4U3FD

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4u3fD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4u3fD02
3L4OA 1CHJA 1QL3A 1FJ0A 4A7PA 2N3BA 1GU2A 3KHUA 1A2SA 1SQQD 1YNRA 2LIRA 2AIUA 2B11B 3JBTB 1E8EA 3CXHD 2LITA 1W5CT 1I8OA 1YTCA 1PP9D 1C75A 3VYMA 2FWLA 2OZ1A 4FA5A 1L9JC 5TISV 2KS1A 3ZCFA 1LMSA 3RN0A 1C7MA 4L3GA 1I5TA 3O0RC 5DJQB 2GC4D 3TDKA 1A8CA 2B4ZA 2PACA 2YQBA 3VNWA 1HZUA 4AALA 3ZOYA 4PJ0V 1BGYD 4KMGA 4FA9A 4RJTA 1CRJA 351CA 1AOFA 4WQCA 4XXLA 3ZOOA 5TJHA 5KKZB 1HCMA 4MU8A 1CXAA 1N15A 1CO6A 1EB7A 3CU4A 5KAIV 2DVHA 1ETPA 3ZOWA 1ZRTD 2GIWA 2Y0EA 1I54A 1IZL0 1KB9D 1GJQA 1CHHA 3WFDC 5B6QA 1LFMA 3L72D 3O1YA 3L74D 1CTJA 1DVVA 2O3JA 2JTIB 1CSUA 2RMZA 2VHDA 2C1UA 3BCCD 2HV4A 2KNCB 3O5CA 3A0BV 1KIBA 2B12B 4IL6V 3PXTA 3DP5A 4K3IA 2DGEA 3M97X 3CP5A 2CXBA 3PHLA 1WEJF 2BCCD 1R0QA 1S6VB 1C6OA 5E79V 1H31B 3FWLA 3TF5A 5B5EV 2C2CA 1N50A 4JCGA 3NWVA 1NTZD 1RZ6A 3CX5W 5DF5A 4D6TD 3L73D 3OCDB 2JWAA 1LS9A 5GTIV 1QYZA 2MTAC 1FI9A 1CTZA 2QG4A 1VYDA 1U74B 1NMIA 1OCDA 1PPJD 1SQXD 1CYJA 3VRDA 1L0LD 3H1KD 2QJYB 1H31A 1CYCA 4WQDA 1L0ND 4WQ8A 1IRVA 4H0JA 3PTZA 2D0SA 2AI5A 2FRCA 5DFSA 4FA1A 1DW2A 2CA3B 1NTKD 3PXWA 1FI7A 1CIEA 3C2CA 1KX7A 4FAVA 3OCDA 1N90A 3L70D 2YIUB 1AOQA 1N9CA 2ZBOA 1M60A 3PH2B 1CRHA 1FI3A 1CRYA 1SQPD 1EZVD 3DMIA 1YICA 1QN2A 2QJPB 1K3HA 2L4DA 4LJIA 4GYDA 1AYGA 3WU2V 2MHMA 1U75B 3VMAA 4GEDB 1YEBA 1CSWA 1B7VA 2ZONG 3CWBD 155CA 1H32B 4U3FD 1LC1A 1IO3A 1P84D 2N3YA 3MK7C 4UB8V 1DIIC 1C52A 1NU1D 1QKSA 1H9XA 4L1QA 2Y0CA 3SJLA 4O1QA 3KZIV 2ZZS1 3L75D 2Q3EA 1AKKA 3ORVA 1KYOW 3GG2A 1RAPA 3ZOXA 4V2KA 2XTSB 1CSXA 1L9BC 1NMLA 1H33B 2EXVA 2B0ZB 3HQ8A 4NFGB 3L4MA 1S5LV 2C1DB 5CIHB 1H32A 1WVEC 5IY51 1C2RA 4J20A 1MZ4A 1JDLA 1CIHA 5CIFB 2V07A 1NTMD 4FANA 2CE0A 1HZVA 5GTHV 1CC5A 2C1VA 5AURA 2JQRA 1E29A 3CXHW 1RZ5A 3HQ6A 1CIGA 1YFCA 4WQAA 4WQ7A 4Y5RA 1K3GA 1MG2D 451CA 3ZBMA 3HQ9A 2YCCA 3RMZA 3WFEC 2C9XB 1H33A 1YCCA 1CIFA 1HJ5A 1I8PA 4XYDB 1HH7A 2C1DA 3WUIA 4EIFA 1J3SA 1C2NA 2ZXYA 1FCDC 1DW0A 3MK7B 5C9MA 5EXQA 1I55A 3H1LD 2N9YB 3RLMA 1CCHA 1I6EA 1F1CA 4EICA 2BH4X 2V08A 1DVHA 4DY9A 1DT1A 2ZOOA 4AAMA 1C6RA 3HQ7A 3H1ID 2RN0A 1NIRA 1BL9A 2FYUD 1F1FA 1W2LA 1H1OA 5KLVD 1H9YA 5C0ZA 4EDFA 5CIDB 2N18C 4PD4D 1FHBA 3SVWA 2L91A 3GW6A 3WC8A 3H1HD 3WFCC 1GKSA 2C8SA 1KV9A 1IQCA 3CX5D 3H1JD 1GDVA 4QAOA 1CEDA 1A56A 4H0KA 3SXTA 1CORA 1M70A 4N0KA 4EIDA 2YK3A 2ORLA 2D0WA 5CIBB 1RAQA 1CRIA 1BCCD 3RN1A 3X39A 2PCCB 4FA4A 2QJKB 3CYTI 3ITKA 1CXCA 3PXSA 1CNOA 2BGVX 3OA8B 3DR0A 2AXTV 3TGUD 1OAEA 1FOCA 3O20A 4UB6V 2BCNB 3A0HV 5KAFV 4AX3A 4AANA 1MG3D 1SQVD 4PW9B 1LC2A 2K9JB 1HROA 3SWSA 1IRWA 2B10B 1YIQA 5CYTR 1KX2A 1QL4A 5CIGB 1GQ1A 4EIEA 4FB1A 1ZZHA 1KB0A 1CSVA 3TYIA 2IBZD 4AAOA 1CTYA 3NBTA 2PCBB 1E2RA 2N9JA 5B66V 2BH5X 1SQBD 2Y0DA 2BLFB 5KLIB 2A06D 4P4QB 1COTA 1GIWA 1CRCA 3OA8A 4O1WA 2N18B 4WQBA 1HRCA 3WFBC 4RSZA 2BPBB 2CA4B 1CYIA 3L71D 2GC7D 4YE1A 1DW1A 1CHIA 5DJQC 4PWAA 1YEAA 3NBSA 5CICB 5H2FV 1CCRA 1I6DA 1BE3D 2FYNB 2GB8B 1HJ3A 1KYOD 1DW3A 1DIQC 1NNOA 3ZIYA 1CRGA 2CE1A 5CIEB 2OZ1B 1HJ4A 1M6ZA 3SLEA 4L3HA 4Q5PA 2N9IA 3PLNA 3PRJA 3A9FA 2I8FA 4WQEA 1C6SA 4WQ9A
chains in the Genus database with same CATH superfamily
1CHJA 5AVWB 5K5GB 4A7PA 2N3BA 1VQMP 1A2SA 1SQQD 2UWJE 1SQQK 3RK3C 1YQ4C 1GTWA 5APVA 1PPJE 3CLQA 1OXZA 4RESB 2LITA 1W5CT 3TNUA 2KUBA 3V2PA 2FWLA 1IFMA 1VPCA 4JQ0D 2WT7A 2M8RA 2E42A 1PP9E 5TISV 3VP8A 1JY3O 1FOSF 1AQ5A 1GU4A 3O0RC 1PGPA 3G6EP 3TDKA 2B4ZA 3NMDA 2ZT9C 3JSVC 2E74B 2QA4P 3KYQA 1Y9BA 2W6JH 3CC7P 4GODA 4YXWH 3RK2C 4EIJA 1CO6A 2B89A 3V5BA 1GW3A 4DOJA 1PGQA 1LP1A 5APWA 3HRNA 1URQD 1FDMA 2JTIB 2A45G 2RMZA 2VHDA 1R5LA 5CCHA 2ZYDA 3O8ZA 2WPVB 3CX5H 2KNCB 1PGJA 1GL2C 3RK3B 1NGMB 3FGAD 2BEQD 3L73G 2OQQA 1L4AC 1ZXGA 4DCKA 3CCVP 1QGKB 1KC8Q 2B12B 3QH9A 2M5AB 2YIUC 1SVFA 1EC5A 3TSIA 3AEFC 3M97X 3A0BE 4W7ZA 1KQLA 1S72P 2FFDA 1PPJG 4WY4C 1WEJF 1S5LE 1R0QA 2E75D 1IO4A 1QEXA 2FYUJ 1HBWA 5E79V 2XDJA 1N7SD 2ZT9B 5AW9B 1N50A 3NWVA 1NTME 2KI7B 2L5GB 4H44D 1PP9G 1OW8A 4D6TD 3L73D 2QJKC 1M1JA 3OCDB 2JWAA 3RK2B 4BRYA 1QYZA 2OYIA 2JP3A 2KOGA 1K9MQ 2JR8A 2QG4A 3KXDA 4TT3H 1PPJD 1CYJA 4IFDK 1GD2E 1NH4A 2Q9IA 1H31A 2OTLP 3MP7B 2ITAA 4WQDA 1IRVA 1GL2B 1E79H 1OW6A 1PZQA 2D0SA 3WUVA 1L4AB 1DW2A 3B5NB 1KX7A 1M57D 4FAVA 4B86A 1N90A 2YIUB 1A02J 5H2FH 3DMIA 3L70E 1K3HA 3RL0D 4WY4B 3L72J 4PD4E 2L4DA 1AYGA 1AA0A 3UIAA 1HF9A 2IFNA 1YEBA 1H8AA 1CSWA 1G2CA 3OJAB 2E5TA 4H13C 2MKVA 1NYHA 2WSEH 2N3YA 1H0TA 1BCCE 1BDCA 3CCMP 2H89C 3ZDMA 3L35A 3SJLA 3Q5SA 4O1QA 3TGUE 2B88A 3P7KA 2Q3EA 4UB8E 3VP9A 1NTZG 5CCGA 1KYOW 2G8YA 1RAPA 1S9KE 3HUSA 4UB6E 3CCJP 1KILB 1NAYA 1SS1A 1X22A 3A5TA 3HE4B 3HQ8A 4OGQB 5TISH 2WPRA 2P58A 2IBZE 1BDDA 1S2EA 5AW0B 3VN0A 1Q81Q 3VYIA 2K3RA 1SQBE 5CHXA 3FXDA 5CIFB 2M3EA 1NTMD 1NTMK 1L0LG 4FANA 1CC5A 3IFMA 1VQ7P 2FKWB 1GZLA 1FOSE 1E29A 3CXHW 2KZIA 2NPSC 1MG2D 451CA 5CCHC 1RHZB 1YJWP 3JCUE 3L70G 4H13B 1HJ5A 3GHGC 2O1KA 1HH7A 2ZXYA 1FCDC 3P8CE 4C7RA 4R4MA 3BRVB 2KK7A 1IC2A 1I6EA 1SQPJ 3KPEA 1F1CA 3W68A 2BH4X 4DY9A 4HYTB 3HQ7A 1GDTA 1BCCG 2RN0A 1NIRA 2FYUD 2CPSA 2FYUK 4K35A 1H1OA 1FU1A 1KTMA 3TGUG 1VQ4P 5AW3B 4PV1D 4EDFA 2N18C 2K88A 4PD4D 1YITP 1YHQP 3WC8A 1FZFA 2AEMA 1KV9A 3WMM0 1T3JA 1FJPA 4CPGA 1VF5C 2E76D 2PGDA 3CMEP 1M70A 3AEEC 2YK3A 1HH0A 1YBKA 2NPSB 1T3UA 1BCCD 3BVHA 1SQBG 3RN1A 3CYTI 3Q1MA 1CNOA 5AVVB 2BGVX 1VQOP 3TGUD 1PIXA 3GHGB 5APXA 3CCQP 3L36A 2ZFCA 5AVTB 3A0HV 1S9KD 5KAFV 4AX3A 4YXDC 2K9JB 2LXCB 4PW9B 4GIFA 1VQ9P 1BGYE 3SWSA 2B10B 1YIQA 2AXTE 5CYTR 4I7ZC 2N1TA 1RE3A 1CSVA 5L8RJ 2IBZD 4AAOA 1JCCA 2N9JA 3AEGC 3IN6A 2WWWA 5B66V 1KB9E 1SQBD 1Q7YQ 1SQBK 2QM8A 1VQ5P 2QJYC 3AE4C 3L74E 3CCSP 1GIWA 2N18B 3VMZA 4RSZA 1LWUC 5DJUB 2CA4B 2Q6QA 1CYIA 3H1KJ 1VF5B 4YE1A 1DIPA 4R4LA 1N8RQ 3HUSC 3NBSA 5CICB 1FZCC 4JYCA 1YTZI 1HJ3A 1OX3A 5KLVJ 2Y9YA 1DW3A 5KKZC 3R2PA 1JB0J 1ZN5A 3CC2P 3H1JG 1CRGA 2CE1A 5CIEB 1QVGO 1HJ4A 1JM0A 1M6ZA 2YO2A 3CCUP 3SLEA 2N9IA 3B71A 2OYOA 2H7HA 3GLMA 3PRJA 1AQTA 4I7ZB 4LLHA 3A9FA 3H32A 4WQ9A 3L4OA 1VQKP 2O01N 4WWIA 1GU2A 1BGYG 1GMJA 2W27A 2LIRA 2AIUA 2A45I 1E8EA 2YMYA 1DEBA 1KYOI 1JCDA 2IDBA 2R44A 1X8YA 2AEFA 3VYMA 1FDOA 2OZ1A 1L0NE 5APUA 4FA5A 3PP5A 1LWUB 2KS1A 3ZCFA 1LMSA 2FXMA 1LT9A 4L3GA 4AUWA 2BASA 3AE3C 3AEDC 2GC4D 1X9VA 2YQBA 3VNWA 3ZOYA 4FA9A 1BGYD 4KMGA 3RBZA 1EZVE 1NHLA 4RJTA 2IZ0A 1FZCB 3T97A 3MGNA 4WQCA 3ZOOA 4IFFA 5KKZB 4MU8A 1URQC 2QRXA 1LTTC 3CXHI 3L37A 5AVSB 2YO3A 1EB7A 3D6ZA 2FY8A 3CU4A 3ZOWA 1Q86Q 1KQSO 1DD3A 1I54A 1KB9D 1GJQA 1S1CX 3KDPB 1W2EA 1CHHA 2WSSH 4U3FE 4ASVA 2HYNA 2P67A 1BE3G 3M0AA 3O1YA 3L74D 1J2JB 1DVVA 1Y8AA 1NU1E 2PRRA 1CSUA 3HTKA 3E7KA 2HV4A 1NKNA 1VQPP 1EXJA 3O5CA 3BATA 3L75E 4K3AA 1MZ9A 2WMMA 1NWQA 3A0BV 1CZQA 1H89A 2K1AA 2E75C 3PXTA 3DP5A 2OYHB 2JWDA 1N7SC 2Q3IA 1IFPA 4H44C 4IL6E 1RE3C 2JO1A 2JEEA 3CCEP 5B5EV 3A0HH 3KZIH 1RZ6A 3TYYA 5CCGD 1L0NG 4BXLA 1HTLC 3EWKA 4TLFA 3AECC 1USDA 3Q5PA 1KFNA 1URQB 1IFDA 1KFMA 1PP9J 5GTIV 3Q5RA 2MTAC 3E1IA 2AXCA 1RE4C 5B66H 3RL0g 1OCDA 1LNQA 3IR9A 3VRDA 1A02F 3H1KD 3H1LE 1U7JA 5KJ7D 3MIWA 2Z4EA 1L0ND 4WQ8A 1L0NK 4H0JA 3PH0A 3V2NA 1FZGA 4U3FG 5DFSA 4FA1A 2CA3B 3RL0C 3EFFK 1OWAA 3H1IE 1DH3A 2J58A 3MD0A 1N7SB 1AOQA 1N9CA 2ZBOA 1M60A 1Q90D 1UIIA 1YI2P 1CRHA 1EZVD 1YICA 1QN2A 2A45H 1Z56A 3L75G 4H44B 1KYOH 1LTJA 1N73A 1FJKA 5AVUB 3E1RA 5AW8B 3H1HE 2RH0A 1FDIA 3CX5E 3BCCJ 2NRGA 2C0WA 1M7LA 2YKQA 1H32B 3D70A 3LIEA 3WU2E 4U3FD 2ZXXA 1IO3A 1QLED 5APTA 1HJBA 1J1DC 4UB8V 1NU1D 2ZYAA 1NU1K 1H9XA 2Y0CA 3L75D 3CXHH 1AKKA 3GG2A 3MZWB 4V2KA 1NMLA 4D6TG 1H33B 1NTZJ 2EXVA 3P32A 2B0ZB 4NFGB 2W6BA 4IOIH 1K73Q 3SWYA 3L4FA 3C1LA 1KORA 1WVEC 5IY51 4HKZH 2PP6A 3RL0B 3F89A 4J20A 1CSBA 4KJMA 5CBOA 3H1LG 3HD7A 1T6AA 2WSEJ 2KP8A 1RF1C 4DJGA 5GTHV 2HPCB 5AURA 3HQ6A 3H1IG 1L0LJ 4WQ7A 3S1KA 2N1TD 1ZOYC 3PJSK 3HQ9A 2C9XB 1YCCA 4RO0A 4I2LC 2PFXA 2V4HA 2P7JA 1M1KQ 1W2BO 1NTKJ 2C1DA 4EIFA 1IFNA 1J3SA 2FYZA 1JMBA 1J1DB 4ZKUA 3I55P 1OIPA 3VOPA 3H1LD 2N9YB 1VL2A 1CCHA 4N78D 1K8AQ 2V08A 3A0BH 1DT1A 4PV1C 2ZOOA 3ABVC 3H1ID 1JOCA 2YXQB 4Z1MH 3CWBJ 2QE7H 1H9YA 2FYUE 3KQGA 2H8PD 2E76C 1AJYA 3SVWA 2L91A 1KQGB 3H1HD 4I6MC 3N4XA 5B5EH 1IQCA 3CX5D 2WTYA 3M9BA 1GDVA 1IJDB 1RF1B 1DX7A 1NKZB 2KZJA 4N0KA 3WUTA 3M9HA 1Q2NA 1OFCX 1X79B 3W67A 2D0WA 5GTIH 2WSCJ 2W6AA 1HWTC 2QJKB 3ITKA 1XTGB 5TISE 3OA8B 3HE5B 3DR0A 2AXTV 1SFCA 3O20A 2XU6A 4C7NA 1NTMG 2LXBA 1MG3D 1LC2A 2HODB 2BCCJ 1IRWA 1LJ2A 1KX2A 1MFTA 4WVZA 3SFEC 5CIGB 1IFJA 5BU5A 3IF4A 1VQNP 1KB0A 1RF0A 2BEZF 5DJTB 1E2RA 3M91A 5CJ0A 1GK6A 3AE8C 1ZP0C 2R3CA 4P4QB 3L72E 1WT6A 2HG5D 1NVOA 2E76B 4O1WA 1YIJP 1RY3A 2GUVA 3LW5H 5KJ7A 1IK9A 1SQXJ 2BPBB 1EDIA 1JTHB 1FBMA 3S4RA 2FYUG 2IX7C 1OW7A 1K05A 3B5ND 1YEAA 1MKMA 4UB8H 3K5BA 2OTKE 2RKLA 4HB1A 2B87A 3TNUB 1NNOA 3M0DA 2WT7B 2FFDC 2WSCH 4L3HA 2R3SA 3H1JJ 4AYCA 1YJ9P 3U1AA 1QL3A 1FJ0A 3JC22 1YNRA 1AVOA 3O6QA 1M1JC 3VTPC 3VMXA 1CI6A 5E79H 4IL6X 5GTHH 4JPZB 2OYIC 1LP1B 1X0TA 3Q3DA 1C75A 4OWFA 1SQVJ 2I8DA 1KILD 5AW7B 5AVRB 4YPCA 2IBZG 3AE6C 2GA1A 3RN0A 2O01J 1XTCC 1OZHA 2ZJSE 4OGQD 1EQ7A 1A8CA 2PACA 1ZR4A 1HZUA 3D0WA 4PJ0V 4H0LD 1SQPE 1CRJA 1AOFA 2QVAA 4XXLA 3SFDC 1HCMA 1CXAA 4JBZA 1ETPA 2FBWC 1ZRTD 2WPSA 2XKMA 2GIWA 4EOTA 2Y0EA 2FFDB 2I1JA 3WFDC 5B6QA 3L71J 5KAIE 1S3JA 3L72D 1JMMA 1P84E 2O3JA 4N6JA 3NFQA 1OVRA 3V4WA 3U59A 1BE3J 5APSA 1U57A 1M1JB 4BRYB 2Q7CA 1N86A 2OYIB 1VQ6P 4IL6V 4K3IA 3A7OA 4Y99C 3CP5A 2CXBA 5CCGC 2YKOA 3PHLA 2QJPC 2BCCD 2QEXP 2AXTH 1H31B 2W90A 2ZYGA 2C2CA 1SQQJ 1VQLP 2QIWA 4W7YA 3M9QA 4HJGH 5APQA 5DF5A 2O01H 1T2KD 1LTSC 3U1CA 5AVXB 1LS9A 3D6YA 4L76A 4ZMDA 4DZOA 1FI9A 1SQPG 2M5AA 5KJ7C 2R32A 2Q1KA 2KYVA 1SQXD 3HD7D 1SQXK 2E43A 2QJYB 1G2CB 3FX0A 1CYCA 3CPWO 1S5LX 3V2QA 3H1KE 3PTZA 2AI5A 2FRCA 2D2CD 1TU3F 3CI9A 1H0TB 2CK3H 1FI7A 3H6PA 5AW4B 3C2CA 4W80A 3OCDA 3EQ2A 3PH2B 4Y99B 3L74G 5KLVE 1CRYA 1SQPD 4JYBA 1SQPK 4XFJA 4BWNA 3CC4P 2OGUA 2QJPB 2XZRA 3HUSB 1EXIA 1PGOA 4ASWA 1OVUA 4LJIA 4GYDA 3WU2V 3II6A 4IFMA 2MHMA 2ZAEB 3MTUE 4GEDB 2ZONG 2KSEA 1GL2A 2FYNC 1P84D 3MK7C 3B5NA 1C52A 1ZLLA 2KLUA 4L1QA 4L73A 2ZZS1 3ORVA 5AVZB 4WY4A 4KHXA 1LT1A 3ZOXA 3A0HE 2XTSB 2YKPA 3GMAA 3KZIE 1FE6A 1KN7A 2LKMA 3L4MA 4D6TJ 1S5LV 5CIHB 3L73J 1RH5B 5AW2B 2IYOA 1MZ4A 4NPEA 1LTAC 2V7QJ 3M06A 4ZNCA 5B66E 2N1TC 1SFCD 4PJ0H 1KD1Q 3H1KG 2A06E 4C46A 1HZVA 1T8ZA 2C1VA 5KAFH 1N7LA 4WB4A 1CIGA 1YFCA 4WQAA 2I1KA 4Y5RA 3NTNA 1KILA 3ZBMA 2KB7P 3R4YA 3MUDA 3WFEC 1C6SA 5KLVG 1CIFA 1HGVA 3LIDA 3HE4A 3GF7A 5APYA 1I8PA 4XYDB 3NXSA 3WUIA 1EZVG 4ZKPA 1C2NA 3MK7B 2P10A 1DW0A 3GF3A 5EXQA 1I55A 5AW5B 2YMKA 1KYOE 4EICA 4N78E 1C6RA 1RQVA 4XA4A 1LTBC 5CJ4A 4IL6H 1JY2P 3OA7A 3USSA 1F1FA 5KLVD 2E75B 4L74A 5KLIC 5KLVK 1NU1G 1LGHB 5C0ZA 1SP4A 4LC1A 2KLVA 2MJZA 4OVNF 3WFCC 1GKSA 3RBXA 4AQRD 4MN4C 1M8OB 3EFGA 2N1TB 2WSFH 1A56A 3CXHE 3SXTA 1IK7A 1CORA 3AE1C 2M3BA 1JO5A 4EIDA 3CCLP 5CIBB 3RK3E 1RAQA 1M56D 1CRIA 2QM7A 2H88C 1LTIC 2V7QH 3X39A 2PCCB 1OVVA 2A06G 4O9BA 1VDFA 1M90Q 1FOCA 4UB6V 2BCNB 4PD4I 1HROA 1BSHA 3OAKA 1NTMJ 1QL4A 1LT9C 1JY2N 4FB1A 1ZZHA 2E5YA 1USEA 2NPSA 5AW1B 2Y9ZA 3SSUA 5KLIB 5CBNA 2A06D 1COTA 1QX8A 1CRCA 1VQ8P 1HRCA 3GHGA 3N7NA 5C39A 3AEAC 3BCCE 3B5NC 3WU2H 1BSNA 2K9JA 1IFIA 3H32B 1H88A 1YQ3C 1CHIA 5DJQC 1FS0E 2IBZI 1SLQA 1S4XA 2GB8B 2XNDH 1MUUA 3H1HG 1KYOD 3L70J 5BVZA 5H2FE 1DIQC 2HR3A 3C8VA 3ZIYA 2OZ1B 1G1IA 2C9NY 2E74D 5B5EE 1NTZE 2J5UA 4GOEA 2KS1B 1NAFA 1J1EC 1LT9B 2XV5A 4QMAA 2Z5HA 2GUSA 1S5LH 3LW5J 2KIKA 2R5DA 3AE5C 5GTIE 1BCCJ 2WQYC 4NPDA 3T97B 5AW6B 3CD6P 3KHUA 1KILC 3D71A 1HJ0A 3CL3D 3MUDC 3JBTB 2B11B 2R5BA 3CXHD 3TGUJ 1L0LE 1I8OA 1YTCA 1PP9D 4OGQC 3RK3D 1L9JC 4H0LC 2WPQA 1KILE 4L75A 1C7MA 1NTKE 1I5TA 1ZV8A 3HTKB 5DJQB 1K04A 3FWNA 1HUCA 3I56P 1KV4A 3BCCG 4AALA 4EI2A 1SQBJ 2HFED 351CA 5TJHA 3BASA 1N15A 1RQUA 2ZT9D 5KAIV 2DVHA 2POHA 1NJIQ 2B9BA 3G3ZA 1IZL0 4N3YB 3AE9C 3CWBE 1LTJC 1N73C 1J1EB 4PV1B 1LWUA 1LFMA 1ZRTE 3RK2D 4PD4H 1CTJA 4LGDE 3SWKA 2C1UA 3BCCD 1UIXA 1FZCA 4GT1A 1KIBA 3AEBC 2DGEA 1GL2D 1AV1A 1L4AD 1KB9I 1P84I 4H0LB 1OMIA 5CMZA 1PL5A 4KT0J 1EDJA 3I5CA 1S6VB 2WVRA 2OARA 1C6OA 2LR2A 3FWLA 1T2KC 2W8ZA 3TF5A 4UB6H 2BCCE 4JCGA 1NTZD 3B8EB 1NTZK 1KZUB 4WY4D 3CX5W 5E79E 4YTPC 4RKUJ 1W5CE 5GTHE 1JY2O 4Y28J 1NTKG 2KSJA 3HD7C 3G9RA 1QVFO 1GW4A 2YXRB 2OYHA 1CTZA 1VYDA 1U74B 1YTZT 1LTJB 1NMIA 1N73B 4EYYQ 3SWFA 1FZBA 2JKVA 2D2CC 2Z5IA 3CCRP 2M0BA 1L0LD 1FZAA 1L0LK 5AVQB 1L2PA 1EDKA 1SQXE 1BGYJ 1QL2A 1ZMEC 2ZXEB 3CWBG 3MHVA 1E5WA 5EFWB 3JCUH 2NZ2A 1NTKD 3A2AA 3PXWA 1LTGC 1CIEA 1NTKK 1Y47A 1ZW0A 1URQA 4GOFA 5BU8B 3L70D 3L72G 1FI3A 2FXPA 3RGUA 3L74J 1U75B 3VMAA 3H1JE 2O1JA 1B7VA 3VMYA 3CWBD 155CA 1FAVA 1LC1A 2XNXA 3HD7B 1DIIC 1JY3P 2BCCG 5AVYB 1QKSA 3QWOC 4H13D 1N7SA 1AFOA 3KZIV 1EZVI 2SPZA 2D2CB 1SQVE 4XE5B 1EDLA 1CSXA 1L9BC 1R5SA 2GM4A 3H25A 2IPPA 2QSIA 1SFCC 2C1DB 1H32A 1C2RA 2KXPB 1JDLA 2YNYA 4DT0A 1CIHA 1PFIA 1SQXG 2C0XA 2OTJP 2CPBA 2V07A 1JUNA 2IFMA 2CE0A 1RF0C 1RE4A 2AEJA 1HGZA 2W83C 4HH2A 2JQRA 2G3AA 1RZ5A 1WRGA 2HLOA 1R8EA 1K3GA 5KAIH 3CMAP 2KNCA 2YCCA 3RMZA 1KB9H 1L0NJ 1P84H 1H33A 3G71P 3L71E 1JY3N 3P8CD 2NPSD 5M1BA 5C9MA 3V6IA 5CCHD 2DW3A 3A3YB 1BE3E 1G1JA 1DD4A 3WUUA 3RLMA 4I1LA 1YYCA 1DVHA 2HPCA 4AAMA 2P2UA 1KMIZ 1BL9A 2ZVOB 1W2LA 1WMKA 1KQFB 1SFCB 4C7NB 3M0DC 4U3FJ 5CIDB 1FHBA 3F5HA 1NOHA 1SQVG 1CW5A 1GK4A 4GKGA 3GW6A 3AE7C 1NU1J 1SQQE 1JEKA 1IZNB 2C8SA 2Q5UA 3H1JD 1U7MA 2OYHC 3TK1A 4QAOA 1CEDA 4OH8B 1ZR2A 4H0KA 3L75J 3AE2C 4U7JA 2ORLA 3C9IA 2PAJA 1N2DC 4FA4A 1VF5D 3IAOA 2K9YA 1CXCA 3PXSA 1L4AA 1JNMA 3OW2O 1NO4A 1OAEA 3FXEA 1MFZA 4AANA 1SQVD 1FC2C 1SQVK 1YJNP 1Q82Q 3G4SP 4PJ0E 3CX5I 3L71G 1GQ1A 2IZ1A 4EIEA 5KAFE 1FZEA 3V2RA 3TYIA 1RF1A 1AVYA 3B4SA 2FXOA 1CTYA 2WSFJ 3NBTA 3P8MC 2PCBB 2WZ7A 2IYPA 1MV8A 2BH5X 2K37A 2J59M 2Y0DA 2VRSA 5KTBA 2B87B 2BLFB 1DEEG 3OA8A 4WQBA 3HE5A 3S9OA 3WFBC 4JF7A 3H1LJ 1D7MA 3BRTB 2HODA 3L71D 2ZVNB 2GC7D 1DW1A 4NPFX 3Q2YA 1GU5A 3H1IJ 4PWAA 3O6QB 5H2FV 1QL1A 1SQQG 1CCRA 1I6DA 2E74C 1BE3D 2FYNB 1CI6B 1HVVA 2H43A 2P1JA 2C9LY 2WITA 4M3LA 1PV3A 3H1HJ 3V4QA 4Q5PA 4WBAA 3PLNA 2N9BA 4GDOA 4D6TE 3L73E 1JTHA 2I8FA 4WQEA 2JJLA 2JDIH
chains in the Genus database with same CATH topology
3L4OA 1CHJA 1QL3A 1FJ0A 4A7PA 2N3BA 1GU2A 3KHUA 1A2SA 1SQQD 1YNRA 2LIRA 2AIUA 2B11B 3JBTB 1E8EA 3CXHD 2LITA 1W5CT 1I8OA 1YTCA 1PP9D 1C75A 3VYMA 2FWLA 2OZ1A 4FA5A 1L9JC 5TISV 2KS1A 3ZCFA 1LMSA 3RN0A 1C7MA 4L3GA 1I5TA 3O0RC 5DJQB 2GC4D 3TDKA 1A8CA 2B4ZA 2PACA 2YQBA 3VNWA 1HZUA 4AALA 3ZOYA 4PJ0V 1BGYD 4KMGA 4FA9A 4RJTA 1CRJA 351CA 1AOFA 4WQCA 4XXLA 3ZOOA 5TJHA 5KKZB 1HCMA 4MU8A 1CXAA 1N15A 1CO6A 1EB7A 3CU4A 5KAIV 2DVHA 1ETPA 3ZOWA 1ZRTD 2GIWA 2Y0EA 1I54A 1IZL0 1KB9D 1GJQA 1CHHA 3WFDC 5B6QA 1LFMA 3L72D 3O1YA 3L74D 1CTJA 1DVVA 2O3JA 2JTIB 1CSUA 2RMZA 2VHDA 2C1UA 3BCCD 2HV4A 2KNCB 3O5CA 3A0BV 1KIBA 2B12B 4IL6V 3PXTA 3DP5A 4K3IA 2DGEA 3M97X 3CP5A 2CXBA 3PHLA 1WEJF 2BCCD 1R0QA 1S6VB 1C6OA 5E79V 1H31B 3FWLA 3TF5A 5B5EV 2C2CA 1N50A 4JCGA 3NWVA 1NTZD 1RZ6A 3CX5W 5DF5A 4D6TD 3L73D 3OCDB 2JWAA 1LS9A 5GTIV 1QYZA 2MTAC 1FI9A 1CTZA 2QG4A 1VYDA 1U74B 1NMIA 1OCDA 1PPJD 1SQXD 1CYJA 3VRDA 1L0LD 3H1KD 2QJYB 1H31A 1CYCA 4WQDA 1L0ND 4WQ8A 1IRVA 4H0JA 3PTZA 2D0SA 2AI5A 2FRCA 5DFSA 4FA1A 1DW2A 2CA3B 1NTKD 3PXWA 1FI7A 1CIEA 3C2CA 1KX7A 4FAVA 3OCDA 1N90A 3L70D 2YIUB 1AOQA 1N9CA 2ZBOA 1M60A 3PH2B 1CRHA 1FI3A 1CRYA 1SQPD 1EZVD 3DMIA 1YICA 1QN2A 2QJPB 1K3HA 2L4DA 4LJIA 4GYDA 1AYGA 3WU2V 2MHMA 1U75B 3VMAA 4GEDB 1YEBA 1CSWA 1B7VA 2ZONG 3CWBD 155CA 1H32B 4U3FD 1LC1A 1IO3A 1P84D 2N3YA 3MK7C 4UB8V 1DIIC 1C52A 1NU1D 1QKSA 1H9XA 4L1QA 2Y0CA 3SJLA 4O1QA 3KZIV 2ZZS1 3L75D 2Q3EA 1AKKA 3ORVA 1KYOW 3GG2A 1RAPA 3ZOXA 4V2KA 2XTSB 1CSXA 1L9BC 1NMLA 1H33B 2EXVA 2B0ZB 3HQ8A 4NFGB 3L4MA 1S5LV 2C1DB 5CIHB 1H32A 1WVEC 5IY51 1C2RA 4J20A 1MZ4A 1JDLA 1CIHA 5CIFB 2V07A 1NTMD 4FANA 2CE0A 1HZVA 5GTHV 1CC5A 2C1VA 5AURA 2JQRA 1E29A 3CXHW 1RZ5A 3HQ6A 1CIGA 1YFCA 4WQAA 4WQ7A 4Y5RA 1K3GA 1MG2D 451CA 3ZBMA 3HQ9A 2YCCA 3RMZA 3WFEC 2C9XB 1H33A 1YCCA 1CIFA 1HJ5A 1I8PA 4XYDB 1HH7A 2C1DA 3WUIA 4EIFA 1J3SA 1C2NA 2ZXYA 1FCDC 1DW0A 3MK7B 5C9MA 5EXQA 1I55A 3H1LD 2N9YB 3RLMA 1CCHA 1I6EA 1F1CA 4EICA 2BH4X 2V08A 1DVHA 4DY9A 1DT1A 2ZOOA 4AAMA 1C6RA 3HQ7A 3H1ID 2RN0A 1NIRA 1BL9A 2FYUD 1F1FA 1W2LA 1H1OA 5KLVD 1H9YA 5C0ZA 4EDFA 5CIDB 2N18C 4PD4D 1FHBA 3SVWA 2L91A 3GW6A 3WC8A 3H1HD 3WFCC 1GKSA 2C8SA 1KV9A 1IQCA 3CX5D 3H1JD 1GDVA 4QAOA 1CEDA 1A56A 4H0KA 3SXTA 1CORA 1M70A 4N0KA 4EIDA 2YK3A 2ORLA 2D0WA 5CIBB 1RAQA 1CRIA 1BCCD 3RN1A 3X39A 2PCCB 4FA4A 2QJKB 3CYTI 3ITKA 1CXCA 3PXSA 1CNOA 2BGVX 3OA8B 3DR0A 2AXTV 3TGUD 1OAEA 1FOCA 3O20A 4UB6V 2BCNB 3A0HV 5KAFV 4AX3A 4AANA 1MG3D 1SQVD 4PW9B 1LC2A 2K9JB 1HROA 3SWSA 1IRWA 2B10B 1YIQA 5CYTR 1KX2A 1QL4A 5CIGB 1GQ1A 4EIEA 4FB1A 1ZZHA 1KB0A 1CSVA 3TYIA 2IBZD 4AAOA 1CTYA 3NBTA 2PCBB 1E2RA 2N9JA 5B66V 2BH5X 1SQBD 2Y0DA 2BLFB 5KLIB 2A06D 4P4QB 1COTA 1GIWA 1CRCA 3OA8A 4O1WA 2N18B 4WQBA 1HRCA 3WFBC 4RSZA 2BPBB 2CA4B 1CYIA 3L71D 2GC7D 4YE1A 1DW1A 1CHIA 5DJQC 4PWAA 1YEAA 3NBSA 5CICB 5H2FV 1CCRA 1I6DA 1BE3D 2FYNB 2GB8B 1HJ3A 1KYOD 1DW3A 1DIQC 1NNOA 3ZIYA 1CRGA 2CE1A 5CIEB 2OZ1B 1HJ4A 1M6ZA 3SLEA 4L3HA 4Q5PA 2N9IA 3PLNA 3PRJA 3A9FA 2I8FA 4WQEA 1C6SA 4WQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4O A;  1CHJ A;  1QL3 A;  1FJ0 A;  4A7P A;  2N3B A;  1GU2 A;  3KHU A;  1A2S A;  1SQQ D;  1YNR A;  2LIR A;  2AIU A;  2B11 B;  3JBT B;  1E8E A;  3CXH D;  2LIT A;  1W5C T;  1I8O A;  1YTC A;  1PP9 D;  1C75 A;  3VYM A;  2FWL A;  2OZ1 A;  4FA5 A;  1L9J C;  5TIS V;  2KS1 A;  3ZCF A;  1LMS A;  3RN0 A;  1C7M A;  4L3G A;  1I5T A;  3O0R C;  5DJQ B;  2GC4 D;  3TDK A;  1A8C A;  2B4Z A;  2PAC A;  2YQB A;  3VNW A;  1HZU A;  4AAL A;  3ZOY A;  4PJ0 V;  1BGY D;  4KMG A;  4FA9 A;  4RJT A;  1CRJ A;  351C A;  1AOF A;  4WQC A;  4XXL A;  3ZOO A;  5TJH A;  5KKZ B;  1HCM A;  4MU8 A;  1CXA A;  1N15 A;  1CO6 A;  1EB7 A;  3CU4 A;  5KAI V;  2DVH A;  1ETP A;  3ZOW A;  1ZRT D;  2GIW A;  2Y0E A;  1I54 A;  1IZL 0;  1KB9 D;  1GJQ A;  1CHH A;  3WFD C;  5B6Q A;  1LFM A;  3L72 D;  3O1Y A;  3L74 D;  1CTJ A;  1DVV A;  2O3J A;  2JTI B;  1CSU A;  2RMZ A;  2VHD A;  2C1U A;  3BCC D;  2HV4 A;  2KNC B;  3O5C A;  3A0B V;  1KIB A;  2B12 B;  4IL6 V;  3PXT A;  3DP5 A;  4K3I A;  2DGE A;  3M97 X;  3CP5 A;  2CXB A;  3PHL A;  1WEJ F;  2BCC D;  1R0Q A;  1S6V B;  1C6O A;  5E79 V;  1H31 B;  3FWL A;  3TF5 A;  5B5E V;  2C2C A;  1N50 A;  4JCG A;  3NWV A;  1NTZ D;  1RZ6 A;  3CX5 W;  5DF5 A;  4D6T D;  3L73 D;  3OCD B;  2JWA A;  1LS9 A;  5GTI V;  1QYZ A;  2MTA C;  1FI9 A;  1CTZ A;  2QG4 A;  1VYD A;  1U74 B;  1NMI A;  1OCD A;  1PPJ D;  1SQX D;  1CYJ A;  3VRD A;  1L0L D;  3H1K D;  2QJY B;  1H31 A;  1CYC A;  4WQD A;  1L0N D;  4WQ8 A;  1IRV A;  4H0J A;  3PTZ A;  2D0S A;  2AI5 A;  2FRC A;  5DFS A;  4FA1 A;  1DW2 A;  2CA3 B;  1NTK D;  3PXW A;  1FI7 A;  1CIE A;  3C2C A;  1KX7 A;  4FAV A;  3OCD A;  1N90 A;  3L70 D;  2YIU B;  1AOQ A;  1N9C A;  2ZBO A;  1M60 A;  3PH2 B;  1CRH A;  1FI3 A;  1CRY A;  1SQP D;  1EZV D;  3DMI A;  1YIC A;  1QN2 A;  2QJP B;  1K3H A;  2L4D A;  4LJI A;  4GYD A;  1AYG A;  3WU2 V;  2MHM A;  1U75 B;  3VMA A;  4GED B;  1YEB A;  1CSW A;  1B7V A;  2ZON G;  3CWB D;  155C A;  1H32 B;  4U3F D;  1LC1 A;  1IO3 A;  1P84 D;  2N3Y A;  3MK7 C;  4UB8 V;  1DII C;  1C52 A;  1NU1 D;  1QKS A;  1H9X A;  4L1Q A;  2Y0C A;  3SJL A;  4O1Q A;  3KZI V;  2ZZS 1;  3L75 D;  2Q3E A;  1AKK A;  3ORV A;  1KYO W;  3GG2 A;  1RAP A;  3ZOX A;  4V2K A;  2XTS B;  1CSX A;  1L9B C;  1NML A;  1H33 B;  2EXV A;  2B0Z B;  3HQ8 A;  4NFG B;  3L4M A;  1S5L V;  2C1D B;  5CIH B;  1H32 A;  1WVE C;  5IY5 1;  1C2R A;  4J20 A;  1MZ4 A;  1JDL A;  1CIH A;  5CIF B;  2V07 A;  1NTM D;  4FAN A;  2CE0 A;  1HZV A;  5GTH V;  1CC5 A;  2C1V A;  5AUR A;  2JQR A;  1E29 A;  3CXH W;  1RZ5 A;  3HQ6 A;  1CIG A;  1YFC A;  4WQA A;  4WQ7 A;  4Y5R A;  1K3G A;  1MG2 D;  451C A;  3ZBM A;  3HQ9 A;  2YCC A;  3RMZ A;  3WFE C;  2C9X B;  1H33 A;  1YCC A;  1CIF A;  1HJ5 A;  1I8P A;  4XYD B;  1HH7 A;  2C1D A;  3WUI A;  4EIF A;  1J3S A;  1C2N A;  2ZXY A;  1FCD C;  1DW0 A;  3MK7 B;  5C9M A;  5EXQ A;  1I55 A;  3H1L D;  2N9Y B;  3RLM A;  1CCH A;  1I6E A;  1F1C A;  4EIC A;  2BH4 X;  2V08 A;  1DVH A;  4DY9 A;  1DT1 A;  2ZOO A;  4AAM A;  1C6R A;  3HQ7 A;  3H1I D;  2RN0 A;  1NIR A;  1BL9 A;  2FYU D;  1F1F A;  1W2L A;  1H1O A;  5KLV D;  1H9Y A;  5C0Z A;  4EDF A;  5CID B;  2N18 C;  4PD4 D;  1FHB A;  3SVW A;  2L91 A;  3GW6 A;  3WC8 A;  3H1H D;  3WFC C;  1GKS A;  2C8S A;  1KV9 A;  1IQC A;  3CX5 D;  3H1J D;  1GDV A;  4QAO A;  1CED A;  1A56 A;  4H0K A;  3SXT A;  1COR A;  1M70 A;  4N0K A;  4EID A;  2YK3 A;  2ORL A;  2D0W A;  5CIB B;  1RAQ A;  1CRI A;  1BCC D;  3RN1 A;  3X39 A;  2PCC B;  4FA4 A;  2QJK B;  3CYT I;  3ITK A;  1CXC A;  3PXS A;  1CNO A;  2BGV X;  3OA8 B;  3DR0 A;  2AXT V;  3TGU D;  1OAE A;  1FOC A;  3O20 A;  4UB6 V;  2BCN B;  3A0H V;  5KAF V;  4AX3 A;  4AAN A;  1MG3 D;  1SQV D;  4PW9 B;  1LC2 A;  2K9J B;  1HRO A;  3SWS A;  1IRW A;  2B10 B;  1YIQ A;  5CYT R;  1KX2 A;  1QL4 A;  5CIG B;  1GQ1 A;  4EIE A;  4FB1 A;  1ZZH A;  1KB0 A;  1CSV A;  3TYI A;  2IBZ D;  4AAO A;  1CTY A;  3NBT A;  2PCB B;  1E2R A;  2N9J A;  5B66 V;  2BH5 X;  1SQB D;  2Y0D A;  2BLF B;  5KLI B;  2A06 D;  4P4Q B;  1COT A;  1GIW A;  1CRC A;  3OA8 A;  4O1W A;  2N18 B;  4WQB A;  1HRC A;  3WFB C;  4RSZ A;  2BPB B;  2CA4 B;  1CYI A;  3L71 D;  2GC7 D;  4YE1 A;  1DW1 A;  1CHI A;  5DJQ C;  4PWA A;  1YEA A;  3NBS A;  5CIC B;  5H2F V;  1CCR A;  1I6D A;  1BE3 D;  2FYN B;  2GB8 B;  1HJ3 A;  1KYO D;  1DW3 A;  1DIQ C;  1NNO A;  3ZIY A;  1CRG A;  2CE1 A;  5CIE B;  2OZ1 B;  1HJ4 A;  1M6Z A;  3SLE A;  4L3H A;  4Q5P A;  2N9I A;  3PLN A;  3PRJ A;  3A9F A;  2I8F A;  4WQE A;  1C6S A;  4WQ9 A; 
#chains in the Genus database with same CATH topology
 1CHJ A;  5AVW B;  5K5G B;  4A7P A;  2N3B A;  1VQM P;  1A2S A;  1SQQ D;  2UWJ E;  1SQQ K;  3RK3 C;  1YQ4 C;  1GTW A;  5APV A;  1PPJ E;  3CLQ A;  1OXZ A;  4RES B;  2LIT A;  1W5C T;  3TNU A;  2KUB A;  3V2P A;  2FWL A;  1IFM A;  1VPC A;  4JQ0 D;  2WT7 A;  2M8R A;  2E42 A;  1PP9 E;  5TIS V;  3VP8 A;  1JY3 O;  1FOS F;  1AQ5 A;  1GU4 A;  3O0R C;  1PGP A;  3G6E P;  3TDK A;  2B4Z A;  3NMD A;  2ZT9 C;  3JSV C;  2E74 B;  2QA4 P;  3KYQ A;  1Y9B A;  2W6J H;  3CC7 P;  4GOD A;  4YXW H;  3RK2 C;  4EIJ A;  1CO6 A;  2B89 A;  3V5B A;  1GW3 A;  4DOJ A;  1PGQ A;  1LP1 A;  5APW A;  3HRN A;  1URQ D;  1FDM A;  2JTI B;  2A45 G;  2RMZ A;  2VHD A;  1R5L A;  5CCH A;  2ZYD A;  3O8Z A;  2WPV B;  3CX5 H;  2KNC B;  1PGJ A;  1GL2 C;  3RK3 B;  1NGM B;  3FGA D;  2BEQ D;  3L73 G;  2OQQ A;  1L4A C;  1ZXG A;  4DCK A;  3CCV P;  1QGK B;  1KC8 Q;  2B12 B;  3QH9 A;  2M5A B;  2YIU C;  1SVF A;  1EC5 A;  3TSI A;  3AEF C;  3M97 X;  3A0B E;  4W7Z A;  1KQL A;  1S72 P;  2FFD A;  1PPJ G;  4WY4 C;  1WEJ F;  1S5L E;  1R0Q A;  2E75 D;  1IO4 A;  1QEX A;  2FYU J;  1HBW A;  5E79 V;  2XDJ A;  1N7S D;  2ZT9 B;  5AW9 B;  1N50 A;  3NWV A;  1NTM E;  2KI7 B;  2L5G B;  4H44 D;  1PP9 G;  1OW8 A;  4D6T D;  3L73 D;  2QJK C;  1M1J A;  3OCD B;  2JWA A;  3RK2 B;  4BRY A;  1QYZ A;  2OYI A;  2JP3 A;  2KOG A;  1K9M Q;  2JR8 A;  2QG4 A;  3KXD A;  4TT3 H;  1PPJ D;  1CYJ A;  4IFD K;  1GD2 E;  1NH4 A;  2Q9I A;  1H31 A;  2OTL P;  3MP7 B;  2ITA A;  4WQD A;  1IRV A;  1GL2 B;  1E79 H;  1OW6 A;  1PZQ A;  2D0S A;  3WUV A;  1L4A B;  1DW2 A;  3B5N B;  1KX7 A;  1M57 D;  4FAV A;  4B86 A;  1N90 A;  2YIU B;  1A02 J;  5H2F H;  3DMI A;  3L70 E;  1K3H A;  3RL0 D;  4WY4 B;  3L72 J;  4PD4 E;  2L4D A;  1AYG A;  1AA0 A;  3UIA A;  1HF9 A;  2IFN A;  1YEB A;  1H8A A;  1CSW A;  1G2C A;  3OJA B;  2E5T A;  4H13 C;  2MKV A;  1NYH A;  2WSE H;  2N3Y A;  1H0T A;  1BCC E;  1BDC A;  3CCM P;  2H89 C;  3ZDM A;  3L35 A;  3SJL A;  3Q5S A;  4O1Q A;  3TGU E;  2B88 A;  3P7K A;  2Q3E A;  4UB8 E;  3VP9 A;  1NTZ G;  5CCG A;  1KYO W;  2G8Y A;  1RAP A;  1S9K E;  3HUS A;  4UB6 E;  3CCJ P;  1KIL B;  1NAY A;  1SS1 A;  1X22 A;  3A5T A;  3HE4 B;  3HQ8 A;  4OGQ B;  5TIS H;  2WPR A;  2P58 A;  2IBZ E;  1BDD A;  1S2E A;  5AW0 B;  3VN0 A;  1Q81 Q;  3VYI A;  2K3R A;  1SQB E;  5CHX A;  3FXD A;  5CIF B;  2M3E A;  1NTM D;  1NTM K;  1L0L G;  4FAN A;  1CC5 A;  3IFM A;  1VQ7 P;  2FKW B;  1GZL A;  1FOS E;  1E29 A;  3CXH W;  2KZI A;  2NPS C;  1MG2 D;  451C A;  5CCH C;  1RHZ B;  1YJW P;  3JCU E;  3L70 G;  4H13 B;  1HJ5 A;  3GHG C;  2O1K A;  1HH7 A;  2ZXY A;  1FCD C;  3P8C E;  4C7R A;  4R4M A;  3BRV B;  2KK7 A;  1IC2 A;  1I6E A;  1SQP J;  3KPE A;  1F1C A;  3W68 A;  2BH4 X;  4DY9 A;  4HYT B;  3HQ7 A;  1GDT A;  1BCC G;  2RN0 A;  1NIR A;  2FYU D;  2CPS A;  2FYU K;  4K35 A;  1H1O A;  1FU1 A;  1KTM A;  3TGU G;  1VQ4 P;  5AW3 B;  4PV1 D;  4EDF A;  2N18 C;  2K88 A;  4PD4 D;  1YIT P;  1YHQ P;  3WC8 A;  1FZF A;  2AEM A;  1KV9 A;  3WMM 0;  1T3J A;  1FJP A;  4CPG A;  1VF5 C;  2E76 D;  2PGD A;  3CME P;  1M70 A;  3AEE C;  2YK3 A;  1HH0 A;  1YBK A;  2NPS B;  1T3U A;  1BCC D;  3BVH A;  1SQB G;  3RN1 A;  3CYT I;  3Q1M A;  1CNO A;  5AVV B;  2BGV X;  1VQO P;  3TGU D;  1PIX A;  3GHG B;  5APX A;  3CCQ P;  3L36 A;  2ZFC A;  5AVT B;  3A0H V;  1S9K D;  5KAF V;  4AX3 A;  4YXD C;  2K9J B;  2LXC B;  4PW9 B;  4GIF A;  1VQ9 P;  1BGY E;  3SWS A;  2B10 B;  1YIQ A;  2AXT E;  5CYT R;  4I7Z C;  2N1T A;  1RE3 A;  1CSV A;  5L8R J;  2IBZ D;  4AAO A;  1JCC A;  2N9J A;  3AEG C;  3IN6 A;  2WWW A;  5B66 V;  1KB9 E;  1SQB D;  1Q7Y Q;  1SQB K;  2QM8 A;  1VQ5 P;  2QJY C;  3AE4 C;  3L74 E;  3CCS P;  1GIW A;  2N18 B;  3VMZ A;  4RSZ A;  1LWU C;  5DJU B;  2CA4 B;  2Q6Q A;  1CYI A;  3H1K J;  1VF5 B;  4YE1 A;  1DIP A;  4R4L A;  1N8R Q;  3HUS C;  3NBS A;  5CIC B;  1FZC C;  4JYC A;  1YTZ I;  1HJ3 A;  1OX3 A;  5KLV J;  2Y9Y A;  1DW3 A;  5KKZ C;  3R2P A;  1JB0 J;  1ZN5 A;  3CC2 P;  3H1J G;  1CRG A;  2CE1 A;  5CIE B;  1QVG O;  1HJ4 A;  1JM0 A;  1M6Z A;  2YO2 A;  3CCU P;  3SLE A;  2N9I A;  3B71 A;  2OYO A;  2H7H A;  3GLM A;  3PRJ A;  1AQT A;  4I7Z B;  4LLH A;  3A9F A;  3H32 A;  4WQ9 A;  3L4O A;  1VQK P;  2O01 N;  4WWI A;  1GU2 A;  1BGY G;  1GMJ A;  2W27 A;  2LIR A;  2AIU A;  2A45 I;  1E8E A;  2YMY A;  1DEB A;  1KYO I;  1JCD A;  2IDB A;  2R44 A;  1X8Y A;  2AEF A;  3VYM A;  1FDO A;  2OZ1 A;  1L0N E;  5APU A;  4FA5 A;  3PP5 A;  1LWU B;  2KS1 A;  3ZCF A;  1LMS A;  2FXM A;  1LT9 A;  4L3G A;  4AUW A;  2BAS A;  3AE3 C;  3AED C;  2GC4 D;  1X9V A;  2YQB A;  3VNW A;  3ZOY A;  4FA9 A;  1BGY D;  4KMG A;  3RBZ A;  1EZV E;  1NHL A;  4RJT A;  2IZ0 A;  1FZC B;  3T97 A;  3MGN A;  4WQC A;  3ZOO A;  4IFF A;  5KKZ B;  4MU8 A;  1URQ C;  2QRX A;  1LTT C;  3CXH I;  3L37 A;  5AVS B;  2YO3 A;  1EB7 A;  3D6Z A;  2FY8 A;  3CU4 A;  3ZOW A;  1Q86 Q;  1KQS O;  1DD3 A;  1I54 A;  1KB9 D;  1GJQ A;  1S1C X;  3KDP B;  1W2E A;  1CHH A;  2WSS H;  4U3F E;  4ASV A;  2HYN A;  2P67 A;  1BE3 G;  3M0A A;  3O1Y A;  3L74 D;  1J2J B;  1DVV A;  1Y8A A;  1NU1 E;  2PRR A;  1CSU A;  3HTK A;  3E7K A;  2HV4 A;  1NKN A;  1VQP P;  1EXJ A;  3O5C A;  3BAT A;  3L75 E;  4K3A A;  1MZ9 A;  2WMM A;  1NWQ A;  3A0B V;  1CZQ A;  1H89 A;  2K1A A;  2E75 C;  3PXT A;  3DP5 A;  2OYH B;  2JWD A;  1N7S C;  2Q3I A;  1IFP A;  4H44 C;  4IL6 E;  1RE3 C;  2JO1 A;  2JEE A;  3CCE P;  5B5E V;  3A0H H;  3KZI H;  1RZ6 A;  3TYY A;  5CCG D;  1L0N G;  4BXL A;  1HTL C;  3EWK A;  4TLF A;  3AEC C;  1USD A;  3Q5P A;  1KFN A;  1URQ B;  1IFD A;  1KFM A;  1PP9 J;  5GTI V;  3Q5R A;  2MTA C;  3E1I A;  2AXC A;  1RE4 C;  5B66 H;  3RL0 g;  1OCD A;  1LNQ A;  3IR9 A;  3VRD A;  1A02 F;  3H1K D;  3H1L E;  1U7J A;  5KJ7 D;  3MIW A;  2Z4E A;  1L0N D;  4WQ8 A;  1L0N K;  4H0J A;  3PH0 A;  3V2N A;  1FZG A;  4U3F G;  5DFS A;  4FA1 A;  2CA3 B;  3RL0 C;  3EFF K;  1OWA A;  3H1I E;  1DH3 A;  2J58 A;  3MD0 A;  1N7S B;  1AOQ A;  1N9C A;  2ZBO A;  1M60 A;  1Q90 D;  1UII A;  1YI2 P;  1CRH A;  1EZV D;  1YIC A;  1QN2 A;  2A45 H;  1Z56 A;  3L75 G;  4H44 B;  1KYO H;  1LTJ A;  1N73 A;  1FJK A;  5AVU B;  3E1R A;  5AW8 B;  3H1H E;  2RH0 A;  1FDI A;  3CX5 E;  3BCC J;  2NRG A;  2C0W A;  1M7L A;  2YKQ A;  1H32 B;  3D70 A;  3LIE A;  3WU2 E;  4U3F D;  2ZXX A;  1IO3 A;  1QLE D;  5APT A;  1HJB A;  1J1D C;  4UB8 V;  1NU1 D;  2ZYA A;  1NU1 K;  1H9X A;  2Y0C A;  3L75 D;  3CXH H;  1AKK A;  3GG2 A;  3MZW B;  4V2K A;  1NML A;  4D6T G;  1H33 B;  1NTZ J;  2EXV A;  3P32 A;  2B0Z B;  4NFG B;  2W6B A;  4IOI H;  1K73 Q;  3SWY A;  3L4F A;  3C1L A;  1KOR A;  1WVE C;  5IY5 1;  4HKZ H;  2PP6 A;  3RL0 B;  3F89 A;  4J20 A;  1CSB A;  4KJM A;  5CBO A;  3H1L G;  3HD7 A;  1T6A A;  2WSE J;  2KP8 A;  1RF1 C;  4DJG A;  5GTH V;  2HPC B;  5AUR A;  3HQ6 A;  3H1I G;  1L0L J;  4WQ7 A;  3S1K A;  2N1T D;  1ZOY C;  3PJS K;  3HQ9 A;  2C9X B;  1YCC A;  4RO0 A;  4I2L C;  2PFX A;  2V4H A;  2P7J A;  1M1K Q;  1W2B O;  1NTK J;  2C1D A;  4EIF A;  1IFN A;  1J3S A;  2FYZ A;  1JMB A;  1J1D B;  4ZKU A;  3I55 P;  1OIP A;  3VOP A;  3H1L D;  2N9Y B;  1VL2 A;  1CCH A;  4N78 D;  1K8A Q;  2V08 A;  3A0B H;  1DT1 A;  4PV1 C;  2ZOO A;  3ABV C;  3H1I D;  1JOC A;  2YXQ B;  4Z1M H;  3CWB J;  2QE7 H;  1H9Y A;  2FYU E;  3KQG A;  2H8P D;  2E76 C;  1AJY A;  3SVW A;  2L91 A;  1KQG B;  3H1H D;  4I6M C;  3N4X A;  5B5E H;  1IQC A;  3CX5 D;  2WTY A;  3M9B A;  1GDV A;  1IJD B;  1RF1 B;  1DX7 A;  1NKZ B;  2KZJ A;  4N0K A;  3WUT A;  3M9H A;  1Q2N A;  1OFC X;  1X79 B;  3W67 A;  2D0W A;  5GTI H;  2WSC J;  2W6A A;  1HWT C;  2QJK B;  3ITK A;  1XTG B;  5TIS E;  3OA8 B;  3HE5 B;  3DR0 A;  2AXT V;  1SFC A;  3O20 A;  2XU6 A;  4C7N A;  1NTM G;  2LXB A;  1MG3 D;  1LC2 A;  2HOD B;  2BCC J;  1IRW A;  1LJ2 A;  1KX2 A;  1MFT A;  4WVZ A;  3SFE C;  5CIG B;  1IFJ A;  5BU5 A;  3IF4 A;  1VQN P;  1KB0 A;  1RF0 A;  2BEZ F;  5DJT B;  1E2R A;  3M91 A;  5CJ0 A;  1GK6 A;  3AE8 C;  1ZP0 C;  2R3C A;  4P4Q B;  3L72 E;  1WT6 A;  2HG5 D;  1NVO A;  2E76 B;  4O1W A;  1YIJ P;  1RY3 A;  2GUV A;  3LW5 H;  5KJ7 A;  1IK9 A;  1SQX J;  2BPB B;  1EDI A;  1JTH B;  1FBM A;  3S4R A;  2FYU G;  2IX7 C;  1OW7 A;  1K05 A;  3B5N D;  1YEA A;  1MKM A;  4UB8 H;  3K5B A;  2OTK E;  2RKL A;  4HB1 A;  2B87 A;  3TNU B;  1NNO A;  3M0D A;  2WT7 B;  2FFD C;  2WSC H;  4L3H A;  2R3S A;  3H1J J;  4AYC A;  1YJ9 P;  3U1A A;  1QL3 A;  1FJ0 A;  3JC2 2;  1YNR A;  1AVO A;  3O6Q A;  1M1J C;  3VTP C;  3VMX A;  1CI6 A;  5E79 H;  4IL6 X;  5GTH H;  4JPZ B;  2OYI C;  1LP1 B;  1X0T A;  3Q3D A;  1C75 A;  4OWF A;  1SQV J;  2I8D A;  1KIL D;  5AW7 B;  5AVR B;  4YPC A;  2IBZ G;  3AE6 C;  2GA1 A;  3RN0 A;  2O01 J;  1XTC C;  1OZH A;  2ZJS E;  4OGQ D;  1EQ7 A;  1A8C A;  2PAC A;  1ZR4 A;  1HZU A;  3D0W A;  4PJ0 V;  4H0L D;  1SQP E;  1CRJ A;  1AOF A;  2QVA A;  4XXL A;  3SFD C;  1HCM A;  1CXA A;  4JBZ A;  1ETP A;  2FBW C;  1ZRT D;  2WPS A;  2XKM A;  2GIW A;  4EOT A;  2Y0E A;  2FFD B;  2I1J A;  3WFD C;  5B6Q A;  3L71 J;  5KAI E;  1S3J A;  3L72 D;  1JMM A;  1P84 E;  2O3J A;  4N6J A;  3NFQ A;  1OVR A;  3V4W A;  3U59 A;  1BE3 J;  5APS A;  1U57 A;  1M1J B;  4BRY B;  2Q7C A;  1N86 A;  2OYI B;  1VQ6 P;  4IL6 V;  4K3I A;  3A7O A;  4Y99 C;  3CP5 A;  2CXB A;  5CCG C;  2YKO A;  3PHL A;  2QJP C;  2BCC D;  2QEX P;  2AXT H;  1H31 B;  2W90 A;  2ZYG A;  2C2C A;  1SQQ J;  1VQL P;  2QIW A;  4W7Y A;  3M9Q A;  4HJG H;  5APQ A;  5DF5 A;  2O01 H;  1T2K D;  1LTS C;  3U1C A;  5AVX B;  1LS9 A;  3D6Y A;  4L76 A;  4ZMD A;  4DZO A;  1FI9 A;  1SQP G;  2M5A A;  5KJ7 C;  2R32 A;  2Q1K A;  2KYV A;  1SQX D;  3HD7 D;  1SQX K;  2E43 A;  2QJY B;  1G2C B;  3FX0 A;  1CYC A;  3CPW O;  1S5L X;  3V2Q A;  3H1K E;  3PTZ A;  2AI5 A;  2FRC A;  2D2C D;  1TU3 F;  3CI9 A;  1H0T B;  2CK3 H;  1FI7 A;  3H6P A;  5AW4 B;  3C2C A;  4W80 A;  3OCD A;  3EQ2 A;  3PH2 B;  4Y99 B;  3L74 G;  5KLV E;  1CRY A;  1SQP D;  4JYB A;  1SQP K;  4XFJ A;  4BWN A;  3CC4 P;  2OGU A;  2QJP B;  2XZR A;  3HUS B;  1EXI A;  1PGO A;  4ASW A;  1OVU A;  4LJI A;  4GYD A;  3WU2 V;  3II6 A;  4IFM A;  2MHM A;  2ZAE B;  3MTU E;  4GED B;  2ZON G;  2KSE A;  1GL2 A;  2FYN C;  1P84 D;  3MK7 C;  3B5N A;  1C52 A;  1ZLL A;  2KLU A;  4L1Q A;  4L73 A;  2ZZS 1;  3ORV A;  5AVZ B;  4WY4 A;  4KHX A;  1LT1 A;  3ZOX A;  3A0H E;  2XTS B;  2YKP A;  3GMA A;  3KZI E;  1FE6 A;  1KN7 A;  2LKM A;  3L4M A;  4D6T J;  1S5L V;  5CIH B;  3L73 J;  1RH5 B;  5AW2 B;  2IYO A;  1MZ4 A;  4NPE A;  1LTA C;  2V7Q J;  3M06 A;  4ZNC A;  5B66 E;  2N1T C;  1SFC D;  4PJ0 H;  1KD1 Q;  3H1K G;  2A06 E;  4C46 A;  1HZV A;  1T8Z A;  2C1V A;  5KAF H;  1N7L A;  4WB4 A;  1CIG A;  1YFC A;  4WQA A;  2I1K A;  4Y5R A;  3NTN A;  1KIL A;  3ZBM A;  2KB7 P;  3R4Y A;  3MUD A;  3WFE C;  1C6S A;  5KLV G;  1CIF A;  1HGV A;  3LID A;  3HE4 A;  3GF7 A;  5APY A;  1I8P A;  4XYD B;  3NXS A;  3WUI A;  1EZV G;  4ZKP A;  1C2N A;  3MK7 B;  2P10 A;  1DW0 A;  3GF3 A;  5EXQ A;  1I55 A;  5AW5 B;  2YMK A;  1KYO E;  4EIC A;  4N78 E;  1C6R A;  1RQV A;  4XA4 A;  1LTB C;  5CJ4 A;  4IL6 H;  1JY2 P;  3OA7 A;  3USS A;  1F1F A;  5KLV D;  2E75 B;  4L74 A;  5KLI C;  5KLV K;  1NU1 G;  1LGH B;  5C0Z A;  1SP4 A;  4LC1 A;  2KLV A;  2MJZ A;  4OVN F;  3WFC C;  1GKS A;  3RBX A;  4AQR D;  4MN4 C;  1M8O B;  3EFG A;  2N1T B;  2WSF H;  1A56 A;  3CXH E;  3SXT A;  1IK7 A;  1COR A;  3AE1 C;  2M3B A;  1JO5 A;  4EID A;  3CCL P;  5CIB B;  3RK3 E;  1RAQ A;  1M56 D;  1CRI A;  2QM7 A;  2H88 C;  1LTI C;  2V7Q H;  3X39 A;  2PCC B;  1OVV A;  2A06 G;  4O9B A;  1VDF A;  1M90 Q;  1FOC A;  4UB6 V;  2BCN B;  4PD4 I;  1HRO A;  1BSH A;  3OAK A;  1NTM J;  1QL4 A;  1LT9 C;  1JY2 N;  4FB1 A;  1ZZH A;  2E5Y A;  1USE A;  2NPS A;  5AW1 B;  2Y9Z A;  3SSU A;  5KLI B;  5CBN A;  2A06 D;  1COT A;  1QX8 A;  1CRC A;  1VQ8 P;  1HRC A;  3GHG A;  3N7N A;  5C39 A;  3AEA C;  3BCC E;  3B5N C;  3WU2 H;  1BSN A;  2K9J A;  1IFI A;  3H32 B;  1H88 A;  1YQ3 C;  1CHI A;  5DJQ C;  1FS0 E;  2IBZ I;  1SLQ A;  1S4X A;  2GB8 B;  2XND H;  1MUU A;  3H1H G;  1KYO D;  3L70 J;  5BVZ A;  5H2F E;  1DIQ C;  2HR3 A;  3C8V A;  3ZIY A;  2OZ1 B;  1G1I A;  2C9N Y;  2E74 D;  5B5E E;  1NTZ E;  2J5U A;  4GOE A;  2KS1 B;  1NAF A;  1J1E C;  1LT9 B;  2XV5 A;  4QMA A;  2Z5H A;  2GUS A;  1S5L H;  3LW5 J;  2KIK A;  2R5D A;  3AE5 C;  5GTI E;  1BCC J;  2WQY C;  4NPD A;  3T97 B;  5AW6 B;  3CD6 P;  3KHU A;  1KIL C;  3D71 A;  1HJ0 A;  3CL3 D;  3MUD C;  3JBT B;  2B11 B;  2R5B A;  3CXH D;  3TGU J;  1L0L E;  1I8O A;  1YTC A;  1PP9 D;  4OGQ C;  3RK3 D;  1L9J C;  4H0L C;  2WPQ A;  1KIL E;  4L75 A;  1C7M A;  1NTK E;  1I5T A;  1ZV8 A;  3HTK B;  5DJQ B;  1K04 A;  3FWN A;  1HUC A;  3I56 P;  1KV4 A;  3BCC G;  4AAL A;  4EI2 A;  1SQB J;  2HFE D;  351C A;  5TJH A;  3BAS A;  1N15 A;  1RQU A;  2ZT9 D;  5KAI V;  2DVH A;  2POH A;  1NJI Q;  2B9B A;  3G3Z A;  1IZL 0;  4N3Y B;  3AE9 C;  3CWB E;  1LTJ C;  1N73 C;  1J1E B;  4PV1 B;  1LWU A;  1LFM A;  1ZRT E;  3RK2 D;  4PD4 H;  1CTJ A;  4LGD E;  3SWK A;  2C1U A;  3BCC D;  1UIX A;  1FZC A;  4GT1 A;  1KIB A;  3AEB C;  2DGE A;  1GL2 D;  1AV1 A;  1L4A D;  1KB9 I;  1P84 I;  4H0L B;  1OMI A;  5CMZ A;  1PL5 A;  4KT0 J;  1EDJ A;  3I5C A;  1S6V B;  2WVR A;  2OAR A;  1C6O A;  2LR2 A;  3FWL A;  1T2K C;  2W8Z A;  3TF5 A;  4UB6 H;  2BCC E;  4JCG A;  1NTZ D;  3B8E B;  1NTZ K;  1KZU B;  4WY4 D;  3CX5 W;  5E79 E;  4YTP C;  4RKU J;  1W5C E;  5GTH E;  1JY2 O;  4Y28 J;  1NTK G;  2KSJ A;  3HD7 C;  3G9R A;  1QVF O;  1GW4 A;  2YXR B;  2OYH A;  1CTZ A;  1VYD A;  1U74 B;  1YTZ T;  1LTJ B;  1NMI A;  1N73 B;  4EYY Q;  3SWF A;  1FZB A;  2JKV A;  2D2C C;  2Z5I A;  3CCR P;  2M0B A;  1L0L D;  1FZA A;  1L0L K;  5AVQ B;  1L2P A;  1EDK A;  1SQX E;  1BGY J;  1QL2 A;  1ZME C;  2ZXE B;  3CWB G;  3MHV A;  1E5W A;  5EFW B;  3JCU H;  2NZ2 A;  1NTK D;  3A2A A;  3PXW A;  1LTG C;  1CIE A;  1NTK K;  1Y47 A;  1ZW0 A;  1URQ A;  4GOF A;  5BU8 B;  3L70 D;  3L72 G;  1FI3 A;  2FXP A;  3RGU A;  3L74 J;  1U75 B;  3VMA A;  3H1J E;  2O1J A;  1B7V A;  3VMY A;  3CWB D;  155C A;  1FAV A;  1LC1 A;  2XNX A;  3HD7 B;  1DII C;  1JY3 P;  2BCC G;  5AVY B;  1QKS A;  3QWO C;  4H13 D;  1N7S A;  1AFO A;  3KZI V;  1EZV I;  2SPZ A;  2D2C B;  1SQV E;  4XE5 B;  1EDL A;  1CSX A;  1L9B C;  1R5S A;  2GM4 A;  3H25 A;  2IPP A;  2QSI A;  1SFC C;  2C1D B;  1H32 A;  1C2R A;  2KXP B;  1JDL A;  2YNY A;  4DT0 A;  1CIH A;  1PFI A;  1SQX G;  2C0X A;  2OTJ P;  2CPB A;  2V07 A;  1JUN A;  2IFM A;  2CE0 A;  1RF0 C;  1RE4 A;  2AEJ A;  1HGZ A;  2W83 C;  4HH2 A;  2JQR A;  2G3A A;  1RZ5 A;  1WRG A;  2HLO A;  1R8E A;  1K3G A;  5KAI H;  3CMA P;  2KNC A;  2YCC A;  3RMZ A;  1KB9 H;  1L0N J;  1P84 H;  1H33 A;  3G71 P;  3L71 E;  1JY3 N;  3P8C D;  2NPS D;  5M1B A;  5C9M A;  3V6I A;  5CCH D;  2DW3 A;  3A3Y B;  1BE3 E;  1G1J A;  1DD4 A;  3WUU A;  3RLM A;  4I1L A;  1YYC A;  1DVH A;  2HPC A;  4AAM A;  2P2U A;  1KMI Z;  1BL9 A;  2ZVO B;  1W2L A;  1WMK A;  1KQF B;  1SFC B;  4C7N B;  3M0D C;  4U3F J;  5CID B;  1FHB A;  3F5H A;  1NOH A;  1SQV G;  1CW5 A;  1GK4 A;  4GKG A;  3GW6 A;  3AE7 C;  1NU1 J;  1SQQ E;  1JEK A;  1IZN B;  2C8S A;  2Q5U A;  3H1J D;  1U7M A;  2OYH C;  3TK1 A;  4QAO A;  1CED A;  4OH8 B;  1ZR2 A;  4H0K A;  3L75 J;  3AE2 C;  4U7J A;  2ORL A;  3C9I A;  2PAJ A;  1N2D C;  4FA4 A;  1VF5 D;  3IAO A;  2K9Y A;  1CXC A;  3PXS A;  1L4A A;  1JNM A;  3OW2 O;  1NO4 A;  1OAE A;  3FXE A;  1MFZ A;  4AAN A;  1SQV D;  1FC2 C;  1SQV K;  1YJN P;  1Q82 Q;  3G4S P;  4PJ0 E;  3CX5 I;  3L71 G;  1GQ1 A;  2IZ1 A;  4EIE A;  5KAF E;  1FZE A;  3V2R A;  3TYI A;  1RF1 A;  1AVY A;  3B4S A;  2FXO A;  1CTY A;  2WSF J;  3NBT A;  3P8M C;  2PCB B;  2WZ7 A;  2IYP A;  1MV8 A;  2BH5 X;  2K37 A;  2J59 M;  2Y0D A;  2VRS A;  5KTB A;  2B87 B;  2BLF B;  1DEE G;  3OA8 A;  4WQB A;  3HE5 A;  3S9O A;  3WFB C;  4JF7 A;  3H1L J;  1D7M A;  3BRT B;  2HOD A;  3L71 D;  2ZVN B;  2GC7 D;  1DW1 A;  4NPF X;  3Q2Y A;  1GU5 A;  3H1I J;  4PWA A;  3O6Q B;  5H2F V;  1QL1 A;  1SQQ G;  1CCR A;  1I6D A;  2E74 C;  1BE3 D;  2FYN B;  1CI6 B;  1HVV A;  2H43 A;  2P1J A;  2C9L Y;  2WIT A;  4M3L A;  1PV3 A;  3H1H J;  3V4Q A;  4Q5P A;  4WBA A;  3PLN A;  2N9B A;  4GDO A;  4D6T E;  3L73 E;  1JTH A;  2I8F A;  4WQE A;  2JJL A;  2JDI H; 
#chains in the Genus database with same CATH homology
 3L4O A;  1CHJ A;  1QL3 A;  1FJ0 A;  4A7P A;  2N3B A;  1GU2 A;  3KHU A;  1A2S A;  1SQQ D;  1YNR A;  2LIR A;  2AIU A;  2B11 B;  3JBT B;  1E8E A;  3CXH D;  2LIT A;  1W5C T;  1I8O A;  1YTC A;  1PP9 D;  1C75 A;  3VYM A;  2FWL A;  2OZ1 A;  4FA5 A;  1L9J C;  5TIS V;  2KS1 A;  3ZCF A;  1LMS A;  3RN0 A;  1C7M A;  4L3G A;  1I5T A;  3O0R C;  5DJQ B;  2GC4 D;  3TDK A;  1A8C A;  2B4Z A;  2PAC A;  2YQB A;  3VNW A;  1HZU A;  4AAL A;  3ZOY A;  4PJ0 V;  1BGY D;  4KMG A;  4FA9 A;  4RJT A;  1CRJ A;  351C A;  1AOF A;  4WQC A;  4XXL A;  3ZOO A;  5TJH A;  5KKZ B;  1HCM A;  4MU8 A;  1CXA A;  1N15 A;  1CO6 A;  1EB7 A;  3CU4 A;  5KAI V;  2DVH A;  1ETP A;  3ZOW A;  1ZRT D;  2GIW A;  2Y0E A;  1I54 A;  1IZL 0;  1KB9 D;  1GJQ A;  1CHH A;  3WFD C;  5B6Q A;  1LFM A;  3L72 D;  3O1Y A;  3L74 D;  1CTJ A;  1DVV A;  2O3J A;  2JTI B;  1CSU A;  2RMZ A;  2VHD A;  2C1U A;  3BCC D;  2HV4 A;  2KNC B;  3O5C A;  3A0B V;  1KIB A;  2B12 B;  4IL6 V;  3PXT A;  3DP5 A;  4K3I A;  2DGE A;  3M97 X;  3CP5 A;  2CXB A;  3PHL A;  1WEJ F;  2BCC D;  1R0Q A;  1S6V B;  1C6O A;  5E79 V;  1H31 B;  3FWL A;  3TF5 A;  5B5E V;  2C2C A;  1N50 A;  4JCG A;  3NWV A;  1NTZ D;  1RZ6 A;  3CX5 W;  5DF5 A;  4D6T D;  3L73 D;  3OCD B;  2JWA A;  1LS9 A;  5GTI V;  1QYZ A;  2MTA C;  1FI9 A;  1CTZ A;  2QG4 A;  1VYD A;  1U74 B;  1NMI A;  1OCD A;  1PPJ D;  1SQX D;  1CYJ A;  3VRD A;  1L0L D;  3H1K D;  2QJY B;  1H31 A;  1CYC A;  4WQD A;  1L0N D;  4WQ8 A;  1IRV A;  4H0J A;  3PTZ A;  2D0S A;  2AI5 A;  2FRC A;  5DFS A;  4FA1 A;  1DW2 A;  2CA3 B;  1NTK D;  3PXW A;  1FI7 A;  1CIE A;  3C2C A;  1KX7 A;  4FAV A;  3OCD A;  1N90 A;  3L70 D;  2YIU B;  1AOQ A;  1N9C A;  2ZBO A;  1M60 A;  3PH2 B;  1CRH A;  1FI3 A;  1CRY A;  1SQP D;  1EZV D;  3DMI A;  1YIC A;  1QN2 A;  2QJP B;  1K3H A;  2L4D A;  4LJI A;  4GYD A;  1AYG A;  3WU2 V;  2MHM A;  1U75 B;  3VMA A;  4GED B;  1YEB A;  1CSW A;  1B7V A;  2ZON G;  3CWB D;  155C A;  1H32 B;  4U3F D;  1LC1 A;  1IO3 A;  1P84 D;  2N3Y A;  3MK7 C;  4UB8 V;  1DII C;  1C52 A;  1NU1 D;  1QKS A;  1H9X A;  4L1Q A;  2Y0C A;  3SJL A;  4O1Q A;  3KZI V;  2ZZS 1;  3L75 D;  2Q3E A;  1AKK A;  3ORV A;  1KYO W;  3GG2 A;  1RAP A;  3ZOX A;  4V2K A;  2XTS B;  1CSX A;  1L9B C;  1NML A;  1H33 B;  2EXV A;  2B0Z B;  3HQ8 A;  4NFG B;  3L4M A;  1S5L V;  2C1D B;  5CIH B;  1H32 A;  1WVE C;  5IY5 1;  1C2R A;  4J20 A;  1MZ4 A;  1JDL A;  1CIH A;  5CIF B;  2V07 A;  1NTM D;  4FAN A;  2CE0 A;  1HZV A;  5GTH V;  1CC5 A;  2C1V A;  5AUR A;  2JQR A;  1E29 A;  3CXH W;  1RZ5 A;  3HQ6 A;  1CIG A;  1YFC A;  4WQA A;  4WQ7 A;  4Y5R A;  1K3G A;  1MG2 D;  451C A;  3ZBM A;  3HQ9 A;  2YCC A;  3RMZ A;  3WFE C;  2C9X B;  1H33 A;  1YCC A;  1CIF A;  1HJ5 A;  1I8P A;  4XYD B;  1HH7 A;  2C1D A;  3WUI A;  4EIF A;  1J3S A;  1C2N A;  2ZXY A;  1FCD C;  1DW0 A;  3MK7 B;  5C9M A;  5EXQ A;  1I55 A;  3H1L D;  2N9Y B;  3RLM A;  1CCH A;  1I6E A;  1F1C A;  4EIC A;  2BH4 X;  2V08 A;  1DVH A;  4DY9 A;  1DT1 A;  2ZOO A;  4AAM A;  1C6R A;  3HQ7 A;  3H1I D;  2RN0 A;  1NIR A;  1BL9 A;  2FYU D;  1F1F A;  1W2L A;  1H1O A;  5KLV D;  1H9Y A;  5C0Z A;  4EDF A;  5CID B;  2N18 C;  4PD4 D;  1FHB A;  3SVW A;  2L91 A;  3GW6 A;  3WC8 A;  3H1H D;  3WFC C;  1GKS A;  2C8S A;  1KV9 A;  1IQC A;  3CX5 D;  3H1J D;  1GDV A;  4QAO A;  1CED A;  1A56 A;  4H0K A;  3SXT A;  1COR A;  1M70 A;  4N0K A;  4EID A;  2YK3 A;  2ORL A;  2D0W A;  5CIB B;  1RAQ A;  1CRI A;  1BCC D;  3RN1 A;  3X39 A;  2PCC B;  4FA4 A;  2QJK B;  3CYT I;  3ITK A;  1CXC A;  3PXS A;  1CNO A;  2BGV X;  3OA8 B;  3DR0 A;  2AXT V;  3TGU D;  1OAE A;  1FOC A;  3O20 A;  4UB6 V;  2BCN B;  3A0H V;  5KAF V;  4AX3 A;  4AAN A;  1MG3 D;  1SQV D;  4PW9 B;  1LC2 A;  2K9J B;  1HRO A;  3SWS A;  1IRW A;  2B10 B;  1YIQ A;  5CYT R;  1KX2 A;  1QL4 A;  5CIG B;  1GQ1 A;  4EIE A;  4FB1 A;  1ZZH A;  1KB0 A;  1CSV A;  3TYI A;  2IBZ D;  4AAO A;  1CTY A;  3NBT A;  2PCB B;  1E2R A;  2N9J A;  5B66 V;  2BH5 X;  1SQB D;  2Y0D A;  2BLF B;  5KLI B;  2A06 D;  4P4Q B;  1COT A;  1GIW A;  1CRC A;  3OA8 A;  4O1W A;  2N18 B;  4WQB A;  1HRC A;  3WFB C;  4RSZ A;  2BPB B;  2CA4 B;  1CYI A;  3L71 D;  2GC7 D;  4YE1 A;  1DW1 A;  1CHI A;  5DJQ C;  4PWA A;  1YEA A;  3NBS A;  5CIC B;  5H2F V;  1CCR A;  1I6D A;  1BE3 D;  2FYN B;  2GB8 B;  1HJ3 A;  1KYO D;  1DW3 A;  1DIQ C;  1NNO A;  3ZIY A;  1CRG A;  2CE1 A;  5CIE B;  2OZ1 B;  1HJ4 A;  1M6Z A;  3SLE A;  4L3H A;  4Q5P A;  2N9I A;  3PLN A;  3PRJ A;  3A9F A;  2I8F A;  4WQE A;  1C6S A;  4WQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...