1KB9D

Yeast cytochrome bc1 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 70
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1kb9D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1kb9D01
1N50A 1BL9A 1I5TA 1IO3A 1FHBA 2CA4B 1KX7A 1OCDA 5TISV 3NBSA 2RMZA 3WFBC 1CRGA 2YQBA 3ZBMA 1KV9A 4QAOA 3CX5D 4EIFA 1CRCA 3L73D 1M70A 4XXLA 5DF5A 1H32A 2PCBB 1N15A 3WFEC 3O1YA 5C9MA 1HJ4A 3VYMA 4FAVA 5KLVD 1CIEA 4MU8A 1CNOA 1CSUA 2BPBB 4FA4A 1RZ5A 1YCCA 4RSZA 3BCCD 1CRJA 4PW9B 1FOCA 3HQ8A 1S6VB 5EXQA 1A2SA 1YICA 3H1JD 1CYJA 5KKZB 1NMLA 3ZOYA 1H9YA 1H33B 1MZ4A 4FANA 1I8OA 4WQEA 2I8FA 3ZIYA 1LC1A 1CSVA 1JDLA 1CORA 1CXCA 2XTSB 1N90A 1GU2A 1HJ5A 1S5LV 2DGEA 351CA 4L3HA 4UB8V 4WQ9A 1I55A 3VMAA 2KS1A 1DT1A 4H0JA 2C1DB 2Q3EA 4GYDA 3SXTA 3A0HV 5CICB 2GC4D 1YIQA 1SQPD 3MK7C 1EZVD 1CTZA 2PCCB 1HH7A 1W5CT 2B10B 3TF5A 1NTZD 1BCCD 1KYOD 4WQCA 1C6RA 2K9JB 2MTAC 2YCCA 3PXTA 3GG2A 3CXHW 3RMZA 3M97X 2Y0DA 4AALA 4FA5A 3CU4A 2V07A 2GC7D 3O5CA 3NWVA 1U74B 1QN2A 4WQDA 1AOFA 3ORVA 4Q5PA 3PHLA 1COTA 3A0BV 4PD4D 1I6DA 2D0WA 3MK7B 4L1QA 2N3BA 5B6QA 1CIGA 5GTIV 2QJKB 1HROA 2YIUB 2CE1A 1CTYA 4EIDA 1HZUA 2N3YA 1CRYA 1CYIA 2LIRA 1FI3A 2VHDA 1PP9D 4WQ7A 5CIEB 3L75D 4N0KA 3CWBD 2N9IA 3PH2B 1C52A 4D6TD 1F1CA 4WQAA 3NBTA 1YFCA 2L91A 4FA9A 3ZOOA 1YEBA 3CX5W 3X39A 3H1KD 3OCDA 1KB9D 3PRJA 2N9JA 1IRWA 3H1HD 2C2CA 3PLNA 3KHUA 3C2CA 3VNWA 1L0LD 3L70D 1I8PA 1NIRA 3OCDB 4U3FD 3DR0A 3DMIA 1C6OA 1FI9A 2Y0EA 1CO6A 4NFGB 5B5EV 2N18C 1CIHA 1H32B 4EICA 5CIHB 3H1LD 1GDVA 2C1VA 1CTJA 2IBZD 2Y0CA 5B66V 3SVWA 2YK3A 5KAIV 1MG3D 1U75B 2CE0A 2QG4A 4YE1A 4EIEA 2ZXYA 5KAFV 1QL4A 4WQBA 1L9JC 3WC8A 1P84D 3O20A 2N18B 1NTMD 1E29A 2FWLA 3DP5A 4H0KA 4AAOA 1IQCA 1LC2A 1F1FA 1B7VA 3HQ7A 4V2KA 3FWLA 4LJIA 2PACA 1IZL0 4DY9A 4P4QB 2C9XB 1H1OA 1ZRTD 1NNOA 3L4MA 1KYOW 1PPJD 1SQBD 3CYTI 2FRCA 3HQ6A 4IL6V 1ZZHA 1DW3A 3RN1A 2DVHA 5KLIB 3A9FA 1H31A 1CXAA 1QKSA 1GJQA 5CIBB 1L9BC 5DFSA 2B4ZA 2D0SA 1IRVA 3PXWA 1NTKD 1J3SA 1FI7A 1C2RA 1RZ6A 2CA3B 4FA1A 1SQQD 1C2NA 3TDKA 2BCCD 4L3GA 5CIDB 1M6ZA 1H31B 2JTIB 1OAEA 1FJ0A 1MG2D 1E8EA 4WQ8A 3PTZA 3WU2V 1N9CA 1K3GA 1A8CA 4FB1A 1ETPA 1LFMA 5CIFB 1HRCA 2AXTV 3HQ9A 3ITKA 4UB6V 2FYNB 4EDFA 4RJTA 5H2FV 1GIWA 1C75A 1E2RA 1C6SA 1QYZA 2BLFB 1HCMA 1LMSA 4KMGA 1EB7A 1DIIC 2MHMA 2N9YB 2B0ZB 5IY51 2FYUD 3WFCC 4AX3A 1W2LA 3TGUD 4AAMA 3SJLA 3VRDA 3ZCFA 1NMIA 1WVEC 3RLMA 1K3HA 3ZOXA 3PXSA 1CSWA 1CRHA 1A56A 1QL3A 5DJQC 2AI5A 3CP5A 1BE3D 1GKSA 1HZVA 1C7MA 3OA8A 5CIGB 2RN0A 1H33A 2AIUA 1YNRA 2ZZS1 1CEDA 5AURA 1CRIA 1YTCA 4Y5RA 3L4OA 2BGVX 1AYGA 1I6EA 2BCNB 3KZIV 2JQRA 1LS9A 1CHIA 1VYDA 2OZ1A 3OA8B 2B11B 3L71D 3H1ID 2V08A 2O3JA 1H9XA 2JWAA 1GQ1A 1I54A 2A06D 1R0QA 5DJQB 1KB0A 1AOQA 4A7PA 2C1DA 1DW0A 155CA 3O0RC 4J20A 3GW6A 2OZ1B 2QJYB 1CHHA 2ZONG 3WUIA 1L0ND 5CYTR 4JCGA 1CYCA 1DVVA 1SQVD 2ORLA 1CCRA 4O1WA 1RAQA 1BGYD 3SLEA 2L4DA 2ZOOA 1SQXD 2BH4X 1DVHA 1CSXA 5TJHA 451CA 1DW2A 3ZOWA 5E79V 1AKKA 3RN0A 1CIFA 1NU1D 1CCHA 3WFDC 3JBTB 2GIWA 2B12B 2C1UA 5C0ZA 2GB8B 1WEJF 1DW1A 3CXHD 3L74D 4O1QA 1DIQC 2HV4A 1YEAA 3TYIA 1KX2A 2LITA 2KNCB 2EXVA 4GEDB 1RAPA 2QJPB 4XYDB 5GTHV 1FCDC 2ZBOA 4PWAA 1CC5A 4K3IA 1M60A 3L72D 2CXBA 1KIBA 2BH5X 2C8SA 4PJ0V 3SWSA 1HJ3A 1CHJA 4AANA
chains in the Genus database with same CATH superfamily
1PGPA 3HUSB 3BCCJ 1PGOA 1IO3A 1SFCA 3NXSA 3L71G 1KX7A 3H1JJ 3WFBC 1CRGA 3ZBMA 2A06G 2IBZE 1AA0A 5KKZC 1M70A 4XXLA 5GTHH 4PV1C 2AXTE 3RL0g 1YJ9P 1Q7YQ 5AVTB 3USSA 1SFCB 3O1YA 4H44C 2O01H 3BATA 3JC22 5K5GB 4FAVA 5H2FE 1CIEA 5CCHD 1EC5A 1N7SC 1IFIA 2V7QJ 1LWUA 1M90Q 1FOCA 3AEGC 3CCQP 5EXQA 1A2SA 3RL0B 5TISH 1G2CA 4EYYQ 2N1TC 2FFDC 3JCUE 1LWUB 1LTJB 2I1JA 3L74G 2ZYDA 1ZMEC 1G2CB 1GL2A 1HJ5A 2DGEA 3CCEP 1KQFB 2IYPA 1FZFA 1Y8AA 2Q3EA 3C9IA 3SXTA 1GL2B 2NZ2A 1HUCA 1W2EA 1U7MA 2LR2A 1HH7A 1BCCD 5L8RJ 3D70A 2MTAC 2WITA 1BDCA 3H6PA 1JCDA 3GLMA 1MKMA 1H88A 2M0BA 4FA5A 3IAOA 4N78D 3CU4A 1RF1B 2V07A 2GC7D 3O5CA 3AE7C 1QN2A 4JBZA 3VYIA 3PHLA 3V2PA 2P10A 3MK7B 3RBXA 2NPSC 1NTZK 1Q86Q 2W27A 1CIGA 2K3RA 1HF9A 2PFXA 1VQOP 1FS0E 5BU8B 2CE1A 2LXBA 1CTYA 1AQTA 3F89A 1VF5B 2WMMA 1QVGO 2KUBA 3AEFC 5AVSB 1HZUA 1CRYA 2OYIA 2VHDA 2E75C 5CIEB 3L75D 1JM0A 3CWBD 2N9IA 4JPZB 3H1LJ 1X22A 3NBTA 1YFCA 1KILC 2L5GB 2RH0A 2OYIB 3AECC 3H1KD 3OCDA 1LT9A 3PRJA 1T3JA 2C2CA 3L70D 5CCHA 2Q6QA 3OCDB 1LT9B 1NTMJ 4OGQC 1CO6A 2OYHB 1SS1A 1OX3A 2OTKE 5CIHB 1WRGA 3H1IE 3M0DC 4L74A 3RK3C 2KIKA 1SQPJ 1GDVA 2C1VA 2IBZI 2IBZD 1NTZG 5H2FH 1NYHA 2HG5D 1KORA 3G3ZA 1VQNP 5KAIV 1MG3D 1U75B 3GHGA 2CE0A 2WPQA 2CK3H 2ZYAA 3WUUA 1ZN5A 1BGYE 3H32A 1KV4A 4W7ZA 2WQYC 1NTKJ 1KFMA 3GHGB 1M1JC 1LC2A 1VQPP 3GF7A 3RBZA 1RF0C 5AW2B 1U57A 4AUWA 4CPGA 1FAVA 1Q90D 1ZRTD 2B87B 1NNOA 4Y99C 2FY8A 2C9LY 3JSVC 3SFEC 1DW3A 3L35A 1JMMA 3CXHE 1AQ5A 2WPVB 3MUDA 5KLIB 2FKWB 5KAFH 1Y9BA 4PD4H 1QKSA 3OJAB 3AE5C 1IRVA 1RHZB 3PXWA 1R8EA 3CCJP 1RZ6A 2CA3B 2QM8A 1OXZA 1HGZA 2JO1A 1S5LE 1GMJA 4UB8E 1OAEA 2POHA 1H8AA 2H43A 2E43A 4U3FG 4WQ8A 4WWIA 1N9CA 4FB1A 4QMAA 4IL6H 3M91A 2R32A 3HQ9A 1KB9H 2ZT9D 1GD2E 1BSHA 1KD1Q 3KQGA 4K3AA 4TLFA 2M5AA 1IZNB 1MZ9A 1C75A 1E2RA 1C6SA 1PZQA 2XZRA 2SPZA 2N9YB 1OVVA 1KILE 2M5AB 5APXA 1BSNA 2HYNA 1ZR2A 4HJGH 3VRDA 4IFDK 2J59M 3I55P 2HPCA 3SWFA 1A56A 1PPJG 2AI5A 5AW1B 5AW0B 2D2CC 1P84H 2FYUK 4DCKA 1YTZT 1GKSA 2ZJSE 1HZVA 3ZDMA 1L0NE 1R5LA 2RN0A 2O01N 3RK3E 2HPCB 1H33A 2AIUA 1YNRA 1SQXJ 1SQQG 2BCCG 1SQQJ 1LS9A 3VMYA 1PIXA 2KZJA 1VQMP 2ZXXA 3H1ID 2M3EA 1EZVE 1GQ1A 1KB0A 4YXDC 1DW0A 155CA 1KYOE 4NPDA 3Q3DA 1N7SD 2QJYB 3CLQA 3WUIA 4JCGA 1NAYA 3AEAC 2YKPA 1YJNP 1BGYD 3QH9A 2Z5IA 2N1TD 1DD3A 1FZEA 2KI7B 2YMYA 3IR9A 5TJHA 3ZOWA 3WUTA 2FBWC 2E74D 4Y28J 2FYUG 2ZYGA 1YITP 2FYUJ 2DW3A 2ZXEB 3CCLP 1MV8A 3TGUG 1SQBK 1AVYA 2KYVA 2C1UA 3HTKA 1GU4A 1SQVK 3CXHI 1PP9E 3CXHD 1DIQC 4D6TE 2KNCB 3MZWB 2HLOA 3HTKB 3M9QA 5GTHV 2ZBOA 2BASA 3SWKA 2YO2A 5APVA 3H1HE 1CC5A 5E79H 3KYQA 1M60A 3CI9A 1RY3A 1OWAA 4YPCA 1FZAA 1X9VA 1FZCC 1HJ3A 1NVOA 3S1KA 1N50A 1VQ4P 3RK2C 4M3LA 1IFPA 4GDOA 2QRXA 2NPSD 5TISV 1KV9A 1CRCA 3L73D 3SFDC 2XNDH 5DF5A 2PCBB 1FBMA 3E7KA 4UB6E 5C9MA 1SQVG 5BVZA 2A45I 4AYCA 5KLVD 3V5BA 1J1EB 1KILD 4MU8A 1CSUA 4FA4A 2Z4EA 1OVRA 1FU1A 3MD0A 1CRJA 1S6VB 4IFMA 5AW4B 1NU1G 1YICA 1GZLA 1MFTA 1EDIA 5KKZB 1NU1J 4PV1B 1H9YA 4FANA 1N7SA 4H44B 1GU5A 1BCCE 4OGQD 2I8FA 4RO0A 3ZIYA 1LC1A 5AW8B 3L4FA 3RK3D 2XDJA 1N7SB 2N1TA 2FFDA 1N7LA 1I55A 3VMAA 2KS1A 1DT1A 1HGVA 3AE8C 4H0JA 2K9YA 2C1DB 3BRTB 3C8VA 1OIPA 3L36A 2W6AA 2K9JA 2LXCB 2BEQD 1G1JA 3AEBC 2N1TB 3L72G 1CZQA 1EZVI 2I8DA 1EZVD 2KS1B 1J2JB 3L72J 3KZIE 1Q82Q 1N2DC 5APTA 1KYOI 2YIUC 1KYOD 1C6RA 2K9JB 2VRSA 3PXTA 3L75J 3CXHW 3CWBJ 1EDJA 3RMZA 3HD7C 2KK7A 2Y0DA 4AALA 5AVVB 1U74B 1IFJA 1LGHB 3ORVA 4Q5PA 1RH5B 3AE2C 3A0BV 5CHXA 2IX7C 1QL1A 2D0WA 3H1KE 4L1QA 2WWWA 3A0HH 1URQC 2N3BA 2WPRA 3L70J 2QJKB 3O6QA 1HROA 1HH0A 4JYBA 5AVRB 4EIDA 2N3YA 3V4WA 3P8MC 2GUSA 1PP9D 2NPSA 3BCCG 1LTBC 3O6QB 1FC2C 4D6TD 1L4AC 3H1JG 4GT1A 1NKNA 1KZUB 1YEBA 3X39A 3CC4P 3I56P 3B5NC 2NPSB 2QE7H 2E5TA 3H1HD 1BE3E 4L73A 1KILA 5GTIH 1I8PA 1RE4C 2YKQA 4GIFA 1AJYA 2E75B 5AVYB 2N18C 5CCGC 3M9HA 4EICA 2XU6A 1KC8Q 3L71E 4PJ0E 4W7YA 1M56D 4KHXA 3WUVA 2A06E 3CCMP 1DH3A 2K88A 1JY3N 3AE6C 3SVWA 2YK3A 3VMZA 1ZRTE 1L0LK 1Q81Q 1H89A 4DZOA 4EIEA 2HODA 4BRYA 1LP1A 5KAFV 3M0DA 1H0TA 1NO4A 2E74C 2ZFCA 3CCVP 3P8CD 1LTTC 1ZW0A 1IFDA 2BEZF 3DP5A 4H0KA 4AAOA 1YHQP 4BRYB 1IQCA 5B5EH 1B7VA 2D2CD 3RK3B 2J5UA 3HQ7A 1M8OB 4LJIA 1IZL0 1H1OA 1KYOW 1SQBD 5B66H 1IFMA 4IL6V 3FGAD 1M1JA 1K9MQ 2O1JA 1ZZHA 1VQ9P 3A7OA 4BXLA 3CL3D 5DJUB 3L74E 1RF0A 1VQLP 2GA1A 3A9FA 3Q5PA 1H31A 2WSCJ 2H88C 1NTMK 1GJQA 4HB1A 1M1JB 1FI7A 4TT3H 1C2RA 4FA1A 4YTPC 2FYNC 1LJ2A 1X8YA 3D6ZA 1M6ZA 4LLHA 3W68A 1H31B 1NWQA 1SQPK 1L0LG 2B89A 1S72P 3CMEP 1L0LJ 2FXMA 4Y99B 1Z56A 1PL5A 1MFZA 3SSUA 3WU2V 4B86A 1QEXA 1NGMB 3VOPA 3QWOC 1ETPA 5CIFB 3HUSC 2KSEA 2AEFA 3WMM0 2NRGA 2KOGA 5BU5A 3S9OA 1NTKK 3H1LG 1S4XA 3BVHA 3CX5E 1GW4A 4ASWA 1G1IA 2K1AA 4H13C 2ZAEB 1EXIA 3CC7P 4KMGA 1EB7A 2B0ZB 1FDOA 5AVZB 1AVOA 2XV5A 1NTMG 2ZVNB 5APQA 2CPSA 2KZIA 2I1KA 3ZCFA 1K05A 1NMIA 3H1IJ 1VPCA 2AXTH 3ZOXA 1UIIA 1N73C 1SQPG 1CW5A 3LW5J 3PP5A 5C39A 2R3SA 3CP5A 1IK7A 1LTJC 1CSBA 3RK2D 1BE3D 1KFNA 1KQGB 4I6MC 3OA8A 1BGYJ 1SP4A 2ZZS1 1CEDA 4NPEA 1UIXA 1YTCA 1NTKG 2W6JH 1OW8A 3L4OA 2BGVX 2OYOA 2JQRA 2OZ1A 1VYDA 4GODA 3OA8B 3FXDA 3JCUH 1LNQA 2B11B 1JY3P 3L71D 2YMKA 2O3JA 1H9XA 3AE4C 2J58A 2A06D 3H32B 1R0QA 1NTZE 2D2CB 4J20A 3GW6A 1LTSC 2OZ1B 4WVZA 1CYCA 1DVVA 5KAIE 1X0TA 5AVWB 1M7LA 3SLEA 2L4DA 1QLED 2BH4X 3II6A 4HH2A 5E79V 1AKKA 4I1LA 2P2UA 1CIFA 4C7NA 3Q2YA 1JTHA 3IFMA 2QSIA 2GIWA 3V2RA 1HJBA 2B12B 1JY2N 2WSCH 3P7KA 2GB8B 1WEJF 1DW1A 1FE6A 2H89C 3Q5SA 3L74D 4O1QA 3D71A 1K73Q 1PGJA 4C7NB 3TYIA 3VTPC 2B9BA 1SQXK 1JTHB 2MKVA 4GEDB 1W5CE 4OWFA 1GW3A 2QJPB 3OA7A 1SQQK 3L73E 4GOEA 4H0LD 3HD7D 1KIBA 2BH5X 4U3FE 1M57D 5KLVE 4AANA 4EIJA 2OYHC 2QA4P 1BL9A 3D6YA 1I5TA 5AW5B 1OW7A 2CA4B 1OCDA 1URQD 3NBSA 1SVFA 4QAOA 2IZ0A 3CX5I 3CX5D 1FZCA 3TK1A 4JYCA 5CMZA 4HYTB 1H32A 3N4XA 1N15A 3WFEC 1HWTC 1L0NG 3CCRP 1L0NJ 1FOSE 2M3BA 2R44A 1FZCB 1Q2NA 1L4AD 2BPBB 1SQXG 5APSA 3SWYA 2PAJA 1NJIQ 1DX7A 3B5ND 4RSZA 3LW5H 2N9BA 3OW2O 1CYJA 3ZOYA 1H33B 1PPJE 4WQEA 1RQUA 5CCGD 4Z1MH 1JDLA 3A3YB 5DJTB 3U1AA 2XTSB 2WZ7A 1GU2A 1NOHA 3M06A 2OQQA 1YJWP 3D0WA 4WQ9A 1ZP0C 1EDLA 2P67A 2YNYA 1ZR4A 1USDA 2BCCE 3AE3C 4GYDA 4YXWH 3A0HV 2R3CA 2GC4D 4XFJA 1SQPD 1CTZA 1W5CT 2IFNA 3CXHH 1YIJP 1NTZD 4WQCA 2YCCA 1PP9J 3GG2A 2C0XA 3MGNA 4D6TJ 3R4YA 1HBWA 1S5LH 3IF4A 3EFFK 4UB8H 4WQDA 2YXRB 5CJ0A 1COTA 3H1HJ 3G71P 3HD7A 2ZT9B 1NU1K 1JY2P 5GTIV 2YIUB 3NMDA 3TGUE 3U1CA 1CYIA 1CI6A 4I7ZC 2LIRA 1URQA 3LIDA 3PH2B 1OZHA 1S2EA 4WQAA 4FA9A 4O9BA 3CX5W 1KMIZ 2A45H 1URQB 3S4RA 3KHUA 3C2CA 1L4AA 5GTHE 2Q7CA 2E5YA 1NIRA 1FJKA 4U3FD 3DR0A 3DMIA 5KJ7C 3P8CE 1FI9A 2Y0EA 4NFGB 5B5EV 3B5NA 4W80A 1L4AB 3VP9A 4H13D 4XA4A 2OGUA 2WSEJ 1NAFA 1MUUA 5CJ4A 3N7NA 1CTJA 1RE4A 2Y0CA 3B5NB 5B66V 2PRRA 1BCCJ 5CCGA 2QJYC 5TISE 1SQBE 2AXCA 1IJDB 1RE3C 2QVAA 4BWNA 3CCUP 1SQVE 4WQBA 5AW9B 1L9JC 3WC8A 1OMIA 1KN7A 3O20A 2N18B 4WBAA 1GDTA 4U7JA 2FWLA 2V4HA 3RGUA 1F1FA 1VQ8P 4V2KA 1KYOH 3FWLA 4DY9A 1QGKB 4LC1A 4LGDE 4I2LC 2FFDB 1IO4A 3L4MA 1PPJD 3CYTI 3HQ6A 2Z5HA 2FRCA 1HTLC 3AE9C 2DVHA 2E74B 3L75G 3CWBG 4H0LC 1CXAA 4DOJA 1L9BC 2B4ZA 3H1KG 4AQRD 1SQQD 3TDKA 2BCCD 3H1KJ 2KP8A 5CIDB 3KPEA 3KDPB 3L72E 1FJ0A 3AEDC 3L70G 1ZXGA 1MG2D 3CC2P 1E8EA 1HJ0A 1A02F 2HR3A 2FXPA 2YXQB 4WY4C 3VP8A 3A5TA 1VQKP 1D7MA 4RESB 4IFFA 2AXTV 2JJLA 3V2QA 3ITKA 3T97A 2IBZG 5APYA 4EI2A 1E79H 2FYNB 3ABVC 4RJTA 5H2FV 1GIWA 3HUSA 1HVVA 4K35A 1QYZA 1BE3J 1T8ZA 2MJZA 1LMSA 1SLQA 2MHMA 2FYZA 2FYUD 2JDIH 1FDMA 1VQ6P 4AX3A 3A0BE 3G4SP 1W2LA 2IPPA 3TGUD 5KTBA 1S1CX 2JEEA 2XKMA 4AAMA 1JNMA 1GTWA 1VL2A 3BCCE 4C7RA 2E76C 3L71J 1WVEC 1BDDA 1XTGB 1K3HA 3H1JE 1KILB 5AW3B 4UB6H 5DJQC 4H13B 1N8RQ 1C7MA 3I5CA 5CIGB 1VQ7P 1N73A 3CCSP 5AURA 3G6EP 1CRIA 4Y5RA 1AYGA 4OGQB 4R4LA 1I6EA 2WSEH 1LTJA 2HODB 1LP1B 1PV3A 1VDFA 2HFED 1IC2A 1N73B 2V08A 1H0TB 2JWAA 4ASVA 1I54A 1AOQA 1K04A 4A7PA 3HE5A 1TU3F 2R5DA 3V6IA 2KLUA 1CHHA 2ZONG 2H8PD 2OARA 2G3AA 3L74J 5CBNA 1FZGA 1SQVD 2ORLA 4IL6X 3HE5B 2WPSA 2ZOOA 5KAFE 4PD4E 1AV1A 1DVHA 3KZIH 451CA 1DW2A 3TYYA 4ZMDA 5CBOA 1J1DC 3PH0A 4RKUJ 3RN0A 2QJKC 1NU1D 1CCHA 1RF1A 3WFDC 1RQVA 5C0ZA 2YKOA 3M9BA 1FZBA 2HV4A 3NTNA 2Q1KA 1KX2A 4IL6E 3E1RA 1USEA 4XYDB 1VQ5P 1KB9E 2KXPB 4PWAA 3O8ZA 4K3IA 1QX8A 1SFCC 1T2KC 1L0LE 3L72D 3BASA 2CXBA 2C8SA 4GOFA 1YQ4C 2UWJE 2WT7A 1FHBA 1U7JA 3H1IG 3GF3A 3WU2E 3H1LE 2RMZA 2YQBA 3LIEA 1OFCX 4EIFA 3RL0C 3EWKA 3A0BH 2WT7B 4OVNF 2OYHA 3U59A 2RKLA 1LWUC 1HJ4A 2Y9YA 3VYMA 1BGYG 1IFNA 2IYOA 4WB4A 1JY2O 1P84E 2WSFJ 2G8YA 3VN0A 1CNOA 3H25A 4PJ0H 1NTME 1DEBA 4OH8B 1RZ5A 4R4MA 1YCCA 2C9NY 2P58A 2P7JA 1LTAC 3BCCD 4PW9B 3FXEA 3HQ8A 1GL2C 3H1JD 1NTZJ 1NMLA 1SQPE 1MZ4A 4DJGA 1I8OA 2JKVA 5KJ7D 1S3JA 3IN6A 3NFQA 1CSVA 5KLVK 4L75A 1CORA 1CXCA 2V7QH 1N90A 3Q1MA 1S5LV 351CA 4L3HA 4UB8V 1PGQA 1DEEG 2B87A 4N3YB 1NTKE 1S5LX 1NKZB 1RF1C 5CICB 1YYCA 1YIQA 3MK7C 3CMAP 3HE4A 1L2PA 1K8AQ 2PCCB 2B10B 3TF5A 1VF5C 2ITAA 1L0NK 1EQ7A 2PGDA 3HE4B 2Q3IA 3TSIA 3M97X 1DIPA 4JQ0D 3L73G 2R5BA 3NWVA 1AOFA 2YO3A 3L73J 4PD4I 4PD4D 1I6DA 2OYIC 5B6QA 2A45G 4EOTA 2WVRA 5KLVG 4KT0J 4U3FJ 5KLVJ 5E79E 5AW6B 5AVQB 1LT9C 1YQ3C 1QL2A 1FI3A 3CX5H 4WQ7A 4N0KA 4C46A 1LT1A 1C52A 1F1CA 2WSSH 2Y9ZA 2L91A 5CCHC 3E1IA 3ZOOA 1KB9I 1KB9D 4WY4D 2N9JA 3CD6P 1IRWA 1W2BO 1LTGC 2H7HA 3PLNA 3VNWA 1L0LD 3PJSK 4DT0A 3WU2H 4I7ZB 1JMBA 1C6OA 1CIHA 2IFMA 1H32B 2IDBA 3GHGC 3RK2B 1PFIA 1FDIA 4KJMA 1NH4A 2XNXA 1OVUA 1EZVG 3H1LD 2ZVOB 1JCCA 5KJ7A 2KLVA 1OW6A 3R2PA 1WMKA 2C0WA 2QG4A 4YE1A 2WSFH 2IZ1A 2ZXYA 2W90A 3W67A 1ZOYC 2E76D 1LTIC 1QL4A 4JF7A 4N6JA 4ZKUA 5KLIC 3P32A 1P84I 1P84D 1KTMA 4PV1D 1NTMD 3AE1C 1SQXE 3OAKA 1E29A 2BCCJ 1A02J 4H44D 1RE3A 5EFWB 1SQQE 2Q5UA 3MUDC 2PACA 2OTLP 1Y47A 4P4QB 2C9XB 1S9KE 3V2NA 3MIWA 4ZKPA 3HRNA 5KAIH 1PP9G 3RN1A 4D6TG 2JR8A 3M0AA 5CIBB 2WTYA 2QJPC 5DFSA 2D0SA 5M1BA 1NTKD 1J3SA 2K37A 1E5WA 1C2NA 1YTZI 4L3GA 3G9RA 3H1HG 4L76A 1YI2P 2JTIB 2QEXP 5APUA 2KNCA 1KQSO 1GK4A 1T6AA 2E42A 3TGUJ 2FYUE 2AEJA 3PTZA 3A0HE 1K3GA 1A8CA 3MP7B 1LFMA 4H0LB 1FJPA 2M8RA 1HRCA 1JUNA 3HD7B 1YBKA 4UB6V 1NHLA 5AVXB 4NPFX 4EDFA 4WY4A 2KB7P 2PP6A 2JP3A 1DD4A 1CI6B 3B8EB 1X79B 2BLFB 3A2AA 1HCMA 3B4SA 1ZV8A 1DIIC 5IY51 4GKGA 3WFCC 1JB0J 4WY4B 2O01J 1R5SA 3V4QA 2CPBA 5GTIE 3SJLA 2B88A 4HKZH 1IK9A 3L37A 3RLMA 1ZLLA 3B71A 3PXSA 1SFCD 1CSWA 1T2KD 3FWNA 1CRHA 1QL3A 1SQBG 2W83C 1BCCG 2P1JA 2E75D 1SQBJ 3Q5RA 3K5BA 1XTCC 3VMXA 1SQVJ 3EQ2A 2Q9IA 2GUVA 3MHVA 1JEKA 1M1KQ 5AVUB 3EFGA 3RL0D 2W6BA 2E76B 3BRVB 2BCNB 3KZIV 1CHIA 2AEMA 1FOSF 2O1KA 2W8ZA 5B5EE 5DJQB 2JWDA 1NU1E 2C1DA 3KXDA 1QVFO 3O0RC 2KSJA 1L0ND 5CYTR 5B66E 1CCRA 4O1WA 1RAQA 1GL2D 4N78E 1AFOA 3TNUA 1SQXD 1CSXA 3MTUE 2ZT9C 1EDKA 3UIAA 2FXOA 1S9KD 3TNUB 3JBTB 2OTJP 5AW7B 1JY3O 2QM7A 4MN4C 4IOIH 1JO5A 3CPWO 3L75E 3CWBE 2GM4A 1YEAA 2LITA 2EXVA 3F5HA 1RAPA 1EXJA 1FCDC 1GK6A 3GMAA 1J1DB 1VF5D 3FX0A 1JOCA 1T3UA 2QIWA 3AEEC 1BE3G 4XE5B 3L70E 1WT6A 4ZNCA 4PJ0V 3T97B 3SWSA 2LKMA 3C1LA 1CHJA 1J1EC 5APWA 1KQLA 1N86A
chains in the Genus database with same CATH topology
1N50A 1BL9A 1I5TA 1IO3A 1FHBA 2CA4B 1KX7A 1OCDA 5TISV 3NBSA 2RMZA 3WFBC 1CRGA 2YQBA 3ZBMA 1KV9A 4QAOA 3CX5D 4EIFA 1CRCA 3L73D 1M70A 4XXLA 5DF5A 1H32A 2PCBB 1N15A 3WFEC 3O1YA 5C9MA 1HJ4A 3VYMA 4FAVA 5KLVD 1CIEA 4MU8A 1CNOA 1CSUA 2BPBB 4FA4A 1RZ5A 1YCCA 4RSZA 3BCCD 1CRJA 4PW9B 1FOCA 3HQ8A 1S6VB 5EXQA 1A2SA 1YICA 3H1JD 1CYJA 5KKZB 1NMLA 3ZOYA 1H9YA 1H33B 1MZ4A 4FANA 1I8OA 4WQEA 2I8FA 3ZIYA 1LC1A 1CSVA 1JDLA 1CORA 1CXCA 2XTSB 1N90A 1GU2A 1HJ5A 1S5LV 2DGEA 351CA 4L3HA 4UB8V 4WQ9A 1I55A 3VMAA 2KS1A 1DT1A 4H0JA 2C1DB 2Q3EA 4GYDA 3SXTA 3A0HV 5CICB 2GC4D 1YIQA 1SQPD 3MK7C 1EZVD 1CTZA 2PCCB 1HH7A 1W5CT 2B10B 3TF5A 1NTZD 1BCCD 1KYOD 4WQCA 1C6RA 2K9JB 2MTAC 2YCCA 3PXTA 3GG2A 3CXHW 3RMZA 3M97X 2Y0DA 4AALA 4FA5A 3CU4A 2V07A 2GC7D 3O5CA 3NWVA 1U74B 1QN2A 4WQDA 1AOFA 3ORVA 4Q5PA 3PHLA 1COTA 3A0BV 4PD4D 1I6DA 2D0WA 3MK7B 4L1QA 2N3BA 5B6QA 1CIGA 5GTIV 2QJKB 1HROA 2YIUB 2CE1A 1CTYA 4EIDA 1HZUA 2N3YA 1CRYA 1CYIA 2LIRA 1FI3A 2VHDA 1PP9D 4WQ7A 5CIEB 3L75D 4N0KA 3CWBD 2N9IA 3PH2B 1C52A 4D6TD 1F1CA 4WQAA 3NBTA 1YFCA 2L91A 4FA9A 3ZOOA 1YEBA 3CX5W 3X39A 3H1KD 3OCDA 1KB9D 3PRJA 2N9JA 1IRWA 3H1HD 2C2CA 3PLNA 3KHUA 3C2CA 3VNWA 1L0LD 3L70D 1I8PA 1NIRA 3OCDB 4U3FD 3DR0A 3DMIA 1C6OA 1FI9A 2Y0EA 1CO6A 4NFGB 5B5EV 2N18C 1CIHA 1H32B 4EICA 5CIHB 3H1LD 1GDVA 2C1VA 1CTJA 2IBZD 2Y0CA 5B66V 3SVWA 2YK3A 5KAIV 1MG3D 1U75B 2CE0A 2QG4A 4YE1A 4EIEA 2ZXYA 5KAFV 1QL4A 4WQBA 1L9JC 3WC8A 1P84D 3O20A 2N18B 1NTMD 1E29A 2FWLA 3DP5A 4H0KA 4AAOA 1IQCA 1LC2A 1F1FA 1B7VA 3HQ7A 4V2KA 3FWLA 4LJIA 2PACA 1IZL0 4DY9A 4P4QB 2C9XB 1H1OA 1ZRTD 1NNOA 3L4MA 1KYOW 1PPJD 1SQBD 3CYTI 2FRCA 3HQ6A 4IL6V 1ZZHA 1DW3A 3RN1A 2DVHA 5KLIB 3A9FA 1H31A 1CXAA 1QKSA 1GJQA 5CIBB 1L9BC 5DFSA 2B4ZA 2D0SA 1IRVA 3PXWA 1NTKD 1J3SA 1FI7A 1C2RA 1RZ6A 2CA3B 4FA1A 1SQQD 1C2NA 3TDKA 2BCCD 4L3GA 5CIDB 1M6ZA 1H31B 2JTIB 1OAEA 1FJ0A 1MG2D 1E8EA 4WQ8A 3PTZA 3WU2V 1N9CA 1K3GA 1A8CA 4FB1A 1ETPA 1LFMA 5CIFB 1HRCA 2AXTV 3HQ9A 3ITKA 4UB6V 2FYNB 4EDFA 4RJTA 5H2FV 1GIWA 1C75A 1E2RA 1C6SA 1QYZA 2BLFB 1HCMA 1LMSA 4KMGA 1EB7A 1DIIC 2MHMA 2N9YB 2B0ZB 5IY51 2FYUD 3WFCC 4AX3A 1W2LA 3TGUD 4AAMA 3SJLA 3VRDA 3ZCFA 1NMIA 1WVEC 3RLMA 1K3HA 3ZOXA 3PXSA 1CSWA 1CRHA 1A56A 1QL3A 5DJQC 2AI5A 3CP5A 1BE3D 1GKSA 1HZVA 1C7MA 3OA8A 5CIGB 2RN0A 1H33A 2AIUA 1YNRA 2ZZS1 1CEDA 5AURA 1CRIA 1YTCA 4Y5RA 3L4OA 2BGVX 1AYGA 1I6EA 2BCNB 3KZIV 2JQRA 1LS9A 1CHIA 1VYDA 2OZ1A 3OA8B 2B11B 3L71D 3H1ID 2V08A 2O3JA 1H9XA 2JWAA 1GQ1A 1I54A 2A06D 1R0QA 5DJQB 1KB0A 1AOQA 4A7PA 2C1DA 1DW0A 155CA 3O0RC 4J20A 3GW6A 2OZ1B 2QJYB 1CHHA 2ZONG 3WUIA 1L0ND 5CYTR 4JCGA 1CYCA 1DVVA 1SQVD 2ORLA 1CCRA 4O1WA 1RAQA 1BGYD 3SLEA 2L4DA 2ZOOA 1SQXD 2BH4X 1DVHA 1CSXA 5TJHA 451CA 1DW2A 3ZOWA 5E79V 1AKKA 3RN0A 1CIFA 1NU1D 1CCHA 3WFDC 3JBTB 2GIWA 2B12B 2C1UA 5C0ZA 2GB8B 1WEJF 1DW1A 3CXHD 3L74D 4O1QA 1DIQC 2HV4A 1YEAA 3TYIA 1KX2A 2LITA 2KNCB 2EXVA 4GEDB 1RAPA 2QJPB 4XYDB 5GTHV 1FCDC 2ZBOA 4PWAA 1CC5A 4K3IA 1M60A 3L72D 2CXBA 1KIBA 2BH5X 2C8SA 4PJ0V 3SWSA 1HJ3A 1CHJA 4AANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N50 A;  1BL9 A;  1I5T A;  1IO3 A;  1FHB A;  2CA4 B;  1KX7 A;  1OCD A;  5TIS V;  3NBS A;  2RMZ A;  3WFB C;  1CRG A;  2YQB A;  3ZBM A;  1KV9 A;  4QAO A;  3CX5 D;  4EIF A;  1CRC A;  3L73 D;  1M70 A;  4XXL A;  5DF5 A;  1H32 A;  2PCB B;  1N15 A;  3WFE C;  3O1Y A;  5C9M A;  1HJ4 A;  3VYM A;  4FAV A;  5KLV D;  1CIE A;  4MU8 A;  1CNO A;  1CSU A;  2BPB B;  4FA4 A;  1RZ5 A;  1YCC A;  4RSZ A;  3BCC D;  1CRJ A;  4PW9 B;  1FOC A;  3HQ8 A;  1S6V B;  5EXQ A;  1A2S A;  1YIC A;  3H1J D;  1CYJ A;  5KKZ B;  1NML A;  3ZOY A;  1H9Y A;  1H33 B;  1MZ4 A;  4FAN A;  1I8O A;  4WQE A;  2I8F A;  3ZIY A;  1LC1 A;  1CSV A;  1JDL A;  1COR A;  1CXC A;  2XTS B;  1N90 A;  1GU2 A;  1HJ5 A;  1S5L V;  2DGE A;  351C A;  4L3H A;  4UB8 V;  4WQ9 A;  1I55 A;  3VMA A;  2KS1 A;  1DT1 A;  4H0J A;  2C1D B;  2Q3E A;  4GYD A;  3SXT A;  3A0H V;  5CIC B;  2GC4 D;  1YIQ A;  1SQP D;  3MK7 C;  1EZV D;  1CTZ A;  2PCC B;  1HH7 A;  1W5C T;  2B10 B;  3TF5 A;  1NTZ D;  1BCC D;  1KYO D;  4WQC A;  1C6R A;  2K9J B;  2MTA C;  2YCC A;  3PXT A;  3GG2 A;  3CXH W;  3RMZ A;  3M97 X;  2Y0D A;  4AAL A;  4FA5 A;  3CU4 A;  2V07 A;  2GC7 D;  3O5C A;  3NWV A;  1U74 B;  1QN2 A;  4WQD A;  1AOF A;  3ORV A;  4Q5P A;  3PHL A;  1COT A;  3A0B V;  4PD4 D;  1I6D A;  2D0W A;  3MK7 B;  4L1Q A;  2N3B A;  5B6Q A;  1CIG A;  5GTI V;  2QJK B;  1HRO A;  2YIU B;  2CE1 A;  1CTY A;  4EID A;  1HZU A;  2N3Y A;  1CRY A;  1CYI A;  2LIR A;  1FI3 A;  2VHD A;  1PP9 D;  4WQ7 A;  5CIE B;  3L75 D;  4N0K A;  3CWB D;  2N9I A;  3PH2 B;  1C52 A;  4D6T D;  1F1C A;  4WQA A;  3NBT A;  1YFC A;  2L91 A;  4FA9 A;  3ZOO A;  1YEB A;  3CX5 W;  3X39 A;  3H1K D;  3OCD A;  1KB9 D;  3PRJ A;  2N9J A;  1IRW A;  3H1H D;  2C2C A;  3PLN A;  3KHU A;  3C2C A;  3VNW A;  1L0L D;  3L70 D;  1I8P A;  1NIR A;  3OCD B;  4U3F D;  3DR0 A;  3DMI A;  1C6O A;  1FI9 A;  2Y0E A;  1CO6 A;  4NFG B;  5B5E V;  2N18 C;  1CIH A;  1H32 B;  4EIC A;  5CIH B;  3H1L D;  1GDV A;  2C1V A;  1CTJ A;  2IBZ D;  2Y0C A;  5B66 V;  3SVW A;  2YK3 A;  5KAI V;  1MG3 D;  1U75 B;  2CE0 A;  2QG4 A;  4YE1 A;  4EIE A;  2ZXY A;  5KAF V;  1QL4 A;  4WQB A;  1L9J C;  3WC8 A;  1P84 D;  3O20 A;  2N18 B;  1NTM D;  1E29 A;  2FWL A;  3DP5 A;  4H0K A;  4AAO A;  1IQC A;  1LC2 A;  1F1F A;  1B7V A;  3HQ7 A;  4V2K A;  3FWL A;  4LJI A;  2PAC A;  1IZL 0;  4DY9 A;  4P4Q B;  2C9X B;  1H1O A;  1ZRT D;  1NNO A;  3L4M A;  1KYO W;  1PPJ D;  1SQB D;  3CYT I;  2FRC A;  3HQ6 A;  4IL6 V;  1ZZH A;  1DW3 A;  3RN1 A;  2DVH A;  5KLI B;  3A9F A;  1H31 A;  1CXA A;  1QKS A;  1GJQ A;  5CIB B;  1L9B C;  5DFS A;  2B4Z A;  2D0S A;  1IRV A;  3PXW A;  1NTK D;  1J3S A;  1FI7 A;  1C2R A;  1RZ6 A;  2CA3 B;  4FA1 A;  1SQQ D;  1C2N A;  3TDK A;  2BCC D;  4L3G A;  5CID B;  1M6Z A;  1H31 B;  2JTI B;  1OAE A;  1FJ0 A;  1MG2 D;  1E8E A;  4WQ8 A;  3PTZ A;  3WU2 V;  1N9C A;  1K3G A;  1A8C A;  4FB1 A;  1ETP A;  1LFM A;  5CIF B;  1HRC A;  2AXT V;  3HQ9 A;  3ITK A;  4UB6 V;  2FYN B;  4EDF A;  4RJT A;  5H2F V;  1GIW A;  1C75 A;  1E2R A;  1C6S A;  1QYZ A;  2BLF B;  1HCM A;  1LMS A;  4KMG A;  1EB7 A;  1DII C;  2MHM A;  2N9Y B;  2B0Z B;  5IY5 1;  2FYU D;  3WFC C;  4AX3 A;  1W2L A;  3TGU D;  4AAM A;  3SJL A;  3VRD A;  3ZCF A;  1NMI A;  1WVE C;  3RLM A;  1K3H A;  3ZOX A;  3PXS A;  1CSW A;  1CRH A;  1A56 A;  1QL3 A;  5DJQ C;  2AI5 A;  3CP5 A;  1BE3 D;  1GKS A;  1HZV A;  1C7M A;  3OA8 A;  5CIG B;  2RN0 A;  1H33 A;  2AIU A;  1YNR A;  2ZZS 1;  1CED A;  5AUR A;  1CRI A;  1YTC A;  4Y5R A;  3L4O A;  2BGV X;  1AYG A;  1I6E A;  2BCN B;  3KZI V;  2JQR A;  1LS9 A;  1CHI A;  1VYD A;  2OZ1 A;  3OA8 B;  2B11 B;  3L71 D;  3H1I D;  2V08 A;  2O3J A;  1H9X A;  2JWA A;  1GQ1 A;  1I54 A;  2A06 D;  1R0Q A;  5DJQ B;  1KB0 A;  1AOQ A;  4A7P A;  2C1D A;  1DW0 A;  155C A;  3O0R C;  4J20 A;  3GW6 A;  2OZ1 B;  2QJY B;  1CHH A;  2ZON G;  3WUI A;  1L0N D;  5CYT R;  4JCG A;  1CYC A;  1DVV A;  1SQV D;  2ORL A;  1CCR A;  4O1W A;  1RAQ A;  1BGY D;  3SLE A;  2L4D A;  2ZOO A;  1SQX D;  2BH4 X;  1DVH A;  1CSX A;  5TJH A;  451C A;  1DW2 A;  3ZOW A;  5E79 V;  1AKK A;  3RN0 A;  1CIF A;  1NU1 D;  1CCH A;  3WFD C;  3JBT B;  2GIW A;  2B12 B;  2C1U A;  5C0Z A;  2GB8 B;  1WEJ F;  1DW1 A;  3CXH D;  3L74 D;  4O1Q A;  1DIQ C;  2HV4 A;  1YEA A;  3TYI A;  1KX2 A;  2LIT A;  2KNC B;  2EXV A;  4GED B;  1RAP A;  2QJP B;  4XYD B;  5GTH V;  1FCD C;  2ZBO A;  4PWA A;  1CC5 A;  4K3I A;  1M60 A;  3L72 D;  2CXB A;  1KIB A;  2BH5 X;  2C8S A;  4PJ0 V;  3SWS A;  1HJ3 A;  1CHJ A;  4AAN A; 
#chains in the Genus database with same CATH topology
 1PGP A;  3HUS B;  3BCC J;  1PGO A;  1IO3 A;  1SFC A;  3NXS A;  3L71 G;  1KX7 A;  3H1J J;  3WFB C;  1CRG A;  3ZBM A;  2A06 G;  2IBZ E;  1AA0 A;  5KKZ C;  1M70 A;  4XXL A;  5GTH H;  4PV1 C;  2AXT E;  3RL0 g;  1YJ9 P;  1Q7Y Q;  5AVT B;  3USS A;  1SFC B;  3O1Y A;  4H44 C;  2O01 H;  3BAT A;  3JC2 2;  5K5G B;  4FAV A;  5H2F E;  1CIE A;  5CCH D;  1EC5 A;  1N7S C;  1IFI A;  2V7Q J;  1LWU A;  1M90 Q;  1FOC A;  3AEG C;  3CCQ P;  5EXQ A;  1A2S A;  3RL0 B;  5TIS H;  1G2C A;  4EYY Q;  2N1T C;  2FFD C;  3JCU E;  1LWU B;  1LTJ B;  2I1J A;  3L74 G;  2ZYD A;  1ZME C;  1G2C B;  1GL2 A;  1HJ5 A;  2DGE A;  3CCE P;  1KQF B;  2IYP A;  1FZF A;  1Y8A A;  2Q3E A;  3C9I A;  3SXT A;  1GL2 B;  2NZ2 A;  1HUC A;  1W2E A;  1U7M A;  2LR2 A;  1HH7 A;  1BCC D;  5L8R J;  3D70 A;  2MTA C;  2WIT A;  1BDC A;  3H6P A;  1JCD A;  3GLM A;  1MKM A;  1H88 A;  2M0B A;  4FA5 A;  3IAO A;  4N78 D;  3CU4 A;  1RF1 B;  2V07 A;  2GC7 D;  3O5C A;  3AE7 C;  1QN2 A;  4JBZ A;  3VYI A;  3PHL A;  3V2P A;  2P10 A;  3MK7 B;  3RBX A;  2NPS C;  1NTZ K;  1Q86 Q;  2W27 A;  1CIG A;  2K3R A;  1HF9 A;  2PFX A;  1VQO P;  1FS0 E;  5BU8 B;  2CE1 A;  2LXB A;  1CTY A;  1AQT A;  3F89 A;  1VF5 B;  2WMM A;  1QVG O;  2KUB A;  3AEF C;  5AVS B;  1HZU A;  1CRY A;  2OYI A;  2VHD A;  2E75 C;  5CIE B;  3L75 D;  1JM0 A;  3CWB D;  2N9I A;  4JPZ B;  3H1L J;  1X22 A;  3NBT A;  1YFC A;  1KIL C;  2L5G B;  2RH0 A;  2OYI B;  3AEC C;  3H1K D;  3OCD A;  1LT9 A;  3PRJ A;  1T3J A;  2C2C A;  3L70 D;  5CCH A;  2Q6Q A;  3OCD B;  1LT9 B;  1NTM J;  4OGQ C;  1CO6 A;  2OYH B;  1SS1 A;  1OX3 A;  2OTK E;  5CIH B;  1WRG A;  3H1I E;  3M0D C;  4L74 A;  3RK3 C;  2KIK A;  1SQP J;  1GDV A;  2C1V A;  2IBZ I;  2IBZ D;  1NTZ G;  5H2F H;  1NYH A;  2HG5 D;  1KOR A;  3G3Z A;  1VQN P;  5KAI V;  1MG3 D;  1U75 B;  3GHG A;  2CE0 A;  2WPQ A;  2CK3 H;  2ZYA A;  3WUU A;  1ZN5 A;  1BGY E;  3H32 A;  1KV4 A;  4W7Z A;  2WQY C;  1NTK J;  1KFM A;  3GHG B;  1M1J C;  1LC2 A;  1VQP P;  3GF7 A;  3RBZ A;  1RF0 C;  5AW2 B;  1U57 A;  4AUW A;  4CPG A;  1FAV A;  1Q90 D;  1ZRT D;  2B87 B;  1NNO A;  4Y99 C;  2FY8 A;  2C9L Y;  3JSV C;  3SFE C;  1DW3 A;  3L35 A;  1JMM A;  3CXH E;  1AQ5 A;  2WPV B;  3MUD A;  5KLI B;  2FKW B;  5KAF H;  1Y9B A;  4PD4 H;  1QKS A;  3OJA B;  3AE5 C;  1IRV A;  1RHZ B;  3PXW A;  1R8E A;  3CCJ P;  1RZ6 A;  2CA3 B;  2QM8 A;  1OXZ A;  1HGZ A;  2JO1 A;  1S5L E;  1GMJ A;  4UB8 E;  1OAE A;  2POH A;  1H8A A;  2H43 A;  2E43 A;  4U3F G;  4WQ8 A;  4WWI A;  1N9C A;  4FB1 A;  4QMA A;  4IL6 H;  3M91 A;  2R32 A;  3HQ9 A;  1KB9 H;  2ZT9 D;  1GD2 E;  1BSH A;  1KD1 Q;  3KQG A;  4K3A A;  4TLF A;  2M5A A;  1IZN B;  1MZ9 A;  1C75 A;  1E2R A;  1C6S A;  1PZQ A;  2XZR A;  2SPZ A;  2N9Y B;  1OVV A;  1KIL E;  2M5A B;  5APX A;  1BSN A;  2HYN A;  1ZR2 A;  4HJG H;  3VRD A;  4IFD K;  2J59 M;  3I55 P;  2HPC A;  3SWF A;  1A56 A;  1PPJ G;  2AI5 A;  5AW1 B;  5AW0 B;  2D2C C;  1P84 H;  2FYU K;  4DCK A;  1YTZ T;  1GKS A;  2ZJS E;  1HZV A;  3ZDM A;  1L0N E;  1R5L A;  2RN0 A;  2O01 N;  3RK3 E;  2HPC B;  1H33 A;  2AIU A;  1YNR A;  1SQX J;  1SQQ G;  2BCC G;  1SQQ J;  1LS9 A;  3VMY A;  1PIX A;  2KZJ A;  1VQM P;  2ZXX A;  3H1I D;  2M3E A;  1EZV E;  1GQ1 A;  1KB0 A;  4YXD C;  1DW0 A;  155C A;  1KYO E;  4NPD A;  3Q3D A;  1N7S D;  2QJY B;  3CLQ A;  3WUI A;  4JCG A;  1NAY A;  3AEA C;  2YKP A;  1YJN P;  1BGY D;  3QH9 A;  2Z5I A;  2N1T D;  1DD3 A;  1FZE A;  2KI7 B;  2YMY A;  3IR9 A;  5TJH A;  3ZOW A;  3WUT A;  2FBW C;  2E74 D;  4Y28 J;  2FYU G;  2ZYG A;  1YIT P;  2FYU J;  2DW3 A;  2ZXE B;  3CCL P;  1MV8 A;  3TGU G;  1SQB K;  1AVY A;  2KYV A;  2C1U A;  3HTK A;  1GU4 A;  1SQV K;  3CXH I;  1PP9 E;  3CXH D;  1DIQ C;  4D6T E;  2KNC B;  3MZW B;  2HLO A;  3HTK B;  3M9Q A;  5GTH V;  2ZBO A;  2BAS A;  3SWK A;  2YO2 A;  5APV A;  3H1H E;  1CC5 A;  5E79 H;  3KYQ A;  1M60 A;  3CI9 A;  1RY3 A;  1OWA A;  4YPC A;  1FZA A;  1X9V A;  1FZC C;  1HJ3 A;  1NVO A;  3S1K A;  1N50 A;  1VQ4 P;  3RK2 C;  4M3L A;  1IFP A;  4GDO A;  2QRX A;  2NPS D;  5TIS V;  1KV9 A;  1CRC A;  3L73 D;  3SFD C;  2XND H;  5DF5 A;  2PCB B;  1FBM A;  3E7K A;  4UB6 E;  5C9M A;  1SQV G;  5BVZ A;  2A45 I;  4AYC A;  5KLV D;  3V5B A;  1J1E B;  1KIL D;  4MU8 A;  1CSU A;  4FA4 A;  2Z4E A;  1OVR A;  1FU1 A;  3MD0 A;  1CRJ A;  1S6V B;  4IFM A;  5AW4 B;  1NU1 G;  1YIC A;  1GZL A;  1MFT A;  1EDI A;  5KKZ B;  1NU1 J;  4PV1 B;  1H9Y A;  4FAN A;  1N7S A;  4H44 B;  1GU5 A;  1BCC E;  4OGQ D;  2I8F A;  4RO0 A;  3ZIY A;  1LC1 A;  5AW8 B;  3L4F A;  3RK3 D;  2XDJ A;  1N7S B;  2N1T A;  2FFD A;  1N7L A;  1I55 A;  3VMA A;  2KS1 A;  1DT1 A;  1HGV A;  3AE8 C;  4H0J A;  2K9Y A;  2C1D B;  3BRT B;  3C8V A;  1OIP A;  3L36 A;  2W6A A;  2K9J A;  2LXC B;  2BEQ D;  1G1J A;  3AEB C;  2N1T B;  3L72 G;  1CZQ A;  1EZV I;  2I8D A;  1EZV D;  2KS1 B;  1J2J B;  3L72 J;  3KZI E;  1Q82 Q;  1N2D C;  5APT A;  1KYO I;  2YIU C;  1KYO D;  1C6R A;  2K9J B;  2VRS A;  3PXT A;  3L75 J;  3CXH W;  3CWB J;  1EDJ A;  3RMZ A;  3HD7 C;  2KK7 A;  2Y0D A;  4AAL A;  5AVV B;  1U74 B;  1IFJ A;  1LGH B;  3ORV A;  4Q5P A;  1RH5 B;  3AE2 C;  3A0B V;  5CHX A;  2IX7 C;  1QL1 A;  2D0W A;  3H1K E;  4L1Q A;  2WWW A;  3A0H H;  1URQ C;  2N3B A;  2WPR A;  3L70 J;  2QJK B;  3O6Q A;  1HRO A;  1HH0 A;  4JYB A;  5AVR B;  4EID A;  2N3Y A;  3V4W A;  3P8M C;  2GUS A;  1PP9 D;  2NPS A;  3BCC G;  1LTB C;  3O6Q B;  1FC2 C;  4D6T D;  1L4A C;  3H1J G;  4GT1 A;  1NKN A;  1KZU B;  1YEB A;  3X39 A;  3CC4 P;  3I56 P;  3B5N C;  2NPS B;  2QE7 H;  2E5T A;  3H1H D;  1BE3 E;  4L73 A;  1KIL A;  5GTI H;  1I8P A;  1RE4 C;  2YKQ A;  4GIF A;  1AJY A;  2E75 B;  5AVY B;  2N18 C;  5CCG C;  3M9H A;  4EIC A;  2XU6 A;  1KC8 Q;  3L71 E;  4PJ0 E;  4W7Y A;  1M56 D;  4KHX A;  3WUV A;  2A06 E;  3CCM P;  1DH3 A;  2K88 A;  1JY3 N;  3AE6 C;  3SVW A;  2YK3 A;  3VMZ A;  1ZRT E;  1L0L K;  1Q81 Q;  1H89 A;  4DZO A;  4EIE A;  2HOD A;  4BRY A;  1LP1 A;  5KAF V;  3M0D A;  1H0T A;  1NO4 A;  2E74 C;  2ZFC A;  3CCV P;  3P8C D;  1LTT C;  1ZW0 A;  1IFD A;  2BEZ F;  3DP5 A;  4H0K A;  4AAO A;  1YHQ P;  4BRY B;  1IQC A;  5B5E H;  1B7V A;  2D2C D;  3RK3 B;  2J5U A;  3HQ7 A;  1M8O B;  4LJI A;  1IZL 0;  1H1O A;  1KYO W;  1SQB D;  5B66 H;  1IFM A;  4IL6 V;  3FGA D;  1M1J A;  1K9M Q;  2O1J A;  1ZZH A;  1VQ9 P;  3A7O A;  4BXL A;  3CL3 D;  5DJU B;  3L74 E;  1RF0 A;  1VQL P;  2GA1 A;  3A9F A;  3Q5P A;  1H31 A;  2WSC J;  2H88 C;  1NTM K;  1GJQ A;  4HB1 A;  1M1J B;  1FI7 A;  4TT3 H;  1C2R A;  4FA1 A;  4YTP C;  2FYN C;  1LJ2 A;  1X8Y A;  3D6Z A;  1M6Z A;  4LLH A;  3W68 A;  1H31 B;  1NWQ A;  1SQP K;  1L0L G;  2B89 A;  1S72 P;  3CME P;  1L0L J;  2FXM A;  4Y99 B;  1Z56 A;  1PL5 A;  1MFZ A;  3SSU A;  3WU2 V;  4B86 A;  1QEX A;  1NGM B;  3VOP A;  3QWO C;  1ETP A;  5CIF B;  3HUS C;  2KSE A;  2AEF A;  3WMM 0;  2NRG A;  2KOG A;  5BU5 A;  3S9O A;  1NTK K;  3H1L G;  1S4X A;  3BVH A;  3CX5 E;  1GW4 A;  4ASW A;  1G1I A;  2K1A A;  4H13 C;  2ZAE B;  1EXI A;  3CC7 P;  4KMG A;  1EB7 A;  2B0Z B;  1FDO A;  5AVZ B;  1AVO A;  2XV5 A;  1NTM G;  2ZVN B;  5APQ A;  2CPS A;  2KZI A;  2I1K A;  3ZCF A;  1K05 A;  1NMI A;  3H1I J;  1VPC A;  2AXT H;  3ZOX A;  1UII A;  1N73 C;  1SQP G;  1CW5 A;  3LW5 J;  3PP5 A;  5C39 A;  2R3S A;  3CP5 A;  1IK7 A;  1LTJ C;  1CSB A;  3RK2 D;  1BE3 D;  1KFN A;  1KQG B;  4I6M C;  3OA8 A;  1BGY J;  1SP4 A;  2ZZS 1;  1CED A;  4NPE A;  1UIX A;  1YTC A;  1NTK G;  2W6J H;  1OW8 A;  3L4O A;  2BGV X;  2OYO A;  2JQR A;  2OZ1 A;  1VYD A;  4GOD A;  3OA8 B;  3FXD A;  3JCU H;  1LNQ A;  2B11 B;  1JY3 P;  3L71 D;  2YMK A;  2O3J A;  1H9X A;  3AE4 C;  2J58 A;  2A06 D;  3H32 B;  1R0Q A;  1NTZ E;  2D2C B;  4J20 A;  3GW6 A;  1LTS C;  2OZ1 B;  4WVZ A;  1CYC A;  1DVV A;  5KAI E;  1X0T A;  5AVW B;  1M7L A;  3SLE A;  2L4D A;  1QLE D;  2BH4 X;  3II6 A;  4HH2 A;  5E79 V;  1AKK A;  4I1L A;  2P2U A;  1CIF A;  4C7N A;  3Q2Y A;  1JTH A;  3IFM A;  2QSI A;  2GIW A;  3V2R A;  1HJB A;  2B12 B;  1JY2 N;  2WSC H;  3P7K A;  2GB8 B;  1WEJ F;  1DW1 A;  1FE6 A;  2H89 C;  3Q5S A;  3L74 D;  4O1Q A;  3D71 A;  1K73 Q;  1PGJ A;  4C7N B;  3TYI A;  3VTP C;  2B9B A;  1SQX K;  1JTH B;  2MKV A;  4GED B;  1W5C E;  4OWF A;  1GW3 A;  2QJP B;  3OA7 A;  1SQQ K;  3L73 E;  4GOE A;  4H0L D;  3HD7 D;  1KIB A;  2BH5 X;  4U3F E;  1M57 D;  5KLV E;  4AAN A;  4EIJ A;  2OYH C;  2QA4 P;  1BL9 A;  3D6Y A;  1I5T A;  5AW5 B;  1OW7 A;  2CA4 B;  1OCD A;  1URQ D;  3NBS A;  1SVF A;  4QAO A;  2IZ0 A;  3CX5 I;  3CX5 D;  1FZC A;  3TK1 A;  4JYC A;  5CMZ A;  4HYT B;  1H32 A;  3N4X A;  1N15 A;  3WFE C;  1HWT C;  1L0N G;  3CCR P;  1L0N J;  1FOS E;  2M3B A;  2R44 A;  1FZC B;  1Q2N A;  1L4A D;  2BPB B;  1SQX G;  5APS A;  3SWY A;  2PAJ A;  1NJI Q;  1DX7 A;  3B5N D;  4RSZ A;  3LW5 H;  2N9B A;  3OW2 O;  1CYJ A;  3ZOY A;  1H33 B;  1PPJ E;  4WQE A;  1RQU A;  5CCG D;  4Z1M H;  1JDL A;  3A3Y B;  5DJT B;  3U1A A;  2XTS B;  2WZ7 A;  1GU2 A;  1NOH A;  3M06 A;  2OQQ A;  1YJW P;  3D0W A;  4WQ9 A;  1ZP0 C;  1EDL A;  2P67 A;  2YNY A;  1ZR4 A;  1USD A;  2BCC E;  3AE3 C;  4GYD A;  4YXW H;  3A0H V;  2R3C A;  2GC4 D;  4XFJ A;  1SQP D;  1CTZ A;  1W5C T;  2IFN A;  3CXH H;  1YIJ P;  1NTZ D;  4WQC A;  2YCC A;  1PP9 J;  3GG2 A;  2C0X A;  3MGN A;  4D6T J;  3R4Y A;  1HBW A;  1S5L H;  3IF4 A;  3EFF K;  4UB8 H;  4WQD A;  2YXR B;  5CJ0 A;  1COT A;  3H1H J;  3G71 P;  3HD7 A;  2ZT9 B;  1NU1 K;  1JY2 P;  5GTI V;  2YIU B;  3NMD A;  3TGU E;  3U1C A;  1CYI A;  1CI6 A;  4I7Z C;  2LIR A;  1URQ A;  3LID A;  3PH2 B;  1OZH A;  1S2E A;  4WQA A;  4FA9 A;  4O9B A;  3CX5 W;  1KMI Z;  2A45 H;  1URQ B;  3S4R A;  3KHU A;  3C2C A;  1L4A A;  5GTH E;  2Q7C A;  2E5Y A;  1NIR A;  1FJK A;  4U3F D;  3DR0 A;  3DMI A;  5KJ7 C;  3P8C E;  1FI9 A;  2Y0E A;  4NFG B;  5B5E V;  3B5N A;  4W80 A;  1L4A B;  3VP9 A;  4H13 D;  4XA4 A;  2OGU A;  2WSE J;  1NAF A;  1MUU A;  5CJ4 A;  3N7N A;  1CTJ A;  1RE4 A;  2Y0C A;  3B5N B;  5B66 V;  2PRR A;  1BCC J;  5CCG A;  2QJY C;  5TIS E;  1SQB E;  2AXC A;  1IJD B;  1RE3 C;  2QVA A;  4BWN A;  3CCU P;  1SQV E;  4WQB A;  5AW9 B;  1L9J C;  3WC8 A;  1OMI A;  1KN7 A;  3O20 A;  2N18 B;  4WBA A;  1GDT A;  4U7J A;  2FWL A;  2V4H A;  3RGU A;  1F1F A;  1VQ8 P;  4V2K A;  1KYO H;  3FWL A;  4DY9 A;  1QGK B;  4LC1 A;  4LGD E;  4I2L C;  2FFD B;  1IO4 A;  3L4M A;  1PPJ D;  3CYT I;  3HQ6 A;  2Z5H A;  2FRC A;  1HTL C;  3AE9 C;  2DVH A;  2E74 B;  3L75 G;  3CWB G;  4H0L C;  1CXA A;  4DOJ A;  1L9B C;  2B4Z A;  3H1K G;  4AQR D;  1SQQ D;  3TDK A;  2BCC D;  3H1K J;  2KP8 A;  5CID B;  3KPE A;  3KDP B;  3L72 E;  1FJ0 A;  3AED C;  3L70 G;  1ZXG A;  1MG2 D;  3CC2 P;  1E8E A;  1HJ0 A;  1A02 F;  2HR3 A;  2FXP A;  2YXQ B;  4WY4 C;  3VP8 A;  3A5T A;  1VQK P;  1D7M A;  4RES B;  4IFF A;  2AXT V;  2JJL A;  3V2Q A;  3ITK A;  3T97 A;  2IBZ G;  5APY A;  4EI2 A;  1E79 H;  2FYN B;  3ABV C;  4RJT A;  5H2F V;  1GIW A;  3HUS A;  1HVV A;  4K35 A;  1QYZ A;  1BE3 J;  1T8Z A;  2MJZ A;  1LMS A;  1SLQ A;  2MHM A;  2FYZ A;  2FYU D;  2JDI H;  1FDM A;  1VQ6 P;  4AX3 A;  3A0B E;  3G4S P;  1W2L A;  2IPP A;  3TGU D;  5KTB A;  1S1C X;  2JEE A;  2XKM A;  4AAM A;  1JNM A;  1GTW A;  1VL2 A;  3BCC E;  4C7R A;  2E76 C;  3L71 J;  1WVE C;  1BDD A;  1XTG B;  1K3H A;  3H1J E;  1KIL B;  5AW3 B;  4UB6 H;  5DJQ C;  4H13 B;  1N8R Q;  1C7M A;  3I5C A;  5CIG B;  1VQ7 P;  1N73 A;  3CCS P;  5AUR A;  3G6E P;  1CRI A;  4Y5R A;  1AYG A;  4OGQ B;  4R4L A;  1I6E A;  2WSE H;  1LTJ A;  2HOD B;  1LP1 B;  1PV3 A;  1VDF A;  2HFE D;  1IC2 A;  1N73 B;  2V08 A;  1H0T B;  2JWA A;  4ASV A;  1I54 A;  1AOQ A;  1K04 A;  4A7P A;  3HE5 A;  1TU3 F;  2R5D A;  3V6I A;  2KLU A;  1CHH A;  2ZON G;  2H8P D;  2OAR A;  2G3A A;  3L74 J;  5CBN A;  1FZG A;  1SQV D;  2ORL A;  4IL6 X;  3HE5 B;  2WPS A;  2ZOO A;  5KAF E;  4PD4 E;  1AV1 A;  1DVH A;  3KZI H;  451C A;  1DW2 A;  3TYY A;  4ZMD A;  5CBO A;  1J1D C;  3PH0 A;  4RKU J;  3RN0 A;  2QJK C;  1NU1 D;  1CCH A;  1RF1 A;  3WFD C;  1RQV A;  5C0Z A;  2YKO A;  3M9B A;  1FZB A;  2HV4 A;  3NTN A;  2Q1K A;  1KX2 A;  4IL6 E;  3E1R A;  1USE A;  4XYD B;  1VQ5 P;  1KB9 E;  2KXP B;  4PWA A;  3O8Z A;  4K3I A;  1QX8 A;  1SFC C;  1T2K C;  1L0L E;  3L72 D;  3BAS A;  2CXB A;  2C8S A;  4GOF A;  1YQ4 C;  2UWJ E;  2WT7 A;  1FHB A;  1U7J A;  3H1I G;  3GF3 A;  3WU2 E;  3H1L E;  2RMZ A;  2YQB A;  3LIE A;  1OFC X;  4EIF A;  3RL0 C;  3EWK A;  3A0B H;  2WT7 B;  4OVN F;  2OYH A;  3U59 A;  2RKL A;  1LWU C;  1HJ4 A;  2Y9Y A;  3VYM A;  1BGY G;  1IFN A;  2IYO A;  4WB4 A;  1JY2 O;  1P84 E;  2WSF J;  2G8Y A;  3VN0 A;  1CNO A;  3H25 A;  4PJ0 H;  1NTM E;  1DEB A;  4OH8 B;  1RZ5 A;  4R4M A;  1YCC A;  2C9N Y;  2P58 A;  2P7J A;  1LTA C;  3BCC D;  4PW9 B;  3FXE A;  3HQ8 A;  1GL2 C;  3H1J D;  1NTZ J;  1NML A;  1SQP E;  1MZ4 A;  4DJG A;  1I8O A;  2JKV A;  5KJ7 D;  1S3J A;  3IN6 A;  3NFQ A;  1CSV A;  5KLV K;  4L75 A;  1COR A;  1CXC A;  2V7Q H;  1N90 A;  3Q1M A;  1S5L V;  351C A;  4L3H A;  4UB8 V;  1PGQ A;  1DEE G;  2B87 A;  4N3Y B;  1NTK E;  1S5L X;  1NKZ B;  1RF1 C;  5CIC B;  1YYC A;  1YIQ A;  3MK7 C;  3CMA P;  3HE4 A;  1L2P A;  1K8A Q;  2PCC B;  2B10 B;  3TF5 A;  1VF5 C;  2ITA A;  1L0N K;  1EQ7 A;  2PGD A;  3HE4 B;  2Q3I A;  3TSI A;  3M97 X;  1DIP A;  4JQ0 D;  3L73 G;  2R5B A;  3NWV A;  1AOF A;  2YO3 A;  3L73 J;  4PD4 I;  4PD4 D;  1I6D A;  2OYI C;  5B6Q A;  2A45 G;  4EOT A;  2WVR A;  5KLV G;  4KT0 J;  4U3F J;  5KLV J;  5E79 E;  5AW6 B;  5AVQ B;  1LT9 C;  1YQ3 C;  1QL2 A;  1FI3 A;  3CX5 H;  4WQ7 A;  4N0K A;  4C46 A;  1LT1 A;  1C52 A;  1F1C A;  2WSS H;  2Y9Z A;  2L91 A;  5CCH C;  3E1I A;  3ZOO A;  1KB9 I;  1KB9 D;  4WY4 D;  2N9J A;  3CD6 P;  1IRW A;  1W2B O;  1LTG C;  2H7H A;  3PLN A;  3VNW A;  1L0L D;  3PJS K;  4DT0 A;  3WU2 H;  4I7Z B;  1JMB A;  1C6O A;  1CIH A;  2IFM A;  1H32 B;  2IDB A;  3GHG C;  3RK2 B;  1PFI A;  1FDI A;  4KJM A;  1NH4 A;  2XNX A;  1OVU A;  1EZV G;  3H1L D;  2ZVO B;  1JCC A;  5KJ7 A;  2KLV A;  1OW6 A;  3R2P A;  1WMK A;  2C0W A;  2QG4 A;  4YE1 A;  2WSF H;  2IZ1 A;  2ZXY A;  2W90 A;  3W67 A;  1ZOY C;  2E76 D;  1LTI C;  1QL4 A;  4JF7 A;  4N6J A;  4ZKU A;  5KLI C;  3P32 A;  1P84 I;  1P84 D;  1KTM A;  4PV1 D;  1NTM D;  3AE1 C;  1SQX E;  3OAK A;  1E29 A;  2BCC J;  1A02 J;  4H44 D;  1RE3 A;  5EFW B;  1SQQ E;  2Q5U A;  3MUD C;  2PAC A;  2OTL P;  1Y47 A;  4P4Q B;  2C9X B;  1S9K E;  3V2N A;  3MIW A;  4ZKP A;  3HRN A;  5KAI H;  1PP9 G;  3RN1 A;  4D6T G;  2JR8 A;  3M0A A;  5CIB B;  2WTY A;  2QJP C;  5DFS A;  2D0S A;  5M1B A;  1NTK D;  1J3S A;  2K37 A;  1E5W A;  1C2N A;  1YTZ I;  4L3G A;  3G9R A;  3H1H G;  4L76 A;  1YI2 P;  2JTI B;  2QEX P;  5APU A;  2KNC A;  1KQS O;  1GK4 A;  1T6A A;  2E42 A;  3TGU J;  2FYU E;  2AEJ A;  3PTZ A;  3A0H E;  1K3G A;  1A8C A;  3MP7 B;  1LFM A;  4H0L B;  1FJP A;  2M8R A;  1HRC A;  1JUN A;  3HD7 B;  1YBK A;  4UB6 V;  1NHL A;  5AVX B;  4NPF X;  4EDF A;  4WY4 A;  2KB7 P;  2PP6 A;  2JP3 A;  1DD4 A;  1CI6 B;  3B8E B;  1X79 B;  2BLF B;  3A2A A;  1HCM A;  3B4S A;  1ZV8 A;  1DII C;  5IY5 1;  4GKG A;  3WFC C;  1JB0 J;  4WY4 B;  2O01 J;  1R5S A;  3V4Q A;  2CPB A;  5GTI E;  3SJL A;  2B88 A;  4HKZ H;  1IK9 A;  3L37 A;  3RLM A;  1ZLL A;  3B71 A;  3PXS A;  1SFC D;  1CSW A;  1T2K D;  3FWN A;  1CRH A;  1QL3 A;  1SQB G;  2W83 C;  1BCC G;  2P1J A;  2E75 D;  1SQB J;  3Q5R A;  3K5B A;  1XTC C;  3VMX A;  1SQV J;  3EQ2 A;  2Q9I A;  2GUV A;  3MHV A;  1JEK A;  1M1K Q;  5AVU B;  3EFG A;  3RL0 D;  2W6B A;  2E76 B;  3BRV B;  2BCN B;  3KZI V;  1CHI A;  2AEM A;  1FOS F;  2O1K A;  2W8Z A;  5B5E E;  5DJQ B;  2JWD A;  1NU1 E;  2C1D A;  3KXD A;  1QVF O;  3O0R C;  2KSJ A;  1L0N D;  5CYT R;  5B66 E;  1CCR A;  4O1W A;  1RAQ A;  1GL2 D;  4N78 E;  1AFO A;  3TNU A;  1SQX D;  1CSX A;  3MTU E;  2ZT9 C;  1EDK A;  3UIA A;  2FXO A;  1S9K D;  3TNU B;  3JBT B;  2OTJ P;  5AW7 B;  1JY3 O;  2QM7 A;  4MN4 C;  4IOI H;  1JO5 A;  3CPW O;  3L75 E;  3CWB E;  2GM4 A;  1YEA A;  2LIT A;  2EXV A;  3F5H A;  1RAP A;  1EXJ A;  1FCD C;  1GK6 A;  3GMA A;  1J1D B;  1VF5 D;  3FX0 A;  1JOC A;  1T3U A;  2QIW A;  3AEE C;  1BE3 G;  4XE5 B;  3L70 E;  1WT6 A;  4ZNC A;  4PJ0 V;  3T97 B;  3SWS A;  2LKM A;  3C1L A;  1CHJ A;  1J1E C;  5APW A;  1KQL A;  1N86 A; 
#chains in the Genus database with same CATH homology
 1N50 A;  1BL9 A;  1I5T A;  1IO3 A;  1FHB A;  2CA4 B;  1KX7 A;  1OCD A;  5TIS V;  3NBS A;  2RMZ A;  3WFB C;  1CRG A;  2YQB A;  3ZBM A;  1KV9 A;  4QAO A;  3CX5 D;  4EIF A;  1CRC A;  3L73 D;  1M70 A;  4XXL A;  5DF5 A;  1H32 A;  2PCB B;  1N15 A;  3WFE C;  3O1Y A;  5C9M A;  1HJ4 A;  3VYM A;  4FAV A;  5KLV D;  1CIE A;  4MU8 A;  1CNO A;  1CSU A;  2BPB B;  4FA4 A;  1RZ5 A;  1YCC A;  4RSZ A;  3BCC D;  1CRJ A;  4PW9 B;  1FOC A;  3HQ8 A;  1S6V B;  5EXQ A;  1A2S A;  1YIC A;  3H1J D;  1CYJ A;  5KKZ B;  1NML A;  3ZOY A;  1H9Y A;  1H33 B;  1MZ4 A;  4FAN A;  1I8O A;  4WQE A;  2I8F A;  3ZIY A;  1LC1 A;  1CSV A;  1JDL A;  1COR A;  1CXC A;  2XTS B;  1N90 A;  1GU2 A;  1HJ5 A;  1S5L V;  2DGE A;  351C A;  4L3H A;  4UB8 V;  4WQ9 A;  1I55 A;  3VMA A;  2KS1 A;  1DT1 A;  4H0J A;  2C1D B;  2Q3E A;  4GYD A;  3SXT A;  3A0H V;  5CIC B;  2GC4 D;  1YIQ A;  1SQP D;  3MK7 C;  1EZV D;  1CTZ A;  2PCC B;  1HH7 A;  1W5C T;  2B10 B;  3TF5 A;  1NTZ D;  1BCC D;  1KYO D;  4WQC A;  1C6R A;  2K9J B;  2MTA C;  2YCC A;  3PXT A;  3GG2 A;  3CXH W;  3RMZ A;  3M97 X;  2Y0D A;  4AAL A;  4FA5 A;  3CU4 A;  2V07 A;  2GC7 D;  3O5C A;  3NWV A;  1U74 B;  1QN2 A;  4WQD A;  1AOF A;  3ORV A;  4Q5P A;  3PHL A;  1COT A;  3A0B V;  4PD4 D;  1I6D A;  2D0W A;  3MK7 B;  4L1Q A;  2N3B A;  5B6Q A;  1CIG A;  5GTI V;  2QJK B;  1HRO A;  2YIU B;  2CE1 A;  1CTY A;  4EID A;  1HZU A;  2N3Y A;  1CRY A;  1CYI A;  2LIR A;  1FI3 A;  2VHD A;  1PP9 D;  4WQ7 A;  5CIE B;  3L75 D;  4N0K A;  3CWB D;  2N9I A;  3PH2 B;  1C52 A;  4D6T D;  1F1C A;  4WQA A;  3NBT A;  1YFC A;  2L91 A;  4FA9 A;  3ZOO A;  1YEB A;  3CX5 W;  3X39 A;  3H1K D;  3OCD A;  1KB9 D;  3PRJ A;  2N9J A;  1IRW A;  3H1H D;  2C2C A;  3PLN A;  3KHU A;  3C2C A;  3VNW A;  1L0L D;  3L70 D;  1I8P A;  1NIR A;  3OCD B;  4U3F D;  3DR0 A;  3DMI A;  1C6O A;  1FI9 A;  2Y0E A;  1CO6 A;  4NFG B;  5B5E V;  2N18 C;  1CIH A;  1H32 B;  4EIC A;  5CIH B;  3H1L D;  1GDV A;  2C1V A;  1CTJ A;  2IBZ D;  2Y0C A;  5B66 V;  3SVW A;  2YK3 A;  5KAI V;  1MG3 D;  1U75 B;  2CE0 A;  2QG4 A;  4YE1 A;  4EIE A;  2ZXY A;  5KAF V;  1QL4 A;  4WQB A;  1L9J C;  3WC8 A;  1P84 D;  3O20 A;  2N18 B;  1NTM D;  1E29 A;  2FWL A;  3DP5 A;  4H0K A;  4AAO A;  1IQC A;  1LC2 A;  1F1F A;  1B7V A;  3HQ7 A;  4V2K A;  3FWL A;  4LJI A;  2PAC A;  1IZL 0;  4DY9 A;  4P4Q B;  2C9X B;  1H1O A;  1ZRT D;  1NNO A;  3L4M A;  1KYO W;  1PPJ D;  1SQB D;  3CYT I;  2FRC A;  3HQ6 A;  4IL6 V;  1ZZH A;  1DW3 A;  3RN1 A;  2DVH A;  5KLI B;  3A9F A;  1H31 A;  1CXA A;  1QKS A;  1GJQ A;  5CIB B;  1L9B C;  5DFS A;  2B4Z A;  2D0S A;  1IRV A;  3PXW A;  1NTK D;  1J3S A;  1FI7 A;  1C2R A;  1RZ6 A;  2CA3 B;  4FA1 A;  1SQQ D;  1C2N A;  3TDK A;  2BCC D;  4L3G A;  5CID B;  1M6Z A;  1H31 B;  2JTI B;  1OAE A;  1FJ0 A;  1MG2 D;  1E8E A;  4WQ8 A;  3PTZ A;  3WU2 V;  1N9C A;  1K3G A;  1A8C A;  4FB1 A;  1ETP A;  1LFM A;  5CIF B;  1HRC A;  2AXT V;  3HQ9 A;  3ITK A;  4UB6 V;  2FYN B;  4EDF A;  4RJT A;  5H2F V;  1GIW A;  1C75 A;  1E2R A;  1C6S A;  1QYZ A;  2BLF B;  1HCM A;  1LMS A;  4KMG A;  1EB7 A;  1DII C;  2MHM A;  2N9Y B;  2B0Z B;  5IY5 1;  2FYU D;  3WFC C;  4AX3 A;  1W2L A;  3TGU D;  4AAM A;  3SJL A;  3VRD A;  3ZCF A;  1NMI A;  1WVE C;  3RLM A;  1K3H A;  3ZOX A;  3PXS A;  1CSW A;  1CRH A;  1A56 A;  1QL3 A;  5DJQ C;  2AI5 A;  3CP5 A;  1BE3 D;  1GKS A;  1HZV A;  1C7M A;  3OA8 A;  5CIG B;  2RN0 A;  1H33 A;  2AIU A;  1YNR A;  2ZZS 1;  1CED A;  5AUR A;  1CRI A;  1YTC A;  4Y5R A;  3L4O A;  2BGV X;  1AYG A;  1I6E A;  2BCN B;  3KZI V;  2JQR A;  1LS9 A;  1CHI A;  1VYD A;  2OZ1 A;  3OA8 B;  2B11 B;  3L71 D;  3H1I D;  2V08 A;  2O3J A;  1H9X A;  2JWA A;  1GQ1 A;  1I54 A;  2A06 D;  1R0Q A;  5DJQ B;  1KB0 A;  1AOQ A;  4A7P A;  2C1D A;  1DW0 A;  155C A;  3O0R C;  4J20 A;  3GW6 A;  2OZ1 B;  2QJY B;  1CHH A;  2ZON G;  3WUI A;  1L0N D;  5CYT R;  4JCG A;  1CYC A;  1DVV A;  1SQV D;  2ORL A;  1CCR A;  4O1W A;  1RAQ A;  1BGY D;  3SLE A;  2L4D A;  2ZOO A;  1SQX D;  2BH4 X;  1DVH A;  1CSX A;  5TJH A;  451C A;  1DW2 A;  3ZOW A;  5E79 V;  1AKK A;  3RN0 A;  1CIF A;  1NU1 D;  1CCH A;  3WFD C;  3JBT B;  2GIW A;  2B12 B;  2C1U A;  5C0Z A;  2GB8 B;  1WEJ F;  1DW1 A;  3CXH D;  3L74 D;  4O1Q A;  1DIQ C;  2HV4 A;  1YEA A;  3TYI A;  1KX2 A;  2LIT A;  2KNC B;  2EXV A;  4GED B;  1RAP A;  2QJP B;  4XYD B;  5GTH V;  1FCD C;  2ZBO A;  4PWA A;  1CC5 A;  4K3I A;  1M60 A;  3L72 D;  2CXB A;  1KIB A;  2BH5 X;  2C8S A;  4PJ0 V;  3SWS A;  1HJ3 A;  1CHJ A;  4AAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...