1KB9D

Yeast cytochrome bc1 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 70
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1kb9D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1kb9D01
1H9YA 3SVWA 1I54A 3CX5D 3TDKA 2OZ1B 1ZZHA 4UB8V 3L4MA 5B5EV 1CYIA 3H1ID 2AXTV 4FANA 1HJ3A 3WUIA 2C2CA 1H1OA 1M60A 1CRHA 1YICA 3PXWA 1M70A 1QKSA 2FWLA 3CXHD 3OCDB 1C6SA 1NTMD 4P4QB 3NWVA 1YEAA 3CX5W 1I6DA 3DP5A 2B10B 4RJTA 2IBZD 1SQXD 1CRYA 2QG4A 2ZXYA 2ZZS1 3JBTB 1GDVA 1OAEA 1K3GA 3L72D 2C1DA 3TYIA 5DFSA 3TGUD 4AX3A 3PHLA 2A06D 1RAQA 1KX2A 2Y0DA 1CYJA 5GTHV 1YTCA 1J3SA 3ZOOA 4WQ7A 1S5LV 1I6EA 2LITA 3HQ8A 5GTIV 1GJQA 1YCCA 4LJIA 2N18B 1CRCA 3WC8A 1CCHA 1H33A 2OZ1A 4L3GA 2B11B 5CICB 1HJ5A 1H31B 4PW9B 4AAMA 1B7VA 1L0LD 3L75D 1KB9D 4MU8A 2C1UA 1CHHA 1PPJD 1DW3A 1YFCA 3M97X 4EIDA 1I8OA 1W5CT 2AI5A 2VHDA 1RZ6A 3O1YA 1QYZA 1CSWA 1R0QA 3O20A 2N9JA 1MG3D 4Y5RA 2I8FA 2B12B 3X39A 5CIBB 1CSVA 1K3HA 1BCCD 1E29A 2LIRA 2PCBB 4EICA 1FI9A 1COTA 3RN1A 3KZIV 2CE1A 3KHUA 2D0WA 3RMZA 1CHIA 4WQCA 4L1QA 2JQRA 2MTAC 1HZUA 1SQPD 5DJQC 4EDFA 3O5CA 1C52A 3OCDA 1CSUA 5B66V 1FOCA 1LC2A 2KNCB 2BH4X 2YK3A 1RAPA 1NTZD 1M6ZA 4J20A 4K3IA 4V2KA 1MG2D 1FI7A 2C8SA 2QJYB 1CYCA 4WQEA 4RSZA 3VYMA 4H0KA 5KKZB 1NMLA 2K9JB 2YCCA 3MK7B 1PP9D 3PXTA 3RN0A 4FB1A 3ZBMA 3L70D 1CTJA 1QL3A 3A9FA 1SQBD 4YE1A 3PXSA 2D0SA 5CIFB 1S6VB 1N50A 4NFGB 3WFEC 1AYGA 3SWSA 1N90A 1LMSA 1F1CA 1SQQD 1CCRA 2XTSB 2QJKB 1ETPA 2ZONG 2C9XB 4H0JA 3OA8B 3WU2V 4QAOA 2GB8B 5CIEB 4DY9A 2C1VA 3ZOYA 4FA4A 1IRWA 4O1QA 2CA4B 1BE3D 1IQCA 1KV9A 3CXHW 1A8CA 1CTZA 3BCCD 2JWAA 2GIWA 1F1FA 1U75B 1DIQC 1IRVA 155CA 1CXCA 1OCDA 2CA3B 3ZCFA 1KYOW 1H33B 4UB6V 1GU2A 1L0ND 1IZL0 2RN0A 1JDLA 3L74D 1KX7A 5KAFV 5B6QA 1L9BC 4WQ8A 2N9YB 1CIFA 2CXBA 1YIQA 2Q3EA 4D6TD 1E2RA 2V08A 1CO6A 2L4DA 2RMZA 3SJLA 2B4ZA 1NMIA 5EXQA 1DW1A 2JTIB 5C9MA 2Y0CA 3GG2A 4IL6V 1EZVD 1KYOD 4XYDB 5CIGB 4WQBA 3HQ9A 3ITKA 3PTZA 1FCDC 3H1HD 4EIEA 1AKKA 1MZ4A 1CSXA 4PWAA 1CIHA 2N9IA 5TISV 1FJ0A 3PH2B 1C6RA 3WFDC 2N3YA 2PACA 1CIGA 4XXLA 1NIRA 2FRCA 2BH5X 3CU4A 3HQ7A 5AURA 4AANA 5E79V 1DVVA 4WQDA 1DT1A 4PD4D 3RLMA 2DGEA 2ZBOA 3L71D 1BGYD 1WEJF 3L73D 1CNOA 3WFBC 1YNRA 4Q5PA 1NNOA 2HV4A 3O0RC 2PCCB 2BLFB 4AALA 2ZOOA 3CYTI 3FWLA 1H32A 4L3HA 3DMIA 1GIWA 5DF5A 3VNWA 2B0ZB 3PLNA 3ORVA 3OA8A 1C6OA 1DW0A 1LFMA 2GC4D 4N0KA 3SXTA 3NBTA 3PRJA 2O3JA 4FA1A 2BCCD 3CP5A 1CORA 4KMGA 3GW6A 5CIDB 4JCGA 3ZOWA 2QJPB 2L91A 1BL9A 3HQ6A 5IY51 2FYUD 5DJQB 1CTYA 1NTKD 1DVHA 2AIUA 1NU1D 1HRCA 1I8PA 3ZOXA 2V07A 4A7PA 4FA5A 1DW2A 3A0HV 4FAVA 1H9XA 1C2RA 3H1JD 4WQAA 3L4OA 3H1LD 1CRGA 2GC7D 1GQ1A 1AOFA 1N15A 3DR0A 5KLVD 1AOQA 1I5TA 1KIBA 2CE0A 2N18C 2YIUB 1A56A 2BCNB 2FYNB 2MHMA 3WFCC 1CRJA 2Y0EA 1FHBA 1RZ5A 2EXVA 3VRDA 1LC1A 3CWBD 2N3BA 1YEBA 3MK7C 4EIFA 1HZVA 1CEDA 1L9JC 2C1DB 4FA9A 1KB0A 4WQ9A 1IO3A 1C75A 3SLEA 3H1KD 2BGVX 1CXAA 1HROA 2YQBA 2BPBB 1HCMA 5TJHA 3A0BV 1CRIA 1LS9A 1QN2A 1U74B 5H2FV 3ZIYA 1A2SA 4U3FD 1DIIC 2KS1A 5KLIB 1CC5A 3NBSA 1WVEC 1CHJA 1HJ4A 3C2CA 5KAIV 1GKSA 3TF5A 1FI3A 1CIEA 4GEDB 1QL4A 4AAOA 2DVHA 1W2LA 1H32B 1P84D 1N9CA 5C0ZA 5CIHB 1C7MA 5CYTR 4PJ0V 1ZRTD 1E8EA 351CA 3VMAA 1VYDA 1SQVD 4O1WA 4GYDA 1H31A 451CA 1C2NA 1EB7A 1I55A 2ORLA 1HH7A
chains in the Genus database with same CATH superfamily
2YKOA 1E5WA 3A0HH 1I54A 1L0NJ 4U3FJ 1NU1K 4UB8V 1QGKB 1HJ3A 1LWUC 1YIJP 2C0WA 1M60A 1YICA 1QKSA 2LR2A 3NXSA 3O8ZA 3AE7C 4OGQD 1G1JA 1YQ3C 3HUSA 1YEAA 2PGDA 3CWBJ 3CPWO 2IDBA 3IAOA 1GTWA 3HTKA 4ZKUA 1BSNA 1GL2A 2ZZS1 3AE6C 1PP9E 4R4MA 3TYIA 5DFSA 3TGUD 1KMIZ 4AX3A 3WUUA 1RAQA 4I7ZB 5GTHV 3D70A 3H1LG 3QH9A 1I6EA 2LITA 3BCCG 1OWAA 2WPQA 1YCCA 4LJIA 3B4SA 3WC8A 2P58A 1M1KQ 1LNQA 1L4AB 2XV5A 3E1IA 4GIFA 2JO1A 1K05A 1R5LA 1M1JC 3Q1MA 1IFIA 1H31B 3L71G 4PW9B 1UIIA 1SQBG 2N9BA 1L0LD 2Z5IA 2E76B 4ASWA 3Q5RA 4MU8A 1U57A 4Y99C 2HODA 1PPJD 1G2CA 5TISH 4D6TG 1DW3A 1YFCA 4EIDA 3B5NC 1G1IA 3L75E 1L0NE 2VHDA 4U3FG 4GOEA 1PP9J 1USDA 3SSUA 3X39A 1SQQJ 5CIBB 5AVYB 3CCRP 3CD6P 1KQGB 2LIRA 2PCBB 4EICA 2LXBA 4ZMDA 4W7ZA 3H25A 1LJ2A 2JWDA 3CWBG 3USSA 1GL2B 1SQPG 1S72P 1ZRTE 2UWJE 4RO0A 3U1AA 1RY3A 4C7RA 2MTAC 4ASVA 2P67A 1D7MA 3L70J 3TK1A 1NHLA 3L74G 5B66V 2PAJA 1JUNA 1GL2D 1M6ZA 4PJ0H 1YYCA 1QLED 4V2KA 1N7SC 1YJWP 1MG2D 1KFMA 4BXLA 2IPPA 4RSZA 1ZN5A 1NMLA 2M0BA 2FXOA 1PP9D 1LWUA 1YQ4C 3PXTA 3HD7D 1ZOYC 1CTJA 5BU8B 1SQBD 4YE1A 3L72J 2QJYC 3AE4C 1JB0J 1JOCA 1ZR4A 1S6VB 4NFGB 3CC4P 1NGMB 2BEQD 3SWSA 4XA4A 3LIDA 2J5UA 1F1CA 1JTHA 1OMIA 1URQD 2C9XB 1IO4A 3WU2V 4QAOA 4IL6X 1JMBA 3UIAA 1IRWA 4O1QA 2CA4B 3JCUE 2WSFH 3CXHW 1G2CB 5KTBA 1A8CA 3QWOC 2OYIA 2B89A 1CTZA 2B87B 2GIWA 1DEBA 2Q3IA 2AEMA 1NTMJ 1NOHA 1NU1J 1CXCA 1M7LA 3H32A 2W90A 3V2NA 3PP5A 3ZCFA 1H33B 2I1JA 2O01J 1M8OB 1IZL0 2RN0A 1NTMK 4LGDE 4XE5B 5KAFV 5B6QA 2N9YB 1CIFA 4D6TD 2KS1B 2FBWC 2V08A 1N73A 4MN4C 2YO3A 3SJLA 1H0TB 4TT3H 2FYUJ 1H89A 2B4ZA 2C9LY 2JTIB 2WQYC 4NPEA 1H0TA 1VDFA 2G3AA 3ITKA 1N73B 1FBMA 3CLQA 3AEGC 1LWUB 3JCUH 1CIHA 2WPRA 2P1JA 4OGQB 3HD7C 1QX8A 2WSFJ 1IFJA 2E74D 4WBAA 3V5BA 2XKMA 1HJBA 2FRCA 2BH5X 1JO5A 1BSHA 1SFCD 1BCCG 1BDDA 4PD4D 3TGUG 1JY3O 1JY2P 2DGEA 2ZBOA 2IYOA 1P84I 1KQFB 3VN0A 1MFTA 3AECC 2YNYA 1GU5A 1JNMA 4PV1D 1OVUA 3H1IG 1NTKJ 5KJ7C 1H32A 3FWNA 1PPJE 2PP6A 3KPEA 1DW0A 1LFMA 2ZVOB 1FDMA 3T97B 1FZFA 2FKWB 1Y47A 3PRJA 1L0LE 5H2FE 3Q5PA 2BCCD 1CORA 3GF3A 1EDJA 2FYUG 4JCGA 3FX0A 3PH0A 2WSCJ 2L91A 2K88A 3HQ6A 5IY51 2POHA 3A3YB 2HR3A 4ZKPA 1NTKD 1KYOH 1LT1A 2N1TC 1M57D 3HTKB 1W2EA 1EZVG 1HRCA 4A7PA 4FA5A 1DW2A 3RK3E 1PL5A 4KT0J 4DZOA 4FAVA 1C2RA 4WQAA 1LTAC 3H1LD 1FJPA 2GC7D 2Q5UA 1GQ1A 2OYOA 1S2EA 1AOQA 1NU1G 1N7SB 1A56A 1J1DB 4WY4A 2JEEA 3CC7P 2K1AA 3L71E 4OWFA 1JY3P 2QM7A 2CK3H 3P8MC 2KZJA 3M9HA 3CWBD 3VP8A 1SQBE 2WT7A 2HPCA 1AA0A 4RKUJ 1YEBA 3MK7C 3TYYA 1KD1Q 5L8RJ 1L9JC 5KAFE 4WQ9A 1IO3A 1BDCA 1PGPA 1X0TA 4HYTB 3VOPA 2YMKA 1HROA 4YXWH 2K37A 3M06A 3AEDC 5AVTB 5TJHA 1LS9A 3V4WA 2KUBA 1YTZI 5KAIV 4K3AA 3TF5A 4I2LC 4PJ0E 2KSJA 3HD7A 1AVOA 2WSSH 3TSIA 1W2LA 3AE3C 3F5HA 5CIHB 3H1LJ 3RK2B 1E8EA 3MP7B 1PIXA 4GYDA 5AW9B 1HUCA 1Y8AA 2OARA 2OZ1B 1ZZHA 1X22A 3D6ZA 3L4MA 3H1ID 1IZNB 4FANA 3WUIA 1WRGA 1KQSO 4RESB 2K3RA 3CXHD 2D2CD 2OTJP 2FYZA 1SQXK 1NTMD 3CX5W 2B10B 3S9OA 4RJTA 4L75A 1VQKP 3A0HE 2IBZD 4DJGA 2QG4A 1OFCX 1VQ4P 2ZXYA 1XTGB 4BRYB 3JBTB 1VF5D 2C1DA 2BCCJ 3GLMA 4LLHA 2FYNC 2R5BA 3PHLA 2A06D 1KILD 3TNUA 3I56P 4I6MC 2JDIH 1CYJA 1YTCA 1EZVI 1OX3A 1LTGC 1S5LV 3H1LE 1GJQA 3MD0A 1CRCA 1FZAA 5B66E 1RE4C 1FZCB 4O9BA 4AYCA 2B11B 1JCCA 1CW5A 5APQA 1HJ5A 3CC2P 1SFCB 2R3CA 1IFDA 1B7VA 1LT9B 2HG5D 1KYOI 2C1UA 1EDIA 3L73E 3L37A 2AXTH 3JC22 3L35A 1IFMA 1CI6A 1ZMEC 2ITAA 2AI5A 4NPFX 4DT0A 2YO2A 1PGOA 5BU5A 3HD7B 3L75G 1L0NG 1QYZA 1R0QA 2N9JA 4Y5RA 3AE5C 1K73Q 3H1JG 1CSVA 2WTYA 4JYCA 3AEEC 3CI9A 3KZIV 2CE1A 3KHUA 1YITP 1CHIA 1SLQA 4L1QA 2IYPA 3D6YA 3MUDC 3CX5E 3BRVB 3FGAD 3G3ZA 4H13D 2V7QH 1KN7A 5AVSB 3KZIH 1RHZB 2KXPB 3OCDA 1CSUA 2K9JA 5GTHE 1FC2C 2KNCB 1NTZD 4WY4B 4J20A 2W6BA 4K3IA 2OYHC 1EZVE 1CYCA 3M0AA 1UIXA 5AVRB 3V2RA 4DOJA 5KKZB 3H1HE 1Q81Q 4WY4C 2R44A 2YCCA 1SQPJ 1T2KC 4UB8H 2OQQA 1SQXG 2OYIC 1HF9A 4GDOA 2O01N 3CX5I 3L70G 5APUA 4IL6H 3PXSA 2D0SA 3NMDA 5CBOA 5CIFB 1PPJG 1EDLA 5CCGD 1N90A 1KZUB 1NTZJ 3B71A 4GKGA 2XTSB 3AE2C 2QJKB 2N1TD 1L0LG 1ETPA 3C9IA 2XNXA 3OA8B 4YXDC 3C8VA 4DY9A 2O1KA 4FA4A 2V7QJ 1SQBJ 1BE3D 1KB9H 1OW7A 1P84E 2G8YA 3D0WA 1KTMA 1ZR2A 3BCCD 3A0BH 1F1FA 2OTKE 5APSA 155CA 1FU1A 4BWNA 2IBZG 1OCDA 2CA3B 1AQTA 3CMEP 4UB6V 1GU2A 3IR9A 4H13B 1L0ND 5CJ4A 3HE5B 1JDLA 1RQUA 1ZXGA 3L74D 2GUVA 1L9BC 3BVHA 2H7HA 3LIEA 1NYHA 1AQ5A 3S1KA 1E2RA 2H8PD 1FOSF 3RL0B 4IOIH 2L5GB 1FZGA 2L4DA 5KJ7D 2BEZF 3TGUJ 1GL2C 1K9MQ 1W5CE 4BRYA 2Y0CA 1NTZE 4IL6V 1WMKA 3GG2A 5AW2B 3SFDC 3A0BE 5BVZA 3WMM0 2JR8A 4WQBA 1NKNA 2W6JH 3HQ9A 4JBZA 3PTZA 1FCDC 2J58A 2HPCB 1TU3F 1VQMP 3P7KA 1CSXA 4N78D 3VYIA 3P32A 4H44B 2FFDA 1E79H 1NTKE 3LW5H 3WU2E 1FJ0A 3HE5A 2Y9ZA 1CIGA 3H1KE 4XXLA 1NIRA 3CMAP 3HQ7A 3W68A 3P8CD 1KFNA 4WQDA 1DT1A 5AVWB 3EFFK 1BCCE 2KI7B 3L71D 1BGYD 1HWTC 2OYHA 1OXZA 1WEJF 4IL6E 3L73D 1YNRA 4GT1A 2E5YA 1N8RQ 4R4LA 1JY2N 3L74J 2PCCB 5KLVG 2ZOOA 4PV1C 4EYYQ 3L72E 1GIWA 5DF5A 3VNWA 2B0ZB 3RK3D 1VQ9P 3OA8A 1X79B 5DJTB 4C7NA 3SXTA 3NBTA 2FYUK 4FA1A 5KAIE 3RL0g 4KMGA 1FZEA 1IJDB 4B86A 4Y28J 2LKMA 3ZOWA 5GTHH 2QJPB 2QE7H 3LW5J 1DVHA 2AIUA 3A2AA 3IN6A 2FXMA 1NU1D 1I8PA 1NTZK 3L73J 2XDJA 1HVVA 3H1JD 2MKVA 1GDTA 1CRGA 1GW3A 4JPZB 1AOFA 3DR0A 3AE1C 3SWFA 1JY3N 1I5TA 1KIBA 2N18C 2W6AA 2AXCA 3KXDA 2MHMA 3WFCC 2KB7P 2ZT9C 2NRGA 1PP9G 2AXTE 1GD2E 1S5LX 5AW3B 5TISE 5KLVK 5DJUB 1HZVA 1X9VA 1CEDA 4FA9A 4W7YA 2XU6A 4H44D 5AVZB 3SLEA 1BE3J 1EXIA 2W27A 1RF1C 3IFMA 2BPBB 1HCMA 3BCCE 5H2FV 3ZIYA 2O1JA 3BRTB 3P8CE 1WVEC 1JCDA 2P7JA 2KZIA 3L70E 1HJ4A 3C2CA 3V2PA 2JP3A 5APWA 1QEXA 5AW0B 3RBXA 1RE3A 4AAOA 2DVHA 1S3JA 2DW3A 4L73A 1H32B 1N9CA 3MZWB 3CX5H 5CCHD 1NWQA 5GTIE 3VMYA 1OW6A 3MGNA 351CA 1Q7YQ 2XZRA 4O1WA 5CMZA 451CA 1C2NA 1I55A 2ZFCA 2WMMA 4U3FE 4LC1A 3Q3DA 1HH7A 1H9YA 2KK7A 1DIPA 3SVWA 3CX5D 1NVOA 2W8ZA 1CYIA 2AXTV 3N7NA 2C2CA 2WZ7A 1CRHA 2ZAEB 3PXWA 3CXHH 4K35A 3H1HG 1YHQP 3CWBE 3M0DC 1C6SA 1JTHB 1LTSC 3TNUB 1RE4A 3NWVA 4Y99B 2PFXA 4U7JA 1SQXD 1OAEA 2HLOA 1RF0A 5GTIH 2NPSC 3SWKA 3L75J 1DH3A 2WT7B 4OGQC 2E5TA 3HUSB 3U1CA 1KX2A 1PFIA 2I8DA 2Y0DA 1J3SA 2E75C 1AV1A 1BGYJ 3OA7A 3OAKA 4PV1B 3ZOOA 1N7LA 4XFJA 4H44C 4QMAA 3M9BA 1CCHA 1H33A 2OZ1A 2A45I 5AVQB 1S5LH 2H88C 1MFZA 3AE8C 4AAMA 3L75D 3WUTA 1KB9D 3HRNA 1CHHA 1SQBK 3BCCJ 3M97X 3A7OA 1I8OA 1MZ9A 1W5CT 2M3BA 2IX7C 3N4XA 1RZ6A 3O1YA 1CSWA 3C1LA 1GW4A 3O20A 5KLVE 2I8FA 3T97A 1CSBA 3R4YA 2GA1A 2R5DA 2E42A 2FY8A 1IC2A 1DEEG 5AW8B 1K3HA 3H1JE 3CCQP 1FI9A 1COTA 3RN1A 3R2PA 2AEJA 3AE9C 2D0WA 3GHGA 4ZNCA 3RMZA 1J2JB 4WQCA 1KYOE 2JQRA 1SQPD 2WPSA 4EDFA 1C52A 3RBZA 1SQVJ 1FOCA 2A06G 2M5AB 1VQ8P 4H0LD 1RAPA 2M3EA 2NPSB 4HJGH 5CJ0A 1FI7A 2C8SA 3I5CA 2QJYB 4GODA 2FFDC 2NPSA 1FS0E 2M5AA 1M90Q 5APVA 1X8YA 3RN0A 1ZW0A 1HBWA 4JYBA 1SQXE 3A9FA 3KDPB 4UB6E 3M0DA 3L72G 3NFQA 1LTTC 2ZYDA 1EQ7A 1FDIA 5KLIC 1N50A 2QRXA 1AJYA 1LMSA 1YTZT 4H0LB 1CCRA 1IK9A 2WWWA 3TGUE 2ZONG 3ABVC 4H0JA 2Q9IA 3Q2YA 5AVXB 2C1VA 3ZOYA 1NAYA 2QJPC 2MJZA 3H1KJ 1KV9A 1XTCC 2JWAA 2Q1KA 1DIQC 1OVVA 3V2QA 1Y9BA 3CL3D 4IFFA 1URQC 4IFDK 2K9YA 1JM0A 2RKLA 2OYIB 3EFGA 2KOGA 2IBZE 1EDKA 1U7JA 5KAIH 1NH4A 5AW6B 1KYOW 1BGYG 1KV4A 4TLFA 1QVFO 2IZ1A 3L74E 2Q6QA 4WQ8A 1YIQA 3RK3B 2CPSA 1L0NK 3V6IA 1MV8A 1YJ9P 4H0LC 3SWYA 2P10A 4HB1A 3VP9A 2RMZA 2B88A 1NMIA 5EXQA 1DW1A 5CCHA 4GOFA 1KYOD 4XYDB 5CIGB 2KP8A 3H1HD 4EIEA 5EFWB 1MZ4A 4OH8B 1NU1E 1KB9E 3KQGA 1LTJA 2D2CB 5TISV 1GZLA 1NTKG 1C6RA 2WSEH 3WU2H 1MUUA 2N3YA 1ZLLA 2QVAA 3WUVA 5K5GB 3CU4A 2H43A 5AURA 4AANA 5E79V 1K8AQ 1SFCC 3E7KA 3RLMA 1GK4A 1L4AD 5CHXA 1CNOA 2E74C 4WWIA 1PGQA 1SP4A 1NNOA 3GHGB 1M1JA 2IFMA 5B5EE 3CYTI 4YTPC 3FWLA 1HGZA 3NTNA 3DMIA 1EXJA 3HE4B 3ORVA 1GK6A 2GC4D 3L4FA 4N0KA 1KC8Q 1LTIC 3VMZA 3H1HJ 3CP5A 1L0LK 1PV3A 3GW6A 1FDOA 1NO4A 3AEFC 2CPBA 1AVYA 1QL2A 2FYUD 1CTYA 4Z1MH 4N78E 3RL0C 4HKZH 1PGJA 1BE3G 2V07A 4WY4D 1K04A 5CCGC 1N73C 1H88A 3A0HV 4WVZA 1H9XA 4PD4I 2B9BA 1R5SA 2YXRB 1N15A 3FXEA 1VQ5P 2CE0A 4PD4H 1KILE 2FYNB 2A06E 2JJLA 1CRJA 2Y0EA 1MKMA 1RZ5A 2EXVA 3VRDA 2KLVA 4AQRD 1EC5A 2E76D 2QIWA 4EIFA 1N86A 3V4QA 1T3UA 1C75A 3H1KD 2BGVX 1CXAA 3A0BV 1CRIA 1QN2A 1U74B 2SPZA 3RK2C 4U3FD 3PJSK 4WB4A 4L74A 1OW8A 1FOSE 3NBSA 1SQVE 1CHJA 2WPVB 2ZYAA 3U59A 4C7NB 3H1IE 1QVGO 4GEDB 1LTJC 3CCUP 1T8ZA 1VF5C 1SVFA 1M56D 1SQPK 1NJIQ 1IK7A 3KZIE 1P84D 2NPSD 5C0ZA 2HODB 1VQ7P 5CYTR 4PJ0V 1JEKA 1ZRTD 1Z56A 1LP1B 3VMAA 1VYDA 1T3JA 1SQQE 1LT9A 1J1EB 1VQPP 1RF1A 3K5BA 1H31A 1DX7A 2ORLA 1SFCA 2VRSA 3O6QB 2BCCE 1URQB 3MIWA 3TDKA 1L4AA 1VQOP 5B5EV 2C9NY 3IF4A 5CCHC 1H1OA 1FAVA 1M70A 3MTUE 3BATA 2FWLA 3CXHE 2FFDB 3MUDA 1L2PA 3BASA 3OCDB 1A02J 4P4QB 1I6DA 3CCLP 3B8EB 3DP5A 4DCKA 4IFMA 2KYVA 1CRYA 4EIJA 5KLVJ 1GDVA 1K3GA 3L72D 5CBNA 1S5LE 2QEXP 2A45G 1SQVK 3RL0D 4H13C 2ZXXA 2KLUA 1DD3A 5B66H 3F89A 5APTA 4JQ0D 2KIKA 4D6TJ 4WQ7A 2N1TA 3W67A 5GTIV 3HQ8A 2Y9YA 3CXHI 2N18B 5CCGA 1Q90D 4L3GA 2KSEA 2QSIA 1USEA 3G71P 1SQQK 5CICB 1KILC 5AW7B 1T2KD 3E1RA 1HH0A 5AVVB 2R32A 1HJ0A 3B5NB 2Q7CA 5KAFH 1VF5B 1LP1A 2WITA 1VQ6P 4C46A 4D6TE 2A45H 1BGYE 3CCEP 2QJKC 1NTMG 3FXDA 5AW1B 5KJ7A 2E76C 3M91A 2H89C 2RH0A 1OIPA 2D2CC 1IFNA 2AEFA 1MG3D 2B12B 3KYQA 1BCCD 1AFOA 2YMYA 1E29A 3L36A 2BASA 3JSVC 1VQNP 1FZCC 3CCJP 2HYNA 1HZUA 1WT6A 5DJQC 3SFEC 4YPCA 2OYHB 3O5CA 3RK2D 1S9KD 2QA4P 1LC2A 2XNDH 2BH4X 2YK3A 1FZBA 2WVRA 2E75D 2QM8A 4EI2A 5H2FH 1IFPA 1BCCJ 3AEBC 4WQEA 1BE3E 2C0XA 4CPGA 3VYMA 4H0KA 2KNCA 2IZ0A 2K9JB 1L0LJ 3MK7B 2NZ2A 3VTPC 2GUSA 4I7ZC 4FB1A 5B5EH 3ZBMA 3L70D 3L71J 2ZVNB 5AVUB 1QL3A 1Q2NA 1VQLP 3H1IJ 4EOTA 2HFED 3WFEC 1AYGA 5E79E 2FXPA 4I1LA 1A02F 4PD4E 1OVRA 1H8AA 3G4SP 1SQQD 4JF7A 3Q5SA 3CCVP 3L73G 1U7MA 1CZQA 2IFNA 1KQLA 2GB8B 5CIEB 2OGUA 1CI6B 1S4XA 1LGHB 2Z5HA 2O01H 2M8RA 1IQCA 2PRRA 2YXQB 1RQVA 4KHXA 3H6PA 1U75B 1S1CX 2Z4EA 1RF1B 1IRVA 1KILB 1S9KE 3GMAA 3AEAC 1OZHA 3S4RA 1LT9C 1YJNP 1KX7A 2BCCG 2GM4A 1Q82Q 5C39A 2CXBA 2Q3EA 1VPCA 3GHGC 3EWKA 1CO6A 3GF7A 2YKPA 3MHVA 1YBKA 3ZDMA 2LXCB 3RK3C 2J59M 5C9MA 5AW5B 2ZJSE 1EZVD 2ZXEB 1AKKA 4AUWA 1P84H 2W83C 5AW4B 4PWAA 1NTKK 2N9IA 1PZQA 1HTLC 3PH2B 3WFDC 3OJAB 2YIUC 2PACA 3D71A 2E74B 2ZT9B 3M9QA 1M1JB 1DVVA 1KILA 1JY2O 1W2BO 3WFBC 2P2UA 4Q5PA 1J1EC 3G6EP 1N2DC 1NKZB 1VL2A 2HV4A 2V4HA 3O0RC 2WSEJ 2BLFB 4AALA 3RGUA 4N6JA 2WSCH 1RE3C 1FZCA 2JKVA 5M1BA 4L3HA 1KORA 3G9RA 1SQXJ 2IBZI 2ZYGA 3PLNA 1C6OA 1L4AC 1LTJB 1JMMA 1SQPE 2O3JA 3CCSP 1NTME 1FJKA 4L76A 1RF0C 2FYUE 5KKZC 5CIDB 3HE4A 1GMJA 4NPDA 4OVNF 1QL1A 3VMXA 1BL9A 5DJQB 4W80A 1J1DC 1ZV8A 3B5NA 2ZT9D 2OTLP 3ZOXA 2E75B 3II6A 3HUSC 1ZP0C 1NTZG 3L4OA 1N7SA 1N7SD 2I1KA 3EQ2A 3CCMP 5KLVD 3H1JJ 2YIUB 1FE6A 2N1TB 1YI2P 5E79H 2BCNB 1HGVA 1FHBA 1LC1A 3B5ND 4KJMA 2N3BA 4UB6H 3H1KG 2B87A 2C1DB 1R8EA 1KB0A 1NAFA 3A5TA 1T6AA 4UB8E 1GU4A 2YQBA 5APYA 1KB9I 1RH5B 1A2SA 2YKQA 2R3SA 1DIIC 2KS1A 1DD4A 4HH2A 5KLIB 1CC5A 1SQVG 1GKSA 3I55P 1FI3A 1CIEA 1SS1A 1QL4A 4M3LA 1C7MA 5APXA 1URQA 1LTBC 3O6QA 4N3YB 3H32B 2E43A 1SQVD 3OW2O 1SQQG 1Q86Q 1EB7A
chains in the Genus database with same CATH topology
1H9YA 3SVWA 1I54A 3CX5D 3TDKA 2OZ1B 1ZZHA 4UB8V 3L4MA 5B5EV 1CYIA 3H1ID 2AXTV 4FANA 1HJ3A 3WUIA 2C2CA 1H1OA 1M60A 1CRHA 1YICA 3PXWA 1M70A 1QKSA 2FWLA 3CXHD 3OCDB 1C6SA 1NTMD 4P4QB 3NWVA 1YEAA 3CX5W 1I6DA 3DP5A 2B10B 4RJTA 2IBZD 1SQXD 1CRYA 2QG4A 2ZXYA 2ZZS1 3JBTB 1GDVA 1OAEA 1K3GA 3L72D 2C1DA 3TYIA 5DFSA 3TGUD 4AX3A 3PHLA 2A06D 1RAQA 1KX2A 2Y0DA 1CYJA 5GTHV 1YTCA 1J3SA 3ZOOA 4WQ7A 1S5LV 1I6EA 2LITA 3HQ8A 5GTIV 1GJQA 1YCCA 4LJIA 2N18B 1CRCA 3WC8A 1CCHA 1H33A 2OZ1A 4L3GA 2B11B 5CICB 1HJ5A 1H31B 4PW9B 4AAMA 1B7VA 1L0LD 3L75D 1KB9D 4MU8A 2C1UA 1CHHA 1PPJD 1DW3A 1YFCA 3M97X 4EIDA 1I8OA 1W5CT 2AI5A 2VHDA 1RZ6A 3O1YA 1QYZA 1CSWA 1R0QA 3O20A 2N9JA 1MG3D 4Y5RA 2I8FA 2B12B 3X39A 5CIBB 1CSVA 1K3HA 1BCCD 1E29A 2LIRA 2PCBB 4EICA 1FI9A 1COTA 3RN1A 3KZIV 2CE1A 3KHUA 2D0WA 3RMZA 1CHIA 4WQCA 4L1QA 2JQRA 2MTAC 1HZUA 1SQPD 5DJQC 4EDFA 3O5CA 1C52A 3OCDA 1CSUA 5B66V 1FOCA 1LC2A 2KNCB 2BH4X 2YK3A 1RAPA 1NTZD 1M6ZA 4J20A 4K3IA 4V2KA 1MG2D 1FI7A 2C8SA 2QJYB 1CYCA 4WQEA 4RSZA 3VYMA 4H0KA 5KKZB 1NMLA 2K9JB 2YCCA 3MK7B 1PP9D 3PXTA 3RN0A 4FB1A 3ZBMA 3L70D 1CTJA 1QL3A 3A9FA 1SQBD 4YE1A 3PXSA 2D0SA 5CIFB 1S6VB 1N50A 4NFGB 3WFEC 1AYGA 3SWSA 1N90A 1LMSA 1F1CA 1SQQD 1CCRA 2XTSB 2QJKB 1ETPA 2ZONG 2C9XB 4H0JA 3OA8B 3WU2V 4QAOA 2GB8B 5CIEB 4DY9A 2C1VA 3ZOYA 4FA4A 1IRWA 4O1QA 2CA4B 1BE3D 1IQCA 1KV9A 3CXHW 1A8CA 1CTZA 3BCCD 2JWAA 2GIWA 1F1FA 1U75B 1DIQC 1IRVA 155CA 1CXCA 1OCDA 2CA3B 3ZCFA 1KYOW 1H33B 4UB6V 1GU2A 1L0ND 1IZL0 2RN0A 1JDLA 3L74D 1KX7A 5KAFV 5B6QA 1L9BC 4WQ8A 2N9YB 1CIFA 2CXBA 1YIQA 2Q3EA 4D6TD 1E2RA 2V08A 1CO6A 2L4DA 2RMZA 3SJLA 2B4ZA 1NMIA 5EXQA 1DW1A 2JTIB 5C9MA 2Y0CA 3GG2A 4IL6V 1EZVD 1KYOD 4XYDB 5CIGB 4WQBA 3HQ9A 3ITKA 3PTZA 1FCDC 3H1HD 4EIEA 1AKKA 1MZ4A 1CSXA 4PWAA 1CIHA 2N9IA 5TISV 1FJ0A 3PH2B 1C6RA 3WFDC 2N3YA 2PACA 1CIGA 4XXLA 1NIRA 2FRCA 2BH5X 3CU4A 3HQ7A 5AURA 4AANA 5E79V 1DVVA 4WQDA 1DT1A 4PD4D 3RLMA 2DGEA 2ZBOA 3L71D 1BGYD 1WEJF 3L73D 1CNOA 3WFBC 1YNRA 4Q5PA 1NNOA 2HV4A 3O0RC 2PCCB 2BLFB 4AALA 2ZOOA 3CYTI 3FWLA 1H32A 4L3HA 3DMIA 1GIWA 5DF5A 3VNWA 2B0ZB 3PLNA 3ORVA 3OA8A 1C6OA 1DW0A 1LFMA 2GC4D 4N0KA 3SXTA 3NBTA 3PRJA 2O3JA 4FA1A 2BCCD 3CP5A 1CORA 4KMGA 3GW6A 5CIDB 4JCGA 3ZOWA 2QJPB 2L91A 1BL9A 3HQ6A 5IY51 2FYUD 5DJQB 1CTYA 1NTKD 1DVHA 2AIUA 1NU1D 1HRCA 1I8PA 3ZOXA 2V07A 4A7PA 4FA5A 1DW2A 3A0HV 4FAVA 1H9XA 1C2RA 3H1JD 4WQAA 3L4OA 3H1LD 1CRGA 2GC7D 1GQ1A 1AOFA 1N15A 3DR0A 5KLVD 1AOQA 1I5TA 1KIBA 2CE0A 2N18C 2YIUB 1A56A 2BCNB 2FYNB 2MHMA 3WFCC 1CRJA 2Y0EA 1FHBA 1RZ5A 2EXVA 3VRDA 1LC1A 3CWBD 2N3BA 1YEBA 3MK7C 4EIFA 1HZVA 1CEDA 1L9JC 2C1DB 4FA9A 1KB0A 4WQ9A 1IO3A 1C75A 3SLEA 3H1KD 2BGVX 1CXAA 1HROA 2YQBA 2BPBB 1HCMA 5TJHA 3A0BV 1CRIA 1LS9A 1QN2A 1U74B 5H2FV 3ZIYA 1A2SA 4U3FD 1DIIC 2KS1A 5KLIB 1CC5A 3NBSA 1WVEC 1CHJA 1HJ4A 3C2CA 5KAIV 1GKSA 3TF5A 1FI3A 1CIEA 4GEDB 1QL4A 4AAOA 2DVHA 1W2LA 1H32B 1P84D 1N9CA 5C0ZA 5CIHB 1C7MA 5CYTR 4PJ0V 1ZRTD 1E8EA 351CA 3VMAA 1VYDA 1SQVD 4O1WA 4GYDA 1H31A 451CA 1C2NA 1EB7A 1I55A 2ORLA 1HH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9Y A;  3SVW A;  1I54 A;  3CX5 D;  3TDK A;  2OZ1 B;  1ZZH A;  4UB8 V;  3L4M A;  5B5E V;  1CYI A;  3H1I D;  2AXT V;  4FAN A;  1HJ3 A;  3WUI A;  2C2C A;  1H1O A;  1M60 A;  1CRH A;  1YIC A;  3PXW A;  1M70 A;  1QKS A;  2FWL A;  3CXH D;  3OCD B;  1C6S A;  1NTM D;  4P4Q B;  3NWV A;  1YEA A;  3CX5 W;  1I6D A;  3DP5 A;  2B10 B;  4RJT A;  2IBZ D;  1SQX D;  1CRY A;  2QG4 A;  2ZXY A;  2ZZS 1;  3JBT B;  1GDV A;  1OAE A;  1K3G A;  3L72 D;  2C1D A;  3TYI A;  5DFS A;  3TGU D;  4AX3 A;  3PHL A;  2A06 D;  1RAQ A;  1KX2 A;  2Y0D A;  1CYJ A;  5GTH V;  1YTC A;  1J3S A;  3ZOO A;  4WQ7 A;  1S5L V;  1I6E A;  2LIT A;  3HQ8 A;  5GTI V;  1GJQ A;  1YCC A;  4LJI A;  2N18 B;  1CRC A;  3WC8 A;  1CCH A;  1H33 A;  2OZ1 A;  4L3G A;  2B11 B;  5CIC B;  1HJ5 A;  1H31 B;  4PW9 B;  4AAM A;  1B7V A;  1L0L D;  3L75 D;  1KB9 D;  4MU8 A;  2C1U A;  1CHH A;  1PPJ D;  1DW3 A;  1YFC A;  3M97 X;  4EID A;  1I8O A;  1W5C T;  2AI5 A;  2VHD A;  1RZ6 A;  3O1Y A;  1QYZ A;  1CSW A;  1R0Q A;  3O20 A;  2N9J A;  1MG3 D;  4Y5R A;  2I8F A;  2B12 B;  3X39 A;  5CIB B;  1CSV A;  1K3H A;  1BCC D;  1E29 A;  2LIR A;  2PCB B;  4EIC A;  1FI9 A;  1COT A;  3RN1 A;  3KZI V;  2CE1 A;  3KHU A;  2D0W A;  3RMZ A;  1CHI A;  4WQC A;  4L1Q A;  2JQR A;  2MTA C;  1HZU A;  1SQP D;  5DJQ C;  4EDF A;  3O5C A;  1C52 A;  3OCD A;  1CSU A;  5B66 V;  1FOC A;  1LC2 A;  2KNC B;  2BH4 X;  2YK3 A;  1RAP A;  1NTZ D;  1M6Z A;  4J20 A;  4K3I A;  4V2K A;  1MG2 D;  1FI7 A;  2C8S A;  2QJY B;  1CYC A;  4WQE A;  4RSZ A;  3VYM A;  4H0K A;  5KKZ B;  1NML A;  2K9J B;  2YCC A;  3MK7 B;  1PP9 D;  3PXT A;  3RN0 A;  4FB1 A;  3ZBM A;  3L70 D;  1CTJ A;  1QL3 A;  3A9F A;  1SQB D;  4YE1 A;  3PXS A;  2D0S A;  5CIF B;  1S6V B;  1N50 A;  4NFG B;  3WFE C;  1AYG A;  3SWS A;  1N90 A;  1LMS A;  1F1C A;  1SQQ D;  1CCR A;  2XTS B;  2QJK B;  1ETP A;  2ZON G;  2C9X B;  4H0J A;  3OA8 B;  3WU2 V;  4QAO A;  2GB8 B;  5CIE B;  4DY9 A;  2C1V A;  3ZOY A;  4FA4 A;  1IRW A;  4O1Q A;  2CA4 B;  1BE3 D;  1IQC A;  1KV9 A;  3CXH W;  1A8C A;  1CTZ A;  3BCC D;  2JWA A;  2GIW A;  1F1F A;  1U75 B;  1DIQ C;  1IRV A;  155C A;  1CXC A;  1OCD A;  2CA3 B;  3ZCF A;  1KYO W;  1H33 B;  4UB6 V;  1GU2 A;  1L0N D;  1IZL 0;  2RN0 A;  1JDL A;  3L74 D;  1KX7 A;  5KAF V;  5B6Q A;  1L9B C;  4WQ8 A;  2N9Y B;  1CIF A;  2CXB A;  1YIQ A;  2Q3E A;  4D6T D;  1E2R A;  2V08 A;  1CO6 A;  2L4D A;  2RMZ A;  3SJL A;  2B4Z A;  1NMI A;  5EXQ A;  1DW1 A;  2JTI B;  5C9M A;  2Y0C A;  3GG2 A;  4IL6 V;  1EZV D;  1KYO D;  4XYD B;  5CIG B;  4WQB A;  3HQ9 A;  3ITK A;  3PTZ A;  1FCD C;  3H1H D;  4EIE A;  1AKK A;  1MZ4 A;  1CSX A;  4PWA A;  1CIH A;  2N9I A;  5TIS V;  1FJ0 A;  3PH2 B;  1C6R A;  3WFD C;  2N3Y A;  2PAC A;  1CIG A;  4XXL A;  1NIR A;  2FRC A;  2BH5 X;  3CU4 A;  3HQ7 A;  5AUR A;  4AAN A;  5E79 V;  1DVV A;  4WQD A;  1DT1 A;  4PD4 D;  3RLM A;  2DGE A;  2ZBO A;  3L71 D;  1BGY D;  1WEJ F;  3L73 D;  1CNO A;  3WFB C;  1YNR A;  4Q5P A;  1NNO A;  2HV4 A;  3O0R C;  2PCC B;  2BLF B;  4AAL A;  2ZOO A;  3CYT I;  3FWL A;  1H32 A;  4L3H A;  3DMI A;  1GIW A;  5DF5 A;  3VNW A;  2B0Z B;  3PLN A;  3ORV A;  3OA8 A;  1C6O A;  1DW0 A;  1LFM A;  2GC4 D;  4N0K A;  3SXT A;  3NBT A;  3PRJ A;  2O3J A;  4FA1 A;  2BCC D;  3CP5 A;  1COR A;  4KMG A;  3GW6 A;  5CID B;  4JCG A;  3ZOW A;  2QJP B;  2L91 A;  1BL9 A;  3HQ6 A;  5IY5 1;  2FYU D;  5DJQ B;  1CTY A;  1NTK D;  1DVH A;  2AIU A;  1NU1 D;  1HRC A;  1I8P A;  3ZOX A;  2V07 A;  4A7P A;  4FA5 A;  1DW2 A;  3A0H V;  4FAV A;  1H9X A;  1C2R A;  3H1J D;  4WQA A;  3L4O A;  3H1L D;  1CRG A;  2GC7 D;  1GQ1 A;  1AOF A;  1N15 A;  3DR0 A;  5KLV D;  1AOQ A;  1I5T A;  1KIB A;  2CE0 A;  2N18 C;  2YIU B;  1A56 A;  2BCN B;  2FYN B;  2MHM A;  3WFC C;  1CRJ A;  2Y0E A;  1FHB A;  1RZ5 A;  2EXV A;  3VRD A;  1LC1 A;  3CWB D;  2N3B A;  1YEB A;  3MK7 C;  4EIF A;  1HZV A;  1CED A;  1L9J C;  2C1D B;  4FA9 A;  1KB0 A;  4WQ9 A;  1IO3 A;  1C75 A;  3SLE A;  3H1K D;  2BGV X;  1CXA A;  1HRO A;  2YQB A;  2BPB B;  1HCM A;  5TJH A;  3A0B V;  1CRI A;  1LS9 A;  1QN2 A;  1U74 B;  5H2F V;  3ZIY A;  1A2S A;  4U3F D;  1DII C;  2KS1 A;  5KLI B;  1CC5 A;  3NBS A;  1WVE C;  1CHJ A;  1HJ4 A;  3C2C A;  5KAI V;  1GKS A;  3TF5 A;  1FI3 A;  1CIE A;  4GED B;  1QL4 A;  4AAO A;  2DVH A;  1W2L A;  1H32 B;  1P84 D;  1N9C A;  5C0Z A;  5CIH B;  1C7M A;  5CYT R;  4PJ0 V;  1ZRT D;  1E8E A;  351C A;  3VMA A;  1VYD A;  1SQV D;  4O1W A;  4GYD A;  1H31 A;  451C A;  1C2N A;  1EB7 A;  1I55 A;  2ORL A;  1HH7 A; 
#chains in the Genus database with same CATH topology
 2YKO A;  1E5W A;  3A0H H;  1I54 A;  1L0N J;  4U3F J;  1NU1 K;  4UB8 V;  1QGK B;  1HJ3 A;  1LWU C;  1YIJ P;  2C0W A;  1M60 A;  1YIC A;  1QKS A;  2LR2 A;  3NXS A;  3O8Z A;  3AE7 C;  4OGQ D;  1G1J A;  1YQ3 C;  3HUS A;  1YEA A;  2PGD A;  3CWB J;  3CPW O;  2IDB A;  3IAO A;  1GTW A;  3HTK A;  4ZKU A;  1BSN A;  1GL2 A;  2ZZS 1;  3AE6 C;  1PP9 E;  4R4M A;  3TYI A;  5DFS A;  3TGU D;  1KMI Z;  4AX3 A;  3WUU A;  1RAQ A;  4I7Z B;  5GTH V;  3D70 A;  3H1L G;  3QH9 A;  1I6E A;  2LIT A;  3BCC G;  1OWA A;  2WPQ A;  1YCC A;  4LJI A;  3B4S A;  3WC8 A;  2P58 A;  1M1K Q;  1LNQ A;  1L4A B;  2XV5 A;  3E1I A;  4GIF A;  2JO1 A;  1K05 A;  1R5L A;  1M1J C;  3Q1M A;  1IFI A;  1H31 B;  3L71 G;  4PW9 B;  1UII A;  1SQB G;  2N9B A;  1L0L D;  2Z5I A;  2E76 B;  4ASW A;  3Q5R A;  4MU8 A;  1U57 A;  4Y99 C;  2HOD A;  1PPJ D;  1G2C A;  5TIS H;  4D6T G;  1DW3 A;  1YFC A;  4EID A;  3B5N C;  1G1I A;  3L75 E;  1L0N E;  2VHD A;  4U3F G;  4GOE A;  1PP9 J;  1USD A;  3SSU A;  3X39 A;  1SQQ J;  5CIB B;  5AVY B;  3CCR P;  3CD6 P;  1KQG B;  2LIR A;  2PCB B;  4EIC A;  2LXB A;  4ZMD A;  4W7Z A;  3H25 A;  1LJ2 A;  2JWD A;  3CWB G;  3USS A;  1GL2 B;  1SQP G;  1S72 P;  1ZRT E;  2UWJ E;  4RO0 A;  3U1A A;  1RY3 A;  4C7R A;  2MTA C;  4ASV A;  2P67 A;  1D7M A;  3L70 J;  3TK1 A;  1NHL A;  3L74 G;  5B66 V;  2PAJ A;  1JUN A;  1GL2 D;  1M6Z A;  4PJ0 H;  1YYC A;  1QLE D;  4V2K A;  1N7S C;  1YJW P;  1MG2 D;  1KFM A;  4BXL A;  2IPP A;  4RSZ A;  1ZN5 A;  1NML A;  2M0B A;  2FXO A;  1PP9 D;  1LWU A;  1YQ4 C;  3PXT A;  3HD7 D;  1ZOY C;  1CTJ A;  5BU8 B;  1SQB D;  4YE1 A;  3L72 J;  2QJY C;  3AE4 C;  1JB0 J;  1JOC A;  1ZR4 A;  1S6V B;  4NFG B;  3CC4 P;  1NGM B;  2BEQ D;  3SWS A;  4XA4 A;  3LID A;  2J5U A;  1F1C A;  1JTH A;  1OMI A;  1URQ D;  2C9X B;  1IO4 A;  3WU2 V;  4QAO A;  4IL6 X;  1JMB A;  3UIA A;  1IRW A;  4O1Q A;  2CA4 B;  3JCU E;  2WSF H;  3CXH W;  1G2C B;  5KTB A;  1A8C A;  3QWO C;  2OYI A;  2B89 A;  1CTZ A;  2B87 B;  2GIW A;  1DEB A;  2Q3I A;  2AEM A;  1NTM J;  1NOH A;  1NU1 J;  1CXC A;  1M7L A;  3H32 A;  2W90 A;  3V2N A;  3PP5 A;  3ZCF A;  1H33 B;  2I1J A;  2O01 J;  1M8O B;  1IZL 0;  2RN0 A;  1NTM K;  4LGD E;  4XE5 B;  5KAF V;  5B6Q A;  2N9Y B;  1CIF A;  4D6T D;  2KS1 B;  2FBW C;  2V08 A;  1N73 A;  4MN4 C;  2YO3 A;  3SJL A;  1H0T B;  4TT3 H;  2FYU J;  1H89 A;  2B4Z A;  2C9L Y;  2JTI B;  2WQY C;  4NPE A;  1H0T A;  1VDF A;  2G3A A;  3ITK A;  1N73 B;  1FBM A;  3CLQ A;  3AEG C;  1LWU B;  3JCU H;  1CIH A;  2WPR A;  2P1J A;  4OGQ B;  3HD7 C;  1QX8 A;  2WSF J;  1IFJ A;  2E74 D;  4WBA A;  3V5B A;  2XKM A;  1HJB A;  2FRC A;  2BH5 X;  1JO5 A;  1BSH A;  1SFC D;  1BCC G;  1BDD A;  4PD4 D;  3TGU G;  1JY3 O;  1JY2 P;  2DGE A;  2ZBO A;  2IYO A;  1P84 I;  1KQF B;  3VN0 A;  1MFT A;  3AEC C;  2YNY A;  1GU5 A;  1JNM A;  4PV1 D;  1OVU A;  3H1I G;  1NTK J;  5KJ7 C;  1H32 A;  3FWN A;  1PPJ E;  2PP6 A;  3KPE A;  1DW0 A;  1LFM A;  2ZVO B;  1FDM A;  3T97 B;  1FZF A;  2FKW B;  1Y47 A;  3PRJ A;  1L0L E;  5H2F E;  3Q5P A;  2BCC D;  1COR A;  3GF3 A;  1EDJ A;  2FYU G;  4JCG A;  3FX0 A;  3PH0 A;  2WSC J;  2L91 A;  2K88 A;  3HQ6 A;  5IY5 1;  2POH A;  3A3Y B;  2HR3 A;  4ZKP A;  1NTK D;  1KYO H;  1LT1 A;  2N1T C;  1M57 D;  3HTK B;  1W2E A;  1EZV G;  1HRC A;  4A7P A;  4FA5 A;  1DW2 A;  3RK3 E;  1PL5 A;  4KT0 J;  4DZO A;  4FAV A;  1C2R A;  4WQA A;  1LTA C;  3H1L D;  1FJP A;  2GC7 D;  2Q5U A;  1GQ1 A;  2OYO A;  1S2E A;  1AOQ A;  1NU1 G;  1N7S B;  1A56 A;  1J1D B;  4WY4 A;  2JEE A;  3CC7 P;  2K1A A;  3L71 E;  4OWF A;  1JY3 P;  2QM7 A;  2CK3 H;  3P8M C;  2KZJ A;  3M9H A;  3CWB D;  3VP8 A;  1SQB E;  2WT7 A;  2HPC A;  1AA0 A;  4RKU J;  1YEB A;  3MK7 C;  3TYY A;  1KD1 Q;  5L8R J;  1L9J C;  5KAF E;  4WQ9 A;  1IO3 A;  1BDC A;  1PGP A;  1X0T A;  4HYT B;  3VOP A;  2YMK A;  1HRO A;  4YXW H;  2K37 A;  3M06 A;  3AED C;  5AVT B;  5TJH A;  1LS9 A;  3V4W A;  2KUB A;  1YTZ I;  5KAI V;  4K3A A;  3TF5 A;  4I2L C;  4PJ0 E;  2KSJ A;  3HD7 A;  1AVO A;  2WSS H;  3TSI A;  1W2L A;  3AE3 C;  3F5H A;  5CIH B;  3H1L J;  3RK2 B;  1E8E A;  3MP7 B;  1PIX A;  4GYD A;  5AW9 B;  1HUC A;  1Y8A A;  2OAR A;  2OZ1 B;  1ZZH A;  1X22 A;  3D6Z A;  3L4M A;  3H1I D;  1IZN B;  4FAN A;  3WUI A;  1WRG A;  1KQS O;  4RES B;  2K3R A;  3CXH D;  2D2C D;  2OTJ P;  2FYZ A;  1SQX K;  1NTM D;  3CX5 W;  2B10 B;  3S9O A;  4RJT A;  4L75 A;  1VQK P;  3A0H E;  2IBZ D;  4DJG A;  2QG4 A;  1OFC X;  1VQ4 P;  2ZXY A;  1XTG B;  4BRY B;  3JBT B;  1VF5 D;  2C1D A;  2BCC J;  3GLM A;  4LLH A;  2FYN C;  2R5B A;  3PHL A;  2A06 D;  1KIL D;  3TNU A;  3I56 P;  4I6M C;  2JDI H;  1CYJ A;  1YTC A;  1EZV I;  1OX3 A;  1LTG C;  1S5L V;  3H1L E;  1GJQ A;  3MD0 A;  1CRC A;  1FZA A;  5B66 E;  1RE4 C;  1FZC B;  4O9B A;  4AYC A;  2B11 B;  1JCC A;  1CW5 A;  5APQ A;  1HJ5 A;  3CC2 P;  1SFC B;  2R3C A;  1IFD A;  1B7V A;  1LT9 B;  2HG5 D;  1KYO I;  2C1U A;  1EDI A;  3L73 E;  3L37 A;  2AXT H;  3JC2 2;  3L35 A;  1IFM A;  1CI6 A;  1ZME C;  2ITA A;  2AI5 A;  4NPF X;  4DT0 A;  2YO2 A;  1PGO A;  5BU5 A;  3HD7 B;  3L75 G;  1L0N G;  1QYZ A;  1R0Q A;  2N9J A;  4Y5R A;  3AE5 C;  1K73 Q;  3H1J G;  1CSV A;  2WTY A;  4JYC A;  3AEE C;  3CI9 A;  3KZI V;  2CE1 A;  3KHU A;  1YIT P;  1CHI A;  1SLQ A;  4L1Q A;  2IYP A;  3D6Y A;  3MUD C;  3CX5 E;  3BRV B;  3FGA D;  3G3Z A;  4H13 D;  2V7Q H;  1KN7 A;  5AVS B;  3KZI H;  1RHZ B;  2KXP B;  3OCD A;  1CSU A;  2K9J A;  5GTH E;  1FC2 C;  2KNC B;  1NTZ D;  4WY4 B;  4J20 A;  2W6B A;  4K3I A;  2OYH C;  1EZV E;  1CYC A;  3M0A A;  1UIX A;  5AVR B;  3V2R A;  4DOJ A;  5KKZ B;  3H1H E;  1Q81 Q;  4WY4 C;  2R44 A;  2YCC A;  1SQP J;  1T2K C;  4UB8 H;  2OQQ A;  1SQX G;  2OYI C;  1HF9 A;  4GDO A;  2O01 N;  3CX5 I;  3L70 G;  5APU A;  4IL6 H;  3PXS A;  2D0S A;  3NMD A;  5CBO A;  5CIF B;  1PPJ G;  1EDL A;  5CCG D;  1N90 A;  1KZU B;  1NTZ J;  3B71 A;  4GKG A;  2XTS B;  3AE2 C;  2QJK B;  2N1T D;  1L0L G;  1ETP A;  3C9I A;  2XNX A;  3OA8 B;  4YXD C;  3C8V A;  4DY9 A;  2O1K A;  4FA4 A;  2V7Q J;  1SQB J;  1BE3 D;  1KB9 H;  1OW7 A;  1P84 E;  2G8Y A;  3D0W A;  1KTM A;  1ZR2 A;  3BCC D;  3A0B H;  1F1F A;  2OTK E;  5APS A;  155C A;  1FU1 A;  4BWN A;  2IBZ G;  1OCD A;  2CA3 B;  1AQT A;  3CME P;  4UB6 V;  1GU2 A;  3IR9 A;  4H13 B;  1L0N D;  5CJ4 A;  3HE5 B;  1JDL A;  1RQU A;  1ZXG A;  3L74 D;  2GUV A;  1L9B C;  3BVH A;  2H7H A;  3LIE A;  1NYH A;  1AQ5 A;  3S1K A;  1E2R A;  2H8P D;  1FOS F;  3RL0 B;  4IOI H;  2L5G B;  1FZG A;  2L4D A;  5KJ7 D;  2BEZ F;  3TGU J;  1GL2 C;  1K9M Q;  1W5C E;  4BRY A;  2Y0C A;  1NTZ E;  4IL6 V;  1WMK A;  3GG2 A;  5AW2 B;  3SFD C;  3A0B E;  5BVZ A;  3WMM 0;  2JR8 A;  4WQB A;  1NKN A;  2W6J H;  3HQ9 A;  4JBZ A;  3PTZ A;  1FCD C;  2J58 A;  2HPC B;  1TU3 F;  1VQM P;  3P7K A;  1CSX A;  4N78 D;  3VYI A;  3P32 A;  4H44 B;  2FFD A;  1E79 H;  1NTK E;  3LW5 H;  3WU2 E;  1FJ0 A;  3HE5 A;  2Y9Z A;  1CIG A;  3H1K E;  4XXL A;  1NIR A;  3CMA P;  3HQ7 A;  3W68 A;  3P8C D;  1KFN A;  4WQD A;  1DT1 A;  5AVW B;  3EFF K;  1BCC E;  2KI7 B;  3L71 D;  1BGY D;  1HWT C;  2OYH A;  1OXZ A;  1WEJ F;  4IL6 E;  3L73 D;  1YNR A;  4GT1 A;  2E5Y A;  1N8R Q;  4R4L A;  1JY2 N;  3L74 J;  2PCC B;  5KLV G;  2ZOO A;  4PV1 C;  4EYY Q;  3L72 E;  1GIW A;  5DF5 A;  3VNW A;  2B0Z B;  3RK3 D;  1VQ9 P;  3OA8 A;  1X79 B;  5DJT B;  4C7N A;  3SXT A;  3NBT A;  2FYU K;  4FA1 A;  5KAI E;  3RL0 g;  4KMG A;  1FZE A;  1IJD B;  4B86 A;  4Y28 J;  2LKM A;  3ZOW A;  5GTH H;  2QJP B;  2QE7 H;  3LW5 J;  1DVH A;  2AIU A;  3A2A A;  3IN6 A;  2FXM A;  1NU1 D;  1I8P A;  1NTZ K;  3L73 J;  2XDJ A;  1HVV A;  3H1J D;  2MKV A;  1GDT A;  1CRG A;  1GW3 A;  4JPZ B;  1AOF A;  3DR0 A;  3AE1 C;  3SWF A;  1JY3 N;  1I5T A;  1KIB A;  2N18 C;  2W6A A;  2AXC A;  3KXD A;  2MHM A;  3WFC C;  2KB7 P;  2ZT9 C;  2NRG A;  1PP9 G;  2AXT E;  1GD2 E;  1S5L X;  5AW3 B;  5TIS E;  5KLV K;  5DJU B;  1HZV A;  1X9V A;  1CED A;  4FA9 A;  4W7Y A;  2XU6 A;  4H44 D;  5AVZ B;  3SLE A;  1BE3 J;  1EXI A;  2W27 A;  1RF1 C;  3IFM A;  2BPB B;  1HCM A;  3BCC E;  5H2F V;  3ZIY A;  2O1J A;  3BRT B;  3P8C E;  1WVE C;  1JCD A;  2P7J A;  2KZI A;  3L70 E;  1HJ4 A;  3C2C A;  3V2P A;  2JP3 A;  5APW A;  1QEX A;  5AW0 B;  3RBX A;  1RE3 A;  4AAO A;  2DVH A;  1S3J A;  2DW3 A;  4L73 A;  1H32 B;  1N9C A;  3MZW B;  3CX5 H;  5CCH D;  1NWQ A;  5GTI E;  3VMY A;  1OW6 A;  3MGN A;  351C A;  1Q7Y Q;  2XZR A;  4O1W A;  5CMZ A;  451C A;  1C2N A;  1I55 A;  2ZFC A;  2WMM A;  4U3F E;  4LC1 A;  3Q3D A;  1HH7 A;  1H9Y A;  2KK7 A;  1DIP A;  3SVW A;  3CX5 D;  1NVO A;  2W8Z A;  1CYI A;  2AXT V;  3N7N A;  2C2C A;  2WZ7 A;  1CRH A;  2ZAE B;  3PXW A;  3CXH H;  4K35 A;  3H1H G;  1YHQ P;  3CWB E;  3M0D C;  1C6S A;  1JTH B;  1LTS C;  3TNU B;  1RE4 A;  3NWV A;  4Y99 B;  2PFX A;  4U7J A;  1SQX D;  1OAE A;  2HLO A;  1RF0 A;  5GTI H;  2NPS C;  3SWK A;  3L75 J;  1DH3 A;  2WT7 B;  4OGQ C;  2E5T A;  3HUS B;  3U1C A;  1KX2 A;  1PFI A;  2I8D A;  2Y0D A;  1J3S A;  2E75 C;  1AV1 A;  1BGY J;  3OA7 A;  3OAK A;  4PV1 B;  3ZOO A;  1N7L A;  4XFJ A;  4H44 C;  4QMA A;  3M9B A;  1CCH A;  1H33 A;  2OZ1 A;  2A45 I;  5AVQ B;  1S5L H;  2H88 C;  1MFZ A;  3AE8 C;  4AAM A;  3L75 D;  3WUT A;  1KB9 D;  3HRN A;  1CHH A;  1SQB K;  3BCC J;  3M97 X;  3A7O A;  1I8O A;  1MZ9 A;  1W5C T;  2M3B A;  2IX7 C;  3N4X A;  1RZ6 A;  3O1Y A;  1CSW A;  3C1L A;  1GW4 A;  3O20 A;  5KLV E;  2I8F A;  3T97 A;  1CSB A;  3R4Y A;  2GA1 A;  2R5D A;  2E42 A;  2FY8 A;  1IC2 A;  1DEE G;  5AW8 B;  1K3H A;  3H1J E;  3CCQ P;  1FI9 A;  1COT A;  3RN1 A;  3R2P A;  2AEJ A;  3AE9 C;  2D0W A;  3GHG A;  4ZNC A;  3RMZ A;  1J2J B;  4WQC A;  1KYO E;  2JQR A;  1SQP D;  2WPS A;  4EDF A;  1C52 A;  3RBZ A;  1SQV J;  1FOC A;  2A06 G;  2M5A B;  1VQ8 P;  4H0L D;  1RAP A;  2M3E A;  2NPS B;  4HJG H;  5CJ0 A;  1FI7 A;  2C8S A;  3I5C A;  2QJY B;  4GOD A;  2FFD C;  2NPS A;  1FS0 E;  2M5A A;  1M90 Q;  5APV A;  1X8Y A;  3RN0 A;  1ZW0 A;  1HBW A;  4JYB A;  1SQX E;  3A9F A;  3KDP B;  4UB6 E;  3M0D A;  3L72 G;  3NFQ A;  1LTT C;  2ZYD A;  1EQ7 A;  1FDI A;  5KLI C;  1N50 A;  2QRX A;  1AJY A;  1LMS A;  1YTZ T;  4H0L B;  1CCR A;  1IK9 A;  2WWW A;  3TGU E;  2ZON G;  3ABV C;  4H0J A;  2Q9I A;  3Q2Y A;  5AVX B;  2C1V A;  3ZOY A;  1NAY A;  2QJP C;  2MJZ A;  3H1K J;  1KV9 A;  1XTC C;  2JWA A;  2Q1K A;  1DIQ C;  1OVV A;  3V2Q A;  1Y9B A;  3CL3 D;  4IFF A;  1URQ C;  4IFD K;  2K9Y A;  1JM0 A;  2RKL A;  2OYI B;  3EFG A;  2KOG A;  2IBZ E;  1EDK A;  1U7J A;  5KAI H;  1NH4 A;  5AW6 B;  1KYO W;  1BGY G;  1KV4 A;  4TLF A;  1QVF O;  2IZ1 A;  3L74 E;  2Q6Q A;  4WQ8 A;  1YIQ A;  3RK3 B;  2CPS A;  1L0N K;  3V6I A;  1MV8 A;  1YJ9 P;  4H0L C;  3SWY A;  2P10 A;  4HB1 A;  3VP9 A;  2RMZ A;  2B88 A;  1NMI A;  5EXQ A;  1DW1 A;  5CCH A;  4GOF A;  1KYO D;  4XYD B;  5CIG B;  2KP8 A;  3H1H D;  4EIE A;  5EFW B;  1MZ4 A;  4OH8 B;  1NU1 E;  1KB9 E;  3KQG A;  1LTJ A;  2D2C B;  5TIS V;  1GZL A;  1NTK G;  1C6R A;  2WSE H;  3WU2 H;  1MUU A;  2N3Y A;  1ZLL A;  2QVA A;  3WUV A;  5K5G B;  3CU4 A;  2H43 A;  5AUR A;  4AAN A;  5E79 V;  1K8A Q;  1SFC C;  3E7K A;  3RLM A;  1GK4 A;  1L4A D;  5CHX A;  1CNO A;  2E74 C;  4WWI A;  1PGQ A;  1SP4 A;  1NNO A;  3GHG B;  1M1J A;  2IFM A;  5B5E E;  3CYT I;  4YTP C;  3FWL A;  1HGZ A;  3NTN A;  3DMI A;  1EXJ A;  3HE4 B;  3ORV A;  1GK6 A;  2GC4 D;  3L4F A;  4N0K A;  1KC8 Q;  1LTI C;  3VMZ A;  3H1H J;  3CP5 A;  1L0L K;  1PV3 A;  3GW6 A;  1FDO A;  1NO4 A;  3AEF C;  2CPB A;  1AVY A;  1QL2 A;  2FYU D;  1CTY A;  4Z1M H;  4N78 E;  3RL0 C;  4HKZ H;  1PGJ A;  1BE3 G;  2V07 A;  4WY4 D;  1K04 A;  5CCG C;  1N73 C;  1H88 A;  3A0H V;  4WVZ A;  1H9X A;  4PD4 I;  2B9B A;  1R5S A;  2YXR B;  1N15 A;  3FXE A;  1VQ5 P;  2CE0 A;  4PD4 H;  1KIL E;  2FYN B;  2A06 E;  2JJL A;  1CRJ A;  2Y0E A;  1MKM A;  1RZ5 A;  2EXV A;  3VRD A;  2KLV A;  4AQR D;  1EC5 A;  2E76 D;  2QIW A;  4EIF A;  1N86 A;  3V4Q A;  1T3U A;  1C75 A;  3H1K D;  2BGV X;  1CXA A;  3A0B V;  1CRI A;  1QN2 A;  1U74 B;  2SPZ A;  3RK2 C;  4U3F D;  3PJS K;  4WB4 A;  4L74 A;  1OW8 A;  1FOS E;  3NBS A;  1SQV E;  1CHJ A;  2WPV B;  2ZYA A;  3U59 A;  4C7N B;  3H1I E;  1QVG O;  4GED B;  1LTJ C;  3CCU P;  1T8Z A;  1VF5 C;  1SVF A;  1M56 D;  1SQP K;  1NJI Q;  1IK7 A;  3KZI E;  1P84 D;  2NPS D;  5C0Z A;  2HOD B;  1VQ7 P;  5CYT R;  4PJ0 V;  1JEK A;  1ZRT D;  1Z56 A;  1LP1 B;  3VMA A;  1VYD A;  1T3J A;  1SQQ E;  1LT9 A;  1J1E B;  1VQP P;  1RF1 A;  3K5B A;  1H31 A;  1DX7 A;  2ORL A;  1SFC A;  2VRS A;  3O6Q B;  2BCC E;  1URQ B;  3MIW A;  3TDK A;  1L4A A;  1VQO P;  5B5E V;  2C9N Y;  3IF4 A;  5CCH C;  1H1O A;  1FAV A;  1M70 A;  3MTU E;  3BAT A;  2FWL A;  3CXH E;  2FFD B;  3MUD A;  1L2P A;  3BAS A;  3OCD B;  1A02 J;  4P4Q B;  1I6D A;  3CCL P;  3B8E B;  3DP5 A;  4DCK A;  4IFM A;  2KYV A;  1CRY A;  4EIJ A;  5KLV J;  1GDV A;  1K3G A;  3L72 D;  5CBN A;  1S5L E;  2QEX P;  2A45 G;  1SQV K;  3RL0 D;  4H13 C;  2ZXX A;  2KLU A;  1DD3 A;  5B66 H;  3F89 A;  5APT A;  4JQ0 D;  2KIK A;  4D6T J;  4WQ7 A;  2N1T A;  3W67 A;  5GTI V;  3HQ8 A;  2Y9Y A;  3CXH I;  2N18 B;  5CCG A;  1Q90 D;  4L3G A;  2KSE A;  2QSI A;  1USE A;  3G71 P;  1SQQ K;  5CIC B;  1KIL C;  5AW7 B;  1T2K D;  3E1R A;  1HH0 A;  5AVV B;  2R32 A;  1HJ0 A;  3B5N B;  2Q7C A;  5KAF H;  1VF5 B;  1LP1 A;  2WIT A;  1VQ6 P;  4C46 A;  4D6T E;  2A45 H;  1BGY E;  3CCE P;  2QJK C;  1NTM G;  3FXD A;  5AW1 B;  5KJ7 A;  2E76 C;  3M91 A;  2H89 C;  2RH0 A;  1OIP A;  2D2C C;  1IFN A;  2AEF A;  1MG3 D;  2B12 B;  3KYQ A;  1BCC D;  1AFO A;  2YMY A;  1E29 A;  3L36 A;  2BAS A;  3JSV C;  1VQN P;  1FZC C;  3CCJ P;  2HYN A;  1HZU A;  1WT6 A;  5DJQ C;  3SFE C;  4YPC A;  2OYH B;  3O5C A;  3RK2 D;  1S9K D;  2QA4 P;  1LC2 A;  2XND H;  2BH4 X;  2YK3 A;  1FZB A;  2WVR A;  2E75 D;  2QM8 A;  4EI2 A;  5H2F H;  1IFP A;  1BCC J;  3AEB C;  4WQE A;  1BE3 E;  2C0X A;  4CPG A;  3VYM A;  4H0K A;  2KNC A;  2IZ0 A;  2K9J B;  1L0L J;  3MK7 B;  2NZ2 A;  3VTP C;  2GUS A;  4I7Z C;  4FB1 A;  5B5E H;  3ZBM A;  3L70 D;  3L71 J;  2ZVN B;  5AVU B;  1QL3 A;  1Q2N A;  1VQL P;  3H1I J;  4EOT A;  2HFE D;  3WFE C;  1AYG A;  5E79 E;  2FXP A;  4I1L A;  1A02 F;  4PD4 E;  1OVR A;  1H8A A;  3G4S P;  1SQQ D;  4JF7 A;  3Q5S A;  3CCV P;  3L73 G;  1U7M A;  1CZQ A;  2IFN A;  1KQL A;  2GB8 B;  5CIE B;  2OGU A;  1CI6 B;  1S4X A;  1LGH B;  2Z5H A;  2O01 H;  2M8R A;  1IQC A;  2PRR A;  2YXQ B;  1RQV A;  4KHX A;  3H6P A;  1U75 B;  1S1C X;  2Z4E A;  1RF1 B;  1IRV A;  1KIL B;  1S9K E;  3GMA A;  3AEA C;  1OZH A;  3S4R A;  1LT9 C;  1YJN P;  1KX7 A;  2BCC G;  2GM4 A;  1Q82 Q;  5C39 A;  2CXB A;  2Q3E A;  1VPC A;  3GHG C;  3EWK A;  1CO6 A;  3GF7 A;  2YKP A;  3MHV A;  1YBK A;  3ZDM A;  2LXC B;  3RK3 C;  2J59 M;  5C9M A;  5AW5 B;  2ZJS E;  1EZV D;  2ZXE B;  1AKK A;  4AUW A;  1P84 H;  2W83 C;  5AW4 B;  4PWA A;  1NTK K;  2N9I A;  1PZQ A;  1HTL C;  3PH2 B;  3WFD C;  3OJA B;  2YIU C;  2PAC A;  3D71 A;  2E74 B;  2ZT9 B;  3M9Q A;  1M1J B;  1DVV A;  1KIL A;  1JY2 O;  1W2B O;  3WFB C;  2P2U A;  4Q5P A;  1J1E C;  3G6E P;  1N2D C;  1NKZ B;  1VL2 A;  2HV4 A;  2V4H A;  3O0R C;  2WSE J;  2BLF B;  4AAL A;  3RGU A;  4N6J A;  2WSC H;  1RE3 C;  1FZC A;  2JKV A;  5M1B A;  4L3H A;  1KOR A;  3G9R A;  1SQX J;  2IBZ I;  2ZYG A;  3PLN A;  1C6O A;  1L4A C;  1LTJ B;  1JMM A;  1SQP E;  2O3J A;  3CCS P;  1NTM E;  1FJK A;  4L76 A;  1RF0 C;  2FYU E;  5KKZ C;  5CID B;  3HE4 A;  1GMJ A;  4NPD A;  4OVN F;  1QL1 A;  3VMX A;  1BL9 A;  5DJQ B;  4W80 A;  1J1D C;  1ZV8 A;  3B5N A;  2ZT9 D;  2OTL P;  3ZOX A;  2E75 B;  3II6 A;  3HUS C;  1ZP0 C;  1NTZ G;  3L4O A;  1N7S A;  1N7S D;  2I1K A;  3EQ2 A;  3CCM P;  5KLV D;  3H1J J;  2YIU B;  1FE6 A;  2N1T B;  1YI2 P;  5E79 H;  2BCN B;  1HGV A;  1FHB A;  1LC1 A;  3B5N D;  4KJM A;  2N3B A;  4UB6 H;  3H1K G;  2B87 A;  2C1D B;  1R8E A;  1KB0 A;  1NAF A;  3A5T A;  1T6A A;  4UB8 E;  1GU4 A;  2YQB A;  5APY A;  1KB9 I;  1RH5 B;  1A2S A;  2YKQ A;  2R3S A;  1DII C;  2KS1 A;  1DD4 A;  4HH2 A;  5KLI B;  1CC5 A;  1SQV G;  1GKS A;  3I55 P;  1FI3 A;  1CIE A;  1SS1 A;  1QL4 A;  4M3L A;  1C7M A;  5APX A;  1URQ A;  1LTB C;  3O6Q A;  4N3Y B;  3H32 B;  2E43 A;  1SQV D;  3OW2 O;  1SQQ G;  1Q86 Q;  1EB7 A; 
#chains in the Genus database with same CATH homology
 1H9Y A;  3SVW A;  1I54 A;  3CX5 D;  3TDK A;  2OZ1 B;  1ZZH A;  4UB8 V;  3L4M A;  5B5E V;  1CYI A;  3H1I D;  2AXT V;  4FAN A;  1HJ3 A;  3WUI A;  2C2C A;  1H1O A;  1M60 A;  1CRH A;  1YIC A;  3PXW A;  1M70 A;  1QKS A;  2FWL A;  3CXH D;  3OCD B;  1C6S A;  1NTM D;  4P4Q B;  3NWV A;  1YEA A;  3CX5 W;  1I6D A;  3DP5 A;  2B10 B;  4RJT A;  2IBZ D;  1SQX D;  1CRY A;  2QG4 A;  2ZXY A;  2ZZS 1;  3JBT B;  1GDV A;  1OAE A;  1K3G A;  3L72 D;  2C1D A;  3TYI A;  5DFS A;  3TGU D;  4AX3 A;  3PHL A;  2A06 D;  1RAQ A;  1KX2 A;  2Y0D A;  1CYJ A;  5GTH V;  1YTC A;  1J3S A;  3ZOO A;  4WQ7 A;  1S5L V;  1I6E A;  2LIT A;  3HQ8 A;  5GTI V;  1GJQ A;  1YCC A;  4LJI A;  2N18 B;  1CRC A;  3WC8 A;  1CCH A;  1H33 A;  2OZ1 A;  4L3G A;  2B11 B;  5CIC B;  1HJ5 A;  1H31 B;  4PW9 B;  4AAM A;  1B7V A;  1L0L D;  3L75 D;  1KB9 D;  4MU8 A;  2C1U A;  1CHH A;  1PPJ D;  1DW3 A;  1YFC A;  3M97 X;  4EID A;  1I8O A;  1W5C T;  2AI5 A;  2VHD A;  1RZ6 A;  3O1Y A;  1QYZ A;  1CSW A;  1R0Q A;  3O20 A;  2N9J A;  1MG3 D;  4Y5R A;  2I8F A;  2B12 B;  3X39 A;  5CIB B;  1CSV A;  1K3H A;  1BCC D;  1E29 A;  2LIR A;  2PCB B;  4EIC A;  1FI9 A;  1COT A;  3RN1 A;  3KZI V;  2CE1 A;  3KHU A;  2D0W A;  3RMZ A;  1CHI A;  4WQC A;  4L1Q A;  2JQR A;  2MTA C;  1HZU A;  1SQP D;  5DJQ C;  4EDF A;  3O5C A;  1C52 A;  3OCD A;  1CSU A;  5B66 V;  1FOC A;  1LC2 A;  2KNC B;  2BH4 X;  2YK3 A;  1RAP A;  1NTZ D;  1M6Z A;  4J20 A;  4K3I A;  4V2K A;  1MG2 D;  1FI7 A;  2C8S A;  2QJY B;  1CYC A;  4WQE A;  4RSZ A;  3VYM A;  4H0K A;  5KKZ B;  1NML A;  2K9J B;  2YCC A;  3MK7 B;  1PP9 D;  3PXT A;  3RN0 A;  4FB1 A;  3ZBM A;  3L70 D;  1CTJ A;  1QL3 A;  3A9F A;  1SQB D;  4YE1 A;  3PXS A;  2D0S A;  5CIF B;  1S6V B;  1N50 A;  4NFG B;  3WFE C;  1AYG A;  3SWS A;  1N90 A;  1LMS A;  1F1C A;  1SQQ D;  1CCR A;  2XTS B;  2QJK B;  1ETP A;  2ZON G;  2C9X B;  4H0J A;  3OA8 B;  3WU2 V;  4QAO A;  2GB8 B;  5CIE B;  4DY9 A;  2C1V A;  3ZOY A;  4FA4 A;  1IRW A;  4O1Q A;  2CA4 B;  1BE3 D;  1IQC A;  1KV9 A;  3CXH W;  1A8C A;  1CTZ A;  3BCC D;  2JWA A;  2GIW A;  1F1F A;  1U75 B;  1DIQ C;  1IRV A;  155C A;  1CXC A;  1OCD A;  2CA3 B;  3ZCF A;  1KYO W;  1H33 B;  4UB6 V;  1GU2 A;  1L0N D;  1IZL 0;  2RN0 A;  1JDL A;  3L74 D;  1KX7 A;  5KAF V;  5B6Q A;  1L9B C;  4WQ8 A;  2N9Y B;  1CIF A;  2CXB A;  1YIQ A;  2Q3E A;  4D6T D;  1E2R A;  2V08 A;  1CO6 A;  2L4D A;  2RMZ A;  3SJL A;  2B4Z A;  1NMI A;  5EXQ A;  1DW1 A;  2JTI B;  5C9M A;  2Y0C A;  3GG2 A;  4IL6 V;  1EZV D;  1KYO D;  4XYD B;  5CIG B;  4WQB A;  3HQ9 A;  3ITK A;  3PTZ A;  1FCD C;  3H1H D;  4EIE A;  1AKK A;  1MZ4 A;  1CSX A;  4PWA A;  1CIH A;  2N9I A;  5TIS V;  1FJ0 A;  3PH2 B;  1C6R A;  3WFD C;  2N3Y A;  2PAC A;  1CIG A;  4XXL A;  1NIR A;  2FRC A;  2BH5 X;  3CU4 A;  3HQ7 A;  5AUR A;  4AAN A;  5E79 V;  1DVV A;  4WQD A;  1DT1 A;  4PD4 D;  3RLM A;  2DGE A;  2ZBO A;  3L71 D;  1BGY D;  1WEJ F;  3L73 D;  1CNO A;  3WFB C;  1YNR A;  4Q5P A;  1NNO A;  2HV4 A;  3O0R C;  2PCC B;  2BLF B;  4AAL A;  2ZOO A;  3CYT I;  3FWL A;  1H32 A;  4L3H A;  3DMI A;  1GIW A;  5DF5 A;  3VNW A;  2B0Z B;  3PLN A;  3ORV A;  3OA8 A;  1C6O A;  1DW0 A;  1LFM A;  2GC4 D;  4N0K A;  3SXT A;  3NBT A;  3PRJ A;  2O3J A;  4FA1 A;  2BCC D;  3CP5 A;  1COR A;  4KMG A;  3GW6 A;  5CID B;  4JCG A;  3ZOW A;  2QJP B;  2L91 A;  1BL9 A;  3HQ6 A;  5IY5 1;  2FYU D;  5DJQ B;  1CTY A;  1NTK D;  1DVH A;  2AIU A;  1NU1 D;  1HRC A;  1I8P A;  3ZOX A;  2V07 A;  4A7P A;  4FA5 A;  1DW2 A;  3A0H V;  4FAV A;  1H9X A;  1C2R A;  3H1J D;  4WQA A;  3L4O A;  3H1L D;  1CRG A;  2GC7 D;  1GQ1 A;  1AOF A;  1N15 A;  3DR0 A;  5KLV D;  1AOQ A;  1I5T A;  1KIB A;  2CE0 A;  2N18 C;  2YIU B;  1A56 A;  2BCN B;  2FYN B;  2MHM A;  3WFC C;  1CRJ A;  2Y0E A;  1FHB A;  1RZ5 A;  2EXV A;  3VRD A;  1LC1 A;  3CWB D;  2N3B A;  1YEB A;  3MK7 C;  4EIF A;  1HZV A;  1CED A;  1L9J C;  2C1D B;  4FA9 A;  1KB0 A;  4WQ9 A;  1IO3 A;  1C75 A;  3SLE A;  3H1K D;  2BGV X;  1CXA A;  1HRO A;  2YQB A;  2BPB B;  1HCM A;  5TJH A;  3A0B V;  1CRI A;  1LS9 A;  1QN2 A;  1U74 B;  5H2F V;  3ZIY A;  1A2S A;  4U3F D;  1DII C;  2KS1 A;  5KLI B;  1CC5 A;  3NBS A;  1WVE C;  1CHJ A;  1HJ4 A;  3C2C A;  5KAI V;  1GKS A;  3TF5 A;  1FI3 A;  1CIE A;  4GED B;  1QL4 A;  4AAO A;  2DVH A;  1W2L A;  1H32 B;  1P84 D;  1N9C A;  5C0Z A;  5CIH B;  1C7M A;  5CYT R;  4PJ0 V;  1ZRT D;  1E8E A;  351C A;  3VMA A;  1VYD A;  1SQV D;  4O1W A;  4GYD A;  1H31 A;  451C A;  1C2N A;  1EB7 A;  1I55 A;  2ORL A;  1HH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...