1KB9D

Yeast cytochrome bc1 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 70
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1kb9D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1kb9D01
4Y5RA 3VYMA 2B12B 1YNRA 3CXHW 1I8PA 4EIEA 2ORLA 5KAIV 2AXTV 4FA1A 1HROA 4UB8V 5DFSA 2O3JA 4EIFA 3OA8B 5DJQC 3M97X 3NBSA 1DVVA 2BCNB 4GYDA 1CIFA 2QJKB 1CC5A 3TYIA 3TF5A 1DW0A 3L70D 4AAMA 4MU8A 4WQ8A 1DIQC 3SJLA 3H1JD 1PPJD 2OZ1A 3MK7B 1OCDA 1NU1D 1CHJA 2L4DA 2KS1A 351CA 4L1QA 3VRDA 2C1UA 4D6TD 2KNCB 1KX7A 1PP9D 1OAEA 4WQEA 1CRGA 3SXTA 2QJPB 2FYNB 1AYGA 5CYTR 2L91A 3WU2V 1FI3A 4O1QA 3DR0A 2B10B 4NFGB 2CE0A 3PXWA 1EB7A 1ETPA 1R0QA 4L3GA 1H33B 3H1KD 1IZL0 1CRIA 1YEAA 3MK7C 3C2CA 5CIEB 1YCCA 1DW1A 4WQ9A 3VMAA 2C1DA 3A0BV 1KYOD 2BLFB 1C6RA 2Y0CA 1BGYD 1RZ5A 2FYUD 1CIEA 1MG2D 1H31B 1FOCA 1FI7A 1CSVA 2MHMA 3WFBC 1SQPD 1IRWA 4JCGA 2BGVX 4FB1A 3L4OA 1A2SA 1QKSA 4PWAA 5TJHA 3OCDA 3GW6A 3ZBMA 3O20A 1HJ4A 5GTIV 3L74D 4H0KA 4U3FD 5DJQB 1CCHA 4XYDB 1FCDC 1CYCA 1CRHA 4A7PA 2A06D 4P4QB 3HQ9A 2BPBB 3L73D 1I8OA 1N90A 1CXCA 2PCCB 1RAQA 2RN0A 1DW2A 2CA3B 1CXAA 3WUIA 1NTKD 4FAVA 3KZIV 1YEBA 1QL4A 1IO3A 1BE3D 2GIWA 4PD4D 2N9IA 1C52A 4KMGA 4PW9B 5DF5A 2CA4B 5GTHV 1U75B 3RLMA 2N18C 2LITA 3ZOXA 4EIDA 155CA 1CORA 1H32B 4O1WA 3ZOOA 2QG4A 2RMZA 2BH5X 4XXLA 1VYDA 3L71D 5EXQA 3PTZA 2JQRA 2I8FA 3CYTI 5AURA 3PH2B 1F1CA 1H32A 2OZ1B 4GEDB 1DIIC 4J20A 1GKSA 2JWAA 2YQBA 1J3SA 1C6SA 1CSWA 1CIGA 1GIWA 1FJ0A 1EZVD 3SWSA 1I54A 1QYZA 1HRCA 1K3HA 3SVWA 2DGEA 2GB8B 3H1ID 1C2NA 4RJTA 1C2RA 1CSUA 3TGUD 2YCCA 3O1YA 4PJ0V 2C9XB 5KLIB 1L0LD 3ZIYA 5CIFB 4Q5PA 2PACA 2ZONG 1M60A 1LC2A 1GU2A 3PXTA 1M70A 2C1DB 2YK3A 3CX5D 1SQQD 1M6ZA 1IRVA 2GC7D 2B0ZB 4K3IA 2K9JB 1AKKA 1B7VA 1AOQA 4FANA 3WFCC 1W2LA 1DW3A 3CP5A 1P84D 1N15A 3RN0A 3OCDB 2PCBB 1MG3D 1I5TA 1S5LV 4FA4A 1YFCA 4EICA 3X39A 4WQBA 1L9JC 1KYOW 1KX2A 2ZOOA 1E29A 1C7MA 1NMLA 1NNOA 2IBZD 3HQ8A 2LIRA 2N18B 3H1HD 2MTAC 3PLNA 2CXBA 2C1VA 3L4MA 4FA9A 1LC1A 1NTMD 3DP5A 1CEDA 4EDFA 3FWLA 1LMSA 1AOFA 3VNWA 3KHUA 4WQAA 1GDVA 2V08A 4DY9A 2D0SA 3ZCFA 2DVHA 1I6EA 5B66V 1CCRA 3CWBD 2Y0DA 1QN2A 3RMZA 2B11B 3PHLA 1CIHA 3CXHD 2CE1A 1K3GA 3O0RC 2C2CA 3HQ6A 3GG2A 2N9JA 1YIQA 1HZVA 1HCMA 5KLVD 4WQDA 1LFMA 1SQXD 1FHBA 4FA5A 1CTZA 1C6OA 1FI9A 1HJ3A 2GC4D 2BCCD 5CIGB 3BCCD 3ZOWA 1DVHA 3ORVA 2Q3EA 5TISV 3JBTB 1CYJA 1E2RA 5C9MA 1H1OA 2N3BA 2QJYB 2D0WA 3PXSA 3SLEA 3OA8A 2EXVA 1DT1A 2AIUA 3RN1A 3WFEC 1CTYA 3TDKA 1NTZD 1GJQA 4QAOA 3O5CA 1A8CA 1W5CT 1YTCA 1JDLA 1IQCA 3L75D 2XTSB 1CYIA 3DMIA 4AX3A 1WEJF 4WQCA 4V2KA 2FRCA 1BCCD 451CA 5KKZB 1CHHA 3ITKA 1GQ1A 4LJIA 5H2FV 5B6QA 5B5EV 2ZXYA 2AI5A 4YE1A 1N9CA 1KV9A 4AALA 5C0ZA 2N9YB 1KIBA 2JTIB 3H1LD 3NBTA 5CIHB 5IY51 3CX5W 1C75A 3A0HV 1E8EA 1H9XA 2B4ZA 5E79V 1HH7A 2ZBOA 3A9FA 1CRYA 1BL9A 1U74B 1HJ5A 1KB9D 1CNOA 5CIBB 3WFDC 3L72D 1SQVD 2C8SA 2FWLA 1KB0A 1WVEC 4IL6V 1ZRTD 2V07A 1SQBD 1YICA 1HZUA 3CU4A 1H9YA 4AAOA 1CTJA 2VHDA 1A56A 1H33A 1S6VB 4N0KA 1CSXA 5CICB 1N50A 4RSZA 1ZZHA 1I55A 1MZ4A 1LS9A 1CRJA 1L0ND 1H31A 1CO6A 2Y0EA 1COTA 2BH4X 1F1FA 3ZOYA 1RZ6A 5KAFV 1CRCA 2YIUB 1NIRA 4UB6V 4WQ7A 1CHIA 1NMIA 5CIDB 4L3HA 1RAPA 1L9BC 3NWVA 4AANA 2N3YA 3WC8A 2HV4A 4H0JA 3PRJA 3HQ7A 1I6DA 2ZZS1 1QL3A
chains in the Genus database with same CATH superfamily
1XTGB 3B71A 2E74C 2B12B 3CXHW 1I8PA 1LNQA 2D2CB 4H13B 4JPZB 1KQGB 3T97B 2JEEA 2NPSB 1S3JA 4GOFA 1VQLP 4PD4H 1MZ9A 2BCNB 1JNMA 4RESB 1W5CE 3D70A 3TF5A 1VQ6P 1L0NG 3L70D 2H7HA 3GLMA 2WSSH 5AW7B 4WQ8A 1SFCD 5CCHC 4U3FG 3H1JD 1JB0J 4ZKPA 1T2KD 1OCDA 2Q3IA 3CWBJ 3RL0B 4L1QA 2KYVA 4H13C 2KNCB 1NTZE 3BVHA 3SFEC 1G1IA 1NTKG 2FYNB 1AYGA 1URQD 3WU2V 5KLVJ 1GZLA 1KILD 2XV5A 1BE3G 3DR0A 2KUBA 3PXWA 1KORA 1J1DB 1CZQA 4ZNCA 4N3YB 1Z56A 3C2CA 4PD4I 1DW1A 1AQ5A 3VMAA 2C1DA 1W2EA 1IK7A 3RK2D 1C6RA 1KFNA 2Y0CA 4ZKUA 3H1LE 1MG2D 2FYNC 3JC22 5KLIC 3WFBC 1JCDA 2P7JA 2OTKE 4FB1A 3KZIE 1EZVG 3L4OA 2ZVNB 3L72E 4PWAA 5TJHA 3HRNA 4JF7A 3JCUH 2XZRA 5B66E 3B5ND 4U3FD 5DJQB 2XDJA 3FX0A 2Z5HA 1EZVI 4A7PA 2OYOA 4P4QB 1RF0C 5APUA 1FZCB 1DW2A 1NTKD 1YEBA 5APWA 3S9OA 2I1KA 2Z4EA 1BE3D 4PD4D 4PV1D 2N9IA 4PW9B 3ZDMA 2C9NY 2O1JA 4KHXA 5GTHV 1ZLLA 1PGJA 1SQBJ 2JR8A 4GODA 4M3LA 1L4AD 1IC2A 4XXLA 1VYDA 5EXQA 1KV4A 3PTZA 1PGPA 1OZHA 2JWAA 1J3SA 3HE4A 1KQSO 3BASA 5CCGA 1EZVD 1U57A 2M0BA 3FWNA 3Q5SA 3P8MC 4RJTA 1CSUA 1FE6A 3O1YA 2O01H 2KSJA 3L70E 1N8RQ 1LWUB 4N6JA 3RGUA 1KQFB 2OYIC 1URQB 1KILB 2PACA 5KJ7D 3S1KA 2Y9ZA 2C0WA 3O6QB 2WT7B 2GC7D 4K3IA 2WPRA 2N1TB 1KILE 2OYHB 3HD7A 1LT1A 2M5AB 1S5LH 1NTZJ 2IZ0A 2XNXA 3H6PA 2PCBB 5AVRB 1I5TA 4AYCA 4WQBA 1KYOW 1NMLA 1NNOA 2LIRA 2N18B 1SQQK 4D6TJ 1PFIA 2CXBA 3V2RA 1FZFA 1QEXA 5AVVB 3L4MA 4EDFA 3DP5A 2AEFA 3B5NB 2N1TC 3N7NA 2AXCA 4WQAA 2R3SA 1CW5A 3ZCFA 2K3RA 1I6EA 1KMIZ 1IFNA 5B66V 4U3FE 1Q7YQ 3IN6A 2L5GB 4PV1B 1E5WA 3L72J 1VDFA 3CWBD 2Y0DA 3AE4C 1JCCA 4OGQC 3EQ2A 2KI7B 3H32B 1FZAA 2FYUJ 4ASVA 1NTKE 1L4AB 3O0RC 1NTMK 1DIPA 1LP1A 4YXWH 1RQUA 5KLVD 4WQDA 1LFMA 5CCGD 2GUSA 1BE3E 2WPQA 4PD4E 1K73Q 1CTZA 3TYYA 2GC4D 1NH4A 1SQBG 1FZBA 2WSFH 3L74J 3MGNA 2Q3EA 4IL6X 1NYHA 1E2RA 4BRYB 3HUSC 1KB9I 1RE3A 3T97A 2NPSA 2M3BA 1A8CA 1W5CT 3LIDA 1JDLA 1RF1A 1IQCA 2RH0A 1YBKA 2XTSB 2J58A 3CCUP 2W6JH 4I7ZB 1DEBA 1M8OB 1YTZI 2MKVA 4AX3A 1X22A 1SQXK 3MUDC 4V2KA 1EZVE 5E79E 1CHHA 3ITKA 3P32A 3W67A 4LJIA 5H2FV 4Z1MH 2ZXYA 2J5UA 1N7LA 1N9CA 1LTSC 4AALA 3A0HH 4IL6E 2YMYA 3AEDC 3RBXA 1KIBA 3C9IA 3L71J 1T8ZA 2KNCA 4C7NA 2IFMA 1GW4A 2AEJA 4I7ZC 4KJMA 1CRYA 1YJWP 3A3YB 3V6IA 3HTKB 1UIXA 2ZXEB 3VTPC 1KB9D 5CIBB 1H0TB 1VQOP 2C8SA 1OW6A 1EC5A 1SQBD 1YICA 5KAFE 2GUVA 1CTJA 1NTZG 1N73B 1NKZB 1S6VB 4N0KA 1X9VA 2XKMA 3JCUE 2QA4P 2QJPC 1L0LJ 4HB1A 1N50A 1M1JB 2FXPA 3CC7P 3LW5H 1S9KD 3M0DC 2B87B 2E74D 2YNYA 1D7MA 2W6BA 1USDA 2BH4X 4D6TG 4XA4A 2B89A 2YIUB 4Y28J 2JKVA 1SQVK 2JDIH 1QGKB 2Y9YA 2OTLP 5CIDB 1YJNP 1RAPA 4NPFX 2FYZA 1L9BC 2N3YA 2HV4A 3U1CA 3FGAD 1QVFO 2K37A 5CCHD 2AXTH 1I6DA 1M1JC 1JEKA 2Z5IA 1DH3A 1FZCA 2E76C 1L0NK 3L72G 3VYMA 3CWBE 4H13D 5KAIV 4FA1A 1HROA 4EIFA 3OA8B 1YJ9P 1GU4A 2YIUC 3M97X 1GDTA 1OX3A 1QVGO 2FBWC 4H44B 5KLVE 1CIFA 4W7YA 4EOTA 1Y9BA 3AE6C 3CXHH 1S5LX 3WU2E 3CL3D 4DOJA 3L74G 3FXDA 3SJLA 2YO3A 4K3AA 3MK7B 4W7ZA 351CA 4Y99B 2O1KA 4D6TD 1ZR4A 2HG5D 1CRGA 1NVOA 5CYTR 1YQ4C 2WMMA 4H44C 2ZJSE 4O1QA 1H88A 2FY8A 4YXDC 2GM4A 2B10B 3CLQA 1S5LE 5AVYB 1LWUA 3CCVP 1OVUA 2K1AA 2W6AA 1URQA 3W68A 1H33B 1KILA 1ZP0C 3D0WA 3MZWB 3ABVC 1SS1A 4RKUJ 3MK7C 1EQ7A 1OW7A 4C46A 1NU1K 1GL2C 4WQ9A 3A0BV 1K8AQ 3O6QA 1RZ5A 2WT7A 2FYUD 3BATA 3PP5A 1FOCA 3D71A 2N1TA 1FI7A 5KTBA 2KSEA 2OYHA 2M5AA 5AW5B 4LC1A 1X8YA 5GTIH 4JCGA 1KB9E 1BCCJ 5C39A 3II6A 1QKSA 2E74B 1SQBE 1HJ4A 4WB4A 3L74D 5GTHE 1BSNA 1FCDC 1CYCA 3C8VA 3RL0g 1GW3A 3MTUE 4WY4B 2BPBB 3L73D 1NGMB 1CXCA 1ZMEC 1RAQA 2M3EA 2CA3B 1CXAA 3WUIA 2IZ1A 3CMEP 3B5NA 1IO3A 2RKLA 1SQPK 1M56D 1C52A 2FFDB 4KMGA 1E79H 1VQNP 5AW6B 2N9BA 2LITA 3AE2C 3ZOXA 1JY2P 1OMIA 4IFFA 1H32B 3CX5I 1YYCA 4O1WA 2PP6A 4HH2A 1HTLC 5CHXA 1J2JB 2RMZA 2AEMA 3H32A 1VPCA 4WY4C 3L71D 1F1CA 1K05A 4GEDB 1DIIC 1L4AA 1VF5C 1GKSA 1C6SA 2KS1B 1GIWA 2FFDC 3VMYA 4PJ0H 1QYZA 1HRCA 3TGUD 3WMM0 4KT0J 1OIPA 1R5LA 1S72P 1LTGC 2C9XB 5KLIB 4BRYA 1L0LD 2CK3H 3A0HE 2HR3A 1M60A 1GU2A 1AFOA 3PXTA 2ZFCA 3CX5D 4D6TE 3A0BH 3HE5B 3MHVA 3AEEC 1FS0E 1IRVA 2O01J 1AKKA 2N1TD 5AW1B 3OW2O 5KJ7A 1ZN5A 2QJYC 4FANA 3WFCC 1DX7A 1DW3A 3CP5A 2K9JA 3RN0A 1Q86Q 5AW3B 3OCDB 3IF4A 1S5LV 1H8AA 4FA4A 1RE4A 3TNUA 1XTCC 4OGQD 5APSA 2E42A 3HQ8A 3H25A 2FYUE 1G2CB 3K5BA 3HTKA 3PLNA 3BRVB 1QL2A 1H0TA 4FA9A 1LC1A 1JOCA 1LMSA 2H89C 1AOFA 3VNWA 1GD2E 3SWFA 2KZJA 1GDVA 1N73A 2V08A 1KYOH 1BCCG 1QX8A 1IFJA 1KD1Q 4JYBA 5AW9B 1CI6B 1HUCA 1PL5A 2CPSA 2Q7CA 2HPCB 2K88A 3L74E 3VN0A 3R2PA 1LTIC 4IFMA 2HFED 1QN2A 2B11B 1BGYJ 3L73E 1N2DC 3U1AA 1N7SB 1K3GA 2C2CA 2KK7A 4NPEA 1YIQA 1HZVA 2OYIB 2E75C 1UIIA 1MV8A 1C6OA 2LXCB 2Q6QA 1HJ3A 3TSIA 3BCCD 4CPGA 3ORVA 1LT9B 5TISV 3JBTB 1R5SA 3Q1MA 3F5HA 2OTJP 1IFIA 5H2FE 3AE8C 2D0WA 3OA8A 3WFEC 3L71E 1YQ3C 1GJQA 4QAOA 3RK3C 1N7SC 3CC4P 2WSFJ 1WRGA 1CYIA 1VL2A 5AVUB 1MKMA 5B5EH 1OVVA 1BCCD 3CPWO 3VP9A 5CJ0A 3CWBG 3WUUA 1VQKP 5AVZB 3TGUE 4EI2A 1FDOA 1LT9C 2AI5A 2KIKA 5C0ZA 1L0LE 5KLVG 2QJKC 1LGHB 4JBZA 3NBTA 1NTZK 3AE5C 1FOSF 1C75A 3A0HV 1NHLA 1AV1A 2FXOA 3Q3DA 1H9XA 2J59M 5APVA 3CX5E 4C7RA 5AW0B 1U74B 1CNOA 5CBNA 2FWLA 1KB0A 1WVEC 5GTIE 4RO0A 3H1IJ 4OGQB 4AAOA 3CU4A 1VQ8P 1JY2N 1NOHA 1A56A 1JTHB 1H33A 2JJLA 5CICB 1ZZHA 1MFZA 1VQ7P 1PPJG 1CRJA 3M9HA 1CO6A 1PZQA 4UB6H 3L36A 1SQQJ 3IR9A 1FU1A 2R5BA 2NRGA 1RZ6A 2YMKA 3G3ZA 5KAIE 2QEXP 1NIRA 1YTZT 2PRRA 3LW5J 4WQ7A 2KB7P 2WSCH 3HUSB 5DJTB 3KQGA 3PH0A 1HBWA 2ZYGA 2KOGA 2JWDA 2PFXA 1YHQP 3HQ7A 4UB8H 2ZZS1 1QL3A 1HWTC 1FJKA 5TISH 4L74A 4EIEA 2ORLA 2AXTV 2O3JA 1LTJC 5CCHA 1M90Q 2P10A 2FFDA 5L8RJ 3NBSA 4H44D 1NTMJ 1EXIA 1JY3P 1OWAA 2KLUA 1CC5A 1JMMA 1QL1A 3L73J 3TYIA 1DW0A 3D6YA 3BCCE 2A45H 3B4SA 1OVRA 2WSEH 1GK6A 1IJDB 1DIQC 3M91A 1PPJD 1GL2D 1AVOA 1CHJA 2A06G 2KS1A 5AVQB 1KX7A 3SXTA 2QJPB 3A0BE 1OW8A 1EDIA 3SFDC 1W2BO 2ZT9C 1BCCE 2BCCJ 3I56P 4NFGB 2CE0A 3MIWA 1RHZB 1EB7A 2WZ7A 3JSVC 2KZIA 1ETPA 1FAVA 4L3GA 3H1KD 1T3UA 3M0AA 3CCLP 2H8PD 1YEAA 1YCCA 2ZYAA 1BGYD 3HE5A 2BEQD 3TGUJ 1JY3O 1VQ4P 3L75J 2WITA 1CSVA 2IDBA 3AEAC 1IRWA 5BVZA 1RF0A 2E76B 1A2SA 1OXZA 3OCDA 1P84H 3A5TA 1JM0A 3ZBMA 5GTIV 5BU8B 2MJZA 2K9YA 1CCHA 2HLOA 1CRHA 3KZIH 3V2QA 4WY4D 3V2PA 2A06D 3HQ9A 2R44A 1G2CA 3V4WA 1VF5D 2WVRA 1NAFA 2RN0A 2BASA 2P67A 1QL4A 3G6EP 3VP8A 2V7QH 3SSUA 2GIWA 1DD4A 2CA4B 1SQVJ 3CCSP 3S4RA 1U75B 1CI6A 3RLMA 4B86A 2FYUG 3PJSK 155CA 2R3CA 1KC8Q 1VQ9P 3Q2YA 2JQRA 1HH0A 1A02J 2I8FA 3CYTI 5AURA 2G8YA 3PH2B 2OZ1B 1L0NJ 1NTKK 4J20A 1P84I 3B8EB 4JYCA 1Q82Q 2OYIA 1CIGA 1FJ0A 1DEEG 1NKNA 3SWSA 2P1JA 1NTMG 1U7MA 1K3HA 3SVWA 1GL2B 2DGEA 3H1ID 1C2NA 3TK1A 1X0TA 3L73G 3Q5PA 4ZMDA 2ZVOB 2IBZI 1LT9A 1R8EA 4PJ0V 1IFMA 3SWKA 3KDPB 3ZIYA 3WUTA 3BRTB 5CCGC 2E5YA 1PPJE 3A2AA 1X79B 1M70A 3BCCJ 3OJAB 2YK3A 1SQQD 2H88C 2Q5UA 1YIJP 1M6ZA 3U59A 1RY3A 1AQTA 2V4HA 1AOQA 3LIEA 2C9LY 1W2LA 3L71G 1P84D 1FJPA 3CXHI 4DJGA 1MG3D 2DW3A 4YTPC 4WVZA 4EICA 3X39A 3H1KE 1KX2A 1GK4A 1E29A 1NU1J 2W8ZA 2IBZD 4WWIA 1S4XA 5AW8B 3HD7C 3H1HD 1BGYE 2MTAC 3TGUG 2IYPA 1PP9J 3WUVA 3G71P 2C0XA 1NTMD 1L0LG 2E75D 2YXRB 1JY3N 3NMDA 3KHUA 3FXEA 4DY9A 1JTHA 4R4MA 4AQRD 1VQPP 4GKGA 1VF5B 1NWQA 2DVHA 3VMXA 1FOSE 1ZW0A 1M7LA 1Y8AA 1CCRA 2ZAEB 4OH8B 2SPZA 2A06E 3F89A 3RMZA 5TISE 3RK3D 1N7SD 3CXHD 2NZ2A 3HQ6A 3OA7A 2N9JA 4GDOA 3HUSA 5K5GB 1HCMA 1SVFA 3V4QA 1SQPJ 1SQXD 5AVTB 4FA5A 1HGZA 2VRSA 2WTYA 2JP3A 5AVXB 2BCCD 4I6MC 1SQVG 3CCQP 3CCJP 4TT3H 1GU5A 2OGUA 3ZOWA 1DVHA 3MUDA 2XU6A 1RF1B 1OFCX 1CYJA 2I8DA 1K04A 1H1OA 1S1CX 2IX7C 2N3BA 2QJYB 3KXDA 3RN1A 2EXVA 1DT1A 2AIUA 3A7OA 1IK9A 3O5CA 1YTCA 4HJGH 3L75D 2WQYC 5KLVK 3DMIA 1WEJF 4WQCA 1KQLA 2FRCA 4ASWA 5AVWB 1GQ1A 1YITP 1HF9A 3H1IE 1RE3C 3RBZA 4OWFA 1EDLA 2D2CC 2LKMA 1IFPA 5B6QA 4C7NB 5B5EV 4LLHA 2NPSC 1RF1C 4YE1A 1JY2O 2N9YB 2BEZF 5E79H 1IZNB 4N78D 2IYOA 2JTIB 2W83C 5IY51 2PGDA 3GF3A 3CX5W 5AVSB 1ZOYC 2B9BA 3BCCG 1SQQE 4IL6H 1HH7A 2ZBOA 3A9FA 1WMKA 4I1LA 1EDJA 1HJ5A 3M0DA 4BXLA 1FDIA 3L35A 1FZEA 1SQVD 3RL0C 1ZRTD 2V07A 3GHGB 1P84E 2W27A 2UWJE 3KPEA 4RSZA 2E75B 1I55A 1MZ4A 3QWOC 5KAFH 2WWWA 2HYNA 3I5CA 1L0ND 1NU1G 2IBZE 1J1DC 1COTA 5APTA 3AE1C 3H1HE 2ZYDA 1M1JA 1PP9G 2B87A 1CRCA 3H1KJ 5APYA 2AXTE 4H0LB 4UB6V 1NTME 1CHIA 1NMIA 1SQBK 3KYQA 3GHGC 1PGQA 3NWVA 4AANA 2YKQA 3RK3B 2P2UA 4H0JA 2ZXXA 4Y5RA 4TLFA 1IFDA 4WBAA 2WSCJ 3GMAA 1TU3F 1YNRA 4UB8V 5DFSA 3RK3E 3CXHE 2IFNA 5DJQC 3CCMP 4H0LC 1DVVA 4GYDA 1ZV8A 1SQPG 2ZT9D 1SQXE 2FXMA 2QJKB 1Q90D 4IFDK 3AECC 1FC2C 2QVAA 1FZCC 2BCCE 1KYOI 1FDMA 1LTTC 3NFQA 3M9BA 2P58A 4AAMA 4MU8A 2QM7A 5APXA 1RQVA 1SFCB 2OZ1A 2HODB 1NU1D 2L4DA 3VRDA 3WU2H 2C1UA 4IOIH 1MFTA 1PP9D 1OAEA 4WQEA 3L75E 2WSEJ 4U7JA 2WPSA 2L91A 1GL2A 4R4LA 1FI3A 2PAJA 3H1JE 1BDCA 2R32A 1NO4A 2POHA 1H89A 5AW4B 1R0QA 3USSA 3G4SP 1SFCC 1IZL0 1CRIA 5CIEB 4N78E 1PIXA 1T2KC 1KYOD 2BLFB 3IAOA 3IFMA 1CIEA 3RK2B 3GF7A 1H31B 3M06A 3V2NA 1LWUC 2MHMA 1SQPD 1URQC 4EIJA 1L2PA 2E76D 1KILC 2BGVX 1K9MQ 2YO2A 3CMAP 2QIWA 1SQVE 1QLED 3GW6A 1ZRTE 3V5BA 4L75A 3O20A 4DZOA 3I55P 1LTJB 2QSIA 4H0KA 1IO4A 4XYDB 3EFGA 3P7KA 1KB9H 3EWKA 2OYHC 4K35A 3H1LJ 2FYUK 4HKZH 1I8OA 1N90A 2O01N 3RK2C 2PCCB 1LJ2A 1L0NE 4FAVA 3KZIV 5GTHH 1GTWA 4WY4A 1ZXGA 3H1KG 1LTAC 5DF5A 2KLVA 2I1JA 2YKOA 2N18C 3H1HJ 1BGYG 1KFMA 1HJBA 4XFJA 1T6AA 4EIDA 1CORA 1PGOA 5EFWB 1Q81Q 3ZOOA 2V7QJ 3VYIA 3B5NC 1AVYA 2QG4A 4OVNF 2BH5X 1HJ0A 4PJ0E 1S2EA 2ZT9B 4GOEA 4QMAA 1H32A 4DCKA 2JO1A 2YQBA 3NXSA 1CSWA 1HVVA 1I54A 4PV1C 2IPPA 5CJ4A 2GB8B 1C2RA 3L4FA 1MUUA 2YCCA 1HGVA 1L4AC 3OAKA 1AA0A 1SQXJ 5CIFB 1KTMA 4Q5PA 3MP7B 2ZONG 1LC2A 1Q2NA 3HD7D 1NU1E 2C1DB 1M57D 3CC2P 3C1LA 2B0ZB 1PP9E 2A45G 4EYYQ 3Q5RA 2K9JB 1PV3A 1AJYA 4JQ0D 5APQA 1BSHA 3UIAA 4HYTB 4BWNA 3TNUB 5CMZA 5AW2B 3QH9A 1N15A 3O8ZA 3L70J 1L0LK 2A45I 4NPDA 1YI2P 1YFCA 3AEGC 3H1JJ 1L9JC 3L37A 1JO5A 3CCEP 2ZOOA 5KJ7C 1C7MA 2LXBA 3P8CD 3H1IG 1KYOE 2XNDH 1EDKA 1VQMP 1FBMA 2C1VA 1CEDA 3FWLA 3CCRP 3D6ZA 2E43A 1SQPE 3GHGA 1RE4C 1J1EB 2R5DA 3AEFC 5B66H 1SP4A 2LR2A 2D0SA 1USEA 1SQQG 2W90A 2G3AA 3PHLA 1CIHA 3H1LG 1N73C 1U7JA 2HPCA 2CE1A 4GT1A 2B88A 3GG2A 2Q9IA 3HE4B 3CD6P 1FHBA 3SWYA 1GMJA 2H43A 1FI9A 1J1EC 5CIGB 3VMZA 1N7SA 2D2CD 3CI9A 2IBZG 2NPSD 1N86A 3H1HG 2QE7H 2QRXA 2OARA 3G9RA 1FZGA 4U3FJ 1JMBA 4L73A 3E1RA 5C9MA 1BDDA 3PXSA 5B5EE 3SLEA 3TDKA 1CTYA 1NTZD 1NTKJ 2OQQA 2KXPB 3R4YA 3VOPA 2WPVB 4W80A 5H2FH 1BE3J 4GIFA 1G1JA 451CA 5KKZB 3RL0D 4L76A 2FKWB 2Q1KA 1M1KQ 2E5TA 5DJUB 1T3JA 4MN4C 3HD7B 1SLQA 1JUNA 5BU5A 2CPBA 1SFCA 4LGDE 1A02F 1KV9A 1NJIQ 1KZUB 2HODA 1LTBC 3AEBC 1SQXG 3NTNA 3H1LD 5CIHB 3E7KA 2BCCG 3AE7C 2ITAA 4I2LC 1E8EA 2YXQB 2B4ZA 5E79V 3AE3C 2QM8A 1BL9A 2GA1A 4XE5B 3E1IA 3N4XA 3WFDC 5KKZC 3L72D 4IL6V 4Y99C 1KN7A 1HZUA 1H9YA 1DD3A 1CSBA 2VHDA 5CBOA 3CX5H 4UB6E 3EFFK 1CSXA 3L75G 3L70G 4AUWA 3H1JG 1LS9A 3MD0A 1H31A 3P8CE 4O9BA 2Y0EA 1VQ5P 3AE9C 1F1FA 3ZOYA 5KAFV 4H0LD 2KP8A 1ZR2A 4UB8E 2YKPA 1LP1B 1WT6A 4L3HA 1S9KE 1LTJA 3M9QA 4YPCA 1Y47A 5M1BA 2M8RA 1EXJA 3WC8A 4DT0A 1NAYA 3PRJA 5KAIH 1RH5B 1B7VA
chains in the Genus database with same CATH topology
4Y5RA 3VYMA 2B12B 1YNRA 3CXHW 1I8PA 4EIEA 2ORLA 5KAIV 2AXTV 4FA1A 1HROA 4UB8V 5DFSA 2O3JA 4EIFA 3OA8B 5DJQC 3M97X 3NBSA 1DVVA 2BCNB 4GYDA 1CIFA 2QJKB 1CC5A 3TYIA 3TF5A 1DW0A 3L70D 4AAMA 4MU8A 4WQ8A 1DIQC 3SJLA 3H1JD 1PPJD 2OZ1A 3MK7B 1OCDA 1NU1D 1CHJA 2L4DA 2KS1A 351CA 4L1QA 3VRDA 2C1UA 4D6TD 2KNCB 1KX7A 1PP9D 1OAEA 4WQEA 1CRGA 3SXTA 2QJPB 2FYNB 1AYGA 5CYTR 2L91A 3WU2V 1FI3A 4O1QA 3DR0A 2B10B 4NFGB 2CE0A 3PXWA 1EB7A 1ETPA 1R0QA 4L3GA 1H33B 3H1KD 1IZL0 1CRIA 1YEAA 3MK7C 3C2CA 5CIEB 1YCCA 1DW1A 4WQ9A 3VMAA 2C1DA 3A0BV 1KYOD 2BLFB 1C6RA 2Y0CA 1BGYD 1RZ5A 2FYUD 1CIEA 1MG2D 1H31B 1FOCA 1FI7A 1CSVA 2MHMA 3WFBC 1SQPD 1IRWA 4JCGA 2BGVX 4FB1A 3L4OA 1A2SA 1QKSA 4PWAA 5TJHA 3OCDA 3GW6A 3ZBMA 3O20A 1HJ4A 5GTIV 3L74D 4H0KA 4U3FD 5DJQB 1CCHA 4XYDB 1FCDC 1CYCA 1CRHA 4A7PA 2A06D 4P4QB 3HQ9A 2BPBB 3L73D 1I8OA 1N90A 1CXCA 2PCCB 1RAQA 2RN0A 1DW2A 2CA3B 1CXAA 3WUIA 1NTKD 4FAVA 3KZIV 1YEBA 1QL4A 1IO3A 1BE3D 2GIWA 4PD4D 2N9IA 1C52A 4KMGA 4PW9B 5DF5A 2CA4B 5GTHV 1U75B 3RLMA 2N18C 2LITA 3ZOXA 4EIDA 155CA 1CORA 1H32B 4O1WA 3ZOOA 2QG4A 2RMZA 2BH5X 4XXLA 1VYDA 3L71D 5EXQA 3PTZA 2JQRA 2I8FA 3CYTI 5AURA 3PH2B 1F1CA 1H32A 2OZ1B 4GEDB 1DIIC 4J20A 1GKSA 2JWAA 2YQBA 1J3SA 1C6SA 1CSWA 1CIGA 1GIWA 1FJ0A 1EZVD 3SWSA 1I54A 1QYZA 1HRCA 1K3HA 3SVWA 2DGEA 2GB8B 3H1ID 1C2NA 4RJTA 1C2RA 1CSUA 3TGUD 2YCCA 3O1YA 4PJ0V 2C9XB 5KLIB 1L0LD 3ZIYA 5CIFB 4Q5PA 2PACA 2ZONG 1M60A 1LC2A 1GU2A 3PXTA 1M70A 2C1DB 2YK3A 3CX5D 1SQQD 1M6ZA 1IRVA 2GC7D 2B0ZB 4K3IA 2K9JB 1AKKA 1B7VA 1AOQA 4FANA 3WFCC 1W2LA 1DW3A 3CP5A 1P84D 1N15A 3RN0A 3OCDB 2PCBB 1MG3D 1I5TA 1S5LV 4FA4A 1YFCA 4EICA 3X39A 4WQBA 1L9JC 1KYOW 1KX2A 2ZOOA 1E29A 1C7MA 1NMLA 1NNOA 2IBZD 3HQ8A 2LIRA 2N18B 3H1HD 2MTAC 3PLNA 2CXBA 2C1VA 3L4MA 4FA9A 1LC1A 1NTMD 3DP5A 1CEDA 4EDFA 3FWLA 1LMSA 1AOFA 3VNWA 3KHUA 4WQAA 1GDVA 2V08A 4DY9A 2D0SA 3ZCFA 2DVHA 1I6EA 5B66V 1CCRA 3CWBD 2Y0DA 1QN2A 3RMZA 2B11B 3PHLA 1CIHA 3CXHD 2CE1A 1K3GA 3O0RC 2C2CA 3HQ6A 3GG2A 2N9JA 1YIQA 1HZVA 1HCMA 5KLVD 4WQDA 1LFMA 1SQXD 1FHBA 4FA5A 1CTZA 1C6OA 1FI9A 1HJ3A 2GC4D 2BCCD 5CIGB 3BCCD 3ZOWA 1DVHA 3ORVA 2Q3EA 5TISV 3JBTB 1CYJA 1E2RA 5C9MA 1H1OA 2N3BA 2QJYB 2D0WA 3PXSA 3SLEA 3OA8A 2EXVA 1DT1A 2AIUA 3RN1A 3WFEC 1CTYA 3TDKA 1NTZD 1GJQA 4QAOA 3O5CA 1A8CA 1W5CT 1YTCA 1JDLA 1IQCA 3L75D 2XTSB 1CYIA 3DMIA 4AX3A 1WEJF 4WQCA 4V2KA 2FRCA 1BCCD 451CA 5KKZB 1CHHA 3ITKA 1GQ1A 4LJIA 5H2FV 5B6QA 5B5EV 2ZXYA 2AI5A 4YE1A 1N9CA 1KV9A 4AALA 5C0ZA 2N9YB 1KIBA 2JTIB 3H1LD 3NBTA 5CIHB 5IY51 3CX5W 1C75A 3A0HV 1E8EA 1H9XA 2B4ZA 5E79V 1HH7A 2ZBOA 3A9FA 1CRYA 1BL9A 1U74B 1HJ5A 1KB9D 1CNOA 5CIBB 3WFDC 3L72D 1SQVD 2C8SA 2FWLA 1KB0A 1WVEC 4IL6V 1ZRTD 2V07A 1SQBD 1YICA 1HZUA 3CU4A 1H9YA 4AAOA 1CTJA 2VHDA 1A56A 1H33A 1S6VB 4N0KA 1CSXA 5CICB 1N50A 4RSZA 1ZZHA 1I55A 1MZ4A 1LS9A 1CRJA 1L0ND 1H31A 1CO6A 2Y0EA 1COTA 2BH4X 1F1FA 3ZOYA 1RZ6A 5KAFV 1CRCA 2YIUB 1NIRA 4UB6V 4WQ7A 1CHIA 1NMIA 5CIDB 4L3HA 1RAPA 1L9BC 3NWVA 4AANA 2N3YA 3WC8A 2HV4A 4H0JA 3PRJA 3HQ7A 1I6DA 2ZZS1 1QL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y5R A;  3VYM A;  2B12 B;  1YNR A;  3CXH W;  1I8P A;  4EIE A;  2ORL A;  5KAI V;  2AXT V;  4FA1 A;  1HRO A;  4UB8 V;  5DFS A;  2O3J A;  4EIF A;  3OA8 B;  5DJQ C;  3M97 X;  3NBS A;  1DVV A;  2BCN B;  4GYD A;  1CIF A;  2QJK B;  1CC5 A;  3TYI A;  3TF5 A;  1DW0 A;  3L70 D;  4AAM A;  4MU8 A;  4WQ8 A;  1DIQ C;  3SJL A;  3H1J D;  1PPJ D;  2OZ1 A;  3MK7 B;  1OCD A;  1NU1 D;  1CHJ A;  2L4D A;  2KS1 A;  351C A;  4L1Q A;  3VRD A;  2C1U A;  4D6T D;  2KNC B;  1KX7 A;  1PP9 D;  1OAE A;  4WQE A;  1CRG A;  3SXT A;  2QJP B;  2FYN B;  1AYG A;  5CYT R;  2L91 A;  3WU2 V;  1FI3 A;  4O1Q A;  3DR0 A;  2B10 B;  4NFG B;  2CE0 A;  3PXW A;  1EB7 A;  1ETP A;  1R0Q A;  4L3G A;  1H33 B;  3H1K D;  1IZL 0;  1CRI A;  1YEA A;  3MK7 C;  3C2C A;  5CIE B;  1YCC A;  1DW1 A;  4WQ9 A;  3VMA A;  2C1D A;  3A0B V;  1KYO D;  2BLF B;  1C6R A;  2Y0C A;  1BGY D;  1RZ5 A;  2FYU D;  1CIE A;  1MG2 D;  1H31 B;  1FOC A;  1FI7 A;  1CSV A;  2MHM A;  3WFB C;  1SQP D;  1IRW A;  4JCG A;  2BGV X;  4FB1 A;  3L4O A;  1A2S A;  1QKS A;  4PWA A;  5TJH A;  3OCD A;  3GW6 A;  3ZBM A;  3O20 A;  1HJ4 A;  5GTI V;  3L74 D;  4H0K A;  4U3F D;  5DJQ B;  1CCH A;  4XYD B;  1FCD C;  1CYC A;  1CRH A;  4A7P A;  2A06 D;  4P4Q B;  3HQ9 A;  2BPB B;  3L73 D;  1I8O A;  1N90 A;  1CXC A;  2PCC B;  1RAQ A;  2RN0 A;  1DW2 A;  2CA3 B;  1CXA A;  3WUI A;  1NTK D;  4FAV A;  3KZI V;  1YEB A;  1QL4 A;  1IO3 A;  1BE3 D;  2GIW A;  4PD4 D;  2N9I A;  1C52 A;  4KMG A;  4PW9 B;  5DF5 A;  2CA4 B;  5GTH V;  1U75 B;  3RLM A;  2N18 C;  2LIT A;  3ZOX A;  4EID A;  155C A;  1COR A;  1H32 B;  4O1W A;  3ZOO A;  2QG4 A;  2RMZ A;  2BH5 X;  4XXL A;  1VYD A;  3L71 D;  5EXQ A;  3PTZ A;  2JQR A;  2I8F A;  3CYT I;  5AUR A;  3PH2 B;  1F1C A;  1H32 A;  2OZ1 B;  4GED B;  1DII C;  4J20 A;  1GKS A;  2JWA A;  2YQB A;  1J3S A;  1C6S A;  1CSW A;  1CIG A;  1GIW A;  1FJ0 A;  1EZV D;  3SWS A;  1I54 A;  1QYZ A;  1HRC A;  1K3H A;  3SVW A;  2DGE A;  2GB8 B;  3H1I D;  1C2N A;  4RJT A;  1C2R A;  1CSU A;  3TGU D;  2YCC A;  3O1Y A;  4PJ0 V;  2C9X B;  5KLI B;  1L0L D;  3ZIY A;  5CIF B;  4Q5P A;  2PAC A;  2ZON G;  1M60 A;  1LC2 A;  1GU2 A;  3PXT A;  1M70 A;  2C1D B;  2YK3 A;  3CX5 D;  1SQQ D;  1M6Z A;  1IRV A;  2GC7 D;  2B0Z B;  4K3I A;  2K9J B;  1AKK A;  1B7V A;  1AOQ A;  4FAN A;  3WFC C;  1W2L A;  1DW3 A;  3CP5 A;  1P84 D;  1N15 A;  3RN0 A;  3OCD B;  2PCB B;  1MG3 D;  1I5T A;  1S5L V;  4FA4 A;  1YFC A;  4EIC A;  3X39 A;  4WQB A;  1L9J C;  1KYO W;  1KX2 A;  2ZOO A;  1E29 A;  1C7M A;  1NML A;  1NNO A;  2IBZ D;  3HQ8 A;  2LIR A;  2N18 B;  3H1H D;  2MTA C;  3PLN A;  2CXB A;  2C1V A;  3L4M A;  4FA9 A;  1LC1 A;  1NTM D;  3DP5 A;  1CED A;  4EDF A;  3FWL A;  1LMS A;  1AOF A;  3VNW A;  3KHU A;  4WQA A;  1GDV A;  2V08 A;  4DY9 A;  2D0S A;  3ZCF A;  2DVH A;  1I6E A;  5B66 V;  1CCR A;  3CWB D;  2Y0D A;  1QN2 A;  3RMZ A;  2B11 B;  3PHL A;  1CIH A;  3CXH D;  2CE1 A;  1K3G A;  3O0R C;  2C2C A;  3HQ6 A;  3GG2 A;  2N9J A;  1YIQ A;  1HZV A;  1HCM A;  5KLV D;  4WQD A;  1LFM A;  1SQX D;  1FHB A;  4FA5 A;  1CTZ A;  1C6O A;  1FI9 A;  1HJ3 A;  2GC4 D;  2BCC D;  5CIG B;  3BCC D;  3ZOW A;  1DVH A;  3ORV A;  2Q3E A;  5TIS V;  3JBT B;  1CYJ A;  1E2R A;  5C9M A;  1H1O A;  2N3B A;  2QJY B;  2D0W A;  3PXS A;  3SLE A;  3OA8 A;  2EXV A;  1DT1 A;  2AIU A;  3RN1 A;  3WFE C;  1CTY A;  3TDK A;  1NTZ D;  1GJQ A;  4QAO A;  3O5C A;  1A8C A;  1W5C T;  1YTC A;  1JDL A;  1IQC A;  3L75 D;  2XTS B;  1CYI A;  3DMI A;  4AX3 A;  1WEJ F;  4WQC A;  4V2K A;  2FRC A;  1BCC D;  451C A;  5KKZ B;  1CHH A;  3ITK A;  1GQ1 A;  4LJI A;  5H2F V;  5B6Q A;  5B5E V;  2ZXY A;  2AI5 A;  4YE1 A;  1N9C A;  1KV9 A;  4AAL A;  5C0Z A;  2N9Y B;  1KIB A;  2JTI B;  3H1L D;  3NBT A;  5CIH B;  5IY5 1;  3CX5 W;  1C75 A;  3A0H V;  1E8E A;  1H9X A;  2B4Z A;  5E79 V;  1HH7 A;  2ZBO A;  3A9F A;  1CRY A;  1BL9 A;  1U74 B;  1HJ5 A;  1KB9 D;  1CNO A;  5CIB B;  3WFD C;  3L72 D;  1SQV D;  2C8S A;  2FWL A;  1KB0 A;  1WVE C;  4IL6 V;  1ZRT D;  2V07 A;  1SQB D;  1YIC A;  1HZU A;  3CU4 A;  1H9Y A;  4AAO A;  1CTJ A;  2VHD A;  1A56 A;  1H33 A;  1S6V B;  4N0K A;  1CSX A;  5CIC B;  1N50 A;  4RSZ A;  1ZZH A;  1I55 A;  1MZ4 A;  1LS9 A;  1CRJ A;  1L0N D;  1H31 A;  1CO6 A;  2Y0E A;  1COT A;  2BH4 X;  1F1F A;  3ZOY A;  1RZ6 A;  5KAF V;  1CRC A;  2YIU B;  1NIR A;  4UB6 V;  4WQ7 A;  1CHI A;  1NMI A;  5CID B;  4L3H A;  1RAP A;  1L9B C;  3NWV A;  4AAN A;  2N3Y A;  3WC8 A;  2HV4 A;  4H0J A;  3PRJ A;  3HQ7 A;  1I6D A;  2ZZS 1;  1QL3 A; 
#chains in the Genus database with same CATH topology
 1XTG B;  3B71 A;  2E74 C;  2B12 B;  3CXH W;  1I8P A;  1LNQ A;  2D2C B;  4H13 B;  4JPZ B;  1KQG B;  3T97 B;  2JEE A;  2NPS B;  1S3J A;  4GOF A;  1VQL P;  4PD4 H;  1MZ9 A;  2BCN B;  1JNM A;  4RES B;  1W5C E;  3D70 A;  3TF5 A;  1VQ6 P;  1L0N G;  3L70 D;  2H7H A;  3GLM A;  2WSS H;  5AW7 B;  4WQ8 A;  1SFC D;  5CCH C;  4U3F G;  3H1J D;  1JB0 J;  4ZKP A;  1T2K D;  1OCD A;  2Q3I A;  3CWB J;  3RL0 B;  4L1Q A;  2KYV A;  4H13 C;  2KNC B;  1NTZ E;  3BVH A;  3SFE C;  1G1I A;  1NTK G;  2FYN B;  1AYG A;  1URQ D;  3WU2 V;  5KLV J;  1GZL A;  1KIL D;  2XV5 A;  1BE3 G;  3DR0 A;  2KUB A;  3PXW A;  1KOR A;  1J1D B;  1CZQ A;  4ZNC A;  4N3Y B;  1Z56 A;  3C2C A;  4PD4 I;  1DW1 A;  1AQ5 A;  3VMA A;  2C1D A;  1W2E A;  1IK7 A;  3RK2 D;  1C6R A;  1KFN A;  2Y0C A;  4ZKU A;  3H1L E;  1MG2 D;  2FYN C;  3JC2 2;  5KLI C;  3WFB C;  1JCD A;  2P7J A;  2OTK E;  4FB1 A;  3KZI E;  1EZV G;  3L4O A;  2ZVN B;  3L72 E;  4PWA A;  5TJH A;  3HRN A;  4JF7 A;  3JCU H;  2XZR A;  5B66 E;  3B5N D;  4U3F D;  5DJQ B;  2XDJ A;  3FX0 A;  2Z5H A;  1EZV I;  4A7P A;  2OYO A;  4P4Q B;  1RF0 C;  5APU A;  1FZC B;  1DW2 A;  1NTK D;  1YEB A;  5APW A;  3S9O A;  2I1K A;  2Z4E A;  1BE3 D;  4PD4 D;  4PV1 D;  2N9I A;  4PW9 B;  3ZDM A;  2C9N Y;  2O1J A;  4KHX A;  5GTH V;  1ZLL A;  1PGJ A;  1SQB J;  2JR8 A;  4GOD A;  4M3L A;  1L4A D;  1IC2 A;  4XXL A;  1VYD A;  5EXQ A;  1KV4 A;  3PTZ A;  1PGP A;  1OZH A;  2JWA A;  1J3S A;  3HE4 A;  1KQS O;  3BAS A;  5CCG A;  1EZV D;  1U57 A;  2M0B A;  3FWN A;  3Q5S A;  3P8M C;  4RJT A;  1CSU A;  1FE6 A;  3O1Y A;  2O01 H;  2KSJ A;  3L70 E;  1N8R Q;  1LWU B;  4N6J A;  3RGU A;  1KQF B;  2OYI C;  1URQ B;  1KIL B;  2PAC A;  5KJ7 D;  3S1K A;  2Y9Z A;  2C0W A;  3O6Q B;  2WT7 B;  2GC7 D;  4K3I A;  2WPR A;  2N1T B;  1KIL E;  2OYH B;  3HD7 A;  1LT1 A;  2M5A B;  1S5L H;  1NTZ J;  2IZ0 A;  2XNX A;  3H6P A;  2PCB B;  5AVR B;  1I5T A;  4AYC A;  4WQB A;  1KYO W;  1NML A;  1NNO A;  2LIR A;  2N18 B;  1SQQ K;  4D6T J;  1PFI A;  2CXB A;  3V2R A;  1FZF A;  1QEX A;  5AVV B;  3L4M A;  4EDF A;  3DP5 A;  2AEF A;  3B5N B;  2N1T C;  3N7N A;  2AXC A;  4WQA A;  2R3S A;  1CW5 A;  3ZCF A;  2K3R A;  1I6E A;  1KMI Z;  1IFN A;  5B66 V;  4U3F E;  1Q7Y Q;  3IN6 A;  2L5G B;  4PV1 B;  1E5W A;  3L72 J;  1VDF A;  3CWB D;  2Y0D A;  3AE4 C;  1JCC A;  4OGQ C;  3EQ2 A;  2KI7 B;  3H32 B;  1FZA A;  2FYU J;  4ASV A;  1NTK E;  1L4A B;  3O0R C;  1NTM K;  1DIP A;  1LP1 A;  4YXW H;  1RQU A;  5KLV D;  4WQD A;  1LFM A;  5CCG D;  2GUS A;  1BE3 E;  2WPQ A;  4PD4 E;  1K73 Q;  1CTZ A;  3TYY A;  2GC4 D;  1NH4 A;  1SQB G;  1FZB A;  2WSF H;  3L74 J;  3MGN A;  2Q3E A;  4IL6 X;  1NYH A;  1E2R A;  4BRY B;  3HUS C;  1KB9 I;  1RE3 A;  3T97 A;  2NPS A;  2M3B A;  1A8C A;  1W5C T;  3LID A;  1JDL A;  1RF1 A;  1IQC A;  2RH0 A;  1YBK A;  2XTS B;  2J58 A;  3CCU P;  2W6J H;  4I7Z B;  1DEB A;  1M8O B;  1YTZ I;  2MKV A;  4AX3 A;  1X22 A;  1SQX K;  3MUD C;  4V2K A;  1EZV E;  5E79 E;  1CHH A;  3ITK A;  3P32 A;  3W67 A;  4LJI A;  5H2F V;  4Z1M H;  2ZXY A;  2J5U A;  1N7L A;  1N9C A;  1LTS C;  4AAL A;  3A0H H;  4IL6 E;  2YMY A;  3AED C;  3RBX A;  1KIB A;  3C9I A;  3L71 J;  1T8Z A;  2KNC A;  4C7N A;  2IFM A;  1GW4 A;  2AEJ A;  4I7Z C;  4KJM A;  1CRY A;  1YJW P;  3A3Y B;  3V6I A;  3HTK B;  1UIX A;  2ZXE B;  3VTP C;  1KB9 D;  5CIB B;  1H0T B;  1VQO P;  2C8S A;  1OW6 A;  1EC5 A;  1SQB D;  1YIC A;  5KAF E;  2GUV A;  1CTJ A;  1NTZ G;  1N73 B;  1NKZ B;  1S6V B;  4N0K A;  1X9V A;  2XKM A;  3JCU E;  2QA4 P;  2QJP C;  1L0L J;  4HB1 A;  1N50 A;  1M1J B;  2FXP A;  3CC7 P;  3LW5 H;  1S9K D;  3M0D C;  2B87 B;  2E74 D;  2YNY A;  1D7M A;  2W6B A;  1USD A;  2BH4 X;  4D6T G;  4XA4 A;  2B89 A;  2YIU B;  4Y28 J;  2JKV A;  1SQV K;  2JDI H;  1QGK B;  2Y9Y A;  2OTL P;  5CID B;  1YJN P;  1RAP A;  4NPF X;  2FYZ A;  1L9B C;  2N3Y A;  2HV4 A;  3U1C A;  3FGA D;  1QVF O;  2K37 A;  5CCH D;  2AXT H;  1I6D A;  1M1J C;  1JEK A;  2Z5I A;  1DH3 A;  1FZC A;  2E76 C;  1L0N K;  3L72 G;  3VYM A;  3CWB E;  4H13 D;  5KAI V;  4FA1 A;  1HRO A;  4EIF A;  3OA8 B;  1YJ9 P;  1GU4 A;  2YIU C;  3M97 X;  1GDT A;  1OX3 A;  1QVG O;  2FBW C;  4H44 B;  5KLV E;  1CIF A;  4W7Y A;  4EOT A;  1Y9B A;  3AE6 C;  3CXH H;  1S5L X;  3WU2 E;  3CL3 D;  4DOJ A;  3L74 G;  3FXD A;  3SJL A;  2YO3 A;  4K3A A;  3MK7 B;  4W7Z A;  351C A;  4Y99 B;  2O1K A;  4D6T D;  1ZR4 A;  2HG5 D;  1CRG A;  1NVO A;  5CYT R;  1YQ4 C;  2WMM A;  4H44 C;  2ZJS E;  4O1Q A;  1H88 A;  2FY8 A;  4YXD C;  2GM4 A;  2B10 B;  3CLQ A;  1S5L E;  5AVY B;  1LWU A;  3CCV P;  1OVU A;  2K1A A;  2W6A A;  1URQ A;  3W68 A;  1H33 B;  1KIL A;  1ZP0 C;  3D0W A;  3MZW B;  3ABV C;  1SS1 A;  4RKU J;  3MK7 C;  1EQ7 A;  1OW7 A;  4C46 A;  1NU1 K;  1GL2 C;  4WQ9 A;  3A0B V;  1K8A Q;  3O6Q A;  1RZ5 A;  2WT7 A;  2FYU D;  3BAT A;  3PP5 A;  1FOC A;  3D71 A;  2N1T A;  1FI7 A;  5KTB A;  2KSE A;  2OYH A;  2M5A A;  5AW5 B;  4LC1 A;  1X8Y A;  5GTI H;  4JCG A;  1KB9 E;  1BCC J;  5C39 A;  3II6 A;  1QKS A;  2E74 B;  1SQB E;  1HJ4 A;  4WB4 A;  3L74 D;  5GTH E;  1BSN A;  1FCD C;  1CYC A;  3C8V A;  3RL0 g;  1GW3 A;  3MTU E;  4WY4 B;  2BPB B;  3L73 D;  1NGM B;  1CXC A;  1ZME C;  1RAQ A;  2M3E A;  2CA3 B;  1CXA A;  3WUI A;  2IZ1 A;  3CME P;  3B5N A;  1IO3 A;  2RKL A;  1SQP K;  1M56 D;  1C52 A;  2FFD B;  4KMG A;  1E79 H;  1VQN P;  5AW6 B;  2N9B A;  2LIT A;  3AE2 C;  3ZOX A;  1JY2 P;  1OMI A;  4IFF A;  1H32 B;  3CX5 I;  1YYC A;  4O1W A;  2PP6 A;  4HH2 A;  1HTL C;  5CHX A;  1J2J B;  2RMZ A;  2AEM A;  3H32 A;  1VPC A;  4WY4 C;  3L71 D;  1F1C A;  1K05 A;  4GED B;  1DII C;  1L4A A;  1VF5 C;  1GKS A;  1C6S A;  2KS1 B;  1GIW A;  2FFD C;  3VMY A;  4PJ0 H;  1QYZ A;  1HRC A;  3TGU D;  3WMM 0;  4KT0 J;  1OIP A;  1R5L A;  1S72 P;  1LTG C;  2C9X B;  5KLI B;  4BRY A;  1L0L D;  2CK3 H;  3A0H E;  2HR3 A;  1M60 A;  1GU2 A;  1AFO A;  3PXT A;  2ZFC A;  3CX5 D;  4D6T E;  3A0B H;  3HE5 B;  3MHV A;  3AEE C;  1FS0 E;  1IRV A;  2O01 J;  1AKK A;  2N1T D;  5AW1 B;  3OW2 O;  5KJ7 A;  1ZN5 A;  2QJY C;  4FAN A;  3WFC C;  1DX7 A;  1DW3 A;  3CP5 A;  2K9J A;  3RN0 A;  1Q86 Q;  5AW3 B;  3OCD B;  3IF4 A;  1S5L V;  1H8A A;  4FA4 A;  1RE4 A;  3TNU A;  1XTC C;  4OGQ D;  5APS A;  2E42 A;  3HQ8 A;  3H25 A;  2FYU E;  1G2C B;  3K5B A;  3HTK A;  3PLN A;  3BRV B;  1QL2 A;  1H0T A;  4FA9 A;  1LC1 A;  1JOC A;  1LMS A;  2H89 C;  1AOF A;  3VNW A;  1GD2 E;  3SWF A;  2KZJ A;  1GDV A;  1N73 A;  2V08 A;  1KYO H;  1BCC G;  1QX8 A;  1IFJ A;  1KD1 Q;  4JYB A;  5AW9 B;  1CI6 B;  1HUC A;  1PL5 A;  2CPS A;  2Q7C A;  2HPC B;  2K88 A;  3L74 E;  3VN0 A;  3R2P A;  1LTI C;  4IFM A;  2HFE D;  1QN2 A;  2B11 B;  1BGY J;  3L73 E;  1N2D C;  3U1A A;  1N7S B;  1K3G A;  2C2C A;  2KK7 A;  4NPE A;  1YIQ A;  1HZV A;  2OYI B;  2E75 C;  1UII A;  1MV8 A;  1C6O A;  2LXC B;  2Q6Q A;  1HJ3 A;  3TSI A;  3BCC D;  4CPG A;  3ORV A;  1LT9 B;  5TIS V;  3JBT B;  1R5S A;  3Q1M A;  3F5H A;  2OTJ P;  1IFI A;  5H2F E;  3AE8 C;  2D0W A;  3OA8 A;  3WFE C;  3L71 E;  1YQ3 C;  1GJQ A;  4QAO A;  3RK3 C;  1N7S C;  3CC4 P;  2WSF J;  1WRG A;  1CYI A;  1VL2 A;  5AVU B;  1MKM A;  5B5E H;  1OVV A;  1BCC D;  3CPW O;  3VP9 A;  5CJ0 A;  3CWB G;  3WUU A;  1VQK P;  5AVZ B;  3TGU E;  4EI2 A;  1FDO A;  1LT9 C;  2AI5 A;  2KIK A;  5C0Z A;  1L0L E;  5KLV G;  2QJK C;  1LGH B;  4JBZ A;  3NBT A;  1NTZ K;  3AE5 C;  1FOS F;  1C75 A;  3A0H V;  1NHL A;  1AV1 A;  2FXO A;  3Q3D A;  1H9X A;  2J59 M;  5APV A;  3CX5 E;  4C7R A;  5AW0 B;  1U74 B;  1CNO A;  5CBN A;  2FWL A;  1KB0 A;  1WVE C;  5GTI E;  4RO0 A;  3H1I J;  4OGQ B;  4AAO A;  3CU4 A;  1VQ8 P;  1JY2 N;  1NOH A;  1A56 A;  1JTH B;  1H33 A;  2JJL A;  5CIC B;  1ZZH A;  1MFZ A;  1VQ7 P;  1PPJ G;  1CRJ A;  3M9H A;  1CO6 A;  1PZQ A;  4UB6 H;  3L36 A;  1SQQ J;  3IR9 A;  1FU1 A;  2R5B A;  2NRG A;  1RZ6 A;  2YMK A;  3G3Z A;  5KAI E;  2QEX P;  1NIR A;  1YTZ T;  2PRR A;  3LW5 J;  4WQ7 A;  2KB7 P;  2WSC H;  3HUS B;  5DJT B;  3KQG A;  3PH0 A;  1HBW A;  2ZYG A;  2KOG A;  2JWD A;  2PFX A;  1YHQ P;  3HQ7 A;  4UB8 H;  2ZZS 1;  1QL3 A;  1HWT C;  1FJK A;  5TIS H;  4L74 A;  4EIE A;  2ORL A;  2AXT V;  2O3J A;  1LTJ C;  5CCH A;  1M90 Q;  2P10 A;  2FFD A;  5L8R J;  3NBS A;  4H44 D;  1NTM J;  1EXI A;  1JY3 P;  1OWA A;  2KLU A;  1CC5 A;  1JMM A;  1QL1 A;  3L73 J;  3TYI A;  1DW0 A;  3D6Y A;  3BCC E;  2A45 H;  3B4S A;  1OVR A;  2WSE H;  1GK6 A;  1IJD B;  1DIQ C;  3M91 A;  1PPJ D;  1GL2 D;  1AVO A;  1CHJ A;  2A06 G;  2KS1 A;  5AVQ B;  1KX7 A;  3SXT A;  2QJP B;  3A0B E;  1OW8 A;  1EDI A;  3SFD C;  1W2B O;  2ZT9 C;  1BCC E;  2BCC J;  3I56 P;  4NFG B;  2CE0 A;  3MIW A;  1RHZ B;  1EB7 A;  2WZ7 A;  3JSV C;  2KZI A;  1ETP A;  1FAV A;  4L3G A;  3H1K D;  1T3U A;  3M0A A;  3CCL P;  2H8P D;  1YEA A;  1YCC A;  2ZYA A;  1BGY D;  3HE5 A;  2BEQ D;  3TGU J;  1JY3 O;  1VQ4 P;  3L75 J;  2WIT A;  1CSV A;  2IDB A;  3AEA C;  1IRW A;  5BVZ A;  1RF0 A;  2E76 B;  1A2S A;  1OXZ A;  3OCD A;  1P84 H;  3A5T A;  1JM0 A;  3ZBM A;  5GTI V;  5BU8 B;  2MJZ A;  2K9Y A;  1CCH A;  2HLO A;  1CRH A;  3KZI H;  3V2Q A;  4WY4 D;  3V2P A;  2A06 D;  3HQ9 A;  2R44 A;  1G2C A;  3V4W A;  1VF5 D;  2WVR A;  1NAF A;  2RN0 A;  2BAS A;  2P67 A;  1QL4 A;  3G6E P;  3VP8 A;  2V7Q H;  3SSU A;  2GIW A;  1DD4 A;  2CA4 B;  1SQV J;  3CCS P;  3S4R A;  1U75 B;  1CI6 A;  3RLM A;  4B86 A;  2FYU G;  3PJS K;  155C A;  2R3C A;  1KC8 Q;  1VQ9 P;  3Q2Y A;  2JQR A;  1HH0 A;  1A02 J;  2I8F A;  3CYT I;  5AUR A;  2G8Y A;  3PH2 B;  2OZ1 B;  1L0N J;  1NTK K;  4J20 A;  1P84 I;  3B8E B;  4JYC A;  1Q82 Q;  2OYI A;  1CIG A;  1FJ0 A;  1DEE G;  1NKN A;  3SWS A;  2P1J A;  1NTM G;  1U7M A;  1K3H A;  3SVW A;  1GL2 B;  2DGE A;  3H1I D;  1C2N A;  3TK1 A;  1X0T A;  3L73 G;  3Q5P A;  4ZMD A;  2ZVO B;  2IBZ I;  1LT9 A;  1R8E A;  4PJ0 V;  1IFM A;  3SWK A;  3KDP B;  3ZIY A;  3WUT A;  3BRT B;  5CCG C;  2E5Y A;  1PPJ E;  3A2A A;  1X79 B;  1M70 A;  3BCC J;  3OJA B;  2YK3 A;  1SQQ D;  2H88 C;  2Q5U A;  1YIJ P;  1M6Z A;  3U59 A;  1RY3 A;  1AQT A;  2V4H A;  1AOQ A;  3LIE A;  2C9L Y;  1W2L A;  3L71 G;  1P84 D;  1FJP A;  3CXH I;  4DJG A;  1MG3 D;  2DW3 A;  4YTP C;  4WVZ A;  4EIC A;  3X39 A;  3H1K E;  1KX2 A;  1GK4 A;  1E29 A;  1NU1 J;  2W8Z A;  2IBZ D;  4WWI A;  1S4X A;  5AW8 B;  3HD7 C;  3H1H D;  1BGY E;  2MTA C;  3TGU G;  2IYP A;  1PP9 J;  3WUV A;  3G71 P;  2C0X A;  1NTM D;  1L0L G;  2E75 D;  2YXR B;  1JY3 N;  3NMD A;  3KHU A;  3FXE A;  4DY9 A;  1JTH A;  4R4M A;  4AQR D;  1VQP P;  4GKG A;  1VF5 B;  1NWQ A;  2DVH A;  3VMX A;  1FOS E;  1ZW0 A;  1M7L A;  1Y8A A;  1CCR A;  2ZAE B;  4OH8 B;  2SPZ A;  2A06 E;  3F89 A;  3RMZ A;  5TIS E;  3RK3 D;  1N7S D;  3CXH D;  2NZ2 A;  3HQ6 A;  3OA7 A;  2N9J A;  4GDO A;  3HUS A;  5K5G B;  1HCM A;  1SVF A;  3V4Q A;  1SQP J;  1SQX D;  5AVT B;  4FA5 A;  1HGZ A;  2VRS A;  2WTY A;  2JP3 A;  5AVX B;  2BCC D;  4I6M C;  1SQV G;  3CCQ P;  3CCJ P;  4TT3 H;  1GU5 A;  2OGU A;  3ZOW A;  1DVH A;  3MUD A;  2XU6 A;  1RF1 B;  1OFC X;  1CYJ A;  2I8D A;  1K04 A;  1H1O A;  1S1C X;  2IX7 C;  2N3B A;  2QJY B;  3KXD A;  3RN1 A;  2EXV A;  1DT1 A;  2AIU A;  3A7O A;  1IK9 A;  3O5C A;  1YTC A;  4HJG H;  3L75 D;  2WQY C;  5KLV K;  3DMI A;  1WEJ F;  4WQC A;  1KQL A;  2FRC A;  4ASW A;  5AVW B;  1GQ1 A;  1YIT P;  1HF9 A;  3H1I E;  1RE3 C;  3RBZ A;  4OWF A;  1EDL A;  2D2C C;  2LKM A;  1IFP A;  5B6Q A;  4C7N B;  5B5E V;  4LLH A;  2NPS C;  1RF1 C;  4YE1 A;  1JY2 O;  2N9Y B;  2BEZ F;  5E79 H;  1IZN B;  4N78 D;  2IYO A;  2JTI B;  2W83 C;  5IY5 1;  2PGD A;  3GF3 A;  3CX5 W;  5AVS B;  1ZOY C;  2B9B A;  3BCC G;  1SQQ E;  4IL6 H;  1HH7 A;  2ZBO A;  3A9F A;  1WMK A;  4I1L A;  1EDJ A;  1HJ5 A;  3M0D A;  4BXL A;  1FDI A;  3L35 A;  1FZE A;  1SQV D;  3RL0 C;  1ZRT D;  2V07 A;  3GHG B;  1P84 E;  2W27 A;  2UWJ E;  3KPE A;  4RSZ A;  2E75 B;  1I55 A;  1MZ4 A;  3QWO C;  5KAF H;  2WWW A;  2HYN A;  3I5C A;  1L0N D;  1NU1 G;  2IBZ E;  1J1D C;  1COT A;  5APT A;  3AE1 C;  3H1H E;  2ZYD A;  1M1J A;  1PP9 G;  2B87 A;  1CRC A;  3H1K J;  5APY A;  2AXT E;  4H0L B;  4UB6 V;  1NTM E;  1CHI A;  1NMI A;  1SQB K;  3KYQ A;  3GHG C;  1PGQ A;  3NWV A;  4AAN A;  2YKQ A;  3RK3 B;  2P2U A;  4H0J A;  2ZXX A;  4Y5R A;  4TLF A;  1IFD A;  4WBA A;  2WSC J;  3GMA A;  1TU3 F;  1YNR A;  4UB8 V;  5DFS A;  3RK3 E;  3CXH E;  2IFN A;  5DJQ C;  3CCM P;  4H0L C;  1DVV A;  4GYD A;  1ZV8 A;  1SQP G;  2ZT9 D;  1SQX E;  2FXM A;  2QJK B;  1Q90 D;  4IFD K;  3AEC C;  1FC2 C;  2QVA A;  1FZC C;  2BCC E;  1KYO I;  1FDM A;  1LTT C;  3NFQ A;  3M9B A;  2P58 A;  4AAM A;  4MU8 A;  2QM7 A;  5APX A;  1RQV A;  1SFC B;  2OZ1 A;  2HOD B;  1NU1 D;  2L4D A;  3VRD A;  3WU2 H;  2C1U A;  4IOI H;  1MFT A;  1PP9 D;  1OAE A;  4WQE A;  3L75 E;  2WSE J;  4U7J A;  2WPS A;  2L91 A;  1GL2 A;  4R4L A;  1FI3 A;  2PAJ A;  3H1J E;  1BDC A;  2R32 A;  1NO4 A;  2POH A;  1H89 A;  5AW4 B;  1R0Q A;  3USS A;  3G4S P;  1SFC C;  1IZL 0;  1CRI A;  5CIE B;  4N78 E;  1PIX A;  1T2K C;  1KYO D;  2BLF B;  3IAO A;  3IFM A;  1CIE A;  3RK2 B;  3GF7 A;  1H31 B;  3M06 A;  3V2N A;  1LWU C;  2MHM A;  1SQP D;  1URQ C;  4EIJ A;  1L2P A;  2E76 D;  1KIL C;  2BGV X;  1K9M Q;  2YO2 A;  3CMA P;  2QIW A;  1SQV E;  1QLE D;  3GW6 A;  1ZRT E;  3V5B A;  4L75 A;  3O20 A;  4DZO A;  3I55 P;  1LTJ B;  2QSI A;  4H0K A;  1IO4 A;  4XYD B;  3EFG A;  3P7K A;  1KB9 H;  3EWK A;  2OYH C;  4K35 A;  3H1L J;  2FYU K;  4HKZ H;  1I8O A;  1N90 A;  2O01 N;  3RK2 C;  2PCC B;  1LJ2 A;  1L0N E;  4FAV A;  3KZI V;  5GTH H;  1GTW A;  4WY4 A;  1ZXG A;  3H1K G;  1LTA C;  5DF5 A;  2KLV A;  2I1J A;  2YKO A;  2N18 C;  3H1H J;  1BGY G;  1KFM A;  1HJB A;  4XFJ A;  1T6A A;  4EID A;  1COR A;  1PGO A;  5EFW B;  1Q81 Q;  3ZOO A;  2V7Q J;  3VYI A;  3B5N C;  1AVY A;  2QG4 A;  4OVN F;  2BH5 X;  1HJ0 A;  4PJ0 E;  1S2E A;  2ZT9 B;  4GOE A;  4QMA A;  1H32 A;  4DCK A;  2JO1 A;  2YQB A;  3NXS A;  1CSW A;  1HVV A;  1I54 A;  4PV1 C;  2IPP A;  5CJ4 A;  2GB8 B;  1C2R A;  3L4F A;  1MUU A;  2YCC A;  1HGV A;  1L4A C;  3OAK A;  1AA0 A;  1SQX J;  5CIF B;  1KTM A;  4Q5P A;  3MP7 B;  2ZON G;  1LC2 A;  1Q2N A;  3HD7 D;  1NU1 E;  2C1D B;  1M57 D;  3CC2 P;  3C1L A;  2B0Z B;  1PP9 E;  2A45 G;  4EYY Q;  3Q5R A;  2K9J B;  1PV3 A;  1AJY A;  4JQ0 D;  5APQ A;  1BSH A;  3UIA A;  4HYT B;  4BWN A;  3TNU B;  5CMZ A;  5AW2 B;  3QH9 A;  1N15 A;  3O8Z A;  3L70 J;  1L0L K;  2A45 I;  4NPD A;  1YI2 P;  1YFC A;  3AEG C;  3H1J J;  1L9J C;  3L37 A;  1JO5 A;  3CCE P;  2ZOO A;  5KJ7 C;  1C7M A;  2LXB A;  3P8C D;  3H1I G;  1KYO E;  2XND H;  1EDK A;  1VQM P;  1FBM A;  2C1V A;  1CED A;  3FWL A;  3CCR P;  3D6Z A;  2E43 A;  1SQP E;  3GHG A;  1RE4 C;  1J1E B;  2R5D A;  3AEF C;  5B66 H;  1SP4 A;  2LR2 A;  2D0S A;  1USE A;  1SQQ G;  2W90 A;  2G3A A;  3PHL A;  1CIH A;  3H1L G;  1N73 C;  1U7J A;  2HPC A;  2CE1 A;  4GT1 A;  2B88 A;  3GG2 A;  2Q9I A;  3HE4 B;  3CD6 P;  1FHB A;  3SWY A;  1GMJ A;  2H43 A;  1FI9 A;  1J1E C;  5CIG B;  3VMZ A;  1N7S A;  2D2C D;  3CI9 A;  2IBZ G;  2NPS D;  1N86 A;  3H1H G;  2QE7 H;  2QRX A;  2OAR A;  3G9R A;  1FZG A;  4U3F J;  1JMB A;  4L73 A;  3E1R A;  5C9M A;  1BDD A;  3PXS A;  5B5E E;  3SLE A;  3TDK A;  1CTY A;  1NTZ D;  1NTK J;  2OQQ A;  2KXP B;  3R4Y A;  3VOP A;  2WPV B;  4W80 A;  5H2F H;  1BE3 J;  4GIF A;  1G1J A;  451C A;  5KKZ B;  3RL0 D;  4L76 A;  2FKW B;  2Q1K A;  1M1K Q;  2E5T A;  5DJU B;  1T3J A;  4MN4 C;  3HD7 B;  1SLQ A;  1JUN A;  5BU5 A;  2CPB A;  1SFC A;  4LGD E;  1A02 F;  1KV9 A;  1NJI Q;  1KZU B;  2HOD A;  1LTB C;  3AEB C;  1SQX G;  3NTN A;  3H1L D;  5CIH B;  3E7K A;  2BCC G;  3AE7 C;  2ITA A;  4I2L C;  1E8E A;  2YXQ B;  2B4Z A;  5E79 V;  3AE3 C;  2QM8 A;  1BL9 A;  2GA1 A;  4XE5 B;  3E1I A;  3N4X A;  3WFD C;  5KKZ C;  3L72 D;  4IL6 V;  4Y99 C;  1KN7 A;  1HZU A;  1H9Y A;  1DD3 A;  1CSB A;  2VHD A;  5CBO A;  3CX5 H;  4UB6 E;  3EFF K;  1CSX A;  3L75 G;  3L70 G;  4AUW A;  3H1J G;  1LS9 A;  3MD0 A;  1H31 A;  3P8C E;  4O9B A;  2Y0E A;  1VQ5 P;  3AE9 C;  1F1F A;  3ZOY A;  5KAF V;  4H0L D;  2KP8 A;  1ZR2 A;  4UB8 E;  2YKP A;  1LP1 B;  1WT6 A;  4L3H A;  1S9K E;  1LTJ A;  3M9Q A;  4YPC A;  1Y47 A;  5M1B A;  2M8R A;  1EXJ A;  3WC8 A;  4DT0 A;  1NAY A;  3PRJ A;  5KAI H;  1RH5 B;  1B7V A; 
#chains in the Genus database with same CATH homology
 4Y5R A;  3VYM A;  2B12 B;  1YNR A;  3CXH W;  1I8P A;  4EIE A;  2ORL A;  5KAI V;  2AXT V;  4FA1 A;  1HRO A;  4UB8 V;  5DFS A;  2O3J A;  4EIF A;  3OA8 B;  5DJQ C;  3M97 X;  3NBS A;  1DVV A;  2BCN B;  4GYD A;  1CIF A;  2QJK B;  1CC5 A;  3TYI A;  3TF5 A;  1DW0 A;  3L70 D;  4AAM A;  4MU8 A;  4WQ8 A;  1DIQ C;  3SJL A;  3H1J D;  1PPJ D;  2OZ1 A;  3MK7 B;  1OCD A;  1NU1 D;  1CHJ A;  2L4D A;  2KS1 A;  351C A;  4L1Q A;  3VRD A;  2C1U A;  4D6T D;  2KNC B;  1KX7 A;  1PP9 D;  1OAE A;  4WQE A;  1CRG A;  3SXT A;  2QJP B;  2FYN B;  1AYG A;  5CYT R;  2L91 A;  3WU2 V;  1FI3 A;  4O1Q A;  3DR0 A;  2B10 B;  4NFG B;  2CE0 A;  3PXW A;  1EB7 A;  1ETP A;  1R0Q A;  4L3G A;  1H33 B;  3H1K D;  1IZL 0;  1CRI A;  1YEA A;  3MK7 C;  3C2C A;  5CIE B;  1YCC A;  1DW1 A;  4WQ9 A;  3VMA A;  2C1D A;  3A0B V;  1KYO D;  2BLF B;  1C6R A;  2Y0C A;  1BGY D;  1RZ5 A;  2FYU D;  1CIE A;  1MG2 D;  1H31 B;  1FOC A;  1FI7 A;  1CSV A;  2MHM A;  3WFB C;  1SQP D;  1IRW A;  4JCG A;  2BGV X;  4FB1 A;  3L4O A;  1A2S A;  1QKS A;  4PWA A;  5TJH A;  3OCD A;  3GW6 A;  3ZBM A;  3O20 A;  1HJ4 A;  5GTI V;  3L74 D;  4H0K A;  4U3F D;  5DJQ B;  1CCH A;  4XYD B;  1FCD C;  1CYC A;  1CRH A;  4A7P A;  2A06 D;  4P4Q B;  3HQ9 A;  2BPB B;  3L73 D;  1I8O A;  1N90 A;  1CXC A;  2PCC B;  1RAQ A;  2RN0 A;  1DW2 A;  2CA3 B;  1CXA A;  3WUI A;  1NTK D;  4FAV A;  3KZI V;  1YEB A;  1QL4 A;  1IO3 A;  1BE3 D;  2GIW A;  4PD4 D;  2N9I A;  1C52 A;  4KMG A;  4PW9 B;  5DF5 A;  2CA4 B;  5GTH V;  1U75 B;  3RLM A;  2N18 C;  2LIT A;  3ZOX A;  4EID A;  155C A;  1COR A;  1H32 B;  4O1W A;  3ZOO A;  2QG4 A;  2RMZ A;  2BH5 X;  4XXL A;  1VYD A;  3L71 D;  5EXQ A;  3PTZ A;  2JQR A;  2I8F A;  3CYT I;  5AUR A;  3PH2 B;  1F1C A;  1H32 A;  2OZ1 B;  4GED B;  1DII C;  4J20 A;  1GKS A;  2JWA A;  2YQB A;  1J3S A;  1C6S A;  1CSW A;  1CIG A;  1GIW A;  1FJ0 A;  1EZV D;  3SWS A;  1I54 A;  1QYZ A;  1HRC A;  1K3H A;  3SVW A;  2DGE A;  2GB8 B;  3H1I D;  1C2N A;  4RJT A;  1C2R A;  1CSU A;  3TGU D;  2YCC A;  3O1Y A;  4PJ0 V;  2C9X B;  5KLI B;  1L0L D;  3ZIY A;  5CIF B;  4Q5P A;  2PAC A;  2ZON G;  1M60 A;  1LC2 A;  1GU2 A;  3PXT A;  1M70 A;  2C1D B;  2YK3 A;  3CX5 D;  1SQQ D;  1M6Z A;  1IRV A;  2GC7 D;  2B0Z B;  4K3I A;  2K9J B;  1AKK A;  1B7V A;  1AOQ A;  4FAN A;  3WFC C;  1W2L A;  1DW3 A;  3CP5 A;  1P84 D;  1N15 A;  3RN0 A;  3OCD B;  2PCB B;  1MG3 D;  1I5T A;  1S5L V;  4FA4 A;  1YFC A;  4EIC A;  3X39 A;  4WQB A;  1L9J C;  1KYO W;  1KX2 A;  2ZOO A;  1E29 A;  1C7M A;  1NML A;  1NNO A;  2IBZ D;  3HQ8 A;  2LIR A;  2N18 B;  3H1H D;  2MTA C;  3PLN A;  2CXB A;  2C1V A;  3L4M A;  4FA9 A;  1LC1 A;  1NTM D;  3DP5 A;  1CED A;  4EDF A;  3FWL A;  1LMS A;  1AOF A;  3VNW A;  3KHU A;  4WQA A;  1GDV A;  2V08 A;  4DY9 A;  2D0S A;  3ZCF A;  2DVH A;  1I6E A;  5B66 V;  1CCR A;  3CWB D;  2Y0D A;  1QN2 A;  3RMZ A;  2B11 B;  3PHL A;  1CIH A;  3CXH D;  2CE1 A;  1K3G A;  3O0R C;  2C2C A;  3HQ6 A;  3GG2 A;  2N9J A;  1YIQ A;  1HZV A;  1HCM A;  5KLV D;  4WQD A;  1LFM A;  1SQX D;  1FHB A;  4FA5 A;  1CTZ A;  1C6O A;  1FI9 A;  1HJ3 A;  2GC4 D;  2BCC D;  5CIG B;  3BCC D;  3ZOW A;  1DVH A;  3ORV A;  2Q3E A;  5TIS V;  3JBT B;  1CYJ A;  1E2R A;  5C9M A;  1H1O A;  2N3B A;  2QJY B;  2D0W A;  3PXS A;  3SLE A;  3OA8 A;  2EXV A;  1DT1 A;  2AIU A;  3RN1 A;  3WFE C;  1CTY A;  3TDK A;  1NTZ D;  1GJQ A;  4QAO A;  3O5C A;  1A8C A;  1W5C T;  1YTC A;  1JDL A;  1IQC A;  3L75 D;  2XTS B;  1CYI A;  3DMI A;  4AX3 A;  1WEJ F;  4WQC A;  4V2K A;  2FRC A;  1BCC D;  451C A;  5KKZ B;  1CHH A;  3ITK A;  1GQ1 A;  4LJI A;  5H2F V;  5B6Q A;  5B5E V;  2ZXY A;  2AI5 A;  4YE1 A;  1N9C A;  1KV9 A;  4AAL A;  5C0Z A;  2N9Y B;  1KIB A;  2JTI B;  3H1L D;  3NBT A;  5CIH B;  5IY5 1;  3CX5 W;  1C75 A;  3A0H V;  1E8E A;  1H9X A;  2B4Z A;  5E79 V;  1HH7 A;  2ZBO A;  3A9F A;  1CRY A;  1BL9 A;  1U74 B;  1HJ5 A;  1KB9 D;  1CNO A;  5CIB B;  3WFD C;  3L72 D;  1SQV D;  2C8S A;  2FWL A;  1KB0 A;  1WVE C;  4IL6 V;  1ZRT D;  2V07 A;  1SQB D;  1YIC A;  1HZU A;  3CU4 A;  1H9Y A;  4AAO A;  1CTJ A;  2VHD A;  1A56 A;  1H33 A;  1S6V B;  4N0K A;  1CSX A;  5CIC B;  1N50 A;  4RSZ A;  1ZZH A;  1I55 A;  1MZ4 A;  1LS9 A;  1CRJ A;  1L0N D;  1H31 A;  1CO6 A;  2Y0E A;  1COT A;  2BH4 X;  1F1F A;  3ZOY A;  1RZ6 A;  5KAF V;  1CRC A;  2YIU B;  1NIR A;  4UB6 V;  4WQ7 A;  1CHI A;  1NMI A;  5CID B;  4L3H A;  1RAP A;  1L9B C;  3NWV A;  4AAN A;  2N3Y A;  3WC8 A;  2HV4 A;  4H0J A;  3PRJ A;  3HQ7 A;  1I6D A;  2ZZS 1;  1QL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...