2ORLA

Solution structure of the cytochrome c- para-aminophenol adduct
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWDENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c iso-1
publication title Cytochrome c and organic molecules: solution structure of the p-aminophenol adduct.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
total genus 36
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2007-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2orlA00
1PP9D 3BCCD 3X39A 1KYOD 1HCMA 1DW1A 2XTSB 5KAFV 3ZBMA 2YIUB 4WQ7A 1I54A 2I8FA 1HZUA 1CYCA 4H0JA 1NMLA 1SQPD 2C2CA 2CA3B 1CORA 1S5LV 4IL6V 1CNOA 5C0ZA 1H1OA 1E2RA 1BE3D 3OCDA 2PCBB 1L0LD 1CIFA 4FA4A 3O0RC 3MK7C 2BCCD 2PACA 1N90A 2LITA 2B4ZA 1N50A 3CWBD 3WFEC 5C9MA 1AOFA 3DMIA 1CC5A 4AAOA 5CIHB 1KX2A 3CX5W 4PJ0V 2N9IA 3WFDC 5B5EV 4PWAA 1KV9A 3SXTA 1FI9A 5CIDB 1DVVA 4K3IA 1L9JC 2HV4A 3H1JD 4P4QB 4WQ8A 1H9YA 2ZBOA 3PXWA 1COTA 1HJ5A 1CRIA 3HQ9A 1CYJA 5CYTR 1HROA 3WUIA 4QAOA 1NTMD 2MTAC 1M6ZA 1WEJF 1IO3A 5KLVD 4H0KA 5H2FV 2C8SA 1H33A 2EXVA 2AIUA 1YEAA 1A8CA 1C52A 1EB7A 1FOCA 1LFMA 1A56A 1YFCA 3OA8B 3HQ7A 1BGYD 3VRDA 1KIBA 4KMGA 3NBTA 4FA5A 4UB6V 2VHDA 1QKSA 1SQVD 3L73D 1GQ1A 5GTIV 1CCRA 2LIRA 1U75B 3TGUD 1R0QA 1H9XA 2BLFB 2FRCA 5CICB 1H32A 3SLEA 3WFCC 1P84D 3KZIV 1I55A 1BCCD 2MHMA 1ZRTD 1CO6A 2C1DB 3RLMA 1C75A 1ZZHA 3SWSA 1H33B 1N15A 1CIHA 1F1CA 3L71D 3WC8A 3A0BV 1DT1A 2ZOOA 1CHHA 5AURA 1HJ4A 3CYTI 5KAIV 3JBTB 1JDLA 2D0WA 1YIQA 1YTCA 1LMSA 4O1QA 2JTIB 1NMIA 4N0KA 1CCHA 5B6QA 4AALA 2N3YA 1S6VB 3O1YA 2N3BA 4PD4D 3CX5D 1CSVA 1K3GA 1QL4A 4YE1A 4LJIA 1MG2D 3CP5A 4EIEA 5IY51 3RN0A 1AYGA 1K3HA 3NBSA 1HH7A 1NTZD 2IBZD 1DW3A 451CA 1WVEC 1GIWA 3HQ8A 4MU8A 1FHBA 5GTHV 2BGVX 1B7VA 3M97X 1CHJA 4FANA 3H1LD 4XYDB 1CEDA 5DF5A 1YNRA 2GIWA 4D6TD 2CE1A 1H31A 1C2RA 1CRHA 1FCDC 3OCDB 4L3HA 3VNWA 2BPBB 2ORLA 4WQ9A 5DJQB 1QN2A 3HQ6A 3A0HV 2OZ1A 3O20A 5CIFB 2PCCB 3H1ID 2QJYB 4NFGB 2D0SA 1I8PA 2V07A 3NWVA 5B66V 4Y5RA 1A2SA 2BH5X 2CXBA 2FYNB 1EZVD 1F1FA 1I8OA 2B11B 2B0ZB 1CSUA 1RAQA 3DP5A 5TISV 3L4MA 4EICA 1CYIA 2C1UA 2C1VA 1DVHA 3VYMA 1CIGA 1IQCA 3L70D 1DIIC 3ZOXA 1YCCA 4GYDA 4AANA 2FYUD 2ZZS1 1YICA 1KX7A 2N18B 1MG3D 4J20A 2AXTV 1CXCA 1H31B 4EIDA 4FB1A 2FWLA 5EXQA 1OAEA 1LC2A 3CXHD 1L9BC 4XXLA 1IZL0 1W2LA 4FA1A 4DY9A 2QJPB 4WQCA 4FA9A 3CXHW 2QJKB 1U74B 2CA4B 1OCDA 1NU1D 3PH2B 3WFBC 3DR0A 2DVHA 3C2CA 4WQBA 1C6OA 1IRVA 1KYOW 1NNOA 4AX3A 1CSWA 2BH4X 1CIEA 2ZXYA 2GC4D 1M70A 3PXTA 2YQBA 4U3FD 1FJ0A 1CRCA 3MK7B 5CIEB 3RMZA 1N9CA 1H32B 1I6DA 3WU2V 1KB0A 1CRYA 5KLIB 1QL3A 4PW9B 1QYZA 5KKZB 2N9JA 1J3SA 3OA8A 1AOQA 3L75D 1HRCA 4WQEA 1CHIA 4WQDA 2AI5A 3A9FA 1I5TA 1AKKA 1RZ6A 4O1WA 1W5CT 2B10B 1SQXD 4AAMA 1FI7A 1DIQC 4RSZA 5CIGB 4V2KA 1C2NA 3ZCFA 1YEBA 1LC1A 4UB8V 4EIFA 1PPJD 2CE0A 2BCNB 4L3GA 3ZOYA 1DW2A 5DFSA 1VYDA 1C6RA 1RAPA 351CA 3CU4A 1SQQD 2C9XB 1NTKD 1GJQA 1MZ4A 155CA 3ZIYA 3ORVA 2A06D 4GEDB 2GB8B 2DGEA 1HJ3A 3L74D 3H1HD 3PXSA 2C1DA 1CSXA 1C7MA 5DJQC 1GU2A 1L0ND 1FI3A 3L4OA 2B12B 1IRWA 1HZVA 4FAVA 3O5CA 1BL9A 1CRGA 2GC7D 4L1QA 5CIBB 3RN1A 2YK3A 3ZOWA 4JCGA 3SVWA 1E8EA 2JQRA 3SJLA 2L4DA 1E29A 2YCCA 3H1KD 2ZONG 2V08A 1I6EA 1DW0A 1CTJA 3L72D 1M60A 1NIRA 4WQAA 1CTYA 1KB9D 5E79V 1CRJA 1CTZA 1GDVA 1CXAA 4Q5PA 1ETPA 1SQBD 1RZ5A 1C6SA 1LS9A 2OZ1B 3TYIA 1GKSA 2N18C 3ZOOA
chains in the Genus database with same CATH superfamily
1PP9D 3BCCD 3X39A 1KYOD 1HCMA 1DW1A 2XTSB 5KAFV 3ZBMA 2YIUB 4WQ7A 1I54A 2I8FA 1HZUA 1CYCA 4H0JA 1NMLA 1SQPD 2C2CA 2CA3B 1CORA 1S5LV 4IL6V 1CNOA 5C0ZA 1H1OA 1E2RA 1BE3D 3OCDA 2PCBB 1L0LD 1CIFA 4FA4A 3O0RC 3MK7C 2BCCD 2PACA 1N90A 2LITA 2B4ZA 1N50A 3CWBD 3WFEC 5C9MA 1AOFA 3DMIA 1CC5A 4AAOA 5CIHB 1KX2A 3CX5W 4PJ0V 2N9IA 3WFDC 5B5EV 4PWAA 1KV9A 3SXTA 1FI9A 5CIDB 1DVVA 4K3IA 3D0WA 1L9JC 2HV4A 3H1JD 4P4QB 4WQ8A 1H9YA 2ZBOA 3PXWA 1COTA 1HJ5A 1CRIA 3HQ9A 1CYJA 5CYTR 1HROA 3WUIA 4QAOA 1NTMD 2MTAC 1M6ZA 1WEJF 1IO3A 5KLVD 4H0KA 5H2FV 2C8SA 1H33A 2EXVA 2AIUA 1YEAA 1A8CA 1C52A 1EB7A 1FOCA 1LFMA 1A56A 1YFCA 3OA8B 3HQ7A 1BGYD 3VRDA 1KIBA 4KMGA 3NBTA 4FA5A 4UB6V 2VHDA 1QKSA 1SQVD 3L73D 1GQ1A 5GTIV 1CCRA 2LIRA 1U75B 3TGUD 1R0QA 1H9XA 2BLFB 2FRCA 5CICB 1H32A 3SLEA 3WFCC 1P84D 3KZIV 1I55A 1BCCD 2MHMA 1ZRTD 1CO6A 2C1DB 3RLMA 1C75A 1ZZHA 3SWSA 1H33B 1N15A 1CIHA 1F1CA 3L71D 3WC8A 3A0BV 1DT1A 2ZOOA 1CHHA 5AURA 1HJ4A 3CYTI 5KAIV 3JBTB 1JDLA 2D0WA 1YIQA 1YTCA 1LMSA 4O1QA 2JTIB 1NMIA 4N0KA 1CCHA 5B6QA 4AALA 2N3YA 1S6VB 3O1YA 2N3BA 4PD4D 3CX5D 1CSVA 1K3GA 1QL4A 4YE1A 4LJIA 1MG2D 3CP5A 4EIEA 5IY51 3RN0A 1AYGA 1K3HA 3NBSA 1HH7A 1NTZD 2IBZD 1DW3A 451CA 1WVEC 1GIWA 3HQ8A 4MU8A 1FHBA 5GTHV 2BGVX 1B7VA 3M97X 1CHJA 4FANA 3H1LD 4XYDB 1CEDA 5DF5A 1YNRA 2GIWA 4D6TD 2CE1A 1H31A 1C2RA 1CRHA 1FCDC 3OCDB 4L3HA 3VNWA 2BPBB 2ORLA 4WQ9A 5DJQB 1QN2A 3HQ6A 3A0HV 2OZ1A 3O20A 5CIFB 2PCCB 3H1ID 2QJYB 4NFGB 2D0SA 1I8PA 2V07A 3NWVA 5B66V 4Y5RA 1A2SA 2BH5X 2CXBA 2FYNB 1EZVD 1F1FA 1I8OA 2B11B 2B0ZB 1CSUA 1RAQA 3DP5A 5TISV 3L4MA 4EICA 1CYIA 2C1UA 2C1VA 1DVHA 3VYMA 1CIGA 1IQCA 3L70D 1DIIC 3ZOXA 1YCCA 4GYDA 4AANA 2FYUD 2ZZS1 1YICA 1KX7A 2N18B 1MG3D 4J20A 2AXTV 1CXCA 1H31B 4EIDA 4FB1A 2FWLA 5EXQA 1OAEA 1LC2A 3CXHD 1L9BC 4XXLA 1IZL0 1W2LA 4FA1A 4DY9A 2QJPB 4WQCA 4FA9A 3CXHW 2QJKB 1U74B 2CA4B 1OCDA 1NU1D 3PH2B 3WFBC 3DR0A 2DVHA 3C2CA 4WQBA 1C6OA 1IRVA 1KYOW 1NNOA 4AX3A 1CSWA 2BH4X 1CIEA 2ZXYA 2GC4D 1M70A 3PXTA 2YQBA 4U3FD 1FJ0A 1CRCA 3MK7B 5CIEB 3RMZA 1N9CA 1H32B 1I6DA 3WU2V 1KB0A 1CRYA 5KLIB 1QL3A 4PW9B 1QYZA 5KKZB 2N9JA 1J3SA 3OA8A 1AOQA 3L75D 1HRCA 4WQEA 1CHIA 4WQDA 2AI5A 3A9FA 1I5TA 1AKKA 1RZ6A 4O1WA 1W5CT 2B10B 1SQXD 4AAMA 1FI7A 1DIQC 4RSZA 5CIGB 4V2KA 1C2NA 3ZCFA 1YEBA 1LC1A 4UB8V 4EIFA 1PPJD 2CE0A 2BCNB 4L3GA 3ZOYA 1DW2A 5DFSA 1VYDA 1C6RA 1RAPA 351CA 3CU4A 1SQQD 2C9XB 1NTKD 1GJQA 1MZ4A 155CA 3ZIYA 3ORVA 2A06D 4GEDB 2GB8B 2DGEA 1HJ3A 3L74D 3H1HD 3PXSA 2C1DA 1CSXA 1C7MA 5DJQC 1GU2A 1L0ND 1FI3A 3L4OA 2B12B 1IRWA 1HZVA 4FAVA 3O5CA 1BL9A 1CRGA 2GC7D 4L1QA 5CIBB 3RN1A 2YK3A 3ZOWA 4JCGA 3SVWA 1E8EA 2JQRA 3SJLA 2L4DA 1E29A 2YCCA 3H1KD 2ZONG 2V08A 1I6EA 1DW0A 1CTJA 3L72D 1M60A 1NIRA 4WQAA 1CTYA 1KB9D 5E79V 1CRJA 1CTZA 1GDVA 1CXAA 4Q5PA 1ETPA 1SQBD 1RZ5A 1C6SA 1LS9A 2OZ1B 3TYIA 1GKSA 2N18C 3ZOOA
chains in the Genus database with same CATH topology
1PP9D 3BCCD 3X39A 1KYOD 1HCMA 1DW1A 2XTSB 5KAFV 3ZBMA 2YIUB 4WQ7A 1I54A 2I8FA 1HZUA 1CYCA 4H0JA 1NMLA 1SQPD 2C2CA 2CA3B 1CORA 1S5LV 4IL6V 1CNOA 5C0ZA 1H1OA 1E2RA 1BE3D 3OCDA 2PCBB 1L0LD 1CIFA 4FA4A 3O0RC 3MK7C 2BCCD 2PACA 1N90A 2LITA 2B4ZA 1N50A 3CWBD 3WFEC 5C9MA 1AOFA 3DMIA 1CC5A 4AAOA 5CIHB 1KX2A 3CX5W 4PJ0V 2N9IA 3WFDC 5B5EV 4PWAA 1KV9A 3SXTA 1FI9A 5CIDB 1DVVA 4K3IA 1L9JC 2HV4A 3H1JD 4P4QB 4WQ8A 1H9YA 2ZBOA 3PXWA 1COTA 1HJ5A 1CRIA 3HQ9A 1CYJA 5CYTR 1HROA 3WUIA 4QAOA 1NTMD 2MTAC 1M6ZA 1WEJF 1IO3A 5KLVD 4H0KA 5H2FV 2C8SA 1H33A 2EXVA 2AIUA 1YEAA 1A8CA 1C52A 1EB7A 1FOCA 1LFMA 1A56A 1YFCA 3OA8B 3HQ7A 1BGYD 3VRDA 1KIBA 4KMGA 3NBTA 4FA5A 4UB6V 2VHDA 1QKSA 1SQVD 3L73D 1GQ1A 5GTIV 1CCRA 2LIRA 1U75B 3TGUD 1R0QA 1H9XA 2BLFB 2FRCA 5CICB 1H32A 3SLEA 3WFCC 1P84D 3KZIV 1I55A 1BCCD 2MHMA 1ZRTD 1CO6A 2C1DB 3RLMA 1C75A 1ZZHA 3SWSA 1H33B 1N15A 1CIHA 1F1CA 3L71D 3WC8A 3A0BV 1DT1A 2ZOOA 1CHHA 5AURA 1HJ4A 3CYTI 5KAIV 3JBTB 1JDLA 2D0WA 1YIQA 1YTCA 1LMSA 4O1QA 2JTIB 1NMIA 4N0KA 1CCHA 5B6QA 4AALA 2N3YA 1S6VB 3O1YA 2N3BA 4PD4D 3CX5D 1CSVA 1K3GA 1QL4A 4YE1A 4LJIA 1MG2D 3CP5A 4EIEA 5IY51 3RN0A 1AYGA 1K3HA 3NBSA 1HH7A 1NTZD 2IBZD 1DW3A 451CA 1WVEC 1GIWA 3HQ8A 4MU8A 1FHBA 5GTHV 2BGVX 1B7VA 3M97X 1CHJA 4FANA 3H1LD 4XYDB 1CEDA 5DF5A 1YNRA 2GIWA 4D6TD 2CE1A 1H31A 1C2RA 1CRHA 1FCDC 3OCDB 4L3HA 3VNWA 2BPBB 2ORLA 4WQ9A 5DJQB 1QN2A 3HQ6A 3A0HV 2OZ1A 3O20A 5CIFB 2PCCB 3H1ID 2QJYB 4NFGB 2D0SA 1I8PA 2V07A 3NWVA 5B66V 4Y5RA 1A2SA 2BH5X 2CXBA 2FYNB 1EZVD 1F1FA 1I8OA 2B11B 2B0ZB 1CSUA 1RAQA 3DP5A 5TISV 3L4MA 4EICA 1CYIA 2C1UA 2C1VA 1DVHA 3VYMA 1CIGA 1IQCA 3L70D 1DIIC 3ZOXA 1YCCA 4GYDA 4AANA 2FYUD 2ZZS1 1YICA 1KX7A 2N18B 1MG3D 4J20A 2AXTV 1CXCA 1H31B 4EIDA 4FB1A 2FWLA 5EXQA 1OAEA 1LC2A 3CXHD 1L9BC 4XXLA 1IZL0 1W2LA 4FA1A 4DY9A 2QJPB 4WQCA 4FA9A 3CXHW 2QJKB 1U74B 2CA4B 1OCDA 1NU1D 3PH2B 3WFBC 3DR0A 2DVHA 3C2CA 4WQBA 1C6OA 1IRVA 1KYOW 1NNOA 4AX3A 1CSWA 2BH4X 1CIEA 2ZXYA 2GC4D 1M70A 3PXTA 2YQBA 4U3FD 1FJ0A 1CRCA 3MK7B 5CIEB 3RMZA 1N9CA 1H32B 1I6DA 3WU2V 1KB0A 1CRYA 5KLIB 1QL3A 4PW9B 1QYZA 5KKZB 2N9JA 1J3SA 3OA8A 1AOQA 3L75D 1HRCA 4WQEA 1CHIA 4WQDA 2AI5A 3A9FA 1I5TA 1AKKA 1RZ6A 4O1WA 1W5CT 2B10B 1SQXD 4AAMA 1FI7A 1DIQC 4RSZA 5CIGB 4V2KA 1C2NA 3ZCFA 1YEBA 1LC1A 4UB8V 4EIFA 1PPJD 2CE0A 2BCNB 4L3GA 3ZOYA 1DW2A 5DFSA 1VYDA 1C6RA 1RAPA 351CA 3CU4A 1SQQD 2C9XB 1NTKD 1GJQA 1MZ4A 155CA 3ZIYA 3ORVA 2A06D 4GEDB 2GB8B 2DGEA 1HJ3A 3L74D 3H1HD 3PXSA 2C1DA 1CSXA 1C7MA 5DJQC 1GU2A 1L0ND 1FI3A 3L4OA 2B12B 1IRWA 1HZVA 4FAVA 3O5CA 1BL9A 1CRGA 2GC7D 4L1QA 5CIBB 3RN1A 2YK3A 3ZOWA 4JCGA 3SVWA 1E8EA 2JQRA 3SJLA 2L4DA 1E29A 2YCCA 3H1KD 2ZONG 2V08A 1I6EA 1DW0A 1CTJA 3L72D 1M60A 1NIRA 4WQAA 1CTYA 1KB9D 5E79V 1CRJA 1CTZA 1GDVA 1CXAA 4Q5PA 1ETPA 1SQBD 1RZ5A 1C6SA 1LS9A 2OZ1B 3TYIA 1GKSA 2N18C 3ZOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 D;  3BCC D;  3X39 A;  1KYO D;  1HCM A;  1DW1 A;  2XTS B;  5KAF V;  3ZBM A;  2YIU B;  4WQ7 A;  1I54 A;  2I8F A;  1HZU A;  1CYC A;  4H0J A;  1NML A;  1SQP D;  2C2C A;  2CA3 B;  1COR A;  1S5L V;  4IL6 V;  1CNO A;  5C0Z A;  1H1O A;  1E2R A;  1BE3 D;  3OCD A;  2PCB B;  1L0L D;  1CIF A;  4FA4 A;  3O0R C;  3MK7 C;  2BCC D;  2PAC A;  1N90 A;  2LIT A;  2B4Z A;  1N50 A;  3CWB D;  3WFE C;  5C9M A;  1AOF A;  3DMI A;  1CC5 A;  4AAO A;  5CIH B;  1KX2 A;  3CX5 W;  4PJ0 V;  2N9I A;  3WFD C;  5B5E V;  4PWA A;  1KV9 A;  3SXT A;  1FI9 A;  5CID B;  1DVV A;  4K3I A;  1L9J C;  2HV4 A;  3H1J D;  4P4Q B;  4WQ8 A;  1H9Y A;  2ZBO A;  3PXW A;  1COT A;  1HJ5 A;  1CRI A;  3HQ9 A;  1CYJ A;  5CYT R;  1HRO A;  3WUI A;  4QAO A;  1NTM D;  2MTA C;  1M6Z A;  1WEJ F;  1IO3 A;  5KLV D;  4H0K A;  5H2F V;  2C8S A;  1H33 A;  2EXV A;  2AIU A;  1YEA A;  1A8C A;  1C52 A;  1EB7 A;  1FOC A;  1LFM A;  1A56 A;  1YFC A;  3OA8 B;  3HQ7 A;  1BGY D;  3VRD A;  1KIB A;  4KMG A;  3NBT A;  4FA5 A;  4UB6 V;  2VHD A;  1QKS A;  1SQV D;  3L73 D;  1GQ1 A;  5GTI V;  1CCR A;  2LIR A;  1U75 B;  3TGU D;  1R0Q A;  1H9X A;  2BLF B;  2FRC A;  5CIC B;  1H32 A;  3SLE A;  3WFC C;  1P84 D;  3KZI V;  1I55 A;  1BCC D;  2MHM A;  1ZRT D;  1CO6 A;  2C1D B;  3RLM A;  1C75 A;  1ZZH A;  3SWS A;  1H33 B;  1N15 A;  1CIH A;  1F1C A;  3L71 D;  3WC8 A;  3A0B V;  1DT1 A;  2ZOO A;  1CHH A;  5AUR A;  1HJ4 A;  3CYT I;  5KAI V;  3JBT B;  1JDL A;  2D0W A;  1YIQ A;  1YTC A;  1LMS A;  4O1Q A;  2JTI B;  1NMI A;  4N0K A;  1CCH A;  5B6Q A;  4AAL A;  2N3Y A;  1S6V B;  3O1Y A;  2N3B A;  4PD4 D;  3CX5 D;  1CSV A;  1K3G A;  1QL4 A;  4YE1 A;  4LJI A;  1MG2 D;  3CP5 A;  4EIE A;  5IY5 1;  3RN0 A;  1AYG A;  1K3H A;  3NBS A;  1HH7 A;  1NTZ D;  2IBZ D;  1DW3 A;  451C A;  1WVE C;  1GIW A;  3HQ8 A;  4MU8 A;  1FHB A;  5GTH V;  2BGV X;  1B7V A;  3M97 X;  1CHJ A;  4FAN A;  3H1L D;  4XYD B;  1CED A;  5DF5 A;  1YNR A;  2GIW A;  4D6T D;  2CE1 A;  1H31 A;  1C2R A;  1CRH A;  1FCD C;  3OCD B;  4L3H A;  3VNW A;  2BPB B;  2ORL A;  4WQ9 A;  5DJQ B;  1QN2 A;  3HQ6 A;  3A0H V;  2OZ1 A;  3O20 A;  5CIF B;  2PCC B;  3H1I D;  2QJY B;  4NFG B;  2D0S A;  1I8P A;  2V07 A;  3NWV A;  5B66 V;  4Y5R A;  1A2S A;  2BH5 X;  2CXB A;  2FYN B;  1EZV D;  1F1F A;  1I8O A;  2B11 B;  2B0Z B;  1CSU A;  1RAQ A;  3DP5 A;  5TIS V;  3L4M A;  4EIC A;  1CYI A;  2C1U A;  2C1V A;  1DVH A;  3VYM A;  1CIG A;  1IQC A;  3L70 D;  1DII C;  3ZOX A;  1YCC A;  4GYD A;  4AAN A;  2FYU D;  2ZZS 1;  1YIC A;  1KX7 A;  2N18 B;  1MG3 D;  4J20 A;  2AXT V;  1CXC A;  1H31 B;  4EID A;  4FB1 A;  2FWL A;  5EXQ A;  1OAE A;  1LC2 A;  3CXH D;  1L9B C;  4XXL A;  1IZL 0;  1W2L A;  4FA1 A;  4DY9 A;  2QJP B;  4WQC A;  4FA9 A;  3CXH W;  2QJK B;  1U74 B;  2CA4 B;  1OCD A;  1NU1 D;  3PH2 B;  3WFB C;  3DR0 A;  2DVH A;  3C2C A;  4WQB A;  1C6O A;  1IRV A;  1KYO W;  1NNO A;  4AX3 A;  1CSW A;  2BH4 X;  1CIE A;  2ZXY A;  2GC4 D;  1M70 A;  3PXT A;  2YQB A;  4U3F D;  1FJ0 A;  1CRC A;  3MK7 B;  5CIE B;  3RMZ A;  1N9C A;  1H32 B;  1I6D A;  3WU2 V;  1KB0 A;  1CRY A;  5KLI B;  1QL3 A;  4PW9 B;  1QYZ A;  5KKZ B;  2N9J A;  1J3S A;  3OA8 A;  1AOQ A;  3L75 D;  1HRC A;  4WQE A;  1CHI A;  4WQD A;  2AI5 A;  3A9F A;  1I5T A;  1AKK A;  1RZ6 A;  4O1W A;  1W5C T;  2B10 B;  1SQX D;  4AAM A;  1FI7 A;  1DIQ C;  4RSZ A;  5CIG B;  4V2K A;  1C2N A;  3ZCF A;  1YEB A;  1LC1 A;  4UB8 V;  4EIF A;  1PPJ D;  2CE0 A;  2BCN B;  4L3G A;  3ZOY A;  1DW2 A;  5DFS A;  1VYD A;  1C6R A;  1RAP A;  351C A;  3CU4 A;  1SQQ D;  2C9X B;  1NTK D;  1GJQ A;  1MZ4 A;  155C A;  3ZIY A;  3ORV A;  2A06 D;  4GED B;  2GB8 B;  2DGE A;  1HJ3 A;  3L74 D;  3H1H D;  3PXS A;  2C1D A;  1CSX A;  1C7M A;  5DJQ C;  1GU2 A;  1L0N D;  1FI3 A;  3L4O A;  2B12 B;  1IRW A;  1HZV A;  4FAV A;  3O5C A;  1BL9 A;  1CRG A;  2GC7 D;  4L1Q A;  5CIB B;  3RN1 A;  2YK3 A;  3ZOW A;  4JCG A;  3SVW A;  1E8E A;  2JQR A;  3SJL A;  2L4D A;  1E29 A;  2YCC A;  3H1K D;  2ZON G;  2V08 A;  1I6E A;  1DW0 A;  1CTJ A;  3L72 D;  1M60 A;  1NIR A;  4WQA A;  1CTY A;  1KB9 D;  5E79 V;  1CRJ A;  1CTZ A;  1GDV A;  1CXA A;  4Q5P A;  1ETP A;  1SQB D;  1RZ5 A;  1C6S A;  1LS9 A;  2OZ1 B;  3TYI A;  1GKS A;  2N18 C;  3ZOO A; 
#chains in the Genus database with same CATH topology
 1PP9 D;  3BCC D;  3X39 A;  1KYO D;  1HCM A;  1DW1 A;  2XTS B;  5KAF V;  3ZBM A;  2YIU B;  4WQ7 A;  1I54 A;  2I8F A;  1HZU A;  1CYC A;  4H0J A;  1NML A;  1SQP D;  2C2C A;  2CA3 B;  1COR A;  1S5L V;  4IL6 V;  1CNO A;  5C0Z A;  1H1O A;  1E2R A;  1BE3 D;  3OCD A;  2PCB B;  1L0L D;  1CIF A;  4FA4 A;  3O0R C;  3MK7 C;  2BCC D;  2PAC A;  1N90 A;  2LIT A;  2B4Z A;  1N50 A;  3CWB D;  3WFE C;  5C9M A;  1AOF A;  3DMI A;  1CC5 A;  4AAO A;  5CIH B;  1KX2 A;  3CX5 W;  4PJ0 V;  2N9I A;  3WFD C;  5B5E V;  4PWA A;  1KV9 A;  3SXT A;  1FI9 A;  5CID B;  1DVV A;  4K3I A;  3D0W A;  1L9J C;  2HV4 A;  3H1J D;  4P4Q B;  4WQ8 A;  1H9Y A;  2ZBO A;  3PXW A;  1COT A;  1HJ5 A;  1CRI A;  3HQ9 A;  1CYJ A;  5CYT R;  1HRO A;  3WUI A;  4QAO A;  1NTM D;  2MTA C;  1M6Z A;  1WEJ F;  1IO3 A;  5KLV D;  4H0K A;  5H2F V;  2C8S A;  1H33 A;  2EXV A;  2AIU A;  1YEA A;  1A8C A;  1C52 A;  1EB7 A;  1FOC A;  1LFM A;  1A56 A;  1YFC A;  3OA8 B;  3HQ7 A;  1BGY D;  3VRD A;  1KIB A;  4KMG A;  3NBT A;  4FA5 A;  4UB6 V;  2VHD A;  1QKS A;  1SQV D;  3L73 D;  1GQ1 A;  5GTI V;  1CCR A;  2LIR A;  1U75 B;  3TGU D;  1R0Q A;  1H9X A;  2BLF B;  2FRC A;  5CIC B;  1H32 A;  3SLE A;  3WFC C;  1P84 D;  3KZI V;  1I55 A;  1BCC D;  2MHM A;  1ZRT D;  1CO6 A;  2C1D B;  3RLM A;  1C75 A;  1ZZH A;  3SWS A;  1H33 B;  1N15 A;  1CIH A;  1F1C A;  3L71 D;  3WC8 A;  3A0B V;  1DT1 A;  2ZOO A;  1CHH A;  5AUR A;  1HJ4 A;  3CYT I;  5KAI V;  3JBT B;  1JDL A;  2D0W A;  1YIQ A;  1YTC A;  1LMS A;  4O1Q A;  2JTI B;  1NMI A;  4N0K A;  1CCH A;  5B6Q A;  4AAL A;  2N3Y A;  1S6V B;  3O1Y A;  2N3B A;  4PD4 D;  3CX5 D;  1CSV A;  1K3G A;  1QL4 A;  4YE1 A;  4LJI A;  1MG2 D;  3CP5 A;  4EIE A;  5IY5 1;  3RN0 A;  1AYG A;  1K3H A;  3NBS A;  1HH7 A;  1NTZ D;  2IBZ D;  1DW3 A;  451C A;  1WVE C;  1GIW A;  3HQ8 A;  4MU8 A;  1FHB A;  5GTH V;  2BGV X;  1B7V A;  3M97 X;  1CHJ A;  4FAN A;  3H1L D;  4XYD B;  1CED A;  5DF5 A;  1YNR A;  2GIW A;  4D6T D;  2CE1 A;  1H31 A;  1C2R A;  1CRH A;  1FCD C;  3OCD B;  4L3H A;  3VNW A;  2BPB B;  2ORL A;  4WQ9 A;  5DJQ B;  1QN2 A;  3HQ6 A;  3A0H V;  2OZ1 A;  3O20 A;  5CIF B;  2PCC B;  3H1I D;  2QJY B;  4NFG B;  2D0S A;  1I8P A;  2V07 A;  3NWV A;  5B66 V;  4Y5R A;  1A2S A;  2BH5 X;  2CXB A;  2FYN B;  1EZV D;  1F1F A;  1I8O A;  2B11 B;  2B0Z B;  1CSU A;  1RAQ A;  3DP5 A;  5TIS V;  3L4M A;  4EIC A;  1CYI A;  2C1U A;  2C1V A;  1DVH A;  3VYM A;  1CIG A;  1IQC A;  3L70 D;  1DII C;  3ZOX A;  1YCC A;  4GYD A;  4AAN A;  2FYU D;  2ZZS 1;  1YIC A;  1KX7 A;  2N18 B;  1MG3 D;  4J20 A;  2AXT V;  1CXC A;  1H31 B;  4EID A;  4FB1 A;  2FWL A;  5EXQ A;  1OAE A;  1LC2 A;  3CXH D;  1L9B C;  4XXL A;  1IZL 0;  1W2L A;  4FA1 A;  4DY9 A;  2QJP B;  4WQC A;  4FA9 A;  3CXH W;  2QJK B;  1U74 B;  2CA4 B;  1OCD A;  1NU1 D;  3PH2 B;  3WFB C;  3DR0 A;  2DVH A;  3C2C A;  4WQB A;  1C6O A;  1IRV A;  1KYO W;  1NNO A;  4AX3 A;  1CSW A;  2BH4 X;  1CIE A;  2ZXY A;  2GC4 D;  1M70 A;  3PXT A;  2YQB A;  4U3F D;  1FJ0 A;  1CRC A;  3MK7 B;  5CIE B;  3RMZ A;  1N9C A;  1H32 B;  1I6D A;  3WU2 V;  1KB0 A;  1CRY A;  5KLI B;  1QL3 A;  4PW9 B;  1QYZ A;  5KKZ B;  2N9J A;  1J3S A;  3OA8 A;  1AOQ A;  3L75 D;  1HRC A;  4WQE A;  1CHI A;  4WQD A;  2AI5 A;  3A9F A;  1I5T A;  1AKK A;  1RZ6 A;  4O1W A;  1W5C T;  2B10 B;  1SQX D;  4AAM A;  1FI7 A;  1DIQ C;  4RSZ A;  5CIG B;  4V2K A;  1C2N A;  3ZCF A;  1YEB A;  1LC1 A;  4UB8 V;  4EIF A;  1PPJ D;  2CE0 A;  2BCN B;  4L3G A;  3ZOY A;  1DW2 A;  5DFS A;  1VYD A;  1C6R A;  1RAP A;  351C A;  3CU4 A;  1SQQ D;  2C9X B;  1NTK D;  1GJQ A;  1MZ4 A;  155C A;  3ZIY A;  3ORV A;  2A06 D;  4GED B;  2GB8 B;  2DGE A;  1HJ3 A;  3L74 D;  3H1H D;  3PXS A;  2C1D A;  1CSX A;  1C7M A;  5DJQ C;  1GU2 A;  1L0N D;  1FI3 A;  3L4O A;  2B12 B;  1IRW A;  1HZV A;  4FAV A;  3O5C A;  1BL9 A;  1CRG A;  2GC7 D;  4L1Q A;  5CIB B;  3RN1 A;  2YK3 A;  3ZOW A;  4JCG A;  3SVW A;  1E8E A;  2JQR A;  3SJL A;  2L4D A;  1E29 A;  2YCC A;  3H1K D;  2ZON G;  2V08 A;  1I6E A;  1DW0 A;  1CTJ A;  3L72 D;  1M60 A;  1NIR A;  4WQA A;  1CTY A;  1KB9 D;  5E79 V;  1CRJ A;  1CTZ A;  1GDV A;  1CXA A;  4Q5P A;  1ETP A;  1SQB D;  1RZ5 A;  1C6S A;  1LS9 A;  2OZ1 B;  3TYI A;  1GKS A;  2N18 C;  3ZOO A; 
#chains in the Genus database with same CATH homology
 1PP9 D;  3BCC D;  3X39 A;  1KYO D;  1HCM A;  1DW1 A;  2XTS B;  5KAF V;  3ZBM A;  2YIU B;  4WQ7 A;  1I54 A;  2I8F A;  1HZU A;  1CYC A;  4H0J A;  1NML A;  1SQP D;  2C2C A;  2CA3 B;  1COR A;  1S5L V;  4IL6 V;  1CNO A;  5C0Z A;  1H1O A;  1E2R A;  1BE3 D;  3OCD A;  2PCB B;  1L0L D;  1CIF A;  4FA4 A;  3O0R C;  3MK7 C;  2BCC D;  2PAC A;  1N90 A;  2LIT A;  2B4Z A;  1N50 A;  3CWB D;  3WFE C;  5C9M A;  1AOF A;  3DMI A;  1CC5 A;  4AAO A;  5CIH B;  1KX2 A;  3CX5 W;  4PJ0 V;  2N9I A;  3WFD C;  5B5E V;  4PWA A;  1KV9 A;  3SXT A;  1FI9 A;  5CID B;  1DVV A;  4K3I A;  1L9J C;  2HV4 A;  3H1J D;  4P4Q B;  4WQ8 A;  1H9Y A;  2ZBO A;  3PXW A;  1COT A;  1HJ5 A;  1CRI A;  3HQ9 A;  1CYJ A;  5CYT R;  1HRO A;  3WUI A;  4QAO A;  1NTM D;  2MTA C;  1M6Z A;  1WEJ F;  1IO3 A;  5KLV D;  4H0K A;  5H2F V;  2C8S A;  1H33 A;  2EXV A;  2AIU A;  1YEA A;  1A8C A;  1C52 A;  1EB7 A;  1FOC A;  1LFM A;  1A56 A;  1YFC A;  3OA8 B;  3HQ7 A;  1BGY D;  3VRD A;  1KIB A;  4KMG A;  3NBT A;  4FA5 A;  4UB6 V;  2VHD A;  1QKS A;  1SQV D;  3L73 D;  1GQ1 A;  5GTI V;  1CCR A;  2LIR A;  1U75 B;  3TGU D;  1R0Q A;  1H9X A;  2BLF B;  2FRC A;  5CIC B;  1H32 A;  3SLE A;  3WFC C;  1P84 D;  3KZI V;  1I55 A;  1BCC D;  2MHM A;  1ZRT D;  1CO6 A;  2C1D B;  3RLM A;  1C75 A;  1ZZH A;  3SWS A;  1H33 B;  1N15 A;  1CIH A;  1F1C A;  3L71 D;  3WC8 A;  3A0B V;  1DT1 A;  2ZOO A;  1CHH A;  5AUR A;  1HJ4 A;  3CYT I;  5KAI V;  3JBT B;  1JDL A;  2D0W A;  1YIQ A;  1YTC A;  1LMS A;  4O1Q A;  2JTI B;  1NMI A;  4N0K A;  1CCH A;  5B6Q A;  4AAL A;  2N3Y A;  1S6V B;  3O1Y A;  2N3B A;  4PD4 D;  3CX5 D;  1CSV A;  1K3G A;  1QL4 A;  4YE1 A;  4LJI A;  1MG2 D;  3CP5 A;  4EIE A;  5IY5 1;  3RN0 A;  1AYG A;  1K3H A;  3NBS A;  1HH7 A;  1NTZ D;  2IBZ D;  1DW3 A;  451C A;  1WVE C;  1GIW A;  3HQ8 A;  4MU8 A;  1FHB A;  5GTH V;  2BGV X;  1B7V A;  3M97 X;  1CHJ A;  4FAN A;  3H1L D;  4XYD B;  1CED A;  5DF5 A;  1YNR A;  2GIW A;  4D6T D;  2CE1 A;  1H31 A;  1C2R A;  1CRH A;  1FCD C;  3OCD B;  4L3H A;  3VNW A;  2BPB B;  2ORL A;  4WQ9 A;  5DJQ B;  1QN2 A;  3HQ6 A;  3A0H V;  2OZ1 A;  3O20 A;  5CIF B;  2PCC B;  3H1I D;  2QJY B;  4NFG B;  2D0S A;  1I8P A;  2V07 A;  3NWV A;  5B66 V;  4Y5R A;  1A2S A;  2BH5 X;  2CXB A;  2FYN B;  1EZV D;  1F1F A;  1I8O A;  2B11 B;  2B0Z B;  1CSU A;  1RAQ A;  3DP5 A;  5TIS V;  3L4M A;  4EIC A;  1CYI A;  2C1U A;  2C1V A;  1DVH A;  3VYM A;  1CIG A;  1IQC A;  3L70 D;  1DII C;  3ZOX A;  1YCC A;  4GYD A;  4AAN A;  2FYU D;  2ZZS 1;  1YIC A;  1KX7 A;  2N18 B;  1MG3 D;  4J20 A;  2AXT V;  1CXC A;  1H31 B;  4EID A;  4FB1 A;  2FWL A;  5EXQ A;  1OAE A;  1LC2 A;  3CXH D;  1L9B C;  4XXL A;  1IZL 0;  1W2L A;  4FA1 A;  4DY9 A;  2QJP B;  4WQC A;  4FA9 A;  3CXH W;  2QJK B;  1U74 B;  2CA4 B;  1OCD A;  1NU1 D;  3PH2 B;  3WFB C;  3DR0 A;  2DVH A;  3C2C A;  4WQB A;  1C6O A;  1IRV A;  1KYO W;  1NNO A;  4AX3 A;  1CSW A;  2BH4 X;  1CIE A;  2ZXY A;  2GC4 D;  1M70 A;  3PXT A;  2YQB A;  4U3F D;  1FJ0 A;  1CRC A;  3MK7 B;  5CIE B;  3RMZ A;  1N9C A;  1H32 B;  1I6D A;  3WU2 V;  1KB0 A;  1CRY A;  5KLI B;  1QL3 A;  4PW9 B;  1QYZ A;  5KKZ B;  2N9J A;  1J3S A;  3OA8 A;  1AOQ A;  3L75 D;  1HRC A;  4WQE A;  1CHI A;  4WQD A;  2AI5 A;  3A9F A;  1I5T A;  1AKK A;  1RZ6 A;  4O1W A;  1W5C T;  2B10 B;  1SQX D;  4AAM A;  1FI7 A;  1DIQ C;  4RSZ A;  5CIG B;  4V2K A;  1C2N A;  3ZCF A;  1YEB A;  1LC1 A;  4UB8 V;  4EIF A;  1PPJ D;  2CE0 A;  2BCN B;  4L3G A;  3ZOY A;  1DW2 A;  5DFS A;  1VYD A;  1C6R A;  1RAP A;  351C A;  3CU4 A;  1SQQ D;  2C9X B;  1NTK D;  1GJQ A;  1MZ4 A;  155C A;  3ZIY A;  3ORV A;  2A06 D;  4GED B;  2GB8 B;  2DGE A;  1HJ3 A;  3L74 D;  3H1H D;  3PXS A;  2C1D A;  1CSX A;  1C7M A;  5DJQ C;  1GU2 A;  1L0N D;  1FI3 A;  3L4O A;  2B12 B;  1IRW A;  1HZV A;  4FAV A;  3O5C A;  1BL9 A;  1CRG A;  2GC7 D;  4L1Q A;  5CIB B;  3RN1 A;  2YK3 A;  3ZOW A;  4JCG A;  3SVW A;  1E8E A;  2JQR A;  3SJL A;  2L4D A;  1E29 A;  2YCC A;  3H1K D;  2ZON G;  2V08 A;  1I6E A;  1DW0 A;  1CTJ A;  3L72 D;  1M60 A;  1NIR A;  4WQA A;  1CTY A;  1KB9 D;  5E79 V;  1CRJ A;  1CTZ A;  1GDV A;  1CXA A;  4Q5P A;  1ETP A;  1SQB D;  1RZ5 A;  1C6S A;  1LS9 A;  2OZ1 B;  3TYI A;  1GKS A;  2N18 C;  3ZOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...