4U3FD

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4u3fD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4u3fD02
1C6RA 2L4DA 4L3GA 1KB9D 1CSVA 1H33A 3TF5A 1JDLA 1H9XA 1YFCA 3WFEC 2V08A 3NWVA 1CHJA 5KAIV 2XTSB 1I5TA 1RZ5A 2YQBA 2BLFB 2BH4X 2AIUA 4FB1A 3H1HD 2VHDA 1CSWA 1L0ND 1QYZA 1DT1A 3L71D 1IRWA 2GC7D 1CTZA 2CXBA 1CNOA 1LFMA 2N9YB 3ZBMA 4PWAA 3RN0A 4Q5PA 5IY51 2BH5X 2PACA 2YCCA 3JBTB 1H33B 2GB8B 351CA 3CXHD 1FJ0A 4O1QA 1CRCA 5B6QA 5C9MA 2Y0DA 1DVVA 1NTKD 5B5EV 4WQCA 1LC2A 1CHHA 4PJ0V 3OA8A 3RLMA 1E8EA 451CA 1C75A 1RAQA 4U3FD 2LIRA 1EZVD 2OZ1A 2AI5A 4IL6V 2FWLA 1N50A 2A06D 1CXAA 1HH7A 1FI9A 1BE3D 1CYJA 1DW3A 2DVHA 3ZOWA 4AAOA 5C0ZA 1MG3D 3L72D 5DF5A 4EICA 1B7VA 2BPBB 1KV9A 3DP5A 1AYGA 5E79V 1DIQC 3WFDC 2ZXYA 3VYMA 3PXWA 3OA8B 1U74B 4WQ9A 2N9IA 1CYCA 5DJQC 3O5CA 3ZOOA 4Y5RA 1HJ3A 2OZ1B 4O1WA 3RMZA 3MK7C 1N90A 3WC8A 2BGVX 4PD4D 1CIFA 4RJTA 2D0WA 3TYIA 2BCNB 3DMIA 3ZOYA 2QJYB 3PXTA 4H0JA 4AX3A 1AOFA 4YE1A 1YNRA 4L1QA 1KYOW 4WQAA 1YICA 1N9CA 2Y0CA 1DIIC 2K9JB 3PRJA 5CIEB 3WUIA 3O1YA 2JTIB 1QKSA 3WFCC 5KAFV 4UB8V 3PHLA 1CXCA 1HROA 1ZZHA 2CA4B 2C2CA 1COTA 1A8CA 3WU2V 3ITKA 3A0BV 4AALA 3C2CA 1ETPA 2JQRA 1FI7A 3L73D 1N15A 5B66V 1C2RA 3L4MA 5DJQB 4NFGB 2KNCB 1CORA 1OAEA 1NNOA 3MK7B 5H2FV 1H32B 1H31A 3VNWA 1KYOD 1CRGA 4WQBA 4J20A 2RMZA 5KKZB 1CIGA 1SQPD 1NU1D 4DY9A 1HZUA 4QAOA 2MHMA 3M97X 1S5LV 2B0ZB 1DW0A 2PCBB 4AAMA 1H1OA 1CC5A 1CSXA 1P84D 1YTCA 5AURA 4XYDB 1NTMD 3L74D 1IO3A 1H31B 1GIWA 1IQCA 3CWBD 2QG4A 2MTAC 2ZONG 1CTYA 1HRCA 1AKKA 2KS1A 1CRYA 1LMSA 3FWLA 2PCCB 3HQ7A 1NMLA 1PPJD 5GTHV 1SQXD 5CIDB 1CCRA 2B12B 3HQ8A 1K3GA 1C7MA 4P4QB 3OCDA 1DVHA 5CIBB 1E29A 1J3SA 1HJ5A 1L9BC 3CU4A 1CIHA 2FRCA 3L70D 3GG2A 2C1VA 2C8SA 3CX5W 2LITA 1H9YA 3GW6A 1F1CA 1DW1A 2FYUD 2C1UA 1CYIA 4V2KA 1C52A 1I55A 1WEJF 1GU2A 1KIBA 1FOCA 2V07A 5CIFB 3HQ6A 1CRJA 1GJQA 1KX7A 1YCCA 3TDKA 1SQVD 5GTIV 3WFBC 2B4ZA 2QJPB 2DGEA 1NTZD 3OCDB 3L4OA 1EB7A 3ZIYA 1CIEA 1M70A 1H32A 1I6EA 1QN2A 4EIFA 1M6ZA 3H1ID 5KLVD 1SQQD 3NBTA 3CX5D 1RZ6A 3H1KD 2N3BA 1QL3A 1CRIA 1I6DA 4K3IA 4A7PA 2FYNB 1WVEC 3CXHW 5DFSA 4WQ8A 4WQ7A 1L0LD 1YEBA 2B11B 4JCGA 3SXTA 3H1JD 155CA 1C6OA 4XXLA 1CEDA 1NMIA 1CSUA 1I54A 4AANA 1A56A 2D0SA 2YK3A 4MU8A 5CICB 1IRVA 1I8PA 3H1LD 1IZL0 1YEAA 2Y0EA 1FCDC 2N18C 5TISV 1BL9A 2BCCD 3RN1A 2N9JA 1R0QA 2QJKB 1CHIA 2ZOOA 1CO6A 3DR0A 1W2LA 1RAPA 5KLIB 4EIEA 1DW2A 3PXSA 1HCMA 4FA9A 1K3HA 5CYTR 4FANA 2GC4D 1GDVA 4UB6V 1KX2A 2O3JA 1LS9A 4WQDA 4FAVA 1YIQA 3A0HV 1KB0A 1U75B 2EXVA 2ZBOA 3SWSA 3ZCFA 2ORLA 3HQ9A 1CRHA 5CIHB 1C6SA 1FHBA 4LJIA 3CYTI 3KZIV 5TJHA 1ZRTD 2IBZD 1MG2D 1I8OA 2RN0A 4GEDB 4L3HA 3CP5A 1CTJA 3A9FA 4EDFA 4KMGA 2Q3EA 2AXTV 4EIDA 1C2NA 3VRDA 1GQ1A 3BCCD 2B10B 2C1DA 3X39A 1SQBD 5EXQA 2N18B 1PP9D 2CE1A 1NIRA 3PH2B 4D6TD 1L9JC 5CIGB 1M60A 2L91A 4WQEA 4FA5A 1GKSA 3SVWA 1BCCD 1F1FA 4GYDA 1BGYD 3PTZA 1W5CT 2I8FA 3SLEA 4H0KA 3VMAA 4FA1A 3TGUD 1MZ4A 1QL4A 3PLNA 1OCDA 1VYDA 2C9XB 1AOQA 1FI3A 4RSZA 3NBSA 1CCHA 2ZZS1 2YIUB 2C1DB 3ORVA 2GIWA 4PW9B 3L75D 3KHUA 4N0KA 1S6VB 3O0RC 4FA4A 2N3YA 1HZVA 2HV4A 1A2SA 3O20A 3ZOXA 2CE0A 1E2RA 2CA3B 1LC1A 2JWAA 3SJLA 1HJ4A
chains in the Genus database with same CATH superfamily
1C6RA 4O9BA 1FZEA 3HRNA 1KB9D 1CSVA 3B71A 1YFCA 1NTKG 1VQ7P 1CSBA 1K05A 3NWVA 1N7SA 5KAIV 2XTSB 3CC7P 2BLFB 2AIUA 4FB1A 2VHDA 1S4XA 2D2CC 1QYZA 2WSEH 1CZQA 1NAFA 3L71D 1IRWA 5CHXA 2A06G 3RK2C 4YXDC 3S4RA 1OVUA 2YMYA 2C0WA 2AEFA 3PJSK 5B6QA 1DX7A 2N1TA 2Y0DA 3W68A 1QVFO 3A0HH 1LC2A 4U3FE 1KQSO 1EZVE 3OA8A 3RLMA 3CMAP 3A0BE 5AW8B 1ZN5A 2LIRA 1JCCA 2Z4EA 1EC5A 4IL6V 4EIJA 2K37A 3CX5H 4IL6X 3BASA 3KDPB 1HH7A 2H88C 2E75C 1BE3D 1CYJA 3ZOWA 4WY4B 2A45I 1YI2P 3JSVC 3L72D 3MTUE 2V7QJ 2P10A 1FJKA 2BPBB 1LTGC 2KSEA 1YBKA 2FYNC 3VN0A 3CCEP 5E79V 2WSFJ 1ZXGA 4GODA 2Y9ZA 4DOJA 4H13B 4WQ9A 5DJQC 3O5CA 4W80A 2OTKE 1Y9BA 1N90A 3M0DC 2ZT9C 3WC8A 1CIFA 2D0WA 1IFDA 3L71G 3NFQA 1NTZJ 5KKZC 1KV4A 1L4AB 4IOIH 3DMIA 3PXTA 1RHZB 4H0LC 5GTHE 1NGMB 1YNRA 2GA1A 3MHVA 4WQAA 1JMMA 1HBWA 4WWIA 1N73B 3RK3E 1VF5C 2Y0CA 2YNYA 1LP1A 1DIIC 1OX3A 3PRJA 4LGDE 3M06A 2FYZA 3V2RA 1EDIA 1YHQP 1M1KQ 3NTNA 1KYOI 4HYTB 1M1JA 4KHXA 2B87B 3A0BV 4AALA 3C2CA 1ETPA 2H89C 5BVZA 3R4YA 5AW4B 1T2KC 3L73D 2AXCA 3USSA 2WZ7A 1OAEA 3MZWB 2KXPB 3G3ZA 1PPJG 1KYOD 1SQXG 4WQBA 2YMKA 1FZCB 3MUDA 1KQGB 4RESB 1CIGA 1SQPD 3L72G 1NU1D 3L35A 3S9OA 4DY9A 1HZUA 3B4SA 1KILA 2QEXP 1W5CE 5KAFE 5AW1B 3L70G 2MHMA 1H8AA 3T97A 1H0TA 5B5EH 1G1JA 2Q3IA 4W7YA 4R4LA 1CSXA 3CWBE 1UIIA 1YTCA 1N86A 4XYDB 4PJ0H 3V4QA 2GUSA 1FZAA 3VOPA 1UIXA 1ZV8A 2NPSD 1SQXJ 2GM4A 2QE7H 2MTAC 2ZONG 2OYIC 1E79H 3HE4B 1KN7A 4L75A 5GTHV 2OARA 2WSEJ 1C7MA 3L70J 4HH2A 4N6JA 3IR9A 1J3SA 1QVGO 1L9BC 3OW2O 1FOSE 1S5LE 2FYUJ 5KLVG 3CD6P 2IDBA 2Q5UA 2LITA 1FC2C 1H9YA 3GW6A 1JMBA 1DW1A 2YKOA 4D6TJ 2C1UA 1SQVE 2V07A 3M0AA 2W6JH 3L73G 1YCCA 3II6A 3M9QA 3VP8A 2J59M 3H1JG 3L4OA 3OJAB 3H1IJ 3HTKB 1H32A 1AV1A 1NU1G 2QJKC 3Q5RA 1I6EA 3H1KJ 1VPCA 2B88A 4EIFA 2YXQB 3SFEC 1M6ZA 3W67A 1SQQD 5KAFH 3E1RA 1CRIA 4DCKA 4K3IA 4A7PA 1NJIQ 1WVEC 3CXHW 3WU2H 3D0WA 3H1JJ 4WQ7A 1L0LD 2JO1A 3V2PA 5B66H 3TNUB 2QA4P 2WT7A 4LLHA 2W6BA 2KZIA 1IZNB 1WT6A 4XXLA 2IYPA 1CSUA 1A56A 2D0SA 2YK3A 1GL2C 4MU8A 5KJ7A 1FCDC 2N18C 3A3YB 2LR2A 2BCCD 1S5LH 1YJWP 1R0QA 2J58A 2ZOOA 1CO6A 3DR0A 3AE5C 4PD4H 2FFDB 5KLIB 4LC1A 1DW2A 3PXSA 4FA9A 2GC4D 2KYVA 2O3JA 1LS9A 2KOGA 1URQD 4JYCA 1ZRTE 2IBZE 4GDOA 2EXVA 2ZBOA 1DEEG 2E74B 2ORLA 3CMEP 1FHBA 1L4AC 1RQUA 1QL1A 1MG2D 3SSUA 1I8OA 5APYA 3I55P 2RN0A 4L3HA 2V4HA 2KZJA 3C1LA 1ZP0C 2FY8A 1GW3A 4K3AA 1PL5A 1SFCD 1SQVK 1C2NA 1LGHB 2O01N 1A02J 2N9BA 1RF1B 3EFGA 3B5NA 1R5SA 4ASWA 1SQBD 4UB6E 5DJUB 2R5DA 3O6QA 5EXQA 2ITAA 1FU1A 1BGYE 1LTIC 3CCRP 1YQ3C 1VQ8P 2Y9YA 1BCCD 3KZIE 4GYDA 1W5CT 2I8FA 3FGAD 3H1HG 3VMAA 1QL4A 3L75J 1OCDA 1LTTC 2ZZS1 3KHUA 1BDCA 3O0RC 1KB9E 2CE0A 2NPSB 1E2RA 2JWAA 1X0TA 1HJ4A 4ZKPA 1OW6A 1KTMA 2WPQA 4ZNCA 2PRRA 2BEZF 3P32A 4I7ZB 2L5GB 1CHJA 3L71E 2C0XA 1I5TA 3CXHI 1RZ5A 1JY3P 3H1LE 1IO4A 1IJDB 1L0ND 2N1TC 1CTZA 2CXBA 1GTWA 1CNOA 3IF4A 2N9YB 2Z5HA 1GZLA 2Q1KA 2XU6A 2BH5X 1OW7A 2PACA 3JBTB 1H33B 2ZXEB 4U7JA 351CA 3CXHD 2QVAA 1JY2P 5C9MA 4WY4A 4UB6H 4JF7A 4XFJA 1DVVA 1NTKD 4WQCA 3MIWA 3M9HA 1T6AA 5KAIE 1BCCG 3RL0D 4IFDK 3C8VA 2QJYC 3AECC 3G9RA 4Y28J 2YO2A 1GW4A 1E8EA 1G1IA 3KZIH 2HG5D 1C75A 3AEBC 3OAKA 3QH9A 5CMZA 3B8EB 1BE3E 4BWNA 2AI5A 2A06D 1CXAA 3AE1C 1S9KD 1HTLC 2WMMA 1DW3A 2DVHA 1L4AA 4AAOA 1MG3D 2WITA 1B7VA 1YITP 1M56D 1DIPA 4PV1D 1RE3A 1N73A 4NPFX 1PGPA 1MFTA 1K73Q 3TGUE 1CYCA 1PZQA 2Q6QA 2OZ1B 4O1WA 3MK7C 4L74A 1RF0A 2PAJA 1MZ9A 3CCVP 1SQVJ 1IK9A 5K5GB 2JJLA 4I6MC 2B87A 2BCNB 1Q2NA 2H8PD 3ABVC 4HB1A 3ZDMA 3HD7D 1N7SD 1M1JC 1KYOW 4Z1MH 1URQB 2R44A 2K88A 3P8MC 4XA4A 3HUSB 5M1BA 1FZCA 2FFDC 3O1YA 5E79E 4H44C 2CPBA 3WFCC 4UB8V 1CXCA 1HROA 4OGQC 3BRTB 1JTHB 1WMKA 3CCSP 2IFMA 3MUDC 3GF7A 1TU3F 1COTA 1A8CA 5KAIH 2E74C 3ITKA 5APQA 1SFCB 1NTMG 3IN6A 1KILC 1N15A 2XZRA 1H89A 1KYOE 2KNCB 4KT0J 3CL3D 1NNOA 1SQPE 5H2FV 1N8RQ 1HWTC 2NZ2A 1P84I 1CRGA 1LT1A 3HE4A 2FXPA 1AJYA 1NAYA 4YXWH 1AVOA 1JUNA 3G71P 5CCHD 4HJGH 2PCBB 2ZFCA 4AAMA 1NTMJ 2A45H 1U7MA 1H1OA 1P84D 1KQFB 3HE5B 1YIJP 1VQLP 1H31B 4IL6H 2PGDA 1HRCA 1AKKA 4NPEA 2HPCB 1NTZG 2PCCB 4L73A 3HQ7A 1PPJD 1SQXD 2XV5A 3V4WA 3HQ8A 4P4QB 3K5BA 1JCDA 1RE4C 1EXJA 2M5AB 2JKVA 1HJ5A 3HTKA 3CU4A 1CIHA 3L70D 5TISE 5E79H 5KTBA 1VQ9P 2WWWA 2JWDA 2E76D 3L37A 1QEXA 1T3JA 2FYUD 1C52A 1I55A 5CJ4A 4ZMDA 1FOCA 5APWA 2KS1B 4IFFA 3HQ6A 1OFCX 1PGOA 1CRJA 1GJQA 3AE6C 3CX5I 5GTIV 4GOEA 5CJ0A 2QJPB 2DGEA 3P7KA 3ZIYA 1EDKA 3CCJP 3TNUA 1M70A 1SQQE 3A2AA 3H1ID 3RL0B 2XNXA 4NPDA 5KLVD 3GHGB 3CX5D 2HLOA 3VTPC 3H1KD 2N3BA 2NRGA 5APXA 1L0LE 2M3EA 2D2CD 1LTJB 1SQPK 5DFSA 1NU1K 3A0BH 3GMAA 5AVYB 2LXBA 2FFDA 3RK3C 2KLVA 1YEBA 5KJ7C 1W2EA 1KFMA 3PH0A 3RK2D 3SXTA 4DT0A 4W7ZA 2MJZA 2FKWB 4JBZA 3H1JD 2H43A 4PV1B 3H1LJ 1NMIA 4AANA 1IC2A 2BCCE 5TISV 3N4XA 3L74E 1LTAC 4RO0A 2YKPA 3BCCG 2FYUG 1W2LA 3LW5H 2YXRB 1X9VA 1FAVA 4EIEA 2Q9IA 5CBNA 4FANA 4JYBA 1YTZI 1KX2A 5AVWB 1RF1A 3HD7B 1KZUB 4D6TG 1S2EA 4MN4C 2OQQA 3CCLP 3ZCFA 1IFNA 2E75D 1QLED 5CIHB 4LJIA 5L8RJ 3B5NC 2JP3A 1G2CB 5GTHH 1CTJA 3A9FA 4EDFA 1BDDA 3BCCJ 4KMGA 3H1IG 1NVOA 1SQBE 1Q7YQ 2AXTV 4EIDA 3H1KG 1M7LA 1PP9J 3X39A 3JC22 1LT9B 2ZT9D 3VYIA 1RE4A 2NPSA 1BCCE 1MKMA 1J1EB 1FZGA 1M60A 1VQ4P 1SVFA 4WQEA 5APVA 1SQQK 5CCGC 3SVWA 3TGUJ 4H0LD 1F1FA 3V2NA 4K35A 2SPZA 4Y99B 1VF5D 3AEGC 1GMJA 1J2JB 2W83C 3NBSA 5AVQB 2YIUB 2C1DB 1L0LK 3L75D 1MUUA 3A5TA 4CPGA 2HV4A 1FDIA 5AVRB 1A2SA 3O20A 3ZOXA 4C7RA 1NO4A 1LC1A 5AVTB 3IAOA 5AVVB 1H33A 3TF5A 1T2KD 1OWAA 1LTSC 3BVHA 5KJ7D 1S1CX 1J1DB 3WFEC 3L36A 1L0NE 5AVXB 1FS0E 1VQMP 2YQBA 2BH4X 1LWUB 3SWYA 3H1HD 1PIXA 1JNMA 4U3FG 4WY4C 2ZYDA 1EZVG 1DT1A 2E76B 2QRXA 1IFPA 1VQPP 4OH8B 3CXHE 3D70A 2LKMA 2R3SA 2WVRA 4H13C 2YCCA 2ZYAA 1NTKE 1FJ0A 1EXIA 4O1QA 1CRCA 3WMM0 4DJGA 1D7MA 1AVYA 1X79B 1JEKA 3OA7A 1CHHA 5APUA 1Q90D 4U3FJ 3S1KA 3AEDC 1JO5A 4M3LA 3B5ND 3RBZA 2A06E 1X8YA 1S9KE 451CA 4JQ0D 4EOTA 5AW2B 2OZ1A 1SQBK 2W8ZA 1N73C 1RE3C 4GIFA 2K3RA 1FI9A 5EFWB 3L75G 4L76A 2D2CB 3LIDA 1RF0C 5DF5A 1KORA 4PD4I 3SWKA 1KV9A 3DP5A 1URQA 1AYGA 2ZXYA 3HUSA 1Q81Q 3PXWA 1U74B 1KQLA 3LW5J 1K04A 2OTJP 2H7HA 5AW0B 2VRSA 1KFNA 1JTHA 4PD4D 1NKZB 1FZCC 3TYIA 1SFCA 2ZAEB 4H0JA 1DD3A 3CC2P 1VQNP 5CCGA 3N7NA 4AX3A 2Q7CA 4YE1A 3CXHH 2KNCA 1HF9A 1ZW0A 1YICA 3KYQA 1SQQJ 3E7KA 2K9JB 5CIEB 2ZVOB 2E75B 2JTIB 1L0NK 1HGZA 3I56P 3PHLA 1ZZHA 2QSIA 2CA4B 4WB4A 1HUCA 2C2CA 4N78D 2AEJA 2JDIH 1CI6B 1RQVA 2IZ0A 2JQRA 4BRYB 1GL2D 4WVZA 1FI7A 3CWBG 2O1KA 3HE5A 5DJQB 4NFGB 1OVVA 4C7NB 1USDA 1H32B 1NTKK 1OXZA 1H31A 1NH4A 5KKZB 4OVNF 4TLFA 1GK6A 1HH0A 1YQ4C 4H0LB 1RY3A 4UB8E 1P84E 1LT9C 2M5AA 1VF5B 1H88A 1L4AD 3L74J 3CCUP 1Q82Q 1CC5A 1XTCC 3CWBJ 2IX7C 1GU5A 5AW9B 1NTMD 1PPJE 1SQXE 3WUVA 4EI2A 1SQVG 1CTYA 5H2FE 3L72E 2KS1A 3FWLA 2JEEA 2W90A 1NMLA 3V2QA 2YIUC 2M8RA 5CIDB 2GUVA 3RBXA 2KSJA 2B12B 1KB9H 3L70E 1E29A 2BASA 2FRCA 2FYUE 1JM0A 3L4FA 2C8SA 3CX5W 5AW5B 1J1DC 1FBMA 1QGKB 2RKLA 3GHGA 1CYIA 1K9MQ 1WEJF 1KIBA 1JY3O 5CIFB 4RKUJ 3D6YA 2XKMA 3H32B 1KX7A 3TDKA 1ZR4A 1M8OB 2P1JA 1LTJA 3FX0A 2P58A 4GKGA 1NTZD 3OCDB 1EB7A 2YKQA 5AVSB 1CIEA 1DH3A 5KLVE 3CX5E 2OYIB 5BU8B 1QN2A 5KLIC 1PGQA 4QMAA 1JY2O 3IFMA 1YYCA 2C9LY 4UB8H 3RGUA 1P84H 1VQOP 1QL3A 1FZBA 3G4SP 3O6QB 2POHA 3L73E 2E43A 3M9BA 1I6DA 3LIEA 2WSSH 3V6IA 1U57A 1M57D 1OMIA 1RH5B 2KK7A 4WQ8A 3BATA 2N1TD 3H1JE 3TSIA 5GTIE 3FXEA 3H25A 4JCGA 2HR3A 1NU1E 3CI9A 3HD7A 1PV3A 1VQKP 1L0NJ 5H2FH 2LXCB 1JOCA 2UWJE 2IBZG 1CEDA 2HODB 1MV8A 1I54A 1EDLA 1RF1C 3NMDA 1SLQA 5CICB 1G2CA 1IRVA 1M90Q 3H1LD 4DZOA 1IZL0 3WUUA 1U7JA 1BL9A 2N9JA 2QJKB 1DEBA 2G3AA 3EWKA 5APSA 1HVVA 1SQXK 1HCMA 3NXSA 1NTKJ 1ZLLA 1GDVA 2ZYGA 3AEAC 4WQDA 4FAVA 1PFIA 2PP6A 3A0HV 3SWFA 1KB0A 3VMXA 1LT9A 1QL2A 3SWSA 1L2PA 3UIAA 2O01H 1CRHA 4I2LC 1BGYG 2I1JA 3SFDC 2E5YA 2QM8A 5DJTB 4IFMA 2FYUK 2BEQD 3CP5A 1YJNP 1A02F 2NPSC 4XE5B 3H6PA 4GOFA 5CCHA 3VRDA 1GQ1A 3BCCD 1GL2B 2C1DA 2OYHB 3P8CD 4I7ZC 2RH0A 3QWOC 2N18B 1PP9D 3MGNA 2CE1A 3PH2B 4D6TD 5CIGB 5B5EE 1BGYJ 1T3UA 2L91A 2M3BA 4FA5A 1KYOH 5KLVK 1GKSA 5GTIH 4PJ0E 1NYHA 2WQYC 1KC8Q 4H0KA 1N7LA 1ZOYC 2K1AA 4FA1A 3RL0g 3TGUD 1VQ6P 3GF3A 3L75E 3O8ZA 3PLNA 3Q2YA 1X22A 1GD2E 1LWUA 1FI3A 3H1LG 4H44D 1EQ7A 3AE9C 2AXTE 4OGQD 1CW5A 2GIWA 4PW9B 1AQTA 1OW8A 1LNQA 2FXOA 2I1KA 2CA3B 2E74D 3SJLA 2L4DA 4L3GA 2W27A 1Y47A 1JDLA 1H9XA 1KILD 1AQ5A 1R8EA 3H1HE 1BSHA 2V08A 3L71J 1WRGA 2P2UA 2QIWA 3R2PA 2OGUA 2P7JA 3CCMP 1KMIZ 3A7OA 1CSWA 4I1LA 2GC7D 4HKZH 1LFMA 3ZBMA 4PWAA 3RN0A 1MFZA 4Q5PA 1BE3G 4B86A 5IY51 5TISH 3EQ2A 2J5UA 1Z56A 3AE8C 3KPEA 1FJPA 2GB8B 1YJ9P 1E5WA 1EZVI 2OTLP 1PP9G 1IFJA 1OZHA 1N7SB 1ZMEC 5B5EV 2ZXXA 2MKVA 4PJ0V 2CPSA 1Q86Q 3WUTA 3WU2E 3Q5SA 2A45G 4WBAA 1RAQA 3TGUG 4U3FD 1EZVD 1BE3J 5B66E 1URQC 2KLUA 2E42A 2FWLA 1KD1Q 1N50A 3HUSC 2R3CA 2XDJA 3L72J 2OYOA 1AFOA 3CCQP 1SS1A 1BSNA 2AXTH 4JPZB 1VQ5P 2N1TB 5C0ZA 1K8AQ 1IFIA 1FOSF 2IFNA 4EICA 3AEEC 1W2BO 1LJ2A 1DIQC 3WFDC 1SFCC 3VYMA 3OA8B 2K9JA 1ZR2A 2N9IA 4PD4E 3ZOOA 1T8ZA 4Y5RA 1HJ3A 3RMZA 3C9IA 5AVZB 1IFMA 2BGVX 4RJTA 2DW3A 1CI6A 3ZOYA 2O01J 2QJYB 1HGVA 3FXDA 1AA0A 4BRYA 3Q5PA 1AOFA 4L1QA 4C7NA 1SQPG 3M0DA 1N9CA 5KLVJ 2WSCH 3F89A 3WUIA 2KUBA 2E5TA 4N78E 1YTZT 3RK3D 1QKSA 5KAFV 5CBOA 3KXDA 2B89A 2FBWC 4BXLA 3L73J 3U59A 2KP8A 3WU2V 3EFFK 1FDOA 5B66V 1C2RA 3L4MA 1NHLA 1S72P 1CORA 2ZJSE 1LTBC 1SQPJ 3MK7B 2WTYA 1GU4A 1NU1J 3AE7C 3VNWA 1LP1B 1OIPA 5AW6B 4ASVA 4J20A 2RMZA 5BU5A 2WPRA 3VMYA 3CC4P 3D6ZA 1QX8A 2G8YA 4QAOA 2OYHC 1M1JB 1USEA 3M97X 1S5LV 4GT1A 1NKNA 2B0ZB 1DW0A 1SP4A 3JCUE 1S5LX 1NTME 3FWNA 1GK4A 5AURA 3G6EP 4H44B 2QJPC 2IZ1A 4OGQB 3L74D 3PP5A 1IO3A 1GIWA 1IQCA 3CWBD 2IPPA 3TK1A 2AEMA 2KB7P 2Z5IA 1CRYA 1LMSA 2PFXA 3H32A 3RL0C 3AE2C 1CCRA 2ZVNB 1S3JA 3GHGC 1KILB 1JY3N 1K3GA 3OCDA 1DVHA 1HJBA 5CIBB 3RK2B 3T97B 1H0TB 3KQGA 1LTJC 1SQQG 3GG2A 2C1VA 2OYIA 2R5BA 5CCGD 1F1CA 1NOHA 2WPVB 1FDMA 4YPCA 4V2KA 3VP9A 2JR8A 1GU2A 3AE4C 1JY2N 3CLQA 4PV1C 1NTZE 3MP7B 1L0LG 3Q1MA 1SQVD 3WFBC 2B4ZA 3M91A 4ZKUA 2C9NY 1GDTA 1XTGB 2WPSA 3GLMA 1JB0J 3VMZA 4KJMA 2HODA 3V5BA 2W6AA 5AW7B 3NBTA 1RZ6A 3HD7C 1N7SC 2BCCG 1FZFA 1R5LA 1HJ0A 3MD0A 1NWQA 2P67A 1EDJA 1DD4A 3JCUH 2FYNB 3AE3C 1L0LJ 4TT3H 3L74G 4WY4D 3Q3DA 2HYNA 2B11B 4AUWA 1Y8AA 3H1HJ 3U1CA 2ZT9B 5AVUB 155CA 1C6OA 3TYYA 4H13D 3CPWO 2HPCA 3U1AA 2V7QH 2BCCJ 2I8DA 1I8PA 1NTMK 1YEAA 2KI7B 2IYOA 2Y0EA 4N3YB 2WSFH 2R32A 1J1EC 3RN1A 1CHIA 2IBZI 2WSCJ 1RAPA 1K3HA 5CYTR 1SQBG 2O1JA 3E1IA 4UB6V 2WT7B 1GL2A 1OVRA 1YIQA 5C39A 2OYHA 4Y99C 1VL2A 1U75B 5CCHC 3F5HA 2QM7A 3HQ9A 1C6SA 2XNDH 2K9YA 1PGJA 3CYTI 3KZIV 5TJHA 1ZRTD 2IBZD 2HFED 3RK3B 4GEDB 3BRVB 3BCCE 2KIKA 2Q3EA 3P8CE 1VDFA 4C46A 1SQBJ 1PP9E 2B10B 1NTZK 2YO3A 4AYCA 4D6TE 2FXMA 1N2DC 1LWUC 1NIRA 3A0HE 1BCCJ 1L9JC 4EYYQ 4AQRD 5APTA 3AEFC 2E76C 1BGYD 3PTZA 1IK7A 3H1IE 3SLEA 3I5CA 2CK3H 1KB9I 1MZ4A 1L0NG 4IL6E 3H1KE 1VYDA 2C9XB 1AOQA 4RSZA 1CCHA 3B5NB 5AW3B 1FE6A 3ORVA 4N0KA 2M0BA 1S6VB 4YTPC 4FA4A 2N3YA 1HZVA 1KILE 2B9BA 4R4MA 4OWFA 3D71A 2QG4A
chains in the Genus database with same CATH topology
1C6RA 2L4DA 4L3GA 1KB9D 1CSVA 1H33A 3TF5A 1JDLA 1H9XA 1YFCA 3WFEC 2V08A 3NWVA 1CHJA 5KAIV 2XTSB 1I5TA 1RZ5A 2YQBA 2BLFB 2BH4X 2AIUA 4FB1A 3H1HD 2VHDA 1CSWA 1L0ND 1QYZA 1DT1A 3L71D 1IRWA 2GC7D 1CTZA 2CXBA 1CNOA 1LFMA 2N9YB 3ZBMA 4PWAA 3RN0A 4Q5PA 5IY51 2BH5X 2PACA 2YCCA 3JBTB 1H33B 2GB8B 351CA 3CXHD 1FJ0A 4O1QA 1CRCA 5B6QA 5C9MA 2Y0DA 1DVVA 1NTKD 5B5EV 4WQCA 1LC2A 1CHHA 4PJ0V 3OA8A 3RLMA 1E8EA 451CA 1C75A 1RAQA 4U3FD 2LIRA 1EZVD 2OZ1A 2AI5A 4IL6V 2FWLA 1N50A 2A06D 1CXAA 1HH7A 1FI9A 1BE3D 1CYJA 1DW3A 2DVHA 3ZOWA 4AAOA 5C0ZA 1MG3D 3L72D 5DF5A 4EICA 1B7VA 2BPBB 1KV9A 3DP5A 1AYGA 5E79V 1DIQC 3WFDC 2ZXYA 3VYMA 3PXWA 3OA8B 1U74B 4WQ9A 2N9IA 1CYCA 5DJQC 3O5CA 3ZOOA 4Y5RA 1HJ3A 2OZ1B 4O1WA 3RMZA 3MK7C 1N90A 3WC8A 2BGVX 4PD4D 1CIFA 4RJTA 2D0WA 3TYIA 2BCNB 3DMIA 3ZOYA 2QJYB 3PXTA 4H0JA 4AX3A 1AOFA 4YE1A 1YNRA 4L1QA 1KYOW 4WQAA 1YICA 1N9CA 2Y0CA 1DIIC 2K9JB 3PRJA 5CIEB 3WUIA 3O1YA 2JTIB 1QKSA 3WFCC 5KAFV 4UB8V 3PHLA 1CXCA 1HROA 1ZZHA 2CA4B 2C2CA 1COTA 1A8CA 3WU2V 3ITKA 3A0BV 4AALA 3C2CA 1ETPA 2JQRA 1FI7A 3L73D 1N15A 5B66V 1C2RA 3L4MA 5DJQB 4NFGB 2KNCB 1CORA 1OAEA 1NNOA 3MK7B 5H2FV 1H32B 1H31A 3VNWA 1KYOD 1CRGA 4WQBA 4J20A 2RMZA 5KKZB 1CIGA 1SQPD 1NU1D 4DY9A 1HZUA 4QAOA 2MHMA 3M97X 1S5LV 2B0ZB 1DW0A 2PCBB 4AAMA 1H1OA 1CC5A 1CSXA 1P84D 1YTCA 5AURA 4XYDB 1NTMD 3L74D 1IO3A 1H31B 1GIWA 1IQCA 3CWBD 2QG4A 2MTAC 2ZONG 1CTYA 1HRCA 1AKKA 2KS1A 1CRYA 1LMSA 3FWLA 2PCCB 3HQ7A 1NMLA 1PPJD 5GTHV 1SQXD 5CIDB 1CCRA 2B12B 3HQ8A 1K3GA 1C7MA 4P4QB 3OCDA 1DVHA 5CIBB 1E29A 1J3SA 1HJ5A 1L9BC 3CU4A 1CIHA 2FRCA 3L70D 3GG2A 2C1VA 2C8SA 3CX5W 2LITA 1H9YA 3GW6A 1F1CA 1DW1A 2FYUD 2C1UA 1CYIA 4V2KA 1C52A 1I55A 1WEJF 1GU2A 1KIBA 1FOCA 2V07A 5CIFB 3HQ6A 1CRJA 1GJQA 1KX7A 1YCCA 3TDKA 1SQVD 5GTIV 3WFBC 2B4ZA 2QJPB 2DGEA 1NTZD 3OCDB 3L4OA 1EB7A 3ZIYA 1CIEA 1M70A 1H32A 1I6EA 1QN2A 4EIFA 1M6ZA 3H1ID 5KLVD 1SQQD 3NBTA 3CX5D 1RZ6A 3H1KD 2N3BA 1QL3A 1CRIA 1I6DA 4K3IA 4A7PA 2FYNB 1WVEC 3CXHW 5DFSA 4WQ8A 4WQ7A 1L0LD 1YEBA 2B11B 4JCGA 3SXTA 3H1JD 155CA 1C6OA 4XXLA 1CEDA 1NMIA 1CSUA 1I54A 4AANA 1A56A 2D0SA 2YK3A 4MU8A 5CICB 1IRVA 1I8PA 3H1LD 1IZL0 1YEAA 2Y0EA 1FCDC 2N18C 5TISV 1BL9A 2BCCD 3RN1A 2N9JA 1R0QA 2QJKB 1CHIA 2ZOOA 1CO6A 3DR0A 1W2LA 1RAPA 5KLIB 4EIEA 1DW2A 3PXSA 1HCMA 4FA9A 1K3HA 5CYTR 4FANA 2GC4D 1GDVA 4UB6V 1KX2A 2O3JA 1LS9A 4WQDA 4FAVA 1YIQA 3A0HV 1KB0A 1U75B 2EXVA 2ZBOA 3SWSA 3ZCFA 2ORLA 3HQ9A 1CRHA 5CIHB 1C6SA 1FHBA 4LJIA 3CYTI 3KZIV 5TJHA 1ZRTD 2IBZD 1MG2D 1I8OA 2RN0A 4GEDB 4L3HA 3CP5A 1CTJA 3A9FA 4EDFA 4KMGA 2Q3EA 2AXTV 4EIDA 1C2NA 3VRDA 1GQ1A 3BCCD 2B10B 2C1DA 3X39A 1SQBD 5EXQA 2N18B 1PP9D 2CE1A 1NIRA 3PH2B 4D6TD 1L9JC 5CIGB 1M60A 2L91A 4WQEA 4FA5A 1GKSA 3SVWA 1BCCD 1F1FA 4GYDA 1BGYD 3PTZA 1W5CT 2I8FA 3SLEA 4H0KA 3VMAA 4FA1A 3TGUD 1MZ4A 1QL4A 3PLNA 1OCDA 1VYDA 2C9XB 1AOQA 1FI3A 4RSZA 3NBSA 1CCHA 2ZZS1 2YIUB 2C1DB 3ORVA 2GIWA 4PW9B 3L75D 3KHUA 4N0KA 1S6VB 3O0RC 4FA4A 2N3YA 1HZVA 2HV4A 1A2SA 3O20A 3ZOXA 2CE0A 1E2RA 2CA3B 1LC1A 2JWAA 3SJLA 1HJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C6R A;  2L4D A;  4L3G A;  1KB9 D;  1CSV A;  1H33 A;  3TF5 A;  1JDL A;  1H9X A;  1YFC A;  3WFE C;  2V08 A;  3NWV A;  1CHJ A;  5KAI V;  2XTS B;  1I5T A;  1RZ5 A;  2YQB A;  2BLF B;  2BH4 X;  2AIU A;  4FB1 A;  3H1H D;  2VHD A;  1CSW A;  1L0N D;  1QYZ A;  1DT1 A;  3L71 D;  1IRW A;  2GC7 D;  1CTZ A;  2CXB A;  1CNO A;  1LFM A;  2N9Y B;  3ZBM A;  4PWA A;  3RN0 A;  4Q5P A;  5IY5 1;  2BH5 X;  2PAC A;  2YCC A;  3JBT B;  1H33 B;  2GB8 B;  351C A;  3CXH D;  1FJ0 A;  4O1Q A;  1CRC A;  5B6Q A;  5C9M A;  2Y0D A;  1DVV A;  1NTK D;  5B5E V;  4WQC A;  1LC2 A;  1CHH A;  4PJ0 V;  3OA8 A;  3RLM A;  1E8E A;  451C A;  1C75 A;  1RAQ A;  4U3F D;  2LIR A;  1EZV D;  2OZ1 A;  2AI5 A;  4IL6 V;  2FWL A;  1N50 A;  2A06 D;  1CXA A;  1HH7 A;  1FI9 A;  1BE3 D;  1CYJ A;  1DW3 A;  2DVH A;  3ZOW A;  4AAO A;  5C0Z A;  1MG3 D;  3L72 D;  5DF5 A;  4EIC A;  1B7V A;  2BPB B;  1KV9 A;  3DP5 A;  1AYG A;  5E79 V;  1DIQ C;  3WFD C;  2ZXY A;  3VYM A;  3PXW A;  3OA8 B;  1U74 B;  4WQ9 A;  2N9I A;  1CYC A;  5DJQ C;  3O5C A;  3ZOO A;  4Y5R A;  1HJ3 A;  2OZ1 B;  4O1W A;  3RMZ A;  3MK7 C;  1N90 A;  3WC8 A;  2BGV X;  4PD4 D;  1CIF A;  4RJT A;  2D0W A;  3TYI A;  2BCN B;  3DMI A;  3ZOY A;  2QJY B;  3PXT A;  4H0J A;  4AX3 A;  1AOF A;  4YE1 A;  1YNR A;  4L1Q A;  1KYO W;  4WQA A;  1YIC A;  1N9C A;  2Y0C A;  1DII C;  2K9J B;  3PRJ A;  5CIE B;  3WUI A;  3O1Y A;  2JTI B;  1QKS A;  3WFC C;  5KAF V;  4UB8 V;  3PHL A;  1CXC A;  1HRO A;  1ZZH A;  2CA4 B;  2C2C A;  1COT A;  1A8C A;  3WU2 V;  3ITK A;  3A0B V;  4AAL A;  3C2C A;  1ETP A;  2JQR A;  1FI7 A;  3L73 D;  1N15 A;  5B66 V;  1C2R A;  3L4M A;  5DJQ B;  4NFG B;  2KNC B;  1COR A;  1OAE A;  1NNO A;  3MK7 B;  5H2F V;  1H32 B;  1H31 A;  3VNW A;  1KYO D;  1CRG A;  4WQB A;  4J20 A;  2RMZ A;  5KKZ B;  1CIG A;  1SQP D;  1NU1 D;  4DY9 A;  1HZU A;  4QAO A;  2MHM A;  3M97 X;  1S5L V;  2B0Z B;  1DW0 A;  2PCB B;  4AAM A;  1H1O A;  1CC5 A;  1CSX A;  1P84 D;  1YTC A;  5AUR A;  4XYD B;  1NTM D;  3L74 D;  1IO3 A;  1H31 B;  1GIW A;  1IQC A;  3CWB D;  2QG4 A;  2MTA C;  2ZON G;  1CTY A;  1HRC A;  1AKK A;  2KS1 A;  1CRY A;  1LMS A;  3FWL A;  2PCC B;  3HQ7 A;  1NML A;  1PPJ D;  5GTH V;  1SQX D;  5CID B;  1CCR A;  2B12 B;  3HQ8 A;  1K3G A;  1C7M A;  4P4Q B;  3OCD A;  1DVH A;  5CIB B;  1E29 A;  1J3S A;  1HJ5 A;  1L9B C;  3CU4 A;  1CIH A;  2FRC A;  3L70 D;  3GG2 A;  2C1V A;  2C8S A;  3CX5 W;  2LIT A;  1H9Y A;  3GW6 A;  1F1C A;  1DW1 A;  2FYU D;  2C1U A;  1CYI A;  4V2K A;  1C52 A;  1I55 A;  1WEJ F;  1GU2 A;  1KIB A;  1FOC A;  2V07 A;  5CIF B;  3HQ6 A;  1CRJ A;  1GJQ A;  1KX7 A;  1YCC A;  3TDK A;  1SQV D;  5GTI V;  3WFB C;  2B4Z A;  2QJP B;  2DGE A;  1NTZ D;  3OCD B;  3L4O A;  1EB7 A;  3ZIY A;  1CIE A;  1M70 A;  1H32 A;  1I6E A;  1QN2 A;  4EIF A;  1M6Z A;  3H1I D;  5KLV D;  1SQQ D;  3NBT A;  3CX5 D;  1RZ6 A;  3H1K D;  2N3B A;  1QL3 A;  1CRI A;  1I6D A;  4K3I A;  4A7P A;  2FYN B;  1WVE C;  3CXH W;  5DFS A;  4WQ8 A;  4WQ7 A;  1L0L D;  1YEB A;  2B11 B;  4JCG A;  3SXT A;  3H1J D;  155C A;  1C6O A;  4XXL A;  1CED A;  1NMI A;  1CSU A;  1I54 A;  4AAN A;  1A56 A;  2D0S A;  2YK3 A;  4MU8 A;  5CIC B;  1IRV A;  1I8P A;  3H1L D;  1IZL 0;  1YEA A;  2Y0E A;  1FCD C;  2N18 C;  5TIS V;  1BL9 A;  2BCC D;  3RN1 A;  2N9J A;  1R0Q A;  2QJK B;  1CHI A;  2ZOO A;  1CO6 A;  3DR0 A;  1W2L A;  1RAP A;  5KLI B;  4EIE A;  1DW2 A;  3PXS A;  1HCM A;  4FA9 A;  1K3H A;  5CYT R;  4FAN A;  2GC4 D;  1GDV A;  4UB6 V;  1KX2 A;  2O3J A;  1LS9 A;  4WQD A;  4FAV A;  1YIQ A;  3A0H V;  1KB0 A;  1U75 B;  2EXV A;  2ZBO A;  3SWS A;  3ZCF A;  2ORL A;  3HQ9 A;  1CRH A;  5CIH B;  1C6S A;  1FHB A;  4LJI A;  3CYT I;  3KZI V;  5TJH A;  1ZRT D;  2IBZ D;  1MG2 D;  1I8O A;  2RN0 A;  4GED B;  4L3H A;  3CP5 A;  1CTJ A;  3A9F A;  4EDF A;  4KMG A;  2Q3E A;  2AXT V;  4EID A;  1C2N A;  3VRD A;  1GQ1 A;  3BCC D;  2B10 B;  2C1D A;  3X39 A;  1SQB D;  5EXQ A;  2N18 B;  1PP9 D;  2CE1 A;  1NIR A;  3PH2 B;  4D6T D;  1L9J C;  5CIG B;  1M60 A;  2L91 A;  4WQE A;  4FA5 A;  1GKS A;  3SVW A;  1BCC D;  1F1F A;  4GYD A;  1BGY D;  3PTZ A;  1W5C T;  2I8F A;  3SLE A;  4H0K A;  3VMA A;  4FA1 A;  3TGU D;  1MZ4 A;  1QL4 A;  3PLN A;  1OCD A;  1VYD A;  2C9X B;  1AOQ A;  1FI3 A;  4RSZ A;  3NBS A;  1CCH A;  2ZZS 1;  2YIU B;  2C1D B;  3ORV A;  2GIW A;  4PW9 B;  3L75 D;  3KHU A;  4N0K A;  1S6V B;  3O0R C;  4FA4 A;  2N3Y A;  1HZV A;  2HV4 A;  1A2S A;  3O20 A;  3ZOX A;  2CE0 A;  1E2R A;  2CA3 B;  1LC1 A;  2JWA A;  3SJL A;  1HJ4 A; 
#chains in the Genus database with same CATH topology
 1C6R A;  4O9B A;  1FZE A;  3HRN A;  1KB9 D;  1CSV A;  3B71 A;  1YFC A;  1NTK G;  1VQ7 P;  1CSB A;  1K05 A;  3NWV A;  1N7S A;  5KAI V;  2XTS B;  3CC7 P;  2BLF B;  2AIU A;  4FB1 A;  2VHD A;  1S4X A;  2D2C C;  1QYZ A;  2WSE H;  1CZQ A;  1NAF A;  3L71 D;  1IRW A;  5CHX A;  2A06 G;  3RK2 C;  4YXD C;  3S4R A;  1OVU A;  2YMY A;  2C0W A;  2AEF A;  3PJS K;  5B6Q A;  1DX7 A;  2N1T A;  2Y0D A;  3W68 A;  1QVF O;  3A0H H;  1LC2 A;  4U3F E;  1KQS O;  1EZV E;  3OA8 A;  3RLM A;  3CMA P;  3A0B E;  5AW8 B;  1ZN5 A;  2LIR A;  1JCC A;  2Z4E A;  1EC5 A;  4IL6 V;  4EIJ A;  2K37 A;  3CX5 H;  4IL6 X;  3BAS A;  3KDP B;  1HH7 A;  2H88 C;  2E75 C;  1BE3 D;  1CYJ A;  3ZOW A;  4WY4 B;  2A45 I;  1YI2 P;  3JSV C;  3L72 D;  3MTU E;  2V7Q J;  2P10 A;  1FJK A;  2BPB B;  1LTG C;  2KSE A;  1YBK A;  2FYN C;  3VN0 A;  3CCE P;  5E79 V;  2WSF J;  1ZXG A;  4GOD A;  2Y9Z A;  4DOJ A;  4H13 B;  4WQ9 A;  5DJQ C;  3O5C A;  4W80 A;  2OTK E;  1Y9B A;  1N90 A;  3M0D C;  2ZT9 C;  3WC8 A;  1CIF A;  2D0W A;  1IFD A;  3L71 G;  3NFQ A;  1NTZ J;  5KKZ C;  1KV4 A;  1L4A B;  4IOI H;  3DMI A;  3PXT A;  1RHZ B;  4H0L C;  5GTH E;  1NGM B;  1YNR A;  2GA1 A;  3MHV A;  4WQA A;  1JMM A;  1HBW A;  4WWI A;  1N73 B;  3RK3 E;  1VF5 C;  2Y0C A;  2YNY A;  1LP1 A;  1DII C;  1OX3 A;  3PRJ A;  4LGD E;  3M06 A;  2FYZ A;  3V2R A;  1EDI A;  1YHQ P;  1M1K Q;  3NTN A;  1KYO I;  4HYT B;  1M1J A;  4KHX A;  2B87 B;  3A0B V;  4AAL A;  3C2C A;  1ETP A;  2H89 C;  5BVZ A;  3R4Y A;  5AW4 B;  1T2K C;  3L73 D;  2AXC A;  3USS A;  2WZ7 A;  1OAE A;  3MZW B;  2KXP B;  3G3Z A;  1PPJ G;  1KYO D;  1SQX G;  4WQB A;  2YMK A;  1FZC B;  3MUD A;  1KQG B;  4RES B;  1CIG A;  1SQP D;  3L72 G;  1NU1 D;  3L35 A;  3S9O A;  4DY9 A;  1HZU A;  3B4S A;  1KIL A;  2QEX P;  1W5C E;  5KAF E;  5AW1 B;  3L70 G;  2MHM A;  1H8A A;  3T97 A;  1H0T A;  5B5E H;  1G1J A;  2Q3I A;  4W7Y A;  4R4L A;  1CSX A;  3CWB E;  1UII A;  1YTC A;  1N86 A;  4XYD B;  4PJ0 H;  3V4Q A;  2GUS A;  1FZA A;  3VOP A;  1UIX A;  1ZV8 A;  2NPS D;  1SQX J;  2GM4 A;  2QE7 H;  2MTA C;  2ZON G;  2OYI C;  1E79 H;  3HE4 B;  1KN7 A;  4L75 A;  5GTH V;  2OAR A;  2WSE J;  1C7M A;  3L70 J;  4HH2 A;  4N6J A;  3IR9 A;  1J3S A;  1QVG O;  1L9B C;  3OW2 O;  1FOS E;  1S5L E;  2FYU J;  5KLV G;  3CD6 P;  2IDB A;  2Q5U A;  2LIT A;  1FC2 C;  1H9Y A;  3GW6 A;  1JMB A;  1DW1 A;  2YKO A;  4D6T J;  2C1U A;  1SQV E;  2V07 A;  3M0A A;  2W6J H;  3L73 G;  1YCC A;  3II6 A;  3M9Q A;  3VP8 A;  2J59 M;  3H1J G;  3L4O A;  3OJA B;  3H1I J;  3HTK B;  1H32 A;  1AV1 A;  1NU1 G;  2QJK C;  3Q5R A;  1I6E A;  3H1K J;  1VPC A;  2B88 A;  4EIF A;  2YXQ B;  3SFE C;  1M6Z A;  3W67 A;  1SQQ D;  5KAF H;  3E1R A;  1CRI A;  4DCK A;  4K3I A;  4A7P A;  1NJI Q;  1WVE C;  3CXH W;  3WU2 H;  3D0W A;  3H1J J;  4WQ7 A;  1L0L D;  2JO1 A;  3V2P A;  5B66 H;  3TNU B;  2QA4 P;  2WT7 A;  4LLH A;  2W6B A;  2KZI A;  1IZN B;  1WT6 A;  4XXL A;  2IYP A;  1CSU A;  1A56 A;  2D0S A;  2YK3 A;  1GL2 C;  4MU8 A;  5KJ7 A;  1FCD C;  2N18 C;  3A3Y B;  2LR2 A;  2BCC D;  1S5L H;  1YJW P;  1R0Q A;  2J58 A;  2ZOO A;  1CO6 A;  3DR0 A;  3AE5 C;  4PD4 H;  2FFD B;  5KLI B;  4LC1 A;  1DW2 A;  3PXS A;  4FA9 A;  2GC4 D;  2KYV A;  2O3J A;  1LS9 A;  2KOG A;  1URQ D;  4JYC A;  1ZRT E;  2IBZ E;  4GDO A;  2EXV A;  2ZBO A;  1DEE G;  2E74 B;  2ORL A;  3CME P;  1FHB A;  1L4A C;  1RQU A;  1QL1 A;  1MG2 D;  3SSU A;  1I8O A;  5APY A;  3I55 P;  2RN0 A;  4L3H A;  2V4H A;  2KZJ A;  3C1L A;  1ZP0 C;  2FY8 A;  1GW3 A;  4K3A A;  1PL5 A;  1SFC D;  1SQV K;  1C2N A;  1LGH B;  2O01 N;  1A02 J;  2N9B A;  1RF1 B;  3EFG A;  3B5N A;  1R5S A;  4ASW A;  1SQB D;  4UB6 E;  5DJU B;  2R5D A;  3O6Q A;  5EXQ A;  2ITA A;  1FU1 A;  1BGY E;  1LTI C;  3CCR P;  1YQ3 C;  1VQ8 P;  2Y9Y A;  1BCC D;  3KZI E;  4GYD A;  1W5C T;  2I8F A;  3FGA D;  3H1H G;  3VMA A;  1QL4 A;  3L75 J;  1OCD A;  1LTT C;  2ZZS 1;  3KHU A;  1BDC A;  3O0R C;  1KB9 E;  2CE0 A;  2NPS B;  1E2R A;  2JWA A;  1X0T A;  1HJ4 A;  4ZKP A;  1OW6 A;  1KTM A;  2WPQ A;  4ZNC A;  2PRR A;  2BEZ F;  3P32 A;  4I7Z B;  2L5G B;  1CHJ A;  3L71 E;  2C0X A;  1I5T A;  3CXH I;  1RZ5 A;  1JY3 P;  3H1L E;  1IO4 A;  1IJD B;  1L0N D;  2N1T C;  1CTZ A;  2CXB A;  1GTW A;  1CNO A;  3IF4 A;  2N9Y B;  2Z5H A;  1GZL A;  2Q1K A;  2XU6 A;  2BH5 X;  1OW7 A;  2PAC A;  3JBT B;  1H33 B;  2ZXE B;  4U7J A;  351C A;  3CXH D;  2QVA A;  1JY2 P;  5C9M A;  4WY4 A;  4UB6 H;  4JF7 A;  4XFJ A;  1DVV A;  1NTK D;  4WQC A;  3MIW A;  3M9H A;  1T6A A;  5KAI E;  1BCC G;  3RL0 D;  4IFD K;  3C8V A;  2QJY C;  3AEC C;  3G9R A;  4Y28 J;  2YO2 A;  1GW4 A;  1E8E A;  1G1I A;  3KZI H;  2HG5 D;  1C75 A;  3AEB C;  3OAK A;  3QH9 A;  5CMZ A;  3B8E B;  1BE3 E;  4BWN A;  2AI5 A;  2A06 D;  1CXA A;  3AE1 C;  1S9K D;  1HTL C;  2WMM A;  1DW3 A;  2DVH A;  1L4A A;  4AAO A;  1MG3 D;  2WIT A;  1B7V A;  1YIT P;  1M56 D;  1DIP A;  4PV1 D;  1RE3 A;  1N73 A;  4NPF X;  1PGP A;  1MFT A;  1K73 Q;  3TGU E;  1CYC A;  1PZQ A;  2Q6Q A;  2OZ1 B;  4O1W A;  3MK7 C;  4L74 A;  1RF0 A;  2PAJ A;  1MZ9 A;  3CCV P;  1SQV J;  1IK9 A;  5K5G B;  2JJL A;  4I6M C;  2B87 A;  2BCN B;  1Q2N A;  2H8P D;  3ABV C;  4HB1 A;  3ZDM A;  3HD7 D;  1N7S D;  1M1J C;  1KYO W;  4Z1M H;  1URQ B;  2R44 A;  2K88 A;  3P8M C;  4XA4 A;  3HUS B;  5M1B A;  1FZC A;  2FFD C;  3O1Y A;  5E79 E;  4H44 C;  2CPB A;  3WFC C;  4UB8 V;  1CXC A;  1HRO A;  4OGQ C;  3BRT B;  1JTH B;  1WMK A;  3CCS P;  2IFM A;  3MUD C;  3GF7 A;  1TU3 F;  1COT A;  1A8C A;  5KAI H;  2E74 C;  3ITK A;  5APQ A;  1SFC B;  1NTM G;  3IN6 A;  1KIL C;  1N15 A;  2XZR A;  1H89 A;  1KYO E;  2KNC B;  4KT0 J;  3CL3 D;  1NNO A;  1SQP E;  5H2F V;  1N8R Q;  1HWT C;  2NZ2 A;  1P84 I;  1CRG A;  1LT1 A;  3HE4 A;  2FXP A;  1AJY A;  1NAY A;  4YXW H;  1AVO A;  1JUN A;  3G71 P;  5CCH D;  4HJG H;  2PCB B;  2ZFC A;  4AAM A;  1NTM J;  2A45 H;  1U7M A;  1H1O A;  1P84 D;  1KQF B;  3HE5 B;  1YIJ P;  1VQL P;  1H31 B;  4IL6 H;  2PGD A;  1HRC A;  1AKK A;  4NPE A;  2HPC B;  1NTZ G;  2PCC B;  4L73 A;  3HQ7 A;  1PPJ D;  1SQX D;  2XV5 A;  3V4W A;  3HQ8 A;  4P4Q B;  3K5B A;  1JCD A;  1RE4 C;  1EXJ A;  2M5A B;  2JKV A;  1HJ5 A;  3HTK A;  3CU4 A;  1CIH A;  3L70 D;  5TIS E;  5E79 H;  5KTB A;  1VQ9 P;  2WWW A;  2JWD A;  2E76 D;  3L37 A;  1QEX A;  1T3J A;  2FYU D;  1C52 A;  1I55 A;  5CJ4 A;  4ZMD A;  1FOC A;  5APW A;  2KS1 B;  4IFF A;  3HQ6 A;  1OFC X;  1PGO A;  1CRJ A;  1GJQ A;  3AE6 C;  3CX5 I;  5GTI V;  4GOE A;  5CJ0 A;  2QJP B;  2DGE A;  3P7K A;  3ZIY A;  1EDK A;  3CCJ P;  3TNU A;  1M70 A;  1SQQ E;  3A2A A;  3H1I D;  3RL0 B;  2XNX A;  4NPD A;  5KLV D;  3GHG B;  3CX5 D;  2HLO A;  3VTP C;  3H1K D;  2N3B A;  2NRG A;  5APX A;  1L0L E;  2M3E A;  2D2C D;  1LTJ B;  1SQP K;  5DFS A;  1NU1 K;  3A0B H;  3GMA A;  5AVY B;  2LXB A;  2FFD A;  3RK3 C;  2KLV A;  1YEB A;  5KJ7 C;  1W2E A;  1KFM A;  3PH0 A;  3RK2 D;  3SXT A;  4DT0 A;  4W7Z A;  2MJZ A;  2FKW B;  4JBZ A;  3H1J D;  2H43 A;  4PV1 B;  3H1L J;  1NMI A;  4AAN A;  1IC2 A;  2BCC E;  5TIS V;  3N4X A;  3L74 E;  1LTA C;  4RO0 A;  2YKP A;  3BCC G;  2FYU G;  1W2L A;  3LW5 H;  2YXR B;  1X9V A;  1FAV A;  4EIE A;  2Q9I A;  5CBN A;  4FAN A;  4JYB A;  1YTZ I;  1KX2 A;  5AVW B;  1RF1 A;  3HD7 B;  1KZU B;  4D6T G;  1S2E A;  4MN4 C;  2OQQ A;  3CCL P;  3ZCF A;  1IFN A;  2E75 D;  1QLE D;  5CIH B;  4LJI A;  5L8R J;  3B5N C;  2JP3 A;  1G2C B;  5GTH H;  1CTJ A;  3A9F A;  4EDF A;  1BDD A;  3BCC J;  4KMG A;  3H1I G;  1NVO A;  1SQB E;  1Q7Y Q;  2AXT V;  4EID A;  3H1K G;  1M7L A;  1PP9 J;  3X39 A;  3JC2 2;  1LT9 B;  2ZT9 D;  3VYI A;  1RE4 A;  2NPS A;  1BCC E;  1MKM A;  1J1E B;  1FZG A;  1M60 A;  1VQ4 P;  1SVF A;  4WQE A;  5APV A;  1SQQ K;  5CCG C;  3SVW A;  3TGU J;  4H0L D;  1F1F A;  3V2N A;  4K35 A;  2SPZ A;  4Y99 B;  1VF5 D;  3AEG C;  1GMJ A;  1J2J B;  2W83 C;  3NBS A;  5AVQ B;  2YIU B;  2C1D B;  1L0L K;  3L75 D;  1MUU A;  3A5T A;  4CPG A;  2HV4 A;  1FDI A;  5AVR B;  1A2S A;  3O20 A;  3ZOX A;  4C7R A;  1NO4 A;  1LC1 A;  5AVT B;  3IAO A;  5AVV B;  1H33 A;  3TF5 A;  1T2K D;  1OWA A;  1LTS C;  3BVH A;  5KJ7 D;  1S1C X;  1J1D B;  3WFE C;  3L36 A;  1L0N E;  5AVX B;  1FS0 E;  1VQM P;  2YQB A;  2BH4 X;  1LWU B;  3SWY A;  3H1H D;  1PIX A;  1JNM A;  4U3F G;  4WY4 C;  2ZYD A;  1EZV G;  1DT1 A;  2E76 B;  2QRX A;  1IFP A;  1VQP P;  4OH8 B;  3CXH E;  3D70 A;  2LKM A;  2R3S A;  2WVR A;  4H13 C;  2YCC A;  2ZYA A;  1NTK E;  1FJ0 A;  1EXI A;  4O1Q A;  1CRC A;  3WMM 0;  4DJG A;  1D7M A;  1AVY A;  1X79 B;  1JEK A;  3OA7 A;  1CHH A;  5APU A;  1Q90 D;  4U3F J;  3S1K A;  3AED C;  1JO5 A;  4M3L A;  3B5N D;  3RBZ A;  2A06 E;  1X8Y A;  1S9K E;  451C A;  4JQ0 D;  4EOT A;  5AW2 B;  2OZ1 A;  1SQB K;  2W8Z A;  1N73 C;  1RE3 C;  4GIF A;  2K3R A;  1FI9 A;  5EFW B;  3L75 G;  4L76 A;  2D2C B;  3LID A;  1RF0 C;  5DF5 A;  1KOR A;  4PD4 I;  3SWK A;  1KV9 A;  3DP5 A;  1URQ A;  1AYG A;  2ZXY A;  3HUS A;  1Q81 Q;  3PXW A;  1U74 B;  1KQL A;  3LW5 J;  1K04 A;  2OTJ P;  2H7H A;  5AW0 B;  2VRS A;  1KFN A;  1JTH A;  4PD4 D;  1NKZ B;  1FZC C;  3TYI A;  1SFC A;  2ZAE B;  4H0J A;  1DD3 A;  3CC2 P;  1VQN P;  5CCG A;  3N7N A;  4AX3 A;  2Q7C A;  4YE1 A;  3CXH H;  2KNC A;  1HF9 A;  1ZW0 A;  1YIC A;  3KYQ A;  1SQQ J;  3E7K A;  2K9J B;  5CIE B;  2ZVO B;  2E75 B;  2JTI B;  1L0N K;  1HGZ A;  3I56 P;  3PHL A;  1ZZH A;  2QSI A;  2CA4 B;  4WB4 A;  1HUC A;  2C2C A;  4N78 D;  2AEJ A;  2JDI H;  1CI6 B;  1RQV A;  2IZ0 A;  2JQR A;  4BRY B;  1GL2 D;  4WVZ A;  1FI7 A;  3CWB G;  2O1K A;  3HE5 A;  5DJQ B;  4NFG B;  1OVV A;  4C7N B;  1USD A;  1H32 B;  1NTK K;  1OXZ A;  1H31 A;  1NH4 A;  5KKZ B;  4OVN F;  4TLF A;  1GK6 A;  1HH0 A;  1YQ4 C;  4H0L B;  1RY3 A;  4UB8 E;  1P84 E;  1LT9 C;  2M5A A;  1VF5 B;  1H88 A;  1L4A D;  3L74 J;  3CCU P;  1Q82 Q;  1CC5 A;  1XTC C;  3CWB J;  2IX7 C;  1GU5 A;  5AW9 B;  1NTM D;  1PPJ E;  1SQX E;  3WUV A;  4EI2 A;  1SQV G;  1CTY A;  5H2F E;  3L72 E;  2KS1 A;  3FWL A;  2JEE A;  2W90 A;  1NML A;  3V2Q A;  2YIU C;  2M8R A;  5CID B;  2GUV A;  3RBX A;  2KSJ A;  2B12 B;  1KB9 H;  3L70 E;  1E29 A;  2BAS A;  2FRC A;  2FYU E;  1JM0 A;  3L4F A;  2C8S A;  3CX5 W;  5AW5 B;  1J1D C;  1FBM A;  1QGK B;  2RKL A;  3GHG A;  1CYI A;  1K9M Q;  1WEJ F;  1KIB A;  1JY3 O;  5CIF B;  4RKU J;  3D6Y A;  2XKM A;  3H32 B;  1KX7 A;  3TDK A;  1ZR4 A;  1M8O B;  2P1J A;  1LTJ A;  3FX0 A;  2P58 A;  4GKG A;  1NTZ D;  3OCD B;  1EB7 A;  2YKQ A;  5AVS B;  1CIE A;  1DH3 A;  5KLV E;  3CX5 E;  2OYI B;  5BU8 B;  1QN2 A;  5KLI C;  1PGQ A;  4QMA A;  1JY2 O;  3IFM A;  1YYC A;  2C9L Y;  4UB8 H;  3RGU A;  1P84 H;  1VQO P;  1QL3 A;  1FZB A;  3G4S P;  3O6Q B;  2POH A;  3L73 E;  2E43 A;  3M9B A;  1I6D A;  3LIE A;  2WSS H;  3V6I A;  1U57 A;  1M57 D;  1OMI A;  1RH5 B;  2KK7 A;  4WQ8 A;  3BAT A;  2N1T D;  3H1J E;  3TSI A;  5GTI E;  3FXE A;  3H25 A;  4JCG A;  2HR3 A;  1NU1 E;  3CI9 A;  3HD7 A;  1PV3 A;  1VQK P;  1L0N J;  5H2F H;  2LXC B;  1JOC A;  2UWJ E;  2IBZ G;  1CED A;  2HOD B;  1MV8 A;  1I54 A;  1EDL A;  1RF1 C;  3NMD A;  1SLQ A;  5CIC B;  1G2C A;  1IRV A;  1M90 Q;  3H1L D;  4DZO A;  1IZL 0;  3WUU A;  1U7J A;  1BL9 A;  2N9J A;  2QJK B;  1DEB A;  2G3A A;  3EWK A;  5APS A;  1HVV A;  1SQX K;  1HCM A;  3NXS A;  1NTK J;  1ZLL A;  1GDV A;  2ZYG A;  3AEA C;  4WQD A;  4FAV A;  1PFI A;  2PP6 A;  3A0H V;  3SWF A;  1KB0 A;  3VMX A;  1LT9 A;  1QL2 A;  3SWS A;  1L2P A;  3UIA A;  2O01 H;  1CRH A;  4I2L C;  1BGY G;  2I1J A;  3SFD C;  2E5Y A;  2QM8 A;  5DJT B;  4IFM A;  2FYU K;  2BEQ D;  3CP5 A;  1YJN P;  1A02 F;  2NPS C;  4XE5 B;  3H6P A;  4GOF A;  5CCH A;  3VRD A;  1GQ1 A;  3BCC D;  1GL2 B;  2C1D A;  2OYH B;  3P8C D;  4I7Z C;  2RH0 A;  3QWO C;  2N18 B;  1PP9 D;  3MGN A;  2CE1 A;  3PH2 B;  4D6T D;  5CIG B;  5B5E E;  1BGY J;  1T3U A;  2L91 A;  2M3B A;  4FA5 A;  1KYO H;  5KLV K;  1GKS A;  5GTI H;  4PJ0 E;  1NYH A;  2WQY C;  1KC8 Q;  4H0K A;  1N7L A;  1ZOY C;  2K1A A;  4FA1 A;  3RL0 g;  3TGU D;  1VQ6 P;  3GF3 A;  3L75 E;  3O8Z A;  3PLN A;  3Q2Y A;  1X22 A;  1GD2 E;  1LWU A;  1FI3 A;  3H1L G;  4H44 D;  1EQ7 A;  3AE9 C;  2AXT E;  4OGQ D;  1CW5 A;  2GIW A;  4PW9 B;  1AQT A;  1OW8 A;  1LNQ A;  2FXO A;  2I1K A;  2CA3 B;  2E74 D;  3SJL A;  2L4D A;  4L3G A;  2W27 A;  1Y47 A;  1JDL A;  1H9X A;  1KIL D;  1AQ5 A;  1R8E A;  3H1H E;  1BSH A;  2V08 A;  3L71 J;  1WRG A;  2P2U A;  2QIW A;  3R2P A;  2OGU A;  2P7J A;  3CCM P;  1KMI Z;  3A7O A;  1CSW A;  4I1L A;  2GC7 D;  4HKZ H;  1LFM A;  3ZBM A;  4PWA A;  3RN0 A;  1MFZ A;  4Q5P A;  1BE3 G;  4B86 A;  5IY5 1;  5TIS H;  3EQ2 A;  2J5U A;  1Z56 A;  3AE8 C;  3KPE A;  1FJP A;  2GB8 B;  1YJ9 P;  1E5W A;  1EZV I;  2OTL P;  1PP9 G;  1IFJ A;  1OZH A;  1N7S B;  1ZME C;  5B5E V;  2ZXX A;  2MKV A;  4PJ0 V;  2CPS A;  1Q86 Q;  3WUT A;  3WU2 E;  3Q5S A;  2A45 G;  4WBA A;  1RAQ A;  3TGU G;  4U3F D;  1EZV D;  1BE3 J;  5B66 E;  1URQ C;  2KLU A;  2E42 A;  2FWL A;  1KD1 Q;  1N50 A;  3HUS C;  2R3C A;  2XDJ A;  3L72 J;  2OYO A;  1AFO A;  3CCQ P;  1SS1 A;  1BSN A;  2AXT H;  4JPZ B;  1VQ5 P;  2N1T B;  5C0Z A;  1K8A Q;  1IFI A;  1FOS F;  2IFN A;  4EIC A;  3AEE C;  1W2B O;  1LJ2 A;  1DIQ C;  3WFD C;  1SFC C;  3VYM A;  3OA8 B;  2K9J A;  1ZR2 A;  2N9I A;  4PD4 E;  3ZOO A;  1T8Z A;  4Y5R A;  1HJ3 A;  3RMZ A;  3C9I A;  5AVZ B;  1IFM A;  2BGV X;  4RJT A;  2DW3 A;  1CI6 A;  3ZOY A;  2O01 J;  2QJY B;  1HGV A;  3FXD A;  1AA0 A;  4BRY A;  3Q5P A;  1AOF A;  4L1Q A;  4C7N A;  1SQP G;  3M0D A;  1N9C A;  5KLV J;  2WSC H;  3F89 A;  3WUI A;  2KUB A;  2E5T A;  4N78 E;  1YTZ T;  3RK3 D;  1QKS A;  5KAF V;  5CBO A;  3KXD A;  2B89 A;  2FBW C;  4BXL A;  3L73 J;  3U59 A;  2KP8 A;  3WU2 V;  3EFF K;  1FDO A;  5B66 V;  1C2R A;  3L4M A;  1NHL A;  1S72 P;  1COR A;  2ZJS E;  1LTB C;  1SQP J;  3MK7 B;  2WTY A;  1GU4 A;  1NU1 J;  3AE7 C;  3VNW A;  1LP1 B;  1OIP A;  5AW6 B;  4ASV A;  4J20 A;  2RMZ A;  5BU5 A;  2WPR A;  3VMY A;  3CC4 P;  3D6Z A;  1QX8 A;  2G8Y A;  4QAO A;  2OYH C;  1M1J B;  1USE A;  3M97 X;  1S5L V;  4GT1 A;  1NKN A;  2B0Z B;  1DW0 A;  1SP4 A;  3JCU E;  1S5L X;  1NTM E;  3FWN A;  1GK4 A;  5AUR A;  3G6E P;  4H44 B;  2QJP C;  2IZ1 A;  4OGQ B;  3L74 D;  3PP5 A;  1IO3 A;  1GIW A;  1IQC A;  3CWB D;  2IPP A;  3TK1 A;  2AEM A;  2KB7 P;  2Z5I A;  1CRY A;  1LMS A;  2PFX A;  3H32 A;  3RL0 C;  3AE2 C;  1CCR A;  2ZVN B;  1S3J A;  3GHG C;  1KIL B;  1JY3 N;  1K3G A;  3OCD A;  1DVH A;  1HJB A;  5CIB B;  3RK2 B;  3T97 B;  1H0T B;  3KQG A;  1LTJ C;  1SQQ G;  3GG2 A;  2C1V A;  2OYI A;  2R5B A;  5CCG D;  1F1C A;  1NOH A;  2WPV B;  1FDM A;  4YPC A;  4V2K A;  3VP9 A;  2JR8 A;  1GU2 A;  3AE4 C;  1JY2 N;  3CLQ A;  4PV1 C;  1NTZ E;  3MP7 B;  1L0L G;  3Q1M A;  1SQV D;  3WFB C;  2B4Z A;  3M91 A;  4ZKU A;  2C9N Y;  1GDT A;  1XTG B;  2WPS A;  3GLM A;  1JB0 J;  3VMZ A;  4KJM A;  2HOD A;  3V5B A;  2W6A A;  5AW7 B;  3NBT A;  1RZ6 A;  3HD7 C;  1N7S C;  2BCC G;  1FZF A;  1R5L A;  1HJ0 A;  3MD0 A;  1NWQ A;  2P67 A;  1EDJ A;  1DD4 A;  3JCU H;  2FYN B;  3AE3 C;  1L0L J;  4TT3 H;  3L74 G;  4WY4 D;  3Q3D A;  2HYN A;  2B11 B;  4AUW A;  1Y8A A;  3H1H J;  3U1C A;  2ZT9 B;  5AVU B;  155C A;  1C6O A;  3TYY A;  4H13 D;  3CPW O;  2HPC A;  3U1A A;  2V7Q H;  2BCC J;  2I8D A;  1I8P A;  1NTM K;  1YEA A;  2KI7 B;  2IYO A;  2Y0E A;  4N3Y B;  2WSF H;  2R32 A;  1J1E C;  3RN1 A;  1CHI A;  2IBZ I;  2WSC J;  1RAP A;  1K3H A;  5CYT R;  1SQB G;  2O1J A;  3E1I A;  4UB6 V;  2WT7 B;  1GL2 A;  1OVR A;  1YIQ A;  5C39 A;  2OYH A;  4Y99 C;  1VL2 A;  1U75 B;  5CCH C;  3F5H A;  2QM7 A;  3HQ9 A;  1C6S A;  2XND H;  2K9Y A;  1PGJ A;  3CYT I;  3KZI V;  5TJH A;  1ZRT D;  2IBZ D;  2HFE D;  3RK3 B;  4GED B;  3BRV B;  3BCC E;  2KIK A;  2Q3E A;  3P8C E;  1VDF A;  4C46 A;  1SQB J;  1PP9 E;  2B10 B;  1NTZ K;  2YO3 A;  4AYC A;  4D6T E;  2FXM A;  1N2D C;  1LWU C;  1NIR A;  3A0H E;  1BCC J;  1L9J C;  4EYY Q;  4AQR D;  5APT A;  3AEF C;  2E76 C;  1BGY D;  3PTZ A;  1IK7 A;  3H1I E;  3SLE A;  3I5C A;  2CK3 H;  1KB9 I;  1MZ4 A;  1L0N G;  4IL6 E;  3H1K E;  1VYD A;  2C9X B;  1AOQ A;  4RSZ A;  1CCH A;  3B5N B;  5AW3 B;  1FE6 A;  3ORV A;  4N0K A;  2M0B A;  1S6V B;  4YTP C;  4FA4 A;  2N3Y A;  1HZV A;  1KIL E;  2B9B A;  4R4M A;  4OWF A;  3D71 A;  2QG4 A; 
#chains in the Genus database with same CATH homology
 1C6R A;  2L4D A;  4L3G A;  1KB9 D;  1CSV A;  1H33 A;  3TF5 A;  1JDL A;  1H9X A;  1YFC A;  3WFE C;  2V08 A;  3NWV A;  1CHJ A;  5KAI V;  2XTS B;  1I5T A;  1RZ5 A;  2YQB A;  2BLF B;  2BH4 X;  2AIU A;  4FB1 A;  3H1H D;  2VHD A;  1CSW A;  1L0N D;  1QYZ A;  1DT1 A;  3L71 D;  1IRW A;  2GC7 D;  1CTZ A;  2CXB A;  1CNO A;  1LFM A;  2N9Y B;  3ZBM A;  4PWA A;  3RN0 A;  4Q5P A;  5IY5 1;  2BH5 X;  2PAC A;  2YCC A;  3JBT B;  1H33 B;  2GB8 B;  351C A;  3CXH D;  1FJ0 A;  4O1Q A;  1CRC A;  5B6Q A;  5C9M A;  2Y0D A;  1DVV A;  1NTK D;  5B5E V;  4WQC A;  1LC2 A;  1CHH A;  4PJ0 V;  3OA8 A;  3RLM A;  1E8E A;  451C A;  1C75 A;  1RAQ A;  4U3F D;  2LIR A;  1EZV D;  2OZ1 A;  2AI5 A;  4IL6 V;  2FWL A;  1N50 A;  2A06 D;  1CXA A;  1HH7 A;  1FI9 A;  1BE3 D;  1CYJ A;  1DW3 A;  2DVH A;  3ZOW A;  4AAO A;  5C0Z A;  1MG3 D;  3L72 D;  5DF5 A;  4EIC A;  1B7V A;  2BPB B;  1KV9 A;  3DP5 A;  1AYG A;  5E79 V;  1DIQ C;  3WFD C;  2ZXY A;  3VYM A;  3PXW A;  3OA8 B;  1U74 B;  4WQ9 A;  2N9I A;  1CYC A;  5DJQ C;  3O5C A;  3ZOO A;  4Y5R A;  1HJ3 A;  2OZ1 B;  4O1W A;  3RMZ A;  3MK7 C;  1N90 A;  3WC8 A;  2BGV X;  4PD4 D;  1CIF A;  4RJT A;  2D0W A;  3TYI A;  2BCN B;  3DMI A;  3ZOY A;  2QJY B;  3PXT A;  4H0J A;  4AX3 A;  1AOF A;  4YE1 A;  1YNR A;  4L1Q A;  1KYO W;  4WQA A;  1YIC A;  1N9C A;  2Y0C A;  1DII C;  2K9J B;  3PRJ A;  5CIE B;  3WUI A;  3O1Y A;  2JTI B;  1QKS A;  3WFC C;  5KAF V;  4UB8 V;  3PHL A;  1CXC A;  1HRO A;  1ZZH A;  2CA4 B;  2C2C A;  1COT A;  1A8C A;  3WU2 V;  3ITK A;  3A0B V;  4AAL A;  3C2C A;  1ETP A;  2JQR A;  1FI7 A;  3L73 D;  1N15 A;  5B66 V;  1C2R A;  3L4M A;  5DJQ B;  4NFG B;  2KNC B;  1COR A;  1OAE A;  1NNO A;  3MK7 B;  5H2F V;  1H32 B;  1H31 A;  3VNW A;  1KYO D;  1CRG A;  4WQB A;  4J20 A;  2RMZ A;  5KKZ B;  1CIG A;  1SQP D;  1NU1 D;  4DY9 A;  1HZU A;  4QAO A;  2MHM A;  3M97 X;  1S5L V;  2B0Z B;  1DW0 A;  2PCB B;  4AAM A;  1H1O A;  1CC5 A;  1CSX A;  1P84 D;  1YTC A;  5AUR A;  4XYD B;  1NTM D;  3L74 D;  1IO3 A;  1H31 B;  1GIW A;  1IQC A;  3CWB D;  2QG4 A;  2MTA C;  2ZON G;  1CTY A;  1HRC A;  1AKK A;  2KS1 A;  1CRY A;  1LMS A;  3FWL A;  2PCC B;  3HQ7 A;  1NML A;  1PPJ D;  5GTH V;  1SQX D;  5CID B;  1CCR A;  2B12 B;  3HQ8 A;  1K3G A;  1C7M A;  4P4Q B;  3OCD A;  1DVH A;  5CIB B;  1E29 A;  1J3S A;  1HJ5 A;  1L9B C;  3CU4 A;  1CIH A;  2FRC A;  3L70 D;  3GG2 A;  2C1V A;  2C8S A;  3CX5 W;  2LIT A;  1H9Y A;  3GW6 A;  1F1C A;  1DW1 A;  2FYU D;  2C1U A;  1CYI A;  4V2K A;  1C52 A;  1I55 A;  1WEJ F;  1GU2 A;  1KIB A;  1FOC A;  2V07 A;  5CIF B;  3HQ6 A;  1CRJ A;  1GJQ A;  1KX7 A;  1YCC A;  3TDK A;  1SQV D;  5GTI V;  3WFB C;  2B4Z A;  2QJP B;  2DGE A;  1NTZ D;  3OCD B;  3L4O A;  1EB7 A;  3ZIY A;  1CIE A;  1M70 A;  1H32 A;  1I6E A;  1QN2 A;  4EIF A;  1M6Z A;  3H1I D;  5KLV D;  1SQQ D;  3NBT A;  3CX5 D;  1RZ6 A;  3H1K D;  2N3B A;  1QL3 A;  1CRI A;  1I6D A;  4K3I A;  4A7P A;  2FYN B;  1WVE C;  3CXH W;  5DFS A;  4WQ8 A;  4WQ7 A;  1L0L D;  1YEB A;  2B11 B;  4JCG A;  3SXT A;  3H1J D;  155C A;  1C6O A;  4XXL A;  1CED A;  1NMI A;  1CSU A;  1I54 A;  4AAN A;  1A56 A;  2D0S A;  2YK3 A;  4MU8 A;  5CIC B;  1IRV A;  1I8P A;  3H1L D;  1IZL 0;  1YEA A;  2Y0E A;  1FCD C;  2N18 C;  5TIS V;  1BL9 A;  2BCC D;  3RN1 A;  2N9J A;  1R0Q A;  2QJK B;  1CHI A;  2ZOO A;  1CO6 A;  3DR0 A;  1W2L A;  1RAP A;  5KLI B;  4EIE A;  1DW2 A;  3PXS A;  1HCM A;  4FA9 A;  1K3H A;  5CYT R;  4FAN A;  2GC4 D;  1GDV A;  4UB6 V;  1KX2 A;  2O3J A;  1LS9 A;  4WQD A;  4FAV A;  1YIQ A;  3A0H V;  1KB0 A;  1U75 B;  2EXV A;  2ZBO A;  3SWS A;  3ZCF A;  2ORL A;  3HQ9 A;  1CRH A;  5CIH B;  1C6S A;  1FHB A;  4LJI A;  3CYT I;  3KZI V;  5TJH A;  1ZRT D;  2IBZ D;  1MG2 D;  1I8O A;  2RN0 A;  4GED B;  4L3H A;  3CP5 A;  1CTJ A;  3A9F A;  4EDF A;  4KMG A;  2Q3E A;  2AXT V;  4EID A;  1C2N A;  3VRD A;  1GQ1 A;  3BCC D;  2B10 B;  2C1D A;  3X39 A;  1SQB D;  5EXQ A;  2N18 B;  1PP9 D;  2CE1 A;  1NIR A;  3PH2 B;  4D6T D;  1L9J C;  5CIG B;  1M60 A;  2L91 A;  4WQE A;  4FA5 A;  1GKS A;  3SVW A;  1BCC D;  1F1F A;  4GYD A;  1BGY D;  3PTZ A;  1W5C T;  2I8F A;  3SLE A;  4H0K A;  3VMA A;  4FA1 A;  3TGU D;  1MZ4 A;  1QL4 A;  3PLN A;  1OCD A;  1VYD A;  2C9X B;  1AOQ A;  1FI3 A;  4RSZ A;  3NBS A;  1CCH A;  2ZZS 1;  2YIU B;  2C1D B;  3ORV A;  2GIW A;  4PW9 B;  3L75 D;  3KHU A;  4N0K A;  1S6V B;  3O0R C;  4FA4 A;  2N3Y A;  1HZV A;  2HV4 A;  1A2S A;  3O20 A;  3ZOX A;  2CE0 A;  1E2R A;  2CA3 B;  1LC1 A;  2JWA A;  3SJL A;  1HJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...