4U3FD

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4u3fD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4u3fD02
5CIGB 5DFSA 1LC2A 3HQ7A 1CCRA 3C2CA 1MZ4A 2DGEA 3PXWA 1LS9A 3WFBC 1CC5A 3DR0A 4EIDA 3X39A 1A56A 1C7MA 1H33B 1JDLA 1ZZHA 1C6SA 3FWLA 2N18B 1GKSA 1GJQA 1DW3A 3TGUD 1EZVD 5KKZB 3VRDA 1L9JC 3ZOWA 3WFEC 2B11B 5KAIV 1AOQA 3KZIV 2D0WA 4Y5RA 1NTMD 1IRWA 1CIFA 4P4QB 1FI7A 3CXHW 1BGYD 1AKKA 3ITKA 3O5CA 1WVEC 4GYDA 2PCCB 3ZOOA 5IY51 1S6VB 3L72D 1YICA 1OCDA 2B4ZA 2C8SA 4PWAA 4FA1A 3GW6A 3RN1A 1CYCA 3GG2A 1CYJA 3L71D 2AIUA 3L75D 2BGVX 2RN0A 4PJ0V 5C0ZA 4WQ8A 1H1OA 2PACA 1I6EA 4AAOA 2HV4A 1U75B 2JTIB 2XTSB 2D0SA 3ZOXA 2O3JA 2FRCA 1YFCA 4EDFA 4RJTA 1P84D 2QJKB 1L0ND 2C2CA 4FAVA 5AURA 1CIHA 4IL6V 1KYOW 2L4DA 1L0LD 1A8CA 1QN2A 4WQAA 1WEJF 3PLNA 1KB9D 2BCCD 2QJYB 2N18C 3SXTA 1QKSA 1FCDC 4L1QA 1NTKD 3PRJA 2YK3A 3O1YA 3CWBD 3RLMA 1CSUA 1CIGA 3PXTA 2KS1A 4YE1A 4QAOA 1E8EA 1CRIA 3A9FA 4K3IA 1C6OA 2C1VA 5CICB 2N9YB 4WQ9A 1I5TA 1RZ6A 1W5CT 1HJ3A 2BCNB 1SQVD 1HZVA 1CORA 3VYMA 1CHHA 1CRYA 1HRCA 2QJPB 1RZ5A 155CA 3MK7B 1C6RA 4LJIA 2JWAA 1YEBA 3PTZA 2AXTV 1COTA 3DMIA 3PXSA 1FI9A 3VNWA 3CU4A 3SVWA 3JBTB 1GIWA 2EXVA 2L91A 3SJLA 4H0KA 4O1QA 3ZOYA 3H1ID 1N90A 2CE0A 1RAPA 1C52A 1KX2A 1PP9D 4FANA 1KIBA 2GB8B 1FOCA 4WQDA 1CHIA 1BE3D 1A2SA 1C2RA 3CXHD 3VMAA 2YQBA 3WFCC 1U74B 1F1FA 4JCGA 1FI3A 3SLEA 3O0RC 1DIIC 3HQ9A 1BCCD 1AOFA 1CTJA 2N3BA 1H32A 1QYZA 4V2KA 4U3FD 1HH7A 3TYIA 1PPJD 1RAQA 1CSVA 1BL9A 2OZ1A 2ZBOA 1J3SA 1QL3A 1LFMA 2ZOOA 1HROA 1HCMA 2N9IA 4UB8V 1FJ0A 1C75A 2YIUB 4FB1A 2ZONG 1DT1A 4GEDB 5C9MA 4PD4D 1H32B 3ZBMA 1SQQD 1CIEA 4L3GA 4WQEA 2GIWA 3RMZA 1HJ4A 2OZ1B 1I55A 3MK7C 1B7VA 2Q3EA 1KYOD 1CTYA 1CXCA 3WU2V 2N3YA 1ZRTD 451CA 1MG2D 4RSZA 5CIHB 2B12B 1CCHA 1L9BC 2FWLA 1DW1A 2C1DA 2ZZS1 3ORVA 4FA5A 2JQRA 4L3HA 1AYGA 2C1UA 1CRJA 1ETPA 2ORLA 5CIDB 1E2RA 2CA4B 2C9XB 2V08A 5CIBB 1M6ZA 2BH5X 3BCCD 2DVHA 5KLIB 3A0HV 3KHUA 4NFGB 1DVVA 3CX5D 1SQBD 2GC7D 1S5LV 3HQ6A 1I54A 2B0ZB 4UB6V 1MG3D 3CX5W 3SWSA 1N15A 2K9JB 1DW2A 2LIRA 1SQPD 1CSXA 3WFDC 1K3GA 1CYIA 1NU1D 3A0BV 1FHBA 3WUIA 1YEAA 5CIFB 4KMGA 5EXQA 2GC4D 2CXBA 1VYDA 3NBSA 3O20A 3L4OA 1OAEA 5H2FV 2LITA 3TF5A 5GTIV 4XXLA 1GU2A 3H1KD 1F1CA 1YTCA 2IBZD 2BLFB 1GQ1A 1YIQA 1CXAA 1M60A 1QL4A 1DW0A 1CRGA 2I8FA 4AALA 1NMLA 1CRHA 2CA3B 3OA8A 5DJQB 1HZUA 2VHDA 2FYUD 3OCDA 3WC8A 4FA4A 3HQ8A 4XYDB 5E79V 1CNOA 2Y0EA 5KAFV 4FA9A 1KV9A 1DVHA 1SQXD 2YCCA 351CA 1CSWA 1CTZA 1M70A 2Y0DA 1N50A 2BPBB 1KB0A 5KLVD 3OA8B 4AAMA 1H9YA 4EIEA 4AX3A 1IRVA 1K3HA 2A06D 1N9CA 3OCDB 2CE1A 2Y0CA 1CHJA 1GDVA 1H31A 5TJHA 3PHLA 1CO6A 2N9JA 5B5EV 2FYNB 3L73D 4WQBA 3NBTA 5DF5A 1LC1A 2KNCB 4Q5PA 1I8PA 3M97X 4A7PA 3H1LD 4AANA 2B10B 4WQCA 1IQCA 2BH4X 4DY9A 2ZXYA 1W2LA 3TDKA 1NMIA 1YCCA 1H31B 5TISV 5GTHV 1E29A 1R0QA 3ZCFA 1I6DA 1NIRA 1DIQC 4PW9B 5B66V 4D6TD 4N0KA 3NWVA 4J20A 5CIEB 1KX7A 1NTZD 3ZIYA 3L70D 4MU8A 2MTAC 4EIFA 5DJQC 2PCBB 4H0JA 1YNRA 4EICA 5B6QA 4WQ7A 1C2NA 1IO3A 2C1DB 3PH2B 5CYTR 3L74D 1CRCA 3RN0A 3DP5A 2QG4A 1H9XA 3L4MA 1LMSA 3CP5A 1I8OA 1IZL0 1EB7A 3H1HD 1CEDA 2RMZA 4O1WA 1NNOA 3CYTI 2AI5A 2V07A 1HJ5A 2MHMA 1H33A 3H1JD
chains in the Genus database with same CATH superfamily
3CX5H 4IL6X 3MD0A 3HQ7A 3HE4A 1SQVK 1IK9A 2W6AA 2WZ7A 1CCRA 4OGQC 1MZ4A 3V4QA 1LS9A 1CC5A 1RE3A 2IBZE 4EIDA 2M5AA 1NKZB 1IFMA 1A56A 3A3YB 1C7MA 2H8PD 4NPFX 2IPPA 3NMDA 1A02J 2N18B 4WVZA 3U59A 3CLQA 3TGUJ 1KILC 1L4AC 1NTMG 2B11B 3GHGA 1KMIZ 1AOQA 2QM7A 5KLVJ 1W2BO 3KZIV 4UB8E 2D0WA 2XKMA 1GW4A 1IRWA 3P32A 1FI7A 1BCCG 3FXDA 1RQUA 3E1RA 3GF3A 2HPCB 5EFWB 4ZMDA 1S6VB 1YICA 1OCDA 2B4ZA 3L35A 2ZYGA 5APTA 2SPZA 4BWNA 4PWAA 2KXPB 4I7ZB 3GG2A 3WU2E 1CYJA 3L71D 3H1LJ 4H0LC 5AW6B 4C7NA 5B5EH 1YYCA 2OYHA 3QH9A 5CJ4A 2KIKA 3M9BA 4RJTA 5AW7B 1KYOW 2YKQA 1L0LD 3L70E 1PGJA 1S3JA 3W68A 3HD7B 3CWBG 1KN7A 3PH0A 3BCCG 2W90A 2POHA 3L74E 3UIAA 1CIGA 3CWBJ 4GDOA 4YE1A 2IBZI 3RL0C 2IYOA 3M06A 3R2PA 2W83C 4UB6H 1USEA 5H2FE 1NU1G 5GTIE 1SQVD 1AQ5A 1BDCA 5CCGD 3N7NA 3VYMA 1RY3A 4Z1MH 2O01J 1OFCX 4I6MC 4AYCA 1LWUB 2WSEJ 3CMEP 1NVOA 1LP1B 1C6RA 3SWKA 5KJ7A 3D6YA 4LJIA 1X79B 3KXDA 4OH8B 5E79E 1FI9A 4WB4A 4ZNCA 5KAFE 3H1IG 2NPSD 2OARA 2HYNA 1NGMB 4H0KA 1N7LA 2KZJA 3H1IJ 4JQ0D 4FANA 1FOCA 4WQDA 4WY4C 1EZVE 3TK1A 1C2RA 2FYUG 3CXHD 2IZ1A 2M3BA 1LTTC 2JJLA 3WFCC 2ZT9C 1GL2D 3H25A 1FI3A 1N8RQ 1BGYE 3KDPB 4Y99C 1JY2O 2QJYC 2Q9IA 1SFCA 1VQMP 1HH7A 5CCHD 1RAQA 2Y9ZA 3SSUA 3L73E 2YXQB 3L72E 1BL9A 1FZCA 1HROA 4UB8V 1FJ0A 1C75A 2YIUB 3L4FA 4FB1A 2AXCA 3T97A 3EFGA 3L75E 2ZONG 4N78D 3LIDA 1GK4A 1CIEA 2H7HA 2P1JA 2P58A 3RMZA 1Y9BA 1N7SC 1YQ3C 1DEEG 1VQPP 1L4AA 1N2DC 2D2CC 2Q3EA 1CTYA 1OWAA 3B5NB 2ZXXA 2OGUA 3WU2V 2N3YA 451CA 1M1JB 1MKMA 1RE4C 1LTAC 4BRYB 1P84E 1L0LJ 1JEKA 5CIHB 2B12B 1JY3P 5BVZA 2ZZS1 5APWA 1VF5C 4Y99B 1MFZA 4K3AA 1UIIA 2ORLA 1E2RA 2CA4B 2V08A 2DVHA 1NTKE 1SLQA 1SQBG 1HVVA 3KHUA 3CCUP 4ZKUA 1HH0A 3CL3D 3HQ6A 2GC7D 5DJTB 2M3EA 1SQBJ 4L73A 2YMKA 1LTJA 1CI6B 1MG3D 3RK3C 1N15A 1SQPD 1S4XA 1S72P 2E43A 1CYIA 1SQVJ 1LTSC 3SFDC 1S9KE 1OVRA 5BU5A 1JOCA 1NTKK 3MUDC 1Q2NA 1EZVI 1DX7A 2CXBA 1ZMEC 4ZKPA 1NYHA 2WPSA 5CHXA 1OAEA 2IBZG 5H2FV 2LITA 3P7KA 3D70A 5GTIV 4H0LD 1OW8A 4RKUJ 1YTCA 2QIWA 1CXAA 3C9IA 2WTYA 1PP9E 1NMLA 5K5GB 3OA8A 5DJQB 1Q81Q 1YTZI 3WC8A 3HQ8A 5E79V 1NTME 2E75C 5KAFV 1LT1A 4N6JA 1A02F 1BCCE 1KB0A 2B89A 1FDOA 4EIEA 4PJ0E 1ZXGA 1CW5A 1N9CA 3E7KA 1KZUB 2CE1A 3RL0D 1NTMK 3CXHH 3O6QB 2JP3A 1EXIA 2FYNB 3L73D 1LC1A 1NAYA 1SQQE 2XU6A 4IOIH 2OYIC 3I56P 1FOSE 4AANA 4WQCA 2KB7P 3VYIA 4QMAA 3AE5C 1YCCA 3AE7C 3BRVB 1DD4A 2ZVOB 1RF0A 2WWWA 1MV8A 1RF1A 1I6DA 2KK7A 4U7JA 1DIQC 5APXA 1SQQK 1Q90D 5AW4B 3L70G 1L0NG 1OW7A 5CIEB 4R4LA 1NTZD 1FOSF 1JB0J 3WU2H 3NXSA 4IL6H 2MTAC 3L70J 2QA4P 4EIFA 3BCCE 2PCBB 4WQ7A 3B5ND 5CYTR 2FFDC 2P67A 3L74J 1BSNA 1IO4A 3KQGA 3CCLP 1NU1E 3PJSK 2R5DA 1SVFA 3A7OA 1I8OA 1IFDA 3U1AA 4O1WA 3IR9A 1HJ5A 4IFDK 3NFQA 1S9KD 5CIGB 1LC2A 3A5TA 2BEQD 1QX8A 2KLVA 4L76A 1NU1K 3M0DA 4BXLA 1U7JA 1Y47A 1FC2C 3CC4P 2AXTH 1N7SD 2KZIA 2QEXP 1H33B 2D2CD 5H2FH 3FGAD 1T6AA 1JDLA 4KHXA 2PAJA 3HE4B 2HODA 3FWLA 3HTKA 2FFDB 2FYUE 1GKSA 4HH2A 1H88A 3TGUD 1BE3G 5AVZB 2JKVA 4GODA 1L9JC 1HGZA 2M5AB 2MJZA 3L36A 4Y5RA 2OTLP 1NTMD 1JTHA 2OYOA 1DD3A 5CCGC 3CXHW 1NHLA 1AKKA 2W27A 5KAFH 1BGYJ 4XE5B 2J58A 3CI9A 2FYUK 3L72G 3RBXA 2QVAA 2J5UA 3ZOOA 2UWJE 3L73J 3AEBC 3GHGB 3L72J 2C8SA 5APVA 1URQC 1OZHA 3L75G 1ZV8A 2WSCJ 3RN1A 3EFFK 2YXRB 3SWYA 2RN0A 3B71A 3L75J 4PJ0V 4I2LC 1PIXA 4EOTA 4HJGH 1K8AQ 5AVSB 4AAOA 1AV1A 4B86A 1M57D 1YFCA 2JWDA 1FDIA 1LT9A 4YPCA 4R4MA 4D6TE 1U7MA 4FAVA 1CIHA 2WSCH 2FXOA 2IFMA 2BCCG 3MZWB 4N3YB 1NTKG 5CCHC 2N18C 1H89A 1VDFA 1FCDC 2E75D 2YK3A 3RLMA 3CWBD 3PRJA 1JY3N 1NTKJ 1URQB 2KS1A 4QAOA 3A2AA 5CICB 4WQ9A 1I5TA 1NH4A 4I1LA 2AEJA 1SQBK 3MP7B 3QWOC 3A0BH 1CHHA 2QRXA 4XA4A 1CRYA 3S4RA 3H1JE 2QJPB 2JEEA 5AW8B 1HJBA 3MK7B 1NOHA 1KV4A 3PTZA 4I7ZC 2HLOA 3DMIA 3VNWA 3CU4A 2EXVA 1PP9G 3SJLA 4HB1A 3H1ID 1RAPA 1KX2A 1PP9J 2GA1A 1K05A 2NRGA 4K35A 4PD4I 3OAKA 4PV1B 1NO4A 2YKOA 2YQBA 3CC2P 1NTMJ 1Q82Q 2PRRA 3HD7C 1BCCJ 1KQLA 4V2KA 3IF4A 2KOGA 3AE9C 2M8RA 1CSVA 3GF7A 1FZFA 1PL5A 2OZ1A 3Q5PA 2IZ0A 1J3SA 1QL3A 1LFMA 1HCMA 4GOEA 5GTHE 2P10A 1SQQG 2WPRA 3D6ZA 1AVYA 4PD4D 1ZW0A 1FU1A 3R4YA 1SQQJ 2FXMA 3H6PA 1VQ4P 1LWUC 5AW1B 1HJ4A 3USSA 1FZCB 3LW5J 1VQ9P 1T3JA 4XFJA 1CXCA 1X8YA 5TISH 3HUSA 1L0NE 1CCHA 1YI2P 3ORVA 4FA5A 4RESB 4RO0A 5B66H 2P7JA 2YO3A 1AYGA 3WUUA 1KB9E 5CMZA 2YKPA 1ETPA 1LGHB 5CIBB 1M6ZA 2BH5X 2W6BA 5KLIB 2CPBA 4LC1A 5AVYB 3BCCJ 4NFGB 3G4SP 1DVVA 2NPSA 1SQBD 3LW5H 1BDDA 5AW0B 1L0NK 1KILE 3CX5W 2ZXEB 2LIRA 3AEGC 1IJDB 1CSXA 1LNQA 3K5BA 1NU1J 1JM0A 2ZFCA 3H1HG 1EDLA 5EXQA 1JUNA 1T2KC 2GC4D 1GL2A 2R3SA 1URQD 1LTJB 2E74B 1XTGB 2YIUC 3M0AA 5APYA 3TF5A 1SS1A 4H13B 2G8YA 2IBZD 2YO2A 2BLFB 4W80A 1YIQA 1FZAA 1KQFB 1FS0E 2O01H 4JYBA 4AALA 2WSEH 3B5NC 2WVRA 1BE3E 3BVHA 5AW5B 4FA4A 3SFEC 4XYDB 1M1JC 2FYUJ 2XZRA 3G71P 1YJ9P 2QM8A 1YJNP 1KV9A 3JCUH 1DVHA 2YCCA 1CSWA 1M70A 1N50A 3CCQP 4U3FE 3KZIH 3OA8B 4AX3A 1IRVA 3S1KA 5M1BA 1M1KQ 5KJ7D 2Q7CA 3CCEP 2Y0CA 1CHJA 2PP6A 2V4HA 1IZNB 3PHLA 5BU8B 1M90Q 3V2PA 4WQBA 5DF5A 2K3RA 2K1AA 3L71G 5CBNA 3M97X 1KILA 4A7PA 3RL0g 4Y28J 1ZOYC 2B88A 3AE8C 3AE6C 2ZXYA 1KYOE 1X0TA 1NMIA 5GTHV 2C9LY 4LLHA 4D6TG 3ZCFA 1GW3A 2IX7C 1YBKA 4WBAA 1Q7YQ 2C0WA 4PD4H 2BCCE 4D6TJ 3D71A 2KSJA 2WSSH 3L70D 3P8CE 5DJQC 2C1DB 1RF1B 3L74D 1CRCA 3RN0A 1Z56A 3MGNA 4EI2A 3L4MA 3TNUA 3HD7D 1LMSA 1EB7A 1FZEA 2XNDH 3H1JG 1USDA 5AVUB 1QVGO 2MKVA 1LJ2A 3M91A 5AVQB 5DFSA 1KORA 3H1JJ 3MTUE 1YJWP 1YTZT 2WT7B 2FYNC 3C2CA 2DGEA 2HR3A 1MZ9A 3WFBC 3H1KE 2FXPA 1FZBA 1VQNP 1JMBA 3DR0A 5AW9B 2BASA 2WSFJ 3AE4C 2FKWB 2I1JA 2KYVA 3N4XA 1ZZHA 1C6SA 2Q6QA 2E74D 1R8EA 1GJQA 1EZVD 5KKZB 1U57A 2LXBA 1SQXE 1EDKA 1FAVA 5KLVE 1N73B 1J1EB 1J2JB 1BGYD 4DT0A 1DH3A 2HODB 3HTKB 3CCMP 3O5CA 2A06E 2ZAEB 1P84I 2WITA 2Q3IA 3L72D 4NPDA 1HBWA 4FA1A 5AW3B 4WY4A 1GU5A 1G2CA 2LXCB 2VRSA 3MHVA 1JTHB 4W7YA 2AIUA 3TYYA 3L75D 2BGVX 4UB8H 1T2KD 2V7QJ 2KLUA 3PP5A 2PACA 1U75B 4NPEA 3Q5SA 1QGKB 1ZRTE 2XTSB 2D0SA 2J59M 2O3JA 1GZLA 4CPGA 1MFTA 3VN0A 1Q86Q 3GLMA 1E5WA 5CJ0A 4EDFA 1M7LA 3F5HA 3IN6A 4JF7A 1P84D 2QJKB 5AURA 4UB6E 2L4DA 1L0NJ 3VOPA 1WEJF 1IFJA 3V5BA 1ZR2A 2BCCD 3SXTA 1QKSA 4L1QA 1OVVA 1NTKD 1CSUA 1N7SA 1RE3C 3CMAP 2G3AA 1E8EA 1CRIA 4HYTB 3A9FA 2K9YA 4K3IA 1SQPG 3H1HE 1RZ6A 4ASVA 2C9NY 1Y8AA 1RE4A 2BCNB 3VMXA 1CORA 2RKLA 1KC8Q 1HRCA 1AVOA 2N1TB 2KS1B 2O1KA 1RZ5A 4H44B 155CA 1QLED 1AQTA 1HJ0A 3GHGC 2JWAA 1YEBA 2PGDA 1COTA 3SVWA 1NJIQ 1GIWA 2RH0A 3AEFC 5GTIH 4O1QA 3BASA 3ZOYA 1XTCC 3CPWO 2CE0A 3D0WA 1PP9D 1KIBA 1OXZA 2DW3A 1KTMA 2W6JH 3H32A 1X9VA 3MUDA 1WT6A 1M56D 1BE3J 4IFFA 1E79H 2E76B 4O9BA 3RBZA 5E79H 4MN4C 3HRNA 1LTBC 4JCGA 2A45G 3VTPC 4U3FG 1DIIC 2B87A 1NWQA 1BCCD 1AOFA 1PPJG 3EQ2A 1CTJA 2N3BA 1H32A 1QYZA 1VPCA 4U3FJ 2B9BA 1JY2N 1ZN5A 4IFMA 2WPQA 3AE2C 1TU3F 1KFMA 2ZOOA 2N9IA 2OTJP 3L71E 4GEDB 5C9MA 1GU4A 1SQQD 3I55P 4L3GA 2GIWA 2QJPC 3WUVA 2OZ1B 3MK7C 2R3CA 3Q5RA 3F89A 3BRTB 3WMM0 2H89C 1ZRTD 4C7NB 4GT1A 1L9BC 2FWLA 1GMJA 1DW1A 2OYHB 2JQRA 2K9JA 1G1IA 4DCKA 2BCCJ 2C1UA 1CRJA 1BSHA 1OX3A 3AEDC 2OYIA 2O01N 1QL1A 3B8EB 3BCCD 5KJ7C 4PV1C 3GMAA 3M9QA 3RK2B 3SWFA 3HUSB 1I54A 1WRGA 2B0ZB 4UB6V 3OW2O 1DW2A 3WFDC 1P84H 5C39A 1NU1D 1QEXA 2QSIA 1FHBA 1YEAA 5CIFB 4KMGA 3Q1MA 1J1DB 3CCRP 2NPSB 3NBSA 3O8ZA 1IFIA 3RGUA 3AE1C 3H1KG 4OWFA 3L4OA 2ZJSE 4ASWA 4DOJA 2FFDA 1GU2A 1SFCC 1F1CA 3H1KJ 1GQ1A 1H0TA 2YMYA 1M60A 5KAIE 1OIPA 1GL2B 1FZCC 2C0XA 2WPVB 2N1TD 2ZYDA 1CSBA 4H44D 2VHDA 2FYUD 3CXHE 3OCDA 3TGUG 1SQXG 1VL2A 3HE5A 5AW2B 4FA9A 5KLVG 1CTZA 1SQXJ 1KFNA 2Y0DA 2KNCA 2A06G 1YQ4C 1CZQA 1JCCA 1H9YA 5KLIC 4EIJA 2GUSA 1PGQA 3V2NA 1JMMA 1H31A 5TJHA 4KT0J 2E76D 1L2PA 1SFCB 4N78E 4OGQB 1OVUA 4GOFA 4Q5PA 3H1LG 4LGDE 4IL6E 1KQSO 5CBOA 2XDJA 4YXWH 4PJ0H 4DY9A 1VQ7P 1W2LA 1MUUA 3TDKA 1LTJC 3T97B 5CCGA 1D7MA 1PFIA 1ZLLA 2E74C 1DEBA 2HG5D 2OTKE 4H13C 1KILB 1L4AB 4D6TD 1FZGA 3NWVA 2JDIH 1URQA 1KX7A 1JNMA 3ZIYA 4MU8A 2XNXA 3P8MC 2XV5A 1AA0A 1YNRA 1IO3A 1FE6A 3W67A 1AFOA 1SP4A 1H9XA 3AE3C 1SQPE 1NKNA 2AXTE 2HFED 1HTLC 1IZL0 1T3UA 3H1HJ 4WWIA 1NNOA 4H0LB 1K73Q 2MHMA 3CXHI 3AECC 3H1JD 3RK2D 1SQPK 5CCHA 3TNUB 3PXWA 1PGPA 1AJYA 3G6EP 3NTNA 3X39A 1R5SA 2E5TA 4YXDC 3M9HA 1X22A 3II6A 5DJUB 4DZOA 1S5LX 1W2EA 1FBMA 1JY2P 2OQQA 1DW3A 2KP8A 1KD1Q 2HPCA 3VRDA 2H88C 3ZOWA 1W5CE 4C46A 1K9MQ 3WFEC 3RL0B 4EYYQ 5KAIV 1HGVA 1PPJE 3V6IA 1CIFA 4P4QB 1YIJP 4PV1D 3ITKA 1RF0C 3V2RA 1WVEC 4GYDA 1RF1C 2PCCB 5IY51 1RHZB 4GKGA 4W7ZA 3VP9A 3IAOA 1KB9I 4DJGA 1VQLP 3GW6A 1N86A 1CYCA 4TLFA 2WQYC 1YITP 1FJPA 3L71J 3MIWA 3TSIA 4L75A 1IC2A 2E42A 5C0ZA 4WQ8A 4M3LA 3BATA 1H1OA 1I6EA 2HV4A 1GDTA 4TT3H 1UIXA 1VQKP 2JTIB 3HD7A 1ZP0C 3ZOXA 1LTGC 2FRCA 4WY4B 3A0HE 2R44A 1G2CB 1SFCD 2PFXA 3G3ZA 3IFMA 4OGQD 1L0LG 1S5LE 1L0ND 2C2CA 4IL6V 2E5YA 2ZT9B 1NTZE 1A8CA 1QN2A 4WQAA 2WMMA 3PLNA 3CX5E 3A0BE 1KB9D 1JY3O 2QJYB 3M0DC 5AVXB 1VQ6P 3O1YA 5KKZC 2Y9YA 1PZQA 1LWUA 3PXTA 1VQ8P 3U1CA 1LP1A 1KILD 1L4AD 1NTZK 1C6OA 2C1VA 1EQ7A 1SQVG 2N9YB 1N73C 1J1EC 1PGOA 1W5CT 1HJ3A 1HZVA 1N7SB 1GTWA 3Q2YA 2R32A 2D2CB 1OMIA 2M0BA 2IDBA 2CK3H 2A45I 4C7RA 2AXTV 3PXSA 2JO1A 2Z5IA 3KYQA 3JBTB 2KUBA 2L91A 5AVTB 1VF5B 1N90A 2ZVNB 2NZ2A 1C52A 2GB8B 2Z5HA 1CHIA 1NAFA 1S1CX 4H13D 3TGUE 1BE3D 1A2SA 3WUTA 3VP8A 5AVWB 2LR2A 3CD6P 3VMAA 2BEZF 2QJKC 1U74B 3RK3B 5APUA 1F1FA 1KYOI 2WSFH 5B5EE 5AVRB 4HKZH 3SLEA 3S9OA 3O0RC 2AEFA 3HQ9A 3VMZA 2YNYA 4U3FD 3TYIA 2P2UA 3E1IA 3H32B 3L37A 1PPJD 1LT9C 5KAIH 1SQXK 3FX0A 3RK3E 3ZDMA 3VMYA 2ZBOA 1IFNA 5KLVK 3B5NA 5TISE 3H1LE 1FJKA 2B87B 1DT1A 1M1JA 2IYPA 4BRYA 3CX5I 1H32B 3ZBMA 5B66E 2ZYAA 3CCSP 3FWNA 4WQEA 2N1TC 2FYZA 1M8OB 4JBZA 4H44C 1I55A 1B7VA 4KJMA 1KYOD 3ABVC 3V4WA 1QVFO 1MG2D 4RSZA 1GD2E 5GTHH 2E75B 2C1DA 1CI6A 2V7QH 3KPEA 1VQ5P 4L3HA 1ZR4A 1R5LA 3CCVP 1JO5A 2CPSA 5CIDB 2C9XB 1LT9B 3P8CD 1PV3A 1HUCA 2AEMA 3CWBE 3A0HV 3C8VA 3CX5D 4WY4D 2K88A 3B4SA 1S5LV 3L74G 2E76C 1HWTC 2LKMA 1LTIC 1GK6A 3SWSA 2K9JB 1K3GA 3JC22 2JR8A 2ZT9D 1SQPJ 3AEAC 3A0BV 3FXEA 2OYIB 2WT7A 3AEEC 3WUIA 2L5GB 1KB9H 4YTPC 1VYDA 2QE7H 3O20A 1T8ZA 4OVNF 1S2EA 2FY8A 3JCUE 4XXLA 3V2QA 3H1KD 1IK7A 2Z4EA 2Q1KA 3H1IE 1QL4A 1EC5A 3KZIE 1DW0A 1CRGA 2I8FA 3Q3DA 5APQA 1CRHA 2CA3B 3CCJP 1HZUA 1N73A 1EDIA 2I1KA 1H8AA 1CNOA 1EZVG 5AVVB 2Y0EA 2IFNA 1RQVA 2OYHC 1H0TB 2H43A 3O6QA 4JPZB 1SQXD 351CA 3OA7A 4AQRD 1VF5D 2BPBB 5KLVD 4JYCA 3OJAB 1BGYG 4AAMA 1HF9A 1K3HA 2A06D 1IFPA 2W8ZA 3OCDB 1DIPA 3RK2C 4AUWA 3HUSC 1EXJA 2GUVA 3HE5B 4GIFA 3L73G 1GDVA 1CO6A 2N9JA 5B5EV 3RK3D 3NBTA 2I8DA 2KNCB 4PD4E 1JCDA 2N9BA 1I8PA 1J1DC 2A45H 3H1LD 2B10B 1QL2A 2NPSC 1IQCA 1WMKA 2BH4X 1EDJA 1OW6A 3G9RA 2GM4A 1H31B 1KQGB 2Q5UA 5TISV 1E29A 3CC7P 1K04A 1L0LE 3I5CA 1R0QA 1NIRA 2FBWC 4PW9B 5L8RJ 5B66V 1NTZG 4N0KA 2R5BA 4J20A 1GL2C 1NTZJ 5KTBA 3C1LA 1VQOP 4H0JA 3EWKA 4EICA 2ITAA 1YHQP 1KYOH 5B6QA 1G1JA 1C2NA 3PH2B 1RH5B 2K37A 1SQBE 1L0LK 3DP5A 2QG4A 5APSA 1SQVE 2N1TA 2O1JA 3A0HH 3CP5A 2KSEA 4L74A 3H1HD 3LIEA 1S5LH 1CEDA 2RMZA 2KI7B 3CYTI 2AI5A 2V07A 1H33A 3JSVC 1FDMA
chains in the Genus database with same CATH topology
5CIGB 5DFSA 1LC2A 3HQ7A 1CCRA 3C2CA 1MZ4A 2DGEA 3PXWA 1LS9A 3WFBC 1CC5A 3DR0A 4EIDA 3X39A 1A56A 1C7MA 1H33B 1JDLA 1ZZHA 1C6SA 3FWLA 2N18B 1GKSA 1GJQA 1DW3A 3TGUD 1EZVD 5KKZB 3VRDA 1L9JC 3ZOWA 3WFEC 2B11B 5KAIV 1AOQA 3KZIV 2D0WA 4Y5RA 1NTMD 1IRWA 1CIFA 4P4QB 1FI7A 3CXHW 1BGYD 1AKKA 3ITKA 3O5CA 1WVEC 4GYDA 2PCCB 3ZOOA 5IY51 1S6VB 3L72D 1YICA 1OCDA 2B4ZA 2C8SA 4PWAA 4FA1A 3GW6A 3RN1A 1CYCA 3GG2A 1CYJA 3L71D 2AIUA 3L75D 2BGVX 2RN0A 4PJ0V 5C0ZA 4WQ8A 1H1OA 2PACA 1I6EA 4AAOA 2HV4A 1U75B 2JTIB 2XTSB 2D0SA 3ZOXA 2O3JA 2FRCA 1YFCA 4EDFA 4RJTA 1P84D 2QJKB 1L0ND 2C2CA 4FAVA 5AURA 1CIHA 4IL6V 1KYOW 2L4DA 1L0LD 1A8CA 1QN2A 4WQAA 1WEJF 3PLNA 1KB9D 2BCCD 2QJYB 2N18C 3SXTA 1QKSA 1FCDC 4L1QA 1NTKD 3PRJA 2YK3A 3O1YA 3CWBD 3RLMA 1CSUA 1CIGA 3PXTA 2KS1A 4YE1A 4QAOA 1E8EA 1CRIA 3A9FA 4K3IA 1C6OA 2C1VA 5CICB 2N9YB 4WQ9A 1I5TA 1RZ6A 1W5CT 1HJ3A 2BCNB 1SQVD 1HZVA 1CORA 3VYMA 1CHHA 1CRYA 1HRCA 2QJPB 1RZ5A 155CA 3MK7B 1C6RA 4LJIA 2JWAA 1YEBA 3PTZA 2AXTV 1COTA 3DMIA 3PXSA 1FI9A 3VNWA 3CU4A 3SVWA 3JBTB 1GIWA 2EXVA 2L91A 3SJLA 4H0KA 4O1QA 3ZOYA 3H1ID 1N90A 2CE0A 1RAPA 1C52A 1KX2A 1PP9D 4FANA 1KIBA 2GB8B 1FOCA 4WQDA 1CHIA 1BE3D 1A2SA 1C2RA 3CXHD 3VMAA 2YQBA 3WFCC 1U74B 1F1FA 4JCGA 1FI3A 3SLEA 3O0RC 1DIIC 3HQ9A 1BCCD 1AOFA 1CTJA 2N3BA 1H32A 1QYZA 4V2KA 4U3FD 1HH7A 3TYIA 1PPJD 1RAQA 1CSVA 1BL9A 2OZ1A 2ZBOA 1J3SA 1QL3A 1LFMA 2ZOOA 1HROA 1HCMA 2N9IA 4UB8V 1FJ0A 1C75A 2YIUB 4FB1A 2ZONG 1DT1A 4GEDB 5C9MA 4PD4D 1H32B 3ZBMA 1SQQD 1CIEA 4L3GA 4WQEA 2GIWA 3RMZA 1HJ4A 2OZ1B 1I55A 3MK7C 1B7VA 2Q3EA 1KYOD 1CTYA 1CXCA 3WU2V 2N3YA 1ZRTD 451CA 1MG2D 4RSZA 5CIHB 2B12B 1CCHA 1L9BC 2FWLA 1DW1A 2C1DA 2ZZS1 3ORVA 4FA5A 2JQRA 4L3HA 1AYGA 2C1UA 1CRJA 1ETPA 2ORLA 5CIDB 1E2RA 2CA4B 2C9XB 2V08A 5CIBB 1M6ZA 2BH5X 3BCCD 2DVHA 5KLIB 3A0HV 3KHUA 4NFGB 1DVVA 3CX5D 1SQBD 2GC7D 1S5LV 3HQ6A 1I54A 2B0ZB 4UB6V 1MG3D 3CX5W 3SWSA 1N15A 2K9JB 1DW2A 2LIRA 1SQPD 1CSXA 3WFDC 1K3GA 1CYIA 1NU1D 3A0BV 1FHBA 3WUIA 1YEAA 5CIFB 4KMGA 5EXQA 2GC4D 2CXBA 1VYDA 3NBSA 3O20A 3L4OA 1OAEA 5H2FV 2LITA 3TF5A 5GTIV 4XXLA 1GU2A 3H1KD 1F1CA 1YTCA 2IBZD 2BLFB 1GQ1A 1YIQA 1CXAA 1M60A 1QL4A 1DW0A 1CRGA 2I8FA 4AALA 1NMLA 1CRHA 2CA3B 3OA8A 5DJQB 1HZUA 2VHDA 2FYUD 3OCDA 3WC8A 4FA4A 3HQ8A 4XYDB 5E79V 1CNOA 2Y0EA 5KAFV 4FA9A 1KV9A 1DVHA 1SQXD 2YCCA 351CA 1CSWA 1CTZA 1M70A 2Y0DA 1N50A 2BPBB 1KB0A 5KLVD 3OA8B 4AAMA 1H9YA 4EIEA 4AX3A 1IRVA 1K3HA 2A06D 1N9CA 3OCDB 2CE1A 2Y0CA 1CHJA 1GDVA 1H31A 5TJHA 3PHLA 1CO6A 2N9JA 5B5EV 2FYNB 3L73D 4WQBA 3NBTA 5DF5A 1LC1A 2KNCB 4Q5PA 1I8PA 3M97X 4A7PA 3H1LD 4AANA 2B10B 4WQCA 1IQCA 2BH4X 4DY9A 2ZXYA 1W2LA 3TDKA 1NMIA 1YCCA 1H31B 5TISV 5GTHV 1E29A 1R0QA 3ZCFA 1I6DA 1NIRA 1DIQC 4PW9B 5B66V 4D6TD 4N0KA 3NWVA 4J20A 5CIEB 1KX7A 1NTZD 3ZIYA 3L70D 4MU8A 2MTAC 4EIFA 5DJQC 2PCBB 4H0JA 1YNRA 4EICA 5B6QA 4WQ7A 1C2NA 1IO3A 2C1DB 3PH2B 5CYTR 3L74D 1CRCA 3RN0A 3DP5A 2QG4A 1H9XA 3L4MA 1LMSA 3CP5A 1I8OA 1IZL0 1EB7A 3H1HD 1CEDA 2RMZA 4O1WA 1NNOA 3CYTI 2AI5A 2V07A 1HJ5A 2MHMA 1H33A 3H1JD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CIG B;  5DFS A;  1LC2 A;  3HQ7 A;  1CCR A;  3C2C A;  1MZ4 A;  2DGE A;  3PXW A;  1LS9 A;  3WFB C;  1CC5 A;  3DR0 A;  4EID A;  3X39 A;  1A56 A;  1C7M A;  1H33 B;  1JDL A;  1ZZH A;  1C6S A;  3FWL A;  2N18 B;  1GKS A;  1GJQ A;  1DW3 A;  3TGU D;  1EZV D;  5KKZ B;  3VRD A;  1L9J C;  3ZOW A;  3WFE C;  2B11 B;  5KAI V;  1AOQ A;  3KZI V;  2D0W A;  4Y5R A;  1NTM D;  1IRW A;  1CIF A;  4P4Q B;  1FI7 A;  3CXH W;  1BGY D;  1AKK A;  3ITK A;  3O5C A;  1WVE C;  4GYD A;  2PCC B;  3ZOO A;  5IY5 1;  1S6V B;  3L72 D;  1YIC A;  1OCD A;  2B4Z A;  2C8S A;  4PWA A;  4FA1 A;  3GW6 A;  3RN1 A;  1CYC A;  3GG2 A;  1CYJ A;  3L71 D;  2AIU A;  3L75 D;  2BGV X;  2RN0 A;  4PJ0 V;  5C0Z A;  4WQ8 A;  1H1O A;  2PAC A;  1I6E A;  4AAO A;  2HV4 A;  1U75 B;  2JTI B;  2XTS B;  2D0S A;  3ZOX A;  2O3J A;  2FRC A;  1YFC A;  4EDF A;  4RJT A;  1P84 D;  2QJK B;  1L0N D;  2C2C A;  4FAV A;  5AUR A;  1CIH A;  4IL6 V;  1KYO W;  2L4D A;  1L0L D;  1A8C A;  1QN2 A;  4WQA A;  1WEJ F;  3PLN A;  1KB9 D;  2BCC D;  2QJY B;  2N18 C;  3SXT A;  1QKS A;  1FCD C;  4L1Q A;  1NTK D;  3PRJ A;  2YK3 A;  3O1Y A;  3CWB D;  3RLM A;  1CSU A;  1CIG A;  3PXT A;  2KS1 A;  4YE1 A;  4QAO A;  1E8E A;  1CRI A;  3A9F A;  4K3I A;  1C6O A;  2C1V A;  5CIC B;  2N9Y B;  4WQ9 A;  1I5T A;  1RZ6 A;  1W5C T;  1HJ3 A;  2BCN B;  1SQV D;  1HZV A;  1COR A;  3VYM A;  1CHH A;  1CRY A;  1HRC A;  2QJP B;  1RZ5 A;  155C A;  3MK7 B;  1C6R A;  4LJI A;  2JWA A;  1YEB A;  3PTZ A;  2AXT V;  1COT A;  3DMI A;  3PXS A;  1FI9 A;  3VNW A;  3CU4 A;  3SVW A;  3JBT B;  1GIW A;  2EXV A;  2L91 A;  3SJL A;  4H0K A;  4O1Q A;  3ZOY A;  3H1I D;  1N90 A;  2CE0 A;  1RAP A;  1C52 A;  1KX2 A;  1PP9 D;  4FAN A;  1KIB A;  2GB8 B;  1FOC A;  4WQD A;  1CHI A;  1BE3 D;  1A2S A;  1C2R A;  3CXH D;  3VMA A;  2YQB A;  3WFC C;  1U74 B;  1F1F A;  4JCG A;  1FI3 A;  3SLE A;  3O0R C;  1DII C;  3HQ9 A;  1BCC D;  1AOF A;  1CTJ A;  2N3B A;  1H32 A;  1QYZ A;  4V2K A;  4U3F D;  1HH7 A;  3TYI A;  1PPJ D;  1RAQ A;  1CSV A;  1BL9 A;  2OZ1 A;  2ZBO A;  1J3S A;  1QL3 A;  1LFM A;  2ZOO A;  1HRO A;  1HCM A;  2N9I A;  4UB8 V;  1FJ0 A;  1C75 A;  2YIU B;  4FB1 A;  2ZON G;  1DT1 A;  4GED B;  5C9M A;  4PD4 D;  1H32 B;  3ZBM A;  1SQQ D;  1CIE A;  4L3G A;  4WQE A;  2GIW A;  3RMZ A;  1HJ4 A;  2OZ1 B;  1I55 A;  3MK7 C;  1B7V A;  2Q3E A;  1KYO D;  1CTY A;  1CXC A;  3WU2 V;  2N3Y A;  1ZRT D;  451C A;  1MG2 D;  4RSZ A;  5CIH B;  2B12 B;  1CCH A;  1L9B C;  2FWL A;  1DW1 A;  2C1D A;  2ZZS 1;  3ORV A;  4FA5 A;  2JQR A;  4L3H A;  1AYG A;  2C1U A;  1CRJ A;  1ETP A;  2ORL A;  5CID B;  1E2R A;  2CA4 B;  2C9X B;  2V08 A;  5CIB B;  1M6Z A;  2BH5 X;  3BCC D;  2DVH A;  5KLI B;  3A0H V;  3KHU A;  4NFG B;  1DVV A;  3CX5 D;  1SQB D;  2GC7 D;  1S5L V;  3HQ6 A;  1I54 A;  2B0Z B;  4UB6 V;  1MG3 D;  3CX5 W;  3SWS A;  1N15 A;  2K9J B;  1DW2 A;  2LIR A;  1SQP D;  1CSX A;  3WFD C;  1K3G A;  1CYI A;  1NU1 D;  3A0B V;  1FHB A;  3WUI A;  1YEA A;  5CIF B;  4KMG A;  5EXQ A;  2GC4 D;  2CXB A;  1VYD A;  3NBS A;  3O20 A;  3L4O A;  1OAE A;  5H2F V;  2LIT A;  3TF5 A;  5GTI V;  4XXL A;  1GU2 A;  3H1K D;  1F1C A;  1YTC A;  2IBZ D;  2BLF B;  1GQ1 A;  1YIQ A;  1CXA A;  1M60 A;  1QL4 A;  1DW0 A;  1CRG A;  2I8F A;  4AAL A;  1NML A;  1CRH A;  2CA3 B;  3OA8 A;  5DJQ B;  1HZU A;  2VHD A;  2FYU D;  3OCD A;  3WC8 A;  4FA4 A;  3HQ8 A;  4XYD B;  5E79 V;  1CNO A;  2Y0E A;  5KAF V;  4FA9 A;  1KV9 A;  1DVH A;  1SQX D;  2YCC A;  351C A;  1CSW A;  1CTZ A;  1M70 A;  2Y0D A;  1N50 A;  2BPB B;  1KB0 A;  5KLV D;  3OA8 B;  4AAM A;  1H9Y A;  4EIE A;  4AX3 A;  1IRV A;  1K3H A;  2A06 D;  1N9C A;  3OCD B;  2CE1 A;  2Y0C A;  1CHJ A;  1GDV A;  1H31 A;  5TJH A;  3PHL A;  1CO6 A;  2N9J A;  5B5E V;  2FYN B;  3L73 D;  4WQB A;  3NBT A;  5DF5 A;  1LC1 A;  2KNC B;  4Q5P A;  1I8P A;  3M97 X;  4A7P A;  3H1L D;  4AAN A;  2B10 B;  4WQC A;  1IQC A;  2BH4 X;  4DY9 A;  2ZXY A;  1W2L A;  3TDK A;  1NMI A;  1YCC A;  1H31 B;  5TIS V;  5GTH V;  1E29 A;  1R0Q A;  3ZCF A;  1I6D A;  1NIR A;  1DIQ C;  4PW9 B;  5B66 V;  4D6T D;  4N0K A;  3NWV A;  4J20 A;  5CIE B;  1KX7 A;  1NTZ D;  3ZIY A;  3L70 D;  4MU8 A;  2MTA C;  4EIF A;  5DJQ C;  2PCB B;  4H0J A;  1YNR A;  4EIC A;  5B6Q A;  4WQ7 A;  1C2N A;  1IO3 A;  2C1D B;  3PH2 B;  5CYT R;  3L74 D;  1CRC A;  3RN0 A;  3DP5 A;  2QG4 A;  1H9X A;  3L4M A;  1LMS A;  3CP5 A;  1I8O A;  1IZL 0;  1EB7 A;  3H1H D;  1CED A;  2RMZ A;  4O1W A;  1NNO A;  3CYT I;  2AI5 A;  2V07 A;  1HJ5 A;  2MHM A;  1H33 A;  3H1J D; 
#chains in the Genus database with same CATH topology
 3CX5 H;  4IL6 X;  3MD0 A;  3HQ7 A;  3HE4 A;  1SQV K;  1IK9 A;  2W6A A;  2WZ7 A;  1CCR A;  4OGQ C;  1MZ4 A;  3V4Q A;  1LS9 A;  1CC5 A;  1RE3 A;  2IBZ E;  4EID A;  2M5A A;  1NKZ B;  1IFM A;  1A56 A;  3A3Y B;  1C7M A;  2H8P D;  4NPF X;  2IPP A;  3NMD A;  1A02 J;  2N18 B;  4WVZ A;  3U59 A;  3CLQ A;  3TGU J;  1KIL C;  1L4A C;  1NTM G;  2B11 B;  3GHG A;  1KMI Z;  1AOQ A;  2QM7 A;  5KLV J;  1W2B O;  3KZI V;  4UB8 E;  2D0W A;  2XKM A;  1GW4 A;  1IRW A;  3P32 A;  1FI7 A;  1BCC G;  3FXD A;  1RQU A;  3E1R A;  3GF3 A;  2HPC B;  5EFW B;  4ZMD A;  1S6V B;  1YIC A;  1OCD A;  2B4Z A;  3L35 A;  2ZYG A;  5APT A;  2SPZ A;  4BWN A;  4PWA A;  2KXP B;  4I7Z B;  3GG2 A;  3WU2 E;  1CYJ A;  3L71 D;  3H1L J;  4H0L C;  5AW6 B;  4C7N A;  5B5E H;  1YYC A;  2OYH A;  3QH9 A;  5CJ4 A;  2KIK A;  3M9B A;  4RJT A;  5AW7 B;  1KYO W;  2YKQ A;  1L0L D;  3L70 E;  1PGJ A;  1S3J A;  3W68 A;  3HD7 B;  3CWB G;  1KN7 A;  3PH0 A;  3BCC G;  2W90 A;  2POH A;  3L74 E;  3UIA A;  1CIG A;  3CWB J;  4GDO A;  4YE1 A;  2IBZ I;  3RL0 C;  2IYO A;  3M06 A;  3R2P A;  2W83 C;  4UB6 H;  1USE A;  5H2F E;  1NU1 G;  5GTI E;  1SQV D;  1AQ5 A;  1BDC A;  5CCG D;  3N7N A;  3VYM A;  1RY3 A;  4Z1M H;  2O01 J;  1OFC X;  4I6M C;  4AYC A;  1LWU B;  2WSE J;  3CME P;  1NVO A;  1LP1 B;  1C6R A;  3SWK A;  5KJ7 A;  3D6Y A;  4LJI A;  1X79 B;  3KXD A;  4OH8 B;  5E79 E;  1FI9 A;  4WB4 A;  4ZNC A;  5KAF E;  3H1I G;  2NPS D;  2OAR A;  2HYN A;  1NGM B;  4H0K A;  1N7L A;  2KZJ A;  3H1I J;  4JQ0 D;  4FAN A;  1FOC A;  4WQD A;  4WY4 C;  1EZV E;  3TK1 A;  1C2R A;  2FYU G;  3CXH D;  2IZ1 A;  2M3B A;  1LTT C;  2JJL A;  3WFC C;  2ZT9 C;  1GL2 D;  3H25 A;  1FI3 A;  1N8R Q;  1BGY E;  3KDP B;  4Y99 C;  1JY2 O;  2QJY C;  2Q9I A;  1SFC A;  1VQM P;  1HH7 A;  5CCH D;  1RAQ A;  2Y9Z A;  3SSU A;  3L73 E;  2YXQ B;  3L72 E;  1BL9 A;  1FZC A;  1HRO A;  4UB8 V;  1FJ0 A;  1C75 A;  2YIU B;  3L4F A;  4FB1 A;  2AXC A;  3T97 A;  3EFG A;  3L75 E;  2ZON G;  4N78 D;  3LID A;  1GK4 A;  1CIE A;  2H7H A;  2P1J A;  2P58 A;  3RMZ A;  1Y9B A;  1N7S C;  1YQ3 C;  1DEE G;  1VQP P;  1L4A A;  1N2D C;  2D2C C;  2Q3E A;  1CTY A;  1OWA A;  3B5N B;  2ZXX A;  2OGU A;  3WU2 V;  2N3Y A;  451C A;  1M1J B;  1MKM A;  1RE4 C;  1LTA C;  4BRY B;  1P84 E;  1L0L J;  1JEK A;  5CIH B;  2B12 B;  1JY3 P;  5BVZ A;  2ZZS 1;  5APW A;  1VF5 C;  4Y99 B;  1MFZ A;  4K3A A;  1UII A;  2ORL A;  1E2R A;  2CA4 B;  2V08 A;  2DVH A;  1NTK E;  1SLQ A;  1SQB G;  1HVV A;  3KHU A;  3CCU P;  4ZKU A;  1HH0 A;  3CL3 D;  3HQ6 A;  2GC7 D;  5DJT B;  2M3E A;  1SQB J;  4L73 A;  2YMK A;  1LTJ A;  1CI6 B;  1MG3 D;  3RK3 C;  1N15 A;  1SQP D;  1S4X A;  1S72 P;  2E43 A;  1CYI A;  1SQV J;  1LTS C;  3SFD C;  1S9K E;  1OVR A;  5BU5 A;  1JOC A;  1NTK K;  3MUD C;  1Q2N A;  1EZV I;  1DX7 A;  2CXB A;  1ZME C;  4ZKP A;  1NYH A;  2WPS A;  5CHX A;  1OAE A;  2IBZ G;  5H2F V;  2LIT A;  3P7K A;  3D70 A;  5GTI V;  4H0L D;  1OW8 A;  4RKU J;  1YTC A;  2QIW A;  1CXA A;  3C9I A;  2WTY A;  1PP9 E;  1NML A;  5K5G B;  3OA8 A;  5DJQ B;  1Q81 Q;  1YTZ I;  3WC8 A;  3HQ8 A;  5E79 V;  1NTM E;  2E75 C;  5KAF V;  1LT1 A;  4N6J A;  1A02 F;  1BCC E;  1KB0 A;  2B89 A;  1FDO A;  4EIE A;  4PJ0 E;  1ZXG A;  1CW5 A;  1N9C A;  3E7K A;  1KZU B;  2CE1 A;  3RL0 D;  1NTM K;  3CXH H;  3O6Q B;  2JP3 A;  1EXI A;  2FYN B;  3L73 D;  1LC1 A;  1NAY A;  1SQQ E;  2XU6 A;  4IOI H;  2OYI C;  3I56 P;  1FOS E;  4AAN A;  4WQC A;  2KB7 P;  3VYI A;  4QMA A;  3AE5 C;  1YCC A;  3AE7 C;  3BRV B;  1DD4 A;  2ZVO B;  1RF0 A;  2WWW A;  1MV8 A;  1RF1 A;  1I6D A;  2KK7 A;  4U7J A;  1DIQ C;  5APX A;  1SQQ K;  1Q90 D;  5AW4 B;  3L70 G;  1L0N G;  1OW7 A;  5CIE B;  4R4L A;  1NTZ D;  1FOS F;  1JB0 J;  3WU2 H;  3NXS A;  4IL6 H;  2MTA C;  3L70 J;  2QA4 P;  4EIF A;  3BCC E;  2PCB B;  4WQ7 A;  3B5N D;  5CYT R;  2FFD C;  2P67 A;  3L74 J;  1BSN A;  1IO4 A;  3KQG A;  3CCL P;  1NU1 E;  3PJS K;  2R5D A;  1SVF A;  3A7O A;  1I8O A;  1IFD A;  3U1A A;  4O1W A;  3IR9 A;  1HJ5 A;  4IFD K;  3NFQ A;  1S9K D;  5CIG B;  1LC2 A;  3A5T A;  2BEQ D;  1QX8 A;  2KLV A;  4L76 A;  1NU1 K;  3M0D A;  4BXL A;  1U7J A;  1Y47 A;  1FC2 C;  3CC4 P;  2AXT H;  1N7S D;  2KZI A;  2QEX P;  1H33 B;  2D2C D;  5H2F H;  3FGA D;  1T6A A;  1JDL A;  4KHX A;  2PAJ A;  3HE4 B;  2HOD A;  3FWL A;  3HTK A;  2FFD B;  2FYU E;  1GKS A;  4HH2 A;  1H88 A;  3TGU D;  1BE3 G;  5AVZ B;  2JKV A;  4GOD A;  1L9J C;  1HGZ A;  2M5A B;  2MJZ A;  3L36 A;  4Y5R A;  2OTL P;  1NTM D;  1JTH A;  2OYO A;  1DD3 A;  5CCG C;  3CXH W;  1NHL A;  1AKK A;  2W27 A;  5KAF H;  1BGY J;  4XE5 B;  2J58 A;  3CI9 A;  2FYU K;  3L72 G;  3RBX A;  2QVA A;  2J5U A;  3ZOO A;  2UWJ E;  3L73 J;  3AEB C;  3GHG B;  3L72 J;  2C8S A;  5APV A;  1URQ C;  1OZH A;  3L75 G;  1ZV8 A;  2WSC J;  3RN1 A;  3EFF K;  2YXR B;  3SWY A;  2RN0 A;  3B71 A;  3L75 J;  4PJ0 V;  4I2L C;  1PIX A;  4EOT A;  4HJG H;  1K8A Q;  5AVS B;  4AAO A;  1AV1 A;  4B86 A;  1M57 D;  1YFC A;  2JWD A;  1FDI A;  1LT9 A;  4YPC A;  4R4M A;  4D6T E;  1U7M A;  4FAV A;  1CIH A;  2WSC H;  2FXO A;  2IFM A;  2BCC G;  3MZW B;  4N3Y B;  1NTK G;  5CCH C;  2N18 C;  1H89 A;  1VDF A;  1FCD C;  2E75 D;  2YK3 A;  3RLM A;  3CWB D;  3PRJ A;  1JY3 N;  1NTK J;  1URQ B;  2KS1 A;  4QAO A;  3A2A A;  5CIC B;  4WQ9 A;  1I5T A;  1NH4 A;  4I1L A;  2AEJ A;  1SQB K;  3MP7 B;  3QWO C;  3A0B H;  1CHH A;  2QRX A;  4XA4 A;  1CRY A;  3S4R A;  3H1J E;  2QJP B;  2JEE A;  5AW8 B;  1HJB A;  3MK7 B;  1NOH A;  1KV4 A;  3PTZ A;  4I7Z C;  2HLO A;  3DMI A;  3VNW A;  3CU4 A;  2EXV A;  1PP9 G;  3SJL A;  4HB1 A;  3H1I D;  1RAP A;  1KX2 A;  1PP9 J;  2GA1 A;  1K05 A;  2NRG A;  4K35 A;  4PD4 I;  3OAK A;  4PV1 B;  1NO4 A;  2YKO A;  2YQB A;  3CC2 P;  1NTM J;  1Q82 Q;  2PRR A;  3HD7 C;  1BCC J;  1KQL A;  4V2K A;  3IF4 A;  2KOG A;  3AE9 C;  2M8R A;  1CSV A;  3GF7 A;  1FZF A;  1PL5 A;  2OZ1 A;  3Q5P A;  2IZ0 A;  1J3S A;  1QL3 A;  1LFM A;  1HCM A;  4GOE A;  5GTH E;  2P10 A;  1SQQ G;  2WPR A;  3D6Z A;  1AVY A;  4PD4 D;  1ZW0 A;  1FU1 A;  3R4Y A;  1SQQ J;  2FXM A;  3H6P A;  1VQ4 P;  1LWU C;  5AW1 B;  1HJ4 A;  3USS A;  1FZC B;  3LW5 J;  1VQ9 P;  1T3J A;  4XFJ A;  1CXC A;  1X8Y A;  5TIS H;  3HUS A;  1L0N E;  1CCH A;  1YI2 P;  3ORV A;  4FA5 A;  4RES B;  4RO0 A;  5B66 H;  2P7J A;  2YO3 A;  1AYG A;  3WUU A;  1KB9 E;  5CMZ A;  2YKP A;  1ETP A;  1LGH B;  5CIB B;  1M6Z A;  2BH5 X;  2W6B A;  5KLI B;  2CPB A;  4LC1 A;  5AVY B;  3BCC J;  4NFG B;  3G4S P;  1DVV A;  2NPS A;  1SQB D;  3LW5 H;  1BDD A;  5AW0 B;  1L0N K;  1KIL E;  3CX5 W;  2ZXE B;  2LIR A;  3AEG C;  1IJD B;  1CSX A;  1LNQ A;  3K5B A;  1NU1 J;  1JM0 A;  2ZFC A;  3H1H G;  1EDL A;  5EXQ A;  1JUN A;  1T2K C;  2GC4 D;  1GL2 A;  2R3S A;  1URQ D;  1LTJ B;  2E74 B;  1XTG B;  2YIU C;  3M0A A;  5APY A;  3TF5 A;  1SS1 A;  4H13 B;  2G8Y A;  2IBZ D;  2YO2 A;  2BLF B;  4W80 A;  1YIQ A;  1FZA A;  1KQF B;  1FS0 E;  2O01 H;  4JYB A;  4AAL A;  2WSE H;  3B5N C;  2WVR A;  1BE3 E;  3BVH A;  5AW5 B;  4FA4 A;  3SFE C;  4XYD B;  1M1J C;  2FYU J;  2XZR A;  3G71 P;  1YJ9 P;  2QM8 A;  1YJN P;  1KV9 A;  3JCU H;  1DVH A;  2YCC A;  1CSW A;  1M70 A;  1N50 A;  3CCQ P;  4U3F E;  3KZI H;  3OA8 B;  4AX3 A;  1IRV A;  3S1K A;  5M1B A;  1M1K Q;  5KJ7 D;  2Q7C A;  3CCE P;  2Y0C A;  1CHJ A;  2PP6 A;  2V4H A;  1IZN B;  3PHL A;  5BU8 B;  1M90 Q;  3V2P A;  4WQB A;  5DF5 A;  2K3R A;  2K1A A;  3L71 G;  5CBN A;  3M97 X;  1KIL A;  4A7P A;  3RL0 g;  4Y28 J;  1ZOY C;  2B88 A;  3AE8 C;  3AE6 C;  2ZXY A;  1KYO E;  1X0T A;  1NMI A;  5GTH V;  2C9L Y;  4LLH A;  4D6T G;  3ZCF A;  1GW3 A;  2IX7 C;  1YBK A;  4WBA A;  1Q7Y Q;  2C0W A;  4PD4 H;  2BCC E;  4D6T J;  3D71 A;  2KSJ A;  2WSS H;  3L70 D;  3P8C E;  5DJQ C;  2C1D B;  1RF1 B;  3L74 D;  1CRC A;  3RN0 A;  1Z56 A;  3MGN A;  4EI2 A;  3L4M A;  3TNU A;  3HD7 D;  1LMS A;  1EB7 A;  1FZE A;  2XND H;  3H1J G;  1USD A;  5AVU B;  1QVG O;  2MKV A;  1LJ2 A;  3M91 A;  5AVQ B;  5DFS A;  1KOR A;  3H1J J;  3MTU E;  1YJW P;  1YTZ T;  2WT7 B;  2FYN C;  3C2C A;  2DGE A;  2HR3 A;  1MZ9 A;  3WFB C;  3H1K E;  2FXP A;  1FZB A;  1VQN P;  1JMB A;  3DR0 A;  5AW9 B;  2BAS A;  2WSF J;  3AE4 C;  2FKW B;  2I1J A;  2KYV A;  3N4X A;  1ZZH A;  1C6S A;  2Q6Q A;  2E74 D;  1R8E A;  1GJQ A;  1EZV D;  5KKZ B;  1U57 A;  2LXB A;  1SQX E;  1EDK A;  1FAV A;  5KLV E;  1N73 B;  1J1E B;  1J2J B;  1BGY D;  4DT0 A;  1DH3 A;  2HOD B;  3HTK B;  3CCM P;  3O5C A;  2A06 E;  2ZAE B;  1P84 I;  2WIT A;  2Q3I A;  3L72 D;  4NPD A;  1HBW A;  4FA1 A;  5AW3 B;  4WY4 A;  1GU5 A;  1G2C A;  2LXC B;  2VRS A;  3MHV A;  1JTH B;  4W7Y A;  2AIU A;  3TYY A;  3L75 D;  2BGV X;  4UB8 H;  1T2K D;  2V7Q J;  2KLU A;  3PP5 A;  2PAC A;  1U75 B;  4NPE A;  3Q5S A;  1QGK B;  1ZRT E;  2XTS B;  2D0S A;  2J59 M;  2O3J A;  1GZL A;  4CPG A;  1MFT A;  3VN0 A;  1Q86 Q;  3GLM A;  1E5W A;  5CJ0 A;  4EDF A;  1M7L A;  3F5H A;  3IN6 A;  4JF7 A;  1P84 D;  2QJK B;  5AUR A;  4UB6 E;  2L4D A;  1L0N J;  3VOP A;  1WEJ F;  1IFJ A;  3V5B A;  1ZR2 A;  2BCC D;  3SXT A;  1QKS A;  4L1Q A;  1OVV A;  1NTK D;  1CSU A;  1N7S A;  1RE3 C;  3CMA P;  2G3A A;  1E8E A;  1CRI A;  4HYT B;  3A9F A;  2K9Y A;  4K3I A;  1SQP G;  3H1H E;  1RZ6 A;  4ASV A;  2C9N Y;  1Y8A A;  1RE4 A;  2BCN B;  3VMX A;  1COR A;  2RKL A;  1KC8 Q;  1HRC A;  1AVO A;  2N1T B;  2KS1 B;  2O1K A;  1RZ5 A;  4H44 B;  155C A;  1QLE D;  1AQT A;  1HJ0 A;  3GHG C;  2JWA A;  1YEB A;  2PGD A;  1COT A;  3SVW A;  1NJI Q;  1GIW A;  2RH0 A;  3AEF C;  5GTI H;  4O1Q A;  3BAS A;  3ZOY A;  1XTC C;  3CPW O;  2CE0 A;  3D0W A;  1PP9 D;  1KIB A;  1OXZ A;  2DW3 A;  1KTM A;  2W6J H;  3H32 A;  1X9V A;  3MUD A;  1WT6 A;  1M56 D;  1BE3 J;  4IFF A;  1E79 H;  2E76 B;  4O9B A;  3RBZ A;  5E79 H;  4MN4 C;  3HRN A;  1LTB C;  4JCG A;  2A45 G;  3VTP C;  4U3F G;  1DII C;  2B87 A;  1NWQ A;  1BCC D;  1AOF A;  1PPJ G;  3EQ2 A;  1CTJ A;  2N3B A;  1H32 A;  1QYZ A;  1VPC A;  4U3F J;  2B9B A;  1JY2 N;  1ZN5 A;  4IFM A;  2WPQ A;  3AE2 C;  1TU3 F;  1KFM A;  2ZOO A;  2N9I A;  2OTJ P;  3L71 E;  4GED B;  5C9M A;  1GU4 A;  1SQQ D;  3I55 P;  4L3G A;  2GIW A;  2QJP C;  3WUV A;  2OZ1 B;  3MK7 C;  2R3C A;  3Q5R A;  3F89 A;  3BRT B;  3WMM 0;  2H89 C;  1ZRT D;  4C7N B;  4GT1 A;  1L9B C;  2FWL A;  1GMJ A;  1DW1 A;  2OYH B;  2JQR A;  2K9J A;  1G1I A;  4DCK A;  2BCC J;  2C1U A;  1CRJ A;  1BSH A;  1OX3 A;  3AED C;  2OYI A;  2O01 N;  1QL1 A;  3B8E B;  3BCC D;  5KJ7 C;  4PV1 C;  3GMA A;  3M9Q A;  3RK2 B;  3SWF A;  3HUS B;  1I54 A;  1WRG A;  2B0Z B;  4UB6 V;  3OW2 O;  1DW2 A;  3WFD C;  1P84 H;  5C39 A;  1NU1 D;  1QEX A;  2QSI A;  1FHB A;  1YEA A;  5CIF B;  4KMG A;  3Q1M A;  1J1D B;  3CCR P;  2NPS B;  3NBS A;  3O8Z A;  1IFI A;  3RGU A;  3AE1 C;  3H1K G;  4OWF A;  3L4O A;  2ZJS E;  4ASW A;  4DOJ A;  2FFD A;  1GU2 A;  1SFC C;  1F1C A;  3H1K J;  1GQ1 A;  1H0T A;  2YMY A;  1M60 A;  5KAI E;  1OIP A;  1GL2 B;  1FZC C;  2C0X A;  2WPV B;  2N1T D;  2ZYD A;  1CSB A;  4H44 D;  2VHD A;  2FYU D;  3CXH E;  3OCD A;  3TGU G;  1SQX G;  1VL2 A;  3HE5 A;  5AW2 B;  4FA9 A;  5KLV G;  1CTZ A;  1SQX J;  1KFN A;  2Y0D A;  2KNC A;  2A06 G;  1YQ4 C;  1CZQ A;  1JCC A;  1H9Y A;  5KLI C;  4EIJ A;  2GUS A;  1PGQ A;  3V2N A;  1JMM A;  1H31 A;  5TJH A;  4KT0 J;  2E76 D;  1L2P A;  1SFC B;  4N78 E;  4OGQ B;  1OVU A;  4GOF A;  4Q5P A;  3H1L G;  4LGD E;  4IL6 E;  1KQS O;  5CBO A;  2XDJ A;  4YXW H;  4PJ0 H;  4DY9 A;  1VQ7 P;  1W2L A;  1MUU A;  3TDK A;  1LTJ C;  3T97 B;  5CCG A;  1D7M A;  1PFI A;  1ZLL A;  2E74 C;  1DEB A;  2HG5 D;  2OTK E;  4H13 C;  1KIL B;  1L4A B;  4D6T D;  1FZG A;  3NWV A;  2JDI H;  1URQ A;  1KX7 A;  1JNM A;  3ZIY A;  4MU8 A;  2XNX A;  3P8M C;  2XV5 A;  1AA0 A;  1YNR A;  1IO3 A;  1FE6 A;  3W67 A;  1AFO A;  1SP4 A;  1H9X A;  3AE3 C;  1SQP E;  1NKN A;  2AXT E;  2HFE D;  1HTL C;  1IZL 0;  1T3U A;  3H1H J;  4WWI A;  1NNO A;  4H0L B;  1K73 Q;  2MHM A;  3CXH I;  3AEC C;  3H1J D;  3RK2 D;  1SQP K;  5CCH A;  3TNU B;  3PXW A;  1PGP A;  1AJY A;  3G6E P;  3NTN A;  3X39 A;  1R5S A;  2E5T A;  4YXD C;  3M9H A;  1X22 A;  3II6 A;  5DJU B;  4DZO A;  1S5L X;  1W2E A;  1FBM A;  1JY2 P;  2OQQ A;  1DW3 A;  2KP8 A;  1KD1 Q;  2HPC A;  3VRD A;  2H88 C;  3ZOW A;  1W5C E;  4C46 A;  1K9M Q;  3WFE C;  3RL0 B;  4EYY Q;  5KAI V;  1HGV A;  1PPJ E;  3V6I A;  1CIF A;  4P4Q B;  1YIJ P;  4PV1 D;  3ITK A;  1RF0 C;  3V2R A;  1WVE C;  4GYD A;  1RF1 C;  2PCC B;  5IY5 1;  1RHZ B;  4GKG A;  4W7Z A;  3VP9 A;  3IAO A;  1KB9 I;  4DJG A;  1VQL P;  3GW6 A;  1N86 A;  1CYC A;  4TLF A;  2WQY C;  1YIT P;  1FJP A;  3L71 J;  3MIW A;  3TSI A;  4L75 A;  1IC2 A;  2E42 A;  5C0Z A;  4WQ8 A;  4M3L A;  3BAT A;  1H1O A;  1I6E A;  2HV4 A;  1GDT A;  4TT3 H;  1UIX A;  1VQK P;  2JTI B;  3HD7 A;  1ZP0 C;  3ZOX A;  1LTG C;  2FRC A;  4WY4 B;  3A0H E;  2R44 A;  1G2C B;  1SFC D;  2PFX A;  3G3Z A;  3IFM A;  4OGQ D;  1L0L G;  1S5L E;  1L0N D;  2C2C A;  4IL6 V;  2E5Y A;  2ZT9 B;  1NTZ E;  1A8C A;  1QN2 A;  4WQA A;  2WMM A;  3PLN A;  3CX5 E;  3A0B E;  1KB9 D;  1JY3 O;  2QJY B;  3M0D C;  5AVX B;  1VQ6 P;  3O1Y A;  5KKZ C;  2Y9Y A;  1PZQ A;  1LWU A;  3PXT A;  1VQ8 P;  3U1C A;  1LP1 A;  1KIL D;  1L4A D;  1NTZ K;  1C6O A;  2C1V A;  1EQ7 A;  1SQV G;  2N9Y B;  1N73 C;  1J1E C;  1PGO A;  1W5C T;  1HJ3 A;  1HZV A;  1N7S B;  1GTW A;  3Q2Y A;  2R32 A;  2D2C B;  1OMI A;  2M0B A;  2IDB A;  2CK3 H;  2A45 I;  4C7R A;  2AXT V;  3PXS A;  2JO1 A;  2Z5I A;  3KYQ A;  3JBT B;  2KUB A;  2L91 A;  5AVT B;  1VF5 B;  1N90 A;  2ZVN B;  2NZ2 A;  1C52 A;  2GB8 B;  2Z5H A;  1CHI A;  1NAF A;  1S1C X;  4H13 D;  3TGU E;  1BE3 D;  1A2S A;  3WUT A;  3VP8 A;  5AVW B;  2LR2 A;  3CD6 P;  3VMA A;  2BEZ F;  2QJK C;  1U74 B;  3RK3 B;  5APU A;  1F1F A;  1KYO I;  2WSF H;  5B5E E;  5AVR B;  4HKZ H;  3SLE A;  3S9O A;  3O0R C;  2AEF A;  3HQ9 A;  3VMZ A;  2YNY A;  4U3F D;  3TYI A;  2P2U A;  3E1I A;  3H32 B;  3L37 A;  1PPJ D;  1LT9 C;  5KAI H;  1SQX K;  3FX0 A;  3RK3 E;  3ZDM A;  3VMY A;  2ZBO A;  1IFN A;  5KLV K;  3B5N A;  5TIS E;  3H1L E;  1FJK A;  2B87 B;  1DT1 A;  1M1J A;  2IYP A;  4BRY A;  3CX5 I;  1H32 B;  3ZBM A;  5B66 E;  2ZYA A;  3CCS P;  3FWN A;  4WQE A;  2N1T C;  2FYZ A;  1M8O B;  4JBZ A;  4H44 C;  1I55 A;  1B7V A;  4KJM A;  1KYO D;  3ABV C;  3V4W A;  1QVF O;  1MG2 D;  4RSZ A;  1GD2 E;  5GTH H;  2E75 B;  2C1D A;  1CI6 A;  2V7Q H;  3KPE A;  1VQ5 P;  4L3H A;  1ZR4 A;  1R5L A;  3CCV P;  1JO5 A;  2CPS A;  5CID B;  2C9X B;  1LT9 B;  3P8C D;  1PV3 A;  1HUC A;  2AEM A;  3CWB E;  3A0H V;  3C8V A;  3CX5 D;  4WY4 D;  2K88 A;  3B4S A;  1S5L V;  3L74 G;  2E76 C;  1HWT C;  2LKM A;  1LTI C;  1GK6 A;  3SWS A;  2K9J B;  1K3G A;  3JC2 2;  2JR8 A;  2ZT9 D;  1SQP J;  3AEA C;  3A0B V;  3FXE A;  2OYI B;  2WT7 A;  3AEE C;  3WUI A;  2L5G B;  1KB9 H;  4YTP C;  1VYD A;  2QE7 H;  3O20 A;  1T8Z A;  4OVN F;  1S2E A;  2FY8 A;  3JCU E;  4XXL A;  3V2Q A;  3H1K D;  1IK7 A;  2Z4E A;  2Q1K A;  3H1I E;  1QL4 A;  1EC5 A;  3KZI E;  1DW0 A;  1CRG A;  2I8F A;  3Q3D A;  5APQ A;  1CRH A;  2CA3 B;  3CCJ P;  1HZU A;  1N73 A;  1EDI A;  2I1K A;  1H8A A;  1CNO A;  1EZV G;  5AVV B;  2Y0E A;  2IFN A;  1RQV A;  2OYH C;  1H0T B;  2H43 A;  3O6Q A;  4JPZ B;  1SQX D;  351C A;  3OA7 A;  4AQR D;  1VF5 D;  2BPB B;  5KLV D;  4JYC A;  3OJA B;  1BGY G;  4AAM A;  1HF9 A;  1K3H A;  2A06 D;  1IFP A;  2W8Z A;  3OCD B;  1DIP A;  3RK2 C;  4AUW A;  3HUS C;  1EXJ A;  2GUV A;  3HE5 B;  4GIF A;  3L73 G;  1GDV A;  1CO6 A;  2N9J A;  5B5E V;  3RK3 D;  3NBT A;  2I8D A;  2KNC B;  4PD4 E;  1JCD A;  2N9B A;  1I8P A;  1J1D C;  2A45 H;  3H1L D;  2B10 B;  1QL2 A;  2NPS C;  1IQC A;  1WMK A;  2BH4 X;  1EDJ A;  1OW6 A;  3G9R A;  2GM4 A;  1H31 B;  1KQG B;  2Q5U A;  5TIS V;  1E29 A;  3CC7 P;  1K04 A;  1L0L E;  3I5C A;  1R0Q A;  1NIR A;  2FBW C;  4PW9 B;  5L8R J;  5B66 V;  1NTZ G;  4N0K A;  2R5B A;  4J20 A;  1GL2 C;  1NTZ J;  5KTB A;  3C1L A;  1VQO P;  4H0J A;  3EWK A;  4EIC A;  2ITA A;  1YHQ P;  1KYO H;  5B6Q A;  1G1J A;  1C2N A;  3PH2 B;  1RH5 B;  2K37 A;  1SQB E;  1L0L K;  3DP5 A;  2QG4 A;  5APS A;  1SQV E;  2N1T A;  2O1J A;  3A0H H;  3CP5 A;  2KSE A;  4L74 A;  3H1H D;  3LIE A;  1S5L H;  1CED A;  2RMZ A;  2KI7 B;  3CYT I;  2AI5 A;  2V07 A;  1H33 A;  3JSV C;  1FDM A; 
#chains in the Genus database with same CATH homology
 5CIG B;  5DFS A;  1LC2 A;  3HQ7 A;  1CCR A;  3C2C A;  1MZ4 A;  2DGE A;  3PXW A;  1LS9 A;  3WFB C;  1CC5 A;  3DR0 A;  4EID A;  3X39 A;  1A56 A;  1C7M A;  1H33 B;  1JDL A;  1ZZH A;  1C6S A;  3FWL A;  2N18 B;  1GKS A;  1GJQ A;  1DW3 A;  3TGU D;  1EZV D;  5KKZ B;  3VRD A;  1L9J C;  3ZOW A;  3WFE C;  2B11 B;  5KAI V;  1AOQ A;  3KZI V;  2D0W A;  4Y5R A;  1NTM D;  1IRW A;  1CIF A;  4P4Q B;  1FI7 A;  3CXH W;  1BGY D;  1AKK A;  3ITK A;  3O5C A;  1WVE C;  4GYD A;  2PCC B;  3ZOO A;  5IY5 1;  1S6V B;  3L72 D;  1YIC A;  1OCD A;  2B4Z A;  2C8S A;  4PWA A;  4FA1 A;  3GW6 A;  3RN1 A;  1CYC A;  3GG2 A;  1CYJ A;  3L71 D;  2AIU A;  3L75 D;  2BGV X;  2RN0 A;  4PJ0 V;  5C0Z A;  4WQ8 A;  1H1O A;  2PAC A;  1I6E A;  4AAO A;  2HV4 A;  1U75 B;  2JTI B;  2XTS B;  2D0S A;  3ZOX A;  2O3J A;  2FRC A;  1YFC A;  4EDF A;  4RJT A;  1P84 D;  2QJK B;  1L0N D;  2C2C A;  4FAV A;  5AUR A;  1CIH A;  4IL6 V;  1KYO W;  2L4D A;  1L0L D;  1A8C A;  1QN2 A;  4WQA A;  1WEJ F;  3PLN A;  1KB9 D;  2BCC D;  2QJY B;  2N18 C;  3SXT A;  1QKS A;  1FCD C;  4L1Q A;  1NTK D;  3PRJ A;  2YK3 A;  3O1Y A;  3CWB D;  3RLM A;  1CSU A;  1CIG A;  3PXT A;  2KS1 A;  4YE1 A;  4QAO A;  1E8E A;  1CRI A;  3A9F A;  4K3I A;  1C6O A;  2C1V A;  5CIC B;  2N9Y B;  4WQ9 A;  1I5T A;  1RZ6 A;  1W5C T;  1HJ3 A;  2BCN B;  1SQV D;  1HZV A;  1COR A;  3VYM A;  1CHH A;  1CRY A;  1HRC A;  2QJP B;  1RZ5 A;  155C A;  3MK7 B;  1C6R A;  4LJI A;  2JWA A;  1YEB A;  3PTZ A;  2AXT V;  1COT A;  3DMI A;  3PXS A;  1FI9 A;  3VNW A;  3CU4 A;  3SVW A;  3JBT B;  1GIW A;  2EXV A;  2L91 A;  3SJL A;  4H0K A;  4O1Q A;  3ZOY A;  3H1I D;  1N90 A;  2CE0 A;  1RAP A;  1C52 A;  1KX2 A;  1PP9 D;  4FAN A;  1KIB A;  2GB8 B;  1FOC A;  4WQD A;  1CHI A;  1BE3 D;  1A2S A;  1C2R A;  3CXH D;  3VMA A;  2YQB A;  3WFC C;  1U74 B;  1F1F A;  4JCG A;  1FI3 A;  3SLE A;  3O0R C;  1DII C;  3HQ9 A;  1BCC D;  1AOF A;  1CTJ A;  2N3B A;  1H32 A;  1QYZ A;  4V2K A;  4U3F D;  1HH7 A;  3TYI A;  1PPJ D;  1RAQ A;  1CSV A;  1BL9 A;  2OZ1 A;  2ZBO A;  1J3S A;  1QL3 A;  1LFM A;  2ZOO A;  1HRO A;  1HCM A;  2N9I A;  4UB8 V;  1FJ0 A;  1C75 A;  2YIU B;  4FB1 A;  2ZON G;  1DT1 A;  4GED B;  5C9M A;  4PD4 D;  1H32 B;  3ZBM A;  1SQQ D;  1CIE A;  4L3G A;  4WQE A;  2GIW A;  3RMZ A;  1HJ4 A;  2OZ1 B;  1I55 A;  3MK7 C;  1B7V A;  2Q3E A;  1KYO D;  1CTY A;  1CXC A;  3WU2 V;  2N3Y A;  1ZRT D;  451C A;  1MG2 D;  4RSZ A;  5CIH B;  2B12 B;  1CCH A;  1L9B C;  2FWL A;  1DW1 A;  2C1D A;  2ZZS 1;  3ORV A;  4FA5 A;  2JQR A;  4L3H A;  1AYG A;  2C1U A;  1CRJ A;  1ETP A;  2ORL A;  5CID B;  1E2R A;  2CA4 B;  2C9X B;  2V08 A;  5CIB B;  1M6Z A;  2BH5 X;  3BCC D;  2DVH A;  5KLI B;  3A0H V;  3KHU A;  4NFG B;  1DVV A;  3CX5 D;  1SQB D;  2GC7 D;  1S5L V;  3HQ6 A;  1I54 A;  2B0Z B;  4UB6 V;  1MG3 D;  3CX5 W;  3SWS A;  1N15 A;  2K9J B;  1DW2 A;  2LIR A;  1SQP D;  1CSX A;  3WFD C;  1K3G A;  1CYI A;  1NU1 D;  3A0B V;  1FHB A;  3WUI A;  1YEA A;  5CIF B;  4KMG A;  5EXQ A;  2GC4 D;  2CXB A;  1VYD A;  3NBS A;  3O20 A;  3L4O A;  1OAE A;  5H2F V;  2LIT A;  3TF5 A;  5GTI V;  4XXL A;  1GU2 A;  3H1K D;  1F1C A;  1YTC A;  2IBZ D;  2BLF B;  1GQ1 A;  1YIQ A;  1CXA A;  1M60 A;  1QL4 A;  1DW0 A;  1CRG A;  2I8F A;  4AAL A;  1NML A;  1CRH A;  2CA3 B;  3OA8 A;  5DJQ B;  1HZU A;  2VHD A;  2FYU D;  3OCD A;  3WC8 A;  4FA4 A;  3HQ8 A;  4XYD B;  5E79 V;  1CNO A;  2Y0E A;  5KAF V;  4FA9 A;  1KV9 A;  1DVH A;  1SQX D;  2YCC A;  351C A;  1CSW A;  1CTZ A;  1M70 A;  2Y0D A;  1N50 A;  2BPB B;  1KB0 A;  5KLV D;  3OA8 B;  4AAM A;  1H9Y A;  4EIE A;  4AX3 A;  1IRV A;  1K3H A;  2A06 D;  1N9C A;  3OCD B;  2CE1 A;  2Y0C A;  1CHJ A;  1GDV A;  1H31 A;  5TJH A;  3PHL A;  1CO6 A;  2N9J A;  5B5E V;  2FYN B;  3L73 D;  4WQB A;  3NBT A;  5DF5 A;  1LC1 A;  2KNC B;  4Q5P A;  1I8P A;  3M97 X;  4A7P A;  3H1L D;  4AAN A;  2B10 B;  4WQC A;  1IQC A;  2BH4 X;  4DY9 A;  2ZXY A;  1W2L A;  3TDK A;  1NMI A;  1YCC A;  1H31 B;  5TIS V;  5GTH V;  1E29 A;  1R0Q A;  3ZCF A;  1I6D A;  1NIR A;  1DIQ C;  4PW9 B;  5B66 V;  4D6T D;  4N0K A;  3NWV A;  4J20 A;  5CIE B;  1KX7 A;  1NTZ D;  3ZIY A;  3L70 D;  4MU8 A;  2MTA C;  4EIF A;  5DJQ C;  2PCB B;  4H0J A;  1YNR A;  4EIC A;  5B6Q A;  4WQ7 A;  1C2N A;  1IO3 A;  2C1D B;  3PH2 B;  5CYT R;  3L74 D;  1CRC A;  3RN0 A;  3DP5 A;  2QG4 A;  1H9X A;  3L4M A;  1LMS A;  3CP5 A;  1I8O A;  1IZL 0;  1EB7 A;  3H1H D;  1CED A;  2RMZ A;  4O1W A;  1NNO A;  3CYT I;  2AI5 A;  2V07 A;  1HJ5 A;  2MHM A;  1H33 A;  3H1J D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...