4U3FD

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4u3fD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4u3fD02
5KLVD 1YEAA 3M97X 1CHIA 4EIFA 1K3GA 2B4ZA 1EZVD 1CRYA 1I6EA 1YTCA 1IZL0 5KAIV 1BGYD 4YE1A 2LIRA 4XXLA 1CORA 1RZ6A 3CP5A 2ZOOA 1CIEA 3C2CA 2KNCB 5EXQA 1IRVA 1IQCA 3OA8B 3FWLA 4IL6V 1H31B 3H1LD 1N90A 4WQBA 1M60A 1NTMD 1FI9A 3CYTI 2FWLA 5CIGB 4O1QA 2CXBA 4JCGA 155CA 1CNOA 2PACA 3H1JD 2L91A 1ZRTD 2D0SA 1N15A 3KHUA 1SQXD 4QAOA 2Y0DA 1RZ5A 1WVEC 2BH5X 2QG4A 2K9JB 3PXSA 351CA 4WQDA 1FI7A 2CA4B 1NNOA 1FI3A 1MG3D 1I5TA 1YICA 2N9JA 3DMIA 5AURA 2MTAC 2YIUB 2C1UA 3ITKA 1HROA 3L4OA 1CIFA 1NTZD 2BCCD 2QJPB 1A8CA 4KMGA 1SQVD 3L71D 4EICA 3O0RC 1CCHA 3L72D 3ZOOA 1QKSA 1NU1D 4WQ7A 4AANA 1CEDA 4WQEA 3ZIYA 1W2LA 2A06D 2YK3A 3X39A 2ZXYA 1CIHA 4WQCA 5DJQB 4WQ9A 3ZOWA 1C6RA 3WFBC 3CX5D 1NMIA 4H0JA 2AXTV 1N50A 2CA3B 4L1QA 3VNWA 3MK7B 4FA1A 3O1YA 1E2RA 1I8OA 1QL4A 4AAOA 1DIQC 4GYDA 1GKSA 2YQBA 3VRDA 1L9JC 1YIQA 2BCNB 1RAPA 451CA 2V07A 1L0LD 1HCMA 3ZCFA 3L4MA 2BGVX 1CXAA 1PP9D 1DW1A 1PPJD 4WQ8A 2BH4X 5KLIB 1AKKA 1H9XA 3HQ6A 1LC1A 1KB0A 4PJ0V 2B10B 1H33A 2DGEA 3WC8A 1COTA 2HV4A 3A0BV 1L9BC 2IBZD 1SQPD 3PXTA 1P84D 2QJYB 3TYIA 3OCDA 2C1DB 2CE1A 2EXVA 3NWVA 3H1KD 2O3JA 1C6OA 2N18B 1S6VB 1KV9A 1CSVA 1CC5A 4PWAA 2QJKB 2PCCB 3PTZA 4Q5PA 2C1DA 1KYOW 1NIRA 1CRCA 1C52A 3NBSA 3CU4A 4O1WA 4UB6V 1S5LV 2JTIB 1KX7A 4L3GA 3L70D 3RN0A 1C75A 3JBTB 2VHDA 3A9FA 2CE0A 4PD4D 2AIUA 1VYDA 4Y5RA 3A0HV 2ZBOA 3CXHD 1YEBA 2GC7D 1FOCA 1F1CA 5CIFB 1NMLA 3SLEA 2LITA 5KKZB 3HQ7A 4FB1A 1FHBA 2D0WA 1MZ4A 5DFSA 4K3IA 1HRCA 3ZOYA 1HH7A 3RLMA 1LFMA 3GG2A 4V2KA 4AAMA 1ETPA 1J3SA 1HJ5A 4UB8V 3TGUD 1CIGA 1K3HA 1QL3A 1GJQA 1IRWA 3MK7C 2GIWA 3OCDB 1C7MA 4EIDA 3KZIV 5B66V 1AOQA 1AOFA 1CTYA 1L0ND 1CHJA 2ORLA 4EDFA 2GC4D 3WFEC 1CTZA 4U3FD 1W5CT 5DF5A 4FA9A 1H32B 4AALA 1A56A 4FAVA 2Y0CA 4J20A 1CYJA 1HZUA 5TJHA 1HZVA 5CIBB 3WFCC 3H1HD 2RMZA 2N9IA 3WU2V 3HQ8A 4A7PA 3ORVA 1CXCA 1DW0A 1FJ0A 5GTHV 2JWAA 1CYCA 2FRCA 1SQBD 3SWSA 3SVWA 2V08A 3SJLA 2N3YA 1M70A 2RN0A 1CO6A 2FYNB 3SXTA 1JDLA 4D6TD 3TF5A 1GDVA 1OCDA 1I55A 4RSZA 2OZ1A 1BE3D 5C9MA 4PW9B 4FANA 1M6ZA 1BL9A 4GEDB 3H1ID 3GW6A 4H0KA 4RJTA 1R0QA 1B7VA 1GU2A 2C9XB 1I6DA 3PH2B 1DVHA 1H32A 2XTSB 1HJ3A 1H9YA 1CRIA 1BCCD 4EIEA 1CRGA 1CTJA 1N9CA 2C8SA 2N3BA 3PXWA 1DVVA 1CSXA 1WEJF 4NFGB 3DP5A 1GQ1A 5GTIV 3CWBD 1GIWA 2C1VA 3O5CA 1RAQA 1CSUA 3VMAA 4XYDB 1YCCA 3L75D 1OAEA 1H31A 1KIBA 3HQ9A 5E79V 3BCCD 1CRHA 1QN2A 1KB9D 3ZOXA 3OA8A 2JQRA 3RMZA 2AI5A 4FA4A 1HJ4A 2OZ1B 2BLFB 2YCCA 1E29A 4MU8A 3ZBMA 5B5EV 3CXHW 3L73D 1C2NA 1U75B 2N18C 3CX5W 1IO3A 5DJQC 5C0ZA 2GB8B 2FYUD 2B0ZB 5IY51 4DY9A 2DVHA 1I54A 2Q3EA 5CIEB 1C2RA 3O20A 1A2SA 2ZONG 5B6QA 1LS9A 5H2FV 1I8PA 5KAFV 1KX2A 5CIDB 1ZZHA 1CYIA 1U74B 2I8FA 2MHMA 1DW3A 3VYMA 1H33B 5CICB 1DIIC 4FA5A 5CYTR 2C2CA 4L3HA 1EB7A 1DT1A 1YNRA 1NTKD 3DR0A 1H1OA 1AYGA 1F1FA 3WUIA 1FCDC 4N0KA 1SQQD 1CSWA 3WFDC 2PCBB 3PLNA 1LMSA 2BPBB 2KS1A 3NBTA 1DW2A 3PRJA 4LJIA 4P4QB 3TDKA 2B11B 5CIHB 1C6SA 1CRJA 1E8EA 4WQAA 2L4DA 1LC2A 1MG2D 1CCRA 2B12B 5TISV 1YFCA 3RN1A 1QYZA 1KYOD 2N9YB 2ZZS1 3PHLA 4AX3A 1CHHA 3L74D 2Y0EA
chains in the Genus database with same CATH superfamily
2Q5UA 3JSVC 3FWNA 1JMBA 3P8CD 3OA7A 2C9LY 2B4ZA 1LJ2A 5E79H 3CX5I 1VQKP 2H88C 2ZOOA 1PGPA 2ZYAA 1KN7A 1IRVA 1BSNA 1IQCA 2YKQA 3OA8B 5L8RJ 1VQOP 4IL6V 1JM0A 3H1LD 1M60A 1IFPA 2NRGA 1GK6A 2PP6A 1L0LK 1SQVJ 2XV5A 1NKZB 3RK3D 3CYTI 5BU5A 3CD6P 2KLUA 5CIGB 3V6IA 1J2JB 3V2PA 1QL1A 1JMMA 1H88A 1N15A 1P84I 2BH5X 3RL0C 4U3FJ 2KOGA 4WQDA 3RK2B 3HE5A 2O01J 2RH0A 1FI3A 1MG3D 4IL6H 1YQ3C 2C1UA 2P67A 4OGQB 1KILA 1A02J 1OFCX 1L4AA 1KZUB 1FDOA 1KB9E 3HD7C 3IR9A 3L73J 2ZXXA 1LP1A 5CCGC 1BE3J 1KYOH 2ZXYA 1CIHA 4WQCA 4GT1A 5DJQB 4KT0J 3AE7C 3Q5RA 1A02F 1C6RA 4WVZA 1SQBJ 2AXTV 4PV1D 1CZQA 1LTAC 2R44A 3VNWA 1NTKE 3CCSP 4YPCA 2AEMA 3CWBJ 4FA1A 1U7JA 1SQBG 1I8OA 1R5LA 3RGUA 1NU1J 1IJDB 2WPVB 451CA 1BGYG 3D6ZA 1NTMJ 2BGVX 1CXAA 1PP9D 2AEJA 1DW1A 2K37A 5KLIB 2L5GB 1EDJA 2IBZG 3L4FA 4PJ0V 1QX8A 3ABVC 3II6A 2IX7C 1COTA 3A0BV 2QM8A 2IBZD 3HUSA 1SQPD 3PXTA 3H1LE 1JY2O 4IFDK 3H1JJ 3AEBC 2FYUJ 2CE1A 1BDDA 2Q1KA 2WPSA 2N18B 3CCJP 1VQ7P 1UIXA 3RK2D 3A0HH 2QJKB 3PTZA 3EWKA 1C52A 5H2FH 1QL2A 1GL2D 4UB6V 1Q7YQ 1S5LV 1FS0E 4H13D 2HR3A 1Q81Q 2HG5D 3RK3B 2CE0A 3BATA 3AE4C 3A0HV 1KQFB 1SQQK 3HE5B 4WY4A 1LT1A 4O9BA 1KYOI 4Y28J 1L0LE 1F1CA 2IZ0A 1BGYJ 4XFJA 4DZOA 2LITA 5KKZB 1W2BO 1SS1A 2JWDA 2WSEJ 3H1HG 1YJ9P 1LFMA 3KPEA 1LNQA 1YITP 3CX5E 1ETPA 4M3LA 5KLVG 1IZNB 4UB8V 2XKMA 1EZVG 1JY3N 1RHZB 2JDIH 1ZV8A 2KXPB 2GIWA 4KJMA 3OCDB 1AOQA 1NTME 4WY4D 3L73G 2WITA 1NTMK 1GDTA 3MUDC 1CTYA 2VRSA 1AA0A 2E5YA 1CHJA 3CXHI 2OTJP 1QLED 5APYA 2WZ7A 2R32A 5KLVJ 2KSEA 4U3FD 3VOPA 1BCCG 1SQXJ 5DF5A 2WSFH 4Y99B 1A56A 1YJWP 3BCCJ 4AQRD 1RF1A 2MJZA 1CYJA 1HZUA 5TJHA 4CPGA 1SQBE 3HQ8A 2AXTH 2LR2A 4TLFA 3CI9A 3B5NA 5AW4B 2IFMA 1VF5D 5CCHC 3HTKB 3TNUB 3H1HE 3SVWA 1DEEG 3H32B 2N3YA 1JO5A 1M70A 1OX3A 1LWUB 1CO6A 2FYNB 3L71J 1NTKG 1DD3A 1LWUC 2LKMA 2O01H 1OCDA 4EYYQ 4GEDB 3H1ID 2ZFCA 5GTHH 3GMAA 2GM4A 1LT9B 1RE4C 3U1CA 1H0TA 1GU2A 2C9XB 4RKUJ 1RF1C 1H32A 2PGDA 1HJ3A 4EIEA 2Z5HA 1CRGA 3NTNA 1CTJA 2N3BA 3DP5A 3LIEA 5CJ4A 2V7QH 3B4SA 4YXWH 2RKLA 2W8ZA 3KQGA 1JCDA 3D70A 1RAQA 1CSUA 4XYDB 3FXEA 1T3JA 1YQ4C 1OAEA 1H31A 2QA4P 3HQ9A 5E79V 2QVAA 1CRHA 3N7NA 1QN2A 1SQVE 1PGOA 3R4YA 2JQRA 3RMZA 4FA4A 2OZ1B 2YCCA 1NTZE 2FYNC 1VDFA 5B5EV 3HD7A 1S5LE 3E1IA 1VF5B 3Q3DA 1Y47A 2N1TA 3MD0A 5KJ7A 1IFDA 4DT0A 5IY51 2HPCA 4RO0A 4I2LC 3O20A 1L0NJ 5KAIE 4ZMDA 5H2FV 5CIDB 1ZZHA 2P2UA 1EDKA 2O01N 1NU1G 1CYIA 1U7MA 3VYMA 1H33B 4EOTA 2OGUA 1NJIQ 1LTIC 1FZFA 1DD4A 2YO2A 2M3BA 4GODA 1J1DB 1DT1A 1T2KC 3DR0A 1F1FA 3M9QA 1FCDC 1HH0A 1VQ4P 1SQQD 1GU4A 3E1RA 3RL0D 5GTIE 2FFDA 2PCBB 3UIAA 3GLMA 1G1JA 3MIWA 3PLNA 2FYUG 5AVXB 1KB9H 4YXDC 4LLHA 1FBMA 1N73C 2B11B 1C6SA 4AYCA 1CRJA 3TGUJ 1KTMA 1J1EC 2L4DA 1JY3P 1LTBC 2Y9ZA 1MG2D 1CCRA 3RN1A 2FYUK 1GK4A 5KLIC 2HODA 5KAIH 1T2KD 1CHHA 4BRYA 1TU3F 3B5NC 1ZRTE 1N7SD 2N9BA 1I6EA 1YTCA 1JUNA 3F5HA 5KAFE 1IFNA 1P84H 4YE1A 1DH3A 4ZKPA 1G2CB 3MZWB 5DJTB 2ZJSE 3GHGB 4IL6E 3FWLA 3N4XA 1H31B 2K3RA 1N90A 2J59M 3O8ZA 2ZVNB 4H13B 1KD1Q 3L71G 1VQ6P 1PZQA 3CCUP 1Q2NA 3H1IJ 1SQXG 1RE3A 2L91A 1G2CA 2JKVA 1SQPG 3VYIA 1SQXD 1FDIA 1CI6A 2W6AA 4D6TJ 1N86A 2Y0DA 1RZ5A 1WVEC 2H43A 1ZR4A 2QG4A 1USEA 4N3YB 3AE2C 3O6QA 4JPZB 2R3SA 3L70J 2LXBA 3DMIA 5AURA 5KLVK 2MTAC 1EXIA 2YIUB 2XZRA 3ITKA 2PRRA 3SWFA 3EFFK 1NTZD 1LWUA 2QJPB 1NTZG 4DJGA 1MV8A 2IBZI 1SQVD 3G71P 3AE5C 1JEKA 3HTKA 3QH9A 2QJPC 1IO4A 1QKSA 1NU1D 1IC2A 3JCUH 4WQEA 2KB7P 5AVSB 1W2LA 2YK3A 1YYCA 3LW5J 3X39A 1FZAA 2E74C 1KB9I 2E75C 2BCCE 2M3EA 3H1JG 3CWBG 3WFBC 1MFZA 4H0JA 1JOCA 1N50A 1JNMA 2WT7A 3VMXA 3MK7B 1LGHB 2HYNA 1E2RA 2M8RA 3S1KA 1QL4A 1AQ5A 1GKSA 2C0WA 5APSA 2E42A 1L9JC 2BCNB 1Y9BA 2V07A 1PP9G 3USSA 2M0BA 3HQ6A 2B10B 1ZR2A 2OTLP 3AEEC 5B66E 5KJ7C 1L9BC 2E5TA 3P32A 4JQ0D 1M1JB 4K35A 4BWNA 3L70E 1SP4A 1EXJA 1IFIA 1EZVE 1IK7A 1K04A 3NWVA 3L37A 3H1KD 2D2CB 3CMAP 1PGQA 5GTIH 1C6OA 1ZW0A 1CC5A 4PWAA 1U57A 2K88A 4IFFA 3TGUG 3VN0A 4LGDE 3EFGA 3L73E 2C1DA 1KYOW 4BXLA 1VQ9P 2I8DA 3H25A 3CU4A 2MKVA 4ASVA 2QE7H 3M9BA 1C75A 3JBTB 2VHDA 1URQB 3VMYA 3A9FA 3AECC 2AIUA 1AV1A 1NU1K 1YEBA 2GC7D 1OMIA 4C7RA 5CJ0A 1JY2P 1H8AA 3HQ7A 2ZVOB 3P8MC 4K3IA 5KAFH 1QVGO 3SWKA 3GG2A 4JBZA 4V2KA 3RK2C 1YI2P 3A5TA 1K3HA 1EDIA 1HGZA 5KJ7D 2HLOA 1Q82Q 1USDA 3I55P 1GU5A 5AW8B 4EIDA 3M91A 1AOFA 3TGUE 1HUCA 2YKPA 1LTGC 1PL5A 2DW3A 1RF1B 2WSCH 3HUSB 3IN6A 1FZCB 4EDFA 3D71A 2E75B 2FXMA 2BASA 4U7JA 2FY8A 2Y0CA 1N73B 4J20A 5CIBB 3H1HD 3ORVA 2PFXA 5B5EH 1K73Q 5CMZA 1DW0A 2B89A 4Y99C 4H44B 2C9NY 1AJYA 2JO1A 2JWAA 2OYHA 4PV1C 4KHXA 1CSBA 4C7NA 1SQBD 3SWSA 1NTZK 4D6TG 3G4SP 2WT7B 2OYHC 2OTKE 4W7ZA 3SXTA 1JDLA 4D6TD 3TF5A 1GDVA 1MZ9A 1YHQP 5C9MA 1BE3D 1VQLP 4FANA 1BL9A 4H44D 2NPSB 1HVVA 2KP8A 3A0BH 3F89A 1I6DA 4UB8E 3KXDA 1GW4A 1N7SA 3A3YB 2E76C 2N1TB 5AW6B 1HJ0A 2YXQB 4L76A 3PXWA 1BSHA 1WEJF 4NFGB 3L72E 1XTGB 1GQ1A 4D6TE 1GD2E 3HUSC 2A06G 2HFED 3FXDA 2JP3A 3O5CA 3G6EP 1FOSF 1YCCA 1QEXA 1KIBA 5AVTB 3BCCD 1KB9D 1NVOA 1FE6A 5AW7B 2E43A 1AVOA 1IFMA 1JCCA 4MU8A 2YIUC 1C2NA 4JF7A 3QWOC 3L70G 3L75E 4GOEA 1ZMEC 2N18C 3CX5W 4W80A 3V5BA 5DJQC 5C0ZA 3VTPC 1YTZT 2B0ZB 3H1LG 3TK1A 1I54A 1A2SA 2ZONG 2FFDB 3Q5SA 3L71E 1BDCA 1U74B 3H1HJ 1DIIC 5CYTR 3L72J 2C2CA 1FZEA 1KV4A 2KS1B 4H13C 4OGQD 3CCRP 1YIJP 1YNRA 3RL0g 2H7HA 3WUIA 3WUUA 3CLQA 2Q3IA 2A45I 2AEFA 4L74A 2XU6A 3D6YA 3VMZA 3L75J 2KS1A 3NBTA 2FXOA 4I7ZB 3HRNA 2QJYC 2YKOA 3PRJA 4P4QB 5H2FE 1Y8AA 2Q6QA 2H89C 2N1TD 1OW7A 3CXHE 3GF7A 1OVUA 1MFTA 5TISV 1QYZA 2N9YB 2ZZS1 3PHLA 1PPJE 4I7ZC 1J1EB 4NPEA 3L74D 2Y0EA 2W6JH 1S3JA 5KLVD 1YEAA 1L0NK 4EIFA 3CCLP 1EZVD 3HD7B 4I1LA 1CRYA 4QMAA 2H8PD 2IZ1A 1XTCC 1S5LH 1IZL0 1HTLC 5KAIV 1QVFO 1BGYD 1M7LA 2LIRA 4XXLA 1CORA 4NPFX 3CP5A 2WQYC 2V4HA 5EXQA 1L0LJ 1SQVK 3VP8A 1NWQA 3BVHA 5AW2B 4WQBA 1FU1A 1R8EA 1NTMD 2WSCJ 2YO3A 1YTZI 1FI9A 4HJGH 1CI6B 2ZAEB 1KILD 2UWJE 3FGAD 4O1QA 2QIWA 2CXBA 3M06A 1CNOA 2W6BA 3WMM0 1ZRTD 5APTA 3WU2H 3HD7D 2K9JB 3PXSA 1X0TA 3B8EB 351CA 2KZIA 1LTTC 2JR8A 1VPCA 1KQGB 5M1BA 2GUVA 2CA4B 2R5BA 3CL3D 1I5TA 2C0XA 4YTPC 3B5NB 3T97A 1FZCC 3NXSA 2WMMA 1R5SA 1DX7A 1L0LG 4IL6X 1HROA 3L4OA 1SFCD 2KUBA 1CIFA 2E76D 3FX0A 1A8CA 3KDPB 3L35A 4GDOA 2KLVA 3L71D 3JC22 4EICA 3O0RC 1CCHA 1CEDA 3ZIYA 2W27A 1S72P 3CWBE 3GHGC 4WQ9A 3ZOWA 1L4AD 1RF0C 5AVUB 3CX5D 1NMIA 2K9YA 2CA3B 4L1QA 5C39A 2G8YA 1FZGA 1FZCA 4DCKA 4TT3H 1FAVA 1RQUA 1SQXE 1AQTA 4PJ0H 2P58A 1PGJA 1DIQC 2YQBA 3VRDA 1EQ7A 3SFEC 1ZXGA 3OJAB 1RAPA 4DOJA 2B88A 1FZBA 3V4WA 4R4MA 1HCMA 1OXZA 3ZCFA 3S4RA 4WQ8A 2BH4X 1H9XA 1LC1A 3V2QA 1SFCC 1KB0A 4W7YA 2DGEA 3WC8A 1WMKA 1LTJB 3KZIE 5AVVB 1T3UA 1X22A 1P84D 3TYIA 2C1DB 3NMDA 1S6VB 1KV9A 1BGYE 2YMKA 3W67A 1HF9A 2PCCB 1SQQG 1IFJA 2IBZE 1NIRA 1URQA 3HE4B 1J1DC 3NBSA 3BASA 3MTUE 1OVRA 4PV1B 4O1WA 2E74D 5KTBA 3HE4A 3L70D 3TYYA 2WTYA 1N8RQ 3C8VA 4PD4D 3H1IG 3TNUA 1KORA 4UB8H 3CXHD 2AXTE 4XA4A 5CIFB 2ZT9B 3A7OA 1URQD 4H0LD 1OWAA 2KNCA 1FHBA 1M8OB 1SQQE 4OWFA 2D0WA 5DFSA 5APUA 2FYUE 2W83C 1GW3A 3ZOYA 1M90Q 3H1JE 5AW1B 3MHVA 1HJ5A 3H32A 5AVWB 3TGUD 2KI7B 1QL3A 2BCCJ 1GJQA 1IRWA 2D2CC 2R5DA 2Q7CA 2D2CD 2YNYA 4BRYB 1HWTC 1K05A 3A0BE 1QGKB 1RY3A 1L0ND 2Z5IA 2O1JA 3CCVP 1Q86Q 1NGMB 1NU1E 1S1CX 3WFEC 1N73A 4N6JA 3H6PA 3Q5PA 1H32B 2QRXA 4AALA 3RBXA 2Q9IA 1HGVA 1HZVA 1NAYA 2N9IA 1M1JC 4A7PA 1KYOE 2ZXEB 2OYIC 1FJ0A 2POHA 5GTHV 1N2DC 5DJUB 2IPPA 1CYCA 4N78D 4OVNF 2KIKA 4JYBA 3IAOA 2V08A 5CCHA 2RN0A 1SQXK 2M5AB 1L4AB 3AEDC 1KQLA 1Q90D 1OVVA 3G3ZA 2OZ1A 1KFNA 3A2AA 1M6ZA 2BEQD 2XNXA 4GKGA 3GW6A 4H0KA 3PH0A 1PP9J 1N7SC 3LW5H 3C9IA 3PH2B 2HPCB 1DVHA 5AVYB 3AE1C 1L2PA 3Q1MA 1CRIA 1BCCD 2R3CA 1N9CA 2C8SA 1FDMA 2LXCB 4L75A 1DVVA 1ZLLA 1JY2N 1S9KD 1NH4A 1GIWA 2C1VA 2A06E 3I56P 3NFQA 3VMAA 1UIIA 4IFMA 1L0NE 3P7KA 1RF0A 1IK9A 2QJKC 1KFMA 3SFDC 1S2EA 3ZOXA 3OA8A 2AI5A 1NAFA 2K9JA 1HJ4A 2BLFB 2O1KA 1WT6A 1E29A 1L4AC 3CXHW 3L36A 5B66H 3AEAC 4HYTB 5APQA 2KZJA 2FFDC 1X8YA 2GB8B 2FYUD 5CCGD 1VQ8P 3U59A 4DY9A 2DVHA 2Q3EA 5CIEB 1C2RA 1S9KE 1JTHA 2IYOA 1RQVA 1LS9A 1I8PA 3JCUE 1KILE 2MHMA 3H1KG 1BCCE 5CICB 2V7QJ 4HH2A 3KZIH 4FA5A 2JEEA 2CPBA 1EB7A 1LTSC 1NHLA 1EDLA 3ZDMA 1L0NG 2NPSA 1CSWA 3EQ2A 3WFDC 4WWIA 1PPJG 1N7LA 1M1KQ 4GIFA 3AE6C 1KMIZ 1LMSA 2BPBB 2ZT9C 2ZYDA 1P84E 1S4XA 5CIHB 5E79E 3TSIA 4WQAA 5EFWB 1HBWA 3RL0B 1MUUA 1YFCA 3AE3C 4EI2A 2QSIA 4HKZH 1KYOD 1ZN5A 2I1JA 4AX3A 2KSJA 2G3AA 1YBKA 1LP1B 4H0LC 2CPSA 2OYIA 1S5LX 2IYPA 3M97X 3CPWO 1CHIA 1K3GA 4HB1A 4PJ0E 3CX5H 1OIPA 1SLQA 4I6MC 5CCHD 3CCEP 2WWWA 5AW0B 4JYCA 3AEGC 1SQPJ 1RZ6A 1CIEA 3C2CA 2KNCB 3KYQA 1FJKA 1E5WA 1AFOA 2XDJA 3O6QB 5AW9B 1PP9E 3M0AA 2GA1A 1VF5C 2YXRB 3M0DC 1X9VA 1FOSE 5APWA 3M0DA 2FWLA 2XNDH 3V4QA 4JCGA 3WU2E 1PV3A 155CA 2PACA 3H1JD 4GOFA 3L74G 2D0SA 3KHUA 4QAOA 2WVRA 1NYHA 2YMYA 4PD4I 3A0HE 1K8AQ 1FI7A 3OW2O 1NNOA 2FBWC 1YICA 2N9JA 1BE3G 2OYOA 5CHXA 1AVYA 2WPRA 3BCCE 3CXHH 2BCCD 3MGNA 5KLVE 1LTJA 2WSEH 1X79B 3CC7P 4KMGA 5CCGA 3L72D 3ZOOA 4H0LB 4WQ7A 4AANA 1OZHA 2A06D 2PAJA 3CCMP 2WSSH 2AXCA 4RESB 3BCCG 1VQ5P 1GL2B 1Z56A 2E75D 2E74B 3O1YA 1GL2A 3R2PA 3L74J 2IFNA 4AAOA 4GYDA 1SQQJ 2KYVA 5APXA 1GL2C 3H1KJ 4K3AA 1YIQA 1DIPA 2K1AA 5TISE 1LTJC 5BU8B 4UB6E 1L0LD 3B5ND 2ITAA 2JJLA 2J5UA 5GTHE 1SFCA 3L4MA 1PPJD 1AKKA 1EZVI 3BRVB 1H33A 1VQNP 2HV4A 1CW5A 3SWYA 3WUTA 4NPDA 2QJYB 1NTKK 1HJBA 1FC2C 1JTHB 3OCDA 3T97B 2FXPA 3L75G 2EXVA 2ZT9D 1K9MQ 1PFIA 5AW5B 2O3JA 2FYZA 4C46A 2WPQA 1CSVA 1E79H 2B87B 1WRGA 3S9OA 1LT9A 4Q5PA 3H1LJ 2QM7A 1CRCA 1T8ZA 1FJPA 1JB0J 1URQC 3AE9C 2JTIB 1M57D 1KX7A 4L3GA 3RN0A 1EC5A 4XE5B 2OQQA 3CCQP 5KKZC 1VYDA 4Y5RA 2ZBOA 1FOCA 2HODB 5CBOA 4U3FG 1SQVG 1NMLA 3SLEA 3AEFC 4FB1A 4U3FE 1SQBK 1MZ4A 3V2NA 1HRCA 1HH7A 3RLMA 1M1JA 1NTKJ 4AAMA 3Q2YA 1J3SA 3V2RA 5AVRB 4C7NB 1CIGA 1N7SB 3CC2P 3CMEP 2A45H 2KK7A 3MK7C 3MUDA 2W90A 4PD4H 4PD4E 1C7MA 3AE8C 3KZIV 5B66V 1BE3E 3WUVA 5AW3B 3IF4A 4ZNCA 3IFMA 4ZKUA 1MKMA 2ORLA 3H1KE 1T6AA 1KILC 2GC4D 1CTZA 3E7KA 1W5CT 5BVZA 3L74E 1ZP0C 4OH8B 1KC8Q 4FA9A 4OGQC 2OYIB 4FAVA 1DEBA 4L73A 1KILB 2IDBA 3WFCC 2RMZA 3WU2V 3D0WA 2CK3H 3M9HA 2A45G 5B5EE 1CXCA 3RK3C 3VP9A 5AVQB 2FKWB 4WBAA 1KQSO 2FRCA 1BCCJ 3G9RA 3SJLA 4MN4C 1D7MA 3LIDA 2WSFJ 4RSZA 1I55A 2ZYGA 4PW9B 4RJTA 1VL2A 1R0QA 3CC4P 1B7VA 3I5CA 1PIXA 1W5CE 1GMJA 3RBZA 5TISH 2XTSB 3BRTB 1H9YA 1NTZJ 3C1LA 3SSUA 1CSXA 1NKNA 5GTIV 3CWBD 3GF3A 3PP5A 3P8CE 3H1IE 4WY4B 2I1KA 1VQPP 3L75D 4UB6H 1H0TB 2B87A 2NPSD 2J58A 3K5BA 4EIJA 1RE4A 1OW8A 3ZBMA 4H44C 3L73D 1U75B 1SQPE 1SQPK 2SPZA 2OYHB 1IO3A 1NTMG 2Y9YA 5B6QA 5KAFV 1KX2A 3GHGA 5APVA 2OARA 2QEXP 2NZ2A 3W68A 4Z1MH 2I8FA 1DW3A 4AUWA 1M56D 2BEZF 1GZLA 1RH5B 5CBNA 1LT9C 3PJSK 4L3HA 4IOIH 1SFCB 2P10A 2E76B 1NTKD 1H1OA 1AYGA 2GUSA 1G1IA 4N0KA 4LC1A 3MP7B 1VQMP 1YJNP 4WB4A 1W2EA 2N1TC 3U1AA 2NPSC 1NO4A 4B86A 2M5AA 1ZOYC 2P1JA 3L72G 2BCCG 1DW2A 1SVFA 3B71A 4LJIA 3RK3E 3TDKA 3OAKA 1OW6A 1JY3O 1E8EA 4WY4C 1GTWA 2B9BA 1LC2A 2Z4EA 4R4LA 4N78E 2B12B 2P7JA 4ASWA 5AVZB 1H89A 1NOHA 1RE3C 5K5GB
chains in the Genus database with same CATH topology
5KLVD 1YEAA 3M97X 1CHIA 4EIFA 1K3GA 2B4ZA 1EZVD 1CRYA 1I6EA 1YTCA 1IZL0 5KAIV 1BGYD 4YE1A 2LIRA 4XXLA 1CORA 1RZ6A 3CP5A 2ZOOA 1CIEA 3C2CA 2KNCB 5EXQA 1IRVA 1IQCA 3OA8B 3FWLA 4IL6V 1H31B 3H1LD 1N90A 4WQBA 1M60A 1NTMD 1FI9A 3CYTI 2FWLA 5CIGB 4O1QA 2CXBA 4JCGA 155CA 1CNOA 2PACA 3H1JD 2L91A 1ZRTD 2D0SA 1N15A 3KHUA 1SQXD 4QAOA 2Y0DA 1RZ5A 1WVEC 2BH5X 2QG4A 2K9JB 3PXSA 351CA 4WQDA 1FI7A 2CA4B 1NNOA 1FI3A 1MG3D 1I5TA 1YICA 2N9JA 3DMIA 5AURA 2MTAC 2YIUB 2C1UA 3ITKA 1HROA 3L4OA 1CIFA 1NTZD 2BCCD 2QJPB 1A8CA 4KMGA 1SQVD 3L71D 4EICA 3O0RC 1CCHA 3L72D 3ZOOA 1QKSA 1NU1D 4WQ7A 4AANA 1CEDA 4WQEA 3ZIYA 1W2LA 2A06D 2YK3A 3X39A 2ZXYA 1CIHA 4WQCA 5DJQB 4WQ9A 3ZOWA 1C6RA 3WFBC 3CX5D 1NMIA 4H0JA 2AXTV 1N50A 2CA3B 4L1QA 3VNWA 3MK7B 4FA1A 3O1YA 1E2RA 1I8OA 1QL4A 4AAOA 1DIQC 4GYDA 1GKSA 2YQBA 3VRDA 1L9JC 1YIQA 2BCNB 1RAPA 451CA 2V07A 1L0LD 1HCMA 3ZCFA 3L4MA 2BGVX 1CXAA 1PP9D 1DW1A 1PPJD 4WQ8A 2BH4X 5KLIB 1AKKA 1H9XA 3HQ6A 1LC1A 1KB0A 4PJ0V 2B10B 1H33A 2DGEA 3WC8A 1COTA 2HV4A 3A0BV 1L9BC 2IBZD 1SQPD 3PXTA 1P84D 2QJYB 3TYIA 3OCDA 2C1DB 2CE1A 2EXVA 3NWVA 3H1KD 2O3JA 1C6OA 2N18B 1S6VB 1KV9A 1CSVA 1CC5A 4PWAA 2QJKB 2PCCB 3PTZA 4Q5PA 2C1DA 1KYOW 1NIRA 1CRCA 1C52A 3NBSA 3CU4A 4O1WA 4UB6V 1S5LV 2JTIB 1KX7A 4L3GA 3L70D 3RN0A 1C75A 3JBTB 2VHDA 3A9FA 2CE0A 4PD4D 2AIUA 1VYDA 4Y5RA 3A0HV 2ZBOA 3CXHD 1YEBA 2GC7D 1FOCA 1F1CA 5CIFB 1NMLA 3SLEA 2LITA 5KKZB 3HQ7A 4FB1A 1FHBA 2D0WA 1MZ4A 5DFSA 4K3IA 1HRCA 3ZOYA 1HH7A 3RLMA 1LFMA 3GG2A 4V2KA 4AAMA 1ETPA 1J3SA 1HJ5A 4UB8V 3TGUD 1CIGA 1K3HA 1QL3A 1GJQA 1IRWA 3MK7C 2GIWA 3OCDB 1C7MA 4EIDA 3KZIV 5B66V 1AOQA 1AOFA 1CTYA 1L0ND 1CHJA 2ORLA 4EDFA 2GC4D 3WFEC 1CTZA 4U3FD 1W5CT 5DF5A 4FA9A 1H32B 4AALA 1A56A 4FAVA 2Y0CA 4J20A 1CYJA 1HZUA 5TJHA 1HZVA 5CIBB 3WFCC 3H1HD 2RMZA 2N9IA 3WU2V 3HQ8A 4A7PA 3ORVA 1CXCA 1DW0A 1FJ0A 5GTHV 2JWAA 1CYCA 2FRCA 1SQBD 3SWSA 3SVWA 2V08A 3SJLA 2N3YA 1M70A 2RN0A 1CO6A 2FYNB 3SXTA 1JDLA 4D6TD 3TF5A 1GDVA 1OCDA 1I55A 4RSZA 2OZ1A 1BE3D 5C9MA 4PW9B 4FANA 1M6ZA 1BL9A 4GEDB 3H1ID 3GW6A 4H0KA 4RJTA 1R0QA 1B7VA 1GU2A 2C9XB 1I6DA 3PH2B 1DVHA 1H32A 2XTSB 1HJ3A 1H9YA 1CRIA 1BCCD 4EIEA 1CRGA 1CTJA 1N9CA 2C8SA 2N3BA 3PXWA 1DVVA 1CSXA 1WEJF 4NFGB 3DP5A 1GQ1A 5GTIV 3CWBD 1GIWA 2C1VA 3O5CA 1RAQA 1CSUA 3VMAA 4XYDB 1YCCA 3L75D 1OAEA 1H31A 1KIBA 3HQ9A 5E79V 3BCCD 1CRHA 1QN2A 1KB9D 3ZOXA 3OA8A 2JQRA 3RMZA 2AI5A 4FA4A 1HJ4A 2OZ1B 2BLFB 2YCCA 1E29A 4MU8A 3ZBMA 5B5EV 3CXHW 3L73D 1C2NA 1U75B 2N18C 3CX5W 1IO3A 5DJQC 5C0ZA 2GB8B 2FYUD 2B0ZB 5IY51 4DY9A 2DVHA 1I54A 2Q3EA 5CIEB 1C2RA 3O20A 1A2SA 2ZONG 5B6QA 1LS9A 5H2FV 1I8PA 5KAFV 1KX2A 5CIDB 1ZZHA 1CYIA 1U74B 2I8FA 2MHMA 1DW3A 3VYMA 1H33B 5CICB 1DIIC 4FA5A 5CYTR 2C2CA 4L3HA 1EB7A 1DT1A 1YNRA 1NTKD 3DR0A 1H1OA 1AYGA 1F1FA 3WUIA 1FCDC 4N0KA 1SQQD 1CSWA 3WFDC 2PCBB 3PLNA 1LMSA 2BPBB 2KS1A 3NBTA 1DW2A 3PRJA 4LJIA 4P4QB 3TDKA 2B11B 5CIHB 1C6SA 1CRJA 1E8EA 4WQAA 2L4DA 1LC2A 1MG2D 1CCRA 2B12B 5TISV 1YFCA 3RN1A 1QYZA 1KYOD 2N9YB 2ZZS1 3PHLA 4AX3A 1CHHA 3L74D 2Y0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV D;  1YEA A;  3M97 X;  1CHI A;  4EIF A;  1K3G A;  2B4Z A;  1EZV D;  1CRY A;  1I6E A;  1YTC A;  1IZL 0;  5KAI V;  1BGY D;  4YE1 A;  2LIR A;  4XXL A;  1COR A;  1RZ6 A;  3CP5 A;  2ZOO A;  1CIE A;  3C2C A;  2KNC B;  5EXQ A;  1IRV A;  1IQC A;  3OA8 B;  3FWL A;  4IL6 V;  1H31 B;  3H1L D;  1N90 A;  4WQB A;  1M60 A;  1NTM D;  1FI9 A;  3CYT I;  2FWL A;  5CIG B;  4O1Q A;  2CXB A;  4JCG A;  155C A;  1CNO A;  2PAC A;  3H1J D;  2L91 A;  1ZRT D;  2D0S A;  1N15 A;  3KHU A;  1SQX D;  4QAO A;  2Y0D A;  1RZ5 A;  1WVE C;  2BH5 X;  2QG4 A;  2K9J B;  3PXS A;  351C A;  4WQD A;  1FI7 A;  2CA4 B;  1NNO A;  1FI3 A;  1MG3 D;  1I5T A;  1YIC A;  2N9J A;  3DMI A;  5AUR A;  2MTA C;  2YIU B;  2C1U A;  3ITK A;  1HRO A;  3L4O A;  1CIF A;  1NTZ D;  2BCC D;  2QJP B;  1A8C A;  4KMG A;  1SQV D;  3L71 D;  4EIC A;  3O0R C;  1CCH A;  3L72 D;  3ZOO A;  1QKS A;  1NU1 D;  4WQ7 A;  4AAN A;  1CED A;  4WQE A;  3ZIY A;  1W2L A;  2A06 D;  2YK3 A;  3X39 A;  2ZXY A;  1CIH A;  4WQC A;  5DJQ B;  4WQ9 A;  3ZOW A;  1C6R A;  3WFB C;  3CX5 D;  1NMI A;  4H0J A;  2AXT V;  1N50 A;  2CA3 B;  4L1Q A;  3VNW A;  3MK7 B;  4FA1 A;  3O1Y A;  1E2R A;  1I8O A;  1QL4 A;  4AAO A;  1DIQ C;  4GYD A;  1GKS A;  2YQB A;  3VRD A;  1L9J C;  1YIQ A;  2BCN B;  1RAP A;  451C A;  2V07 A;  1L0L D;  1HCM A;  3ZCF A;  3L4M A;  2BGV X;  1CXA A;  1PP9 D;  1DW1 A;  1PPJ D;  4WQ8 A;  2BH4 X;  5KLI B;  1AKK A;  1H9X A;  3HQ6 A;  1LC1 A;  1KB0 A;  4PJ0 V;  2B10 B;  1H33 A;  2DGE A;  3WC8 A;  1COT A;  2HV4 A;  3A0B V;  1L9B C;  2IBZ D;  1SQP D;  3PXT A;  1P84 D;  2QJY B;  3TYI A;  3OCD A;  2C1D B;  2CE1 A;  2EXV A;  3NWV A;  3H1K D;  2O3J A;  1C6O A;  2N18 B;  1S6V B;  1KV9 A;  1CSV A;  1CC5 A;  4PWA A;  2QJK B;  2PCC B;  3PTZ A;  4Q5P A;  2C1D A;  1KYO W;  1NIR A;  1CRC A;  1C52 A;  3NBS A;  3CU4 A;  4O1W A;  4UB6 V;  1S5L V;  2JTI B;  1KX7 A;  4L3G A;  3L70 D;  3RN0 A;  1C75 A;  3JBT B;  2VHD A;  3A9F A;  2CE0 A;  4PD4 D;  2AIU A;  1VYD A;  4Y5R A;  3A0H V;  2ZBO A;  3CXH D;  1YEB A;  2GC7 D;  1FOC A;  1F1C A;  5CIF B;  1NML A;  3SLE A;  2LIT A;  5KKZ B;  3HQ7 A;  4FB1 A;  1FHB A;  2D0W A;  1MZ4 A;  5DFS A;  4K3I A;  1HRC A;  3ZOY A;  1HH7 A;  3RLM A;  1LFM A;  3GG2 A;  4V2K A;  4AAM A;  1ETP A;  1J3S A;  1HJ5 A;  4UB8 V;  3TGU D;  1CIG A;  1K3H A;  1QL3 A;  1GJQ A;  1IRW A;  3MK7 C;  2GIW A;  3OCD B;  1C7M A;  4EID A;  3KZI V;  5B66 V;  1AOQ A;  1AOF A;  1CTY A;  1L0N D;  1CHJ A;  2ORL A;  4EDF A;  2GC4 D;  3WFE C;  1CTZ A;  4U3F D;  1W5C T;  5DF5 A;  4FA9 A;  1H32 B;  4AAL A;  1A56 A;  4FAV A;  2Y0C A;  4J20 A;  1CYJ A;  1HZU A;  5TJH A;  1HZV A;  5CIB B;  3WFC C;  3H1H D;  2RMZ A;  2N9I A;  3WU2 V;  3HQ8 A;  4A7P A;  3ORV A;  1CXC A;  1DW0 A;  1FJ0 A;  5GTH V;  2JWA A;  1CYC A;  2FRC A;  1SQB D;  3SWS A;  3SVW A;  2V08 A;  3SJL A;  2N3Y A;  1M70 A;  2RN0 A;  1CO6 A;  2FYN B;  3SXT A;  1JDL A;  4D6T D;  3TF5 A;  1GDV A;  1OCD A;  1I55 A;  4RSZ A;  2OZ1 A;  1BE3 D;  5C9M A;  4PW9 B;  4FAN A;  1M6Z A;  1BL9 A;  4GED B;  3H1I D;  3GW6 A;  4H0K A;  4RJT A;  1R0Q A;  1B7V A;  1GU2 A;  2C9X B;  1I6D A;  3PH2 B;  1DVH A;  1H32 A;  2XTS B;  1HJ3 A;  1H9Y A;  1CRI A;  1BCC D;  4EIE A;  1CRG A;  1CTJ A;  1N9C A;  2C8S A;  2N3B A;  3PXW A;  1DVV A;  1CSX A;  1WEJ F;  4NFG B;  3DP5 A;  1GQ1 A;  5GTI V;  3CWB D;  1GIW A;  2C1V A;  3O5C A;  1RAQ A;  1CSU A;  3VMA A;  4XYD B;  1YCC A;  3L75 D;  1OAE A;  1H31 A;  1KIB A;  3HQ9 A;  5E79 V;  3BCC D;  1CRH A;  1QN2 A;  1KB9 D;  3ZOX A;  3OA8 A;  2JQR A;  3RMZ A;  2AI5 A;  4FA4 A;  1HJ4 A;  2OZ1 B;  2BLF B;  2YCC A;  1E29 A;  4MU8 A;  3ZBM A;  5B5E V;  3CXH W;  3L73 D;  1C2N A;  1U75 B;  2N18 C;  3CX5 W;  1IO3 A;  5DJQ C;  5C0Z A;  2GB8 B;  2FYU D;  2B0Z B;  5IY5 1;  4DY9 A;  2DVH A;  1I54 A;  2Q3E A;  5CIE B;  1C2R A;  3O20 A;  1A2S A;  2ZON G;  5B6Q A;  1LS9 A;  5H2F V;  1I8P A;  5KAF V;  1KX2 A;  5CID B;  1ZZH A;  1CYI A;  1U74 B;  2I8F A;  2MHM A;  1DW3 A;  3VYM A;  1H33 B;  5CIC B;  1DII C;  4FA5 A;  5CYT R;  2C2C A;  4L3H A;  1EB7 A;  1DT1 A;  1YNR A;  1NTK D;  3DR0 A;  1H1O A;  1AYG A;  1F1F A;  3WUI A;  1FCD C;  4N0K A;  1SQQ D;  1CSW A;  3WFD C;  2PCB B;  3PLN A;  1LMS A;  2BPB B;  2KS1 A;  3NBT A;  1DW2 A;  3PRJ A;  4LJI A;  4P4Q B;  3TDK A;  2B11 B;  5CIH B;  1C6S A;  1CRJ A;  1E8E A;  4WQA A;  2L4D A;  1LC2 A;  1MG2 D;  1CCR A;  2B12 B;  5TIS V;  1YFC A;  3RN1 A;  1QYZ A;  1KYO D;  2N9Y B;  2ZZS 1;  3PHL A;  4AX3 A;  1CHH A;  3L74 D;  2Y0E A; 
#chains in the Genus database with same CATH topology
 2Q5U A;  3JSV C;  3FWN A;  1JMB A;  3P8C D;  3OA7 A;  2C9L Y;  2B4Z A;  1LJ2 A;  5E79 H;  3CX5 I;  1VQK P;  2H88 C;  2ZOO A;  1PGP A;  2ZYA A;  1KN7 A;  1IRV A;  1BSN A;  1IQC A;  2YKQ A;  3OA8 B;  5L8R J;  1VQO P;  4IL6 V;  1JM0 A;  3H1L D;  1M60 A;  1IFP A;  2NRG A;  1GK6 A;  2PP6 A;  1L0L K;  1SQV J;  2XV5 A;  1NKZ B;  3RK3 D;  3CYT I;  5BU5 A;  3CD6 P;  2KLU A;  5CIG B;  3V6I A;  1J2J B;  3V2P A;  1QL1 A;  1JMM A;  1H88 A;  1N15 A;  1P84 I;  2BH5 X;  3RL0 C;  4U3F J;  2KOG A;  4WQD A;  3RK2 B;  3HE5 A;  2O01 J;  2RH0 A;  1FI3 A;  1MG3 D;  4IL6 H;  1YQ3 C;  2C1U A;  2P67 A;  4OGQ B;  1KIL A;  1A02 J;  1OFC X;  1L4A A;  1KZU B;  1FDO A;  1KB9 E;  3HD7 C;  3IR9 A;  3L73 J;  2ZXX A;  1LP1 A;  5CCG C;  1BE3 J;  1KYO H;  2ZXY A;  1CIH A;  4WQC A;  4GT1 A;  5DJQ B;  4KT0 J;  3AE7 C;  3Q5R A;  1A02 F;  1C6R A;  4WVZ A;  1SQB J;  2AXT V;  4PV1 D;  1CZQ A;  1LTA C;  2R44 A;  3VNW A;  1NTK E;  3CCS P;  4YPC A;  2AEM A;  3CWB J;  4FA1 A;  1U7J A;  1SQB G;  1I8O A;  1R5L A;  3RGU A;  1NU1 J;  1IJD B;  2WPV B;  451C A;  1BGY G;  3D6Z A;  1NTM J;  2BGV X;  1CXA A;  1PP9 D;  2AEJ A;  1DW1 A;  2K37 A;  5KLI B;  2L5G B;  1EDJ A;  2IBZ G;  3L4F A;  4PJ0 V;  1QX8 A;  3ABV C;  3II6 A;  2IX7 C;  1COT A;  3A0B V;  2QM8 A;  2IBZ D;  3HUS A;  1SQP D;  3PXT A;  3H1L E;  1JY2 O;  4IFD K;  3H1J J;  3AEB C;  2FYU J;  2CE1 A;  1BDD A;  2Q1K A;  2WPS A;  2N18 B;  3CCJ P;  1VQ7 P;  1UIX A;  3RK2 D;  3A0H H;  2QJK B;  3PTZ A;  3EWK A;  1C52 A;  5H2F H;  1QL2 A;  1GL2 D;  4UB6 V;  1Q7Y Q;  1S5L V;  1FS0 E;  4H13 D;  2HR3 A;  1Q81 Q;  2HG5 D;  3RK3 B;  2CE0 A;  3BAT A;  3AE4 C;  3A0H V;  1KQF B;  1SQQ K;  3HE5 B;  4WY4 A;  1LT1 A;  4O9B A;  1KYO I;  4Y28 J;  1L0L E;  1F1C A;  2IZ0 A;  1BGY J;  4XFJ A;  4DZO A;  2LIT A;  5KKZ B;  1W2B O;  1SS1 A;  2JWD A;  2WSE J;  3H1H G;  1YJ9 P;  1LFM A;  3KPE A;  1LNQ A;  1YIT P;  3CX5 E;  1ETP A;  4M3L A;  5KLV G;  1IZN B;  4UB8 V;  2XKM A;  1EZV G;  1JY3 N;  1RHZ B;  2JDI H;  1ZV8 A;  2KXP B;  2GIW A;  4KJM A;  3OCD B;  1AOQ A;  1NTM E;  4WY4 D;  3L73 G;  2WIT A;  1NTM K;  1GDT A;  3MUD C;  1CTY A;  2VRS A;  1AA0 A;  2E5Y A;  1CHJ A;  3CXH I;  2OTJ P;  1QLE D;  5APY A;  2WZ7 A;  2R32 A;  5KLV J;  2KSE A;  4U3F D;  3VOP A;  1BCC G;  1SQX J;  5DF5 A;  2WSF H;  4Y99 B;  1A56 A;  1YJW P;  3BCC J;  4AQR D;  1RF1 A;  2MJZ A;  1CYJ A;  1HZU A;  5TJH A;  4CPG A;  1SQB E;  3HQ8 A;  2AXT H;  2LR2 A;  4TLF A;  3CI9 A;  3B5N A;  5AW4 B;  2IFM A;  1VF5 D;  5CCH C;  3HTK B;  3TNU B;  3H1H E;  3SVW A;  1DEE G;  3H32 B;  2N3Y A;  1JO5 A;  1M70 A;  1OX3 A;  1LWU B;  1CO6 A;  2FYN B;  3L71 J;  1NTK G;  1DD3 A;  1LWU C;  2LKM A;  2O01 H;  1OCD A;  4EYY Q;  4GED B;  3H1I D;  2ZFC A;  5GTH H;  3GMA A;  2GM4 A;  1LT9 B;  1RE4 C;  3U1C A;  1H0T A;  1GU2 A;  2C9X B;  4RKU J;  1RF1 C;  1H32 A;  2PGD A;  1HJ3 A;  4EIE A;  2Z5H A;  1CRG A;  3NTN A;  1CTJ A;  2N3B A;  3DP5 A;  3LIE A;  5CJ4 A;  2V7Q H;  3B4S A;  4YXW H;  2RKL A;  2W8Z A;  3KQG A;  1JCD A;  3D70 A;  1RAQ A;  1CSU A;  4XYD B;  3FXE A;  1T3J A;  1YQ4 C;  1OAE A;  1H31 A;  2QA4 P;  3HQ9 A;  5E79 V;  2QVA A;  1CRH A;  3N7N A;  1QN2 A;  1SQV E;  1PGO A;  3R4Y A;  2JQR A;  3RMZ A;  4FA4 A;  2OZ1 B;  2YCC A;  1NTZ E;  2FYN C;  1VDF A;  5B5E V;  3HD7 A;  1S5L E;  3E1I A;  1VF5 B;  3Q3D A;  1Y47 A;  2N1T A;  3MD0 A;  5KJ7 A;  1IFD A;  4DT0 A;  5IY5 1;  2HPC A;  4RO0 A;  4I2L C;  3O20 A;  1L0N J;  5KAI E;  4ZMD A;  5H2F V;  5CID B;  1ZZH A;  2P2U A;  1EDK A;  2O01 N;  1NU1 G;  1CYI A;  1U7M A;  3VYM A;  1H33 B;  4EOT A;  2OGU A;  1NJI Q;  1LTI C;  1FZF A;  1DD4 A;  2YO2 A;  2M3B A;  4GOD A;  1J1D B;  1DT1 A;  1T2K C;  3DR0 A;  1F1F A;  3M9Q A;  1FCD C;  1HH0 A;  1VQ4 P;  1SQQ D;  1GU4 A;  3E1R A;  3RL0 D;  5GTI E;  2FFD A;  2PCB B;  3UIA A;  3GLM A;  1G1J A;  3MIW A;  3PLN A;  2FYU G;  5AVX B;  1KB9 H;  4YXD C;  4LLH A;  1FBM A;  1N73 C;  2B11 B;  1C6S A;  4AYC A;  1CRJ A;  3TGU J;  1KTM A;  1J1E C;  2L4D A;  1JY3 P;  1LTB C;  2Y9Z A;  1MG2 D;  1CCR A;  3RN1 A;  2FYU K;  1GK4 A;  5KLI C;  2HOD A;  5KAI H;  1T2K D;  1CHH A;  4BRY A;  1TU3 F;  3B5N C;  1ZRT E;  1N7S D;  2N9B A;  1I6E A;  1YTC A;  1JUN A;  3F5H A;  5KAF E;  1IFN A;  1P84 H;  4YE1 A;  1DH3 A;  4ZKP A;  1G2C B;  3MZW B;  5DJT B;  2ZJS E;  3GHG B;  4IL6 E;  3FWL A;  3N4X A;  1H31 B;  2K3R A;  1N90 A;  2J59 M;  3O8Z A;  2ZVN B;  4H13 B;  1KD1 Q;  3L71 G;  1VQ6 P;  1PZQ A;  3CCU P;  1Q2N A;  3H1I J;  1SQX G;  1RE3 A;  2L91 A;  1G2C A;  2JKV A;  1SQP G;  3VYI A;  1SQX D;  1FDI A;  1CI6 A;  2W6A A;  4D6T J;  1N86 A;  2Y0D A;  1RZ5 A;  1WVE C;  2H43 A;  1ZR4 A;  2QG4 A;  1USE A;  4N3Y B;  3AE2 C;  3O6Q A;  4JPZ B;  2R3S A;  3L70 J;  2LXB A;  3DMI A;  5AUR A;  5KLV K;  2MTA C;  1EXI A;  2YIU B;  2XZR A;  3ITK A;  2PRR A;  3SWF A;  3EFF K;  1NTZ D;  1LWU A;  2QJP B;  1NTZ G;  4DJG A;  1MV8 A;  2IBZ I;  1SQV D;  3G71 P;  3AE5 C;  1JEK A;  3HTK A;  3QH9 A;  2QJP C;  1IO4 A;  1QKS A;  1NU1 D;  1IC2 A;  3JCU H;  4WQE A;  2KB7 P;  5AVS B;  1W2L A;  2YK3 A;  1YYC A;  3LW5 J;  3X39 A;  1FZA A;  2E74 C;  1KB9 I;  2E75 C;  2BCC E;  2M3E A;  3H1J G;  3CWB G;  3WFB C;  1MFZ A;  4H0J A;  1JOC A;  1N50 A;  1JNM A;  2WT7 A;  3VMX A;  3MK7 B;  1LGH B;  2HYN A;  1E2R A;  2M8R A;  3S1K A;  1QL4 A;  1AQ5 A;  1GKS A;  2C0W A;  5APS A;  2E42 A;  1L9J C;  2BCN B;  1Y9B A;  2V07 A;  1PP9 G;  3USS A;  2M0B A;  3HQ6 A;  2B10 B;  1ZR2 A;  2OTL P;  3AEE C;  5B66 E;  5KJ7 C;  1L9B C;  2E5T A;  3P32 A;  4JQ0 D;  1M1J B;  4K35 A;  4BWN A;  3L70 E;  1SP4 A;  1EXJ A;  1IFI A;  1EZV E;  1IK7 A;  1K04 A;  3NWV A;  3L37 A;  3H1K D;  2D2C B;  3CMA P;  1PGQ A;  5GTI H;  1C6O A;  1ZW0 A;  1CC5 A;  4PWA A;  1U57 A;  2K88 A;  4IFF A;  3TGU G;  3VN0 A;  4LGD E;  3EFG A;  3L73 E;  2C1D A;  1KYO W;  4BXL A;  1VQ9 P;  2I8D A;  3H25 A;  3CU4 A;  2MKV A;  4ASV A;  2QE7 H;  3M9B A;  1C75 A;  3JBT B;  2VHD A;  1URQ B;  3VMY A;  3A9F A;  3AEC C;  2AIU A;  1AV1 A;  1NU1 K;  1YEB A;  2GC7 D;  1OMI A;  4C7R A;  5CJ0 A;  1JY2 P;  1H8A A;  3HQ7 A;  2ZVO B;  3P8M C;  4K3I A;  5KAF H;  1QVG O;  3SWK A;  3GG2 A;  4JBZ A;  4V2K A;  3RK2 C;  1YI2 P;  3A5T A;  1K3H A;  1EDI A;  1HGZ A;  5KJ7 D;  2HLO A;  1Q82 Q;  1USD A;  3I55 P;  1GU5 A;  5AW8 B;  4EID A;  3M91 A;  1AOF A;  3TGU E;  1HUC A;  2YKP A;  1LTG C;  1PL5 A;  2DW3 A;  1RF1 B;  2WSC H;  3HUS B;  3IN6 A;  1FZC B;  4EDF A;  3D71 A;  2E75 B;  2FXM A;  2BAS A;  4U7J A;  2FY8 A;  2Y0C A;  1N73 B;  4J20 A;  5CIB B;  3H1H D;  3ORV A;  2PFX A;  5B5E H;  1K73 Q;  5CMZ A;  1DW0 A;  2B89 A;  4Y99 C;  4H44 B;  2C9N Y;  1AJY A;  2JO1 A;  2JWA A;  2OYH A;  4PV1 C;  4KHX A;  1CSB A;  4C7N A;  1SQB D;  3SWS A;  1NTZ K;  4D6T G;  3G4S P;  2WT7 B;  2OYH C;  2OTK E;  4W7Z A;  3SXT A;  1JDL A;  4D6T D;  3TF5 A;  1GDV A;  1MZ9 A;  1YHQ P;  5C9M A;  1BE3 D;  1VQL P;  4FAN A;  1BL9 A;  4H44 D;  2NPS B;  1HVV A;  2KP8 A;  3A0B H;  3F89 A;  1I6D A;  4UB8 E;  3KXD A;  1GW4 A;  1N7S A;  3A3Y B;  2E76 C;  2N1T B;  5AW6 B;  1HJ0 A;  2YXQ B;  4L76 A;  3PXW A;  1BSH A;  1WEJ F;  4NFG B;  3L72 E;  1XTG B;  1GQ1 A;  4D6T E;  1GD2 E;  3HUS C;  2A06 G;  2HFE D;  3FXD A;  2JP3 A;  3O5C A;  3G6E P;  1FOS F;  1YCC A;  1QEX A;  1KIB A;  5AVT B;  3BCC D;  1KB9 D;  1NVO A;  1FE6 A;  5AW7 B;  2E43 A;  1AVO A;  1IFM A;  1JCC A;  4MU8 A;  2YIU C;  1C2N A;  4JF7 A;  3QWO C;  3L70 G;  3L75 E;  4GOE A;  1ZME C;  2N18 C;  3CX5 W;  4W80 A;  3V5B A;  5DJQ C;  5C0Z A;  3VTP C;  1YTZ T;  2B0Z B;  3H1L G;  3TK1 A;  1I54 A;  1A2S A;  2ZON G;  2FFD B;  3Q5S A;  3L71 E;  1BDC A;  1U74 B;  3H1H J;  1DII C;  5CYT R;  3L72 J;  2C2C A;  1FZE A;  1KV4 A;  2KS1 B;  4H13 C;  4OGQ D;  3CCR P;  1YIJ P;  1YNR A;  3RL0 g;  2H7H A;  3WUI A;  3WUU A;  3CLQ A;  2Q3I A;  2A45 I;  2AEF A;  4L74 A;  2XU6 A;  3D6Y A;  3VMZ A;  3L75 J;  2KS1 A;  3NBT A;  2FXO A;  4I7Z B;  3HRN A;  2QJY C;  2YKO A;  3PRJ A;  4P4Q B;  5H2F E;  1Y8A A;  2Q6Q A;  2H89 C;  2N1T D;  1OW7 A;  3CXH E;  3GF7 A;  1OVU A;  1MFT A;  5TIS V;  1QYZ A;  2N9Y B;  2ZZS 1;  3PHL A;  1PPJ E;  4I7Z C;  1J1E B;  4NPE A;  3L74 D;  2Y0E A;  2W6J H;  1S3J A;  5KLV D;  1YEA A;  1L0N K;  4EIF A;  3CCL P;  1EZV D;  3HD7 B;  4I1L A;  1CRY A;  4QMA A;  2H8P D;  2IZ1 A;  1XTC C;  1S5L H;  1IZL 0;  1HTL C;  5KAI V;  1QVF O;  1BGY D;  1M7L A;  2LIR A;  4XXL A;  1COR A;  4NPF X;  3CP5 A;  2WQY C;  2V4H A;  5EXQ A;  1L0L J;  1SQV K;  3VP8 A;  1NWQ A;  3BVH A;  5AW2 B;  4WQB A;  1FU1 A;  1R8E A;  1NTM D;  2WSC J;  2YO3 A;  1YTZ I;  1FI9 A;  4HJG H;  1CI6 B;  2ZAE B;  1KIL D;  2UWJ E;  3FGA D;  4O1Q A;  2QIW A;  2CXB A;  3M06 A;  1CNO A;  2W6B A;  3WMM 0;  1ZRT D;  5APT A;  3WU2 H;  3HD7 D;  2K9J B;  3PXS A;  1X0T A;  3B8E B;  351C A;  2KZI A;  1LTT C;  2JR8 A;  1VPC A;  1KQG B;  5M1B A;  2GUV A;  2CA4 B;  2R5B A;  3CL3 D;  1I5T A;  2C0X A;  4YTP C;  3B5N B;  3T97 A;  1FZC C;  3NXS A;  2WMM A;  1R5S A;  1DX7 A;  1L0L G;  4IL6 X;  1HRO A;  3L4O A;  1SFC D;  2KUB A;  1CIF A;  2E76 D;  3FX0 A;  1A8C A;  3KDP B;  3L35 A;  4GDO A;  2KLV A;  3L71 D;  3JC2 2;  4EIC A;  3O0R C;  1CCH A;  1CED A;  3ZIY A;  2W27 A;  1S72 P;  3CWB E;  3GHG C;  4WQ9 A;  3ZOW A;  1L4A D;  1RF0 C;  5AVU B;  3CX5 D;  1NMI A;  2K9Y A;  2CA3 B;  4L1Q A;  5C39 A;  2G8Y A;  1FZG A;  1FZC A;  4DCK A;  4TT3 H;  1FAV A;  1RQU A;  1SQX E;  1AQT A;  4PJ0 H;  2P58 A;  1PGJ A;  1DIQ C;  2YQB A;  3VRD A;  1EQ7 A;  3SFE C;  1ZXG A;  3OJA B;  1RAP A;  4DOJ A;  2B88 A;  1FZB A;  3V4W A;  4R4M A;  1HCM A;  1OXZ A;  3ZCF A;  3S4R A;  4WQ8 A;  2BH4 X;  1H9X A;  1LC1 A;  3V2Q A;  1SFC C;  1KB0 A;  4W7Y A;  2DGE A;  3WC8 A;  1WMK A;  1LTJ B;  3KZI E;  5AVV B;  1T3U A;  1X22 A;  1P84 D;  3TYI A;  2C1D B;  3NMD A;  1S6V B;  1KV9 A;  1BGY E;  2YMK A;  3W67 A;  1HF9 A;  2PCC B;  1SQQ G;  1IFJ A;  2IBZ E;  1NIR A;  1URQ A;  3HE4 B;  1J1D C;  3NBS A;  3BAS A;  3MTU E;  1OVR A;  4PV1 B;  4O1W A;  2E74 D;  5KTB A;  3HE4 A;  3L70 D;  3TYY A;  2WTY A;  1N8R Q;  3C8V A;  4PD4 D;  3H1I G;  3TNU A;  1KOR A;  4UB8 H;  3CXH D;  2AXT E;  4XA4 A;  5CIF B;  2ZT9 B;  3A7O A;  1URQ D;  4H0L D;  1OWA A;  2KNC A;  1FHB A;  1M8O B;  1SQQ E;  4OWF A;  2D0W A;  5DFS A;  5APU A;  2FYU E;  2W83 C;  1GW3 A;  3ZOY A;  1M90 Q;  3H1J E;  5AW1 B;  3MHV A;  1HJ5 A;  3H32 A;  5AVW B;  3TGU D;  2KI7 B;  1QL3 A;  2BCC J;  1GJQ A;  1IRW A;  2D2C C;  2R5D A;  2Q7C A;  2D2C D;  2YNY A;  4BRY B;  1HWT C;  1K05 A;  3A0B E;  1QGK B;  1RY3 A;  1L0N D;  2Z5I A;  2O1J A;  3CCV P;  1Q86 Q;  1NGM B;  1NU1 E;  1S1C X;  3WFE C;  1N73 A;  4N6J A;  3H6P A;  3Q5P A;  1H32 B;  2QRX A;  4AAL A;  3RBX A;  2Q9I A;  1HGV A;  1HZV A;  1NAY A;  2N9I A;  1M1J C;  4A7P A;  1KYO E;  2ZXE B;  2OYI C;  1FJ0 A;  2POH A;  5GTH V;  1N2D C;  5DJU B;  2IPP A;  1CYC A;  4N78 D;  4OVN F;  2KIK A;  4JYB A;  3IAO A;  2V08 A;  5CCH A;  2RN0 A;  1SQX K;  2M5A B;  1L4A B;  3AED C;  1KQL A;  1Q90 D;  1OVV A;  3G3Z A;  2OZ1 A;  1KFN A;  3A2A A;  1M6Z A;  2BEQ D;  2XNX A;  4GKG A;  3GW6 A;  4H0K A;  3PH0 A;  1PP9 J;  1N7S C;  3LW5 H;  3C9I A;  3PH2 B;  2HPC B;  1DVH A;  5AVY B;  3AE1 C;  1L2P A;  3Q1M A;  1CRI A;  1BCC D;  2R3C A;  1N9C A;  2C8S A;  1FDM A;  2LXC B;  4L75 A;  1DVV A;  1ZLL A;  1JY2 N;  1S9K D;  1NH4 A;  1GIW A;  2C1V A;  2A06 E;  3I56 P;  3NFQ A;  3VMA A;  1UII A;  4IFM A;  1L0N E;  3P7K A;  1RF0 A;  1IK9 A;  2QJK C;  1KFM A;  3SFD C;  1S2E A;  3ZOX A;  3OA8 A;  2AI5 A;  1NAF A;  2K9J A;  1HJ4 A;  2BLF B;  2O1K A;  1WT6 A;  1E29 A;  1L4A C;  3CXH W;  3L36 A;  5B66 H;  3AEA C;  4HYT B;  5APQ A;  2KZJ A;  2FFD C;  1X8Y A;  2GB8 B;  2FYU D;  5CCG D;  1VQ8 P;  3U59 A;  4DY9 A;  2DVH A;  2Q3E A;  5CIE B;  1C2R A;  1S9K E;  1JTH A;  2IYO A;  1RQV A;  1LS9 A;  1I8P A;  3JCU E;  1KIL E;  2MHM A;  3H1K G;  1BCC E;  5CIC B;  2V7Q J;  4HH2 A;  3KZI H;  4FA5 A;  2JEE A;  2CPB A;  1EB7 A;  1LTS C;  1NHL A;  1EDL A;  3ZDM A;  1L0N G;  2NPS A;  1CSW A;  3EQ2 A;  3WFD C;  4WWI A;  1PPJ G;  1N7L A;  1M1K Q;  4GIF A;  3AE6 C;  1KMI Z;  1LMS A;  2BPB B;  2ZT9 C;  2ZYD A;  1P84 E;  1S4X A;  5CIH B;  5E79 E;  3TSI A;  4WQA A;  5EFW B;  1HBW A;  3RL0 B;  1MUU A;  1YFC A;  3AE3 C;  4EI2 A;  2QSI A;  4HKZ H;  1KYO D;  1ZN5 A;  2I1J A;  4AX3 A;  2KSJ A;  2G3A A;  1YBK A;  1LP1 B;  4H0L C;  2CPS A;  2OYI A;  1S5L X;  2IYP A;  3M97 X;  3CPW O;  1CHI A;  1K3G A;  4HB1 A;  4PJ0 E;  3CX5 H;  1OIP A;  1SLQ A;  4I6M C;  5CCH D;  3CCE P;  2WWW A;  5AW0 B;  4JYC A;  3AEG C;  1SQP J;  1RZ6 A;  1CIE A;  3C2C A;  2KNC B;  3KYQ A;  1FJK A;  1E5W A;  1AFO A;  2XDJ A;  3O6Q B;  5AW9 B;  1PP9 E;  3M0A A;  2GA1 A;  1VF5 C;  2YXR B;  3M0D C;  1X9V A;  1FOS E;  5APW A;  3M0D A;  2FWL A;  2XND H;  3V4Q A;  4JCG A;  3WU2 E;  1PV3 A;  155C A;  2PAC A;  3H1J D;  4GOF A;  3L74 G;  2D0S A;  3KHU A;  4QAO A;  2WVR A;  1NYH A;  2YMY A;  4PD4 I;  3A0H E;  1K8A Q;  1FI7 A;  3OW2 O;  1NNO A;  2FBW C;  1YIC A;  2N9J A;  1BE3 G;  2OYO A;  5CHX A;  1AVY A;  2WPR A;  3BCC E;  3CXH H;  2BCC D;  3MGN A;  5KLV E;  1LTJ A;  2WSE H;  1X79 B;  3CC7 P;  4KMG A;  5CCG A;  3L72 D;  3ZOO A;  4H0L B;  4WQ7 A;  4AAN A;  1OZH A;  2A06 D;  2PAJ A;  3CCM P;  2WSS H;  2AXC A;  4RES B;  3BCC G;  1VQ5 P;  1GL2 B;  1Z56 A;  2E75 D;  2E74 B;  3O1Y A;  1GL2 A;  3R2P A;  3L74 J;  2IFN A;  4AAO A;  4GYD A;  1SQQ J;  2KYV A;  5APX A;  1GL2 C;  3H1K J;  4K3A A;  1YIQ A;  1DIP A;  2K1A A;  5TIS E;  1LTJ C;  5BU8 B;  4UB6 E;  1L0L D;  3B5N D;  2ITA A;  2JJL A;  2J5U A;  5GTH E;  1SFC A;  3L4M A;  1PPJ D;  1AKK A;  1EZV I;  3BRV B;  1H33 A;  1VQN P;  2HV4 A;  1CW5 A;  3SWY A;  3WUT A;  4NPD A;  2QJY B;  1NTK K;  1HJB A;  1FC2 C;  1JTH B;  3OCD A;  3T97 B;  2FXP A;  3L75 G;  2EXV A;  2ZT9 D;  1K9M Q;  1PFI A;  5AW5 B;  2O3J A;  2FYZ A;  4C46 A;  2WPQ A;  1CSV A;  1E79 H;  2B87 B;  1WRG A;  3S9O A;  1LT9 A;  4Q5P A;  3H1L J;  2QM7 A;  1CRC A;  1T8Z A;  1FJP A;  1JB0 J;  1URQ C;  3AE9 C;  2JTI B;  1M57 D;  1KX7 A;  4L3G A;  3RN0 A;  1EC5 A;  4XE5 B;  2OQQ A;  3CCQ P;  5KKZ C;  1VYD A;  4Y5R A;  2ZBO A;  1FOC A;  2HOD B;  5CBO A;  4U3F G;  1SQV G;  1NML A;  3SLE A;  3AEF C;  4FB1 A;  4U3F E;  1SQB K;  1MZ4 A;  3V2N A;  1HRC A;  1HH7 A;  3RLM A;  1M1J A;  1NTK J;  4AAM A;  3Q2Y A;  1J3S A;  3V2R A;  5AVR B;  4C7N B;  1CIG A;  1N7S B;  3CC2 P;  3CME P;  2A45 H;  2KK7 A;  3MK7 C;  3MUD A;  2W90 A;  4PD4 H;  4PD4 E;  1C7M A;  3AE8 C;  3KZI V;  5B66 V;  1BE3 E;  3WUV A;  5AW3 B;  3IF4 A;  4ZNC A;  3IFM A;  4ZKU A;  1MKM A;  2ORL A;  3H1K E;  1T6A A;  1KIL C;  2GC4 D;  1CTZ A;  3E7K A;  1W5C T;  5BVZ A;  3L74 E;  1ZP0 C;  4OH8 B;  1KC8 Q;  4FA9 A;  4OGQ C;  2OYI B;  4FAV A;  1DEB A;  4L73 A;  1KIL B;  2IDB A;  3WFC C;  2RMZ A;  3WU2 V;  3D0W A;  2CK3 H;  3M9H A;  2A45 G;  5B5E E;  1CXC A;  3RK3 C;  3VP9 A;  5AVQ B;  2FKW B;  4WBA A;  1KQS O;  2FRC A;  1BCC J;  3G9R A;  3SJL A;  4MN4 C;  1D7M A;  3LID A;  2WSF J;  4RSZ A;  1I55 A;  2ZYG A;  4PW9 B;  4RJT A;  1VL2 A;  1R0Q A;  3CC4 P;  1B7V A;  3I5C A;  1PIX A;  1W5C E;  1GMJ A;  3RBZ A;  5TIS H;  2XTS B;  3BRT B;  1H9Y A;  1NTZ J;  3C1L A;  3SSU A;  1CSX A;  1NKN A;  5GTI V;  3CWB D;  3GF3 A;  3PP5 A;  3P8C E;  3H1I E;  4WY4 B;  2I1K A;  1VQP P;  3L75 D;  4UB6 H;  1H0T B;  2B87 A;  2NPS D;  2J58 A;  3K5B A;  4EIJ A;  1RE4 A;  1OW8 A;  3ZBM A;  4H44 C;  3L73 D;  1U75 B;  1SQP E;  1SQP K;  2SPZ A;  2OYH B;  1IO3 A;  1NTM G;  2Y9Y A;  5B6Q A;  5KAF V;  1KX2 A;  3GHG A;  5APV A;  2OAR A;  2QEX P;  2NZ2 A;  3W68 A;  4Z1M H;  2I8F A;  1DW3 A;  4AUW A;  1M56 D;  2BEZ F;  1GZL A;  1RH5 B;  5CBN A;  1LT9 C;  3PJS K;  4L3H A;  4IOI H;  1SFC B;  2P10 A;  2E76 B;  1NTK D;  1H1O A;  1AYG A;  2GUS A;  1G1I A;  4N0K A;  4LC1 A;  3MP7 B;  1VQM P;  1YJN P;  4WB4 A;  1W2E A;  2N1T C;  3U1A A;  2NPS C;  1NO4 A;  4B86 A;  2M5A A;  1ZOY C;  2P1J A;  3L72 G;  2BCC G;  1DW2 A;  1SVF A;  3B71 A;  4LJI A;  3RK3 E;  3TDK A;  3OAK A;  1OW6 A;  1JY3 O;  1E8E A;  4WY4 C;  1GTW A;  2B9B A;  1LC2 A;  2Z4E A;  4R4L A;  4N78 E;  2B12 B;  2P7J A;  4ASW A;  5AVZ B;  1H89 A;  1NOH A;  1RE3 C;  5K5G B; 
#chains in the Genus database with same CATH homology
 5KLV D;  1YEA A;  3M97 X;  1CHI A;  4EIF A;  1K3G A;  2B4Z A;  1EZV D;  1CRY A;  1I6E A;  1YTC A;  1IZL 0;  5KAI V;  1BGY D;  4YE1 A;  2LIR A;  4XXL A;  1COR A;  1RZ6 A;  3CP5 A;  2ZOO A;  1CIE A;  3C2C A;  2KNC B;  5EXQ A;  1IRV A;  1IQC A;  3OA8 B;  3FWL A;  4IL6 V;  1H31 B;  3H1L D;  1N90 A;  4WQB A;  1M60 A;  1NTM D;  1FI9 A;  3CYT I;  2FWL A;  5CIG B;  4O1Q A;  2CXB A;  4JCG A;  155C A;  1CNO A;  2PAC A;  3H1J D;  2L91 A;  1ZRT D;  2D0S A;  1N15 A;  3KHU A;  1SQX D;  4QAO A;  2Y0D A;  1RZ5 A;  1WVE C;  2BH5 X;  2QG4 A;  2K9J B;  3PXS A;  351C A;  4WQD A;  1FI7 A;  2CA4 B;  1NNO A;  1FI3 A;  1MG3 D;  1I5T A;  1YIC A;  2N9J A;  3DMI A;  5AUR A;  2MTA C;  2YIU B;  2C1U A;  3ITK A;  1HRO A;  3L4O A;  1CIF A;  1NTZ D;  2BCC D;  2QJP B;  1A8C A;  4KMG A;  1SQV D;  3L71 D;  4EIC A;  3O0R C;  1CCH A;  3L72 D;  3ZOO A;  1QKS A;  1NU1 D;  4WQ7 A;  4AAN A;  1CED A;  4WQE A;  3ZIY A;  1W2L A;  2A06 D;  2YK3 A;  3X39 A;  2ZXY A;  1CIH A;  4WQC A;  5DJQ B;  4WQ9 A;  3ZOW A;  1C6R A;  3WFB C;  3CX5 D;  1NMI A;  4H0J A;  2AXT V;  1N50 A;  2CA3 B;  4L1Q A;  3VNW A;  3MK7 B;  4FA1 A;  3O1Y A;  1E2R A;  1I8O A;  1QL4 A;  4AAO A;  1DIQ C;  4GYD A;  1GKS A;  2YQB A;  3VRD A;  1L9J C;  1YIQ A;  2BCN B;  1RAP A;  451C A;  2V07 A;  1L0L D;  1HCM A;  3ZCF A;  3L4M A;  2BGV X;  1CXA A;  1PP9 D;  1DW1 A;  1PPJ D;  4WQ8 A;  2BH4 X;  5KLI B;  1AKK A;  1H9X A;  3HQ6 A;  1LC1 A;  1KB0 A;  4PJ0 V;  2B10 B;  1H33 A;  2DGE A;  3WC8 A;  1COT A;  2HV4 A;  3A0B V;  1L9B C;  2IBZ D;  1SQP D;  3PXT A;  1P84 D;  2QJY B;  3TYI A;  3OCD A;  2C1D B;  2CE1 A;  2EXV A;  3NWV A;  3H1K D;  2O3J A;  1C6O A;  2N18 B;  1S6V B;  1KV9 A;  1CSV A;  1CC5 A;  4PWA A;  2QJK B;  2PCC B;  3PTZ A;  4Q5P A;  2C1D A;  1KYO W;  1NIR A;  1CRC A;  1C52 A;  3NBS A;  3CU4 A;  4O1W A;  4UB6 V;  1S5L V;  2JTI B;  1KX7 A;  4L3G A;  3L70 D;  3RN0 A;  1C75 A;  3JBT B;  2VHD A;  3A9F A;  2CE0 A;  4PD4 D;  2AIU A;  1VYD A;  4Y5R A;  3A0H V;  2ZBO A;  3CXH D;  1YEB A;  2GC7 D;  1FOC A;  1F1C A;  5CIF B;  1NML A;  3SLE A;  2LIT A;  5KKZ B;  3HQ7 A;  4FB1 A;  1FHB A;  2D0W A;  1MZ4 A;  5DFS A;  4K3I A;  1HRC A;  3ZOY A;  1HH7 A;  3RLM A;  1LFM A;  3GG2 A;  4V2K A;  4AAM A;  1ETP A;  1J3S A;  1HJ5 A;  4UB8 V;  3TGU D;  1CIG A;  1K3H A;  1QL3 A;  1GJQ A;  1IRW A;  3MK7 C;  2GIW A;  3OCD B;  1C7M A;  4EID A;  3KZI V;  5B66 V;  1AOQ A;  1AOF A;  1CTY A;  1L0N D;  1CHJ A;  2ORL A;  4EDF A;  2GC4 D;  3WFE C;  1CTZ A;  4U3F D;  1W5C T;  5DF5 A;  4FA9 A;  1H32 B;  4AAL A;  1A56 A;  4FAV A;  2Y0C A;  4J20 A;  1CYJ A;  1HZU A;  5TJH A;  1HZV A;  5CIB B;  3WFC C;  3H1H D;  2RMZ A;  2N9I A;  3WU2 V;  3HQ8 A;  4A7P A;  3ORV A;  1CXC A;  1DW0 A;  1FJ0 A;  5GTH V;  2JWA A;  1CYC A;  2FRC A;  1SQB D;  3SWS A;  3SVW A;  2V08 A;  3SJL A;  2N3Y A;  1M70 A;  2RN0 A;  1CO6 A;  2FYN B;  3SXT A;  1JDL A;  4D6T D;  3TF5 A;  1GDV A;  1OCD A;  1I55 A;  4RSZ A;  2OZ1 A;  1BE3 D;  5C9M A;  4PW9 B;  4FAN A;  1M6Z A;  1BL9 A;  4GED B;  3H1I D;  3GW6 A;  4H0K A;  4RJT A;  1R0Q A;  1B7V A;  1GU2 A;  2C9X B;  1I6D A;  3PH2 B;  1DVH A;  1H32 A;  2XTS B;  1HJ3 A;  1H9Y A;  1CRI A;  1BCC D;  4EIE A;  1CRG A;  1CTJ A;  1N9C A;  2C8S A;  2N3B A;  3PXW A;  1DVV A;  1CSX A;  1WEJ F;  4NFG B;  3DP5 A;  1GQ1 A;  5GTI V;  3CWB D;  1GIW A;  2C1V A;  3O5C A;  1RAQ A;  1CSU A;  3VMA A;  4XYD B;  1YCC A;  3L75 D;  1OAE A;  1H31 A;  1KIB A;  3HQ9 A;  5E79 V;  3BCC D;  1CRH A;  1QN2 A;  1KB9 D;  3ZOX A;  3OA8 A;  2JQR A;  3RMZ A;  2AI5 A;  4FA4 A;  1HJ4 A;  2OZ1 B;  2BLF B;  2YCC A;  1E29 A;  4MU8 A;  3ZBM A;  5B5E V;  3CXH W;  3L73 D;  1C2N A;  1U75 B;  2N18 C;  3CX5 W;  1IO3 A;  5DJQ C;  5C0Z A;  2GB8 B;  2FYU D;  2B0Z B;  5IY5 1;  4DY9 A;  2DVH A;  1I54 A;  2Q3E A;  5CIE B;  1C2R A;  3O20 A;  1A2S A;  2ZON G;  5B6Q A;  1LS9 A;  5H2F V;  1I8P A;  5KAF V;  1KX2 A;  5CID B;  1ZZH A;  1CYI A;  1U74 B;  2I8F A;  2MHM A;  1DW3 A;  3VYM A;  1H33 B;  5CIC B;  1DII C;  4FA5 A;  5CYT R;  2C2C A;  4L3H A;  1EB7 A;  1DT1 A;  1YNR A;  1NTK D;  3DR0 A;  1H1O A;  1AYG A;  1F1F A;  3WUI A;  1FCD C;  4N0K A;  1SQQ D;  1CSW A;  3WFD C;  2PCB B;  3PLN A;  1LMS A;  2BPB B;  2KS1 A;  3NBT A;  1DW2 A;  3PRJ A;  4LJI A;  4P4Q B;  3TDK A;  2B11 B;  5CIH B;  1C6S A;  1CRJ A;  1E8E A;  4WQA A;  2L4D A;  1LC2 A;  1MG2 D;  1CCR A;  2B12 B;  5TIS V;  1YFC A;  3RN1 A;  1QYZ A;  1KYO D;  2N9Y B;  2ZZS 1;  3PHL A;  4AX3 A;  1CHH A;  3L74 D;  2Y0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...