1SQVD

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqvD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqvD02
5AURA 2ZBOA 5TISV 4WQ9A 1CRJA 1H9XA 2RN0A 1CTJA 1H31A 2OZ1B 4RSZA 1SQQD 2YK3A 2BCCD 1S5LV 1I8OA 3L70D 1U74B 1DW3A 3CX5W 3OCDB 5CIDB 3HQ9A 2FWLA 3PLNA 2L91A 1MZ4A 1CHJA 1E2RA 5B5EV 3PXSA 2V08A 1F1CA 2N18C 3CWBD 1CSXA 2HV4A 1IZL0 1R0QA 3L4OA 4WQ7A 5CIGB 2PCCB 5KKZB 2D0WA 1QL4A 2BH4X 2I8FA 1LC2A 1MG3D 2V07A 2B0ZB 1NTZD 4N0KA 1L0ND 1FHBA 1WVEC 3ZOWA 1H32A 3PRJA 2RMZA 3KZIV 4EICA 2YCCA 1BGYD 3RMZA 2YQBA 1ETPA 1CIHA 1YNRA 4WQEA 5E79V 1CYJA 2O3JA 3PXTA 2B10B 3PXWA 3CXHW 1KX2A 4EIDA 1P84D 1LMSA 1GDVA 3ZIYA 4FANA 3A9FA 2N9YB 1C6SA 4XXLA 4GEDB 4XYDB 5CICB 1A2SA 1YCCA 1A8CA 1KYOD 1H33A 2GC4D 3WFDC 5B66V 3H1KD 2JTIB 1NIRA 1N15A 4RJTA 4V2KA 1AKKA 1NTMD 1BL9A 3JBTB 2N18B 2C1VA 2PCBB 5KAIV 4AAOA 4GYDA 1M60A 3O20A 1HH7A 1I6EA 1DW2A 1ZRTD 2MHMA 3CU4A 1YEBA 5CIHB 4FA9A 1PP9D 1IQCA 4FAVA 1OCDA 3CX5D 3WC8A 5B6QA 3H1HD 4WQAA 1RAPA 1KYOW 1M70A 1MG2D 1L0LD 5CIFB 5KAFV 1IRWA 1LS9A 1WEJF 2Y0CA 1N50A 1CIEA 1EZVD 1I6DA 1CIFA 1GIWA 2ZOOA 2BPBB 4H0JA 1CC5A 2C1UA 1FI9A 1C6RA 3CYTI 3ZCFA 3SJLA 1CHHA 2KS1A 2Y0EA 3BCCD 3M97X 1DW1A 2QJYB 4WQDA 2L4DA 3L72D 3CXHD 3WU2V 4YE1A 4UB6V 1CYCA 4D6TD 2YIUB 1YEAA 1KB9D 1HJ4A 1HJ5A 1LC1A 1K3GA 1ZZHA 1HZVA 1CORA 5TJHA 1QL3A 2B11B 3RN1A 1KX7A 1SQXD 3C2CA 4A7PA 1W2LA 3L74D 1IRVA 3OCDA 2Y0DA 4U3FD 1DVHA 4EIEA 155CA 2AXTV 1H32B 4O1WA 3FWLA 3ITKA 5EXQA 1OAEA 1DIIC 3OA8B 1VYDA 2N9JA 2BH5X 2AIUA 1SQVD 2GIWA 1I5TA 2QG4A 2N3BA 5IY51 2MTAC 4WQ8A 1COTA 1H9YA 5KLVD 4FA5A 1CRHA 1NMLA 3HQ7A 1E29A 1L9JC 1N90A 1L9BC 1I8PA 1GJQA 4AAMA 4WQCA 3H1ID 1C2NA 5C0ZA 5CIBB 1M6ZA 2FRCA 3SVWA 1FI7A 3NBSA 3HQ8A 4K3IA 1FCDC 5DFSA 1DT1A 3TGUD 1CO6A 3TF5A 1DW0A 2ZZS1 1QN2A 2JQRA 3SWSA 3MK7C 1CYIA 1C75A 1HCMA 3SXTA 2BCNB 1CRCA 4AX3A 1DIQC 2Q3EA 1NU1D 2ZONG 1B7VA 3VYMA 4LJIA 3ZOOA 1AOQA 1J3SA 2C1DB 4J20A 4MU8A 2QJPB 3WFEC 3WFCC 1CRGA 1FJ0A 4PW9B 1CCHA 1QKSA 1H1OA 3ZOYA 3L75D 3A0HV 1AOFA 3VNWA 351CA 1F1FA 2CA3B 2CE1A 2EXVA 5DF5A 3X39A 1H31B 2C9XB 1C6OA 1I54A 2FYUD 1NNOA 3VMAA 3DR0A 3O1YA 1JDLA 5GTIV 2ZXYA 4P4QB 1FI3A 1NTKD 1LFMA 2C2CA 2B12B 2CXBA 5GTHV 1CIGA 4FA4A 1U75B 1CSVA 3ZBMA 1CSUA 4UB8V 1GU2A 2OZ1A 4FA1A 1HZUA 1CTZA 3MK7B 1FOCA 2AI5A 1A56A 4WQBA 1IO3A 1QYZA 1N9CA 1S6VB 1CXCA 2JWAA 1RAQA 1CTYA 3GG2A 1EB7A 1CSWA 3PH2B 3L71D 1CHIA 1GKSA 3WUIA 3HQ6A 4NFGB 2LIRA 2C8SA 1CEDA 1CRYA 2CE0A 2GB8B 1PPJD 3SLEA 1NMIA 1AYGA 451CA 4L1QA 3O0RC 1YTCA 1SQPD 4FB1A 4Q5PA 5DJQC 2K9JB 2FYNB 1K3HA 1I55A 1C52A 3OA8A 4O1QA 3GW6A 3TDKA 3CP5A 2DVHA 4L3HA 4AANA 1H33B 1CNOA 4DY9A 4H0KA 3PTZA 4EIFA 4KMGA 4PWAA 1C7MA 1DVVA 3TYIA 1W5CT 2GC7D 2QJKB 3H1LD 1YICA 1RZ5A 2N3YA 4AALA 3DMIA 2D0SA 4Y5RA 3RN0A 1CXAA 3NWVA 5C9MA 2DGEA 2A06D 1HRCA 1BCCD 1GQ1A 3H1JD 2N9IA 2BLFB 2LITA 1KB0A 2CA4B 3PHLA 2XTSB 1YIQA 2VHDA 1BE3D 2PACA 3WFBC 1E8EA 4PJ0V 5CYTR 2B4ZA 4EDFA 4PD4D 2ORLA 3DP5A 2IBZD 3L4MA 1KIBA 2C1DA 3RLMA 3ZOXA 5H2FV 3NBTA 3VRDA 3KHUA 1HROA 5DJQB 1SQBD 1HJ3A 5CIEB 3A0BV 4L3GA 1C2RA 2KNCB 5KLIB 3O5CA 1YFCA 3ORVA 4IL6V 1KV9A 1RZ6A 2BGVX 3L73D 4QAOA 1CRIA 1CCRA 4JCGA
chains in the Genus database with same CATH superfamily
2P2UA 2YXQB 2XV5A 3AEBC 2HODA 2A45G 2KSEA 3AEDC 4ZNCA 1ZR2A 1H31A 1JMMA 2YK3A 2BCCD 1JTHA 1KORA 2OYIC 3RK3B 1KQLA 1I8OA 1S2EA 1U74B 3I55P 2D2CC 3KQGA 1BGYE 2JO1A 5CIDB 2Y9YA 1YI2P 5B5EV 1BSHA 1RE3C 2DW3A 1F1CA 3CWBD 1CSXA 1IZL0 1QVGO 2WSCJ 2ZYGA 2YKPA 1NYHA 2OTLP 3AECC 5CCHD 1MG3D 3RK2C 3BCCJ 1NTZD 1FHBA 3CL3D 1RY3A 1RF1A 3PRJA 3CCRP 4JPZB 2YCCA 3G3ZA 4W7YA 1YNRA 3H1JE 2QEXP 3V4WA 5E79V 5BVZA 1CI6A 4ZKUA 2B10B 3CXHW 3VP8A 1P84D 1GDVA 3CI9A 1X8YA 5AVTB 1U7MA 3V5BA 1YJ9P 4XYDB 4CPGA 2WMMA 1YCCA 2OYIB 3CX5E 1Y9BA 2QM8A 1T3UA 1SQBE 2D2CB 2QJYC 2P1JA 1GW3A 1N15A 3NMDA 4RJTA 3HE5B 2YIUC 2ITAA 5KLVJ 4H0LD 1YJWP 3MD0A 4U7JA 1HH7A 3AEEC 3CU4A 2BCCE 5CIHB 2R5BA 3V2NA 5GTIH 3RK2B 1GU5A 1IQCA 1FOSE 4FAVA 4B86A 1OVRA 5B6QA 1EDJA 1DX7A 5GTHH 3MHVA 3KYQA 4KJMA 2HPCB 1T3JA 4OVNF 1KV4A 5KAFV 1S9KD 1LS9A 1WEJF 1KB9E 1JCCA 2Q3IA 1KYOH 1QL2A 1CIFA 4OH8B 3TSIA 1GIWA 2A06G 2BPBB 2Q9IA 1FI9A 5KLVK 2K37A 1K04A 1NWQA 3ZCFA 2KNCA 3PJSK 2M8RA 4GKGA 3RBXA 3CC7P 1DW1A 2QJYB 5AW4B 1S1CX 2H8PD 1VL2A 2QM7A 1Y47A 1M7LA 4D6TD 2YIUB 2KOGA 4WY4D 3V2RA 1HJ4A 2LR2A 3D0WA 1HZVA 1CORA 5TJHA 1SQXD 3C2CA 1W2LA 3L74D 2M0BA 2Y0DA 4U3FD 2FYZA 2P10A 1LTJC 5AVYB 3CXHI 1H88A 1M1JC 1FZEA 1OAEA 1DIIC 3WUTA 5AVVB 1IJDB 1VYDA 1MFTA 3P8MC 3L70J 2BH5X 1MFZA 2WVRA 3LIDA 5APVA 3G4SP 1COTA 1NMLA 3L72G 1E29A 2C9LY 4AAMA 1GJQA 1YQ4C 1EQ7A 4GDOA 1M6ZA 1FI7A 3GHGC 2GA1A 1KQSO 1K73Q 5CBOA 2WSFJ 1RHZB 5H2FH 3NTNA 1ZOYC 1KD1Q 1CYIA 3SXTA 3SSUA 2N1TA 2WQYC 3T97A 2E75D 3HTKA 1PGPA 2WTYA 3VYMA 3M0DA 1J3SA 2WT7B 1LTJB 3WFCC 5KTBA 1M1JB 3H1LJ 1CCHA 1QKSA 2J58A 1YTZT 4R4MA 2OQQA 1HTLC 4D6TE 3SWFA 351CA 2HR3A 1F1FA 4L75A 2CA3B 2CE1A 3QH9A 3H1KG 2C9XB 1I54A 1L0NK 3FWNA 5B5EH 1LP1A 2ZYDA 1VQOP 3DR0A 1YJNP 1JDLA 1EZVI 1IC2A 3GHGB 1PPJE 3AE8C 2K3RA 5AVWB 1CSVA 3ZBMA 2KZJA 3B8EB 2N1TD 2WITA 1VPCA 3HUSA 5KJ7C 4WQBA 2PGDA 1QYZA 1RE4C 1M56D 5E79H 2JWAA 5AW3B 3O6QB 1GTWA 2JJLA 3PH2B 1GKSA 5APWA 2Z5HA 1CRYA 1YITP 2GB8B 1HGVA 1NMIA 2WPQA 3TNUA 1OVUA 3H6PA 4L1QA 3O0RC 1YBKA 1GW4A 2PP6A 3BCCG 4YXDC 4Q5PA 3LW5J 3OA7A 5L8RJ 2KZIA 1ZR4A 1K3HA 2H43A 4BRYA 3G6EP 3OA8A 5KLIC 3KZIE 4AANA 1W2BO 1R5SA 1AVOA 1L2PA 2JR8A 1GL2C 4EIFA 5CCGC 1HUCA 1DVVA 3RGUA 1W5CT 3AEFC 2GC7D 1YICA 2P67A 2WPSA 2NPSA 4PV1D 1G1IA 1S4XA 1X79B 3AEAC 5KAFH 3NWVA 2KXPB 1LTSC 4C7NB 2A06D 2N9IA 2H7HA 2LITA 3E1RA 1SFCA 4HYTB 1W5CE 5KLVG 1KILD 1NO4A 2PACA 1PL5A 2B4ZA 2B89A 2UWJE 2K9YA 2ORLA 3DP5A 1FU1A 3L4MA 1KIBA 2QSIA 3MUDA 3RL0g 1S3JA 4KT0J 4L3GA 1C2RA 5KLIB 3NXSA 1KV9A 4HJGH 3L73D 1FDIA 1GL2B 1SQVK 2IBZI 4JCGA 1CTJA 2OYHA 2ZYAA 4EI2A 4N78D 2R44A 3FX0A 1L0LJ 2WSEH 1SS1A 3OCDB 2FFDC 1SFCD 3PXSA 1VQPP 2ZAEB 3P7KA 4IOIH 1OZHA 3CX5H 1R0QA 4I6MC 2KIKA 1PGQA 2JWDA 1LC2A 1LT1A 3E1IA 5EFWB 2V07A 5CCHC 1NU1K 3L72J 1H32A 3GLMA 3F5HA 3KZIV 3OJAB 3RMZA 1BGYD 1LTGC 1JNMA 2YQBA 2A06E 1ETPA 4WQEA 1RH5B 2O3JA 5AW1B 1L0LK 3PXTA 1HH0A 1AQ5A 3PXWA 2O1KA 2NRGA 1M1KQ 3L70G 1BDDA 2M3EA 3NFQA 1YIJP 1G2CA 3VP9A 2OYOA 2K9JA 1A8CA 3A2AA 2K1AA 1H33A 1KB9H 2CPSA 1P84I 3WFDC 3CLQA 5B66V 3H1KD 2JTIB 1Q90D 1NIRA 5CHXA 2FFDB 3A5TA 2YKOA 1NTKK 1SLQA 3U1AA 1AKKA 3VTPC 1CW5A 2O01J 1VQ6P 4OGQD 3JBTB 4H0LC 1FBMA 1FZGA 1I6EA 1FAVA 4N6JA 3MGNA 1FJKA 4FA9A 4N78E 1IFJA 1UIXA 3CX5D 5M1BA 1KYOW 3KDPB 2PFXA 1T2KD 3KPEA 3L72E 3H1LG 1IRWA 4W7ZA 3A0HE 5AW6B 2HODB 1LTIC 4H0JA 1SQPK 2C1UA 1JTHB 1C6RA 3CYTI 4TT3H 3S1KA 3SJLA 3L75J 3AE7C 1CHHA 2KS1A 2Y0EA 3BCCD 5AW8B 2C0XA 1JY3O 2RKLA 3QWOC 1FZFA 4YPCA 1KB9D 4WY4C 3H1HG 4H0LB 3Q5RA 1ZZHA 1PGJA 3RN1A 2SPZA 1KFNA 3VMZA 1FJPA 5AW5B 1DVHA 1JY3P 2M5AA 1GMJA 1KTMA 3V4QA 2QJPC 4O1WA 1IZNB 5EXQA 3H1KE 1HWTC 3A7OA 1H89A 1U57A 2E74C 2B87B 2N9JA 1OVVA 4RKUJ 1XTCC 4H13D 2N3BA 4OWFA 4IFDK 4XA4A 4WQ8A 4TLFA 5KLVD 1VQ7P 2XNXA 4FA5A 3M91A 1CRHA 1N73A 5AVXB 3CWBJ 1L9BC 3V2QA 3L36A 1I8PA 4NPDA 1OFCX 4AUWA 2POHA 1VQ9P 2C9NY 1EXIA 3HRNA 3HQ8A 3M9BA 1KQFB 4K3IA 2L5GB 1FCDC 2IYOA 1YQ3C 1DT1A 2QVAA 1CO6A 3TF5A 3M0AA 3RK3D 1FDMA 4I1LA 3SWSA 3MK7C 4WY4B 3D70A 1C75A 1VQMP 2OYIA 1CRCA 1KYOI 2KI7B 4AX3A 2JP3A 2E75C 2Q1KA 3V2PA 4DZOA 3H32A 4LJIA 1AOQA 2C1DB 1SQVG 3FXEA 3HE5A 3IAOA 2QJPB 1K9MQ 1BDCA 3BCCE 3CCSP 1H1OA 1QX8A 3ZOYA 2P58A 3A0HV 1AOFA 1AQTA 2E74B 2BEZF 2FBWC 3H1IG 2IZ1A 3KXDA 2EXVA 4PJ0E 1IFPA 1BCCJ 1VQLP 5DF5A 3Q5SA 2KLUA 1NTZK 2IPPA 1NAYA 1GK4A 2IDBA 1OMIA 3VMAA 2KUBA 3TGUG 2HPCA 3AE5C 3B71A 1BE3J 3RL0D 3A0BE 2ZXYA 2OGUA 5APSA 1LFMA 3CCEP 3TK1A 2CXBA 4IL6E 4M3LA 1U75B 2A45H 2OZ1A 1HZUA 3KZIH 2GUVA 3MK7B 1FOCA 2AI5A 5KLVE 1MKMA 1S5LE 1L0LG 1N9CA 1S6VB 2IX7C 3M0DC 1CXCA 3TYYA 1RAQA 2E75B 3GG2A 2W8ZA 1EB7A 1CSWA 1NJIQ 1EZVG 4RO0A 3WUIA 1LNQA 1N2DC 1NOHA 2LIRA 2C8SA 2AXCA 1SQQJ 1PPJD 1ZW0A 5APXA 3RK3E 3RK2D 1RF0A 3CC2P 1NTKG 5DJQC 1JUNA 1C52A 3TDKA 2DVHA 1URQA 2HG5D 1SQXJ 3PTZA 4U3FJ 4KMGA 1BE3E 2W27A 3LIEA 1L0NJ 3TYIA 3GMAA 4ASVA 4Z1MH 3H1LD 3CMAP 4L74A 1JO5A 3DMIA 2H88C 2G8YA 2PRRA 3HUSC 4PD4E 4PV1C 4Y5RA 1EDIA 1SQQK 1CXAA 1MZ9A 2DGEA 4KHXA 3CCQP 1SQPG 3UIAA 2Q5UA 4EOTA 3WUUA 1YIQA 1KILC 2OARA 1Y8AA 5KKZC 1IFIA 1E8EA 5KAIE 2N9BA 4PJ0V 4QMAA 3RBZA 1SQXK 1HJ0A 3L70E 2XU6A 3RLMA 4HB1A 2W90A 2WT7A 1LTJA 4YXWH 1HBWA 5DJQB 1URQD 1JM0A 1NTMJ 5CIEB 3A0BV 1GDTA 3MP7B 1JY3N 1JMBA 4IL6V 1KN7A 4QAOA 2W83C 1XTGB 1PP9J 5AURA 5TISV 1JY2O 3H1HJ 3AE2C 1T8ZA 2E5YA 4RSZA 1CZQA 1LT9C 1S5LV 1FZCC 1J1DB 1L0NE 3HUSB 3O8ZA 4PV1B 1DW3A 3CX5W 1EXJA 3MIWA 3Q1MA 2W6JH 3HQ9A 3L75G 2L91A 1MZ4A 1QEXA 1E2RA 2V08A 1JY2P 2N18C 2IBZG 1ZXGA 2MJZA 2QRXA 2HV4A 4DJGA 1DD3A 1NTMK 4UB6E 1LGHB 1JCDA 1KILB 5CIGB 5KKZB 2D0WA 3H1LE 2I8FA 1YHQP 2B0ZB 3IF4A 4JBZA 1WVEC 3BATA 3O6QA 3ZOWA 3B5NA 2B88A 1ZN5A 4EICA 2AXTE 2IFMA 1CIHA 2KLVA 2NZ2A 1K8AQ 2V7QJ 4EIDA 3ZIYA 4FANA 1VF5D 3CCVP 3Q5PA 3ZDMA 3A9FA 1N7SA 2N9YB 1FOSF 4XXLA 2OYHC 5CICB 2I1KA 4JQ0D 4C46A 1LT9B 1R5LA 1FZCB 1USEA 3CWBG 2E76D 3HD7C 1SP4A 3H1HE 1OW8A 1H8AA 1EDKA 2GUSA 2GC4D 2WWWA 3CCJP 3A0HH 5AW0B 1SQVJ 2MKVA 5BU8B 4V2KA 3P32A 5B66E 2XKMA 1NTZG 2N18B 1Q82Q 3AE3C 5KAIV 4GYDA 3H1IJ 1DW2A 2M3BA 1ZRTD 1L4AA 2MHMA 5KJ7A 2HLOA 1YEBA 1DEEG 3B5ND 1VQ4P 2PAJA 1OCDA 2R3CA 1PGOA 1M70A 2FXPA 3TGUJ 1MG2D 2AEMA 1A02F 1L0LD 3FXDA 5DJUB 1T2KC 3H25A 3CXHE 1OX3A 2Y0CA 1N50A 1CIEA 1EZVD 1I6DA 1USDA 1N7SD 4YTPC 3E7KA 1NU1J 4GOEA 1NKNA 2ZT9D 4LC1A 2R3SA 3CX5I 2HFED 4WVZA 2NPSD 2OYHB 2IZ0A 1BCCG 4NPEA 1CC5A 4HH2A 1H0TA 5AW9B 1EC5A 3HD7B 1SVFA 3CC4P 1E79H 3M97X 3D6YA 1BE3G 1TU3F 4WQDA 2L4DA 3L72D 1GL2A 3SFEC 5CCGA 4H44D 4YE1A 4UB6V 2YMKA 1SQVE 2FYUJ 3BRTB 2YXRB 1HJ5A 1NGMB 1L4AD 5KJ7D 4UB8E 3D71A 4GODA 3W67A 3C9IA 1KX7A 1AV1A 4A7PA 1YYCA 2I1JA 1IRVA 3OCDA 2IFNA 1HVVA 155CA 2AXTV 1NTKJ 3H1IE 1H32B 1GZLA 3AE9C 1DIPA 1KB9I 2IYPA 1NAFA 5AW2B 1KMIZ 2WSSH 1SQQG 2H89C 3VN0A 2AIUA 4DCKA 2ZFCA 3TGUE 2WSCH 2QG4A 1M57D 4H13C 1H9YA 3L71J 1ZRTE 1N90A 4ZKPA 2FYUK 2I8DA 5K5GB 1JOCA 2RH0A 4WQCA 1C2NA 5CIBB 4MN4C 3SVWA 1AJYA 1L0LE 4IL6X 1HJBA 3NBSA 1SQXG 1WRGA 4PJ0H 3L74G 1JEKA 2ZXXA 1SQPJ 5DFSA 4U3FG 1EZVE 3HE4A 1L0NG 2ZZS1 2R5DA 3U1CA 1HCMA 3BRVB 2BCNB 4BWNA 3A0BH 3JC22 2Q3EA 3G9RA 1RF1C 1IK9A 4WB4A 4IL6H 3ZOOA 1DH3A 4J20A 2FFDA 2YMYA 4MU8A 1LWUA 4PW9B 1NTKE 3L75D 1FS0E 1S5LH 4JYBA 1Q7YQ 1JY2N 5CJ4A 3AEGC 3R2PA 3JSVC 4H13B 5CCHA 2E5TA 1N73C 3H1JJ 3X39A 1H31B 3IFMA 1C6OA 2ZVOB 1NTMG 3O1YA 5APUA 1KZUB 2HYNA 3RL0C 5DJTB 4P4QB 2C2CA 2B12B 4N3YB 1OW6A 3ABVC 2E42A 1CIGA 4FA4A 1FC2C 1PP9G 3BVHA 1CSUA 4UB8V 1OW7A 1SQBJ 1SQPE 1CTZA 1A56A 1NHLA 1IO3A 2Z5IA 3L37A 3IN6A 3B4SA 2M5AB 1CTYA 1QLED 1RF1B 3EQ2A 3BASA 5CJ0A 1CHIA 3HQ6A 2B9BA 4PD4H 1VQKP 1CEDA 5CMZA 2CE0A 2BCCJ 1CI6B 3C8VA 4Y28J 1IFMA 1IO4A 3N4XA 1YTZI 1N73B 2XNDH 3GW6A 5APQA 2JKVA 4L3HA 1SQBK 2B87A 5KAIH 3RL0B 2LXBA 3CCUP 3L75E 1NTZJ 4PWAA 2N3YA 4AALA 2IBZE 1LTTC 3RN0A 3H32B 1A02J 4K35A 1HRCA 2KB7P 1BCCD 1GQ1A 3AE1C 1RE3A 1KB0A 3K5BA 4WWIA 3V6IA 4GT1A 2Q7CA 3PHLA 2J5UA 1J2JB 2XTSB 3EFGA 4WY4A 1BE3D 2WSFH 4NPFX 1T6AA 5APYA 3WFBC 3FGAD 3M06A 4EIJA 5CYTR 2QIWA 1RF0C 2A45I 2WPRA 2LXCB 4PD4D 1JB0J 2QA4P 2C1DA 3ZOXA 3NBTA 3VRDA 1G1JA 3OW2O 1URQC 4UB6H 2KNCB 1QVFO 5APTA 5AVZB 3O5CA 1LTAC 3P8CD 3CWBE 4GIFA 2BGVX 1ZLLA 1X22A 1N7LA 1CCRA 4AQRD 2ZBOA 1NU1G 4WQ9A 1CRJA 1H9XA 2AXTH 2RN0A 4AYCA 3USSA 2OZ1B 1SQQD 2ZVNB 4I2LC 1NTZE 5TISE 2N1TC 3L70D 2D2CD 2V4HA 3S9OA 2FWLA 3A3YB 3PLNA 2KK7A 3SWKA 2E43A 1CHJA 1P84E 1U7JA 3WU2E 4DOJA 1MV8A 2FYUG 3L4OA 3M9QA 4WQ7A 1MUUA 2PCCB 3MZWB 1QL4A 2BH4X 1AA0A 1PFIA 4N0KA 5AVQB 1L0ND 2FXMA 5B66H 1CRIA 3L73G 2RMZA 4IFFA 4D6TJ 4ASWA 3GF3A 1KC8Q 1BCCE 1FE6A 2E74D 1URQB 3GF7A 1CYJA 1OIPA 3VMYA 1KX2A 2CPBA 1LMSA 3EWKA 3L74J 1ZMEC 2P7JA 1VF5C 3M9HA 1C6SA 4GEDB 1J1DC 3L71G 1A2SA 3LW5H 3R4YA 3CXHH 1IFNA 2E76C 2N1TB 1KYOD 3T97B 4EYYQ 2G3AA 1OWAA 3HTKB 2WZ7A 3S4RA 4L73A 1S9KE 2V7QH 3CPWO 3P8CE 1NTMD 1BL9A 2C1VA 2PCBB 4AAOA 1QL1A 1NH4A 4ZMDA 1AVYA 1M60A 3O20A 1BGYG 4XE5B 1SQQE 2KP8A 1PP9D 1FZAA 3B5NC 3WC8A 3U59A 3H1HD 4WQAA 1LP1B 1RAPA 3VMXA 4WBAA 5CIFB 1M1JA 4UB8H 1J1EC 5BU5A 1VDFA 1N7SC 2ZOOA 1VF5B 2ZT9C 1SQXE 2YKQA 3L74E 1W2EA 2NPSC 3H1JG 1VQ5P 4U3FE 2AEFA 2E76B 1FZBA 4O9BA 1GU4A 2ZJSE 5GTIE 3GHGA 1SFCC 1OXZA 2LKMA 5CBNA 3CXHD 3WU2V 1CYCA 4H44C 4Y99C 1YEAA 5GTHE 3L35A 1Z56A 2Y9ZA 1LC1A 2YNYA 1K3GA 1SQBG 1L4AC 1QL3A 2B11B 1E5WA 3TNUB 3W68A 2FXOA 2Q6QA 1PZQA 3MUDC 4EIEA 3N7NA 1ZP0C 3B5NB 1KYOE 3FWLA 1NVOA 3ITKA 2R32A 4BRYB 3OA8B 2OTKE 1Q2NA 2BEQD 2BCCG 2KSJA 1KILA 1R8EA 1J1EB 1NTME 2W6AA 4GOFA 1SQVD 2GIWA 1I5TA 2JEEA 1S72P 5IY51 1N7SB 2MTAC 2JDIH 2ZT9B 3HQ7A 1L9JC 4DT0A 2NPSB 1PP9E 3CCMP 2C0WA 3H1ID 5C0ZA 4C7RA 2FY8A 3L4FA 2FRCA 1D7MA 3I5CA 4HKZH 1LJ2A 1SFCB 3TGUD 1DW0A 1IK7A 2AEJA 4H44B 4OGQC 4Y99B 1QN2A 2O1JA 2JQRA 4K3AA 3JCUH 1LT9A 1VQ8P 1FZCA 1L4AB 1DEBA 3IR9A 1DIQC 1NU1D 2ZONG 1K05A 1B7VA 1RE4A 4C7NA 1HF9A 2Z4EA 1X9VA 1PV3A 3WFEC 1FDOA 2J59M 1CRGA 1CSBA 3VOPA 1FJ0A 3AE6C 1VQNP 2XDJA 1GK6A 2K88A 3WUVA 2O01H 4I7ZC 3VNWA 2GM4A 1DD4A 2YO2A 4IFMA 1WT6A 5AW7B 2FYUD 2FYNC 1H0TB 1NNOA 3AE4C 5H2FE 5C39A 1RQVA 4LGDE 2QE7H 5GTIV 4LLHA 3PP5A 1FI3A 1NTKD 2O01N 2CK3H 3C1LA 5GTHV 4BXLA 2QJKC 1GU2A 3G71P 4FA1A 3MTUE 4OGQB 1RQUA 3I56P 1NKZB 3HD7A 5AVSB 4JF7A 3CCLP 4XFJA 1HGZA 3L73J 2ZXEB 3OAKA 3L71D 1LWUC 3CD6P 3PH0A 3CMEP 1ZV8A 5B5EE 1EDLA 4NFGB 3EFFK 2KYVA 4I7ZB 3SLEA 1UIIA 1AYGA 451CA 5AVRB 2XZRA 1YTCA 1M8OB 1SQPD 1N86A 4FB1A 1G2CB 3WMM0 1AFOA 1Q86Q 2K9JB 1NU1E 2FYNB 2W6BA 1I55A 4O1QA 4D6TG 3CP5A 1H33B 1CNOA 3F89A 2WPVB 1WMKA 4DY9A 1GL2D 5E79E 1KILE 2OTJP 4H0KA 5CCGD 3SWYA 4R4LA 4RESB 4W80A 1C7MA 3HE4B 1X0TA 2QJKB 1RZ5A 3RK3C 1BGYJ 2D0SA 3D6ZA 3HD7D 1S5LX 1M90Q 1IFDA 3Q3DA 2FYUE 1KQGB 1Q81Q 5C9MA 1PPJG 3Q2YA 1PIXA 3H1JD 2BLFB 1LWUB 5TISH 3L73E 2CA4B 5AVUB 2VHDA 1N8RQ 1QGKB 4EDFA 3SFDC 2VRSA 3H1KJ 1GD2E 2IBZD 5H2FV 1P84H 3KHUA 3II6A 1HROA 1SQBD 3WU2H 1HJ3A 4JYCA 2WSEJ 2FKWB 3JCUE 2BASA 3L71E 3VYIA 2KS1B 1YFCA 3ORVA 1LTBC 5KAFE 4L76A 1RZ6A 1KFMA 4PD4I 1BSNA 2YO3A
chains in the Genus database with same CATH topology
5AURA 2ZBOA 5TISV 4WQ9A 1CRJA 1H9XA 2RN0A 1CTJA 1H31A 2OZ1B 4RSZA 1SQQD 2YK3A 2BCCD 1S5LV 1I8OA 3L70D 1U74B 1DW3A 3CX5W 3OCDB 5CIDB 3HQ9A 2FWLA 3PLNA 2L91A 1MZ4A 1CHJA 1E2RA 5B5EV 3PXSA 2V08A 1F1CA 2N18C 3CWBD 1CSXA 2HV4A 1IZL0 1R0QA 3L4OA 4WQ7A 5CIGB 2PCCB 5KKZB 2D0WA 1QL4A 2BH4X 2I8FA 1LC2A 1MG3D 2V07A 2B0ZB 1NTZD 4N0KA 1L0ND 1FHBA 1WVEC 3ZOWA 1H32A 3PRJA 2RMZA 3KZIV 4EICA 2YCCA 1BGYD 3RMZA 2YQBA 1ETPA 1CIHA 1YNRA 4WQEA 5E79V 1CYJA 2O3JA 3PXTA 2B10B 3PXWA 3CXHW 1KX2A 4EIDA 1P84D 1LMSA 1GDVA 3ZIYA 4FANA 3A9FA 2N9YB 1C6SA 4XXLA 4GEDB 4XYDB 5CICB 1A2SA 1YCCA 1A8CA 1KYOD 1H33A 2GC4D 3WFDC 5B66V 3H1KD 2JTIB 1NIRA 1N15A 4RJTA 4V2KA 1AKKA 1NTMD 1BL9A 3JBTB 2N18B 2C1VA 2PCBB 5KAIV 4AAOA 4GYDA 1M60A 3O20A 1HH7A 1I6EA 1DW2A 1ZRTD 2MHMA 3CU4A 1YEBA 5CIHB 4FA9A 1PP9D 1IQCA 4FAVA 1OCDA 3CX5D 3WC8A 5B6QA 3H1HD 4WQAA 1RAPA 1KYOW 1M70A 1MG2D 1L0LD 5CIFB 5KAFV 1IRWA 1LS9A 1WEJF 2Y0CA 1N50A 1CIEA 1EZVD 1I6DA 1CIFA 1GIWA 2ZOOA 2BPBB 4H0JA 1CC5A 2C1UA 1FI9A 1C6RA 3CYTI 3ZCFA 3SJLA 1CHHA 2KS1A 2Y0EA 3BCCD 3M97X 1DW1A 2QJYB 4WQDA 2L4DA 3L72D 3CXHD 3WU2V 4YE1A 4UB6V 1CYCA 4D6TD 2YIUB 1YEAA 1KB9D 1HJ4A 1HJ5A 1LC1A 1K3GA 1ZZHA 1HZVA 1CORA 5TJHA 1QL3A 2B11B 3RN1A 1KX7A 1SQXD 3C2CA 4A7PA 1W2LA 3L74D 1IRVA 3OCDA 2Y0DA 4U3FD 1DVHA 4EIEA 155CA 2AXTV 1H32B 4O1WA 3FWLA 3ITKA 5EXQA 1OAEA 1DIIC 3OA8B 1VYDA 2N9JA 2BH5X 2AIUA 1SQVD 2GIWA 1I5TA 2QG4A 2N3BA 5IY51 2MTAC 4WQ8A 1COTA 1H9YA 5KLVD 4FA5A 1CRHA 1NMLA 3HQ7A 1E29A 1L9JC 1N90A 1L9BC 1I8PA 1GJQA 4AAMA 4WQCA 3H1ID 1C2NA 5C0ZA 5CIBB 1M6ZA 2FRCA 3SVWA 1FI7A 3NBSA 3HQ8A 4K3IA 1FCDC 5DFSA 1DT1A 3TGUD 1CO6A 3TF5A 1DW0A 2ZZS1 1QN2A 2JQRA 3SWSA 3MK7C 1CYIA 1C75A 1HCMA 3SXTA 2BCNB 1CRCA 4AX3A 1DIQC 2Q3EA 1NU1D 2ZONG 1B7VA 3VYMA 4LJIA 3ZOOA 1AOQA 1J3SA 2C1DB 4J20A 4MU8A 2QJPB 3WFEC 3WFCC 1CRGA 1FJ0A 4PW9B 1CCHA 1QKSA 1H1OA 3ZOYA 3L75D 3A0HV 1AOFA 3VNWA 351CA 1F1FA 2CA3B 2CE1A 2EXVA 5DF5A 3X39A 1H31B 2C9XB 1C6OA 1I54A 2FYUD 1NNOA 3VMAA 3DR0A 3O1YA 1JDLA 5GTIV 2ZXYA 4P4QB 1FI3A 1NTKD 1LFMA 2C2CA 2B12B 2CXBA 5GTHV 1CIGA 4FA4A 1U75B 1CSVA 3ZBMA 1CSUA 4UB8V 1GU2A 2OZ1A 4FA1A 1HZUA 1CTZA 3MK7B 1FOCA 2AI5A 1A56A 4WQBA 1IO3A 1QYZA 1N9CA 1S6VB 1CXCA 2JWAA 1RAQA 1CTYA 3GG2A 1EB7A 1CSWA 3PH2B 3L71D 1CHIA 1GKSA 3WUIA 3HQ6A 4NFGB 2LIRA 2C8SA 1CEDA 1CRYA 2CE0A 2GB8B 1PPJD 3SLEA 1NMIA 1AYGA 451CA 4L1QA 3O0RC 1YTCA 1SQPD 4FB1A 4Q5PA 5DJQC 2K9JB 2FYNB 1K3HA 1I55A 1C52A 3OA8A 4O1QA 3GW6A 3TDKA 3CP5A 2DVHA 4L3HA 4AANA 1H33B 1CNOA 4DY9A 4H0KA 3PTZA 4EIFA 4KMGA 4PWAA 1C7MA 1DVVA 3TYIA 1W5CT 2GC7D 2QJKB 3H1LD 1YICA 1RZ5A 2N3YA 4AALA 3DMIA 2D0SA 4Y5RA 3RN0A 1CXAA 3NWVA 5C9MA 2DGEA 2A06D 1HRCA 1BCCD 1GQ1A 3H1JD 2N9IA 2BLFB 2LITA 1KB0A 2CA4B 3PHLA 2XTSB 1YIQA 2VHDA 1BE3D 2PACA 3WFBC 1E8EA 4PJ0V 5CYTR 2B4ZA 4EDFA 4PD4D 2ORLA 3DP5A 2IBZD 3L4MA 1KIBA 2C1DA 3RLMA 3ZOXA 5H2FV 3NBTA 3VRDA 3KHUA 1HROA 5DJQB 1SQBD 1HJ3A 5CIEB 3A0BV 4L3GA 1C2RA 2KNCB 5KLIB 3O5CA 1YFCA 3ORVA 4IL6V 1KV9A 1RZ6A 2BGVX 3L73D 4QAOA 1CRIA 1CCRA 4JCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AUR A;  2ZBO A;  5TIS V;  4WQ9 A;  1CRJ A;  1H9X A;  2RN0 A;  1CTJ A;  1H31 A;  2OZ1 B;  4RSZ A;  1SQQ D;  2YK3 A;  2BCC D;  1S5L V;  1I8O A;  3L70 D;  1U74 B;  1DW3 A;  3CX5 W;  3OCD B;  5CID B;  3HQ9 A;  2FWL A;  3PLN A;  2L91 A;  1MZ4 A;  1CHJ A;  1E2R A;  5B5E V;  3PXS A;  2V08 A;  1F1C A;  2N18 C;  3CWB D;  1CSX A;  2HV4 A;  1IZL 0;  1R0Q A;  3L4O A;  4WQ7 A;  5CIG B;  2PCC B;  5KKZ B;  2D0W A;  1QL4 A;  2BH4 X;  2I8F A;  1LC2 A;  1MG3 D;  2V07 A;  2B0Z B;  1NTZ D;  4N0K A;  1L0N D;  1FHB A;  1WVE C;  3ZOW A;  1H32 A;  3PRJ A;  2RMZ A;  3KZI V;  4EIC A;  2YCC A;  1BGY D;  3RMZ A;  2YQB A;  1ETP A;  1CIH A;  1YNR A;  4WQE A;  5E79 V;  1CYJ A;  2O3J A;  3PXT A;  2B10 B;  3PXW A;  3CXH W;  1KX2 A;  4EID A;  1P84 D;  1LMS A;  1GDV A;  3ZIY A;  4FAN A;  3A9F A;  2N9Y B;  1C6S A;  4XXL A;  4GED B;  4XYD B;  5CIC B;  1A2S A;  1YCC A;  1A8C A;  1KYO D;  1H33 A;  2GC4 D;  3WFD C;  5B66 V;  3H1K D;  2JTI B;  1NIR A;  1N15 A;  4RJT A;  4V2K A;  1AKK A;  1NTM D;  1BL9 A;  3JBT B;  2N18 B;  2C1V A;  2PCB B;  5KAI V;  4AAO A;  4GYD A;  1M60 A;  3O20 A;  1HH7 A;  1I6E A;  1DW2 A;  1ZRT D;  2MHM A;  3CU4 A;  1YEB A;  5CIH B;  4FA9 A;  1PP9 D;  1IQC A;  4FAV A;  1OCD A;  3CX5 D;  3WC8 A;  5B6Q A;  3H1H D;  4WQA A;  1RAP A;  1KYO W;  1M70 A;  1MG2 D;  1L0L D;  5CIF B;  5KAF V;  1IRW A;  1LS9 A;  1WEJ F;  2Y0C A;  1N50 A;  1CIE A;  1EZV D;  1I6D A;  1CIF A;  1GIW A;  2ZOO A;  2BPB B;  4H0J A;  1CC5 A;  2C1U A;  1FI9 A;  1C6R A;  3CYT I;  3ZCF A;  3SJL A;  1CHH A;  2KS1 A;  2Y0E A;  3BCC D;  3M97 X;  1DW1 A;  2QJY B;  4WQD A;  2L4D A;  3L72 D;  3CXH D;  3WU2 V;  4YE1 A;  4UB6 V;  1CYC A;  4D6T D;  2YIU B;  1YEA A;  1KB9 D;  1HJ4 A;  1HJ5 A;  1LC1 A;  1K3G A;  1ZZH A;  1HZV A;  1COR A;  5TJH A;  1QL3 A;  2B11 B;  3RN1 A;  1KX7 A;  1SQX D;  3C2C A;  4A7P A;  1W2L A;  3L74 D;  1IRV A;  3OCD A;  2Y0D A;  4U3F D;  1DVH A;  4EIE A;  155C A;  2AXT V;  1H32 B;  4O1W A;  3FWL A;  3ITK A;  5EXQ A;  1OAE A;  1DII C;  3OA8 B;  1VYD A;  2N9J A;  2BH5 X;  2AIU A;  1SQV D;  2GIW A;  1I5T A;  2QG4 A;  2N3B A;  5IY5 1;  2MTA C;  4WQ8 A;  1COT A;  1H9Y A;  5KLV D;  4FA5 A;  1CRH A;  1NML A;  3HQ7 A;  1E29 A;  1L9J C;  1N90 A;  1L9B C;  1I8P A;  1GJQ A;  4AAM A;  4WQC A;  3H1I D;  1C2N A;  5C0Z A;  5CIB B;  1M6Z A;  2FRC A;  3SVW A;  1FI7 A;  3NBS A;  3HQ8 A;  4K3I A;  1FCD C;  5DFS A;  1DT1 A;  3TGU D;  1CO6 A;  3TF5 A;  1DW0 A;  2ZZS 1;  1QN2 A;  2JQR A;  3SWS A;  3MK7 C;  1CYI A;  1C75 A;  1HCM A;  3SXT A;  2BCN B;  1CRC A;  4AX3 A;  1DIQ C;  2Q3E A;  1NU1 D;  2ZON G;  1B7V A;  3VYM A;  4LJI A;  3ZOO A;  1AOQ A;  1J3S A;  2C1D B;  4J20 A;  4MU8 A;  2QJP B;  3WFE C;  3WFC C;  1CRG A;  1FJ0 A;  4PW9 B;  1CCH A;  1QKS A;  1H1O A;  3ZOY A;  3L75 D;  3A0H V;  1AOF A;  3VNW A;  351C A;  1F1F A;  2CA3 B;  2CE1 A;  2EXV A;  5DF5 A;  3X39 A;  1H31 B;  2C9X B;  1C6O A;  1I54 A;  2FYU D;  1NNO A;  3VMA A;  3DR0 A;  3O1Y A;  1JDL A;  5GTI V;  2ZXY A;  4P4Q B;  1FI3 A;  1NTK D;  1LFM A;  2C2C A;  2B12 B;  2CXB A;  5GTH V;  1CIG A;  4FA4 A;  1U75 B;  1CSV A;  3ZBM A;  1CSU A;  4UB8 V;  1GU2 A;  2OZ1 A;  4FA1 A;  1HZU A;  1CTZ A;  3MK7 B;  1FOC A;  2AI5 A;  1A56 A;  4WQB A;  1IO3 A;  1QYZ A;  1N9C A;  1S6V B;  1CXC A;  2JWA A;  1RAQ A;  1CTY A;  3GG2 A;  1EB7 A;  1CSW A;  3PH2 B;  3L71 D;  1CHI A;  1GKS A;  3WUI A;  3HQ6 A;  4NFG B;  2LIR A;  2C8S A;  1CED A;  1CRY A;  2CE0 A;  2GB8 B;  1PPJ D;  3SLE A;  1NMI A;  1AYG A;  451C A;  4L1Q A;  3O0R C;  1YTC A;  1SQP D;  4FB1 A;  4Q5P A;  5DJQ C;  2K9J B;  2FYN B;  1K3H A;  1I55 A;  1C52 A;  3OA8 A;  4O1Q A;  3GW6 A;  3TDK A;  3CP5 A;  2DVH A;  4L3H A;  4AAN A;  1H33 B;  1CNO A;  4DY9 A;  4H0K A;  3PTZ A;  4EIF A;  4KMG A;  4PWA A;  1C7M A;  1DVV A;  3TYI A;  1W5C T;  2GC7 D;  2QJK B;  3H1L D;  1YIC A;  1RZ5 A;  2N3Y A;  4AAL A;  3DMI A;  2D0S A;  4Y5R A;  3RN0 A;  1CXA A;  3NWV A;  5C9M A;  2DGE A;  2A06 D;  1HRC A;  1BCC D;  1GQ1 A;  3H1J D;  2N9I A;  2BLF B;  2LIT A;  1KB0 A;  2CA4 B;  3PHL A;  2XTS B;  1YIQ A;  2VHD A;  1BE3 D;  2PAC A;  3WFB C;  1E8E A;  4PJ0 V;  5CYT R;  2B4Z A;  4EDF A;  4PD4 D;  2ORL A;  3DP5 A;  2IBZ D;  3L4M A;  1KIB A;  2C1D A;  3RLM A;  3ZOX A;  5H2F V;  3NBT A;  3VRD A;  3KHU A;  1HRO A;  5DJQ B;  1SQB D;  1HJ3 A;  5CIE B;  3A0B V;  4L3G A;  1C2R A;  2KNC B;  5KLI B;  3O5C A;  1YFC A;  3ORV A;  4IL6 V;  1KV9 A;  1RZ6 A;  2BGV X;  3L73 D;  4QAO A;  1CRI A;  1CCR A;  4JCG A; 
#chains in the Genus database with same CATH topology
 2P2U A;  2YXQ B;  2XV5 A;  3AEB C;  2HOD A;  2A45 G;  2KSE A;  3AED C;  4ZNC A;  1ZR2 A;  1H31 A;  1JMM A;  2YK3 A;  2BCC D;  1JTH A;  1KOR A;  2OYI C;  3RK3 B;  1KQL A;  1I8O A;  1S2E A;  1U74 B;  3I55 P;  2D2C C;  3KQG A;  1BGY E;  2JO1 A;  5CID B;  2Y9Y A;  1YI2 P;  5B5E V;  1BSH A;  1RE3 C;  2DW3 A;  1F1C A;  3CWB D;  1CSX A;  1IZL 0;  1QVG O;  2WSC J;  2ZYG A;  2YKP A;  1NYH A;  2OTL P;  3AEC C;  5CCH D;  1MG3 D;  3RK2 C;  3BCC J;  1NTZ D;  1FHB A;  3CL3 D;  1RY3 A;  1RF1 A;  3PRJ A;  3CCR P;  4JPZ B;  2YCC A;  3G3Z A;  4W7Y A;  1YNR A;  3H1J E;  2QEX P;  3V4W A;  5E79 V;  5BVZ A;  1CI6 A;  4ZKU A;  2B10 B;  3CXH W;  3VP8 A;  1P84 D;  1GDV A;  3CI9 A;  1X8Y A;  5AVT B;  1U7M A;  3V5B A;  1YJ9 P;  4XYD B;  4CPG A;  2WMM A;  1YCC A;  2OYI B;  3CX5 E;  1Y9B A;  2QM8 A;  1T3U A;  1SQB E;  2D2C B;  2QJY C;  2P1J A;  1GW3 A;  1N15 A;  3NMD A;  4RJT A;  3HE5 B;  2YIU C;  2ITA A;  5KLV J;  4H0L D;  1YJW P;  3MD0 A;  4U7J A;  1HH7 A;  3AEE C;  3CU4 A;  2BCC E;  5CIH B;  2R5B A;  3V2N A;  5GTI H;  3RK2 B;  1GU5 A;  1IQC A;  1FOS E;  4FAV A;  4B86 A;  1OVR A;  5B6Q A;  1EDJ A;  1DX7 A;  5GTH H;  3MHV A;  3KYQ A;  4KJM A;  2HPC B;  1T3J A;  4OVN F;  1KV4 A;  5KAF V;  1S9K D;  1LS9 A;  1WEJ F;  1KB9 E;  1JCC A;  2Q3I A;  1KYO H;  1QL2 A;  1CIF A;  4OH8 B;  3TSI A;  1GIW A;  2A06 G;  2BPB B;  2Q9I A;  1FI9 A;  5KLV K;  2K37 A;  1K04 A;  1NWQ A;  3ZCF A;  2KNC A;  3PJS K;  2M8R A;  4GKG A;  3RBX A;  3CC7 P;  1DW1 A;  2QJY B;  5AW4 B;  1S1C X;  2H8P D;  1VL2 A;  2QM7 A;  1Y47 A;  1M7L A;  4D6T D;  2YIU B;  2KOG A;  4WY4 D;  3V2R A;  1HJ4 A;  2LR2 A;  3D0W A;  1HZV A;  1COR A;  5TJH A;  1SQX D;  3C2C A;  1W2L A;  3L74 D;  2M0B A;  2Y0D A;  4U3F D;  2FYZ A;  2P10 A;  1LTJ C;  5AVY B;  3CXH I;  1H88 A;  1M1J C;  1FZE A;  1OAE A;  1DII C;  3WUT A;  5AVV B;  1IJD B;  1VYD A;  1MFT A;  3P8M C;  3L70 J;  2BH5 X;  1MFZ A;  2WVR A;  3LID A;  5APV A;  3G4S P;  1COT A;  1NML A;  3L72 G;  1E29 A;  2C9L Y;  4AAM A;  1GJQ A;  1YQ4 C;  1EQ7 A;  4GDO A;  1M6Z A;  1FI7 A;  3GHG C;  2GA1 A;  1KQS O;  1K73 Q;  5CBO A;  2WSF J;  1RHZ B;  5H2F H;  3NTN A;  1ZOY C;  1KD1 Q;  1CYI A;  3SXT A;  3SSU A;  2N1T A;  2WQY C;  3T97 A;  2E75 D;  3HTK A;  1PGP A;  2WTY A;  3VYM A;  3M0D A;  1J3S A;  2WT7 B;  1LTJ B;  3WFC C;  5KTB A;  1M1J B;  3H1L J;  1CCH A;  1QKS A;  2J58 A;  1YTZ T;  4R4M A;  2OQQ A;  1HTL C;  4D6T E;  3SWF A;  351C A;  2HR3 A;  1F1F A;  4L75 A;  2CA3 B;  2CE1 A;  3QH9 A;  3H1K G;  2C9X B;  1I54 A;  1L0N K;  3FWN A;  5B5E H;  1LP1 A;  2ZYD A;  1VQO P;  3DR0 A;  1YJN P;  1JDL A;  1EZV I;  1IC2 A;  3GHG B;  1PPJ E;  3AE8 C;  2K3R A;  5AVW B;  1CSV A;  3ZBM A;  2KZJ A;  3B8E B;  2N1T D;  2WIT A;  1VPC A;  3HUS A;  5KJ7 C;  4WQB A;  2PGD A;  1QYZ A;  1RE4 C;  1M56 D;  5E79 H;  2JWA A;  5AW3 B;  3O6Q B;  1GTW A;  2JJL A;  3PH2 B;  1GKS A;  5APW A;  2Z5H A;  1CRY A;  1YIT P;  2GB8 B;  1HGV A;  1NMI A;  2WPQ A;  3TNU A;  1OVU A;  3H6P A;  4L1Q A;  3O0R C;  1YBK A;  1GW4 A;  2PP6 A;  3BCC G;  4YXD C;  4Q5P A;  3LW5 J;  3OA7 A;  5L8R J;  2KZI A;  1ZR4 A;  1K3H A;  2H43 A;  4BRY A;  3G6E P;  3OA8 A;  5KLI C;  3KZI E;  4AAN A;  1W2B O;  1R5S A;  1AVO A;  1L2P A;  2JR8 A;  1GL2 C;  4EIF A;  5CCG C;  1HUC A;  1DVV A;  3RGU A;  1W5C T;  3AEF C;  2GC7 D;  1YIC A;  2P67 A;  2WPS A;  2NPS A;  4PV1 D;  1G1I A;  1S4X A;  1X79 B;  3AEA C;  5KAF H;  3NWV A;  2KXP B;  1LTS C;  4C7N B;  2A06 D;  2N9I A;  2H7H A;  2LIT A;  3E1R A;  1SFC A;  4HYT B;  1W5C E;  5KLV G;  1KIL D;  1NO4 A;  2PAC A;  1PL5 A;  2B4Z A;  2B89 A;  2UWJ E;  2K9Y A;  2ORL A;  3DP5 A;  1FU1 A;  3L4M A;  1KIB A;  2QSI A;  3MUD A;  3RL0 g;  1S3J A;  4KT0 J;  4L3G A;  1C2R A;  5KLI B;  3NXS A;  1KV9 A;  4HJG H;  3L73 D;  1FDI A;  1GL2 B;  1SQV K;  2IBZ I;  4JCG A;  1CTJ A;  2OYH A;  2ZYA A;  4EI2 A;  4N78 D;  2R44 A;  3FX0 A;  1L0L J;  2WSE H;  1SS1 A;  3OCD B;  2FFD C;  1SFC D;  3PXS A;  1VQP P;  2ZAE B;  3P7K A;  4IOI H;  1OZH A;  3CX5 H;  1R0Q A;  4I6M C;  2KIK A;  1PGQ A;  2JWD A;  1LC2 A;  1LT1 A;  3E1I A;  5EFW B;  2V07 A;  5CCH C;  1NU1 K;  3L72 J;  1H32 A;  3GLM A;  3F5H A;  3KZI V;  3OJA B;  3RMZ A;  1BGY D;  1LTG C;  1JNM A;  2YQB A;  2A06 E;  1ETP A;  4WQE A;  1RH5 B;  2O3J A;  5AW1 B;  1L0L K;  3PXT A;  1HH0 A;  1AQ5 A;  3PXW A;  2O1K A;  2NRG A;  1M1K Q;  3L70 G;  1BDD A;  2M3E A;  3NFQ A;  1YIJ P;  1G2C A;  3VP9 A;  2OYO A;  2K9J A;  1A8C A;  3A2A A;  2K1A A;  1H33 A;  1KB9 H;  2CPS A;  1P84 I;  3WFD C;  3CLQ A;  5B66 V;  3H1K D;  2JTI B;  1Q90 D;  1NIR A;  5CHX A;  2FFD B;  3A5T A;  2YKO A;  1NTK K;  1SLQ A;  3U1A A;  1AKK A;  3VTP C;  1CW5 A;  2O01 J;  1VQ6 P;  4OGQ D;  3JBT B;  4H0L C;  1FBM A;  1FZG A;  1I6E A;  1FAV A;  4N6J A;  3MGN A;  1FJK A;  4FA9 A;  4N78 E;  1IFJ A;  1UIX A;  3CX5 D;  5M1B A;  1KYO W;  3KDP B;  2PFX A;  1T2K D;  3KPE A;  3L72 E;  3H1L G;  1IRW A;  4W7Z A;  3A0H E;  5AW6 B;  2HOD B;  1LTI C;  4H0J A;  1SQP K;  2C1U A;  1JTH B;  1C6R A;  3CYT I;  4TT3 H;  3S1K A;  3SJL A;  3L75 J;  3AE7 C;  1CHH A;  2KS1 A;  2Y0E A;  3BCC D;  5AW8 B;  2C0X A;  1JY3 O;  2RKL A;  3QWO C;  1FZF A;  4YPC A;  1KB9 D;  4WY4 C;  3H1H G;  4H0L B;  3Q5R A;  1ZZH A;  1PGJ A;  3RN1 A;  2SPZ A;  1KFN A;  3VMZ A;  1FJP A;  5AW5 B;  1DVH A;  1JY3 P;  2M5A A;  1GMJ A;  1KTM A;  3V4Q A;  2QJP C;  4O1W A;  1IZN B;  5EXQ A;  3H1K E;  1HWT C;  3A7O A;  1H89 A;  1U57 A;  2E74 C;  2B87 B;  2N9J A;  1OVV A;  4RKU J;  1XTC C;  4H13 D;  2N3B A;  4OWF A;  4IFD K;  4XA4 A;  4WQ8 A;  4TLF A;  5KLV D;  1VQ7 P;  2XNX A;  4FA5 A;  3M91 A;  1CRH A;  1N73 A;  5AVX B;  3CWB J;  1L9B C;  3V2Q A;  3L36 A;  1I8P A;  4NPD A;  1OFC X;  4AUW A;  2POH A;  1VQ9 P;  2C9N Y;  1EXI A;  3HRN A;  3HQ8 A;  3M9B A;  1KQF B;  4K3I A;  2L5G B;  1FCD C;  2IYO A;  1YQ3 C;  1DT1 A;  2QVA A;  1CO6 A;  3TF5 A;  3M0A A;  3RK3 D;  1FDM A;  4I1L A;  3SWS A;  3MK7 C;  4WY4 B;  3D70 A;  1C75 A;  1VQM P;  2OYI A;  1CRC A;  1KYO I;  2KI7 B;  4AX3 A;  2JP3 A;  2E75 C;  2Q1K A;  3V2P A;  4DZO A;  3H32 A;  4LJI A;  1AOQ A;  2C1D B;  1SQV G;  3FXE A;  3HE5 A;  3IAO A;  2QJP B;  1K9M Q;  1BDC A;  3BCC E;  3CCS P;  1H1O A;  1QX8 A;  3ZOY A;  2P58 A;  3A0H V;  1AOF A;  1AQT A;  2E74 B;  2BEZ F;  2FBW C;  3H1I G;  2IZ1 A;  3KXD A;  2EXV A;  4PJ0 E;  1IFP A;  1BCC J;  1VQL P;  5DF5 A;  3Q5S A;  2KLU A;  1NTZ K;  2IPP A;  1NAY A;  1GK4 A;  2IDB A;  1OMI A;  3VMA A;  2KUB A;  3TGU G;  2HPC A;  3AE5 C;  3B71 A;  1BE3 J;  3RL0 D;  3A0B E;  2ZXY A;  2OGU A;  5APS A;  1LFM A;  3CCE P;  3TK1 A;  2CXB A;  4IL6 E;  4M3L A;  1U75 B;  2A45 H;  2OZ1 A;  1HZU A;  3KZI H;  2GUV A;  3MK7 B;  1FOC A;  2AI5 A;  5KLV E;  1MKM A;  1S5L E;  1L0L G;  1N9C A;  1S6V B;  2IX7 C;  3M0D C;  1CXC A;  3TYY A;  1RAQ A;  2E75 B;  3GG2 A;  2W8Z A;  1EB7 A;  1CSW A;  1NJI Q;  1EZV G;  4RO0 A;  3WUI A;  1LNQ A;  1N2D C;  1NOH A;  2LIR A;  2C8S A;  2AXC A;  1SQQ J;  1PPJ D;  1ZW0 A;  5APX A;  3RK3 E;  3RK2 D;  1RF0 A;  3CC2 P;  1NTK G;  5DJQ C;  1JUN A;  1C52 A;  3TDK A;  2DVH A;  1URQ A;  2HG5 D;  1SQX J;  3PTZ A;  4U3F J;  4KMG A;  1BE3 E;  2W27 A;  3LIE A;  1L0N J;  3TYI A;  3GMA A;  4ASV A;  4Z1M H;  3H1L D;  3CMA P;  4L74 A;  1JO5 A;  3DMI A;  2H88 C;  2G8Y A;  2PRR A;  3HUS C;  4PD4 E;  4PV1 C;  4Y5R A;  1EDI A;  1SQQ K;  1CXA A;  1MZ9 A;  2DGE A;  4KHX A;  3CCQ P;  1SQP G;  3UIA A;  2Q5U A;  4EOT A;  3WUU A;  1YIQ A;  1KIL C;  2OAR A;  1Y8A A;  5KKZ C;  1IFI A;  1E8E A;  5KAI E;  2N9B A;  4PJ0 V;  4QMA A;  3RBZ A;  1SQX K;  1HJ0 A;  3L70 E;  2XU6 A;  3RLM A;  4HB1 A;  2W90 A;  2WT7 A;  1LTJ A;  4YXW H;  1HBW A;  5DJQ B;  1URQ D;  1JM0 A;  1NTM J;  5CIE B;  3A0B V;  1GDT A;  3MP7 B;  1JY3 N;  1JMB A;  4IL6 V;  1KN7 A;  4QAO A;  2W83 C;  1XTG B;  1PP9 J;  5AUR A;  5TIS V;  1JY2 O;  3H1H J;  3AE2 C;  1T8Z A;  2E5Y A;  4RSZ A;  1CZQ A;  1LT9 C;  1S5L V;  1FZC C;  1J1D B;  1L0N E;  3HUS B;  3O8Z A;  4PV1 B;  1DW3 A;  3CX5 W;  1EXJ A;  3MIW A;  3Q1M A;  2W6J H;  3HQ9 A;  3L75 G;  2L91 A;  1MZ4 A;  1QEX A;  1E2R A;  2V08 A;  1JY2 P;  2N18 C;  2IBZ G;  1ZXG A;  2MJZ A;  2QRX A;  2HV4 A;  4DJG A;  1DD3 A;  1NTM K;  4UB6 E;  1LGH B;  1JCD A;  1KIL B;  5CIG B;  5KKZ B;  2D0W A;  3H1L E;  2I8F A;  1YHQ P;  2B0Z B;  3IF4 A;  4JBZ A;  1WVE C;  3BAT A;  3O6Q A;  3ZOW A;  3B5N A;  2B88 A;  1ZN5 A;  4EIC A;  2AXT E;  2IFM A;  1CIH A;  2KLV A;  2NZ2 A;  1K8A Q;  2V7Q J;  4EID A;  3ZIY A;  4FAN A;  1VF5 D;  3CCV P;  3Q5P A;  3ZDM A;  3A9F A;  1N7S A;  2N9Y B;  1FOS F;  4XXL A;  2OYH C;  5CIC B;  2I1K A;  4JQ0 D;  4C46 A;  1LT9 B;  1R5L A;  1FZC B;  1USE A;  3CWB G;  2E76 D;  3HD7 C;  1SP4 A;  3H1H E;  1OW8 A;  1H8A A;  1EDK A;  2GUS A;  2GC4 D;  2WWW A;  3CCJ P;  3A0H H;  5AW0 B;  1SQV J;  2MKV A;  5BU8 B;  4V2K A;  3P32 A;  5B66 E;  2XKM A;  1NTZ G;  2N18 B;  1Q82 Q;  3AE3 C;  5KAI V;  4GYD A;  3H1I J;  1DW2 A;  2M3B A;  1ZRT D;  1L4A A;  2MHM A;  5KJ7 A;  2HLO A;  1YEB A;  1DEE G;  3B5N D;  1VQ4 P;  2PAJ A;  1OCD A;  2R3C A;  1PGO A;  1M70 A;  2FXP A;  3TGU J;  1MG2 D;  2AEM A;  1A02 F;  1L0L D;  3FXD A;  5DJU B;  1T2K C;  3H25 A;  3CXH E;  1OX3 A;  2Y0C A;  1N50 A;  1CIE A;  1EZV D;  1I6D A;  1USD A;  1N7S D;  4YTP C;  3E7K A;  1NU1 J;  4GOE A;  1NKN A;  2ZT9 D;  4LC1 A;  2R3S A;  3CX5 I;  2HFE D;  4WVZ A;  2NPS D;  2OYH B;  2IZ0 A;  1BCC G;  4NPE A;  1CC5 A;  4HH2 A;  1H0T A;  5AW9 B;  1EC5 A;  3HD7 B;  1SVF A;  3CC4 P;  1E79 H;  3M97 X;  3D6Y A;  1BE3 G;  1TU3 F;  4WQD A;  2L4D A;  3L72 D;  1GL2 A;  3SFE C;  5CCG A;  4H44 D;  4YE1 A;  4UB6 V;  2YMK A;  1SQV E;  2FYU J;  3BRT B;  2YXR B;  1HJ5 A;  1NGM B;  1L4A D;  5KJ7 D;  4UB8 E;  3D71 A;  4GOD A;  3W67 A;  3C9I A;  1KX7 A;  1AV1 A;  4A7P A;  1YYC A;  2I1J A;  1IRV A;  3OCD A;  2IFN A;  1HVV A;  155C A;  2AXT V;  1NTK J;  3H1I E;  1H32 B;  1GZL A;  3AE9 C;  1DIP A;  1KB9 I;  2IYP A;  1NAF A;  5AW2 B;  1KMI Z;  2WSS H;  1SQQ G;  2H89 C;  3VN0 A;  2AIU A;  4DCK A;  2ZFC A;  3TGU E;  2WSC H;  2QG4 A;  1M57 D;  4H13 C;  1H9Y A;  3L71 J;  1ZRT E;  1N90 A;  4ZKP A;  2FYU K;  2I8D A;  5K5G B;  1JOC A;  2RH0 A;  4WQC A;  1C2N A;  5CIB B;  4MN4 C;  3SVW A;  1AJY A;  1L0L E;  4IL6 X;  1HJB A;  3NBS A;  1SQX G;  1WRG A;  4PJ0 H;  3L74 G;  1JEK A;  2ZXX A;  1SQP J;  5DFS A;  4U3F G;  1EZV E;  3HE4 A;  1L0N G;  2ZZS 1;  2R5D A;  3U1C A;  1HCM A;  3BRV B;  2BCN B;  4BWN A;  3A0B H;  3JC2 2;  2Q3E A;  3G9R A;  1RF1 C;  1IK9 A;  4WB4 A;  4IL6 H;  3ZOO A;  1DH3 A;  4J20 A;  2FFD A;  2YMY A;  4MU8 A;  1LWU A;  4PW9 B;  1NTK E;  3L75 D;  1FS0 E;  1S5L H;  4JYB A;  1Q7Y Q;  1JY2 N;  5CJ4 A;  3AEG C;  3R2P A;  3JSV C;  4H13 B;  5CCH A;  2E5T A;  1N73 C;  3H1J J;  3X39 A;  1H31 B;  3IFM A;  1C6O A;  2ZVO B;  1NTM G;  3O1Y A;  5APU A;  1KZU B;  2HYN A;  3RL0 C;  5DJT B;  4P4Q B;  2C2C A;  2B12 B;  4N3Y B;  1OW6 A;  3ABV C;  2E42 A;  1CIG A;  4FA4 A;  1FC2 C;  1PP9 G;  3BVH A;  1CSU A;  4UB8 V;  1OW7 A;  1SQB J;  1SQP E;  1CTZ A;  1A56 A;  1NHL A;  1IO3 A;  2Z5I A;  3L37 A;  3IN6 A;  3B4S A;  2M5A B;  1CTY A;  1QLE D;  1RF1 B;  3EQ2 A;  3BAS A;  5CJ0 A;  1CHI A;  3HQ6 A;  2B9B A;  4PD4 H;  1VQK P;  1CED A;  5CMZ A;  2CE0 A;  2BCC J;  1CI6 B;  3C8V A;  4Y28 J;  1IFM A;  1IO4 A;  3N4X A;  1YTZ I;  1N73 B;  2XND H;  3GW6 A;  5APQ A;  2JKV A;  4L3H A;  1SQB K;  2B87 A;  5KAI H;  3RL0 B;  2LXB A;  3CCU P;  3L75 E;  1NTZ J;  4PWA A;  2N3Y A;  4AAL A;  2IBZ E;  1LTT C;  3RN0 A;  3H32 B;  1A02 J;  4K35 A;  1HRC A;  2KB7 P;  1BCC D;  1GQ1 A;  3AE1 C;  1RE3 A;  1KB0 A;  3K5B A;  4WWI A;  3V6I A;  4GT1 A;  2Q7C A;  3PHL A;  2J5U A;  1J2J B;  2XTS B;  3EFG A;  4WY4 A;  1BE3 D;  2WSF H;  4NPF X;  1T6A A;  5APY A;  3WFB C;  3FGA D;  3M06 A;  4EIJ A;  5CYT R;  2QIW A;  1RF0 C;  2A45 I;  2WPR A;  2LXC B;  4PD4 D;  1JB0 J;  2QA4 P;  2C1D A;  3ZOX A;  3NBT A;  3VRD A;  1G1J A;  3OW2 O;  1URQ C;  4UB6 H;  2KNC B;  1QVF O;  5APT A;  5AVZ B;  3O5C A;  1LTA C;  3P8C D;  3CWB E;  4GIF A;  2BGV X;  1ZLL A;  1X22 A;  1N7L A;  1CCR A;  4AQR D;  2ZBO A;  1NU1 G;  4WQ9 A;  1CRJ A;  1H9X A;  2AXT H;  2RN0 A;  4AYC A;  3USS A;  2OZ1 B;  1SQQ D;  2ZVN B;  4I2L C;  1NTZ E;  5TIS E;  2N1T C;  3L70 D;  2D2C D;  2V4H A;  3S9O A;  2FWL A;  3A3Y B;  3PLN A;  2KK7 A;  3SWK A;  2E43 A;  1CHJ A;  1P84 E;  1U7J A;  3WU2 E;  4DOJ A;  1MV8 A;  2FYU G;  3L4O A;  3M9Q A;  4WQ7 A;  1MUU A;  2PCC B;  3MZW B;  1QL4 A;  2BH4 X;  1AA0 A;  1PFI A;  4N0K A;  5AVQ B;  1L0N D;  2FXM A;  5B66 H;  1CRI A;  3L73 G;  2RMZ A;  4IFF A;  4D6T J;  4ASW A;  3GF3 A;  1KC8 Q;  1BCC E;  1FE6 A;  2E74 D;  1URQ B;  3GF7 A;  1CYJ A;  1OIP A;  3VMY A;  1KX2 A;  2CPB A;  1LMS A;  3EWK A;  3L74 J;  1ZME C;  2P7J A;  1VF5 C;  3M9H A;  1C6S A;  4GED B;  1J1D C;  3L71 G;  1A2S A;  3LW5 H;  3R4Y A;  3CXH H;  1IFN A;  2E76 C;  2N1T B;  1KYO D;  3T97 B;  4EYY Q;  2G3A A;  1OWA A;  3HTK B;  2WZ7 A;  3S4R A;  4L73 A;  1S9K E;  2V7Q H;  3CPW O;  3P8C E;  1NTM D;  1BL9 A;  2C1V A;  2PCB B;  4AAO A;  1QL1 A;  1NH4 A;  4ZMD A;  1AVY A;  1M60 A;  3O20 A;  1BGY G;  4XE5 B;  1SQQ E;  2KP8 A;  1PP9 D;  1FZA A;  3B5N C;  3WC8 A;  3U59 A;  3H1H D;  4WQA A;  1LP1 B;  1RAP A;  3VMX A;  4WBA A;  5CIF B;  1M1J A;  4UB8 H;  1J1E C;  5BU5 A;  1VDF A;  1N7S C;  2ZOO A;  1VF5 B;  2ZT9 C;  1SQX E;  2YKQ A;  3L74 E;  1W2E A;  2NPS C;  3H1J G;  1VQ5 P;  4U3F E;  2AEF A;  2E76 B;  1FZB A;  4O9B A;  1GU4 A;  2ZJS E;  5GTI E;  3GHG A;  1SFC C;  1OXZ A;  2LKM A;  5CBN A;  3CXH D;  3WU2 V;  1CYC A;  4H44 C;  4Y99 C;  1YEA A;  5GTH E;  3L35 A;  1Z56 A;  2Y9Z A;  1LC1 A;  2YNY A;  1K3G A;  1SQB G;  1L4A C;  1QL3 A;  2B11 B;  1E5W A;  3TNU B;  3W68 A;  2FXO A;  2Q6Q A;  1PZQ A;  3MUD C;  4EIE A;  3N7N A;  1ZP0 C;  3B5N B;  1KYO E;  3FWL A;  1NVO A;  3ITK A;  2R32 A;  4BRY B;  3OA8 B;  2OTK E;  1Q2N A;  2BEQ D;  2BCC G;  2KSJ A;  1KIL A;  1R8E A;  1J1E B;  1NTM E;  2W6A A;  4GOF A;  1SQV D;  2GIW A;  1I5T A;  2JEE A;  1S72 P;  5IY5 1;  1N7S B;  2MTA C;  2JDI H;  2ZT9 B;  3HQ7 A;  1L9J C;  4DT0 A;  2NPS B;  1PP9 E;  3CCM P;  2C0W A;  3H1I D;  5C0Z A;  4C7R A;  2FY8 A;  3L4F A;  2FRC A;  1D7M A;  3I5C A;  4HKZ H;  1LJ2 A;  1SFC B;  3TGU D;  1DW0 A;  1IK7 A;  2AEJ A;  4H44 B;  4OGQ C;  4Y99 B;  1QN2 A;  2O1J A;  2JQR A;  4K3A A;  3JCU H;  1LT9 A;  1VQ8 P;  1FZC A;  1L4A B;  1DEB A;  3IR9 A;  1DIQ C;  1NU1 D;  2ZON G;  1K05 A;  1B7V A;  1RE4 A;  4C7N A;  1HF9 A;  2Z4E A;  1X9V A;  1PV3 A;  3WFE C;  1FDO A;  2J59 M;  1CRG A;  1CSB A;  3VOP A;  1FJ0 A;  3AE6 C;  1VQN P;  2XDJ A;  1GK6 A;  2K88 A;  3WUV A;  2O01 H;  4I7Z C;  3VNW A;  2GM4 A;  1DD4 A;  2YO2 A;  4IFM A;  1WT6 A;  5AW7 B;  2FYU D;  2FYN C;  1H0T B;  1NNO A;  3AE4 C;  5H2F E;  5C39 A;  1RQV A;  4LGD E;  2QE7 H;  5GTI V;  4LLH A;  3PP5 A;  1FI3 A;  1NTK D;  2O01 N;  2CK3 H;  3C1L A;  5GTH V;  4BXL A;  2QJK C;  1GU2 A;  3G71 P;  4FA1 A;  3MTU E;  4OGQ B;  1RQU A;  3I56 P;  1NKZ B;  3HD7 A;  5AVS B;  4JF7 A;  3CCL P;  4XFJ A;  1HGZ A;  3L73 J;  2ZXE B;  3OAK A;  3L71 D;  1LWU C;  3CD6 P;  3PH0 A;  3CME P;  1ZV8 A;  5B5E E;  1EDL A;  4NFG B;  3EFF K;  2KYV A;  4I7Z B;  3SLE A;  1UII A;  1AYG A;  451C A;  5AVR B;  2XZR A;  1YTC A;  1M8O B;  1SQP D;  1N86 A;  4FB1 A;  1G2C B;  3WMM 0;  1AFO A;  1Q86 Q;  2K9J B;  1NU1 E;  2FYN B;  2W6B A;  1I55 A;  4O1Q A;  4D6T G;  3CP5 A;  1H33 B;  1CNO A;  3F89 A;  2WPV B;  1WMK A;  4DY9 A;  1GL2 D;  5E79 E;  1KIL E;  2OTJ P;  4H0K A;  5CCG D;  3SWY A;  4R4L A;  4RES B;  4W80 A;  1C7M A;  3HE4 B;  1X0T A;  2QJK B;  1RZ5 A;  3RK3 C;  1BGY J;  2D0S A;  3D6Z A;  3HD7 D;  1S5L X;  1M90 Q;  1IFD A;  3Q3D A;  2FYU E;  1KQG B;  1Q81 Q;  5C9M A;  1PPJ G;  3Q2Y A;  1PIX A;  3H1J D;  2BLF B;  1LWU B;  5TIS H;  3L73 E;  2CA4 B;  5AVU B;  2VHD A;  1N8R Q;  1QGK B;  4EDF A;  3SFD C;  2VRS A;  3H1K J;  1GD2 E;  2IBZ D;  5H2F V;  1P84 H;  3KHU A;  3II6 A;  1HRO A;  1SQB D;  3WU2 H;  1HJ3 A;  4JYC A;  2WSE J;  2FKW B;  3JCU E;  2BAS A;  3L71 E;  3VYI A;  2KS1 B;  1YFC A;  3ORV A;  1LTB C;  5KAF E;  4L76 A;  1RZ6 A;  1KFM A;  4PD4 I;  1BSN A;  2YO3 A; 
#chains in the Genus database with same CATH homology
 5AUR A;  2ZBO A;  5TIS V;  4WQ9 A;  1CRJ A;  1H9X A;  2RN0 A;  1CTJ A;  1H31 A;  2OZ1 B;  4RSZ A;  1SQQ D;  2YK3 A;  2BCC D;  1S5L V;  1I8O A;  3L70 D;  1U74 B;  1DW3 A;  3CX5 W;  3OCD B;  5CID B;  3HQ9 A;  2FWL A;  3PLN A;  2L91 A;  1MZ4 A;  1CHJ A;  1E2R A;  5B5E V;  3PXS A;  2V08 A;  1F1C A;  2N18 C;  3CWB D;  1CSX A;  2HV4 A;  1IZL 0;  1R0Q A;  3L4O A;  4WQ7 A;  5CIG B;  2PCC B;  5KKZ B;  2D0W A;  1QL4 A;  2BH4 X;  2I8F A;  1LC2 A;  1MG3 D;  2V07 A;  2B0Z B;  1NTZ D;  4N0K A;  1L0N D;  1FHB A;  1WVE C;  3ZOW A;  1H32 A;  3PRJ A;  2RMZ A;  3KZI V;  4EIC A;  2YCC A;  1BGY D;  3RMZ A;  2YQB A;  1ETP A;  1CIH A;  1YNR A;  4WQE A;  5E79 V;  1CYJ A;  2O3J A;  3PXT A;  2B10 B;  3PXW A;  3CXH W;  1KX2 A;  4EID A;  1P84 D;  1LMS A;  1GDV A;  3ZIY A;  4FAN A;  3A9F A;  2N9Y B;  1C6S A;  4XXL A;  4GED B;  4XYD B;  5CIC B;  1A2S A;  1YCC A;  1A8C A;  1KYO D;  1H33 A;  2GC4 D;  3WFD C;  5B66 V;  3H1K D;  2JTI B;  1NIR A;  1N15 A;  4RJT A;  4V2K A;  1AKK A;  1NTM D;  1BL9 A;  3JBT B;  2N18 B;  2C1V A;  2PCB B;  5KAI V;  4AAO A;  4GYD A;  1M60 A;  3O20 A;  1HH7 A;  1I6E A;  1DW2 A;  1ZRT D;  2MHM A;  3CU4 A;  1YEB A;  5CIH B;  4FA9 A;  1PP9 D;  1IQC A;  4FAV A;  1OCD A;  3CX5 D;  3WC8 A;  5B6Q A;  3H1H D;  4WQA A;  1RAP A;  1KYO W;  1M70 A;  1MG2 D;  1L0L D;  5CIF B;  5KAF V;  1IRW A;  1LS9 A;  1WEJ F;  2Y0C A;  1N50 A;  1CIE A;  1EZV D;  1I6D A;  1CIF A;  1GIW A;  2ZOO A;  2BPB B;  4H0J A;  1CC5 A;  2C1U A;  1FI9 A;  1C6R A;  3CYT I;  3ZCF A;  3SJL A;  1CHH A;  2KS1 A;  2Y0E A;  3BCC D;  3M97 X;  1DW1 A;  2QJY B;  4WQD A;  2L4D A;  3L72 D;  3CXH D;  3WU2 V;  4YE1 A;  4UB6 V;  1CYC A;  4D6T D;  2YIU B;  1YEA A;  1KB9 D;  1HJ4 A;  1HJ5 A;  1LC1 A;  1K3G A;  1ZZH A;  1HZV A;  1COR A;  5TJH A;  1QL3 A;  2B11 B;  3RN1 A;  1KX7 A;  1SQX D;  3C2C A;  4A7P A;  1W2L A;  3L74 D;  1IRV A;  3OCD A;  2Y0D A;  4U3F D;  1DVH A;  4EIE A;  155C A;  2AXT V;  1H32 B;  4O1W A;  3FWL A;  3ITK A;  5EXQ A;  1OAE A;  1DII C;  3OA8 B;  1VYD A;  2N9J A;  2BH5 X;  2AIU A;  1SQV D;  2GIW A;  1I5T A;  2QG4 A;  2N3B A;  5IY5 1;  2MTA C;  4WQ8 A;  1COT A;  1H9Y A;  5KLV D;  4FA5 A;  1CRH A;  1NML A;  3HQ7 A;  1E29 A;  1L9J C;  1N90 A;  1L9B C;  1I8P A;  1GJQ A;  4AAM A;  4WQC A;  3H1I D;  1C2N A;  5C0Z A;  5CIB B;  1M6Z A;  2FRC A;  3SVW A;  1FI7 A;  3NBS A;  3HQ8 A;  4K3I A;  1FCD C;  5DFS A;  1DT1 A;  3TGU D;  1CO6 A;  3TF5 A;  1DW0 A;  2ZZS 1;  1QN2 A;  2JQR A;  3SWS A;  3MK7 C;  1CYI A;  1C75 A;  1HCM A;  3SXT A;  2BCN B;  1CRC A;  4AX3 A;  1DIQ C;  2Q3E A;  1NU1 D;  2ZON G;  1B7V A;  3VYM A;  4LJI A;  3ZOO A;  1AOQ A;  1J3S A;  2C1D B;  4J20 A;  4MU8 A;  2QJP B;  3WFE C;  3WFC C;  1CRG A;  1FJ0 A;  4PW9 B;  1CCH A;  1QKS A;  1H1O A;  3ZOY A;  3L75 D;  3A0H V;  1AOF A;  3VNW A;  351C A;  1F1F A;  2CA3 B;  2CE1 A;  2EXV A;  5DF5 A;  3X39 A;  1H31 B;  2C9X B;  1C6O A;  1I54 A;  2FYU D;  1NNO A;  3VMA A;  3DR0 A;  3O1Y A;  1JDL A;  5GTI V;  2ZXY A;  4P4Q B;  1FI3 A;  1NTK D;  1LFM A;  2C2C A;  2B12 B;  2CXB A;  5GTH V;  1CIG A;  4FA4 A;  1U75 B;  1CSV A;  3ZBM A;  1CSU A;  4UB8 V;  1GU2 A;  2OZ1 A;  4FA1 A;  1HZU A;  1CTZ A;  3MK7 B;  1FOC A;  2AI5 A;  1A56 A;  4WQB A;  1IO3 A;  1QYZ A;  1N9C A;  1S6V B;  1CXC A;  2JWA A;  1RAQ A;  1CTY A;  3GG2 A;  1EB7 A;  1CSW A;  3PH2 B;  3L71 D;  1CHI A;  1GKS A;  3WUI A;  3HQ6 A;  4NFG B;  2LIR A;  2C8S A;  1CED A;  1CRY A;  2CE0 A;  2GB8 B;  1PPJ D;  3SLE A;  1NMI A;  1AYG A;  451C A;  4L1Q A;  3O0R C;  1YTC A;  1SQP D;  4FB1 A;  4Q5P A;  5DJQ C;  2K9J B;  2FYN B;  1K3H A;  1I55 A;  1C52 A;  3OA8 A;  4O1Q A;  3GW6 A;  3TDK A;  3CP5 A;  2DVH A;  4L3H A;  4AAN A;  1H33 B;  1CNO A;  4DY9 A;  4H0K A;  3PTZ A;  4EIF A;  4KMG A;  4PWA A;  1C7M A;  1DVV A;  3TYI A;  1W5C T;  2GC7 D;  2QJK B;  3H1L D;  1YIC A;  1RZ5 A;  2N3Y A;  4AAL A;  3DMI A;  2D0S A;  4Y5R A;  3RN0 A;  1CXA A;  3NWV A;  5C9M A;  2DGE A;  2A06 D;  1HRC A;  1BCC D;  1GQ1 A;  3H1J D;  2N9I A;  2BLF B;  2LIT A;  1KB0 A;  2CA4 B;  3PHL A;  2XTS B;  1YIQ A;  2VHD A;  1BE3 D;  2PAC A;  3WFB C;  1E8E A;  4PJ0 V;  5CYT R;  2B4Z A;  4EDF A;  4PD4 D;  2ORL A;  3DP5 A;  2IBZ D;  3L4M A;  1KIB A;  2C1D A;  3RLM A;  3ZOX A;  5H2F V;  3NBT A;  3VRD A;  3KHU A;  1HRO A;  5DJQ B;  1SQB D;  1HJ3 A;  5CIE B;  3A0B V;  4L3G A;  1C2R A;  2KNC B;  5KLI B;  3O5C A;  1YFC A;  3ORV A;  4IL6 V;  1KV9 A;  1RZ6 A;  2BGV X;  3L73 D;  4QAO A;  1CRI A;  1CCR A;  4JCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...