G;  5AVT B;  3H1H G;  2KYV A;  5K5G B;  1A8C A;  1YTZ T;  2C0W A;  4DT0 A;  1L0N E;  2J58 A;  3S9O A;  1H9Y A;  1VQ5 P;  1MFT A;  1KQS O;  1EXJ A;  1E8E A;  5KLV E;  1BDC A;  1FC2 C;  2E74 D;  5H2F H;  3RK2 C;  4WVZ A;  3AEG C;  3JC2 2;  1JUN A;  3IR9 A;  1N73 B;  1PP9 J;  4D6T J;  1N7S C;  1PZQ A;  4AUW A;  4L3H A;  3DMI A;  3CI9 A;  1VQK P;  3CD6 P;  3O8Z A;  5CJ4 A;  4UB8 H;  4PJ0 V;  2AEJ A;  1KB9 I;  2W8Z A;  1YBK A;  4C7R A;  2ZT9 B;  1RZ6 A;  1DIP A;  3WU2 H;  1KV4 A;  2N18 C;  4O1W A;  1HCM A;  3CCJ P;  3AEE C;  3E1I A;  1OVV A;  1SQX G;  1NML A;  3CX5 H;  4DY9 A;  3VMZ A;  1SQQ K;  4PV1 C;  2FYN B;  1IK9 A;  1M1K Q;  4H13 C;  2HPC A;  1NTZ J;  5CBN A;  3AEC C;  3V4Q A;  2QA4 P;  1AYG A;  1D7M A;  2B9B A;  1PGP A;  1L0L K;  3MK7 C;  3L74 E;  1QKS A;  1YCC A;  1EDL A;  1FI3 A;  3ZDM A;  3WU2 E;  1S9K D;  2KS1 A;  4LGD E;  1RAQ A;  2ZXY A;  2IFN A;  5EFW B;  5CYT R;  2G8Y A;  2CXB A;  2R3C A;  2YXQ B;  3CCL P;  3H32 A;  5BVZ A;  2ZXX A;  1T2K C;  1PP9 D;  4D6T D;  4PD4 E;  1SFC D;  1E79 H;  4WWI A;  2FXP A;  2R5B A;  2FYU G;  3TNU B;  3L73 E;  3HE4 A;  3A9F A;  4IFM A;  3TYY A;  2V08 A;  3LW5 H;  1DX7 A;  2BCC D;  1I5T A;  1QLE D;  1F1C A;  1M70 A;  3C8V A;  4GIF A;  3SVW A;  3GF7 A;  5CCG D;  5C0Z A;  3SWF A;  2V07 A;  2IYP A;  2YKO A;  3V5B A;  3LIE A;  1DD3 A;  2FY8 A;  3CXH D;  1IFD A;  1L0L J;  3VOP A;  3LID A;  4IL6 X;  4FA1 A;  1F1F A;  2D0W A;  1H31 B;  1RQU A;  1VQL P;  2KNC B;  2AXT H;  2I1J A;  1JTH A;  2O01 N;  3CME P;  5APV A;  3D6Y A;  3WC8 A;  4WQC A;  1SP4 A;  4TLF A;  1JM0 A;  4L74 A;  2D2C B;  2C9L Y;  1FU1 A;  1N90 A;  1HUC A;  2V4H A;  4H44 B;  1YQ3 C;  3DR0 A;  2CE0 A;  3G4S P;  2OYI B;  3PXT A;  1OW7 A;  2W6J H;  1VF5 C;  3L71 G;  3FGA D;  1FAV A;  3OCD A;  1USE A;  4NFG B;  3L70 D;  1OMI A;  1QL3 A;  4YE1 A;  1RE3 A;  2WSS H;  3KZI E;  3OJA B;  5C9M A;  5GTI H;  2FYU J;  1LTJ A;  4ZKP A;  2OTJ P;  1JMM A;  2WSF H;  2XKM A;  3U1C A;  3AE8 C;  3SWY A;  3H1L G;  2XU6 A;  1JTH B;  1RHZ B;  3CXH I;  3G3Z A;  1LJ2 A;  3L71 E;  2ZBO A;  1T6A A;  1CRH A;  5B5E H;  2ZYA A;  1IK7 A;  3VMA A;  1OXZ A;  3GF3 A;  1L2P A;  1AQ5 A;  2B10 B;  1LTT C;  1NU1 G;  1IRV A;  1PL5 A;  1BE3 D;  4RO0 A;  1CHH A;  2PCC B;  3H1K E;  3RBX A;  1S3J A;  1SQB J;  1LTB C;  3M06 A;  2D2C C;  3L4F A;  3USS A;  1FZG A;  1XTG B;  1GU4 A;  3VRD A;  3V2Q A;  5CIE B;  1KX2 A;  2N3Y A;  5AW3 B;  1BGY G;  3HE5 A;  1NU1 D;  2HPC B;  2KIK A;  3HD7 D;  2Q1K A;  3MZW B;  1NH4 A;  2OYH C;  3BRT B;  1KB9 H;  5DJT B;  3HRN A;  1SFC A;  2W83 C;  2IX7 C;  1I6D A;  2YKP A;  4CPG A;  1SQV E;  3CCU P;  2PCB B;  2MKV A;  2IFM A;  1KFN A;  4UB6 H;  1HJB A;  2PAJ A;  4KMG A;  2FKW B;  4HH2 A;  1K04 A;  5KAI V;  1CCH A;  2FYZ A;  2N1T D;  2YIU C;  4KHX A;  5KJ7 C;  1N9C A;  3D70 A;  2B0Z B;  2L5G B;  4LLH A;  1CIG A;  3H1H E;  4HYT B;  3NWV A;  3WFC C;  2YNY A;  4H0K A;  1X9V A;  2KP8 A;  3HE4 B;  2C0X A;  1SQB G;  4MN4 C;  1X8Y A;  1FHB A;  5CIB B;  3L75 G;  2PP6 A;  3L72 J;  1CSX A;  4RES B;  3H1I J;  4U3F J;  2KLU A;  4WQD A;  5CIF B;  4JPZ B;  3HD7 C;  2H7H A;  4FA4 A;  3HQ7 A;  3KQG A;  2I8D A;  2L4D A;  5TIS V;  2JKV A;  1SQQ J;  2CA4 B;  3JCU E;  2O01 J;  3TDK A;  3TGU J;  1YI2 P;  3M9B A;  1M56 D;  1NNO A;  5AVQ B;  1KIL E;  2A06 E;  1YEB A;  1PFI A;  1N73 A;  2ITA A;  2M5A B;  3PJS K;  5AVX B;  2KLV A;  1B7V A;  2PAC A;  2B88 A;  2QEX P;  3SJL A;  1S5L E;  2XND H;  5CID B;  2EXV A;  3R4Y A;  2H43 A;  2WIT A;  4KJM A;  5AW8 B;  3VP8 A;  3G6E P;  2M8R A;  3PHL A;  1C2N A;  2QJP B;  2BCC J;  2XV5 A;  1GJQ A;  3A0H H;  2M3B A;  3RBZ A;  3Q5P A;  4RKU J;  2ZVO B;  2OGU A;  1HWT C;  4XYD B;  1LTJ B;  1M6Z A;  2N9Y B;  3PH2 B;  1RF1 B;  2IDB A;  5CCH A;  2YCC A;  2KZI A;  1P84 I;  3M91 A;  1FZC C;  3B4S A;  1E5W A;  4FA9 A;  1OW6 A;  2QRX A;  1RY3 A;  1Z56 A;  4GOE A;  1IO3 A;  2ZON G;  1QN2 A;  5AVS B;  3UIA A;  1HJ4 A;  2FRC A;  5CCH C;  2G3A A;  1HGZ A;  2FFD A;  3KYQ A;  1A2S A;  1LC1 A;  5DFS A;  1YJ9 P;  1RAP A;  1K8A Q;  3L71 J;  4GDO A;  2B12 B;  1JCC A;  3A2A A;  3L4O A;  3U1A A;  1CSB A;  1MG2 D;  2C9X B;  3KZI V;  4AAO A;  3A7O A;  1KYO D;  5KAI H;  2PRR A;  1EZV G;  3SWK A;  3T97 A;  1LMS A;  3EQ2 A;  2QG4 A;  3CCQ P;  1URQ B;  1NU1 J;  2GA1 A;  2D2C D;  1WT6 A;  3L75 E;  3U59 A;  3V2R A;  3HD7 B;  5KLV K;  2ZT9 C;  2BPB B;  3EFG A;  1W5C T;  3C2C A;  1FS0 E;  5B66 E;  1FZC B;  2C1U A;  3C9I A;  2JWD A;  5KAF V;  3PXS A;  1BL9 A;  4PD4 I;  2Y0C A;  4GOD A;  1NTK D;  2C2C A;  4K3A A;  1R8E A;  3WMM 0;  2K9J B;  3P8C D;  1XTC C;  2AXT V;  1SQX J;  1K3H A;  2ZAE B;  2GIW A;  4YPC A;  5AVR B;  1G2C B;  1CCR A;  3CX5 W;  1KQG B;  1LNQ A;  2RH0 A;  1CRY A;  1YIC A;  1URQ D;  2BCN B;  3PTZ A;  1KYO I;  351C A;  5AW5 B;  1FDM A;  4C7N A;  1I6E A;  1NOH A;  1PP9 G;  4D6T G;  4N78 E;  1CYC A;  4H13 D;  1VPC A;  3FWL A;  1E29 A;  3L35 A;  3Q1M A;  2ZFC A;  2LR2 A;  2CPB A;  3B8E B;  1DW0 A;  5GTH V;  1EDJ A;  3RK3 D;  1MKM A;  2KI7 B;  2ZJS E;  1KMI Z;  2K1A A;  2O1J A;  2XNX A;  3P32 A;  1KN7 A;  3AE1 C;  3P8M C;  3BCC D;  1NTZ G;  3RL0 D;  2WVR A;  4N0K A;  4YXW H;  4BRY B;  5APY A;  3WFD C;  1KOR A;  5M1B A;  2H89 C;  1JMB A;  1PPJ E;  1SQX D;  1LFM A;  2IYO A;  2WT7 A;  2JDI H;  3KDP B;  4L76 A;  1RH5 B;  4EIC A;  3AE7 C;  1URQ C;  3HUS B;  4KT0 J;  4N6J A;  1GMJ A;  1SQB K;  3B71 A;  2J59 M;  2O3J A;  3PP5 A;  1PIX A;  1BE3 G;  3CC2 P;  4Q5P A;  1EZV E;  1HJ5 A;  3B5N A;  3VMY A;  1SQP D;  1GD2 E;  4NPF X;  1M8O B;  1MG3 D;  4BXL A;  3RN1 A;  2BCC E;  1SQB E;  3AEB C;  1N7S B;  3RGU A;  2WPS A;  2WPQ A;  3CX5 I;  1CSW A;  2FFD B;  4AQR D;  1L4A C;  3TSI A;  1ZN5 A;  2WQY C;  1Q90 D;  1SQV J;  2CA3 B;  2FWL A;  4UB8 V;  5KKZ B;  3WUT A;  3CWB G;  2M3E A;  4GKG A;  3A5T A;  3O0R C;  1AFO A;  1Y9B A;  3NMD A;  1BCC E;  3A0H E;  4Y28 J;  4XA4 A;  2XZR A;  3L70 J;  3AE6 C;  1RE3 C;  1VQ6 P;  2WPR A;  2WZ7 A;  1NYH A;  5AVW B;  1SLQ A;  2QJK C;  1OW8 A;  4XE5 B;  2P2U A;  2A45 I;  4L3G A;  1X0T A;  5TIS H;  3FX0 A;  1DVH A;  1NTZ K;  4OWF A;  1CIE A;  3B5N D;  2N1T A;  3D71 A;  1UIX A;  2R3S A;  3G71 P;  2YO3 A;  1S5L X;  3HTK B;  2B11 B;  1NTZ E;  1QL2 A;  5DJU B;  3CMA P;  1NTM D;  3ZBM A;  1VQ4 P;  5H2F E;  4H0L B;  1QGK B;  1DW1 A;  1JB0 J;  2QSI A;  3VYI A;  1U7M A;  1U7J A;  1CHI A;  3L70 G;  3O1Y A;  1N50 A;  2I1K A;  2C1D A;  3BAT A;  3S4R A;  1N8R Q;  3BAS A;  1CSV A;  1HGV A;  4JYB A;  2FYN C;  3IFM A;  1YNR A;  4Y99 B;  3H1L D;  4Y99 C;  5B6Q A;  2A45 H;  3HQ6 A;  2QJK B;  2QJY B;  3WUU A;  2E42 A;  1H89 A;  4P4Q B;  3ABV C;  1YTZ I;  1Y8A A;  3MUD C;  1CTJ A;  4WQB A;  3TNU A;  1COT A;  1LWU A;  1CZQ A;  3KXD A;  2OYI A;  1S9K E;  2N9J A;  5KKZ C;  1CI6 B;  2E74 C;  3H1I D;  4U3F D;  1OCD A;  2E74 B;  5APX A;  1X79 B;  1HJ3 A;  4LJI A;  4EI2 A;  2N3B A;  1IFJ A;  5CMZ A;  1SS1 A;  4GOF A;  4PD4 D;  4XXL A;  1KQF B;  2LIR A;  3L36 A;  1YTC A;  2QM7 A;  1DW2 A;  4O1Q A;  1P84 H;  2A06 G;  1I8O A;  5KAF E;  1FZF A;  1HRO A;  1CRI A;  2Q7C A;  2HOD B;  3CXH H;  4W80 A;  3H6P A;  1HZV A;  5B5E E;  3HQ9 A;  4WB4 A;  1SQX K;  2WSC J;  3M9H A;  2OZ1 A;  5CIC B;  1NAY A;  4PJ0 E;  2Q3I A;  2JJL A;  1KC8 Q;  5CJ0 A;  1H32 A;  1HRC A;  1M1J C;  1BSH A;  3KZI H;  3M0A A;  2IZ0 A;  2MTA C;  3CLQ A;  2N18 B;  2VHD A;  3JSV C;  5GTI V;  1C6S A;  2QIW A;  1KB9 D;  1M1J A;  2KSJ A;  1BE3 J;  3HE5 B;  1H88 A;  3IAO A;  2A06 D;  1KIL D;  5EXQ A;  1YIQ A;  1Q86 Q;  1FZA A;  4J20 A;  3FXE A;  2ZYG A;  4R4L A;  1LWU C;  5AVU B;  5B5E V;  1T3J A;  1L0L E;  1JDL A;  2OYH A;  5GTH E;  3VNW A;  1URQ A;  1N73 C;  2KUB A;  3Q3D A;  2DW3 A;  1T2K D;  1ZW0 A;  2OYO A;  4IL6 H;  2QJP C;  3L74 D;  4GED B;  2K9Y A;  2POH A;  1N7S D;  2Z5I A;  3AEA C;  2AXT E;  1W2E A;  4DJG A;  2IBZ E;  2KZJ A;  3MGN A;  2IBZ G;  3CCE P;  3RLM A;  1NAF A;  4JCG A;  5BU5 A;  2BEZ F;  1L9J C;  2WPV B;  3MHV A;  3CCR P;  5KLV G;  2IBZ I;  5CBO A;  1WMK A;  1S5L V;  1L9B C;  2E5Y A;  2OYH B;  3CWB E;  1ZP0 C;  3CCM P;  2KXP B;  1JNM A;  1BGY E;  1DT1 A;  2VRS A;  1L0N K;  1RE4 C;  1SFC B;  4WBA A;  4JBZ A;  1OVU A;  1IFP A;  1GDT A;  2D0S A;  1ZR2 A;  3SWS A;  3CL3 D;  4UB6 V;  3SXT A;  4FB1 A;  2KSE A;  3B5N B;  2HR3 A;  2E5T A;  3PH0 A;  3L74 G;  2HLO A;  1VYD A;  1VL2 A;  1CTY A;  1R5L A;  5AW7 B;  5AW4 B;  2GC4 D;  5KLI B;  3GMA A;  3RL0 g;  1L0N J;  1SQV D;  3KHU A;  3OAK A;  4RJT A;  2WSC H;  1EQ7 A;  3VTP C;  5AW9 B;  3GHG C;  4EIE A;  3ZOY A;  1L0N D;  4QAO A;  1NTK E;  2WSF J;  5CHX A;  3M97 X;  3H1J J;  4UB8 E;  2QVA A;  1LT9 C;  1LTA C;  4H44 C;  4WQ7 A;  3S1K A;  1Q82 Q;  2DGE A;  3H1J D;  1IQC A;  1ZZH A;  2UWJ E;  2N9I A;  3L71 D;  1VDF A;  3D0W A;  2HOD A;  1JCD A;  3CPW O;  4EYY Q;  2ZZS 1;  1SQV K;  2FFD C;  1KQL A;  2Y9Y A;  2Y9Z A;  1JY3 P;  2KS1 B;  5APW A;  2P10 A;  4EID A;  2Q6Q A;  5CCG C;  4IOI H;  2H88 C;  5CCH D;  4EDF A;  1DH3 A;  3AEF C;  4ASW A;  4B86 A;  2WWW A;  2FYU K;  4LC1 A;  1OWA A;  3L72 E;  1KTM A;  1FBM A;  1ZR4 A;  1FI9 A;  1GL2 C;  3NFQ A;  5E79 V;  5AVY B;  2BCC G;  1FZE A;  5AW6 B;  1ZXG A;  1HBW A;  1SQQ D;  3L73 G;  4H0L C;  3H1K J;  3HQ8 A;  3II6 A;  4U7J A;  3RK2 D;  4EIJ A;  4AAM A;  4NPE A;  2HFE D;  1I55 A;  4Y5R A;  2PFX A;  451C A;  1RF1 C;  4R4M A;  1KIL B;  1DEB A;  2NPS B;  3CCV P;  3SFD C;  1VF5 D;  2FXM A;  3L73 D;  1EDK A;  1HH0 A;  1SQQ G;  2CPS A;  3CXH W;  1MZ9 A;  4DOJ A;  1KX7 A;  1H33 A;  1W2L A;  2FYU D;  4C7N B;  4TT3 H;  1JY3 N;  1CI6 A;  3RK2 B;  2C1V A;  1MV8 A;  3F89 A;  4QMA A;  2H8P D;  1H9X A;  4PV1 B;  1U74 B;  1LP1 A;  1LTI C;  4H13 B;  1YIT P;  1QVF O;  3BCC J;  2W27 A;  5AUR A;  3P7K A;  1M57 D;  3OA8 A;  2RN0 A;  1KIL A;  2QJY C;  4N3Y B;  2B4Z A;  2CE1 A;  2BEQ D;  1NTK G;  2ZOO A;  5BU8 B;  3WFB C;  2ZYD A;  2K3R A;  5E79 H;  4BRY A;  1M7L A;  1JO5 A;  3OA7 A;  1KB0 A;  1LT1 A;  5APS A;  3MUD A;  2N1T C;  1LP1 B;  1ETP A;  3EWK A;  2YKQ A;  2WSE H;  1IJD B;  2W6B A;  4WQA A;  1LWU B;  2E76 C;  3MTU E;  1AV1 A;  1H32 B;  1SFC C;  3HUS A;  1HF9 A;  3L70 E;  3P8C E;  1A56 A;  1SQP J;  3WUV A;  155C A;  1BGY J;  3VN0 A;  1M1J B;  1WVE C;  3X39 A;  5DJQ C;  2M0B A;  2P1J A;  1GKS A;  2XDJ A;  4ZNC A;  1NWQ A;  2YMY A;  3SSU A;  4C46 A;  3CCS P;  4FA5 A;  2MHM A;  3F5H A;  1CIH A;  3L72 G;  4I7Z C;  1C2R A;  2O01 H;  3O6Q A;  1LT9 A;  2P58 A;  1BE3 E;  1KZU B;  4WQ8 A;  3EFF K;  1KIB A;  1KFM A;  1HH7 A;  3A0B V;  1H8A A;  4N78 D;  1I54 A;  3A0H V;  5AVV B;  3L37 A;  1LC2 A;  1NGM B;  1P84 D;  2Z4E A;  1RQV A;  4H44 D;  2QM8 A;  4IL6 E;  1GL2 A;  4HB1 A;  2OZ1 B;  4WQ9 A;  1FDI A;  1JY3 O;  3I55 P;  1C52 A;  2BH4 X;  4H0L D;  4PD4 H;  2YK3 A;  3N7N A;  1GZL A;  3NTN A;  3T97 B;  1NKZ B;  2OTK E;  3CC7 P;  3CX5 D;  3O20 A;  3IN6 A;  1J1E C;  1MFZ A;  1TU3 F;  2LIT A;  1YYC A;  4A7P A;  3V6I A;  1S4X A;  1AVY A;  1M90 Q;  3L75 D;  3AE2 C;  4OGQ D;  2W90 A;  4WY4 C;  1CO6 A;  4MU8 A;  4I6M C;  3GHG B;  2E75 B;  3TF5 A;  1FJK A;  1NTM G;  2BLF B;  1LS9 A;  2Q9I A;  5APU A;  3WUI A;  3V4W A;  4WY4 A;  1H0T A;  4WY4 D;  3SFE C;  3W68 A;  1SQB D;  3VMX A;  3H1H D;  3PXW A;  1L0L G;  2Q3E A;  1L4A B;  1NTM J;  1T3U A;  1J1D C;  1X22 A;  3H1L J;  1AVO A;  2I8F A;  1J1D B;  3FWN A;  1CW5 A;  3AE4 C;  2OAR A;  3M0D A;  3ZOX A;  1PPJ G;  3MIW A;  5CCG A;  1Q2N A;  1NMI A;  2B89 A;  3L74 J;  4GT1 A;  2Z5H A;  1YIJ P;  2C8S A;  2E75 D;  3QWO C;  1YJN P;  1LGH B;  3E1R A; 
#chains in the Genus database with same CATH homology
 5GTI V;  1C6S A;  1KB9 D;  1HZU A;  3TYI A;  3TDK A;  1NNO A;  4K3I A;  1YEB A;  1CED A;  2A06 D;  5EXQ A;  1YIQ A;  4J20 A;  1NIR A;  1B7V A;  3ZOO A;  2PAC A;  5B5E V;  3TGU D;  3L72 D;  3SJL A;  5TJH A;  1JDL A;  1L0L D;  5CID B;  2EXV A;  2L91 A;  3VNW A;  3ORV A;  2Y0D A;  1RZ5 A;  1GQ1 A;  3PHL A;  1C2N A;  2QJP B;  4PW9 B;  1GJQ A;  1H1O A;  3L74 D;  4GED B;  4AAL A;  2IBZ D;  4EIF A;  5B66 V;  4GYD A;  2DVH A;  4XYD B;  3RLM A;  3ZCF A;  4JCG A;  1M6Z A;  2GC7 D;  2N9Y B;  3PH2 B;  1L9J C;  3O5C A;  2GB8 B;  1CXA A;  1S5L V;  1M60 A;  3H1K D;  1L9B C;  2YCC A;  1C75 A;  1I8P A;  4FA9 A;  1ZRT D;  3DP5 A;  4IL6 V;  1CNO A;  2Y0E A;  1IO3 A;  2ZON G;  1OAE A;  1QN2 A;  1DT1 A;  1HJ4 A;  2FRC A;  1KYO W;  1A2S A;  1LC1 A;  1FCD C;  3OA8 B;  5DFS A;  1RAP A;  2C1D B;  2YIU B;  2D0S A;  3SWS A;  2B12 B;  4UB6 V;  3SXT A;  4FB1 A;  1C6R A;  3L4O A;  1MZ4 A;  1MG2 D;  2C9X B;  3KZI V;  3SLE A;  4AAO A;  1KYO D;  1E2R A;  1H33 B;  1COR A;  1VYD A;  1LMS A;  1CTY A;  2QG4 A;  3RMZ A;  2GC4 D;  1KV9 A;  5KLI B;  3GW6 A;  3WFE C;  1SQV D;  2BPB B;  1CTZ A;  3KHU A;  1W5C T;  3C2C A;  3OCD B;  1CRG A;  2C1U A;  2ORL A;  4RJT A;  1C7M A;  5KAF V;  3PXS A;  3NBS A;  1BL9 A;  3ZOY A;  1A8C A;  4EIE A;  2Y0C A;  1NTK D;  2C2C A;  1L0N D;  4QAO A;  1H9Y A;  2JTI B;  3M97 X;  2K9J B;  2AXT V;  1K3H A;  1C6O A;  2GIW A;  5KLV D;  1E8E A;  3JBT B;  1J3S A;  1CSU A;  1CCR A;  4PWA A;  4WQ7 A;  3CX5 W;  2DGE A;  3H1J D;  1IQC A;  1ZZH A;  1CRY A;  1YIC A;  2N9I A;  1NTZ D;  3L71 D;  2BCN B;  3PTZ A;  2XTS B;  3DMI A;  4L3H A;  351C A;  1I6E A;  2AI5 A;  3CP5 A;  2ZZS 1;  5CIH B;  1CYC A;  4PJ0 V;  4FAN A;  3FWL A;  1E29 A;  3VYM A;  1RZ6 A;  1DW0 A;  3CYT I;  5GTH V;  4EID A;  1GDV A;  2N18 C;  4O1W A;  1HCM A;  3L4M A;  1AOF A;  1CC5 A;  4EDF A;  4RSZ A;  1NML A;  4DY9 A;  3BCC D;  4N0K A;  2FYN B;  3WFD C;  1FI9 A;  5E79 V;  1DVV A;  1AYG A;  2YQB A;  1SQX D;  1LFM A;  3MK7 C;  1QKS A;  1YCC A;  1FI3 A;  1SQQ D;  2KS1 A;  1RAQ A;  3HQ8 A;  2ZXY A;  4EIC A;  1CYI A;  5CYT R;  4AAM A;  2CXB A;  1I55 A;  4Y5R A;  1S6V B;  451C A;  1R0Q A;  2O3J A;  1PP9 D;  4D6T D;  4Q5P A;  3L73 D;  3CWB D;  1HJ5 A;  1CYJ A;  3CXH W;  1DII C;  1KX7 A;  3A9F A;  1H33 A;  1SQP D;  1W2L A;  2FYU D;  2V08 A;  2BCC D;  3NBT A;  1MG3 D;  1I5T A;  1AOQ A;  3RN1 A;  1F1C A;  1M70 A;  3SVW A;  2C1V A;  5C0Z A;  1H9X A;  1U74 B;  2V07 A;  3ZOW A;  3GG2 A;  1CSW A;  3CXH D;  5AUR A;  2BGV X;  3OA8 A;  4FA1 A;  1F1F A;  1AKK A;  2RN0 A;  1CXC A;  2D0W A;  1H31 B;  2B4Z A;  2CE1 A;  2CA3 B;  2FWL A;  4UB8 V;  5KKZ B;  2ZOO A;  3O0R C;  3WFB C;  2KNC B;  4AAN A;  1BCC D;  3WC8 A;  2JQR A;  1KB0 A;  1GU2 A;  4WQC A;  1CRC A;  1ETP A;  1N90 A;  3CU4 A;  1WEJ F;  4WQA A;  3DR0 A;  2CE0 A;  3PXT A;  1H32 B;  3OCD A;  4L3G A;  4NFG B;  3L70 D;  1DVH A;  1A56 A;  1CIE A;  1QL3 A;  4YE1 A;  155C A;  5C9M A;  1K3G A;  2HV4 A;  1IZL 0;  1CIF A;  1WVE C;  3X39 A;  5DJQ C;  1FOC A;  1GKS A;  3WU2 V;  4FA5 A;  2MHM A;  1CIH A;  1C2R A;  2B11 B;  2ZBO A;  4H0J A;  1CRH A;  1GIW A;  1NTM D;  3VMA A;  4WQE A;  2B10 B;  3ZBM A;  1IRV A;  4WQ8 A;  1BE3 D;  1KIB A;  1CHH A;  1DW1 A;  1HH7 A;  3A0B V;  2PCC B;  1I54 A;  3A0H V;  1CHI A;  3O1Y A;  1N50 A;  1LC2 A;  1P84 D;  2C1D A;  1BGY D;  1FI7 A;  2RMZ A;  3RN0 A;  1YEA A;  2OZ1 B;  4WQ9 A;  1CSV A;  3VRD A;  1YNR A;  1C52 A;  2BH4 X;  2YK3 A;  3H1L D;  5B6Q A;  3HQ6 A;  2QJK B;  5CIE B;  1KX2 A;  2N3Y A;  2QJY B;  5IY5 1;  1FJ0 A;  4P4Q B;  3CX5 D;  3O20 A;  1CTJ A;  4WQB A;  1NU1 D;  1COT A;  1PPJ D;  3ITK A;  2LIT A;  4A7P A;  2N9J A;  1CRJ A;  1IRW A;  1EB7 A;  3L75 D;  3H1I D;  4U3F D;  3PLN A;  1QYZ A;  1OCD A;  1I6D A;  1HJ3 A;  4LJI A;  2PCB B;  2N3B A;  2BH5 X;  1CO6 A;  4MU8 A;  4PD4 D;  1U75 B;  4KMG A;  4XXL A;  1EZV D;  4L1Q A;  2LIR A;  3TF5 A;  5KAI V;  1YTC A;  1CCH A;  1DW2 A;  2BLF B;  1H31 A;  1LS9 A;  4O1Q A;  1N9C A;  3WUI A;  4FAV A;  2B0Z B;  1N15 A;  1I8O A;  1CIG A;  1HRO A;  1CRI A;  1SQB D;  3NWV A;  2JWA A;  3WFC C;  3H1H D;  4H0K A;  3PXW A;  1DIQ C;  1FHB A;  5CIB B;  1DW3 A;  2Q3E A;  3PRJ A;  1HZV A;  3MK7 B;  5DJQ B;  3HQ9 A;  1CSX A;  5CIG B;  2I8F A;  4WQD A;  5CIF B;  2OZ1 A;  5CIC B;  1CHJ A;  1QL4 A;  1H32 A;  1HRC A;  2AIU A;  3ZOX A;  3HQ7 A;  4FA4 A;  1NMI A;  2MTA C;  2L4D A;  5TIS V;  5DF5 A;  4AX3 A;  2C8S A;  4V2K A;  2N18 B;  5H2F V;  3ZIY A;  2CA4 B;  1YFC A;  2VHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...