1KB9D

Yeast cytochrome bc1 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
246
structure length
246
Chain Sequence
b'MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
molecule tags Oxidoreductase/electron transport
source organism Saccharomyces cerevisiae
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
total genus 70
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1kb9D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1kb9D01
4L3HA 2K9JB 2FYNB 2CA3B 4P4QB 2B12B 4EIEA 3O20A 3PTZA 4U3FD 4Y5RA 3L75D 1DW0A 1NNOA 3KZIV 5CIDB 4RJTA 1CRHA 3MK7B 2GC4D 3TDKA 1LMSA 1U75B 2JWAA 1CO6A 1C2RA 1H31B 5E79V 3KHUA 2ORLA 1QL4A 1OCDA 1BCCD 4XXLA 2N9YB 3CX5W 3X39A 4FAVA 1MG2D 2C1DB 1FI9A 3DR0A 2BH4X 1GU2A 3HQ6A 5KLIB 5KKZB 2V07A 1MG3D 1DW2A 1QYZA 4GYDA 2JQRA 1H33A 1NU1D 2QJKB 2B11B 3A0BV 1CHJA 4H0KA 1RAPA 1N50A 5B66V 3ZCFA 1NTMD 4EIDA 2EXVA 1ZRTD 1YTCA 2C1VA 1BE3D 1BGYD 2LITA 1CSUA 5B5EV 1H31A 4WQ9A 2AXTV 1L0ND 5DJQC 3HQ9A 3TGUD 2C8SA 4A7PA 3L71D 4K3IA 4D6TD 1CSXA 2B4ZA 3OCDB 2Q3EA 2N3BA 4MU8A 1OAEA 1K3GA 3ZOOA 1PPJD 5KAFV 1N9CA 1H32B 2L4DA 5H2FV 1FI7A 1SQXD 2N18B 1HH7A 3SXTA 1K3HA 3SLEA 2C1UA 1F1CA 2BPBB 3CU4A 3PXWA 1M6ZA 1HZVA 1GJQA 2O3JA 1I8OA 1ZZHA 3ORVA 1H9YA 2AIUA 1IO3A 2QJYB 3VYMA 5C9MA 1FHBA 2CE1A 2HV4A 2D0WA 1I55A 2PCCB 1HROA 5CIEB 5B6QA 1QL3A 2KNCB 3PXTA 4WQBA 4WQAA 1YIQA 1GIWA 3C2CA 3SJLA 3H1HD 3DMIA 3H1JD 3GG2A 1WVEC 5CIBB 4FA1A 2CA4B 1DVHA 1CYJA 1S6VB 1B7VA 2N3YA 1RZ5A 1ETPA 3FWLA 3OA8A 1C52A 1KYOW 1COTA 2KS1A 1H33B 3H1KD 1CTYA 1NTKD 2YCCA 3PLNA 5CICB 4L1QA 1SQPD 1CHHA 5GTHV 3HQ8A 5CIHB 1WEJF 2BCCD 1C7MA 1H32A 5C0ZA 1RZ6A 5TISV 1HZUA 2N9JA 1I6DA 1CCRA 1YEAA 1CRYA 2I8FA 2DGEA 2XTSB 3A0HV 3WFBC 1SQVD 3PXSA 1NTZD 5KLVD 3ZOYA 5TJHA 1E29A 4V2KA 4EDFA 3O1YA 1I5TA 2IBZD 3ZBMA 3CWBD 1HCMA 1CORA 1CTJA 4DY9A 1KYOD 1C2NA 4WQ7A 3L72D 1NIRA 4FB1A 3RN0A 2N9IA 4FANA 2BGVX 3L70D 1I8PA 4AX3A 2GIWA 4GEDB 4AAOA 1HRCA 1KB9D 1CSWA 1FJ0A 2C9XB 2OZ1A 2MHMA 2RMZA 1SQBD 3CXHW 3O0RC 1KB0A 1L9JC 3JBTB 1CHIA 2C2CA 5CIGB 3HQ7A 1C6RA 1FOCA 4Q5PA 4FA9A 1KV9A 351CA 3TYIA 4AAMA 2BCNB 5KAIV 4UB8V 4EICA 4AANA 1A2SA 1LC1A 5EXQA 1AOQA 3DP5A 2ZOOA 1I6EA 1N90A 1VYDA 3L4OA 1NMIA 4J20A 4PD4D 1QKSA 1IZL0 2L91A 1IQCA 1DT1A 1CYIA 1F1FA 3MK7C 4FA4A 2RN0A 3O5CA 1KX7A 1AKKA 3H1LD 1S5LV 3SVWA 4XYDB 4PJ0V 1HJ3A 3NBTA 3A9FA 1LFMA 3RMZA 3PHLA 4EIFA 2Y0EA 2FRCA 4PW9B 2B10B 155CA 3WFDC 2YK3A 4LJIA 5DJQB 1CEDA 1I54A 2Y0CA 1N15A 1CCHA 1DW3A 3ZOWA 3ZIYA 1W5CT 3PH2B 3ITKA 2LIRA 3RN1A 1R0QA 4UB6V 4RSZA 1A8CA 3L74D 3NWVA 3RLMA 1C6OA 2AI5A 1CRCA 2QJPB 5DF5A 1EB7A 1GQ1A 1W2LA 3M97X 2Y0DA 1A56A 2B0ZB 1U74B 4AALA 1CYCA 4WQCA 1CIEA 2MTAC 1CXCA 1YFCA 1P84D 2FWLA 2ZONG 1E2RA 5CYTR 2OZ1B 4N0KA 1CNOA 1H9XA 1EZVD 1BL9A 2CE0A 1GKSA 1AOFA 1IRVA 2DVHA 1DIQC 1SQQD 3CP5A 4IL6V 2GC7D 2QG4A 3OA8B 451CA 2BLFB 1LC2A 1M60A 1RAQA 3OCDA 4WQDA 1KX2A 1DVVA 4QAOA 4KMGA 1CRJA 1YCCA 1E8EA 1CSVA 2YIUB 1YICA 1HJ4A 4FA5A 3L73D 1L0LD 1CRGA 1LS9A 3VNWA 3L4MA 1JDLA 1YEBA 2A06D 2PACA 1FCDC 3WUIA 2GB8B 3WU2V 2ZZS1 3VMAA 1YNRA 4O1WA 1CTZA 2VHDA 3PRJA 3NBSA 1FI3A 1L9BC 2ZBOA 3WFCC 5DFSA 1CIGA 1HJ5A 2D0SA 4PWAA 2JTIB 3CYTI 3GW6A 2V08A 4L3GA 1C75A 1CIFA 3H1ID 3WC8A 5GTIV 1PP9D 3WFEC 1MZ4A 2C1DA 4WQEA 4YE1A 2PCBB 1CRIA 2ZXYA 4NFGB 1M70A 5CIFB 1CC5A 3BCCD 1IRWA 3SWSA 1DW1A 1C6SA 1J3SA 1NMLA 4H0JA 2FYUD 3CXHD 3ZOXA 3TF5A 2CXBA 1QN2A 4WQ8A 1H1OA 5IY51 2BH5X 4O1QA 4JCGA 5AURA 1KIBA 1CXAA 3CX5D 1AYGA 1GDVA 3VRDA 1CIHA 2YQBA 1DIIC 2N18C
chains in the Genus database with same CATH superfamily
4P4QB 4WY4C 1FOSF 3HD7A 3KDPB 2YIUC 2I1KA 2B9BA 2MJZA 1AVYA 1DW0A 1JB0J 3VMYA 1X22A 4C7NB 1KMIZ 2AXTE 4OVNF 2OYIA 3BCCG 2FYNC 3CMEP 4Y99B 1BE3E 2FYUG 5GTHH 1LT9B 1NGMB 1JCDA 1C2RA 1QEXA 1H31B 1IFNA 5TISH 1BCCD 4XXLA 2KIKA 1OW7A 3X39A 1NTKK 4FAVA 1T3UA 3RBXA 4NPDA 3II6A 3L71G 1YTZT 1VF5C 2JWDA 4GYDA 2BCCJ 2JQRA 4IL6E 3WU2E 3H1HG 4OGQD 3O6QB 1N73A 3L75G 2C9LY 3T97A 1OW8A 3AE3C 1EDLA 5B66V 3ZCFA 1YQ4C 3A0HE 1YTCA 1OVRA 4CPGA 5B5EV 3WMM0 1LNQA 1QX8A 1GL2D 2P1JA 5AW4B 3TGUD 2WVRA 2W6BA 4ZKPA 4NPEA 5BU5A 1CSXA 3H1JE 4K35A 4MU8A 4AQRD 5CJ4A 2GM4A 5AW6B 4DZOA 1NU1G 1SQXD 2N18B 3OA7A 3L70E 3P8MC 1NH4A 5B5EE 3WUUA 1HGVA 3EFFK 3SLEA 2HG5D 2BPBB 3TSIA 1QL2A 1HF9A 3CCQP 1SQXJ 1GJQA 3L70G 5AVTB 2A45I 3H1IE 3M9QA 3A5TA 4H0LD 3ORVA 1ZV8A 2QJYB 2E5TA 2CE1A 4KHXA 1LTIC 1ZW0A 3HUSB 3HRNA 3LIEA 1HGZA 2E75C 4WQBA 3V2PA 3IF4A 1VQOP 5KTBA 3GG2A 1WVEC 5CIBB 2K1AA 3L36A 3RL0B 2W83C 2FBWC 1URQA 2YKOA 4XA4A 1RZ5A 1JO5A 3OA8A 2GA1A 1NTKD 1L4AB 5CICB 1BGYG 1WEJF 1L0NG 2NPSD 2BCCD 3H25A 1C7MA 1H32A 5E79H 5CCHA 1HZUA 1N86A 3P8CD 3TK1A 1SFCB 5CBNA 1VL2A 2DGEA 2XTSB 3A0HV 2FYUK 3KQGA 4N6JA 1AQ5A 5TJHA 2AEJA 1CW5A 4V2KA 4EDFA 2WSFJ 1KN7A 1SQXG 1NTZJ 2H8PD 3ZDMA 3ZBMA 1SFCC 2K88A 3FXEA 4IL6H 1M57D 1CORA 1CTJA 3OJAB 4WY4D 1N8RQ 2PGDA 1NIRA 2C0WA 3BCCE 2W6JH 3L70D 3L74G 4AAOA 2QA4P 2ITAA 1FJ0A 4L76A 2O1JA 1USEA 2HODB 1KV4A 2RMZA 1KB0A 1LTJC 1ZR4A 3JBTB 1IFJA 1CHIA 1J1DB 1MUUA 3VMZA 4H44C 2UWJE 3H32B 4Q5PA 1LTJA 1AFOA 1NTZG 2QEXP 2WTYA 2QE7H 351CA 3U59A 1OXZA 1YHQP 2BCNB 4I6MC 1WT6A 2FYUJ 1LC1A 1KZUB 1SQQG 2FFDA 2B89A 1AQTA 3U1AA 3L4OA 3KPEA 3L72G 4PD4D 1NTKG 1FJPA 1ZOYC 1IQCA 1U7JA 5AW7B 1JNMA 3W67A 1DT1A 1SQVJ 1CYIA 5GTIH 2BCCG 1JY3O 4FA4A 2RN0A 4UB6E 1OVUA 2N1TA 1PPJE 3S9OA 1HJ3A 4EIFA 2FRCA 1NAYA 2V4HA 3WFDC 3FXDA 1FC2C 1L2PA 2HPCA 4GOFA 2ZXXA 3ZOWA 1W5CT 3ITKA 2SPZA 5CMZA 1RF1B 3RN1A 1R0QA 4UB6V 4RSZA 2BASA 3L74D 3RLMA 3OAKA 5AVSB 4Z1MH 1C6OA 2AI5A 4N78E 1Q81Q 2OYIB 1ZRTE 1JY2O 2QJPC 2JKVA 1N2DC 5DF5A 2FFDB 3V2QA 3LW5H 2O01N 2B0ZB 1URQC 1CYCA 2FXOA 2CK3H 2HYNA 1SQBK 2KK7A 4DCKA 1E2RA 1DH3A 4ZKUA 4Y28J 1CNOA 3D6YA 3Q5SA 1FZCA 1FZCB 5AVRB 2DVHA 1DIQC 1NJIQ 1T2KC 1EXJA 1SQQD 1SQPE 451CA 2PAJA 2BLFB 2R3CA 1M60A 1L4AA 1KX2A 1DVVA 4QAOA 2YIUB 1OWAA 1VQ8P 1KFNA 3R4YA 4RO0A 3TGUJ 5CCGD 4C7NA 3AE7C 3L72E 1MZ9A 4W7YA 1RF0A 2R3SA 2J59M 1G2CB 4O1WA 1T6AA 4HYTB 3V2RA 2KXPB 4U7JA 1SQPK 1CTZA 4AUWA 1NTKE 1HUCA 2WMMA 5DFSA 5GTHE 2D0SA 1LTTC 5B5EH 2JTIB 3GW6A 2W27A 2AXTH 4HH2A 4Y99C 2KSJA 2I8DA 5CCGA 4C46A 2ZFCA 3L35A 4EIJA 1ZXGA 1PP9D 1NVOA 3CC2P 1KFMA 1MZ4A 2OYHB 4N78D 1VQKP 3HD7C 1NU1E 5C39A 1L4AD 1S9KE 1BSNA 2Q3IA 1RF1C 1EZVG 1SS1A 3L74J 3SWSA 1DW1A 1NMLA 1IFPA 3CXHD 3ZOXA 1NTZK 1QN2A 4WQ8A 1RQVA 5IY51 2BH5X 1OFCX 1T3JA 3K5BA 3HE4A 3KXDA 1HWTC 3MIWA 3CX5D 2E75B 1RE4A 2OYIC 1CIHA 3JC22 5DJTB 4L3HA 2FYNB 3O20A 1VQPP 3PTZA 4U3FD 3V6IA 1LT9C 1NKNA 1KB9E 5TISE 4W7ZA 2IYOA 1EDKA 3AEDC 1FU1A 1Z56A 1KB9H 2GC4D 3TYYA 1NTME 1RE3C 1YJNP 1S2EA 2KZIA 2YO3A 1U75B 4H13C 2YMKA 2B87B 5KAIE 1L0NJ 4OH8B 2ZT9D 1QL4A 2N9YB 3CD6P 3QH9A 2E42A 2C1DB 3G6EP 2FYUE 3C8VA 3LIDA 1FI9A 1FS0E 3PP5A 2BH4X 1GU2A 1EZVE 4IFMA 3WUVA 1L4AC 5AW2B 1LTAC 1PP9G 2V07A 1MG3D 1HH0A 4D6TG 2BEZF 1BCCE 3B5NA 3A0BV 2ZT9B 1EQ7A 1EDJA 4BRYB 1RAPA 4KT0J 1N50A 3TGUE 5KJ7A 1NTMD 3IFMA 1ZRTD 1BE3D 1CSUA 4OGQC 1FE6A 2C0XA 1S4XA 1IK9A 1GK6A 2KYVA 2IX7C 3RK2B 4HB1A 4JPZB 4XE5B 1J2JB 1NTMJ 1KQSO 4KJMA 3OCDB 2N3BA 3G4SP 4C7RA 4LLHA 1PPJD 5KAFV 2KZJA 5AVYB 2L4DA 3VP8A 2R5BA 1FI7A 2O1KA 2MKVA 1SQBJ 3SXTA 1IO4A 3H1KJ 2V7QJ 1F1CA 3CU4A 1SQPG 2O3JA 1I8OA 2H43A 1QL1A 2ZVOB 1H9YA 5C9MA 2JEEA 1S5LH 2RH0A 3HUSC 2B87A 2PCCB 3SWFA 1HROA 2ZYGA 1KILD 1GIWA 2WWWA 3C2CA 3SJLA 3H1HD 3DMIA 5KJ7C 4H0LB 1CYJA 1B7VA 2N3YA 2YKQA 4GODA 1ETPA 1SP4A 4UB6H 1C52A 2KS1A 1CTYA 1FJKA 1CHHA 3RK2C 5CIHB 3F5HA 5TISV 2HODA 3A2AA 3E1IA 2N9JA 5KLVK 1CRYA 3H1LG 4YTPC 2I8FA 3AEFC 4DOJA 1LTGC 3PXSA 1PPJG 5KLVD 1FZBA 3CX5H 2GUSA 1PFIA 3P7KA 1KYOD 1XTCC 2N9IA 2BGVX 4BWNA 4O9BA 1U7MA 4GEDB 2I1JA 1HRCA 1VF5D 2WSCH 1CI6A 3AE8C 2A45G 1PGQA 2LXBA 4U3FE 1YQ3C 2YXQB 3C9IA 3FGAD 4OWFA 1FDOA 3CXHW 3O0RC 1AA0A 5CIGB 2ZAEB 3HQ7A 4YPCA 1FOCA 5BU8B 1KV9A 4AYCA 2QM8A 1SQBE 4EICA 4AANA 2OARA 1YYCA 1DIPA 2ZOOA 4RESB 1I6EA 1NMIA 1RE3A 1W2BO 2QVAA 2JDIH 1JOCA 5KLVJ 1MV8A 1LP1B 2A45H 2JJLA 4EOTA 2J58A 3HUSA 5AW5B 3HE5A 4HJGH 1WRGA 1S5LV 4GKGA 3SVWA 2K9JA 5CCGC 5AVWB 1S72P 2KOGA 3H1IJ 3VTPC 2A06G 4PW9B 3MGNA 1SQXE 2P2UA 2YK3A 3C1LA 1CEDA 2PP6A 1N15A 1RF0C 1BGYE 4H0LC 1R8EA 3ZIYA 1FZFA 4ASWA 2AEFA 2J5UA 3NWVA 3H1JJ 3HD7D 1JTHA 2QJPB 1VQ4P 3AEAC 1LTJB 1GQ1A 3AE6C 3L73G 2Y0DA 1LJ2A 3Q5RA 3CWBE 1CXCA 5CBOA 4H44B 2FWLA 1L0NK 3SWYA 3UIAA 2CPSA 2E5YA 1GZLA 1BL9A 3A3YB 1SQPJ 3D70A 1GKSA 1AOFA 2Z5HA 1IRVA 5AVZB 1OVVA 5DJUB 1D7MA 2QG4A 3OA8B 4ZMDA 5KJ7D 4WQDA 4R4LA 2E74B 4B86A 3H1IG 3IN6A 1L0LE 3B4SA 3V5BA 1E8EA 1CSVA 2Q9IA 2IDBA 1YICA 4EI2A 3CC7P 3D0WA 4K3AA 1T2KD 1X8YA 1LS9A 1KB9I 3VNWA 1FCDC 1GU4A 3WUIA 3GF3A 4JYBA 1BE3J 3L75J 5APYA 1GW4A 1Q90D 4H13D 1SVFA 2BCCE 2N1TD 3PRJA 3NBSA 1L9BC 3M0AA 1HJ0A 4PWAA 2ZT9C 3CYTI 3HTKB 1C75A 1NU1J 1ZN5A 2W6AA 1K73Q 1NOHA 2M0BA 1EC5A 3S4RA 4JF7A 4WQEA 1W5CE 4YE1A 3NXSA 1DD3A 5AVXB 3GHGA 3EWKA 2FFDC 2WSEH 4NFGB 4I7ZB 1M70A 1KYOE 1CC5A 4D6TE 3CLQA 3RK3D 1J3SA 2FYZA 2FYUD 1RF1A 4PD4E 2CXBA 5AVVB 2E74C 1AJYA 1PP9J 2JR8A 2WPQA 3CX5E 4I7ZC 3VP9A 2ZXEB 1QVGO 1S3JA 5AURA 2ZYAA 2DW3A 1GDVA 1CZQA 2YQBA 2N18C 2K9JB 2K37A 2XDJA 5AW8B 2B12B 4EIEA 1L0LK 1U57A 4Y5RA 3MUDC 1NNOA 1KQGB 3KZIV 4GDOA 1CRHA 1P84I 3MK7B 1L0NE 1FOSE 2NPSA 3MTUE 2KSEA 1CO6A 1Q2NA 2OYHA 3KHUA 3AEEC 1OCDA 4WWIA 3CX5W 4W80A 4IFDK 3T97B 1MG2D 1Y8AA 1BSHA 2OTKE 3DR0A 1NU1K 3HQ6A 5KLIB 4EYYQ 3A0HH 1DW2A 1URQD 3B71A 3HTKA 1QYZA 1GTWA 2QRXA 1H33A 1X79B 4DJGA 3JCUE 2QJKB 2B11B 3A0BE 2Q7CA 1FAVA 3WU2H 2LR2A 3RK2D 1H88A 2XZRA 3QWOC 5AVQB 1J1EC 1EZVI 4QMAA 3U1CA 4EIDA 3L37A 2C1VA 4PV1C 1A02J 1R5SA 1XTGB 4WQ9A 4WVZA 2W90A 4OGQB 4JQ0D 4HKZH 1BCCG 3HQ9A 4M3LA 3EQ2A 4A7PA 3L71D 4L74A 1KILE 3BVHA 4D6TD 2B4ZA 5APUA 5APVA 4TT3H 3H1JG 5M1BA 3CCJP 5H2FV 5KAIH 3HD7B 4UB8H 3CWBG 2JO1A 1HH7A 2QJYC 4IOIH 4GIFA 2WZ7A 3IR9A 3BASA 3BRTB 1NTMG 3PXWA 3AE2C 3FWNA 2Z4EA 1ZZHA 1BCCJ 1H8AA 1IO3A 1FHBA 1SLQA 4JYCA 1QLED 2HV4A 2D0WA 2P67A 1I55A 3PH0A 2HFED 2YXRB 3GHGB 5CIEB 4MN4C 1QL3A 4RKUJ 4WQAA 1VQ5P 4FA1A 2A06E 2CA4B 1DVHA 3L71E 1S6VB 1ZP0C 1KILA 1KYOW 1H33B 3H1KD 2WSFH 2M5AA 2AEMA 1BE3G 3CXHI 3VN0A 4TLFA 1Q86Q 2IZ0A 5C0ZA 1RZ6A 3MUDA 2N1TB 2ZYDA 1YTZI 3CX5I 2Q1KA 1VQ6P 2BEQD 3WFBC 1SQVD 2K9YA 3H1HJ 1NTZD 3ZOYA 4L75A 3O1YA 2IBZD 3JCUH 1PV3A 1PGJA 1JTHB 1SFCD 3L72D 1S5LX 3RN0A 3L74E 4LC1A 3CCLP 4WY4A 5B66H 1S5LE 3H1KE 3D6ZA 1I8PA 3M91A 2GIWA 1KB9D 2D2CB 1CSWA 4ASVA 2C9XB 3D71A 2MHMA 1SQBD 1RE4C 2P7JA 2WITA 2B88A 2VRSA 3HE4B 1VDFA 4N3YB 2GUVA 1C6RA 4FA9A 2Q6QA 1Y9BA 1SQQK 2KLUA 2E76D 2OGUA 4AAMA 3B5ND 5KAIV 1OZHA 2K3RA 1A2SA 5EXQA 1AOQA 3L73J 1N90A 2CPBA 4J20A 3WUTA 1QKSA 2L91A 2HPCB 1F1FA 1K04A 1IJDB 3H1LD 2WT7B 4PV1D 3RMZA 2Y0EA 1M1JB 3V4QA 1NWQA 1N73C 2LXCB 1LT1A 5KLVG 1M7LA 4I1LA 2IBZG 1ZMEC 2KS1B 1CCHA 1DW3A 3VYIA 3SFDC 3L72J 1URQB 5AVUB 2AXCA 2KLVA 1A8CA 2H88C 2IPPA 3R2PA 1VQ9P 4UB8E 5APQA 1X0TA 5EFWB 1VPCA 4L73A 1FDIA 1EB7A 3M9BA 4IL6X 3Q3DA 5KAFE 1A56A 1MKMA 3RK3C 1U74B 4AALA 4WQCA 1CIEA 2P10A 2ZJSE 3CI9A 1P84D 5E79E 3JSVC 2E74D 3AE1C 2ZONG 2OZ1B 4N0KA 1GDTA 5AW1B 3VOPA 1M1JA 1G1JA 1JMBA 2WPRA 1IFMA 3AEBC 2GC7D 2KP8A 1PL5A 1LC2A 1RAQA 3OCDA 3SFEC 4KMGA 5AW9B 3USSA 3W68A 2G3AA 3L73E 1N7SB 1DEEG 1GD2E 3E7KA 2WSEJ 1KTMA 1NAFA 1HJ4A 3L75E 4FA5A 1L0LD 1CRGA 1GU5A 3L4MA 2A06D 1IFDA 3H6PA 3L4FA 3WU2V 5KLIC 2NPSB 5GTIE 3RK3E 3VMAA 1YNRA 1J1DC 1NHLA 2PRRA 5CCHC 3E1RA 1UIIA 1FI3A 1LWUB 2ZBOA 1LWUC 1KQLA 1HJ5A 3H32A 2YNYA 1SQQJ 1KYOH 3AECC 2OYHC 2V08A 1YITP 1KILB 1CIFA 3FX0A 1KQFB 3H1ID 3RK3B 3RL0D 5APWA 3WC8A 5GTIV 1CI6B 1IZNB 2G8YA 2N1TC 2POHA 2WSSH 1AVOA 1HTLC 3I5CA 3RGUA 2C1DA 3CWBJ 2ZXYA 1BDDA 2E75D 3BCCD 1PGPA 2KB7P 1IC2A 1L0LJ 1E5WA 4PD4H 1Q7YQ 1ZLLA 4O1QA 2YO2A 4JCGA 1P84E 4LGDE 1M8OB 1KIBA 2H7HA 1FZEA 1AYGA 3I55P 3VRDA 1DIIC 3S1KA 3P8CE 2CA3B 2NPSC 3HE5B 2V7QH 3PJSK 3AE4C 1KC8Q 3L75D 2C9NY 5CIDB 4RJTA 1NTZE 2HLOA 2L5GB 2O01J 3TDKA 1YI2P 2WPSA 2XU6A 1KORA 1LMSA 2JWAA 3ABVC 2IFNA 1PIXA 1JY3N 5E79V 2ORLA 3CXHE 3TGUG 1FZAA 1Q82Q 1JM0A 3CCMP 1JMMA 5KKZB 1IFIA 2YKPA 1LTBC 1HJBA 3NTNA 3Q2YA 4IFFA 4WB4A 3GHGC 1NU1D 2Z5IA 5APTA 2M5AB 1CHJA 4H0KA 5KKZC 2P58A 1E79H 5APSA 4H44D 5KLVE 2EXVA 3V4WA 3CCVP 1WMKA 3GMAA 3CL3D 2NRGA 2QJKC 1BGYD 2LITA 2OYOA 3CXHH 1H31A 1H0TB 2AXTV 1L0ND 5DJQC 2KI7B 1N7SA 1NYHA 1GW3A 2C8SA 1NO4A 1SQVK 3BRVB 4K3IA 3AEGC 2Q3EA 3H1HE 1OAEA 1K3GA 3ZOOA 1FBMA 1K8AQ 1N9CA 1H32B 1OX3A 3MZWB 4U3FJ 1SFCA 3LW5J 3CMAP 1GL2B 2NZ2A 1QGKB 1GMJA 1K3HA 1YJ9P 2C1UA 1FZGA 1G1IA 1M6ZA 1HZVA 2LKMA 5CCHD 4XFJA 4GT1A 5APXA 2E43A 2AIUA 3VYMA 1N7SC 1JY3P 1LT9A 4PJ0H 2FKWB 2E76C 2O01H 3B5NC 2KNCA 1HVVA 3BATA 5B6QA 2KNCB 3PXTA 1YIQA 2XNDH 3H1JD 1JY2N 2N9BA 3RL0C 1KILC 2RKLA 3EFGA 1UIXA 4BRYA 3AE9C 2FY8A 2XKMA 1CSBA 3P32A 3KZIH 3FWLA 3Q5PA 3M0DA 1COTA 1OW6A 4DT0A 2YCCA 3PLNA 1RH5B 4L1QA 4NPFX 2WT7A 1SQPD 5GTHV 1NTMK 3HQ8A 1PP9E 1M1JC 1N7LA 2WPVB 1SQQE 1MFZA 1I6DA 1CCRA 3G71P 1YJWP 1YEAA 1PGOA 4D6TJ 3CCUP 1PZQA 3RL0g 3GLMA 2IBZE 2IFMA 1VF5B 1E29A 1K9MQ 1H0TA 1I5TA 1SQVE 3AE5C 3CWBD 1S1CX 3RBZA 1HCMA 4DY9A 2QSIA 1VQ7P 1C2NA 4WQ7A 3CPWO 3GF7A 4FB1A 3I56P 1LTSC 5L8RJ 1S9KD 1RHZB 4FANA 4AX3A 1LGHB 1GL2A 2E76B 4ZNCA 2OZ1A 2OQQA 2JP3A 4WY4B 1L9JC 1SQXK 2C2CA 1SQVG 1VQMP 5CHXA 2M8RA 3CC4P 3TYIA 4YXDC 1M1KQ 4UB8V 3F89A 3L71J 3DP5A 4R4MA 1EDIA 1Y47A 3H1KG 3BCCJ 1FZCC 1VYDA 1T8ZA 1K05A 1VQNP 3MD0A 1IZL0 1H89A 3MHVA 2W8ZA 3MK7C 1VQLP 3O5CA 1KX7A 2Q5UA 2R5DA 2PFXA 1AKKA 1JUNA 1SQBG 4XYDB 4PJ0V 3NBTA 3PHLA 3A9FA 1LFMA 2QM7A 2OTJP 3MP7B 2B10B 3N4XA 3O6QA 155CA 1N73B 1LWUA 1M90Q 4LJIA 5DJQB 2ZVNB 1I54A 1LP1A 2Y0CA 1YIJP 3PH2B 4JBZA 1X9VA 2LIRA 4PV1B 2QIWA 1USDA 1CRCA 1JEKA 1IK7A 2XNXA 1BGYJ 2FXPA 1ZR2A 1W2LA 3M97X 3G9RA 2WSCJ 2MTAC 1YFCA 3A7OA 3H1LE 1DEBA 5CYTR 1N7SD 1H9XA 1EZVD 1A02F 2IZ1A 2CE0A 3CCSP 1GL2C 3V2NA 3NFQA 3CP5A 2D2CC 3B8EB 4IL6V 3H1LJ 5AW0B 3G3ZA 1P84H 5AW3B 1CRJA 3L70J 1YCCA 3SWKA 1AV1A 3KYQA 4H13B 2R32A 1JY2P 3CCEP 3Q1MA 4BXLA 1KD1Q 3NMDA 5B66E 1MFTA 1BDCA 3TNUB 3L73D 1RQUA 3SSUA 3TNUA 1JDLA 1YEBA 4WBAA 2PACA 3A0BH 4I2LC 3N7NA 1R5LA 2GB8B 2ZZS1 4YXWH 5K5GB 2VHDA 5H2FE 5CJ0A 2H89C 3WFCC 2R44A 1HBWA 1CIGA 2KUBA 2IBZI 2OTLP 2Y9YA 2YMYA 4L3GA 1KYOI 3M0DC 1OMIA 1NTKJ 2WQYC 3O8ZA 5BVZA 2M3EA 4PD4I 3WFEC 1DX7A 1EXIA 5KAFH 3M06A 4U3FG 2PCBB 5H2FH 1G2CA 1CRIA 1J1EB 1DD4A 1QVFO 3OW2O 1M56D 2D2CD 3M9HA 2HR3A 2IYPA 5CIFB 1FDMA 1YBKA 2FXMA 1IRWA 1C6SA 3KZIE 1RY3A 4H0JA 3TF5A 1NKZB 1H1OA 1JCCA 1TU3F 4GOEA 2XV5A 1W2EA 1OIPA 3B5NB 2Y9ZA 2M3BA 1CXAA 3CCRP 3IAOA 4PJ0E 1GK4A 3VMXA 1L0LG
chains in the Genus database with same CATH topology
4L3HA 2K9JB 2FYNB 2CA3B 4P4QB 2B12B 4EIEA 3O20A 3PTZA 4U3FD 4Y5RA 3L75D 1DW0A 1NNOA 3KZIV 5CIDB 4RJTA 1CRHA 3MK7B 2GC4D 3TDKA 1LMSA 1U75B 2JWAA 1CO6A 1C2RA 1H31B 5E79V 3KHUA 2ORLA 1QL4A 1OCDA 1BCCD 4XXLA 2N9YB 3CX5W 3X39A 4FAVA 1MG2D 2C1DB 1FI9A 3DR0A 2BH4X 1GU2A 3HQ6A 5KLIB 5KKZB 2V07A 1MG3D 1DW2A 1QYZA 4GYDA 2JQRA 1H33A 1NU1D 2QJKB 2B11B 3A0BV 1CHJA 4H0KA 1RAPA 1N50A 5B66V 3ZCFA 1NTMD 4EIDA 2EXVA 1ZRTD 1YTCA 2C1VA 1BE3D 1BGYD 2LITA 1CSUA 5B5EV 1H31A 4WQ9A 2AXTV 1L0ND 5DJQC 3HQ9A 3TGUD 2C8SA 4A7PA 3L71D 4K3IA 4D6TD 1CSXA 2B4ZA 3OCDB 2Q3EA 2N3BA 4MU8A 1OAEA 1K3GA 3ZOOA 1PPJD 5KAFV 1N9CA 1H32B 2L4DA 5H2FV 1FI7A 1SQXD 2N18B 1HH7A 3SXTA 1K3HA 3SLEA 2C1UA 1F1CA 2BPBB 3CU4A 3PXWA 1M6ZA 1HZVA 1GJQA 2O3JA 1I8OA 1ZZHA 3ORVA 1H9YA 2AIUA 1IO3A 2QJYB 3VYMA 5C9MA 1FHBA 2CE1A 2HV4A 2D0WA 1I55A 2PCCB 1HROA 5CIEB 5B6QA 1QL3A 2KNCB 3PXTA 4WQBA 4WQAA 1YIQA 1GIWA 3C2CA 3SJLA 3H1HD 3DMIA 3H1JD 3GG2A 1WVEC 5CIBB 4FA1A 2CA4B 1DVHA 1CYJA 1S6VB 1B7VA 2N3YA 1RZ5A 1ETPA 3FWLA 3OA8A 1C52A 1KYOW 1COTA 2KS1A 1H33B 3H1KD 1CTYA 1NTKD 2YCCA 3PLNA 5CICB 4L1QA 1SQPD 1CHHA 5GTHV 3HQ8A 5CIHB 1WEJF 2BCCD 1C7MA 1H32A 5C0ZA 1RZ6A 5TISV 1HZUA 2N9JA 1I6DA 1CCRA 1YEAA 1CRYA 2I8FA 2DGEA 2XTSB 3A0HV 3WFBC 1SQVD 3PXSA 1NTZD 5KLVD 3ZOYA 5TJHA 1E29A 4V2KA 4EDFA 3O1YA 1I5TA 2IBZD 3ZBMA 3CWBD 1HCMA 1CORA 1CTJA 4DY9A 1KYOD 1C2NA 4WQ7A 3L72D 1NIRA 4FB1A 3RN0A 2N9IA 4FANA 2BGVX 3L70D 1I8PA 4AX3A 2GIWA 4GEDB 4AAOA 1HRCA 1KB9D 1CSWA 1FJ0A 2C9XB 2OZ1A 2MHMA 2RMZA 1SQBD 3CXHW 3O0RC 1KB0A 1L9JC 3JBTB 1CHIA 2C2CA 5CIGB 3HQ7A 1C6RA 1FOCA 4Q5PA 4FA9A 1KV9A 351CA 3TYIA 4AAMA 2BCNB 5KAIV 4UB8V 4EICA 4AANA 1A2SA 1LC1A 5EXQA 1AOQA 3DP5A 2ZOOA 1I6EA 1N90A 1VYDA 3L4OA 1NMIA 4J20A 4PD4D 1QKSA 1IZL0 2L91A 1IQCA 1DT1A 1CYIA 1F1FA 3MK7C 4FA4A 2RN0A 3O5CA 1KX7A 1AKKA 3H1LD 1S5LV 3SVWA 4XYDB 4PJ0V 1HJ3A 3NBTA 3A9FA 1LFMA 3RMZA 3PHLA 4EIFA 2Y0EA 2FRCA 4PW9B 2B10B 155CA 3WFDC 2YK3A 4LJIA 5DJQB 1CEDA 1I54A 2Y0CA 1N15A 1CCHA 1DW3A 3ZOWA 3ZIYA 1W5CT 3PH2B 3ITKA 2LIRA 3RN1A 1R0QA 4UB6V 4RSZA 1A8CA 3L74D 3NWVA 3RLMA 1C6OA 2AI5A 1CRCA 2QJPB 5DF5A 1EB7A 1GQ1A 1W2LA 3M97X 2Y0DA 1A56A 2B0ZB 1U74B 4AALA 1CYCA 4WQCA 1CIEA 2MTAC 1CXCA 1YFCA 1P84D 2FWLA 2ZONG 1E2RA 5CYTR 2OZ1B 4N0KA 1CNOA 1H9XA 1EZVD 1BL9A 2CE0A 1GKSA 1AOFA 1IRVA 2DVHA 1DIQC 1SQQD 3CP5A 4IL6V 2GC7D 2QG4A 3OA8B 451CA 2BLFB 1LC2A 1M60A 1RAQA 3OCDA 4WQDA 1KX2A 1DVVA 4QAOA 4KMGA 1CRJA 1YCCA 1E8EA 1CSVA 2YIUB 1YICA 1HJ4A 4FA5A 3L73D 1L0LD 1CRGA 1LS9A 3VNWA 3L4MA 1JDLA 1YEBA 2A06D 2PACA 1FCDC 3WUIA 2GB8B 3WU2V 2ZZS1 3VMAA 1YNRA 4O1WA 1CTZA 2VHDA 3PRJA 3NBSA 1FI3A 1L9BC 2ZBOA 3WFCC 5DFSA 1CIGA 1HJ5A 2D0SA 4PWAA 2JTIB 3CYTI 3GW6A 2V08A 4L3GA 1C75A 1CIFA 3H1ID 3WC8A 5GTIV 1PP9D 3WFEC 1MZ4A 2C1DA 4WQEA 4YE1A 2PCBB 1CRIA 2ZXYA 4NFGB 1M70A 5CIFB 1CC5A 3BCCD 1IRWA 3SWSA 1DW1A 1C6SA 1J3SA 1NMLA 4H0JA 2FYUD 3CXHD 3ZOXA 3TF5A 2CXBA 1QN2A 4WQ8A 1H1OA 5IY51 2BH5X 4O1QA 4JCGA 5AURA 1KIBA 1CXAA 3CX5D 1AYGA 1GDVA 3VRDA 1CIHA 2YQBA 1DIIC 2N18C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3H A;  2K9J B;  2FYN B;  2CA3 B;  4P4Q B;  2B12 B;  4EIE A;  3O20 A;  3PTZ A;  4U3F D;  4Y5R A;  3L75 D;  1DW0 A;  1NNO A;  3KZI V;  5CID B;  4RJT A;  1CRH A;  3MK7 B;  2GC4 D;  3TDK A;  1LMS A;  1U75 B;  2JWA A;  1CO6 A;  1C2R A;  1H31 B;  5E79 V;  3KHU A;  2ORL A;  1QL4 A;  1OCD A;  1BCC D;  4XXL A;  2N9Y B;  3CX5 W;  3X39 A;  4FAV A;  1MG2 D;  2C1D B;  1FI9 A;  3DR0 A;  2BH4 X;  1GU2 A;  3HQ6 A;  5KLI B;  5KKZ B;  2V07 A;  1MG3 D;  1DW2 A;  1QYZ A;  4GYD A;  2JQR A;  1H33 A;  1NU1 D;  2QJK B;  2B11 B;  3A0B V;  1CHJ A;  4H0K A;  1RAP A;  1N50 A;  5B66 V;  3ZCF A;  1NTM D;  4EID A;  2EXV A;  1ZRT D;  1YTC A;  2C1V A;  1BE3 D;  1BGY D;  2LIT A;  1CSU A;  5B5E V;  1H31 A;  4WQ9 A;  2AXT V;  1L0N D;  5DJQ C;  3HQ9 A;  3TGU D;  2C8S A;  4A7P A;  3L71 D;  4K3I A;  4D6T D;  1CSX A;  2B4Z A;  3OCD B;  2Q3E A;  2N3B A;  4MU8 A;  1OAE A;  1K3G A;  3ZOO A;  1PPJ D;  5KAF V;  1N9C A;  1H32 B;  2L4D A;  5H2F V;  1FI7 A;  1SQX D;  2N18 B;  1HH7 A;  3SXT A;  1K3H A;  3SLE A;  2C1U A;  1F1C A;  2BPB B;  3CU4 A;  3PXW A;  1M6Z A;  1HZV A;  1GJQ A;  2O3J A;  1I8O A;  1ZZH A;  3ORV A;  1H9Y A;  2AIU A;  1IO3 A;  2QJY B;  3VYM A;  5C9M A;  1FHB A;  2CE1 A;  2HV4 A;  2D0W A;  1I55 A;  2PCC B;  1HRO A;  5CIE B;  5B6Q A;  1QL3 A;  2KNC B;  3PXT A;  4WQB A;  4WQA A;  1YIQ A;  1GIW A;  3C2C A;  3SJL A;  3H1H D;  3DMI A;  3H1J D;  3GG2 A;  1WVE C;  5CIB B;  4FA1 A;  2CA4 B;  1DVH A;  1CYJ A;  1S6V B;  1B7V A;  2N3Y A;  1RZ5 A;  1ETP A;  3FWL A;  3OA8 A;  1C52 A;  1KYO W;  1COT A;  2KS1 A;  1H33 B;  3H1K D;  1CTY A;  1NTK D;  2YCC A;  3PLN A;  5CIC B;  4L1Q A;  1SQP D;  1CHH A;  5GTH V;  3HQ8 A;  5CIH B;  1WEJ F;  2BCC D;  1C7M A;  1H32 A;  5C0Z A;  1RZ6 A;  5TIS V;  1HZU A;  2N9J A;  1I6D A;  1CCR A;  1YEA A;  1CRY A;  2I8F A;  2DGE A;  2XTS B;  3A0H V;  3WFB C;  1SQV D;  3PXS A;  1NTZ D;  5KLV D;  3ZOY A;  5TJH A;  1E29 A;  4V2K A;  4EDF A;  3O1Y A;  1I5T A;  2IBZ D;  3ZBM A;  3CWB D;  1HCM A;  1COR A;  1CTJ A;  4DY9 A;  1KYO D;  1C2N A;  4WQ7 A;  3L72 D;  1NIR A;  4FB1 A;  3RN0 A;  2N9I A;  4FAN A;  2BGV X;  3L70 D;  1I8P A;  4AX3 A;  2GIW A;  4GED B;  4AAO A;  1HRC A;  1KB9 D;  1CSW A;  1FJ0 A;  2C9X B;  2OZ1 A;  2MHM A;  2RMZ A;  1SQB D;  3CXH W;  3O0R C;  1KB0 A;  1L9J C;  3JBT B;  1CHI A;  2C2C A;  5CIG B;  3HQ7 A;  1C6R A;  1FOC A;  4Q5P A;  4FA9 A;  1KV9 A;  351C A;  3TYI A;  4AAM A;  2BCN B;  5KAI V;  4UB8 V;  4EIC A;  4AAN A;  1A2S A;  1LC1 A;  5EXQ A;  1AOQ A;  3DP5 A;  2ZOO A;  1I6E A;  1N90 A;  1VYD A;  3L4O A;  1NMI A;  4J20 A;  4PD4 D;  1QKS A;  1IZL 0;  2L91 A;  1IQC A;  1DT1 A;  1CYI A;  1F1F A;  3MK7 C;  4FA4 A;  2RN0 A;  3O5C A;  1KX7 A;  1AKK A;  3H1L D;  1S5L V;  3SVW A;  4XYD B;  4PJ0 V;  1HJ3 A;  3NBT A;  3A9F A;  1LFM A;  3RMZ A;  3PHL A;  4EIF A;  2Y0E A;  2FRC A;  4PW9 B;  2B10 B;  155C A;  3WFD C;  2YK3 A;  4LJI A;  5DJQ B;  1CED A;  1I54 A;  2Y0C A;  1N15 A;  1CCH A;  1DW3 A;  3ZOW A;  3ZIY A;  1W5C T;  3PH2 B;  3ITK A;  2LIR A;  3RN1 A;  1R0Q A;  4UB6 V;  4RSZ A;  1A8C A;  3L74 D;  3NWV A;  3RLM A;  1C6O A;  2AI5 A;  1CRC A;  2QJP B;  5DF5 A;  1EB7 A;  1GQ1 A;  1W2L A;  3M97 X;  2Y0D A;  1A56 A;  2B0Z B;  1U74 B;  4AAL A;  1CYC A;  4WQC A;  1CIE A;  2MTA C;  1CXC A;  1YFC A;  1P84 D;  2FWL A;  2ZON G;  1E2R A;  5CYT R;  2OZ1 B;  4N0K A;  1CNO A;  1H9X A;  1EZV D;  1BL9 A;  2CE0 A;  1GKS A;  1AOF A;  1IRV A;  2DVH A;  1DIQ C;  1SQQ D;  3CP5 A;  4IL6 V;  2GC7 D;  2QG4 A;  3OA8 B;  451C A;  2BLF B;  1LC2 A;  1M60 A;  1RAQ A;  3OCD A;  4WQD A;  1KX2 A;  1DVV A;  4QAO A;  4KMG A;  1CRJ A;  1YCC A;  1E8E A;  1CSV A;  2YIU B;  1YIC A;  1HJ4 A;  4FA5 A;  3L73 D;  1L0L D;  1CRG A;  1LS9 A;  3VNW A;  3L4M A;  1JDL A;  1YEB A;  2A06 D;  2PAC A;  1FCD C;  3WUI A;  2GB8 B;  3WU2 V;  2ZZS 1;  3VMA A;  1YNR A;  4O1W A;  1CTZ A;  2VHD A;  3PRJ A;  3NBS A;  1FI3 A;  1L9B C;  2ZBO A;  3WFC C;  5DFS A;  1CIG A;  1HJ5 A;  2D0S A;  4PWA A;  2JTI B;  3CYT I;  3GW6 A;  2V08 A;  4L3G A;  1C75 A;  1CIF A;  3H1I D;  3WC8 A;  5GTI V;  1PP9 D;  3WFE C;  1MZ4 A;  2C1D A;  4WQE A;  4YE1 A;  2PCB B;  1CRI A;  2ZXY A;  4NFG B;  1M70 A;  5CIF B;  1CC5 A;  3BCC D;  1IRW A;  3SWS A;  1DW1 A;  1C6S A;  1J3S A;  1NML A;  4H0J A;  2FYU D;  3CXH D;  3ZOX A;  3TF5 A;  2CXB A;  1QN2 A;  4WQ8 A;  1H1O A;  5IY5 1;  2BH5 X;  4O1Q A;  4JCG A;  5AUR A;  1KIB A;  1CXA A;  3CX5 D;  1AYG A;  1GDV A;  3VRD A;  1CIH A;  2YQB A;  1DII C;  2N18 C; 
#chains in the Genus database with same CATH topology
 4P4Q B;  4WY4 C;  1FOS F;  3HD7 A;  3KDP B;  2YIU C;  2I1K A;  2B9B A;  2MJZ A;  1AVY A;  1DW0 A;  1JB0 J;  3VMY A;  1X22 A;  4C7N B;  1KMI Z;  2AXT E;  4OVN F;  2OYI A;  3BCC G;  2FYN C;  3CME P;  4Y99 B;  1BE3 E;  2FYU G;  5GTH H;  1LT9 B;  1NGM B;  1JCD A;  1C2R A;  1QEX A;  1H31 B;  1IFN A;  5TIS H;  1BCC D;  4XXL A;  2KIK A;  1OW7 A;  3X39 A;  1NTK K;  4FAV A;  1T3U A;  3RBX A;  4NPD A;  3II6 A;  3L71 G;  1YTZ T;  1VF5 C;  2JWD A;  4GYD A;  2BCC J;  2JQR A;  4IL6 E;  3WU2 E;  3H1H G;  4OGQ D;  3O6Q B;  1N73 A;  3L75 G;  2C9L Y;  3T97 A;  1OW8 A;  3AE3 C;  1EDL A;  5B66 V;  3ZCF A;  1YQ4 C;  3A0H E;  1YTC A;  1OVR A;  4CPG A;  5B5E V;  3WMM 0;  1LNQ A;  1QX8 A;  1GL2 D;  2P1J A;  5AW4 B;  3TGU D;  2WVR A;  2W6B A;  4ZKP A;  4NPE A;  5BU5 A;  1CSX A;  3H1J E;  4K35 A;  4MU8 A;  4AQR D;  5CJ4 A;  2GM4 A;  5AW6 B;  4DZO A;  1NU1 G;  1SQX D;  2N18 B;  3OA7 A;  3L70 E;  3P8M C;  1NH4 A;  5B5E E;  3WUU A;  1HGV A;  3EFF K;  3SLE A;  2HG5 D;  2BPB B;  3TSI A;  1QL2 A;  1HF9 A;  3CCQ P;  1SQX J;  1GJQ A;  3L70 G;  5AVT B;  2A45 I;  3H1I E;  3M9Q A;  3A5T A;  4H0L D;  3ORV A;  1ZV8 A;  2QJY B;  2E5T A;  2CE1 A;  4KHX A;  1LTI C;  1ZW0 A;  3HUS B;  3HRN A;  3LIE A;  1HGZ A;  2E75 C;  4WQB A;  3V2P A;  3IF4 A;  1VQO P;  5KTB A;  3GG2 A;  1WVE C;  5CIB B;  2K1A A;  3L36 A;  3RL0 B;  2W83 C;  2FBW C;  1URQ A;  2YKO A;  4XA4 A;  1RZ5 A;  1JO5 A;  3OA8 A;  2GA1 A;  1NTK D;  1L4A B;  5CIC B;  1BGY G;  1WEJ F;  1L0N G;  2NPS D;  2BCC D;  3H25 A;  1C7M A;  1H32 A;  5E79 H;  5CCH A;  1HZU A;  1N86 A;  3P8C D;  3TK1 A;  1SFC B;  5CBN A;  1VL2 A;  2DGE A;  2XTS B;  3A0H V;  2FYU K;  3KQG A;  4N6J A;  1AQ5 A;  5TJH A;  2AEJ A;  1CW5 A;  4V2K A;  4EDF A;  2WSF J;  1KN7 A;  1SQX G;  1NTZ J;  2H8P D;  3ZDM A;  3ZBM A;  1SFC C;  2K88 A;  3FXE A;  4IL6 H;  1M57 D;  1COR A;  1CTJ A;  3OJA B;  4WY4 D;  1N8R Q;  2PGD A;  1NIR A;  2C0W A;  3BCC E;  2W6J H;  3L70 D;  3L74 G;  4AAO A;  2QA4 P;  2ITA A;  1FJ0 A;  4L76 A;  2O1J A;  1USE A;  2HOD B;  1KV4 A;  2RMZ A;  1KB0 A;  1LTJ C;  1ZR4 A;  3JBT B;  1IFJ A;  1CHI A;  1J1D B;  1MUU A;  3VMZ A;  4H44 C;  2UWJ E;  3H32 B;  4Q5P A;  1LTJ A;  1AFO A;  1NTZ G;  2QEX P;  2WTY A;  2QE7 H;  351C A;  3U59 A;  1OXZ A;  1YHQ P;  2BCN B;  4I6M C;  1WT6 A;  2FYU J;  1LC1 A;  1KZU B;  1SQQ G;  2FFD A;  2B89 A;  1AQT A;  3U1A A;  3L4O A;  3KPE A;  3L72 G;  4PD4 D;  1NTK G;  1FJP A;  1ZOY C;  1IQC A;  1U7J A;  5AW7 B;  1JNM A;  3W67 A;  1DT1 A;  1SQV J;  1CYI A;  5GTI H;  2BCC G;  1JY3 O;  4FA4 A;  2RN0 A;  4UB6 E;  1OVU A;  2N1T A;  1PPJ E;  3S9O A;  1HJ3 A;  4EIF A;  2FRC A;  1NAY A;  2V4H A;  3WFD C;  3FXD A;  1FC2 C;  1L2P A;  2HPC A;  4GOF A;  2ZXX A;  3ZOW A;  1W5C T;  3ITK A;  2SPZ A;  5CMZ A;  1RF1 B;  3RN1 A;  1R0Q A;  4UB6 V;  4RSZ A;  2BAS A;  3L74 D;  3RLM A;  3OAK A;  5AVS B;  4Z1M H;  1C6O A;  2AI5 A;  4N78 E;  1Q81 Q;  2OYI B;  1ZRT E;  1JY2 O;  2QJP C;  2JKV A;  1N2D C;  5DF5 A;  2FFD B;  3V2Q A;  3LW5 H;  2O01 N;  2B0Z B;  1URQ C;  1CYC A;  2FXO A;  2CK3 H;  2HYN A;  1SQB K;  2KK7 A;  4DCK A;  1E2R A;  1DH3 A;  4ZKU A;  4Y28 J;  1CNO A;  3D6Y A;  3Q5S A;  1FZC A;  1FZC B;  5AVR B;  2DVH A;  1DIQ C;  1NJI Q;  1T2K C;  1EXJ A;  1SQQ D;  1SQP E;  451C A;  2PAJ A;  2BLF B;  2R3C A;  1M60 A;  1L4A A;  1KX2 A;  1DVV A;  4QAO A;  2YIU B;  1OWA A;  1VQ8 P;  1KFN A;  3R4Y A;  4RO0 A;  3TGU J;  5CCG D;  4C7N A;  3AE7 C;  3L72 E;  1MZ9 A;  4W7Y A;  1RF0 A;  2R3S A;  2J59 M;  1G2C B;  4O1W A;  1T6A A;  4HYT B;  3V2R A;  2KXP B;  4U7J A;  1SQP K;  1CTZ A;  4AUW A;  1NTK E;  1HUC A;  2WMM A;  5DFS A;  5GTH E;  2D0S A;  1LTT C;  5B5E H;  2JTI B;  3GW6 A;  2W27 A;  2AXT H;  4HH2 A;  4Y99 C;  2KSJ A;  2I8D A;  5CCG A;  4C46 A;  2ZFC A;  3L35 A;  4EIJ A;  1ZXG A;  1PP9 D;  1NVO A;  3CC2 P;  1KFM A;  1MZ4 A;  2OYH B;  4N78 D;  1VQK P;  3HD7 C;  1NU1 E;  5C39 A;  1L4A D;  1S9K E;  1BSN A;  2Q3I A;  1RF1 C;  1EZV G;  1SS1 A;  3L74 J;  3SWS A;  1DW1 A;  1NML A;  1IFP A;  3CXH D;  3ZOX A;  1NTZ K;  1QN2 A;  4WQ8 A;  1RQV A;  5IY5 1;  2BH5 X;  1OFC X;  1T3J A;  3K5B A;  3HE4 A;  3KXD A;  1HWT C;  3MIW A;  3CX5 D;  2E75 B;  1RE4 A;  2OYI C;  1CIH A;  3JC2 2;  5DJT B;  4L3H A;  2FYN B;  3O20 A;  1VQP P;  3PTZ A;  4U3F D;  3V6I A;  1LT9 C;  1NKN A;  1KB9 E;  5TIS E;  4W7Z A;  2IYO A;  1EDK A;  3AED C;  1FU1 A;  1Z56 A;  1KB9 H;  2GC4 D;  3TYY A;  1NTM E;  1RE3 C;  1YJN P;  1S2E A;  2KZI A;  2YO3 A;  1U75 B;  4H13 C;  2YMK A;  2B87 B;  5KAI E;  1L0N J;  4OH8 B;  2ZT9 D;  1QL4 A;  2N9Y B;  3CD6 P;  3QH9 A;  2E42 A;  2C1D B;  3G6E P;  2FYU E;  3C8V A;  3LID A;  1FI9 A;  1FS0 E;  3PP5 A;  2BH4 X;  1GU2 A;  1EZV E;  4IFM A;  3WUV A;  1L4A C;  5AW2 B;  1LTA C;  1PP9 G;  2V07 A;  1MG3 D;  1HH0 A;  4D6T G;  2BEZ F;  1BCC E;  3B5N A;  3A0B V;  2ZT9 B;  1EQ7 A;  1EDJ A;  4BRY B;  1RAP A;  4KT0 J;  1N50 A;  3TGU E;  5KJ7 A;  1NTM D;  3IFM A;  1ZRT D;  1BE3 D;  1CSU A;  4OGQ C;  1FE6 A;  2C0X A;  1S4X A;  1IK9 A;  1GK6 A;  2KYV A;  2IX7 C;  3RK2 B;  4HB1 A;  4JPZ B;  4XE5 B;  1J2J B;  1NTM J;  1KQS O;  4KJM A;  3OCD B;  2N3B A;  3G4S P;  4C7R A;  4LLH A;  1PPJ D;  5KAF V;  2KZJ A;  5AVY B;  2L4D A;  3VP8 A;  2R5B A;  1FI7 A;  2O1K A;  2MKV A;  1SQB J;  3SXT A;  1IO4 A;  3H1K J;  2V7Q J;  1F1C A;  3CU4 A;  1SQP G;  2O3J A;  1I8O A;  2H43 A;  1QL1 A;  2ZVO B;  1H9Y A;  5C9M A;  2JEE A;  1S5L H;  2RH0 A;  3HUS C;  2B87 A;  2PCC B;  3SWF A;  1HRO A;  2ZYG A;  1KIL D;  1GIW A;  2WWW A;  3C2C A;  3SJL A;  3H1H D;  3DMI A;  5KJ7 C;  4H0L B;  1CYJ A;  1B7V A;  2N3Y A;  2YKQ A;  4GOD A;  1ETP A;  1SP4 A;  4UB6 H;  1C52 A;  2KS1 A;  1CTY A;  1FJK A;  1CHH A;  3RK2 C;  5CIH B;  3F5H A;  5TIS V;  2HOD A;  3A2A A;  3E1I A;  2N9J A;  5KLV K;  1CRY A;  3H1L G;  4YTP C;  2I8F A;  3AEF C;  4DOJ A;  1LTG C;  3PXS A;  1PPJ G;  5KLV D;  1FZB A;  3CX5 H;  2GUS A;  1PFI A;  3P7K A;  1KYO D;  1XTC C;  2N9I A;  2BGV X;  4BWN A;  4O9B A;  1U7M A;  4GED B;  2I1J A;  1HRC A;  1VF5 D;  2WSC H;  1CI6 A;  3AE8 C;  2A45 G;  1PGQ A;  2LXB A;  4U3F E;  1YQ3 C;  2YXQ B;  3C9I A;  3FGA D;  4OWF A;  1FDO A;  3CXH W;  3O0R C;  1AA0 A;  5CIG B;  2ZAE B;  3HQ7 A;  4YPC A;  1FOC A;  5BU8 B;  1KV9 A;  4AYC A;  2QM8 A;  1SQB E;  4EIC A;  4AAN A;  2OAR A;  1YYC A;  1DIP A;  2ZOO A;  4RES B;  1I6E A;  1NMI A;  1RE3 A;  1W2B O;  2QVA A;  2JDI H;  1JOC A;  5KLV J;  1MV8 A;  1LP1 B;  2A45 H;  2JJL A;  4EOT A;  2J58 A;  3HUS A;  5AW5 B;  3HE5 A;  4HJG H;  1WRG A;  1S5L V;  4GKG A;  3SVW A;  2K9J A;  5CCG C;  5AVW B;  1S72 P;  2KOG A;  3H1I J;  3VTP C;  2A06 G;  4PW9 B;  3MGN A;  1SQX E;  2P2U A;  2YK3 A;  3C1L A;  1CED A;  2PP6 A;  1N15 A;  1RF0 C;  1BGY E;  4H0L C;  1R8E A;  3ZIY A;  1FZF A;  4ASW A;  2AEF A;  2J5U A;  3NWV A;  3H1J J;  3HD7 D;  1JTH A;  2QJP B;  1VQ4 P;  3AEA C;  1LTJ B;  1GQ1 A;  3AE6 C;  3L73 G;  2Y0D A;  1LJ2 A;  3Q5R A;  3CWB E;  1CXC A;  5CBO A;  4H44 B;  2FWL A;  1L0N K;  3SWY A;  3UIA A;  2CPS A;  2E5Y A;  1GZL A;  1BL9 A;  3A3Y B;  1SQP J;  3D70 A;  1GKS A;  1AOF A;  2Z5H A;  1IRV A;  5AVZ B;  1OVV A;  5DJU B;  1D7M A;  2QG4 A;  3OA8 B;  4ZMD A;  5KJ7 D;  4WQD A;  4R4L A;  2E74 B;  4B86 A;  3H1I G;  3IN6 A;  1L0L E;  3B4S A;  3V5B A;  1E8E A;  1CSV A;  2Q9I A;  2IDB A;  1YIC A;  4EI2 A;  3CC7 P;  3D0W A;  4K3A A;  1T2K D;  1X8Y A;  1LS9 A;  1KB9 I;  3VNW A;  1FCD C;  1GU4 A;  3WUI A;  3GF3 A;  4JYB A;  1BE3 J;  3L75 J;  5APY A;  1GW4 A;  1Q90 D;  4H13 D;  1SVF A;  2BCC E;  2N1T D;  3PRJ A;  3NBS A;  1L9B C;  3M0A A;  1HJ0 A;  4PWA A;  2ZT9 C;  3CYT I;  3HTK B;  1C75 A;  1NU1 J;  1ZN5 A;  2W6A A;  1K73 Q;  1NOH A;  2M0B A;  1EC5 A;  3S4R A;  4JF7 A;  4WQE A;  1W5C E;  4YE1 A;  3NXS A;  1DD3 A;  5AVX B;  3GHG A;  3EWK A;  2FFD C;  2WSE H;  4NFG B;  4I7Z B;  1M70 A;  1KYO E;  1CC5 A;  4D6T E;  3CLQ A;  3RK3 D;  1J3S A;  2FYZ A;  2FYU D;  1RF1 A;  4PD4 E;  2CXB A;  5AVV B;  2E74 C;  1AJY A;  1PP9 J;  2JR8 A;  2WPQ A;  3CX5 E;  4I7Z C;  3VP9 A;  2ZXE B;  1QVG O;  1S3J A;  5AUR A;  2ZYA A;  2DW3 A;  1GDV A;  1CZQ A;  2YQB A;  2N18 C;  2K9J B;  2K37 A;  2XDJ A;  5AW8 B;  2B12 B;  4EIE A;  1L0L K;  1U57 A;  4Y5R A;  3MUD C;  1NNO A;  1KQG B;  3KZI V;  4GDO A;  1CRH A;  1P84 I;  3MK7 B;  1L0N E;  1FOS E;  2NPS A;  3MTU E;  2KSE A;  1CO6 A;  1Q2N A;  2OYH A;  3KHU A;  3AEE C;  1OCD A;  4WWI A;  3CX5 W;  4W80 A;  4IFD K;  3T97 B;  1MG2 D;  1Y8A A;  1BSH A;  2OTK E;  3DR0 A;  1NU1 K;  3HQ6 A;  5KLI B;  4EYY Q;  3A0H H;  1DW2 A;  1URQ D;  3B71 A;  3HTK A;  1QYZ A;  1GTW A;  2QRX A;  1H33 A;  1X79 B;  4DJG A;  3JCU E;  2QJK B;  2B11 B;  3A0B E;  2Q7C A;  1FAV A;  3WU2 H;  2LR2 A;  3RK2 D;  1H88 A;  2XZR A;  3QWO C;  5AVQ B;  1J1E C;  1EZV I;  4QMA A;  3U1C A;  4EID A;  3L37 A;  2C1V A;  4PV1 C;  1A02 J;  1R5S A;  1XTG B;  4WQ9 A;  4WVZ A;  2W90 A;  4OGQ B;  4JQ0 D;  4HKZ H;  1BCC G;  3HQ9 A;  4M3L A;  3EQ2 A;  4A7P A;  3L71 D;  4L74 A;  1KIL E;  3BVH A;  4D6T D;  2B4Z A;  5APU A;  5APV A;  4TT3 H;  3H1J G;  5M1B A;  3CCJ P;  5H2F V;  5KAI H;  3HD7 B;  4UB8 H;  3CWB G;  2JO1 A;  1HH7 A;  2QJY C;  4IOI H;  4GIF A;  2WZ7 A;  3IR9 A;  3BAS A;  3BRT B;  1NTM G;  3PXW A;  3AE2 C;  3FWN A;  2Z4E A;  1ZZH A;  1BCC J;  1H8A A;  1IO3 A;  1FHB A;  1SLQ A;  4JYC A;  1QLE D;  2HV4 A;  2D0W A;  2P67 A;  1I55 A;  3PH0 A;  2HFE D;  2YXR B;  3GHG B;  5CIE B;  4MN4 C;  1QL3 A;  4RKU J;  4WQA A;  1VQ5 P;  4FA1 A;  2A06 E;  2CA4 B;  1DVH A;  3L71 E;  1S6V B;  1ZP0 C;  1KIL A;  1KYO W;  1H33 B;  3H1K D;  2WSF H;  2M5A A;  2AEM A;  1BE3 G;  3CXH I;  3VN0 A;  4TLF A;  1Q86 Q;  2IZ0 A;  5C0Z A;  1RZ6 A;  3MUD A;  2N1T B;  2ZYD A;  1YTZ I;  3CX5 I;  2Q1K A;  1VQ6 P;  2BEQ D;  3WFB C;  1SQV D;  2K9Y A;  3H1H J;  1NTZ D;  3ZOY A;  4L75 A;  3O1Y A;  2IBZ D;  3JCU H;  1PV3 A;  1PGJ A;  1JTH B;  1SFC D;  3L72 D;  1S5L X;  3RN0 A;  3L74 E;  4LC1 A;  3CCL P;  4WY4 A;  5B66 H;  1S5L E;  3H1K E;  3D6Z A;  1I8P A;  3M91 A;  2GIW A;  1KB9 D;  2D2C B;  1CSW A;  4ASV A;  2C9X B;  3D71 A;  2MHM A;  1SQB D;  1RE4 C;  2P7J A;  2WIT A;  2B88 A;  2VRS A;  3HE4 B;  1VDF A;  4N3Y B;  2GUV A;  1C6R A;  4FA9 A;  2Q6Q A;  1Y9B A;  1SQQ K;  2KLU A;  2E76 D;  2OGU A;  4AAM A;  3B5N D;  5KAI V;  1OZH A;  2K3R A;  1A2S A;  5EXQ A;  1AOQ A;  3L73 J;  1N90 A;  2CPB A;  4J20 A;  3WUT A;  1QKS A;  2L91 A;  2HPC B;  1F1F A;  1K04 A;  1IJD B;  3H1L D;  2WT7 B;  4PV1 D;  3RMZ A;  2Y0E A;  1M1J B;  3V4Q A;  1NWQ A;  1N73 C;  2LXC B;  1LT1 A;  5KLV G;  1M7L A;  4I1L A;  2IBZ G;  1ZME C;  2KS1 B;  1CCH A;  1DW3 A;  3VYI A;  3SFD C;  3L72 J;  1URQ B;  5AVU B;  2AXC A;  2KLV A;  1A8C A;  2H88 C;  2IPP A;  3R2P A;  1VQ9 P;  4UB8 E;  5APQ A;  1X0T A;  5EFW B;  1VPC A;  4L73 A;  1FDI A;  1EB7 A;  3M9B A;  4IL6 X;  3Q3D A;  5KAF E;  1A56 A;  1MKM A;  3RK3 C;  1U74 B;  4AAL A;  4WQC A;  1CIE A;  2P10 A;  2ZJS E;  3CI9 A;  1P84 D;  5E79 E;  3JSV C;  2E74 D;  3AE1 C;  2ZON G;  2OZ1 B;  4N0K A;  1GDT A;  5AW1 B;  3VOP A;  1M1J A;  1G1J A;  1JMB A;  2WPR A;  1IFM A;  3AEB C;  2GC7 D;  2KP8 A;  1PL5 A;  1LC2 A;  1RAQ A;  3OCD A;  3SFE C;  4KMG A;  5AW9 B;  3USS A;  3W68 A;  2G3A A;  3L73 E;  1N7S B;  1DEE G;  1GD2 E;  3E7K A;  2WSE J;  1KTM A;  1NAF A;  1HJ4 A;  3L75 E;  4FA5 A;  1L0L D;  1CRG A;  1GU5 A;  3L4M A;  2A06 D;  1IFD A;  3H6P A;  3L4F A;  3WU2 V;  5KLI C;  2NPS B;  5GTI E;  3RK3 E;  3VMA A;  1YNR A;  1J1D C;  1NHL A;  2PRR A;  5CCH C;  3E1R A;  1UII A;  1FI3 A;  1LWU B;  2ZBO A;  1LWU C;  1KQL A;  1HJ5 A;  3H32 A;  2YNY A;  1SQQ J;  1KYO H;  3AEC C;  2OYH C;  2V08 A;  1YIT P;  1KIL B;  1CIF A;  3FX0 A;  1KQF B;  3H1I D;  3RK3 B;  3RL0 D;  5APW A;  3WC8 A;  5GTI V;  1CI6 B;  1IZN B;  2G8Y A;  2N1T C;  2POH A;  2WSS H;  1AVO A;  1HTL C;  3I5C A;  3RGU A;  2C1D A;  3CWB J;  2ZXY A;  1BDD A;  2E75 D;  3BCC D;  1PGP A;  2KB7 P;  1IC2 A;  1L0L J;  1E5W A;  4PD4 H;  1Q7Y Q;  1ZLL A;  4O1Q A;  2YO2 A;  4JCG A;  1P84 E;  4LGD E;  1M8O B;  1KIB A;  2H7H A;  1FZE A;  1AYG A;  3I55 P;  3VRD A;  1DII C;  3S1K A;  3P8C E;  2CA3 B;  2NPS C;  3HE5 B;  2V7Q H;  3PJS K;  3AE4 C;  1KC8 Q;  3L75 D;  2C9N Y;  5CID B;  4RJT A;  1NTZ E;  2HLO A;  2L5G B;  2O01 J;  3TDK A;  1YI2 P;  2WPS A;  2XU6 A;  1KOR A;  1LMS A;  2JWA A;  3ABV C;  2IFN A;  1PIX A;  1JY3 N;  5E79 V;  2ORL A;  3CXH E;  3TGU G;  1FZA A;  1Q82 Q;  1JM0 A;  3CCM P;  1JMM A;  5KKZ B;  1IFI A;  2YKP A;  1LTB C;  1HJB A;  3NTN A;  3Q2Y A;  4IFF A;  4WB4 A;  3GHG C;  1NU1 D;  2Z5I A;  5APT A;  2M5A B;  1CHJ A;  4H0K A;  5KKZ C;  2P58 A;  1E79 H;  5APS A;  4H44 D;  5KLV E;  2EXV A;  3V4W A;  3CCV P;  1WMK A;  3GMA A;  3CL3 D;  2NRG A;  2QJK C;  1BGY D;  2LIT A;  2OYO A;  3CXH H;  1H31 A;  1H0T B;  2AXT V;  1L0N D;  5DJQ C;  2KI7 B;  1N7S A;  1NYH A;  1GW3 A;  2C8S A;  1NO4 A;  1SQV K;  3BRV B;  4K3I A;  3AEG C;  2Q3E A;  3H1H E;  1OAE A;  1K3G A;  3ZOO A;  1FBM A;  1K8A Q;  1N9C A;  1H32 B;  1OX3 A;  3MZW B;  4U3F J;  1SFC A;  3LW5 J;  3CMA P;  1GL2 B;  2NZ2 A;  1QGK B;  1GMJ A;  1K3H A;  1YJ9 P;  2C1U A;  1FZG A;  1G1I A;  1M6Z A;  1HZV A;  2LKM A;  5CCH D;  4XFJ A;  4GT1 A;  5APX A;  2E43 A;  2AIU A;  3VYM A;  1N7S C;  1JY3 P;  1LT9 A;  4PJ0 H;  2FKW B;  2E76 C;  2O01 H;  3B5N C;  2KNC A;  1HVV A;  3BAT A;  5B6Q A;  2KNC B;  3PXT A;  1YIQ A;  2XND H;  3H1J D;  1JY2 N;  2N9B A;  3RL0 C;  1KIL C;  2RKL A;  3EFG A;  1UIX A;  4BRY A;  3AE9 C;  2FY8 A;  2XKM A;  1CSB A;  3P32 A;  3KZI H;  3FWL A;  3Q5P A;  3M0D A;  1COT A;  1OW6 A;  4DT0 A;  2YCC A;  3PLN A;  1RH5 B;  4L1Q A;  4NPF X;  2WT7 A;  1SQP D;  5GTH V;  1NTM K;  3HQ8 A;  1PP9 E;  1M1J C;  1N7L A;  2WPV B;  1SQQ E;  1MFZ A;  1I6D A;  1CCR A;  3G71 P;  1YJW P;  1YEA A;  1PGO A;  4D6T J;  3CCU P;  1PZQ A;  3RL0 g;  3GLM A;  2IBZ E;  2IFM A;  1VF5 B;  1E29 A;  1K9M Q;  1H0T A;  1I5T A;  1SQV E;  3AE5 C;  3CWB D;  1S1C X;  3RBZ A;  1HCM A;  4DY9 A;  2QSI A;  1VQ7 P;  1C2N A;  4WQ7 A;  3CPW O;  3GF7 A;  4FB1 A;  3I56 P;  1LTS C;  5L8R J;  1S9K D;  1RHZ B;  4FAN A;  4AX3 A;  1LGH B;  1GL2 A;  2E76 B;  4ZNC A;  2OZ1 A;  2OQQ A;  2JP3 A;  4WY4 B;  1L9J C;  1SQX K;  2C2C A;  1SQV G;  1VQM P;  5CHX A;  2M8R A;  3CC4 P;  3TYI A;  4YXD C;  1M1K Q;  4UB8 V;  3F89 A;  3L71 J;  3DP5 A;  4R4M A;  1EDI A;  1Y47 A;  3H1K G;  3BCC J;  1FZC C;  1VYD A;  1T8Z A;  1K05 A;  1VQN P;  3MD0 A;  1IZL 0;  1H89 A;  3MHV A;  2W8Z A;  3MK7 C;  1VQL P;  3O5C A;  1KX7 A;  2Q5U A;  2R5D A;  2PFX A;  1AKK A;  1JUN A;  1SQB G;  4XYD B;  4PJ0 V;  3NBT A;  3PHL A;  3A9F A;  1LFM A;  2QM7 A;  2OTJ P;  3MP7 B;  2B10 B;  3N4X A;  3O6Q A;  155C A;  1N73 B;  1LWU A;  1M90 Q;  4LJI A;  5DJQ B;  2ZVN B;  1I54 A;  1LP1 A;  2Y0C A;  1YIJ P;  3PH2 B;  4JBZ A;  1X9V A;  2LIR A;  4PV1 B;  2QIW A;  1USD A;  1CRC A;  1JEK A;  1IK7 A;  2XNX A;  1BGY J;  2FXP A;  1ZR2 A;  1W2L A;  3M97 X;  3G9R A;  2WSC J;  2MTA C;  1YFC A;  3A7O A;  3H1L E;  1DEB A;  5CYT R;  1N7S D;  1H9X A;  1EZV D;  1A02 F;  2IZ1 A;  2CE0 A;  3CCS P;  1GL2 C;  3V2N A;  3NFQ A;  3CP5 A;  2D2C C;  3B8E B;  4IL6 V;  3H1L J;  5AW0 B;  3G3Z A;  1P84 H;  5AW3 B;  1CRJ A;  3L70 J;  1YCC A;  3SWK A;  1AV1 A;  3KYQ A;  4H13 B;  2R32 A;  1JY2 P;  3CCE P;  3Q1M A;  4BXL A;  1KD1 Q;  3NMD A;  5B66 E;  1MFT A;  1BDC A;  3TNU B;  3L73 D;  1RQU A;  3SSU A;  3TNU A;  1JDL A;  1YEB A;  4WBA A;  2PAC A;  3A0B H;  4I2L C;  3N7N A;  1R5L A;  2GB8 B;  2ZZS 1;  4YXW H;  5K5G B;  2VHD A;  5H2F E;  5CJ0 A;  2H89 C;  3WFC C;  2R44 A;  1HBW A;  1CIG A;  2KUB A;  2IBZ I;  2OTL P;  2Y9Y A;  2YMY A;  4L3G A;  1KYO I;  3M0D C;  1OMI A;  1NTK J;  2WQY C;  3O8Z A;  5BVZ A;  2M3E A;  4PD4 I;  3WFE C;  1DX7 A;  1EXI A;  5KAF H;  3M06 A;  4U3F G;  2PCB B;  5H2F H;  1G2C A;  1CRI A;  1J1E B;  1DD4 A;  1QVF O;  3OW2 O;  1M56 D;  2D2C D;  3M9H A;  2HR3 A;  2IYP A;  5CIF B;  1FDM A;  1YBK A;  2FXM A;  1IRW A;  1C6S A;  3KZI E;  1RY3 A;  4H0J A;  3TF5 A;  1NKZ B;  1H1O A;  1JCC A;  1TU3 F;  4GOE A;  2XV5 A;  1W2E A;  1OIP A;  3B5N B;  2Y9Z A;  2M3B A;  1CXA A;  3CCR P;  3IAO A;  4PJ0 E;  1GK4 A;  3VMX A;  1L0L G; 
#chains in the Genus database with same CATH homology
 4L3H A;  2K9J B;  2FYN B;  2CA3 B;  4P4Q B;  2B12 B;  4EIE A;  3O20 A;  3PTZ A;  4U3F D;  4Y5R A;  3L75 D;  1DW0 A;  1NNO A;  3KZI V;  5CID B;  4RJT A;  1CRH A;  3MK7 B;  2GC4 D;  3TDK A;  1LMS A;  1U75 B;  2JWA A;  1CO6 A;  1C2R A;  1H31 B;  5E79 V;  3KHU A;  2ORL A;  1QL4 A;  1OCD A;  1BCC D;  4XXL A;  2N9Y B;  3CX5 W;  3X39 A;  4FAV A;  1MG2 D;  2C1D B;  1FI9 A;  3DR0 A;  2BH4 X;  1GU2 A;  3HQ6 A;  5KLI B;  5KKZ B;  2V07 A;  1MG3 D;  1DW2 A;  1QYZ A;  4GYD A;  2JQR A;  1H33 A;  1NU1 D;  2QJK B;  2B11 B;  3A0B V;  1CHJ A;  4H0K A;  1RAP A;  1N50 A;  5B66 V;  3ZCF A;  1NTM D;  4EID A;  2EXV A;  1ZRT D;  1YTC A;  2C1V A;  1BE3 D;  1BGY D;  2LIT A;  1CSU A;  5B5E V;  1H31 A;  4WQ9 A;  2AXT V;  1L0N D;  5DJQ C;  3HQ9 A;  3TGU D;  2C8S A;  4A7P A;  3L71 D;  4K3I A;  4D6T D;  1CSX A;  2B4Z A;  3OCD B;  2Q3E A;  2N3B A;  4MU8 A;  1OAE A;  1K3G A;  3ZOO A;  1PPJ D;  5KAF V;  1N9C A;  1H32 B;  2L4D A;  5H2F V;  1FI7 A;  1SQX D;  2N18 B;  1HH7 A;  3SXT A;  1K3H A;  3SLE A;  2C1U A;  1F1C A;  2BPB B;  3CU4 A;  3PXW A;  1M6Z A;  1HZV A;  1GJQ A;  2O3J A;  1I8O A;  1ZZH A;  3ORV A;  1H9Y A;  2AIU A;  1IO3 A;  2QJY B;  3VYM A;  5C9M A;  1FHB A;  2CE1 A;  2HV4 A;  2D0W A;  1I55 A;  2PCC B;  1HRO A;  5CIE B;  5B6Q A;  1QL3 A;  2KNC B;  3PXT A;  4WQB A;  4WQA A;  1YIQ A;  1GIW A;  3C2C A;  3SJL A;  3H1H D;  3DMI A;  3H1J D;  3GG2 A;  1WVE C;  5CIB B;  4FA1 A;  2CA4 B;  1DVH A;  1CYJ A;  1S6V B;  1B7V A;  2N3Y A;  1RZ5 A;  1ETP A;  3FWL A;  3OA8 A;  1C52 A;  1KYO W;  1COT A;  2KS1 A;  1H33 B;  3H1K D;  1CTY A;  1NTK D;  2YCC A;  3PLN A;  5CIC B;  4L1Q A;  1SQP D;  1CHH A;  5GTH V;  3HQ8 A;  5CIH B;  1WEJ F;  2BCC D;  1C7M A;  1H32 A;  5C0Z A;  1RZ6 A;  5TIS V;  1HZU A;  2N9J A;  1I6D A;  1CCR A;  1YEA A;  1CRY A;  2I8F A;  2DGE A;  2XTS B;  3A0H V;  3WFB C;  1SQV D;  3PXS A;  1NTZ D;  5KLV D;  3ZOY A;  5TJH A;  1E29 A;  4V2K A;  4EDF A;  3O1Y A;  1I5T A;  2IBZ D;  3ZBM A;  3CWB D;  1HCM A;  1COR A;  1CTJ A;  4DY9 A;  1KYO D;  1C2N A;  4WQ7 A;  3L72 D;  1NIR A;  4FB1 A;  3RN0 A;  2N9I A;  4FAN A;  2BGV X;  3L70 D;  1I8P A;  4AX3 A;  2GIW A;  4GED B;  4AAO A;  1HRC A;  1KB9 D;  1CSW A;  1FJ0 A;  2C9X B;  2OZ1 A;  2MHM A;  2RMZ A;  1SQB D;  3CXH W;  3O0R C;  1KB0 A;  1L9J C;  3JBT B;  1CHI A;  2C2C A;  5CIG B;  3HQ7 A;  1C6R A;  1FOC A;  4Q5P A;  4FA9 A;  1KV9 A;  351C A;  3TYI A;  4AAM A;  2BCN B;  5KAI V;  4UB8 V;  4EIC A;  4AAN A;  1A2S A;  1LC1 A;  5EXQ A;  1AOQ A;  3DP5 A;  2ZOO A;  1I6E A;  1N90 A;  1VYD A;  3L4O A;  1NMI A;  4J20 A;  4PD4 D;  1QKS A;  1IZL 0;  2L91 A;  1IQC A;  1DT1 A;  1CYI A;  1F1F A;  3MK7 C;  4FA4 A;  2RN0 A;  3O5C A;  1KX7 A;  1AKK A;  3H1L D;  1S5L V;  3SVW A;  4XYD B;  4PJ0 V;  1HJ3 A;  3NBT A;  3A9F A;  1LFM A;  3RMZ A;  3PHL A;  4EIF A;  2Y0E A;  2FRC A;  4PW9 B;  2B10 B;  155C A;  3WFD C;  2YK3 A;  4LJI A;  5DJQ B;  1CED A;  1I54 A;  2Y0C A;  1N15 A;  1CCH A;  1DW3 A;  3ZOW A;  3ZIY A;  1W5C T;  3PH2 B;  3ITK A;  2LIR A;  3RN1 A;  1R0Q A;  4UB6 V;  4RSZ A;  1A8C A;  3L74 D;  3NWV A;  3RLM A;  1C6O A;  2AI5 A;  1CRC A;  2QJP B;  5DF5 A;  1EB7 A;  1GQ1 A;  1W2L A;  3M97 X;  2Y0D A;  1A56 A;  2B0Z B;  1U74 B;  4AAL A;  1CYC A;  4WQC A;  1CIE A;  2MTA C;  1CXC A;  1YFC A;  1P84 D;  2FWL A;  2ZON G;  1E2R A;  5CYT R;  2OZ1 B;  4N0K A;  1CNO A;  1H9X A;  1EZV D;  1BL9 A;  2CE0 A;  1GKS A;  1AOF A;  1IRV A;  2DVH A;  1DIQ C;  1SQQ D;  3CP5 A;  4IL6 V;  2GC7 D;  2QG4 A;  3OA8 B;  451C A;  2BLF B;  1LC2 A;  1M60 A;  1RAQ A;  3OCD A;  4WQD A;  1KX2 A;  1DVV A;  4QAO A;  4KMG A;  1CRJ A;  1YCC A;  1E8E A;  1CSV A;  2YIU B;  1YIC A;  1HJ4 A;  4FA5 A;  3L73 D;  1L0L D;  1CRG A;  1LS9 A;  3VNW A;  3L4M A;  1JDL A;  1YEB A;  2A06 D;  2PAC A;  1FCD C;  3WUI A;  2GB8 B;  3WU2 V;  2ZZS 1;  3VMA A;  1YNR A;  4O1W A;  1CTZ A;  2VHD A;  3PRJ A;  3NBS A;  1FI3 A;  1L9B C;  2ZBO A;  3WFC C;  5DFS A;  1CIG A;  1HJ5 A;  2D0S A;  4PWA A;  2JTI B;  3CYT I;  3GW6 A;  2V08 A;  4L3G A;  1C75 A;  1CIF A;  3H1I D;  3WC8 A;  5GTI V;  1PP9 D;  3WFE C;  1MZ4 A;  2C1D A;  4WQE A;  4YE1 A;  2PCB B;  1CRI A;  2ZXY A;  4NFG B;  1M70 A;  5CIF B;  1CC5 A;  3BCC D;  1IRW A;  3SWS A;  1DW1 A;  1C6S A;  1J3S A;  1NML A;  4H0J A;  2FYU D;  3CXH D;  3ZOX A;  3TF5 A;  2CXB A;  1QN2 A;  4WQ8 A;  1H1O A;  5IY5 1;  2BH5 X;  4O1Q A;  4JCG A;  5AUR A;  1KIB A;  1CXA A;  3CX5 D;  1AYG A;  1GDV A;  3VRD A;  1CIH A;  2YQB A;  1DII C;  2N18 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...