4U3FD

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4u3fD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4u3fD02
3H1HD 1HZUA 2DGEA 2DVHA 1LC1A 5CIEB 1IZL0 3TGUD 2V08A 2CA4B 4RSZA 4WQAA 1C52A 3PHLA 1NTMD 3MK7B 1CTJA 2FYUD 1N15A 4EIFA 2Y0EA 4L3HA 3C2CA 2I8FA 1A56A 1SQXD 2N18C 2PCCB 1QYZA 3ITKA 3L73D 3M97X 4H0JA 4WQDA 1GDVA 2C1VA 1HJ4A 1NU1D 2C1UA 1MZ4A 2C1DA 3ZOWA 2CE0A 4GEDB 4AALA 1SQBD 1C75A 1H32A 2FRCA 1LMSA 3A0HV 3SXTA 1U74B 1GU2A 1I55A 1SQPD 4LJIA 1CTZA 1BCCD 2RMZA 3WFCC 1KX2A 1AOFA 5E79V 2N9YB 1DVVA 3O5CA 1F1CA 3TF5A 4WQCA 3PRJA 1E2RA 1LFMA 4A7PA 2MTAC 1QKSA 1RAPA 5C0ZA 1HRCA 4K3IA 1CC5A 2QJPB 3WC8A 5CYTR 1K3GA 3PH2B 4WQ8A 3WFBC 1KV9A 1I6DA 4WQ7A 1KB9D 5H2FV 2OZ1B 3CX5D 3KZIV 1E8EA 2ZOOA 1NIRA 1ZRTD 3PTZA 5KKZB 1OCDA 1CIEA 1BL9A 2JQRA 3L4MA 1OAEA 4PJ0V 1ETPA 1HROA 1NTZD 1YEBA 1H33A 5AURA 3O1YA 3H1ID 3L75D 1CIHA 1CCRA 3PLNA 1NNOA 4Q5PA 1YIQA 3H1KD 1CSXA 4RJTA 3WU2V 1SQQD 3PXWA 1L0ND 1MG3D 3L70D 1KIBA 2YIUB 1CXAA 4AAMA 3ZIYA 4FA4A 4PW9B 3JBTB 1C7MA 2LIRA 4O1WA 4N0KA 451CA 2Q3EA 2ZXYA 4EDFA 2L91A 1C6RA 1CHJA 1S6VB 3PXSA 3H1LD 1WEJF 3CP5A 2KNCB 1H31B 1C6OA 2CXBA 2XTSB 3HQ9A 3ZOYA 2BH4X 5KAIV 3MK7C 3H1JD 1CSVA 2BCCD 1CRGA 1E29A 2FWLA 3L72D 5CICB 3TDKA 2D0SA 4IL6V 3KHUA 1CRIA 1RZ5A 2GIWA 3DP5A 3CX5W 3ZOXA 1AOQA 1PPJD 1N50A 1DIQC 1H9YA 4FA5A 1CIFA 2MHMA 3VMAA 1M60A 5C9MA 2K9JB 2BCNB 1GKSA 2BLFB 1DW0A 155CA 1IRWA 4AX3A 1CRCA 2N3BA 3OA8A 3RN1A 3OCDB 1VYDA 3TYIA 3SVWA 1CSUA 2EXVA 1CRJA 1DVHA 1M6ZA 3WFDC 1AKKA 4PD4D 5DJQB 2GB8B 1L0LD 1ZZHA 1COTA 2O3JA 1LC2A 1IO3A 3HQ6A 2AI5A 3X39A 1PP9D 3CXHD 2JWAA 2PACA 3A0BV 1KYOD 3HQ8A 2GC4D 1SQVD 1I6EA 2AXTV 2BH5X 1CO6A 2JTIB 3O0RC 4YE1A 3PXTA 2D0WA 2B12B 2YCCA 1HZVA 1P84D 1L9BC 2B11B 3A9FA 1YFCA 2N9IA 4QAOA 1EB7A 3WUIA 2ORLA 4XXLA 1NTKD 4MU8A 3L4OA 5B6QA 2YQBA 1FI3A 3SLEA 3VYMA 1C6SA 4DY9A 3GW6A 2C1DB 1CYIA 1K3HA 4PWAA 1CEDA 1RAQA 1H32B 5CIFB 2OZ1A 1CYJA 4WQEA 4P4QB 1J3SA 1U75B 1NMIA 2C8SA 2N9JA 1HJ3A 3CU4A 2FYNB 1CYCA 2CE1A 1FHBA 3HQ7A 1FI9A 1CORA 2LITA 5KLIB 3NBTA 1QL3A 2RN0A 3ORVA 1A8CA 5GTHV 4L1QA 4EIEA 2C9XB 1I5TA 5KAFV 2N18B 1DIIC 1DW3A 4O1QA 2KS1A 1GIWA 4J20A 2B4ZA 4H0KA 4WQ9A 2ZONG 5IY51 1CSWA 3CXHW 1LS9A 2B10B 5B5EV 1H9XA 2V07A 4UB6V 4KMGA 3SJLA 2B0ZB 1CTYA 1N9CA 1KYOW 1FI7A 1CRHA 1DT1A 3ZBMA 5CIHB 2VHDA 1FJ0A 1CHIA 2L4DA 1M70A 1MG2D 2BGVX 3SWSA 1L9JC 1W2LA 4UB8V 1DW1A 5TISV 4FAVA 2ZBOA 5B66V 2QJKB 4FANA 1CRYA 1KB0A 1H33B 1HH7A 1N90A 1NMLA 2Y0CA 3VRDA 2GC7D 1RZ6A 1GQ1A 1W5CT 1CHHA 2BPBB 1HCMA 1B7VA 3L74D 3RMZA 1F1FA 3RN0A 3VNWA 4AANA 1EZVD 1GJQA 1H31A 1FOCA 5DJQC 1CCHA 1AYGA 2ZZS1 1H1OA 3BCCD 1IRVA 5CIGB 4GYDA 4FA1A 5EXQA 2PCBB 1BGYD 1KX7A 1WVEC 3ZCFA 3CYTI 1IQCA 3NBSA 1HJ5A 1JDLA 4L3GA 1A2SA 1YNRA 2QG4A 3ZOOA 1CXCA 2QJYB 2Y0DA 5GTIV 3DR0A 1CNOA 2N3YA 2AIUA 1C2NA 5DFSA 3CWBD 1QL4A 2A06D 4EIDA 5CIDB 1R0QA 3OCDA 3FWLA 4FA9A 3RLMA 5CIBB 1C2RA 3WFEC 4AAOA 351CA 4XYDB 4V2KA 2YK3A 1I8OA 4FB1A 1CIGA 4JCGA 3O20A 4WQBA 5KLVD 4NFGB 2HV4A 1I8PA 1I54A 3DMIA 1QN2A 4Y5RA 1YTCA 5TJHA 1YICA 4D6TD 1YEAA 4U3FD 1YCCA 3OA8B 1DW2A 5DF5A 2IBZD 2CA3B 2C2CA 1BE3D 3GG2A 4EICA 1S5LV 3L71D 3NWVA 1FCDC
chains in the Genus database with same CATH superfamily
5BU8B 1PGOA 1VF5B 1X9VA 2PGDA 3JCUH 1HZUA 1JTHA 2DVHA 1LC1A 2FYNC 1P84E 1PGQA 1LWUB 3H1IJ 4JYBA 3CLQA 5APSA 3MK7B 1CTJA 2J59M 2Y0EA 1EDJA 2QSIA 5KLVG 3G9RA 2I8FA 1A56A 2N18C 5EFWB 3M9BA 1RE4A 4WQDA 1GU4A 2E76C 5KLVE 1ZR4A 1WT6A 3AE9C 4PV1C 4UB8E 3RL0D 3CXHH 3ZOWA 4GEDB 5B66E 2Q7CA 1SQBD 2ZYGA 1HVVA 2E74B 3M0DC 3TGUG 1U74B 1I55A 2WVRA 3NTNA 4H44D 3KPEA 4WBAA 2N9YB 1JNMA 3R2PA 3TGUE 4A7PA 1JCCA 5KJ7A 1HRCA 4K3IA 1CC5A 2H89C 3L72J 4IL6H 2M3EA 1K3GA 3PH2B 2SPZA 1KV9A 2YO3A 1I6DA 2WPRA 1SQXE 1FZCA 3RK3B 1KILA 3KZIV 3MP7B 1NIRA 1SQPG 1RQVA 1YIJP 1BL9A 2IZ0A 3L4MA 1OFCX 2E42A 1SQPE 4JF7A 3I5CA 1HROA 2NPSA 2MJZA 3HE5B 3O1YA 3H1ID 1OW7A 2D2CB 5AW9B 4IL6X 4WB4A 4XA4A 4QMAA 3WU2V 2KLVA 1URQB 1QEXA 2ZT9B 2JWDA 3ZIYA 2XDJA 1FJKA 1NKZB 5APUA 4AQRD 2CK3H 1EC5A 3P8CD 2LIRA 4O1WA 3B5NB 1FAVA 1IFMA 2Q3EA 4EI2A 4EDFA 1G1JA 2L91A 1T2KD 2WWWA 3S9OA 2N1TC 1S6VB 1LTJB 1NTZE 3CD6P 2KNCB 3LIDA 3HQ9A 2BH4X 4U3FG 3L72D 2AEJA 2D0SA 1AVOA 1CRIA 2GIWA 4LC1A 1N73B 3CX5W 3ZOXA 1LT9C 1L0LK 1HUCA 4U3FE 1GW3A 1DIQC 1H9YA 1VQPP 1L4AC 1CIFA 2FKWB 3U1AA 2KZJA 5AVQB 2WSFJ 2K9JB 4N6JA 1S4XA 3CC4P 4AX3A 5AVWB 3H1LG 1X8YA 3VMXA 3HTKA 1IK7A 3OCDB 3AE5C 4DCKA 5BVZA 4OGQD 2EXVA 1CRJA 5KAFH 3WFDC 3H1JJ 3H1LE 2GB8B 1COTA 5KTBA 5B5EH 1IO3A 1XTGB 5CCGC 4UB6H 2ZT9D 1OXZA 2AI5A 1PPJG 4U7JA 3QWOC 4KJMA 3AE8C 1S9KD 3SFEC 1KYOD 4MN4C 3HQ8A 1EDIA 2OYIB 3CCSP 4XE5B 5TISH 1PPJE 1XTCC 2JTIB 3V6IA 3GHGA 3U1CA 3VP8A 5AW3B 5KLVK 2B12B 1GL2A 1L0LJ 2E75C 2PP6A 2B11B 2N9IA 1LTTC 4QAOA 2WZ7A 2ORLA 4HJGH 2BEZF 4K35A 1GD2E 4PD4E 1UIXA 2G8YA 1JY2P 1LP1A 1LTAC 3LIEA 3AE2C 1CEDA 1KILD 5H2FH 1UIIA 4KHXA 1HH0A 3TYYA 2W6AA 3Q5SA 1CYJA 1U75B 2ZXEB 1NMIA 2C8SA 2FYNB 3E1IA 1H0TA 3TK1A 1SQXK 5KLIB 4N78D 2WT7B 1U7JA 2YNYA 4L1QA 1YI2P 2C9XB 3G4SP 2N18B 1T3JA 1DIIC 2XNXA 3W67A 2JEEA 2E76B 2OYHC 5KLVJ 1SQPK 4PV1B 2N9BA 1H9XA 2V07A 1ZR2A 4KMGA 1FDIA 1K04A 1VQ5P 1N9CA 2IBZI 1FI7A 3H32B 4RKUJ 3ZBMA 5CIHB 5K5GB 2NRGA 3IAOA 3LW5J 2L4DA 1ZMEC 1J1DC 3CX5H 4DJGA 2K88A 1H33B 1HH7A 1N90A 2Y0CA 3TGUJ 3O6QA 1RZ6A 1GQ1A 2HR3A 1HBWA 2WMMA 1T2KC 2BPBB 1USDA 1B7VA 4JBZA 4R4LA 2HODA 1EZVD 1SQXJ 2KUBA 1GJQA 5KAIH 1FOCA 5DJQC 1CCHA 3BCCD 4ZMDA 1L4AA 1NTZK 1VQKP 4PJ0E 5CBNA 2AXTE 1IQCA 3V2RA 1A2SA 2M5AB 3AE4C 1FOSF 1SQPJ 2HPCA 3CCQP 1IJDB 2Q9IA 5DFSA 3MD0A 3L74G 3A5TA 4EIDA 1QL1A 4OGQC 1H88A 3IFMA 4GOEA 1KB9I 2WSFH 3II6A 4C7NA 2E76D 3L74E 1I8OA 4FB1A 5KLVD 1RE4C 2HV4A 2WQYC 1I8PA 3KZIH 4GT1A 3DMIA 4Y5RA 1SVFA 1YTCA 1OMIA 1KQSO 4YXDC 1KMIZ 3A0BH 4I1LA 3EFGA 4ZKUA 3K5BA 5DF5A 1KQLA 2G3AA 2N1TB 1JEKA 1FCDC 1GZLA 1KD1Q 1GL2D 1NTZJ 3TGUD 4RSZA 1AQTA 1MZ9A 4EIFA 4L3HA 1KFMA 3F5HA 3WU2H 1E5WA 3C2CA 3VP9A 5KJ7C 2FY8A 2WPSA 1SQXD 1LT9B 1RHZB 2K3RA 1JMBA 4U3FJ 1M1JC 3M9HA 1W2BO 3VOPA 2C1UA 2JR8A 4I2LC 5AW1B 3CCMP 4AALA 2HYNA 3RBZA 3L71G 2FRCA 2W6JH 3G3ZA 1FE6A 3SXTA 1GU2A 1SQPD 1VDFA 2RMZA 1NTMG 5AVVB 3BRVB 2IBZE 2KIKA 1AOFA 4BWNA 2FYUG 1DVVA 2B87A 3H1LJ 3L71E 5C39A 3RK2C 3GLMA 3PRJA 2NPSC 5GTHH 4BRYA 1LFMA 2HG5D 3HD7A 1FZAA 1NTME 1QKSA 3JSVC 1P84H 1RAPA 5C0ZA 1SP4A 2FYUE 1JCDA 2QJPB 3WC8A 5CYTR 1R5LA 3C9IA 5H2FV 3RL0B 1T8ZA 2H88C 1KZUB 5AVYB 4HYTB 1NU1E 1BCCG 3KXDA 1OCDA 3VYIA 1CIEA 2N1TD 2E75B 1ZOYC 3F89A 1QGKB 5B66H 4PJ0V 1EZVG 1BCCE 1NTZD 3S1KA 3L37A 2KS1B 5AURA 3LW5H 4RESB 3BCCG 3CXHI 2QVAA 3PLNA 1FJPA 1NNOA 1YIQA 1T6AA 1CSXA 2I8DA 5CBOA 2A45G 1MG3D 2IDBA 1JMMA 3BCCE 2FXOA 1KIBA 2KYVA 1L4AD 1LGHB 2YKPA 1X0TA 1KB9E 1S5LE 4RO0A 1G2CA 1GU5A 1ZRTE 2DW3A 4N0KA 451CA 1RH5B 3MIWA 2O01J 1LTBC 1BSHA 1NAYA 3H25A 4I6MC 4B86A 3PXSA 2KK7A 3H1LD 3CL3D 5CCGD 2OYHB 3CP5A 1LTIC 2Q3IA 2Y9YA 2CXBA 1OZHA 5KAIV 5L8RJ 1CSVA 2R3SA 1CRGA 1E29A 5CICB 3TDKA 3M91A 3KHUA 1RZ5A 1OVUA 1NWQA 3L70E 2W27A 1PPJD 1J1DB 3L36A 2YKQA 3A0HE 1NAFA 5CJ4A 4FA5A 1GKSA 2E75D 2BLFB 1DW0A 1CRCA 2N3BA 3GHGC 3OA8A 3RN1A 3TYIA 1SQXG 1GL2C 4DZOA 2ZVOB 1GK6A 4PD4D 5DJQB 1M1JA 2O3JA 4I7ZB 5APXA 3HUSA 2KSJA 1LTJA 3USSA 1N7LA 2IFMA 1S72P 2K37A 4GODA 4IFMA 3A0BV 3SWYA 4H13D 2GC4D 1I6EA 1SLQA 2Q6QA 1N73A 1JTHB 1QX8A 2WSEJ 3JCUE 3V2PA 4OGQB 3O0RC 1N7SA 5AVZB 1FDMA 3PP5A 3PXTA 2D0WA 1IFIA 2WITA 5AW6B 3G6EP 2QM8A 1HZVA 1NO4A 1L9BC 1FZEA 1VQLP 3L74J 3HD7D 1WRGA 4XXLA 2YO2A 2ZYAA 4MU8A 5B6QA 1FOSE 2WSSH 3KQGA 3T97A 3VYMA 2H43A 3C1LA 1SQVG 1CZQA 3VN0A 4PWAA 5CHXA 2H7HA 3CXHE 1RAQA 1NTMK 1K8AQ 2OZ1A 2YIUC 2FYUK 1LT1A 1NTZG 2KSEA 4P4QB 1SQVE 2M3BA 1CYCA 1S2EA 1FHBA 1LTSC 1VQ9P 2LITA 2B89A 2RH0A 3NBTA 1QL3A 3ORVA 1NTKG 5GTHV 1NU1K 1VPCA 2XKMA 4EIEA 4NPDA 1S3JA 2IPPA 1DW3A 4IL6E 2B4ZA 2V4HA 1NTKE 4H0KA 2R5DA 4IFFA 2LKMA 2ZONG 1CSWA 1KV4A 1FZCB 1KILB 4C46A 2I1KA 1CTYA 1MFTA 5DJUB 1DH3A 1KYOW 4PD4H 1DT1A 2B9BA 4OH8B 2AEMA 1FJ0A 3V4WA 4UB8V 3L71J 3W68A 2ZBOA 3IF4A 5B66V 2QJKB 1CRYA 3RK2B 3Q5RA 2NPSB 3VRDA 1HGVA 3Q2YA 1NTMJ 3M06A 5AVSB 2IFNA 1BDDA 3A3YB 3PJSK 2FYUJ 5AVTB 1HCMA 3L74D 5BU5A 2Q1KA 2E5YA 1QLED 1F1FA 3RN0A 1JO5A 1HWTC 3D6ZA 1DEEG 1H31A 4GDOA 1YTZI 1H1OA 1NU1J 5CIGB 4GYDA 3G71P 2PCBB 2ZJSE 3MZWB 4HKZH 3SSUA 1NHLA 1FZBA 3NBSA 1JDLA 4L3GA 1ZLLA 1IFJA 1BCCJ 1HTLC 3A2AA 2ZVNB 3MTUE 3DR0A 2R44A 2N3YA 3UIAA 2HFED 4WY4A 4IOIH 5KJ7D 3C8VA 3MUDA 1OIPA 4FA9A 3RLMA 5CIBB 2P2UA 1FC2C 4XYDB 1PGJA 4JPZB 3BCCJ 1YITP 3CX5I 3O20A 1BGYG 3GF7A 4EIJA 4NFGB 4JQ0D 1JY2N 1YICA 3B4SA 3QH9A 4H13C 1YCCA 1BGYE 3CCEP 3HTKB 2Z5IA 1DW2A 3OA7A 1AFOA 2IBZD 2CA3B 3CWBG 3RK2D 2C2CA 2YMYA 4PJ0H 2NPSD 2AXTH 1N7SD 4NPFX 3L71D 3NWVA 3V5BA 2DGEA 5KAFE 5CIEB 1IK9A 2V08A 4HB1A 2CA4B 4WQAA 3PHLA 1NTMD 1DIPA 3CWBE 2AXCA 1IFNA 2FYUD 1N15A 4YPCA 1PFIA 3HD7C 1VF5C 4UB6E 2K9YA 1JY3O 2PCCB 1FDOA 3L70J 1MUUA 3M97X 2I1JA 4Y99C 4D6TG 1GDVA 2C1VA 1NU1D 4Z1MH 5TISE 2C1DA 1BE3G 2CE0A 1AA0A 3GHGB 1H32A 4ZNCA 4D6TE 2FFDA 3H1HG 1LMSA 1KYOH 2JJLA 1GL2B 2OARA 2R5BA 4LJIA 1CTZA 1BCCD 1KX2A 1BE3E 1AV1A 3O5CA 1YJWP 2Y9ZA 3H1HE 2WSCJ 4ASWA 3IN6A 1GW4A 1SQVK 3IR9A 2QIWA 2MTAC 3L73G 2JP3A 2VRSA 1LP1B 4WQ8A 3WFBC 5AW8B 1SFCA 3CMEP 1KB9D 1AJYA 3L73E 2W8ZA 2ZOOA 4OVNF 1H0TB 2POHA 1ZRTD 3PTZA 3EWKA 1NTKK 1N86A 1QVFO 2KI7B 3B71A 3RK3E 2O1JA 2JDIH 1OAEA 2L5GB 3AE3C 2QEXP 4AYCA 2QJYC 3HE4A 2FXPA 1CIHA 3GF3A 1CCRA 3VTPC 4Q5PA 1K05A 1EDLA 4RJTA 4N3YB 3D6YA 1JB0J 1FU1A 3L70D 2P1JA 2YIUB 1IO4A 1CXAA 1YQ3C 3HRNA 1CSBA 2M8RA 4FA4A 1MV8A 1RF1A 1SQVJ 1CI6A 4PW9B 3JBTB 2KP8A 2QM7A 1EXJA 3CX5E 1P84I 5APWA 1URQC 3O6QB 2ZXYA 3P7KA 1OW6A 5AW7B 1J1EC 3P32A 3L75G 3BVHA 1JUNA 4YTPC 1CHJA 3GMAA 1R5SA 2HODB 3CC7P 3TNUA 1IFDA 2QA4P 1K73Q 1WEJF 1NTKJ 1SQQG 1L0NG 3L75E 2ZFCA 3ZOYA 3WMM0 2YMKA 1VQOP 5APQA 3AEEC 3H1KE 2FWLA 1L4AB 3HUSC 3DP5A 1LTJC 2IBZG 1SQQE 4EYYQ 2GUVA 1L0NE 1AOQA 4GIFA 1N50A 2HPCB 1YJNP 1PL5A 1M60A 1IRWA 1N73C 1NYHA 2NZ2A 2A45H 1VYDA 1N7SC 1AQ5A 3SVWA 1CSUA 1DVHA 2IZ1A 1M6ZA 4C7NB 1AKKA 2RKLA 1LWUA 2BCCG 1NU1G 1ZZHA 3CCRP 4W80A 3HQ6A 2WPQA 3KZIE 3X39A 2JWAA 3CXHD 1ZW0A 2BCCE 5GTIE 1JOCA 1SQVD 3AEFC 4UB8H 2C9LY 1MFZA 2AXTV 1BDCA 2IYPA 2E43A 3BRTB 4YE1A 5KKZC 2LXBA 3AE7C 2M0BA 3NFQA 5CCHA 1K9MQ 2C0WA 3WUIA 3WU2E 2JKVA 1NTKD 1PP9G 2YQBA 1M90Q 2ZYDA 1FI3A 1IZNB 1Q7YQ 1R8EA 4L74A 1NGMB 4DY9A 3GW6A 2WSCH 1CYIA 1K3HA 4H13B 1BGYJ 1PP9E 3D70A 5CIFB 2J58A 4WWIA 3CU4A 2B88A 1RF0A 1NH4A 2CE1A 3D0WA 2R3CA 1FI9A 3V4QA 3CWBJ 1D7MA 4BRYB 3M9QA 2RN0A 2LXCB 1H89A 3HD7B 1A8CA 1LTGC 5APVA 5CJ0A 3L70G 1I5TA 1USEA 3OW2O 3HE5A 4Y99B 1GIWA 5KLIC 4J20A 1Q82Q 4WQ9A 5AVXB 1LS9A 2B10B 2W6BA 4HH2A 1KORA 4D6TJ 1URQA 2BEQD 3KDPB 1N8RQ 4K3AA 3Q3DA 5E79E 4JYCA 1CHIA 1M70A 2BGVX 1L9JC 3D71A 1BE3J 4L73A 4FAVA 3V2NA 3H1HJ 1KB0A 3B5NA 3P8MC 3RL0g 3Q1MA 4WY4C 1E79H 1GTWA 1CHHA 1X22A 3MUDC 3FWNA 1A02F 4H0LC 3R4YA 3RMZA 4OWFA 1YYCA 1ZXGA 2KNCA 3L73J 1FZFA 5M1BA 1AYGA 1X79B 1NKNA 5APTA 4ASVA 1IRVA 2W83C 1Z56A 4FA1A 1A02J 1KC8Q 1BGYD 1KX7A 2Z5HA 1G2CB 3ZCFA 3CYTI 1HJ5A 3AECC 4XFJA 2QG4A 1KTMA 1HJBA 2QJYB 2Y0DA 1SQQK 5GTIV 1PGPA 1L0NK 2K9JA 1M7LA 1C2NA 3CWBD 1Y9BA 1QL4A 1VF5D 2PAJA 4PD4I 1R0QA 3OCDA 1NJIQ 2Q5UA 3EQ2A 1C2RA 3WFEC 351CA 1VQMP 2YK3A 2QE7H 1W5CE 2JO1A 4WQBA 1OX3A 2OTKE 3AE6C 3E1RA 1VQ4P 1DD3A 5TJHA 2YKOA 4D6TD 1YEAA 4DT0A 1Q86Q 1J1EB 3OA8B 1Q2NA 2FFDC 1RE3A 2OYIA 1BE3D 3GG2A 2A06G 4EICA 3B8EB 1S5LV 2E74D 4GOFA 3M0AA 3H1HD 3CCJP 1IZL0 2OGUA 2O01N 5CCHD 2WPVB 1C52A 1ZV8A 1M1JB 3L75J 1QVGO 2E5TA 2ZAEB 2LR2A 2A06E 3H1KJ 3HUSB 1OW8A 1Q81Q 2FXMA 1S1CX 1JM0A 1SQQJ 1L0NJ 3TSIA 1QYZA 3ITKA 3L73D 1HJ0A 4H0JA 1SFCC 3WUUA 1YTZT 1PZQA 1HJ4A 3BATA 1MZ4A 3FGAD 3RK3D 3N4XA 1C75A 3BASA 2PRRA 2PFXA 1N7SB 3V2QA 3A0HV 3VMYA 3WFCC 1GDTA 1DEBA 1JY2O 2P58A 5E79V 1F1CA 3OAKA 5APYA 3TF5A 4WQCA 1M56D 1Y8AA 2MKVA 1E2RA 2CPBA 2WT7A 2OQQA 2O01H 3U59A 4EOTA 3T97B 3WUVA 2BCCJ 2D2CD 4WQ7A 3ZDMA 2QRXA 2OZ1B 1URQD 1SQBG 3CMAP 1M57D 1J2JB 1RQUA 4L75A 3CX5D 1E8EA 1ZN5A 1RF1C 2QJPC 3H32A 5KKZB 3M0DA 2JQRA 5AW0B 1SQBE 4ZKPA 3RL0C 3B5ND 1ETPA 1YEBA 1H33A 4O9BA 2AEFA 4AUWA 2H8PD 3ABVC 3L75D 4H44C 3H1KD 4M3LA 3O8ZA 1KYOI 1SQQD 3FXEA 1PP9J 3SWFA 1W2EA 3PXWA 1L0ND 1TU3F 2KB7P 2P67A 4AAMA 3AEGC 4KT0J 1OVRA 2K1AA 1C7MA 2KXPB 1IC2A 2V7QJ 2OTJP 1VQ8P 2M5AA 3A7OA 2Z4EA 3H1IG 3I55P 3S4RA 1C6RA 1N2DC 3AEDC 5B5EE 2WSEH 1KQFB 3N7NA 4LLHA 3SFDC 4TLFA 2KZIA 1VQNP 1LWUC 3KYQA 4W7YA 1H31B 1C6OA 3H1IE 2XTSB 3MK7C 3H1JD 3AEAC 2BCCD 4IL6V 1EQ7A 3L35A 2HLOA 2CPSA 2KOGA 1KQGB 1LJ2A 2MHMA 3VMAA 5C9MA 1U7MA 2BCNB 4WY4B 155CA 1VQ7P 3P8CE 4YXWH 4H0LB 2ZXXA 2E74C 2W90A 2N1TA 4R4MA 3CI9A 3EFFK 1KFNA 4TT3H 5CCHC 2UWJE 3L72G 1L0LD 1EDKA 2XZRA 1LC2A 1IFPA 5H2FE 3MHVA 1M8OB 2WTYA 1PP9D 1NVOA 4DOJA 3L72E 1LT9A 2PACA 3L4FA 4I7ZC 1EXIA 4Y28J 1DX7A 1JY3P 4WVZA 3RK3C 2ITAA 4IFDK 2BH5X 1CO6A 1T3UA 1RF0C 4LGDE 1OWAA 3H6PA 2YCCA 1EZVI 2XNDH 1P84D 1JY3N 2IYOA 3A9FA 1YFCA 1EB7A 3MGNA 3CC2P 1YBKA 3L4OA 5CCGA 3SLEA 3CCLP 3AE1C 1FBMA 2D2CC 1C6SA 1GK4A 2A45I 3Q5PA 2C1DB 4PV1D 1H32B 2FFDB 2FBWC 2ZT9C 2P7JA 1S9KE 1WMKA 4WQEA 1KYOE 2O1KA 1J3SA 2OYOA 2N9JA 4WY4D 1HJ3A 3PH0A 5GTIH 1OVVA 3AEBC 2P10A 3HQ7A 4NPEA 1CORA 4H0LD 3H1KG 1LNQA 3B5NC 1KN7A 5KAIE 5KAFV 2XV5A 2GA1A 4W7ZA 4CPGA 1U57A 4L76A 4O1QA 5AW5B 1SQBK 2KS1A 5DJTB 1SFCB 5IY51 3CXHW 5B5EV 4UB6V 3SJLA 2B0ZB 5CMZA 1CRHA 2GM4A 1Q90D 2VHDA 1VL2A 1KILE 1KB9H 1G1IA 1MG2D 3SWSA 1FZCC 1W2LA 1KILC 5TISV 1DW1A 1S5LH 2FYZA 4FANA 1ZP0C 1BSNA 1NMLA 3NMDA 3HE4B 3CCUP 2GC7D 3H1JG 3WUTA 1YQ4C 1W5CT 1M1KQ 3RBXA 4N78E 2QJKC 2YXRB 3FXDA 2V7QH 3VNWA 4AANA 3H1JE 2OYHA 2KLUA 2GUSA 3OJAB 5AW2B 3A0BE 1MKMA 1DD4A 1GMJA 2YXQB 1RF1B 2ZZS1 3JC22 4BXLA 1CI6B 3CCVP 3RGUA 5EXQA 1Y47A 3SWKA 2C9NY 1SS1A 1SQBJ 1WVEC 3VMZA 1S5LX 3A0HH 1YNRA 3CPWO 3ZOOA 1L2PA 1AVYA 5AVUB 1CXCA 1RE3C 2OYIC 1CW5A 5E79H 1CNOA 1L0LG 1RY3A 4H44B 3TNUB 2AIUA 2XU6A 2A06D 3NXSA 5CIDB 1H8AA 1PV3A 3FWLA 5AVRB 2C0XA 1HF9A 3FX0A 1L0LE 2J5UA 4AAOA 1SFCD 4V2KA 1YHQP 3I56P 1PIXA 1CIGA 1VQ6P 4JCGA 1FZGA 1YJ9P 1EZVE 1HGZA 2R32A 2IX7C 4GKGA 1I54A 1QN2A 2BASA 5AW4B 1NOHA 4U3FD 2OTLP 1FS0E 2B87B 4C7RA 3E7KA 1QL2A 5GTHE
chains in the Genus database with same CATH topology
3H1HD 1HZUA 2DGEA 2DVHA 1LC1A 5CIEB 1IZL0 3TGUD 2V08A 2CA4B 4RSZA 4WQAA 1C52A 3PHLA 1NTMD 3MK7B 1CTJA 2FYUD 1N15A 4EIFA 2Y0EA 4L3HA 3C2CA 2I8FA 1A56A 1SQXD 2N18C 2PCCB 1QYZA 3ITKA 3L73D 3M97X 4H0JA 4WQDA 1GDVA 2C1VA 1HJ4A 1NU1D 2C1UA 1MZ4A 2C1DA 3ZOWA 2CE0A 4GEDB 4AALA 1SQBD 1C75A 1H32A 2FRCA 1LMSA 3A0HV 3SXTA 1U74B 1GU2A 1I55A 1SQPD 4LJIA 1CTZA 1BCCD 2RMZA 3WFCC 1KX2A 1AOFA 5E79V 2N9YB 1DVVA 3O5CA 1F1CA 3TF5A 4WQCA 3PRJA 1E2RA 1LFMA 4A7PA 2MTAC 1QKSA 1RAPA 5C0ZA 1HRCA 4K3IA 1CC5A 2QJPB 3WC8A 5CYTR 1K3GA 3PH2B 4WQ8A 3WFBC 1KV9A 1I6DA 4WQ7A 1KB9D 5H2FV 2OZ1B 3CX5D 3KZIV 1E8EA 2ZOOA 1NIRA 1ZRTD 3PTZA 5KKZB 1OCDA 1CIEA 1BL9A 2JQRA 3L4MA 1OAEA 4PJ0V 1ETPA 1HROA 1NTZD 1YEBA 1H33A 5AURA 3O1YA 3H1ID 3L75D 1CIHA 1CCRA 3PLNA 1NNOA 4Q5PA 1YIQA 3H1KD 1CSXA 4RJTA 3WU2V 1SQQD 3PXWA 1L0ND 1MG3D 3L70D 1KIBA 2YIUB 1CXAA 4AAMA 3ZIYA 4FA4A 4PW9B 3JBTB 1C7MA 2LIRA 4O1WA 4N0KA 451CA 2Q3EA 2ZXYA 4EDFA 2L91A 1C6RA 1CHJA 1S6VB 3PXSA 3H1LD 1WEJF 3CP5A 2KNCB 1H31B 1C6OA 2CXBA 2XTSB 3HQ9A 3ZOYA 2BH4X 5KAIV 3MK7C 3H1JD 1CSVA 2BCCD 1CRGA 1E29A 2FWLA 3L72D 5CICB 3TDKA 2D0SA 4IL6V 3KHUA 1CRIA 1RZ5A 2GIWA 3DP5A 3CX5W 3ZOXA 1AOQA 1PPJD 1N50A 1DIQC 1H9YA 4FA5A 1CIFA 2MHMA 3VMAA 1M60A 5C9MA 2K9JB 2BCNB 1GKSA 2BLFB 1DW0A 155CA 1IRWA 4AX3A 1CRCA 2N3BA 3OA8A 3RN1A 3OCDB 1VYDA 3TYIA 3SVWA 1CSUA 2EXVA 1CRJA 1DVHA 1M6ZA 3WFDC 1AKKA 4PD4D 5DJQB 2GB8B 1L0LD 1ZZHA 1COTA 2O3JA 1LC2A 1IO3A 3HQ6A 2AI5A 3X39A 1PP9D 3CXHD 2JWAA 2PACA 3A0BV 1KYOD 3HQ8A 2GC4D 1SQVD 1I6EA 2AXTV 2BH5X 1CO6A 2JTIB 3O0RC 4YE1A 3PXTA 2D0WA 2B12B 2YCCA 1HZVA 1P84D 1L9BC 2B11B 3A9FA 1YFCA 2N9IA 4QAOA 1EB7A 3WUIA 2ORLA 4XXLA 1NTKD 4MU8A 3L4OA 5B6QA 2YQBA 1FI3A 3SLEA 3VYMA 1C6SA 4DY9A 3GW6A 2C1DB 1CYIA 1K3HA 4PWAA 1CEDA 1RAQA 1H32B 5CIFB 2OZ1A 1CYJA 4WQEA 4P4QB 1J3SA 1U75B 1NMIA 2C8SA 2N9JA 1HJ3A 3CU4A 2FYNB 1CYCA 2CE1A 1FHBA 3HQ7A 1FI9A 1CORA 2LITA 5KLIB 3NBTA 1QL3A 2RN0A 3ORVA 1A8CA 5GTHV 4L1QA 4EIEA 2C9XB 1I5TA 5KAFV 2N18B 1DIIC 1DW3A 4O1QA 2KS1A 1GIWA 4J20A 2B4ZA 4H0KA 4WQ9A 2ZONG 5IY51 1CSWA 3CXHW 1LS9A 2B10B 5B5EV 1H9XA 2V07A 4UB6V 4KMGA 3SJLA 2B0ZB 1CTYA 1N9CA 1KYOW 1FI7A 1CRHA 1DT1A 3ZBMA 5CIHB 2VHDA 1FJ0A 1CHIA 2L4DA 1M70A 1MG2D 2BGVX 3SWSA 1L9JC 1W2LA 4UB8V 1DW1A 5TISV 4FAVA 2ZBOA 5B66V 2QJKB 4FANA 1CRYA 1KB0A 1H33B 1HH7A 1N90A 1NMLA 2Y0CA 3VRDA 2GC7D 1RZ6A 1GQ1A 1W5CT 1CHHA 2BPBB 1HCMA 1B7VA 3L74D 3RMZA 1F1FA 3RN0A 3VNWA 4AANA 1EZVD 1GJQA 1H31A 1FOCA 5DJQC 1CCHA 1AYGA 2ZZS1 1H1OA 3BCCD 1IRVA 5CIGB 4GYDA 4FA1A 5EXQA 2PCBB 1BGYD 1KX7A 1WVEC 3ZCFA 3CYTI 1IQCA 3NBSA 1HJ5A 1JDLA 4L3GA 1A2SA 1YNRA 2QG4A 3ZOOA 1CXCA 2QJYB 2Y0DA 5GTIV 3DR0A 1CNOA 2N3YA 2AIUA 1C2NA 5DFSA 3CWBD 1QL4A 2A06D 4EIDA 5CIDB 1R0QA 3OCDA 3FWLA 4FA9A 3RLMA 5CIBB 1C2RA 3WFEC 4AAOA 351CA 4XYDB 4V2KA 2YK3A 1I8OA 4FB1A 1CIGA 4JCGA 3O20A 4WQBA 5KLVD 4NFGB 2HV4A 1I8PA 1I54A 3DMIA 1QN2A 4Y5RA 1YTCA 5TJHA 1YICA 4D6TD 1YEAA 4U3FD 1YCCA 3OA8B 1DW2A 5DF5A 2IBZD 2CA3B 2C2CA 1BE3D 3GG2A 4EICA 1S5LV 3L71D 3NWVA 1FCDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H D;  1HZU A;  2DGE A;  2DVH A;  1LC1 A;  5CIE B;  1IZL 0;  3TGU D;  2V08 A;  2CA4 B;  4RSZ A;  4WQA A;  1C52 A;  3PHL A;  1NTM D;  3MK7 B;  1CTJ A;  2FYU D;  1N15 A;  4EIF A;  2Y0E A;  4L3H A;  3C2C A;  2I8F A;  1A56 A;  1SQX D;  2N18 C;  2PCC B;  1QYZ A;  3ITK A;  3L73 D;  3M97 X;  4H0J A;  4WQD A;  1GDV A;  2C1V A;  1HJ4 A;  1NU1 D;  2C1U A;  1MZ4 A;  2C1D A;  3ZOW A;  2CE0 A;  4GED B;  4AAL A;  1SQB D;  1C75 A;  1H32 A;  2FRC A;  1LMS A;  3A0H V;  3SXT A;  1U74 B;  1GU2 A;  1I55 A;  1SQP D;  4LJI A;  1CTZ A;  1BCC D;  2RMZ A;  3WFC C;  1KX2 A;  1AOF A;  5E79 V;  2N9Y B;  1DVV A;  3O5C A;  1F1C A;  3TF5 A;  4WQC A;  3PRJ A;  1E2R A;  1LFM A;  4A7P A;  2MTA C;  1QKS A;  1RAP A;  5C0Z A;  1HRC A;  4K3I A;  1CC5 A;  2QJP B;  3WC8 A;  5CYT R;  1K3G A;  3PH2 B;  4WQ8 A;  3WFB C;  1KV9 A;  1I6D A;  4WQ7 A;  1KB9 D;  5H2F V;  2OZ1 B;  3CX5 D;  3KZI V;  1E8E A;  2ZOO A;  1NIR A;  1ZRT D;  3PTZ A;  5KKZ B;  1OCD A;  1CIE A;  1BL9 A;  2JQR A;  3L4M A;  1OAE A;  4PJ0 V;  1ETP A;  1HRO A;  1NTZ D;  1YEB A;  1H33 A;  5AUR A;  3O1Y A;  3H1I D;  3L75 D;  1CIH A;  1CCR A;  3PLN A;  1NNO A;  4Q5P A;  1YIQ A;  3H1K D;  1CSX A;  4RJT A;  3WU2 V;  1SQQ D;  3PXW A;  1L0N D;  1MG3 D;  3L70 D;  1KIB A;  2YIU B;  1CXA A;  4AAM A;  3ZIY A;  4FA4 A;  4PW9 B;  3JBT B;  1C7M A;  2LIR A;  4O1W A;  4N0K A;  451C A;  2Q3E A;  2ZXY A;  4EDF A;  2L91 A;  1C6R A;  1CHJ A;  1S6V B;  3PXS A;  3H1L D;  1WEJ F;  3CP5 A;  2KNC B;  1H31 B;  1C6O A;  2CXB A;  2XTS B;  3HQ9 A;  3ZOY A;  2BH4 X;  5KAI V;  3MK7 C;  3H1J D;  1CSV A;  2BCC D;  1CRG A;  1E29 A;  2FWL A;  3L72 D;  5CIC B;  3TDK A;  2D0S A;  4IL6 V;  3KHU A;  1CRI A;  1RZ5 A;  2GIW A;  3DP5 A;  3CX5 W;  3ZOX A;  1AOQ A;  1PPJ D;  1N50 A;  1DIQ C;  1H9Y A;  4FA5 A;  1CIF A;  2MHM A;  3VMA A;  1M60 A;  5C9M A;  2K9J B;  2BCN B;  1GKS A;  2BLF B;  1DW0 A;  155C A;  1IRW A;  4AX3 A;  1CRC A;  2N3B A;  3OA8 A;  3RN1 A;  3OCD B;  1VYD A;  3TYI A;  3SVW A;  1CSU A;  2EXV A;  1CRJ A;  1DVH A;  1M6Z A;  3WFD C;  1AKK A;  4PD4 D;  5DJQ B;  2GB8 B;  1L0L D;  1ZZH A;  1COT A;  2O3J A;  1LC2 A;  1IO3 A;  3HQ6 A;  2AI5 A;  3X39 A;  1PP9 D;  3CXH D;  2JWA A;  2PAC A;  3A0B V;  1KYO D;  3HQ8 A;  2GC4 D;  1SQV D;  1I6E A;  2AXT V;  2BH5 X;  1CO6 A;  2JTI B;  3O0R C;  4YE1 A;  3PXT A;  2D0W A;  2B12 B;  2YCC A;  1HZV A;  1P84 D;  1L9B C;  2B11 B;  3A9F A;  1YFC A;  2N9I A;  4QAO A;  1EB7 A;  3WUI A;  2ORL A;  4XXL A;  1NTK D;  4MU8 A;  3L4O A;  5B6Q A;  2YQB A;  1FI3 A;  3SLE A;  3VYM A;  1C6S A;  4DY9 A;  3GW6 A;  2C1D B;  1CYI A;  1K3H A;  4PWA A;  1CED A;  1RAQ A;  1H32 B;  5CIF B;  2OZ1 A;  1CYJ A;  4WQE A;  4P4Q B;  1J3S A;  1U75 B;  1NMI A;  2C8S A;  2N9J A;  1HJ3 A;  3CU4 A;  2FYN B;  1CYC A;  2CE1 A;  1FHB A;  3HQ7 A;  1FI9 A;  1COR A;  2LIT A;  5KLI B;  3NBT A;  1QL3 A;  2RN0 A;  3ORV A;  1A8C A;  5GTH V;  4L1Q A;  4EIE A;  2C9X B;  1I5T A;  5KAF V;  2N18 B;  1DII C;  1DW3 A;  4O1Q A;  2KS1 A;  1GIW A;  4J20 A;  2B4Z A;  4H0K A;  4WQ9 A;  2ZON G;  5IY5 1;  1CSW A;  3CXH W;  1LS9 A;  2B10 B;  5B5E V;  1H9X A;  2V07 A;  4UB6 V;  4KMG A;  3SJL A;  2B0Z B;  1CTY A;  1N9C A;  1KYO W;  1FI7 A;  1CRH A;  1DT1 A;  3ZBM A;  5CIH B;  2VHD A;  1FJ0 A;  1CHI A;  2L4D A;  1M70 A;  1MG2 D;  2BGV X;  3SWS A;  1L9J C;  1W2L A;  4UB8 V;  1DW1 A;  5TIS V;  4FAV A;  2ZBO A;  5B66 V;  2QJK B;  4FAN A;  1CRY A;  1KB0 A;  1H33 B;  1HH7 A;  1N90 A;  1NML A;  2Y0C A;  3VRD A;  2GC7 D;  1RZ6 A;  1GQ1 A;  1W5C T;  1CHH A;  2BPB B;  1HCM A;  1B7V A;  3L74 D;  3RMZ A;  1F1F A;  3RN0 A;  3VNW A;  4AAN A;  1EZV D;  1GJQ A;  1H31 A;  1FOC A;  5DJQ C;  1CCH A;  1AYG A;  2ZZS 1;  1H1O A;  3BCC D;  1IRV A;  5CIG B;  4GYD A;  4FA1 A;  5EXQ A;  2PCB B;  1BGY D;  1KX7 A;  1WVE C;  3ZCF A;  3CYT I;  1IQC A;  3NBS A;  1HJ5 A;  1JDL A;  4L3G A;  1A2S A;  1YNR A;  2QG4 A;  3ZOO A;  1CXC A;  2QJY B;  2Y0D A;  5GTI V;  3DR0 A;  1CNO A;  2N3Y A;  2AIU A;  1C2N A;  5DFS A;  3CWB D;  1QL4 A;  2A06 D;  4EID A;  5CID B;  1R0Q A;  3OCD A;  3FWL A;  4FA9 A;  3RLM A;  5CIB B;  1C2R A;  3WFE C;  4AAO A;  351C A;  4XYD B;  4V2K A;  2YK3 A;  1I8O A;  4FB1 A;  1CIG A;  4JCG A;  3O20 A;  4WQB A;  5KLV D;  4NFG B;  2HV4 A;  1I8P A;  1I54 A;  3DMI A;  1QN2 A;  4Y5R A;  1YTC A;  5TJH A;  1YIC A;  4D6T D;  1YEA A;  4U3F D;  1YCC A;  3OA8 B;  1DW2 A;  5DF5 A;  2IBZ D;  2CA3 B;  2C2C A;  1BE3 D;  3GG2 A;  4EIC A;  1S5L V;  3L71 D;  3NWV A;  1FCD C; 
#chains in the Genus database with same CATH topology
 5BU8 B;  1PGO A;  1VF5 B;  1X9V A;  2PGD A;  3JCU H;  1HZU A;  1JTH A;  2DVH A;  1LC1 A;  2FYN C;  1P84 E;  1PGQ A;  1LWU B;  3H1I J;  4JYB A;  3CLQ A;  5APS A;  3MK7 B;  1CTJ A;  2J59 M;  2Y0E A;  1EDJ A;  2QSI A;  5KLV G;  3G9R A;  2I8F A;  1A56 A;  2N18 C;  5EFW B;  3M9B A;  1RE4 A;  4WQD A;  1GU4 A;  2E76 C;  5KLV E;  1ZR4 A;  1WT6 A;  3AE9 C;  4PV1 C;  4UB8 E;  3RL0 D;  3CXH H;  3ZOW A;  4GED B;  5B66 E;  2Q7C A;  1SQB D;  2ZYG A;  1HVV A;  2E74 B;  3M0D C;  3TGU G;  1U74 B;  1I55 A;  2WVR A;  3NTN A;  4H44 D;  3KPE A;  4WBA A;  2N9Y B;  1JNM A;  3R2P A;  3TGU E;  4A7P A;  1JCC A;  5KJ7 A;  1HRC A;  4K3I A;  1CC5 A;  2H89 C;  3L72 J;  4IL6 H;  2M3E A;  1K3G A;  3PH2 B;  2SPZ A;  1KV9 A;  2YO3 A;  1I6D A;  2WPR A;  1SQX E;  1FZC A;  3RK3 B;  1KIL A;  3KZI V;  3MP7 B;  1NIR A;  1SQP G;  1RQV A;  1YIJ P;  1BL9 A;  2IZ0 A;  3L4M A;  1OFC X;  2E42 A;  1SQP E;  4JF7 A;  3I5C A;  1HRO A;  2NPS A;  2MJZ A;  3HE5 B;  3O1Y A;  3H1I D;  1OW7 A;  2D2C B;  5AW9 B;  4IL6 X;  4WB4 A;  4XA4 A;  4QMA A;  3WU2 V;  2KLV A;  1URQ B;  1QEX A;  2ZT9 B;  2JWD A;  3ZIY A;  2XDJ A;  1FJK A;  1NKZ B;  5APU A;  4AQR D;  2CK3 H;  1EC5 A;  3P8C D;  2LIR A;  4O1W A;  3B5N B;  1FAV A;  1IFM A;  2Q3E A;  4EI2 A;  4EDF A;  1G1J A;  2L91 A;  1T2K D;  2WWW A;  3S9O A;  2N1T C;  1S6V B;  1LTJ B;  1NTZ E;  3CD6 P;  2KNC B;  3LID A;  3HQ9 A;  2BH4 X;  4U3F G;  3L72 D;  2AEJ A;  2D0S A;  1AVO A;  1CRI A;  2GIW A;  4LC1 A;  1N73 B;  3CX5 W;  3ZOX A;  1LT9 C;  1L0L K;  1HUC A;  4U3F E;  1GW3 A;  1DIQ C;  1H9Y A;  1VQP P;  1L4A C;  1CIF A;  2FKW B;  3U1A A;  2KZJ A;  5AVQ B;  2WSF J;  2K9J B;  4N6J A;  1S4X A;  3CC4 P;  4AX3 A;  5AVW B;  3H1L G;  1X8Y A;  3VMX A;  3HTK A;  1IK7 A;  3OCD B;  3AE5 C;  4DCK A;  5BVZ A;  4OGQ D;  2EXV A;  1CRJ A;  5KAF H;  3WFD C;  3H1J J;  3H1L E;  2GB8 B;  1COT A;  5KTB A;  5B5E H;  1IO3 A;  1XTG B;  5CCG C;  4UB6 H;  2ZT9 D;  1OXZ A;  2AI5 A;  1PPJ G;  4U7J A;  3QWO C;  4KJM A;  3AE8 C;  1S9K D;  3SFE C;  1KYO D;  4MN4 C;  3HQ8 A;  1EDI A;  2OYI B;  3CCS P;  4XE5 B;  5TIS H;  1PPJ E;  1XTC C;  2JTI B;  3V6I A;  3GHG A;  3U1C A;  3VP8 A;  5AW3 B;  5KLV K;  2B12 B;  1GL2 A;  1L0L J;  2E75 C;  2PP6 A;  2B11 B;  2N9I A;  1LTT C;  4QAO A;  2WZ7 A;  2ORL A;  4HJG H;  2BEZ F;  4K35 A;  1GD2 E;  4PD4 E;  1UIX A;  2G8Y A;  1JY2 P;  1LP1 A;  1LTA C;  3LIE A;  3AE2 C;  1CED A;  1KIL D;  5H2F H;  1UII A;  4KHX A;  1HH0 A;  3TYY A;  2W6A A;  3Q5S A;  1CYJ A;  1U75 B;  2ZXE B;  1NMI A;  2C8S A;  2FYN B;  3E1I A;  1H0T A;  3TK1 A;  1SQX K;  5KLI B;  4N78 D;  2WT7 B;  1U7J A;  2YNY A;  4L1Q A;  1YI2 P;  2C9X B;  3G4S P;  2N18 B;  1T3J A;  1DII C;  2XNX A;  3W67 A;  2JEE A;  2E76 B;  2OYH C;  5KLV J;  1SQP K;  4PV1 B;  2N9B A;  1H9X A;  2V07 A;  1ZR2 A;  4KMG A;  1FDI A;  1K04 A;  1VQ5 P;  1N9C A;  2IBZ I;  1FI7 A;  3H32 B;  4RKU J;  3ZBM A;  5CIH B;  5K5G B;  2NRG A;  3IAO A;  3LW5 J;  2L4D A;  1ZME C;  1J1D C;  3CX5 H;  4DJG A;  2K88 A;  1H33 B;  1HH7 A;  1N90 A;  2Y0C A;  3TGU J;  3O6Q A;  1RZ6 A;  1GQ1 A;  2HR3 A;  1HBW A;  2WMM A;  1T2K C;  2BPB B;  1USD A;  1B7V A;  4JBZ A;  4R4L A;  2HOD A;  1EZV D;  1SQX J;  2KUB A;  1GJQ A;  5KAI H;  1FOC A;  5DJQ C;  1CCH A;  3BCC D;  4ZMD A;  1L4A A;  1NTZ K;  1VQK P;  4PJ0 E;  5CBN A;  2AXT E;  1IQC A;  3V2R A;  1A2S A;  2M5A B;  3AE4 C;  1FOS F;  1SQP J;  2HPC A;  3CCQ P;  1IJD B;  2Q9I A;  5DFS A;  3MD0 A;  3L74 G;  3A5T A;  4EID A;  1QL1 A;  4OGQ C;  1H88 A;  3IFM A;  4GOE A;  1KB9 I;  2WSF H;  3II6 A;  4C7N A;  2E76 D;  3L74 E;  1I8O A;  4FB1 A;  5KLV D;  1RE4 C;  2HV4 A;  2WQY C;  1I8P A;  3KZI H;  4GT1 A;  3DMI A;  4Y5R A;  1SVF A;  1YTC A;  1OMI A;  1KQS O;  4YXD C;  1KMI Z;  3A0B H;  4I1L A;  3EFG A;  4ZKU A;  3K5B A;  5DF5 A;  1KQL A;  2G3A A;  2N1T B;  1JEK A;  1FCD C;  1GZL A;  1KD1 Q;  1GL2 D;  1NTZ J;  3TGU D;  4RSZ A;  1AQT A;  1MZ9 A;  4EIF A;  4L3H A;  1KFM A;  3F5H A;  3WU2 H;  1E5W A;  3C2C A;  3VP9 A;  5KJ7 C;  2FY8 A;  2WPS A;  1SQX D;  1LT9 B;  1RHZ B;  2K3R A;  1JMB A;  4U3F J;  1M1J C;  3M9H A;  1W2B O;  3VOP A;  2C1U A;  2JR8 A;  4I2L C;  5AW1 B;  3CCM P;  4AAL A;  2HYN A;  3RBZ A;  3L71 G;  2FRC A;  2W6J H;  3G3Z A;  1FE6 A;  3SXT A;  1GU2 A;  1SQP D;  1VDF A;  2RMZ A;  1NTM G;  5AVV B;  3BRV B;  2IBZ E;  2KIK A;  1AOF A;  4BWN A;  2FYU G;  1DVV A;  2B87 A;  3H1L J;  3L71 E;  5C39 A;  3RK2 C;  3GLM A;  3PRJ A;  2NPS C;  5GTH H;  4BRY A;  1LFM A;  2HG5 D;  3HD7 A;  1FZA A;  1NTM E;  1QKS A;  3JSV C;  1P84 H;  1RAP A;  5C0Z A;  1SP4 A;  2FYU E;  1JCD A;  2QJP B;  3WC8 A;  5CYT R;  1R5L A;  3C9I A;  5H2F V;  3RL0 B;  1T8Z A;  2H88 C;  1KZU B;  5AVY B;  4HYT B;  1NU1 E;  1BCC G;  3KXD A;  1OCD A;  3VYI A;  1CIE A;  2N1T D;  2E75 B;  1ZOY C;  3F89 A;  1QGK B;  5B66 H;  4PJ0 V;  1EZV G;  1BCC E;  1NTZ D;  3S1K A;  3L37 A;  2KS1 B;  5AUR A;  3LW5 H;  4RES B;  3BCC G;  3CXH I;  2QVA A;  3PLN A;  1FJP A;  1NNO A;  1YIQ A;  1T6A A;  1CSX A;  2I8D A;  5CBO A;  2A45 G;  1MG3 D;  2IDB A;  1JMM A;  3BCC E;  2FXO A;  1KIB A;  2KYV A;  1L4A D;  1LGH B;  2YKP A;  1X0T A;  1KB9 E;  1S5L E;  4RO0 A;  1G2C A;  1GU5 A;  1ZRT E;  2DW3 A;  4N0K A;  451C A;  1RH5 B;  3MIW A;  2O01 J;  1LTB C;  1BSH A;  1NAY A;  3H25 A;  4I6M C;  4B86 A;  3PXS A;  2KK7 A;  3H1L D;  3CL3 D;  5CCG D;  2OYH B;  3CP5 A;  1LTI C;  2Q3I A;  2Y9Y A;  2CXB A;  1OZH A;  5KAI V;  5L8R J;  1CSV A;  2R3S A;  1CRG A;  1E29 A;  5CIC B;  3TDK A;  3M91 A;  3KHU A;  1RZ5 A;  1OVU A;  1NWQ A;  3L70 E;  2W27 A;  1PPJ D;  1J1D B;  3L36 A;  2YKQ A;  3A0H E;  1NAF A;  5CJ4 A;  4FA5 A;  1GKS A;  2E75 D;  2BLF B;  1DW0 A;  1CRC A;  2N3B A;  3GHG C;  3OA8 A;  3RN1 A;  3TYI A;  1SQX G;  1GL2 C;  4DZO A;  2ZVO B;  1GK6 A;  4PD4 D;  5DJQ B;  1M1J A;  2O3J A;  4I7Z B;  5APX A;  3HUS A;  2KSJ A;  1LTJ A;  3USS A;  1N7L A;  2IFM A;  1S72 P;  2K37 A;  4GOD A;  4IFM A;  3A0B V;  3SWY A;  4H13 D;  2GC4 D;  1I6E A;  1SLQ A;  2Q6Q A;  1N73 A;  1JTH B;  1QX8 A;  2WSE J;  3JCU E;  3V2P A;  4OGQ B;  3O0R C;  1N7S A;  5AVZ B;  1FDM A;  3PP5 A;  3PXT A;  2D0W A;  1IFI A;  2WIT A;  5AW6 B;  3G6E P;  2QM8 A;  1HZV A;  1NO4 A;  1L9B C;  1FZE A;  1VQL P;  3L74 J;  3HD7 D;  1WRG A;  4XXL A;  2YO2 A;  2ZYA A;  4MU8 A;  5B6Q A;  1FOS E;  2WSS H;  3KQG A;  3T97 A;  3VYM A;  2H43 A;  3C1L A;  1SQV G;  1CZQ A;  3VN0 A;  4PWA A;  5CHX A;  2H7H A;  3CXH E;  1RAQ A;  1NTM K;  1K8A Q;  2OZ1 A;  2YIU C;  2FYU K;  1LT1 A;  1NTZ G;  2KSE A;  4P4Q B;  1SQV E;  2M3B A;  1CYC A;  1S2E A;  1FHB A;  1LTS C;  1VQ9 P;  2LIT A;  2B89 A;  2RH0 A;  3NBT A;  1QL3 A;  3ORV A;  1NTK G;  5GTH V;  1NU1 K;  1VPC A;  2XKM A;  4EIE A;  4NPD A;  1S3J A;  2IPP A;  1DW3 A;  4IL6 E;  2B4Z A;  2V4H A;  1NTK E;  4H0K A;  2R5D A;  4IFF A;  2LKM A;  2ZON G;  1CSW A;  1KV4 A;  1FZC B;  1KIL B;  4C46 A;  2I1K A;  1CTY A;  1MFT A;  5DJU B;  1DH3 A;  1KYO W;  4PD4 H;  1DT1 A;  2B9B A;  4OH8 B;  2AEM A;  1FJ0 A;  3V4W A;  4UB8 V;  3L71 J;  3W68 A;  2ZBO A;  3IF4 A;  5B66 V;  2QJK B;  1CRY A;  3RK2 B;  3Q5R A;  2NPS B;  3VRD A;  1HGV A;  3Q2Y A;  1NTM J;  3M06 A;  5AVS B;  2IFN A;  1BDD A;  3A3Y B;  3PJS K;  2FYU J;  5AVT B;  1HCM A;  3L74 D;  5BU5 A;  2Q1K A;  2E5Y A;  1QLE D;  1F1F A;  3RN0 A;  1JO5 A;  1HWT C;  3D6Z A;  1DEE G;  1H31 A;  4GDO A;  1YTZ I;  1H1O A;  1NU1 J;  5CIG B;  4GYD A;  3G71 P;  2PCB B;  2ZJS E;  3MZW B;  4HKZ H;  3SSU A;  1NHL A;  1FZB A;  3NBS A;  1JDL A;  4L3G A;  1ZLL A;  1IFJ A;  1BCC J;  1HTL C;  3A2A A;  2ZVN B;  3MTU E;  3DR0 A;  2R44 A;  2N3Y A;  3UIA A;  2HFE D;  4WY4 A;  4IOI H;  5KJ7 D;  3C8V A;  3MUD A;  1OIP A;  4FA9 A;  3RLM A;  5CIB B;  2P2U A;  1FC2 C;  4XYD B;  1PGJ A;  4JPZ B;  3BCC J;  1YIT P;  3CX5 I;  3O20 A;  1BGY G;  3GF7 A;  4EIJ A;  4NFG B;  4JQ0 D;  1JY2 N;  1YIC A;  3B4S A;  3QH9 A;  4H13 C;  1YCC A;  1BGY E;  3CCE P;  3HTK B;  2Z5I A;  1DW2 A;  3OA7 A;  1AFO A;  2IBZ D;  2CA3 B;  3CWB G;  3RK2 D;  2C2C A;  2YMY A;  4PJ0 H;  2NPS D;  2AXT H;  1N7S D;  4NPF X;  3L71 D;  3NWV A;  3V5B A;  2DGE A;  5KAF E;  5CIE B;  1IK9 A;  2V08 A;  4HB1 A;  2CA4 B;  4WQA A;  3PHL A;  1NTM D;  1DIP A;  3CWB E;  2AXC A;  1IFN A;  2FYU D;  1N15 A;  4YPC A;  1PFI A;  3HD7 C;  1VF5 C;  4UB6 E;  2K9Y A;  1JY3 O;  2PCC B;  1FDO A;  3L70 J;  1MUU A;  3M97 X;  2I1J A;  4Y99 C;  4D6T G;  1GDV A;  2C1V A;  1NU1 D;  4Z1M H;  5TIS E;  2C1D A;  1BE3 G;  2CE0 A;  1AA0 A;  3GHG B;  1H32 A;  4ZNC A;  4D6T E;  2FFD A;  3H1H G;  1LMS A;  1KYO H;  2JJL A;  1GL2 B;  2OAR A;  2R5B A;  4LJI A;  1CTZ A;  1BCC D;  1KX2 A;  1BE3 E;  1AV1 A;  3O5C A;  1YJW P;  2Y9Z A;  3H1H E;  2WSC J;  4ASW A;  3IN6 A;  1GW4 A;  1SQV K;  3IR9 A;  2QIW A;  2MTA C;  3L73 G;  2JP3 A;  2VRS A;  1LP1 B;  4WQ8 A;  3WFB C;  5AW8 B;  1SFC A;  3CME P;  1KB9 D;  1AJY A;  3L73 E;  2W8Z A;  2ZOO A;  4OVN F;  1H0T B;  2POH A;  1ZRT D;  3PTZ A;  3EWK A;  1NTK K;  1N86 A;  1QVF O;  2KI7 B;  3B71 A;  3RK3 E;  2O1J A;  2JDI H;  1OAE A;  2L5G B;  3AE3 C;  2QEX P;  4AYC A;  2QJY C;  3HE4 A;  2FXP A;  1CIH A;  3GF3 A;  1CCR A;  3VTP C;  4Q5P A;  1K05 A;  1EDL A;  4RJT A;  4N3Y B;  3D6Y A;  1JB0 J;  1FU1 A;  3L70 D;  2P1J A;  2YIU B;  1IO4 A;  1CXA A;  1YQ3 C;  3HRN A;  1CSB A;  2M8R A;  4FA4 A;  1MV8 A;  1RF1 A;  1SQV J;  1CI6 A;  4PW9 B;  3JBT B;  2KP8 A;  2QM7 A;  1EXJ A;  3CX5 E;  1P84 I;  5APW A;  1URQ C;  3O6Q B;  2ZXY A;  3P7K A;  1OW6 A;  5AW7 B;  1J1E C;  3P32 A;  3L75 G;  3BVH A;  1JUN A;  4YTP C;  1CHJ A;  3GMA A;  1R5S A;  2HOD B;  3CC7 P;  3TNU A;  1IFD A;  2QA4 P;  1K73 Q;  1WEJ F;  1NTK J;  1SQQ G;  1L0N G;  3L75 E;  2ZFC A;  3ZOY A;  3WMM 0;  2YMK A;  1VQO P;  5APQ A;  3AEE C;  3H1K E;  2FWL A;  1L4A B;  3HUS C;  3DP5 A;  1LTJ C;  2IBZ G;  1SQQ E;  4EYY Q;  2GUV A;  1L0N E;  1AOQ A;  4GIF A;  1N50 A;  2HPC B;  1YJN P;  1PL5 A;  1M60 A;  1IRW A;  1N73 C;  1NYH A;  2NZ2 A;  2A45 H;  1VYD A;  1N7S C;  1AQ5 A;  3SVW A;  1CSU A;  1DVH A;  2IZ1 A;  1M6Z A;  4C7N B;  1AKK A;  2RKL A;  1LWU A;  2BCC G;  1NU1 G;  1ZZH A;  3CCR P;  4W80 A;  3HQ6 A;  2WPQ A;  3KZI E;  3X39 A;  2JWA A;  3CXH D;  1ZW0 A;  2BCC E;  5GTI E;  1JOC A;  1SQV D;  3AEF C;  4UB8 H;  2C9L Y;  1MFZ A;  2AXT V;  1BDC A;  2IYP A;  2E43 A;  3BRT B;  4YE1 A;  5KKZ C;  2LXB A;  3AE7 C;  2M0B A;  3NFQ A;  5CCH A;  1K9M Q;  2C0W A;  3WUI A;  3WU2 E;  2JKV A;  1NTK D;  1PP9 G;  2YQB A;  1M90 Q;  2ZYD A;  1FI3 A;  1IZN B;  1Q7Y Q;  1R8E A;  4L74 A;  1NGM B;  4DY9 A;  3GW6 A;  2WSC H;  1CYI A;  1K3H A;  4H13 B;  1BGY J;  1PP9 E;  3D70 A;  5CIF B;  2J58 A;  4WWI A;  3CU4 A;  2B88 A;  1RF0 A;  1NH4 A;  2CE1 A;  3D0W A;  2R3C A;  1FI9 A;  3V4Q A;  3CWB J;  1D7M A;  4BRY B;  3M9Q A;  2RN0 A;  2LXC B;  1H89 A;  3HD7 B;  1A8C A;  1LTG C;  5APV A;  5CJ0 A;  3L70 G;  1I5T A;  1USE A;  3OW2 O;  3HE5 A;  4Y99 B;  1GIW A;  5KLI C;  4J20 A;  1Q82 Q;  4WQ9 A;  5AVX B;  1LS9 A;  2B10 B;  2W6B A;  4HH2 A;  1KOR A;  4D6T J;  1URQ A;  2BEQ D;  3KDP B;  1N8R Q;  4K3A A;  3Q3D A;  5E79 E;  4JYC A;  1CHI A;  1M70 A;  2BGV X;  1L9J C;  3D71 A;  1BE3 J;  4L73 A;  4FAV A;  3V2N A;  3H1H J;  1KB0 A;  3B5N A;  3P8M C;  3RL0 g;  3Q1M A;  4WY4 C;  1E79 H;  1GTW A;  1CHH A;  1X22 A;  3MUD C;  3FWN A;  1A02 F;  4H0L C;  3R4Y A;  3RMZ A;  4OWF A;  1YYC A;  1ZXG A;  2KNC A;  3L73 J;  1FZF A;  5M1B A;  1AYG A;  1X79 B;  1NKN A;  5APT A;  4ASV A;  1IRV A;  2W83 C;  1Z56 A;  4FA1 A;  1A02 J;  1KC8 Q;  1BGY D;  1KX7 A;  2Z5H A;  1G2C B;  3ZCF A;  3CYT I;  1HJ5 A;  3AEC C;  4XFJ A;  2QG4 A;  1KTM A;  1HJB A;  2QJY B;  2Y0D A;  1SQQ K;  5GTI V;  1PGP A;  1L0N K;  2K9J A;  1M7L A;  1C2N A;  3CWB D;  1Y9B A;  1QL4 A;  1VF5 D;  2PAJ A;  4PD4 I;  1R0Q A;  3OCD A;  1NJI Q;  2Q5U A;  3EQ2 A;  1C2R A;  3WFE C;  351C A;  1VQM P;  2YK3 A;  2QE7 H;  1W5C E;  2JO1 A;  4WQB A;  1OX3 A;  2OTK E;  3AE6 C;  3E1R A;  1VQ4 P;  1DD3 A;  5TJH A;  2YKO A;  4D6T D;  1YEA A;  4DT0 A;  1Q86 Q;  1J1E B;  3OA8 B;  1Q2N A;  2FFD C;  1RE3 A;  2OYI A;  1BE3 D;  3GG2 A;  2A06 G;  4EIC A;  3B8E B;  1S5L V;  2E74 D;  4GOF A;  3M0A A;  3H1H D;  3CCJ P;  1IZL 0;  2OGU A;  2O01 N;  5CCH D;  2WPV B;  1C52 A;  1ZV8 A;  1M1J B;  3L75 J;  1QVG O;  2E5T A;  2ZAE B;  2LR2 A;  2A06 E;  3H1K J;  3HUS B;  1OW8 A;  1Q81 Q;  2FXM A;  1S1C X;  1JM0 A;  1SQQ J;  1L0N J;  3TSI A;  1QYZ A;  3ITK A;  3L73 D;  1HJ0 A;  4H0J A;  1SFC C;  3WUU A;  1YTZ T;  1PZQ A;  1HJ4 A;  3BAT A;  1MZ4 A;  3FGA D;  3RK3 D;  3N4X A;  1C75 A;  3BAS A;  2PRR A;  2PFX A;  1N7S B;  3V2Q A;  3A0H V;  3VMY A;  3WFC C;  1GDT A;  1DEB A;  1JY2 O;  2P58 A;  5E79 V;  1F1C A;  3OAK A;  5APY A;  3TF5 A;  4WQC A;  1M56 D;  1Y8A A;  2MKV A;  1E2R A;  2CPB A;  2WT7 A;  2OQQ A;  2O01 H;  3U59 A;  4EOT A;  3T97 B;  3WUV A;  2BCC J;  2D2C D;  4WQ7 A;  3ZDM A;  2QRX A;  2OZ1 B;  1URQ D;  1SQB G;  3CMA P;  1M57 D;  1J2J B;  1RQU A;  4L75 A;  3CX5 D;  1E8E A;  1ZN5 A;  1RF1 C;  2QJP C;  3H32 A;  5KKZ B;  3M0D A;  2JQR A;  5AW0 B;  1SQB E;  4ZKP A;  3RL0 C;  3B5N D;  1ETP A;  1YEB A;  1H33 A;  4O9B A;  2AEF A;  4AUW A;  2H8P D;  3ABV C;  3L75 D;  4H44 C;  3H1K D;  4M3L A;  3O8Z A;  1KYO I;  1SQQ D;  3FXE A;  1PP9 J;  3SWF A;  1W2E A;  3PXW A;  1L0N D;  1TU3 F;  2KB7 P;  2P67 A;  4AAM A;  3AEG C;  4KT0 J;  1OVR A;  2K1A A;  1C7M A;  2KXP B;  1IC2 A;  2V7Q J;  2OTJ P;  1VQ8 P;  2M5A A;  3A7O A;  2Z4E A;  3H1I G;  3I55 P;  3S4R A;  1C6R A;  1N2D C;  3AED C;  5B5E E;  2WSE H;  1KQF B;  3N7N A;  4LLH A;  3SFD C;  4TLF A;  2KZI A;  1VQN P;  1LWU C;  3KYQ A;  4W7Y A;  1H31 B;  1C6O A;  3H1I E;  2XTS B;  3MK7 C;  3H1J D;  3AEA C;  2BCC D;  4IL6 V;  1EQ7 A;  3L35 A;  2HLO A;  2CPS A;  2KOG A;  1KQG B;  1LJ2 A;  2MHM A;  3VMA A;  5C9M A;  1U7M A;  2BCN B;  4WY4 B;  155C A;  1VQ7 P;  3P8C E;  4YXW H;  4H0L B;  2ZXX A;  2E74 C;  2W90 A;  2N1T A;  4R4M A;  3CI9 A;  3EFF K;  1KFN A;  4TT3 H;  5CCH C;  2UWJ E;  3L72 G;  1L0L D;  1EDK A;  2XZR A;  1LC2 A;  1IFP A;  5H2F E;  3MHV A;  1M8O B;  2WTY A;  1PP9 D;  1NVO A;  4DOJ A;  3L72 E;  1LT9 A;  2PAC A;  3L4F A;  4I7Z C;  1EXI A;  4Y28 J;  1DX7 A;  1JY3 P;  4WVZ A;  3RK3 C;  2ITA A;  4IFD K;  2BH5 X;  1CO6 A;  1T3U A;  1RF0 C;  4LGD E;  1OWA A;  3H6P A;  2YCC A;  1EZV I;  2XND H;  1P84 D;  1JY3 N;  2IYO A;  3A9F A;  1YFC A;  1EB7 A;  3MGN A;  3CC2 P;  1YBK A;  3L4O A;  5CCG A;  3SLE A;  3CCL P;  3AE1 C;  1FBM A;  2D2C C;  1C6S A;  1GK4 A;  2A45 I;  3Q5P A;  2C1D B;  4PV1 D;  1H32 B;  2FFD B;  2FBW C;  2ZT9 C;  2P7J A;  1S9K E;  1WMK A;  4WQE A;  1KYO E;  2O1K A;  1J3S A;  2OYO A;  2N9J A;  4WY4 D;  1HJ3 A;  3PH0 A;  5GTI H;  1OVV A;  3AEB C;  2P10 A;  3HQ7 A;  4NPE A;  1COR A;  4H0L D;  3H1K G;  1LNQ A;  3B5N C;  1KN7 A;  5KAI E;  5KAF V;  2XV5 A;  2GA1 A;  4W7Z A;  4CPG A;  1U57 A;  4L76 A;  4O1Q A;  5AW5 B;  1SQB K;  2KS1 A;  5DJT B;  1SFC B;  5IY5 1;  3CXH W;  5B5E V;  4UB6 V;  3SJL A;  2B0Z B;  5CMZ A;  1CRH A;  2GM4 A;  1Q90 D;  2VHD A;  1VL2 A;  1KIL E;  1KB9 H;  1G1I A;  1MG2 D;  3SWS A;  1FZC C;  1W2L A;  1KIL C;  5TIS V;  1DW1 A;  1S5L H;  2FYZ A;  4FAN A;  1ZP0 C;  1BSN A;  1NML A;  3NMD A;  3HE4 B;  3CCU P;  2GC7 D;  3H1J G;  3WUT A;  1YQ4 C;  1W5C T;  1M1K Q;  3RBX A;  4N78 E;  2QJK C;  2YXR B;  3FXD A;  2V7Q H;  3VNW A;  4AAN A;  3H1J E;  2OYH A;  2KLU A;  2GUS A;  3OJA B;  5AW2 B;  3A0B E;  1MKM A;  1DD4 A;  1GMJ A;  2YXQ B;  1RF1 B;  2ZZS 1;  3JC2 2;  4BXL A;  1CI6 B;  3CCV P;  3RGU A;  5EXQ A;  1Y47 A;  3SWK A;  2C9N Y;  1SS1 A;  1SQB J;  1WVE C;  3VMZ A;  1S5L X;  3A0H H;  1YNR A;  3CPW O;  3ZOO A;  1L2P A;  1AVY A;  5AVU B;  1CXC A;  1RE3 C;  2OYI C;  1CW5 A;  5E79 H;  1CNO A;  1L0L G;  1RY3 A;  4H44 B;  3TNU B;  2AIU A;  2XU6 A;  2A06 D;  3NXS A;  5CID B;  1H8A A;  1PV3 A;  3FWL A;  5AVR B;  2C0X A;  1HF9 A;  3FX0 A;  1L0L E;  2J5U A;  4AAO A;  1SFC D;  4V2K A;  1YHQ P;  3I56 P;  1PIX A;  1CIG A;  1VQ6 P;  4JCG A;  1FZG A;  1YJ9 P;  1EZV E;  1HGZ A;  2R32 A;  2IX7 C;  4GKG A;  1I54 A;  1QN2 A;  2BAS A;  5AW4 B;  1NOH A;  4U3F D;  2OTL P;  1FS0 E;  2B87 B;  4C7R A;  3E7K A;  1QL2 A;  5GTH E; 
#chains in the Genus database with same CATH homology
 3H1H D;  1HZU A;  2DGE A;  2DVH A;  1LC1 A;  5CIE B;  1IZL 0;  3TGU D;  2V08 A;  2CA4 B;  4RSZ A;  4WQA A;  1C52 A;  3PHL A;  1NTM D;  3MK7 B;  1CTJ A;  2FYU D;  1N15 A;  4EIF A;  2Y0E A;  4L3H A;  3C2C A;  2I8F A;  1A56 A;  1SQX D;  2N18 C;  2PCC B;  1QYZ A;  3ITK A;  3L73 D;  3M97 X;  4H0J A;  4WQD A;  1GDV A;  2C1V A;  1HJ4 A;  1NU1 D;  2C1U A;  1MZ4 A;  2C1D A;  3ZOW A;  2CE0 A;  4GED B;  4AAL A;  1SQB D;  1C75 A;  1H32 A;  2FRC A;  1LMS A;  3A0H V;  3SXT A;  1U74 B;  1GU2 A;  1I55 A;  1SQP D;  4LJI A;  1CTZ A;  1BCC D;  2RMZ A;  3WFC C;  1KX2 A;  1AOF A;  5E79 V;  2N9Y B;  1DVV A;  3O5C A;  1F1C A;  3TF5 A;  4WQC A;  3PRJ A;  1E2R A;  1LFM A;  4A7P A;  2MTA C;  1QKS A;  1RAP A;  5C0Z A;  1HRC A;  4K3I A;  1CC5 A;  2QJP B;  3WC8 A;  5CYT R;  1K3G A;  3PH2 B;  4WQ8 A;  3WFB C;  1KV9 A;  1I6D A;  4WQ7 A;  1KB9 D;  5H2F V;  2OZ1 B;  3CX5 D;  3KZI V;  1E8E A;  2ZOO A;  1NIR A;  1ZRT D;  3PTZ A;  5KKZ B;  1OCD A;  1CIE A;  1BL9 A;  2JQR A;  3L4M A;  1OAE A;  4PJ0 V;  1ETP A;  1HRO A;  1NTZ D;  1YEB A;  1H33 A;  5AUR A;  3O1Y A;  3H1I D;  3L75 D;  1CIH A;  1CCR A;  3PLN A;  1NNO A;  4Q5P A;  1YIQ A;  3H1K D;  1CSX A;  4RJT A;  3WU2 V;  1SQQ D;  3PXW A;  1L0N D;  1MG3 D;  3L70 D;  1KIB A;  2YIU B;  1CXA A;  4AAM A;  3ZIY A;  4FA4 A;  4PW9 B;  3JBT B;  1C7M A;  2LIR A;  4O1W A;  4N0K A;  451C A;  2Q3E A;  2ZXY A;  4EDF A;  2L91 A;  1C6R A;  1CHJ A;  1S6V B;  3PXS A;  3H1L D;  1WEJ F;  3CP5 A;  2KNC B;  1H31 B;  1C6O A;  2CXB A;  2XTS B;  3HQ9 A;  3ZOY A;  2BH4 X;  5KAI V;  3MK7 C;  3H1J D;  1CSV A;  2BCC D;  1CRG A;  1E29 A;  2FWL A;  3L72 D;  5CIC B;  3TDK A;  2D0S A;  4IL6 V;  3KHU A;  1CRI A;  1RZ5 A;  2GIW A;  3DP5 A;  3CX5 W;  3ZOX A;  1AOQ A;  1PPJ D;  1N50 A;  1DIQ C;  1H9Y A;  4FA5 A;  1CIF A;  2MHM A;  3VMA A;  1M60 A;  5C9M A;  2K9J B;  2BCN B;  1GKS A;  2BLF B;  1DW0 A;  155C A;  1IRW A;  4AX3 A;  1CRC A;  2N3B A;  3OA8 A;  3RN1 A;  3OCD B;  1VYD A;  3TYI A;  3SVW A;  1CSU A;  2EXV A;  1CRJ A;  1DVH A;  1M6Z A;  3WFD C;  1AKK A;  4PD4 D;  5DJQ B;  2GB8 B;  1L0L D;  1ZZH A;  1COT A;  2O3J A;  1LC2 A;  1IO3 A;  3HQ6 A;  2AI5 A;  3X39 A;  1PP9 D;  3CXH D;  2JWA A;  2PAC A;  3A0B V;  1KYO D;  3HQ8 A;  2GC4 D;  1SQV D;  1I6E A;  2AXT V;  2BH5 X;  1CO6 A;  2JTI B;  3O0R C;  4YE1 A;  3PXT A;  2D0W A;  2B12 B;  2YCC A;  1HZV A;  1P84 D;  1L9B C;  2B11 B;  3A9F A;  1YFC A;  2N9I A;  4QAO A;  1EB7 A;  3WUI A;  2ORL A;  4XXL A;  1NTK D;  4MU8 A;  3L4O A;  5B6Q A;  2YQB A;  1FI3 A;  3SLE A;  3VYM A;  1C6S A;  4DY9 A;  3GW6 A;  2C1D B;  1CYI A;  1K3H A;  4PWA A;  1CED A;  1RAQ A;  1H32 B;  5CIF B;  2OZ1 A;  1CYJ A;  4WQE A;  4P4Q B;  1J3S A;  1U75 B;  1NMI A;  2C8S A;  2N9J A;  1HJ3 A;  3CU4 A;  2FYN B;  1CYC A;  2CE1 A;  1FHB A;  3HQ7 A;  1FI9 A;  1COR A;  2LIT A;  5KLI B;  3NBT A;  1QL3 A;  2RN0 A;  3ORV A;  1A8C A;  5GTH V;  4L1Q A;  4EIE A;  2C9X B;  1I5T A;  5KAF V;  2N18 B;  1DII C;  1DW3 A;  4O1Q A;  2KS1 A;  1GIW A;  4J20 A;  2B4Z A;  4H0K A;  4WQ9 A;  2ZON G;  5IY5 1;  1CSW A;  3CXH W;  1LS9 A;  2B10 B;  5B5E V;  1H9X A;  2V07 A;  4UB6 V;  4KMG A;  3SJL A;  2B0Z B;  1CTY A;  1N9C A;  1KYO W;  1FI7 A;  1CRH A;  1DT1 A;  3ZBM A;  5CIH B;  2VHD A;  1FJ0 A;  1CHI A;  2L4D A;  1M70 A;  1MG2 D;  2BGV X;  3SWS A;  1L9J C;  1W2L A;  4UB8 V;  1DW1 A;  5TIS V;  4FAV A;  2ZBO A;  5B66 V;  2QJK B;  4FAN A;  1CRY A;  1KB0 A;  1H33 B;  1HH7 A;  1N90 A;  1NML A;  2Y0C A;  3VRD A;  2GC7 D;  1RZ6 A;  1GQ1 A;  1W5C T;  1CHH A;  2BPB B;  1HCM A;  1B7V A;  3L74 D;  3RMZ A;  1F1F A;  3RN0 A;  3VNW A;  4AAN A;  1EZV D;  1GJQ A;  1H31 A;  1FOC A;  5DJQ C;  1CCH A;  1AYG A;  2ZZS 1;  1H1O A;  3BCC D;  1IRV A;  5CIG B;  4GYD A;  4FA1 A;  5EXQ A;  2PCB B;  1BGY D;  1KX7 A;  1WVE C;  3ZCF A;  3CYT I;  1IQC A;  3NBS A;  1HJ5 A;  1JDL A;  4L3G A;  1A2S A;  1YNR A;  2QG4 A;  3ZOO A;  1CXC A;  2QJY B;  2Y0D A;  5GTI V;  3DR0 A;  1CNO A;  2N3Y A;  2AIU A;  1C2N A;  5DFS A;  3CWB D;  1QL4 A;  2A06 D;  4EID A;  5CID B;  1R0Q A;  3OCD A;  3FWL A;  4FA9 A;  3RLM A;  5CIB B;  1C2R A;  3WFE C;  4AAO A;  351C A;  4XYD B;  4V2K A;  2YK3 A;  1I8O A;  4FB1 A;  1CIG A;  4JCG A;  3O20 A;  4WQB A;  5KLV D;  4NFG B;  2HV4 A;  1I8P A;  1I54 A;  3DMI A;  1QN2 A;  4Y5R A;  1YTC A;  5TJH A;  1YIC A;  4D6T D;  1YEA A;  4U3F D;  1YCC A;  3OA8 B;  1DW2 A;  5DF5 A;  2IBZ D;  2CA3 B;  2C2C A;  1BE3 D;  3GG2 A;  4EIC A;  1S5L V;  3L71 D;  3NWV A;  1FCD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...