1KB9D

Yeast cytochrome bc1 complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 70
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1kb9D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1kb9D01
3CU4A 1P84D 1C52A 4J20A 3L73D 3ZOXA 3BCCD 4AALA 1YTCA 1BE3D 1GU2A 4WQBA 1C75A 1L9JC 1HJ5A 3TYIA 1HJ4A 2CE1A 1CO6A 1U75B 4RSZA 4FANA 2QG4A 3HQ8A 1H31A 2V07A 4Y5RA 2N9JA 1DIQC 3MK7C 2K9JB 5AURA 1CCRA 3PXWA 2C1DA 1DVHA 2Q3EA 1L0ND 3O5CA 4P4QB 5C9MA 2AIUA 3OA8A 3H1LD 2B10B 4A7PA 4FAVA 1CHIA 1C2NA 1RAQA 1I8PA 1CORA 4WQEA 3MK7B 1KB0A 3L71D 3H1JD 1N9CA 5CIFB 4O1QA 2C1VA 1CIGA 2ZZS1 1I6DA 2N3BA 5B66V 4FA4A 3WFBC 2FRCA 1FI9A 2ZONG 3ZCFA 2FYUD 3PTZA 4V2KA 1H33A 2JQRA 1CRCA 5KAIV 3A0BV 4D6TD 1GIWA 1SQXD 1FJ0A 1SQPD 4H0KA 4PD4D 5CYTR 5GTHV 1PPJD 3ORVA 5IY51 1CHHA 1KV9A 1A56A 1J3SA 2IBZD 2BH4X 1QKSA 3OCDA 3PH2B 3DMIA 3H1ID 2B0ZB 1F1FA 2B12B 1GDVA 1HZUA 1CCHA 5CIHB 4IL6V 1S6VB 1NNOA 3TGUD 3NBTA 3PXSA 5GTIV 4YE1A 1DIIC 1CTJA 1CSVA 3VRDA 3H1KD 4Q5PA 1KB9D 2BCNB 1FOCA 4L3GA 1CXCA 1W2LA 4QAOA 3L75D 1C7MA 3HQ6A 2XTSB 1YEBA 4AANA 1H9YA 1W5CT 3ZOYA 1KIBA 1CNOA 3ZOOA 1CEDA 1K3HA 5CIDB 1YIQA 2LITA 2B4ZA 1LS9A 1AOFA 4LJIA 5CIBB 1QL3A 1DW0A 2PACA 4RJTA 3SVWA 2RN0A 3FWLA 3CYTI 1PP9D 2C2CA 5EXQA 5E79V 3SJLA 4FA5A 2YK3A 3WUIA 1M60A 3RN1A 1FCDC 1EZVD 1K3GA 1QYZA 2MTAC 2N9IA 1IZL0 1L0LD 2DGEA 1R0QA 1EB7A 1N50A 4PW9B 4EIEA 1CYIA 1B7VA 5KLIB 3DP5A 2RMZA 1IQCA 1H31B 4L3HA 2KS1A 2C1UA 3SXTA 2CXBA 3O20A 2CA4B 5KAFV 1MG2D 1U74B 1QN2A 4WQDA 3HQ7A 5KKZB 2C1DB 5TISV 1ZRTD 2CA3B 2BLFB 3NBSA 1AYGA 1SQVD 1BGYD 3NWVA 3L70D 1H32A 351CA 1IRVA 1HCMA 1C6RA 1CRJA 3CP5A 3VYMA 2PCCB 1HH7A 1CYJA 2FWLA 1SQQD 3WC8A 3L4MA 4WQAA 4AAOA 1YNRA 2O3JA 4PWAA 4MU8A 1HRCA 1A8CA 1YCCA 4WQ8A 3CXHW 2FYNB 3H1HD 1CC5A 2C9XB 1MZ4A 1AKKA 2JTIB 3HQ9A 3JBTB 1H33B 1A2SA 1YFCA 3ITKA 1OCDA 2GC4D 3DR0A 4NFGB 2Y0DA 4GEDB 2N9YB 1DW2A 3ZOWA 1OAEA 3GG2A 1NMLA 4N0KA 3RN0A 1HJ3A 5C0ZA 1CRHA 3ZBMA 1M6ZA 1C6SA 2V08A 1FI3A 2QJPB 2Y0EA 3OCDB 2L4DA 3CX5W 1CYCA 1H9XA 4UB8V 4DY9A 1NTMD 1E8EA 1IRWA 2YCCA 3CWBD 2D0SA 4WQ7A 1S5LV 1ZZHA 3X39A 2LIRA 2N18C 1GKSA 1DW3A 2Y0CA 2KNCB 1YICA 1I6EA 1NU1D 2OZ1A 1IO3A 1WVEC 5B5EV 3GW6A 5B6QA 2I8FA 3TF5A 2QJYB 1FI7A 1E2RA 1E29A 5CIEB 1C2RA 2A06D 1LFMA 2BGVX 4O1WA 3PHLA 4KMGA 1BL9A 3A9FA 5DF5A 3WFEC 1NMIA 3CXHD 1KX2A 4H0JA 2GB8B 1CRYA 4WQCA 2L91A 5CICB 4EDFA 1CIEA 1QL4A 2BH5X 2GC7D 4K3IA 3WFCC 2YQBA 5DFSA 2D0WA 1JDLA 1BCCD 2ZBOA 2BPBB 4EIFA 2AXTV 1FHBA 2ZXYA 4EICA 2C8SA 4U3FD 3VMAA 4FA1A 3O0RC 1CHJA 5CIGB 1H1OA 3CX5D 2YIUB 5TJHA 4EIDA 3OA8B 2B11B 1KYOW 2DVHA 3L4OA 4AAMA 3L72D 3WU2V 1CSUA 1NTKD 4FA9A 1AOQA 1DW1A 2AI5A 3KZIV 4JCGA 1L9BC 1F1CA 1I54A 1HZVA 1CSWA 1H32B 1N15A 1DVVA 1YEAA 1I8OA 1SQBD 2ORLA 2N3YA 4AX3A 3SLEA 1CSXA 3KHUA 155CA 1CRGA 1C6OA 1NIRA 451CA 1KX7A 3PXTA 1MG3D 1RAPA 3A0HV 2HV4A 1GQ1A 3PLNA 4XXLA 1N90A 3C2CA 1ETPA 3ZIYA 4WQ9A 3VNWA 2PCBB 1RZ5A 5H2FV 1VYDA 1CRIA 3RMZA 3TDKA 1LC1A 1CTYA 4GYDA 2EXVA 5KLVD 5DJQC 3L74D 3WFDC 1HROA 4XYDB 3PRJA 2CE0A 1M70A 1COTA 2JWAA 3O1YA 2BCCD 1WEJF 2GIWA 3RLMA 4UB6V 2VHDA 1I5TA 1GJQA 4L1QA 1LC2A 1CXAA 1CTZA 5DJQB 1I55A 4FB1A 1CIHA 4PJ0V 1NTZD 1DT1A 1KYOD 2OZ1B 2ZOOA 1RZ6A 3SWSA 1LMSA 2QJKB 3M97X 1CIFA 2N18B 2MHMA
chains in the Genus database with same CATH superfamily
1NTZE 1P84D 1KILB 3O6QB 3EFGA 3ZOXA 3L73D 4C7RA 1USDA 1AFOA 2J58A 2W6JH 2XZRA 3KXDA 2ZT9D 2P1JA 3A0HE 1QVGO 1VQKP 1ZP0C 1KILE 1Y9BA 1M90Q 1HJ4A 5CJ0A 2E74B 1XTCC 3HUSB 4GKGA 1R5LA 1PGOA 1HH0A 2C0XA 3L35A 2N9JA 1DIQC 3MK7C 2K9JB 4Y99B 2QE7H 3HD7A 2J5UA 2JEEA 1NTMJ 3A0BE 2C1DA 2BCCJ 4N6JA 1DVHA 1NTKK 2RH0A 3CXHH 1RE4C 1JY2N 1JUNA 1GDTA 5C9MA 2B10B 1E79H 3V2NA 1SQBK 1CORA 1AQTA 1N9CA 1OW6A 5CIFB 1TU3F 3BATA 2O01N 5GTIE 4ZMDA 4FA4A 3WFBC 2W6AA 2FFDA 1FI9A 3H1LE 2WWWA 5CCGA 3D6YA 1SFCD 1FZGA 3KPEA 1SQVE 2AXCA 1N86A 1HBWA 2JQRA 3L73J 1CRCA 5APTA 5KAIV 2R3SA 4H0KA 4PD4D 5CYTR 1MFTA 2OARA 1QX8A 3CMEP 4WY4C 1J3SA 3A2AA 4N78E 4PD4I 4L74A 2QIWA 2P7JA 1FDIA 1SQXE 1E5WA 2QM7A 1QEXA 3PXSA 3V4QA 3H1KD 1KB9D 1IO4A 4L3GA 2WVRA 1W2LA 3S1KA 3L75D 1NTZK 1RF1C 3H1IE 2GM4A 1C7MA 3USSA 3IF4A 5KAFH 4ZNCA 1K3HA 1J1EC 1FS0E 2LITA 1J1DC 1KYOI 1ZLLA 3FX0A 2B4ZA 5TISH 3RK3B 1IFPA 1QL3A 1DW0A 2PACA 1H89A 1GMJA 1L2PA 1JY3O 5KLIC 3RK3E 4FA5A 3WUIA 3B5NB 3GHGB 1K3GA 3H6PA 2N9IA 2IFMA 4OGQB 1R0QA 2I1KA 4Z1MH 4PW9B 1YJ9P 3DP5A 2WPQA 3S4RA 5KAIE 2C0WA 3ABVC 1EZVE 2CXBA 1KTMA 3O20A 1K05A 1L0NG 1URQA 4HB1A 3H32A 1EDKA 4WQDA 3HQ7A 5KKZB 2OQQA 1QVFO 2JJLA 1AYGA 3H1KJ 3L71G 3H1JG 1SQVK 3L75J 1LTSC 1A02F 2M3EA 1OIPA 3N7NA 2FBWC 2N1TC 3F5HA 3L4MA 2LXCB 1N73C 1EXJA 1VQMP 3MUDA 1BGYE 1N2DC 3L70E 1QGKB 1FE6A 1UIIA 2FYNB 3A7OA 4D6TG 3FGAD 1YITP 3HRNA 1AKKA 1SQPG 1SQQE 2N1TD 3JBTB 1SQXK 2DW3A 1M7LA 1OCDA 2GC4D 2IBZG 3M0DA 3I56P 1DW2A 2QM8A 1N7SC 4N0KA 3RN0A 1HJ3A 2YKPA 2D2CB 4ASWA 1FI3A 1LTAC 2QJPB 3AE9C 4H13B 3V2RA 4ZKPA 3TGUG 1LTJB 1U7JA 1VDFA 3LIEA 1Q7YQ 1JY2P 1N7SD 4JQ0D 2AEJA 1CI6B 3CWBD 2D0SA 2KXPB 1S5LV 2Q7CA 1T3UA 1GKSA 1DD4A 3LIDA 3CCUP 3VN0A 2AXTE 1MUUA 4DJGA 1IK9A 3A5TA 1NU1D 1H88A 1IO3A 1NTME 1KV4A 5B5EV 2JKVA 2BCCE 4I6MC 2WSEH 3WU2H 3CI9A 3VMZA 4L75A 2QJYB 1E2RA 2Q6QA 5CIEB 1C2RA 2A06D 1LFMA 1LNQA 3QWOC 2O01H 1N7LA 3PHLA 4KMGA 3A9FA 3WFEC 3CXHD 4HJGH 3HTKB 2BEZF 1GW3A 2GB8B 1M1JA 1CRYA 2IYOA 4I2LC 4LGDE 4IOIH 5L8RJ 1LGHB 2BASA 3WFCC 3HD7D 2YQBA 5AVWB 2I1JA 5AW9B 2YO3A 1Q86Q 1RF0C 4EIFA 1FHBA 3M9BA 5APVA 1WMKA 3L73E 2CPBA 2YXRB 2W90A 4U3FD 3O0RC 1SQVG 2R32A 5H2FE 2DVHA 3L72D 1CSUA 1FOSF 3KZIV 3CWBJ 3OAKA 1H0TB 2OYOA 1L9BC 1I54A 1HZVA 1SQQK 4H44B 2OTLP 3AEBC 2ORLA 4WWIA 1N8RQ 3B4SA 3KHUA 3WUVA 4IL6H 1NU1J 1NIRA 1S5LE 4UB6H 451CA 2PP6A 1RE4A 1RAPA 2HV4A 1GD2E 3PLNA 1WRGA 4XFJA 2HPCB 1N90A 1BSNA 1ETPA 2IZ0A 5B5EE 2V7QH 5AW8B 2Z4EA 2K88A 3VNWA 1NO4A 2JO1A 3VOPA 4WB4A 1YQ4C 1SFCB 1RZ5A 1X79B 2WSFJ 1GL2C 1CRIA 1JTHB 3TDKA 1AQ5A 1CTYA 5KLVD 1L4AA 5AW2B 4PV1C 3AE7C 4I7ZB 1KQLA 2JWAA 5E79H 3O1YA 1VQNP 1NAFA 1NTMK 3AE1C 4U3FJ 1NOHA 3JCUH 4WY4A 4PD4E 2IDBA 1HTLC 1YQ3C 1MKMA 2VHDA 3BRTB 3L72J 4PV1D 3MP7B 3HE4B 4JBZA 4PJ0V 3KYQA 2OYHA 2PFXA 1DIPA 2P67A 3PJSK 1GU4A 1X22A 3C8VA 3M0AA 2ZOOA 2HLOA 1LMSA 2HYNA 3KZIE 1YJWP 3P8CE 1A02J 2MHMA 3W68A 1RF1A 3AEFC 3OW2O 1KYOE 1NKZB 3L75E 1HGVA 2QEXP 1FJPA 1H8AA 1BE3D 1GU2A 1C75A 3RL0C 3EWKA 5B66H 1HJ5A 2ZFCA 3TYIA 4RO0A 2CE1A 3D70A 1U75B 1NYHA 3PP5A 1PZQA 3HQ8A 1FZBA 5KLVJ 4EI2A 2GUSA 1PFIA 3MGNA 5AVSB 1YJNP 3RL0D 5AVYB 2PGDA 3L70G 3CCEP 3Q5RA 3HE5A 1CCRA 3PXWA 3H25A 2AIUA 3OA8A 1VF5C 3T97B 4FAVA 1YTZI 2YXQB 3CC2P 5KJ7C 4IFMA 1KB0A 2H8PD 1QLED 1AV1A 2ZZS1 1L0NE 2W8ZA 2SPZA 2N3BA 1VF5D 1LWUB 3M9HA 4PJ0E 3TYYA 5AVXB 2OTKE 2FYUD 3NFQA 3CPWO 1X0TA 3H1JE 1H33A 2VRSA 3A0BV 2N1TA 1OWAA 2ZYAA 3NXSA 1BE3J 4NPDA 1PPJD 1GU5A 1N73A 1CHHA 1D7MA 1KV9A 5CMZA 2KZJA 3SWYA 2R44A 2BH4X 3OCDA 2BCCG 3TNUB 1OVVA 2QRXA 1SLQA 1S9KE 1F1FA 1BDCA 1CCHA 4U7JA 5CIHB 1FZFA 5GTIV 1CTJA 2E5YA 2IFNA 1YI2P 4KT0J 1CXCA 4QAOA 2B9BA 3C9IA 4TLFA 2QJYC 3CD6P 2XKMA 2C9LY 4AANA 4L73A 4C7NB 2XV5A 5CIBB 3RBXA 3L37A 4RJTA 3SVWA 3L73G 1K9MQ 3CWBE 2I8DA 1PGJA 1W5CE 2AEFA 2C2CA 3SJLA 2YK3A 1P84I 2FYUJ 3Q5SA 2WMMA 2V4HA 1M60A 2Q9IA 3EQ2A 2MTAC 1NU1E 1IZL0 1L0LD 2DGEA 3BVHA 2OYIC 2WT7A 5DJUB 1ZV8A 2XNDH 1CYIA 1LT9C 2Q1KA 4QMAA 1IQCA 2NPSC 2KS1A 5KAFV 2WSFH 3HD7B 4GOFA 2K9JA 3SWFA 2WSEJ 2H88C 1QN2A 1L0NK 2C1DB 5TISV 2YMKA 4WVZA 2QSIA 1AJYA 2NPSD 1DD3A 1H32A 351CA 1KN7A 1RF0A 1AA0A 1CRJA 2O01J 1HGZA 2E76B 2LXBA 2ZJSE 2PCCB 3BRVB 3CC7P 3B71A 3WC8A 4XA4A 1RE3C 1CSBA 1X9VA 3CC4P 1L4AC 1ZRTE 3FWNA 3VP8A 1YNRA 3CCRP 1IK7A 1A8CA 2FFDB 1PGQA 3E1RA 1W2BO 2C9XB 1MZ4A 4W7ZA 3V2PA 2JTIB 3HQ9A 4HKZH 1U7MA 1L4AD 1IFIA 1SQPK 2ZXEB 5AVZB 1VPCA 3II6A 3OJAB 4EOTA 2H7HA 3GG2A 4GDOA 1LP1A 1CRHA 4DT0A 1EDLA 1L0LJ 5AW1B 1ZOYC 2OYHC 1JY3N 2IPPA 3CX5W 4WY4D 2W6BA 1H9XA 2HODB 4UB8V 3H1KG 3V6IA 4KHXA 4GIFA 4DY9A 3L75G 1GL2A 2YCCA 2M8RA 2WSCH 1KB9I 3X39A 5KLVE 2LIRA 5APUA 3QH9A 5KAFE 3D0WA 3AE2C 1GZLA 2V7QJ 3CCQP 2Y0CA 2KNCB 2FKWB 5TISE 4YTPC 2OZ1A 3GW6A 5B6QA 1NU1K 4EIJA 1FI7A 3G3ZA 2M5AA 5AVUB 2E75C 4IFFA 1UIXA 3Q5PA 1JMMA 4JF7A 4H0JA 4JYCA 5APXA 3B5NA 1CIEA 4C46A 1FZCC 1QL4A 1G2CA 2GC7D 4K3IA 2D0WA 1JDLA 2E75D 4IL6X 5BU5A 1USEA 1BCCD 1JNMA 2BPBB 2AXTV 1URQB 5KAIH 3H32B 1Z56A 4AQRD 2YIUB 3L4OA 1KYOW 3WU2V 3I55P 1NTKD 1YHQP 4UB8E 2A45G 2Y9YA 1N15A 5CBOA 1DVVA 1SQBD 2N3YA 1IFNA 3I5CA 1FC2C 155CA 2A45I 3PXTA 2H43A 1SS1A 1WT6A 5AW6B 1RHZB 3ZIYA 4WQ9A 3SWKA 1Q2NA 5KJ7A 1YIJP 2PCBB 1NJIQ 1FOSE 2KZIA 3U59A 2YNYA 5H2FV 1ZN5A 3AEDC 3RMZA 2G3AA 1OW7A 1OZHA 1R8EA 4CPGA 2M0BA 5KLVK 3SSUA 3L74D 4XYDB 3MTUE 3PH0A 1M70A 1COTA 4H0LB 1BCCJ 3AE4C 3P32A 3CWBG 4K35A 1WEJF 2QJKC 1Q90D 5AW7B 4UB6V 1GJQA 1CXAA 1KILC 1NTKJ 5DJQB 1NU1G 1NTZD 1MFZA 4KJMA 3WUUA 3LW5J 1K8AQ 3AECC 1FZAA 1NH4A 3RL0g 1OVRA 4JYBA 1VL2A 1SQBJ 2NZ2A 3WU2E 3L36A 1EDIA 2A06G 2E74C 3HUSC 3WMM0 1KILD 3M97X 1KORA 2N18B 1YYCA 4O9BA 2Y9ZA 3CCLP 3CU4A 1GK4A 1RQVA 4Y99C 3BCCD 4AALA 1YTCA 5AVVB 3RK2B 1NGMB 2E74D 1LJ2A 1NAYA 1M1JB 1S3JA 3CXHI 1JY3P 1CO6A 2ZT9B 1OVUA 4FANA 1P84E 2B89A 4U3FG 1H31A 1IZNB 4BRYA 1MV8A 5AURA 3L72G 5GTHH 1RY3A 2OYIA 3O5CA 3KQGA 1L0LE 3H1LD 1LT9A 1CHIA 3E1IA 2NPSA 1C2NA 2HR3A 2WQYC 2KSJA 3MK7B 3IN6A 4UB6E 2C1VA 1CIGA 5B66V 2JP3A 3VTPC 3C1LA 3CX5H 2Z5IA 1S5LH 3ZCFA 1XTGB 4V2KA 1NWQA 3AE8C 5EFWB 1KD1Q 3BCCJ 5APQA 1GIWA 1RE3A 5KLVG 1SQXD 2B87B 1OW8A 2HG5D 1A56A 5APSA 1QKSA 1DX7A 1JCCA 2XU6A 1X8YA 1GL2D 3H1ID 4GOEA 2B12B 3AE3C 1GDVA 1G1IA 1IFJA 3RK3C 2KP8A 3JCUE 1DIIC 1ZR4A 4WY4B 4Q5PA 4B86A 3HQ6A 2XTSB 4N3YB 3H1LJ 1CNOA 3ZOOA 2R5BA 1JEKA 1KFNA 1KQGB 3B5NC 3GHGC 5CIDB 3G9RA 1OXZA 4ZKUA 3CMAP 3IAOA 3GF7A 4OGQC 3H1KE 1KB9E 4BWNA 5APYA 4I1LA 3D71A 3CYTI 4RESB 1BE3G 1RF1B 3B5ND 1PP9D 5EXQA 1J1EB 1FCDC 1EZVD 5B66E 1J1DB 5KKZC 1SVFA 1EB7A 1L0LK 2WSCJ 5KLIB 2O1JA 1J2JB 4L3HA 1FAVA 2C1UA 3H1IJ 2CA4B 3D6ZA 4K3AA 3HE5B 1BSHA 1FZCA 2CA3B 2BLFB 3AE5C 1BGYD 2FYNC 3NWVA 3L70D 4R4LA 5CCHC 3CP5A 3VYMA 3T97A 2FWLA 1SQQD 4DZOA 4AAOA 2LKMA 4JPZB 4ASVA 2D2CC 4PWAA 2CK3H 4MU8A 2FYUG 5KJ7D 3MZWB 1LTIC 1YCCA 4WQ8A 5CCHD 2QJPC 1AVYA 2G8YA 1KC8Q 4H13C 3E7KA 3H1HD 1CC5A 1LTJC 1T8ZA 3LW5H 3P8MC 1JB0J 3NTNA 1PPJG 4PJ0H 1PP9J 1DH3A 1H33B 1A2SA 1YFCA 2D2CD 4NFGB 3ITKA 2Y0DA 2N1TB 2N9YB 4GEDB 2NRGA 3ZOWA 1OAEA 1HJBA 2ZAEB 4H13D 4HH2A 2KYVA 2YKQA 2GUVA 1N73B 3ZBMA 2V08A 3CCVP 2Y0EA 3OCDB 3O8ZA 3CLQA 1JO5A 2L4DA 1CZQA 1CYCA 2MJZA 2ITAA 2YMYA 3UIAA 1K73Q 2XDJA 3AEAC 1IC2A 4DOJA 1NTMD 1IRWA 1N7SB 2ZXXA 1Q81Q 2ZYDA 1GK6A 2N18C 1BGYJ 2C9NY 1YICA 1HUCA 1ZR2A 3CCJP 1WVEC 1VQ5P 1DEBA 4C7NA 1SQQJ 2I8FA 3TF5A 5KTBA 1KILA 3O6QA 2BGVX 4O1WA 3H1HJ 1S72P 3CL3D 1L0LG 1BL9A 4XE5B 4EDFA 3A0HH 2FXOA 3HUSA 3VMYA 2OGUA 5DFSA 2WT7B 2A06E 5AW4B 5K5GB 4H44C 3P7KA 3CXHE 2ZXYA 3N4XA 3BCCE 2KS1B 3VMAA 2Z5HA 1CHJA 3A0BH 3EFFK 1H1OA 3CX5D 5TJHA 4EIDA 2B11B 3V4WA 1S1CX 2ZVOB 2P58A 4FA9A 1HF9A 2AI5A 4H44D 3K5BA 4YXWH 1ZMEC 3V5BA 1H32B 3CX5I 1NHLA 4U3FE 1IFMA 1T2KC 2OTJP 1SFCC 3U1AA 1CRGA 1C6OA 3L72E 2Q5UA 2IX7C 5GTIH 2PRRA 1MG3D 1GQ1A 5C39A 3FXDA 3C2CA 1M56D 3AEEC 4I7ZC 1T2KD 1ZXGA 4YPCA 3L4FA 3SFEC 1JY2O 2WITA 1LP1B 2P10A 4IFDK 1EQ7A 1EDJA 1AVOA 1HROA 5AVQB 1VQ9P 3PRJA 1FDOA 2Q3IA 2HODA 2W27A 4LC1A 1KQSO 1GL2B 3RLMA 1I5TA 4L1QA 1YBKA 3P8CD 1I55A 2WPVB 2KK7A 4PV1B 1KYOD 3B8EB 3G71P 1RQUA 2ZVNB 2KNCA 2OZ1B 3SWSA 1RZ6A 2M3BA 3SFDC 2JR8A 3JSVC 3IFMA 2MKVA 4DCKA 1C52A 2M5AB 4J20A 3GHGA 2QVAA 4WQBA 1OFCX 1L9JC 4LLHA 1VQ6P 2XNXA 1BCCG 4RSZA 1G2CB 2QG4A 5CHXA 4BXLA 4GODA 2V07A 4Y5RA 4OWFA 1BE3E 1PP9E 4NPFX 1S5LX 3BASA 1NTKG 1PV3A 3RL0B 1JOCA 2Q3EA 1K04A 1LWUC 2K37A 1L0ND 4WBAA 4P4QB 2LR2A 1M1KQ 2CPSA 1SQBG 4A7PA 2FXPA 2B88A 1RAQA 3Q1MA 1I8PA 4WQEA 2IYPA 1S2EA 3L71D 1SP4A 3H1JD 1HJ0A 2FY8A 4UB8H 4O1QA 1I6DA 3VMXA 1LT1A 2KB7P 4OH8B 2FRCA 1Q82Q 1KQFB 1DEEG 1IFDA 4HYTB 2ZONG 2UWJE 1VF5B 5CCHA 4MN4C 3PTZA 3AE6C 3M9QA 2BEQD 2J59M 1S9KD 3VP9A 2R5DA 5CJ4A 4D6TD 2E43A 1FJ0A 1FU1A 1SQPD 2GA1A 5GTHV 2YKOA 3L74G 3ORVA 5IY51 5BU8B 2IBZD 2FYUE 3PH2B 4TT3H 3DMIA 1LTJA 2QA4P 2B0ZB 1OMIA 3H1HE 1HZUA 1KMIZ 2IBZI 4IL6V 1S6VB 1PPJE 1NNOA 3TGUD 3U1CA 3NBTA 1CI6A 4YE1A 3G6EP 3MIWA 1CSVA 3VRDA 2BCNB 1NTZG 1FOCA 4OVNF 1L0NJ 5AVTB 1YEBA 1H9YA 1W5CT 3ZOYA 5AVRB 1KIBA 1LTBC 1CEDA 2AXTH 1YIQA 3R4YA 1LS9A 3L71J 1AOFA 4LJIA 3H1JJ 4R4MA 1QL1A 3V2QA 1JCDA 3M91A 2RN0A 3BCCG 3FWLA 3RBZA 3NMDA 5E79V 3TK1A 3RN1A 2K1AA 2KSEA 3HD7C 3HTKA 1RH5B 5AW0B 1QYZA 2IZ1A 4D6TJ 1FJKA 1SQPJ 1N50A 1PIXA 1T6AA 4EIEA 3L74J 2JWDA 2O1KA 4AUWA 1B7VA 3CCMP 1VQ4P 2RMZA 2E76C 1H31B 1P84H 4BRYB 3SXTA 5GTHE 1MG2D 5BVZA 1U74B 1HVVA 3H1LG 4W7YA 4Y28J 3TGUJ 1ZRTD 5H2FH 3NBSA 3VYIA 2FFDC 2OYIB 1H0TA 1SQVD 5CCGC 2E76D 1NTZJ 1LT9B 2K9YA 1IRVA 1HCMA 1C6RA 1CW5A 4GT1A 2KLVA 4IL6E 2NPSB 2WTYA 1HH7A 1CYJA 1LTGC 2PAJA 2WZ7A 5CBNA 4WQAA 4M3LA 5CCGD 2O3JA 2KUBA 1HRCA 4N78D 3CX5E 3S9OA 2HPCA 3CXHW 1M57D 2FYUK 4RKUJ 1NKNA 1SQXG 1JM0A 1HWTC 5B5EH 2E42A 2KLUA 3DR0A 1SFCA 1L4AB 1W2EA 1JTHA 1NMLA 5C0ZA 3H1IG 2KOGA 1M6ZA 1C6SA 2ZYGA 2B87A 5E79E 2FXMA 3GF3A 1VQ7P 3KDPB 3CCSP 2P2UA 2W83C 1KFMA 1E8EA 3GLMA 5DJTB 3RGUA 1OX3A 4PD4H 4WQ7A 3HE4A 3RK3D 1VQPP 1ZZHA 1SQVJ 2OYHB 2AEMA 1DW3A 3FXEA 1I6EA 2JDIH 2WSSH 1MZ9A 3F89A 1PL5A 1PP9G 3KZIH 2HFED 1E29A 3OA7A 1KB9H 4OGQD 1EZVG 3R2PA 1VQ8P 1KYOH 4AYCA 5DF5A 1SQXJ 2YO2A 2POHA 1NMIA 1BDDA 1URQC 1KX2A 1FDMA 4WQCA 2L91A 5CICB 2YIUC 1EZVI 1G1JA 3W67A 2BH5X 3G4SP 4EYYQ 2ZBOA 3WUTA 1T3JA 1GW4A 5AW3B 1URQD 2E75B 3MD0A 4EICA 1KZUB 2C8SA 1ZW0A 2H89C 4FA1A 5CIGB 1BGYG 3Q2YA 1EXIA 3OA8B 4AAMA 3MUDC 1FZCB 1YTZT 1AOQA 3A3YB 1BCCE 1DW1A 4JCGA 1SQQG 4YXDC 1F1CA 2R3CA 1CSWA 2WPRA 1VQOP 1LTTC 3Q3DA 1YEAA 1I8OA 1S4XA 4AX3A 5AW5B 3SLEA 1CSXA 3M0DC 1KX7A 1LWUA 1NTKE 3H1HG 4W80A 1VQLP 3A0HV 3IR9A 3JC22 1PGPA 5APWA 4XXLA 1U57A 2WPSA 4H0LC 3TSIA 1IJDB 1SQBE 1FZEA 3L71E 1VYDA 2A45H 1LC1A 4GYDA 2EXVA 4H0LD 3MHVA 3TNUA 5DJQC 3WFDC 1R5SA 3AEGC 1QL2A 1JMBA 2CE0A 2KIKA 1NTMG 1M8OB 2FYZA 1Y47A 2BCCD 5M1BA 3M06A 2N9BA 4D6TE 1SQPE 2GIWA 1NVOA 3L74E 3L70J 1N7SA 2K3RA 1LC2A 2RKLA 1CTZA 2IBZE 4FB1A 1GTWA 1CIHA 3GMAA 2KI7B 4NPEA 1DT1A 3RK2C 1EC5A 2E5TA 1FBMA 4L76A 1M1JC 2ZT9C 3TGUE 1Y8AA 2QJKB 2L5GB 3ZDMA 1CIFA 3RK2D
chains in the Genus database with same CATH topology
3CU4A 1P84D 1C52A 4J20A 3L73D 3ZOXA 3BCCD 4AALA 1YTCA 1BE3D 1GU2A 4WQBA 1C75A 1L9JC 1HJ5A 3TYIA 1HJ4A 2CE1A 1CO6A 1U75B 4RSZA 4FANA 2QG4A 3HQ8A 1H31A 2V07A 4Y5RA 2N9JA 1DIQC 3MK7C 2K9JB 5AURA 1CCRA 3PXWA 2C1DA 1DVHA 2Q3EA 1L0ND 3O5CA 4P4QB 5C9MA 2AIUA 3OA8A 3H1LD 2B10B 4A7PA 4FAVA 1CHIA 1C2NA 1RAQA 1I8PA 1CORA 4WQEA 3MK7B 1KB0A 3L71D 3H1JD 1N9CA 5CIFB 4O1QA 2C1VA 1CIGA 2ZZS1 1I6DA 2N3BA 5B66V 4FA4A 3WFBC 2FRCA 1FI9A 2ZONG 3ZCFA 2FYUD 3PTZA 4V2KA 1H33A 2JQRA 1CRCA 5KAIV 3A0BV 4D6TD 1GIWA 1SQXD 1FJ0A 1SQPD 4H0KA 4PD4D 5CYTR 5GTHV 1PPJD 3ORVA 5IY51 1CHHA 1KV9A 1A56A 1J3SA 2IBZD 2BH4X 1QKSA 3OCDA 3PH2B 3DMIA 3H1ID 2B0ZB 1F1FA 2B12B 1GDVA 1HZUA 1CCHA 5CIHB 4IL6V 1S6VB 1NNOA 3TGUD 3NBTA 3PXSA 5GTIV 4YE1A 1DIIC 1CTJA 1CSVA 3VRDA 3H1KD 4Q5PA 1KB9D 2BCNB 1FOCA 4L3GA 1CXCA 1W2LA 4QAOA 3L75D 1C7MA 3HQ6A 2XTSB 1YEBA 4AANA 1H9YA 1W5CT 3ZOYA 1KIBA 1CNOA 3ZOOA 1CEDA 1K3HA 5CIDB 1YIQA 2LITA 2B4ZA 1LS9A 1AOFA 4LJIA 5CIBB 1QL3A 1DW0A 2PACA 4RJTA 3SVWA 2RN0A 3FWLA 3CYTI 1PP9D 2C2CA 5EXQA 5E79V 3SJLA 4FA5A 2YK3A 3WUIA 1M60A 3RN1A 1FCDC 1EZVD 1K3GA 1QYZA 2MTAC 2N9IA 1IZL0 1L0LD 2DGEA 1R0QA 1EB7A 1N50A 4PW9B 4EIEA 1CYIA 1B7VA 5KLIB 3DP5A 2RMZA 1IQCA 1H31B 4L3HA 2KS1A 2C1UA 3SXTA 2CXBA 3O20A 2CA4B 5KAFV 1MG2D 1U74B 1QN2A 4WQDA 3HQ7A 5KKZB 2C1DB 5TISV 1ZRTD 2CA3B 2BLFB 3NBSA 1AYGA 1SQVD 1BGYD 3NWVA 3L70D 1H32A 351CA 1IRVA 1HCMA 1C6RA 1CRJA 3CP5A 3VYMA 2PCCB 1HH7A 1CYJA 2FWLA 1SQQD 3WC8A 3L4MA 4WQAA 4AAOA 1YNRA 2O3JA 4PWAA 4MU8A 1HRCA 1A8CA 1YCCA 4WQ8A 3CXHW 2FYNB 3H1HD 1CC5A 2C9XB 1MZ4A 1AKKA 2JTIB 3HQ9A 3JBTB 1H33B 1A2SA 1YFCA 3ITKA 1OCDA 2GC4D 3DR0A 4NFGB 2Y0DA 4GEDB 2N9YB 1DW2A 3ZOWA 1OAEA 3GG2A 1NMLA 4N0KA 3RN0A 1HJ3A 5C0ZA 1CRHA 3ZBMA 1M6ZA 1C6SA 2V08A 1FI3A 2QJPB 2Y0EA 3OCDB 2L4DA 3CX5W 1CYCA 1H9XA 4UB8V 4DY9A 1NTMD 1E8EA 1IRWA 2YCCA 3CWBD 2D0SA 4WQ7A 1S5LV 1ZZHA 3X39A 2LIRA 2N18C 1GKSA 1DW3A 2Y0CA 2KNCB 1YICA 1I6EA 1NU1D 2OZ1A 1IO3A 1WVEC 5B5EV 3GW6A 5B6QA 2I8FA 3TF5A 2QJYB 1FI7A 1E2RA 1E29A 5CIEB 1C2RA 2A06D 1LFMA 2BGVX 4O1WA 3PHLA 4KMGA 1BL9A 3A9FA 5DF5A 3WFEC 1NMIA 3CXHD 1KX2A 4H0JA 2GB8B 1CRYA 4WQCA 2L91A 5CICB 4EDFA 1CIEA 1QL4A 2BH5X 2GC7D 4K3IA 3WFCC 2YQBA 5DFSA 2D0WA 1JDLA 1BCCD 2ZBOA 2BPBB 4EIFA 2AXTV 1FHBA 2ZXYA 4EICA 2C8SA 4U3FD 3VMAA 4FA1A 3O0RC 1CHJA 5CIGB 1H1OA 3CX5D 2YIUB 5TJHA 4EIDA 3OA8B 2B11B 1KYOW 2DVHA 3L4OA 4AAMA 3L72D 3WU2V 1CSUA 1NTKD 4FA9A 1AOQA 1DW1A 2AI5A 3KZIV 4JCGA 1L9BC 1F1CA 1I54A 1HZVA 1CSWA 1H32B 1N15A 1DVVA 1YEAA 1I8OA 1SQBD 2ORLA 2N3YA 4AX3A 3SLEA 1CSXA 3KHUA 155CA 1CRGA 1C6OA 1NIRA 451CA 1KX7A 3PXTA 1MG3D 1RAPA 3A0HV 2HV4A 1GQ1A 3PLNA 4XXLA 1N90A 3C2CA 1ETPA 3ZIYA 4WQ9A 3VNWA 2PCBB 1RZ5A 5H2FV 1VYDA 1CRIA 3RMZA 3TDKA 1LC1A 1CTYA 4GYDA 2EXVA 5KLVD 5DJQC 3L74D 3WFDC 1HROA 4XYDB 3PRJA 2CE0A 1M70A 1COTA 2JWAA 3O1YA 2BCCD 1WEJF 2GIWA 3RLMA 4UB6V 2VHDA 1I5TA 1GJQA 4L1QA 1LC2A 1CXAA 1CTZA 5DJQB 1I55A 4FB1A 1CIHA 4PJ0V 1NTZD 1DT1A 1KYOD 2OZ1B 2ZOOA 1RZ6A 3SWSA 1LMSA 2QJKB 3M97X 1CIFA 2N18B 2MHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CU4 A;  1P84 D;  1C52 A;  4J20 A;  3L73 D;  3ZOX A;  3BCC D;  4AAL A;  1YTC A;  1BE3 D;  1GU2 A;  4WQB A;  1C75 A;  1L9J C;  1HJ5 A;  3TYI A;  1HJ4 A;  2CE1 A;  1CO6 A;  1U75 B;  4RSZ A;  4FAN A;  2QG4 A;  3HQ8 A;  1H31 A;  2V07 A;  4Y5R A;  2N9J A;  1DIQ C;  3MK7 C;  2K9J B;  5AUR A;  1CCR A;  3PXW A;  2C1D A;  1DVH A;  2Q3E A;  1L0N D;  3O5C A;  4P4Q B;  5C9M A;  2AIU A;  3OA8 A;  3H1L D;  2B10 B;  4A7P A;  4FAV A;  1CHI A;  1C2N A;  1RAQ A;  1I8P A;  1COR A;  4WQE A;  3MK7 B;  1KB0 A;  3L71 D;  3H1J D;  1N9C A;  5CIF B;  4O1Q A;  2C1V A;  1CIG A;  2ZZS 1;  1I6D A;  2N3B A;  5B66 V;  4FA4 A;  3WFB C;  2FRC A;  1FI9 A;  2ZON G;  3ZCF A;  2FYU D;  3PTZ A;  4V2K A;  1H33 A;  2JQR A;  1CRC A;  5KAI V;  3A0B V;  4D6T D;  1GIW A;  1SQX D;  1FJ0 A;  1SQP D;  4H0K A;  4PD4 D;  5CYT R;  5GTH V;  1PPJ D;  3ORV A;  5IY5 1;  1CHH A;  1KV9 A;  1A56 A;  1J3S A;  2IBZ D;  2BH4 X;  1QKS A;  3OCD A;  3PH2 B;  3DMI A;  3H1I D;  2B0Z B;  1F1F A;  2B12 B;  1GDV A;  1HZU A;  1CCH A;  5CIH B;  4IL6 V;  1S6V B;  1NNO A;  3TGU D;  3NBT A;  3PXS A;  5GTI V;  4YE1 A;  1DII C;  1CTJ A;  1CSV A;  3VRD A;  3H1K D;  4Q5P A;  1KB9 D;  2BCN B;  1FOC A;  4L3G A;  1CXC A;  1W2L A;  4QAO A;  3L75 D;  1C7M A;  3HQ6 A;  2XTS B;  1YEB A;  4AAN A;  1H9Y A;  1W5C T;  3ZOY A;  1KIB A;  1CNO A;  3ZOO A;  1CED A;  1K3H A;  5CID B;  1YIQ A;  2LIT A;  2B4Z A;  1LS9 A;  1AOF A;  4LJI A;  5CIB B;  1QL3 A;  1DW0 A;  2PAC A;  4RJT A;  3SVW A;  2RN0 A;  3FWL A;  3CYT I;  1PP9 D;  2C2C A;  5EXQ A;  5E79 V;  3SJL A;  4FA5 A;  2YK3 A;  3WUI A;  1M60 A;  3RN1 A;  1FCD C;  1EZV D;  1K3G A;  1QYZ A;  2MTA C;  2N9I A;  1IZL 0;  1L0L D;  2DGE A;  1R0Q A;  1EB7 A;  1N50 A;  4PW9 B;  4EIE A;  1CYI A;  1B7V A;  5KLI B;  3DP5 A;  2RMZ A;  1IQC A;  1H31 B;  4L3H A;  2KS1 A;  2C1U A;  3SXT A;  2CXB A;  3O20 A;  2CA4 B;  5KAF V;  1MG2 D;  1U74 B;  1QN2 A;  4WQD A;  3HQ7 A;  5KKZ B;  2C1D B;  5TIS V;  1ZRT D;  2CA3 B;  2BLF B;  3NBS A;  1AYG A;  1SQV D;  1BGY D;  3NWV A;  3L70 D;  1H32 A;  351C A;  1IRV A;  1HCM A;  1C6R A;  1CRJ A;  3CP5 A;  3VYM A;  2PCC B;  1HH7 A;  1CYJ A;  2FWL A;  1SQQ D;  3WC8 A;  3L4M A;  4WQA A;  4AAO A;  1YNR A;  2O3J A;  4PWA A;  4MU8 A;  1HRC A;  1A8C A;  1YCC A;  4WQ8 A;  3CXH W;  2FYN B;  3H1H D;  1CC5 A;  2C9X B;  1MZ4 A;  1AKK A;  2JTI B;  3HQ9 A;  3JBT B;  1H33 B;  1A2S A;  1YFC A;  3ITK A;  1OCD A;  2GC4 D;  3DR0 A;  4NFG B;  2Y0D A;  4GED B;  2N9Y B;  1DW2 A;  3ZOW A;  1OAE A;  3GG2 A;  1NML A;  4N0K A;  3RN0 A;  1HJ3 A;  5C0Z A;  1CRH A;  3ZBM A;  1M6Z A;  1C6S A;  2V08 A;  1FI3 A;  2QJP B;  2Y0E A;  3OCD B;  2L4D A;  3CX5 W;  1CYC A;  1H9X A;  4UB8 V;  4DY9 A;  1NTM D;  1E8E A;  1IRW A;  2YCC A;  3CWB D;  2D0S A;  4WQ7 A;  1S5L V;  1ZZH A;  3X39 A;  2LIR A;  2N18 C;  1GKS A;  1DW3 A;  2Y0C A;  2KNC B;  1YIC A;  1I6E A;  1NU1 D;  2OZ1 A;  1IO3 A;  1WVE C;  5B5E V;  3GW6 A;  5B6Q A;  2I8F A;  3TF5 A;  2QJY B;  1FI7 A;  1E2R A;  1E29 A;  5CIE B;  1C2R A;  2A06 D;  1LFM A;  2BGV X;  4O1W A;  3PHL A;  4KMG A;  1BL9 A;  3A9F A;  5DF5 A;  3WFE C;  1NMI A;  3CXH D;  1KX2 A;  4H0J A;  2GB8 B;  1CRY A;  4WQC A;  2L91 A;  5CIC B;  4EDF A;  1CIE A;  1QL4 A;  2BH5 X;  2GC7 D;  4K3I A;  3WFC C;  2YQB A;  5DFS A;  2D0W A;  1JDL A;  1BCC D;  2ZBO A;  2BPB B;  4EIF A;  2AXT V;  1FHB A;  2ZXY A;  4EIC A;  2C8S A;  4U3F D;  3VMA A;  4FA1 A;  3O0R C;  1CHJ A;  5CIG B;  1H1O A;  3CX5 D;  2YIU B;  5TJH A;  4EID A;  3OA8 B;  2B11 B;  1KYO W;  2DVH A;  3L4O A;  4AAM A;  3L72 D;  3WU2 V;  1CSU A;  1NTK D;  4FA9 A;  1AOQ A;  1DW1 A;  2AI5 A;  3KZI V;  4JCG A;  1L9B C;  1F1C A;  1I54 A;  1HZV A;  1CSW A;  1H32 B;  1N15 A;  1DVV A;  1YEA A;  1I8O A;  1SQB D;  2ORL A;  2N3Y A;  4AX3 A;  3SLE A;  1CSX A;  3KHU A;  155C A;  1CRG A;  1C6O A;  1NIR A;  451C A;  1KX7 A;  3PXT A;  1MG3 D;  1RAP A;  3A0H V;  2HV4 A;  1GQ1 A;  3PLN A;  4XXL A;  1N90 A;  3C2C A;  1ETP A;  3ZIY A;  4WQ9 A;  3VNW A;  2PCB B;  1RZ5 A;  5H2F V;  1VYD A;  1CRI A;  3RMZ A;  3TDK A;  1LC1 A;  1CTY A;  4GYD A;  2EXV A;  5KLV D;  5DJQ C;  3L74 D;  3WFD C;  1HRO A;  4XYD B;  3PRJ A;  2CE0 A;  1M70 A;  1COT A;  2JWA A;  3O1Y A;  2BCC D;  1WEJ F;  2GIW A;  3RLM A;  4UB6 V;  2VHD A;  1I5T A;  1GJQ A;  4L1Q A;  1LC2 A;  1CXA A;  1CTZ A;  5DJQ B;  1I55 A;  4FB1 A;  1CIH A;  4PJ0 V;  1NTZ D;  1DT1 A;  1KYO D;  2OZ1 B;  2ZOO A;  1RZ6 A;  3SWS A;  1LMS A;  2QJK B;  3M97 X;  1CIF A;  2N18 B;  2MHM A; 
#chains in the Genus database with same CATH topology
 1NTZ E;  1P84 D;  1KIL B;  3O6Q B;  3EFG A;  3ZOX A;  3L73 D;  4C7R A;  1USD A;  1AFO A;  2J58 A;  2W6J H;  2XZR A;  3KXD A;  2ZT9 D;  2P1J A;  3A0H E;  1QVG O;  1VQK P;  1ZP0 C;  1KIL E;  1Y9B A;  1M90 Q;  1HJ4 A;  5CJ0 A;  2E74 B;  1XTC C;  3HUS B;  4GKG A;  1R5L A;  1PGO A;  1HH0 A;  2C0X A;  3L35 A;  2N9J A;  1DIQ C;  3MK7 C;  2K9J B;  4Y99 B;  2QE7 H;  3HD7 A;  2J5U A;  2JEE A;  1NTM J;  3A0B E;  2C1D A;  2BCC J;  4N6J A;  1DVH A;  1NTK K;  2RH0 A;  3CXH H;  1RE4 C;  1JY2 N;  1JUN A;  1GDT A;  5C9M A;  2B10 B;  1E79 H;  3V2N A;  1SQB K;  1COR A;  1AQT A;  1N9C A;  1OW6 A;  5CIF B;  1TU3 F;  3BAT A;  2O01 N;  5GTI E;  4ZMD A;  4FA4 A;  3WFB C;  2W6A A;  2FFD A;  1FI9 A;  3H1L E;  2WWW A;  5CCG A;  3D6Y A;  1SFC D;  1FZG A;  3KPE A;  1SQV E;  2AXC A;  1N86 A;  1HBW A;  2JQR A;  3L73 J;  1CRC A;  5APT A;  5KAI V;  2R3S A;  4H0K A;  4PD4 D;  5CYT R;  1MFT A;  2OAR A;  1QX8 A;  3CME P;  4WY4 C;  1J3S A;  3A2A A;  4N78 E;  4PD4 I;  4L74 A;  2QIW A;  2P7J A;  1FDI A;  1SQX E;  1E5W A;  2QM7 A;  1QEX A;  3PXS A;  3V4Q A;  3H1K D;  1KB9 D;  1IO4 A;  4L3G A;  2WVR A;  1W2L A;  3S1K A;  3L75 D;  1NTZ K;  1RF1 C;  3H1I E;  2GM4 A;  1C7M A;  3USS A;  3IF4 A;  5KAF H;  4ZNC A;  1K3H A;  1J1E C;  1FS0 E;  2LIT A;  1J1D C;  1KYO I;  1ZLL A;  3FX0 A;  2B4Z A;  5TIS H;  3RK3 B;  1IFP A;  1QL3 A;  1DW0 A;  2PAC A;  1H89 A;  1GMJ A;  1L2P A;  1JY3 O;  5KLI C;  3RK3 E;  4FA5 A;  3WUI A;  3B5N B;  3GHG B;  1K3G A;  3H6P A;  2N9I A;  2IFM A;  4OGQ B;  1R0Q A;  2I1K A;  4Z1M H;  4PW9 B;  1YJ9 P;  3DP5 A;  2WPQ A;  3S4R A;  5KAI E;  2C0W A;  3ABV C;  1EZV E;  2CXB A;  1KTM A;  3O20 A;  1K05 A;  1L0N G;  1URQ A;  4HB1 A;  3H32 A;  1EDK A;  4WQD A;  3HQ7 A;  5KKZ B;  2OQQ A;  1QVF O;  2JJL A;  1AYG A;  3H1K J;  3L71 G;  3H1J G;  1SQV K;  3L75 J;  1LTS C;  1A02 F;  2M3E A;  1OIP A;  3N7N A;  2FBW C;  2N1T C;  3F5H A;  3L4M A;  2LXC B;  1N73 C;  1EXJ A;  1VQM P;  3MUD A;  1BGY E;  1N2D C;  3L70 E;  1QGK B;  1FE6 A;  1UII A;  2FYN B;  3A7O A;  4D6T G;  3FGA D;  1YIT P;  3HRN A;  1AKK A;  1SQP G;  1SQQ E;  2N1T D;  3JBT B;  1SQX K;  2DW3 A;  1M7L A;  1OCD A;  2GC4 D;  2IBZ G;  3M0D A;  3I56 P;  1DW2 A;  2QM8 A;  1N7S C;  4N0K A;  3RN0 A;  1HJ3 A;  2YKP A;  2D2C B;  4ASW A;  1FI3 A;  1LTA C;  2QJP B;  3AE9 C;  4H13 B;  3V2R A;  4ZKP A;  3TGU G;  1LTJ B;  1U7J A;  1VDF A;  3LIE A;  1Q7Y Q;  1JY2 P;  1N7S D;  4JQ0 D;  2AEJ A;  1CI6 B;  3CWB D;  2D0S A;  2KXP B;  1S5L V;  2Q7C A;  1T3U A;  1GKS A;  1DD4 A;  3LID A;  3CCU P;  3VN0 A;  2AXT E;  1MUU A;  4DJG A;  1IK9 A;  3A5T A;  1NU1 D;  1H88 A;  1IO3 A;  1NTM E;  1KV4 A;  5B5E V;  2JKV A;  2BCC E;  4I6M C;  2WSE H;  3WU2 H;  3CI9 A;  3VMZ A;  4L75 A;  2QJY B;  1E2R A;  2Q6Q A;  5CIE B;  1C2R A;  2A06 D;  1LFM A;  1LNQ A;  3QWO C;  2O01 H;  1N7L A;  3PHL A;  4KMG A;  3A9F A;  3WFE C;  3CXH D;  4HJG H;  3HTK B;  2BEZ F;  1GW3 A;  2GB8 B;  1M1J A;  1CRY A;  2IYO A;  4I2L C;  4LGD E;  4IOI H;  5L8R J;  1LGH B;  2BAS A;  3WFC C;  3HD7 D;  2YQB A;  5AVW B;  2I1J A;  5AW9 B;  2YO3 A;  1Q86 Q;  1RF0 C;  4EIF A;  1FHB A;  3M9B A;  5APV A;  1WMK A;  3L73 E;  2CPB A;  2YXR B;  2W90 A;  4U3F D;  3O0R C;  1SQV G;  2R32 A;  5H2F E;  2DVH A;  3L72 D;  1CSU A;  1FOS F;  3KZI V;  3CWB J;  3OAK A;  1H0T B;  2OYO A;  1L9B C;  1I54 A;  1HZV A;  1SQQ K;  4H44 B;  2OTL P;  3AEB C;  2ORL A;  4WWI A;  1N8R Q;  3B4S A;  3KHU A;  3WUV A;  4IL6 H;  1NU1 J;  1NIR A;  1S5L E;  4UB6 H;  451C A;  2PP6 A;  1RE4 A;  1RAP A;  2HV4 A;  1GD2 E;  3PLN A;  1WRG A;  4XFJ A;  2HPC B;  1N90 A;  1BSN A;  1ETP A;  2IZ0 A;  5B5E E;  2V7Q H;  5AW8 B;  2Z4E A;  2K88 A;  3VNW A;  1NO4 A;  2JO1 A;  3VOP A;  4WB4 A;  1YQ4 C;  1SFC B;  1RZ5 A;  1X79 B;  2WSF J;  1GL2 C;  1CRI A;  1JTH B;  3TDK A;  1AQ5 A;  1CTY A;  5KLV D;  1L4A A;  5AW2 B;  4PV1 C;  3AE7 C;  4I7Z B;  1KQL A;  2JWA A;  5E79 H;  3O1Y A;  1VQN P;  1NAF A;  1NTM K;  3AE1 C;  4U3F J;  1NOH A;  3JCU H;  4WY4 A;  4PD4 E;  2IDB A;  1HTL C;  1YQ3 C;  1MKM A;  2VHD A;  3BRT B;  3L72 J;  4PV1 D;  3MP7 B;  3HE4 B;  4JBZ A;  4PJ0 V;  3KYQ A;  2OYH A;  2PFX A;  1DIP A;  2P67 A;  3PJS K;  1GU4 A;  1X22 A;  3C8V A;  3M0A A;  2ZOO A;  2HLO A;  1LMS A;  2HYN A;  3KZI E;  1YJW P;  3P8C E;  1A02 J;  2MHM A;  3W68 A;  1RF1 A;  3AEF C;  3OW2 O;  1KYO E;  1NKZ B;  3L75 E;  1HGV A;  2QEX P;  1FJP A;  1H8A A;  1BE3 D;  1GU2 A;  1C75 A;  3RL0 C;  3EWK A;  5B66 H;  1HJ5 A;  2ZFC A;  3TYI A;  4RO0 A;  2CE1 A;  3D70 A;  1U75 B;  1NYH A;  3PP5 A;  1PZQ A;  3HQ8 A;  1FZB A;  5KLV J;  4EI2 A;  2GUS A;  1PFI A;  3MGN A;  5AVS B;  1YJN P;  3RL0 D;  5AVY B;  2PGD A;  3L70 G;  3CCE P;  3Q5R A;  3HE5 A;  1CCR A;  3PXW A;  3H25 A;  2AIU A;  3OA8 A;  1VF5 C;  3T97 B;  4FAV A;  1YTZ I;  2YXQ B;  3CC2 P;  5KJ7 C;  4IFM A;  1KB0 A;  2H8P D;  1QLE D;  1AV1 A;  2ZZS 1;  1L0N E;  2W8Z A;  2SPZ A;  2N3B A;  1VF5 D;  1LWU B;  3M9H A;  4PJ0 E;  3TYY A;  5AVX B;  2OTK E;  2FYU D;  3NFQ A;  3CPW O;  1X0T A;  3H1J E;  1H33 A;  2VRS A;  3A0B V;  2N1T A;  1OWA A;  2ZYA A;  3NXS A;  1BE3 J;  4NPD A;  1PPJ D;  1GU5 A;  1N73 A;  1CHH A;  1D7M A;  1KV9 A;  5CMZ A;  2KZJ A;  3SWY A;  2R44 A;  2BH4 X;  3OCD A;  2BCC G;  3TNU B;  1OVV A;  2QRX A;  1SLQ A;  1S9K E;  1F1F A;  1BDC A;  1CCH A;  4U7J A;  5CIH B;  1FZF A;  5GTI V;  1CTJ A;  2E5Y A;  2IFN A;  1YI2 P;  4KT0 J;  1CXC A;  4QAO A;  2B9B A;  3C9I A;  4TLF A;  2QJY C;  3CD6 P;  2XKM A;  2C9L Y;  4AAN A;  4L73 A;  4C7N B;  2XV5 A;  5CIB B;  3RBX A;  3L37 A;  4RJT A;  3SVW A;  3L73 G;  1K9M Q;  3CWB E;  2I8D A;  1PGJ A;  1W5C E;  2AEF A;  2C2C A;  3SJL A;  2YK3 A;  1P84 I;  2FYU J;  3Q5S A;  2WMM A;  2V4H A;  1M60 A;  2Q9I A;  3EQ2 A;  2MTA C;  1NU1 E;  1IZL 0;  1L0L D;  2DGE A;  3BVH A;  2OYI C;  2WT7 A;  5DJU B;  1ZV8 A;  2XND H;  1CYI A;  1LT9 C;  2Q1K A;  4QMA A;  1IQC A;  2NPS C;  2KS1 A;  5KAF V;  2WSF H;  3HD7 B;  4GOF A;  2K9J A;  3SWF A;  2WSE J;  2H88 C;  1QN2 A;  1L0N K;  2C1D B;  5TIS V;  2YMK A;  4WVZ A;  2QSI A;  1AJY A;  2NPS D;  1DD3 A;  1H32 A;  351C A;  1KN7 A;  1RF0 A;  1AA0 A;  1CRJ A;  2O01 J;  1HGZ A;  2E76 B;  2LXB A;  2ZJS E;  2PCC B;  3BRV B;  3CC7 P;  3B71 A;  3WC8 A;  4XA4 A;  1RE3 C;  1CSB A;  1X9V A;  3CC4 P;  1L4A C;  1ZRT E;  3FWN A;  3VP8 A;  1YNR A;  3CCR P;  1IK7 A;  1A8C A;  2FFD B;  1PGQ A;  3E1R A;  1W2B O;  2C9X B;  1MZ4 A;  4W7Z A;  3V2P A;  2JTI B;  3HQ9 A;  4HKZ H;  1U7M A;  1L4A D;  1IFI A;  1SQP K;  2ZXE B;  5AVZ B;  1VPC A;  3II6 A;  3OJA B;  4EOT A;  2H7H A;  3GG2 A;  4GDO A;  1LP1 A;  1CRH A;  4DT0 A;  1EDL A;  1L0L J;  5AW1 B;  1ZOY C;  2OYH C;  1JY3 N;  2IPP A;  3CX5 W;  4WY4 D;  2W6B A;  1H9X A;  2HOD B;  4UB8 V;  3H1K G;  3V6I A;  4KHX A;  4GIF A;  4DY9 A;  3L75 G;  1GL2 A;  2YCC A;  2M8R A;  2WSC H;  1KB9 I;  3X39 A;  5KLV E;  2LIR A;  5APU A;  3QH9 A;  5KAF E;  3D0W A;  3AE2 C;  1GZL A;  2V7Q J;  3CCQ P;  2Y0C A;  2KNC B;  2FKW B;  5TIS E;  4YTP C;  2OZ1 A;  3GW6 A;  5B6Q A;  1NU1 K;  4EIJ A;  1FI7 A;  3G3Z A;  2M5A A;  5AVU B;  2E75 C;  4IFF A;  1UIX A;  3Q5P A;  1JMM A;  4JF7 A;  4H0J A;  4JYC A;  5APX A;  3B5N A;  1CIE A;  4C46 A;  1FZC C;  1QL4 A;  1G2C A;  2GC7 D;  4K3I A;  2D0W A;  1JDL A;  2E75 D;  4IL6 X;  5BU5 A;  1USE A;  1BCC D;  1JNM A;  2BPB B;  2AXT V;  1URQ B;  5KAI H;  3H32 B;  1Z56 A;  4AQR D;  2YIU B;  3L4O A;  1KYO W;  3WU2 V;  3I55 P;  1NTK D;  1YHQ P;  4UB8 E;  2A45 G;  2Y9Y A;  1N15 A;  5CBO A;  1DVV A;  1SQB D;  2N3Y A;  1IFN A;  3I5C A;  1FC2 C;  155C A;  2A45 I;  3PXT A;  2H43 A;  1SS1 A;  1WT6 A;  5AW6 B;  1RHZ B;  3ZIY A;  4WQ9 A;  3SWK A;  1Q2N A;  5KJ7 A;  1YIJ P;  2PCB B;  1NJI Q;  1FOS E;  2KZI A;  3U59 A;  2YNY A;  5H2F V;  1ZN5 A;  3AED C;  3RMZ A;  2G3A A;  1OW7 A;  1OZH A;  1R8E A;  4CPG A;  2M0B A;  5KLV K;  3SSU A;  3L74 D;  4XYD B;  3MTU E;  3PH0 A;  1M70 A;  1COT A;  4H0L B;  1BCC J;  3AE4 C;  3P32 A;  3CWB G;  4K35 A;  1WEJ F;  2QJK C;  1Q90 D;  5AW7 B;  4UB6 V;  1GJQ A;  1CXA A;  1KIL C;  1NTK J;  5DJQ B;  1NU1 G;  1NTZ D;  1MFZ A;  4KJM A;  3WUU A;  3LW5 J;  1K8A Q;  3AEC C;  1FZA A;  1NH4 A;  3RL0 g;  1OVR A;  4JYB A;  1VL2 A;  1SQB J;  2NZ2 A;  3WU2 E;  3L36 A;  1EDI A;  2A06 G;  2E74 C;  3HUS C;  3WMM 0;  1KIL D;  3M97 X;  1KOR A;  2N18 B;  1YYC A;  4O9B A;  2Y9Z A;  3CCL P;  3CU4 A;  1GK4 A;  1RQV A;  4Y99 C;  3BCC D;  4AAL A;  1YTC A;  5AVV B;  3RK2 B;  1NGM B;  2E74 D;  1LJ2 A;  1NAY A;  1M1J B;  1S3J A;  3CXH I;  1JY3 P;  1CO6 A;  2ZT9 B;  1OVU A;  4FAN A;  1P84 E;  2B89 A;  4U3F G;  1H31 A;  1IZN B;  4BRY A;  1MV8 A;  5AUR A;  3L72 G;  5GTH H;  1RY3 A;  2OYI A;  3O5C A;  3KQG A;  1L0L E;  3H1L D;  1LT9 A;  1CHI A;  3E1I A;  2NPS A;  1C2N A;  2HR3 A;  2WQY C;  2KSJ A;  3MK7 B;  3IN6 A;  4UB6 E;  2C1V A;  1CIG A;  5B66 V;  2JP3 A;  3VTP C;  3C1L A;  3CX5 H;  2Z5I A;  1S5L H;  3ZCF A;  1XTG B;  4V2K A;  1NWQ A;  3AE8 C;  5EFW B;  1KD1 Q;  3BCC J;  5APQ A;  1GIW A;  1RE3 A;  5KLV G;  1SQX D;  2B87 B;  1OW8 A;  2HG5 D;  1A56 A;  5APS A;  1QKS A;  1DX7 A;  1JCC A;  2XU6 A;  1X8Y A;  1GL2 D;  3H1I D;  4GOE A;  2B12 B;  3AE3 C;  1GDV A;  1G1I A;  1IFJ A;  3RK3 C;  2KP8 A;  3JCU E;  1DII C;  1ZR4 A;  4WY4 B;  4Q5P A;  4B86 A;  3HQ6 A;  2XTS B;  4N3Y B;  3H1L J;  1CNO A;  3ZOO A;  2R5B A;  1JEK A;  1KFN A;  1KQG B;  3B5N C;  3GHG C;  5CID B;  3G9R A;  1OXZ A;  4ZKU A;  3CMA P;  3IAO A;  3GF7 A;  4OGQ C;  3H1K E;  1KB9 E;  4BWN A;  5APY A;  4I1L A;  3D71 A;  3CYT I;  4RES B;  1BE3 G;  1RF1 B;  3B5N D;  1PP9 D;  5EXQ A;  1J1E B;  1FCD C;  1EZV D;  5B66 E;  1J1D B;  5KKZ C;  1SVF A;  1EB7 A;  1L0L K;  2WSC J;  5KLI B;  2O1J A;  1J2J B;  4L3H A;  1FAV A;  2C1U A;  3H1I J;  2CA4 B;  3D6Z A;  4K3A A;  3HE5 B;  1BSH A;  1FZC A;  2CA3 B;  2BLF B;  3AE5 C;  1BGY D;  2FYN C;  3NWV A;  3L70 D;  4R4L A;  5CCH C;  3CP5 A;  3VYM A;  3T97 A;  2FWL A;  1SQQ D;  4DZO A;  4AAO A;  2LKM A;  4JPZ B;  4ASV A;  2D2C C;  4PWA A;  2CK3 H;  4MU8 A;  2FYU G;  5KJ7 D;  3MZW B;  1LTI C;  1YCC A;  4WQ8 A;  5CCH D;  2QJP C;  1AVY A;  2G8Y A;  1KC8 Q;  4H13 C;  3E7K A;  3H1H D;  1CC5 A;  1LTJ C;  1T8Z A;  3LW5 H;  3P8M C;  1JB0 J;  3NTN A;  1PPJ G;  4PJ0 H;  1PP9 J;  1DH3 A;  1H33 B;  1A2S A;  1YFC A;  2D2C D;  4NFG B;  3ITK A;  2Y0D A;  2N1T B;  2N9Y B;  4GED B;  2NRG A;  3ZOW A;  1OAE A;  1HJB A;  2ZAE B;  4H13 D;  4HH2 A;  2KYV A;  2YKQ A;  2GUV A;  1N73 B;  3ZBM A;  2V08 A;  3CCV P;  2Y0E A;  3OCD B;  3O8Z A;  3CLQ A;  1JO5 A;  2L4D A;  1CZQ A;  1CYC A;  2MJZ A;  2ITA A;  2YMY A;  3UIA A;  1K73 Q;  2XDJ A;  3AEA C;  1IC2 A;  4DOJ A;  1NTM D;  1IRW A;  1N7S B;  2ZXX A;  1Q81 Q;  2ZYD A;  1GK6 A;  2N18 C;  1BGY J;  2C9N Y;  1YIC A;  1HUC A;  1ZR2 A;  3CCJ P;  1WVE C;  1VQ5 P;  1DEB A;  4C7N A;  1SQQ J;  2I8F A;  3TF5 A;  5KTB A;  1KIL A;  3O6Q A;  2BGV X;  4O1W A;  3H1H J;  1S72 P;  3CL3 D;  1L0L G;  1BL9 A;  4XE5 B;  4EDF A;  3A0H H;  2FXO A;  3HUS A;  3VMY A;  2OGU A;  5DFS A;  2WT7 B;  2A06 E;  5AW4 B;  5K5G B;  4H44 C;  3P7K A;  3CXH E;  2ZXY A;  3N4X A;  3BCC E;  2KS1 B;  3VMA A;  2Z5H A;  1CHJ A;  3A0B H;  3EFF K;  1H1O A;  3CX5 D;  5TJH A;  4EID A;  2B11 B;  3V4W A;  1S1C X;  2ZVO B;  2P58 A;  4FA9 A;  1HF9 A;  2AI5 A;  4H44 D;  3K5B A;  4YXW H;  1ZME C;  3V5B A;  1H32 B;  3CX5 I;  1NHL A;  4U3F E;  1IFM A;  1T2K C;  2OTJ P;  1SFC C;  3U1A A;  1CRG A;  1C6O A;  3L72 E;  2Q5U A;  2IX7 C;  5GTI H;  2PRR A;  1MG3 D;  1GQ1 A;  5C39 A;  3FXD A;  3C2C A;  1M56 D;  3AEE C;  4I7Z C;  1T2K D;  1ZXG A;  4YPC A;  3L4F A;  3SFE C;  1JY2 O;  2WIT A;  1LP1 B;  2P10 A;  4IFD K;  1EQ7 A;  1EDJ A;  1AVO A;  1HRO A;  5AVQ B;  1VQ9 P;  3PRJ A;  1FDO A;  2Q3I A;  2HOD A;  2W27 A;  4LC1 A;  1KQS O;  1GL2 B;  3RLM A;  1I5T A;  4L1Q A;  1YBK A;  3P8C D;  1I55 A;  2WPV B;  2KK7 A;  4PV1 B;  1KYO D;  3B8E B;  3G71 P;  1RQU A;  2ZVN B;  2KNC A;  2OZ1 B;  3SWS A;  1RZ6 A;  2M3B A;  3SFD C;  2JR8 A;  3JSV C;  3IFM A;  2MKV A;  4DCK A;  1C52 A;  2M5A B;  4J20 A;  3GHG A;  2QVA A;  4WQB A;  1OFC X;  1L9J C;  4LLH A;  1VQ6 P;  2XNX A;  1BCC G;  4RSZ A;  1G2C B;  2QG4 A;  5CHX A;  4BXL A;  4GOD A;  2V07 A;  4Y5R A;  4OWF A;  1BE3 E;  1PP9 E;  4NPF X;  1S5L X;  3BAS A;  1NTK G;  1PV3 A;  3RL0 B;  1JOC A;  2Q3E A;  1K04 A;  1LWU C;  2K37 A;  1L0N D;  4WBA A;  4P4Q B;  2LR2 A;  1M1K Q;  2CPS A;  1SQB G;  4A7P A;  2FXP A;  2B88 A;  1RAQ A;  3Q1M A;  1I8P A;  4WQE A;  2IYP A;  1S2E A;  3L71 D;  1SP4 A;  3H1J D;  1HJ0 A;  2FY8 A;  4UB8 H;  4O1Q A;  1I6D A;  3VMX A;  1LT1 A;  2KB7 P;  4OH8 B;  2FRC A;  1Q82 Q;  1KQF B;  1DEE G;  1IFD A;  4HYT B;  2ZON G;  2UWJ E;  1VF5 B;  5CCH A;  4MN4 C;  3PTZ A;  3AE6 C;  3M9Q A;  2BEQ D;  2J59 M;  1S9K D;  3VP9 A;  2R5D A;  5CJ4 A;  4D6T D;  2E43 A;  1FJ0 A;  1FU1 A;  1SQP D;  2GA1 A;  5GTH V;  2YKO A;  3L74 G;  3ORV A;  5IY5 1;  5BU8 B;  2IBZ D;  2FYU E;  3PH2 B;  4TT3 H;  3DMI A;  1LTJ A;  2QA4 P;  2B0Z B;  1OMI A;  3H1H E;  1HZU A;  1KMI Z;  2IBZ I;  4IL6 V;  1S6V B;  1PPJ E;  1NNO A;  3TGU D;  3U1C A;  3NBT A;  1CI6 A;  4YE1 A;  3G6E P;  3MIW A;  1CSV A;  3VRD A;  2BCN B;  1NTZ G;  1FOC A;  4OVN F;  1L0N J;  5AVT B;  1YEB A;  1H9Y A;  1W5C T;  3ZOY A;  5AVR B;  1KIB A;  1LTB C;  1CED A;  2AXT H;  1YIQ A;  3R4Y A;  1LS9 A;  3L71 J;  1AOF A;  4LJI A;  3H1J J;  4R4M A;  1QL1 A;  3V2Q A;  1JCD A;  3M91 A;  2RN0 A;  3BCC G;  3FWL A;  3RBZ A;  3NMD A;  5E79 V;  3TK1 A;  3RN1 A;  2K1A A;  2KSE A;  3HD7 C;  3HTK A;  1RH5 B;  5AW0 B;  1QYZ A;  2IZ1 A;  4D6T J;  1FJK A;  1SQP J;  1N50 A;  1PIX A;  1T6A A;  4EIE A;  3L74 J;  2JWD A;  2O1K A;  4AUW A;  1B7V A;  3CCM P;  1VQ4 P;  2RMZ A;  2E76 C;  1H31 B;  1P84 H;  4BRY B;  3SXT A;  5GTH E;  1MG2 D;  5BVZ A;  1U74 B;  1HVV A;  3H1L G;  4W7Y A;  4Y28 J;  3TGU J;  1ZRT D;  5H2F H;  3NBS A;  3VYI A;  2FFD C;  2OYI B;  1H0T A;  1SQV D;  5CCG C;  2E76 D;  1NTZ J;  1LT9 B;  2K9Y A;  1IRV A;  1HCM A;  1C6R A;  1CW5 A;  4GT1 A;  2KLV A;  4IL6 E;  2NPS B;  2WTY A;  1HH7 A;  1CYJ A;  1LTG C;  2PAJ A;  2WZ7 A;  5CBN A;  4WQA A;  4M3L A;  5CCG D;  2O3J A;  2KUB A;  1HRC A;  4N78 D;  3CX5 E;  3S9O A;  2HPC A;  3CXH W;  1M57 D;  2FYU K;  4RKU J;  1NKN A;  1SQX G;  1JM0 A;  1HWT C;  5B5E H;  2E42 A;  2KLU A;  3DR0 A;  1SFC A;  1L4A B;  1W2E A;  1JTH A;  1NML A;  5C0Z A;  3H1I G;  2KOG A;  1M6Z A;  1C6S A;  2ZYG A;  2B87 A;  5E79 E;  2FXM A;  3GF3 A;  1VQ7 P;  3KDP B;  3CCS P;  2P2U A;  2W83 C;  1KFM A;  1E8E A;  3GLM A;  5DJT B;  3RGU A;  1OX3 A;  4PD4 H;  4WQ7 A;  3HE4 A;  3RK3 D;  1VQP P;  1ZZH A;  1SQV J;  2OYH B;  2AEM A;  1DW3 A;  3FXE A;  1I6E A;  2JDI H;  2WSS H;  1MZ9 A;  3F89 A;  1PL5 A;  1PP9 G;  3KZI H;  2HFE D;  1E29 A;  3OA7 A;  1KB9 H;  4OGQ D;  1EZV G;  3R2P A;  1VQ8 P;  1KYO H;  4AYC A;  5DF5 A;  1SQX J;  2YO2 A;  2POH A;  1NMI A;  1BDD A;  1URQ C;  1KX2 A;  1FDM A;  4WQC A;  2L91 A;  5CIC B;  2YIU C;  1EZV I;  1G1J A;  3W67 A;  2BH5 X;  3G4S P;  4EYY Q;  2ZBO A;  3WUT A;  1T3J A;  1GW4 A;  5AW3 B;  1URQ D;  2E75 B;  3MD0 A;  4EIC A;  1KZU B;  2C8S A;  1ZW0 A;  2H89 C;  4FA1 A;  5CIG B;  1BGY G;  3Q2Y A;  1EXI A;  3OA8 B;  4AAM A;  3MUD C;  1FZC B;  1YTZ T;  1AOQ A;  3A3Y B;  1BCC E;  1DW1 A;  4JCG A;  1SQQ G;  4YXD C;  1F1C A;  2R3C A;  1CSW A;  2WPR A;  1VQO P;  1LTT C;  3Q3D A;  1YEA A;  1I8O A;  1S4X A;  4AX3 A;  5AW5 B;  3SLE A;  1CSX A;  3M0D C;  1KX7 A;  1LWU A;  1NTK E;  3H1H G;  4W80 A;  1VQL P;  3A0H V;  3IR9 A;  3JC2 2;  1PGP A;  5APW A;  4XXL A;  1U57 A;  2WPS A;  4H0L C;  3TSI A;  1IJD B;  1SQB E;  1FZE A;  3L71 E;  1VYD A;  2A45 H;  1LC1 A;  4GYD A;  2EXV A;  4H0L D;  3MHV A;  3TNU A;  5DJQ C;  3WFD C;  1R5S A;  3AEG C;  1QL2 A;  1JMB A;  2CE0 A;  2KIK A;  1NTM G;  1M8O B;  2FYZ A;  1Y47 A;  2BCC D;  5M1B A;  3M06 A;  2N9B A;  4D6T E;  1SQP E;  2GIW A;  1NVO A;  3L74 E;  3L70 J;  1N7S A;  2K3R A;  1LC2 A;  2RKL A;  1CTZ A;  2IBZ E;  4FB1 A;  1GTW A;  1CIH A;  3GMA A;  2KI7 B;  4NPE A;  1DT1 A;  3RK2 C;  1EC5 A;  2E5T A;  1FBM A;  4L76 A;  1M1J C;  2ZT9 C;  3TGU E;  1Y8A A;  2QJK B;  2L5G B;  3ZDM A;  1CIF A;  3RK2 D; 
#chains in the Genus database with same CATH homology
 3CU4 A;  1P84 D;  1C52 A;  4J20 A;  3L73 D;  3ZOX A;  3BCC D;  4AAL A;  1YTC A;  1BE3 D;  1GU2 A;  4WQB A;  1C75 A;  1L9J C;  1HJ5 A;  3TYI A;  1HJ4 A;  2CE1 A;  1CO6 A;  1U75 B;  4RSZ A;  4FAN A;  2QG4 A;  3HQ8 A;  1H31 A;  2V07 A;  4Y5R A;  2N9J A;  1DIQ C;  3MK7 C;  2K9J B;  5AUR A;  1CCR A;  3PXW A;  2C1D A;  1DVH A;  2Q3E A;  1L0N D;  3O5C A;  4P4Q B;  5C9M A;  2AIU A;  3OA8 A;  3H1L D;  2B10 B;  4A7P A;  4FAV A;  1CHI A;  1C2N A;  1RAQ A;  1I8P A;  1COR A;  4WQE A;  3MK7 B;  1KB0 A;  3L71 D;  3H1J D;  1N9C A;  5CIF B;  4O1Q A;  2C1V A;  1CIG A;  2ZZS 1;  1I6D A;  2N3B A;  5B66 V;  4FA4 A;  3WFB C;  2FRC A;  1FI9 A;  2ZON G;  3ZCF A;  2FYU D;  3PTZ A;  4V2K A;  1H33 A;  2JQR A;  1CRC A;  5KAI V;  3A0B V;  4D6T D;  1GIW A;  1SQX D;  1FJ0 A;  1SQP D;  4H0K A;  4PD4 D;  5CYT R;  5GTH V;  1PPJ D;  3ORV A;  5IY5 1;  1CHH A;  1KV9 A;  1A56 A;  1J3S A;  2IBZ D;  2BH4 X;  1QKS A;  3OCD A;  3PH2 B;  3DMI A;  3H1I D;  2B0Z B;  1F1F A;  2B12 B;  1GDV A;  1HZU A;  1CCH A;  5CIH B;  4IL6 V;  1S6V B;  1NNO A;  3TGU D;  3NBT A;  3PXS A;  5GTI V;  4YE1 A;  1DII C;  1CTJ A;  1CSV A;  3VRD A;  3H1K D;  4Q5P A;  1KB9 D;  2BCN B;  1FOC A;  4L3G A;  1CXC A;  1W2L A;  4QAO A;  3L75 D;  1C7M A;  3HQ6 A;  2XTS B;  1YEB A;  4AAN A;  1H9Y A;  1W5C T;  3ZOY A;  1KIB A;  1CNO A;  3ZOO A;  1CED A;  1K3H A;  5CID B;  1YIQ A;  2LIT A;  2B4Z A;  1LS9 A;  1AOF A;  4LJI A;  5CIB B;  1QL3 A;  1DW0 A;  2PAC A;  4RJT A;  3SVW A;  2RN0 A;  3FWL A;  3CYT I;  1PP9 D;  2C2C A;  5EXQ A;  5E79 V;  3SJL A;  4FA5 A;  2YK3 A;  3WUI A;  1M60 A;  3RN1 A;  1FCD C;  1EZV D;  1K3G A;  1QYZ A;  2MTA C;  2N9I A;  1IZL 0;  1L0L D;  2DGE A;  1R0Q A;  1EB7 A;  1N50 A;  4PW9 B;  4EIE A;  1CYI A;  1B7V A;  5KLI B;  3DP5 A;  2RMZ A;  1IQC A;  1H31 B;  4L3H A;  2KS1 A;  2C1U A;  3SXT A;  2CXB A;  3O20 A;  2CA4 B;  5KAF V;  1MG2 D;  1U74 B;  1QN2 A;  4WQD A;  3HQ7 A;  5KKZ B;  2C1D B;  5TIS V;  1ZRT D;  2CA3 B;  2BLF B;  3NBS A;  1AYG A;  1SQV D;  1BGY D;  3NWV A;  3L70 D;  1H32 A;  351C A;  1IRV A;  1HCM A;  1C6R A;  1CRJ A;  3CP5 A;  3VYM A;  2PCC B;  1HH7 A;  1CYJ A;  2FWL A;  1SQQ D;  3WC8 A;  3L4M A;  4WQA A;  4AAO A;  1YNR A;  2O3J A;  4PWA A;  4MU8 A;  1HRC A;  1A8C A;  1YCC A;  4WQ8 A;  3CXH W;  2FYN B;  3H1H D;  1CC5 A;  2C9X B;  1MZ4 A;  1AKK A;  2JTI B;  3HQ9 A;  3JBT B;  1H33 B;  1A2S A;  1YFC A;  3ITK A;  1OCD A;  2GC4 D;  3DR0 A;  4NFG B;  2Y0D A;  4GED B;  2N9Y B;  1DW2 A;  3ZOW A;  1OAE A;  3GG2 A;  1NML A;  4N0K A;  3RN0 A;  1HJ3 A;  5C0Z A;  1CRH A;  3ZBM A;  1M6Z A;  1C6S A;  2V08 A;  1FI3 A;  2QJP B;  2Y0E A;  3OCD B;  2L4D A;  3CX5 W;  1CYC A;  1H9X A;  4UB8 V;  4DY9 A;  1NTM D;  1E8E A;  1IRW A;  2YCC A;  3CWB D;  2D0S A;  4WQ7 A;  1S5L V;  1ZZH A;  3X39 A;  2LIR A;  2N18 C;  1GKS A;  1DW3 A;  2Y0C A;  2KNC B;  1YIC A;  1I6E A;  1NU1 D;  2OZ1 A;  1IO3 A;  1WVE C;  5B5E V;  3GW6 A;  5B6Q A;  2I8F A;  3TF5 A;  2QJY B;  1FI7 A;  1E2R A;  1E29 A;  5CIE B;  1C2R A;  2A06 D;  1LFM A;  2BGV X;  4O1W A;  3PHL A;  4KMG A;  1BL9 A;  3A9F A;  5DF5 A;  3WFE C;  1NMI A;  3CXH D;  1KX2 A;  4H0J A;  2GB8 B;  1CRY A;  4WQC A;  2L91 A;  5CIC B;  4EDF A;  1CIE A;  1QL4 A;  2BH5 X;  2GC7 D;  4K3I A;  3WFC C;  2YQB A;  5DFS A;  2D0W A;  1JDL A;  1BCC D;  2ZBO A;  2BPB B;  4EIF A;  2AXT V;  1FHB A;  2ZXY A;  4EIC A;  2C8S A;  4U3F D;  3VMA A;  4FA1 A;  3O0R C;  1CHJ A;  5CIG B;  1H1O A;  3CX5 D;  2YIU B;  5TJH A;  4EID A;  3OA8 B;  2B11 B;  1KYO W;  2DVH A;  3L4O A;  4AAM A;  3L72 D;  3WU2 V;  1CSU A;  1NTK D;  4FA9 A;  1AOQ A;  1DW1 A;  2AI5 A;  3KZI V;  4JCG A;  1L9B C;  1F1C A;  1I54 A;  1HZV A;  1CSW A;  1H32 B;  1N15 A;  1DVV A;  1YEA A;  1I8O A;  1SQB D;  2ORL A;  2N3Y A;  4AX3 A;  3SLE A;  1CSX A;  3KHU A;  155C A;  1CRG A;  1C6O A;  1NIR A;  451C A;  1KX7 A;  3PXT A;  1MG3 D;  1RAP A;  3A0H V;  2HV4 A;  1GQ1 A;  3PLN A;  4XXL A;  1N90 A;  3C2C A;  1ETP A;  3ZIY A;  4WQ9 A;  3VNW A;  2PCB B;  1RZ5 A;  5H2F V;  1VYD A;  1CRI A;  3RMZ A;  3TDK A;  1LC1 A;  1CTY A;  4GYD A;  2EXV A;  5KLV D;  5DJQ C;  3L74 D;  3WFD C;  1HRO A;  4XYD B;  3PRJ A;  2CE0 A;  1M70 A;  1COT A;  2JWA A;  3O1Y A;  2BCC D;  1WEJ F;  2GIW A;  3RLM A;  4UB6 V;  2VHD A;  1I5T A;  1GJQ A;  4L1Q A;  1LC2 A;  1CXA A;  1CTZ A;  5DJQ B;  1I55 A;  4FB1 A;  1CIH A;  4PJ0 V;  1NTZ D;  1DT1 A;  1KYO D;  2OZ1 B;  2ZOO A;  1RZ6 A;  3SWS A;  1LMS A;  2QJK B;  3M97 X;  1CIF A;  2N18 B;  2MHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...