2FYNB

Crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 61
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2fynB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2fynB02
1HZUA 1CO6A 1FJ0A 1CRJA 3L4OA 2IBZD 2YCCA 3PRJA 2N18C 2GC4D 3BCCD 4EIFA 1YEAA 1RZ6A 4YE1A 3GG2A 4FA1A 5E79V 451CA 4AALA 2MTAC 2Y0CA 2B4ZA 1C75A 3H1LD 1BGYD 1N9CA 1E29A 1CNOA 1YICA 2CE1A 5KAIV 3L73D 3RLMA 1QKSA 2AIUA 3ZIYA 1L0ND 3WC8A 5CIEB 2L4DA 4L3HA 3CX5D 4AAOA 3A0BV 1F1CA 1NTKD 2LIRA 1CYCA 4WQ8A 155CA 3A0HV 1H9XA 1P84D 1S5LV 5KLIB 4H0KA 1HCMA 1K3HA 4GYDA 3NWVA 4EIEA 3HQ9A 1DIQC 2V07A 2L91A 3M97X 1I55A 1GDVA 1HZVA 3CYTI 3OCDB 2ORLA 4PW9B 4QAOA 2LITA 1A2SA 2FYNB 1KB9D 3O1YA 1K3GA 1U75B 3RMZA 4WQBA 1HJ4A 3JBTB 4UB6V 1MG3D 2PACA 1BCCD 4WQAA 1ZRTD 1H31A 1NIRA 1KIBA 2D0SA 1YNRA 4FA4A 3SLEA 2A06D 1CSXA 4IL6V 2K9JB 3HQ8A 1VYDA 3CU4A 1KB0A 2I8FA 1CIEA 1KX7A 1IO3A 2N9JA 1CC5A 1GIWA 1IZL0 5GTIV 3L4MA 2BCNB 1I6EA 4WQEA 2BPBB 1HROA 1I54A 3L75D 4RJTA 5KAFV 1L9JC 2C1UA 1C2RA 1FOCA 4FB1A 1SQVD 4L1QA 3L71D 5AURA 4EIDA 1DT1A 1COTA 1CRYA 4J20A 3SJLA 3ORVA 4EDFA 3SXTA 1GQ1A 1MG2D 1C6SA 1NNOA 1QN2A 1DIIC 3H1ID 1H32B 2AI5A 3ZOWA 4WQCA 1DW1A 1CYIA 1DVVA 1HJ5A 1I6DA 1PPJD 4DY9A 1CCRA 2OZ1B 3CP5A 1OAEA 3CWBD 2GB8B 2B10B 5DJQB 3O0RC 1HRCA 1DW0A 1F1FA 1JDLA 1IQCA 4UB8V 1LFMA 1AYGA 1KYOD 1H32A 2V08A 1CIGA 1NTMD 1FI7A 1RZ5A 1KYOW 1M6ZA 2N18B 1N50A 2KNCB 3VNWA 3TDKA 2GC7D 1M70A 4FA9A 4A7PA 2ZZS1 1CRCA 2OZ1A 1CIFA 1C6OA 3L74D 4WQ7A 1CRGA 1I8OA 2CA4B 3CX5W 3ZCFA 5B5EV 1MZ4A 5TISV 1CORA 5CIBB 3SWSA 1H9YA 1KV9A 3KZIV 4RSZA 2BH4X 2BGVX 1EB7A 2EXVA 1HJ3A 1SQBD 2B0ZB 1PP9D 1GU2A 2C2CA 1H1OA 1SQXD 1C52A 5CIGB 1SQQD 2AXTV 4FA5A 4PWAA 1OCDA 2YIUB 1W2LA 1CSWA 3PXSA 1FI9A 1CHIA 3CXHD 4O1WA 1C7MA 4L3GA 3WFDC 1NU1D 1NMIA 2PCBB 5B66V 3CXHW 4PJ0V 5C0ZA 4NFGB 1LC2A 3RN0A 4AANA 2QG4A 2ZXYA 3OCDA 1ETPA 2YK3A 1CRIA 2KS1A 1H33B 1CXAA 3MK7C 2C8SA 2BCCD 2CA3B 2FWLA 1LS9A 1YTCA 1RAQA 1CSUA 1C2NA 5C9MA 3TGUD 2N9IA 5TJHA 3WFEC 2MHMA 2JWAA 2C1VA 4H0JA 2JQRA 4D6TD 1I8PA 2DGEA 1CEDA 2CXBA 4Y5RA 3ZOYA 1WEJF 3NBTA 1YFCA 2B12B 3ITKA 4MU8A 3DR0A 1FI3A 1CRHA 1I5TA 5KKZB 2PCCB 3X39A 2N9YB 3ZOOA 4LJIA 1FHBA 3OA8B 1CSVA 1KX2A 4N0KA 2Q3EA 2ZBOA 1CXCA 2Y0EA 1CIHA 1HH7A 4AAMA 1A8CA 1CTJA 2ZOOA 1N15A 2FRCA 2ZONG 3SVWA 2BLFB 5DFSA 3WFCC 4P4QB 1N90A 1SQPD 1NTZD 2O3JA 3C2CA 3KHUA 2DVHA 2QJYB 3ZOXA 4XXLA 3ZBMA 1R0QA 3L72D 3OA8A 1L0LD 3PH2B 2FYUD 2XTSB 1BL9A 4Q5PA 2RMZA 2HV4A 1DW3A 1CHHA 1FCDC 4XYDB 2JTIB 2VHDA 1H31B 5B6QA 1J3SA 5CIFB 3L70D 2GIWA 5DF5A 5H2FV 1AOQA 3O20A 3WUIA 1RAPA 5CYTR 5IY51 1IRWA 3O5CA 1QYZA 2C9XB 3VYMA 4O1QA 1W5CT 4WQ9A 1CYJA 4EICA 1AKKA 3PLNA 2RN0A 3PXTA 3FWLA 1CTYA 1LMSA 2N3BA 2YQBA 3NBSA 5KLVD 1YEBA 3WU2V 3GW6A 3PHLA 1M60A 3H1JD 1E2RA 1QL4A 4U3FD 3TF5A 1E8EA 3PXWA 5GTHV 5CIHB 3HQ7A 3WFBC 1S6VB 2C1DB 1A56A 1C6RA 1L9BC 3DMIA 2Y0DA 1GJQA 3H1KD 1DVHA 1EZVD 3VRDA 2B11B 4KMGA 4AX3A 3DP5A 3MK7B 1IRVA 1GKSA 1CTZA 1B7VA 1LC1A 2N3YA 5CICB 3TYIA 1ZZHA 3A9FA 1H33A 3HQ6A 4GEDB 2QJPB 3H1HD 4PD4D 1YIQA 2D0WA 3PTZA 2C1DA 2BH5X 5CIDB 5DJQC 1BE3D 1CCHA 4V2KA 4FAVA 5EXQA 4FANA 2QJKB 1YCCA 1WVEC 1AOFA 2CE0A 1U74B 3RN1A 4JCGA 1QL3A 1NMLA 4WQDA 4K3IA 351CA 1CHJA 1DW2A 3VMAA
chains in the Genus database with same CATH superfamily
1HZUA 1RE3C 3T97B 2N18C 2GC4D 2KI7B 3BCCD 3FGAD 1X9VA 1LP1B 1SVFA 3IR9A 5E79V 4AALA 2MTAC 2Y0CA 1KILE 1C75A 2LKMA 1SQPE 3HRNA 1CW5A 2QJYC 1Q2NA 3L74G 5KAIV 3RLMA 1QKSA 2AIUA 1SQXJ 1YQ4C 3HE5A 1JO5A 4L3HA 1LT1A 3A0BV 1SFCB 2O01H 3L70E 3PH0A 2QA4P 5APYA 1NU1J 1ZP0C 5CCGC 4GYDA 1DIQC 1I55A 1GDVA 1CZQA 1J1DC 2KZJA 1YITP 1X0TA 3AE6C 2ORLA 1GTWA 1IJDB 2WSCJ 2OTKE 1M1JC 1JY2O 1T3JA 1K3GA 3C9IA 1L4AA 4WQBA 4UB6V 3H1JE 1MG3D 1K73Q 4WQAA 2BCCG 5DJTB 2OYHA 1QL1A 3SLEA 4D6TJ 2A06D 4IL6V 1VYDA 1PGQA 1KB0A 2I8DA 3TGUG 1HWTC 3WMM0 1KX7A 2N9JA 1RH5B 2WSEJ 1OVVA 5KJ7A 3L4MA 2MKVA 5APTA 4H0LD 2BCNB 2BPBB 3OJAB 5KTBA 2H7HA 2KSJA 2W6JH 1L9JC 1NKZB 1Y47A 1FOCA 2B88A 3SSUA 3F5HA 1CRYA 3I56P 1N7SA 1SQXK 3ORVA 4EDFA 3A2AA 2Q6QA 1MG2D 1IO4A 3BATA 1QN2A 1BE3E 3B4SA 1CSBA 3LW5J 3VMZA 1SQPJ 1LT9A 1FBMA 1FOSF 1N73C 1DIPA 1VPCA 2WZ7A 3HD7B 1NYHA 3VN0A 1OAEA 3RK3B 3CWBD 2B10B 4I7ZB 1DW0A 1F1FA 1HH0A 2WPRA 4UB8V 5CCHA 2LR2A 1LTJB 5GTIE 3L70J 1RZ5A 1VQ6P 2FYUG 2N18B 1N50A 2PAJA 2FXPA 3MUDA 4YXWH 5DJUB 1M70A 3H32B 1LNQA 4A7PA 4RO0A 2SPZA 1CIFA 1NTKE 3Q3DA 1SQBG 3L74D 2O1KA 1LP1A 3CX5W 4DOJA 3ZCFA 1CORA 2QEXP 1MFZA 3SWSA 2AEJA 1KV9A 3H1JJ 4RSZA 2YKPA 1ZW0A 5GTIH 2FYZA 4U3FJ 1KB9E 2B0ZB 1WMKA 2C2CA 2OTJP 5KLVG 1ZMEC 1BCCE 3SFEC 1FDMA 2XNXA 5CCHD 4IFDK 1CHIA 1J1DB 4O1WA 4RKUJ 1NKNA 1SQPK 3WFDC 3MTUE 1BDDA 1GDTA 5B66V 3CXHW 1M1JB 3V4WA 3AE5C 3CCMP 2YK3A 3H1HJ 3P8CE 4H44B 5BU8B 2WPQA 2BCCD 3D71A 5AW2B 3L75E 1OIPA 1LS9A 1BE3J 1VL2A 1C2NA 2OYIC 5C9MA 3TGUD 2ZAEB 1URQC 4L75A 5TJHA 2C9NY 4I6MC 1IZNB 4H0JA 2DW3A 3P8MC 3H1IE 2DGEA 2R5DA 5AVSB 1WEJF 2Q1KA 3NBTA 1FOSE 4H0LC 3C8VA 3ITKA 1AQTA 4MU8A 2B87B 2OGUA 2AEFA 3FX0A 3X39A 3H1LG 3A0HH 2KSEA 4KJMA 2JR8A 2Y0EA 1OVRA 1HH7A 1NTKJ 1S3JA 2IZ0A 3B5ND 4N78D 1CTJA 1ZV8A 1NTME 3BRTB 1N73B 2HG5D 1L0NG 3JCUE 2FRCA 1YJNP 1GU5A 3PP5A 4XFJA 2W8ZA 2GUSA 2H8PD 5GTHE 4DJGA 4XXLA 3ZBMA 1P84E 3AE4C 4YPCA 2FYUD 1LWUC 1Q7YQ 3S9OA 1DW3A 3D70A 1BCCJ 1CHHA 2K3RA 1FCDC 2WSSH 4HB1A 2FXOA 1RE3A 2FYNC 2KYVA 3JCUH 1H31B 1PP9E 3CXHI 3WUUA 1AOQA 1JTHB 1UIIA 3CX5H 3GHGC 3V5BA 1QYZA 3CMAP 3A7OA 3CXHE 1KFNA 3SFDC 2QM7A 1P84H 1M7LA 3L75J 1N8RQ 3G71P 2N3BA 5KLVD 3WU2V 4IOIH 1M60A 1E2RA 2BASA 1OWAA 2CK3H 5CIHB 1SS1A 4WBAA 5AW5B 3L36A 5APWA 3H1IJ 3GF3A 1S6VB 2C1DB 1NWQA 1KTMA 2J59M 3EFFK 1NTKK 5CCGA 5AVRB 5KAIE 1FE6A 3RBXA 5CCHC 4Z1MH 2W90A 1HF9A 1RY3A 5AW3B 3DP5A 3AECC 1IRVA 1M1JA 1U57A 1VQNP 1LTIC 3RGUA 3A0BE 1YJWP 3TYIA 2Z5HA 2RKLA 2OYIB 3AE9C 1URQB 2XKMA 3IN6A 2C0XA 4C7NB 3CCJP 2BH5X 1K05A 1NTMJ 4LGDE 2CE0A 1FZBA 3HE5B 4WVZA 5AVXB 4H0LB 4K3IA 351CA 3B8EB 1T3UA 1CRJA 3L4OA 1HGZA 1RF1C 4EIFA 1RZ6A 4YE1A 3CI9A 4FA1A 4ASWA 2B87A 3H1LD 5CCGD 1N9CA 1NTZE 4IL6E 1EDJA 1CNOA 1GW4A 1YICA 1HJ0A 3CCLP 2YKQA 1GU4A 3L72E 1PP9J 2YMYA 4ZNCA 3CCEP 1L0ND 2M3BA 1LGHB 2WVRA 2YNYA 1HUCA 4NPEA 4PJ0H 3U1AA 3CX5D 3B5NC 4AAOA 1N73A 1OMIA 3RK2C 3D0WA 1CYCA 1M8OB 3CCVP 1SQXG 1IFJA 155CA 3A0HV 3AEEC 2H88C 1ZR2A 1N2DC 1H9XA 1P84D 3CCQP 4H0KA 3SWKA 3M97X 3EWKA 1Y9BA 2FYNB 1NU1G 1R5SA 3CCRP 3W68A 1Q90D 1NTMK 3CD6P 3GHGB 4EOTA 1ZRTD 1EZVI 1H31A 2ZVOB 1S1CX 2ZT9C 1OVUA 1JTHA 2ZYAA 3G9RA 3LIDA 3TK1A 2OARA 1IO3A 1CC5A 2IZ1A 1IZL0 1EZVE 2R5BA 1Q82Q 2P58A 2OQQA 4WQEA 4D6TG 1LT9B 1HROA 1I54A 1Q86Q 5KAFV 2H43A 1BSNA 2YMKA 5AURA 1DT1A 2AEMA 1COTA 4PD4E 3CCSP 3SXTA 1S5LE 2WSCH 1C6SA 4GIFA 2WT7B 2IBZI 2QJKC 1YJ9P 3F89A 2AI5A 2HLOA 3VMXA 1GK6A 1CYIA 5AVVB 1DH3A 1NTZJ 1KMIZ 4DY9A 2A45I 2IBZE 3CP5A 2WPVB 3M9HA 4R4MA 3JSVC 3PJSK 3L72J 2WSEH 2GB8B 2OYIA 1GL2C 3AEAC 1URQA 4PD4H 4QMAA 1SQPG 1K9MQ 1JM0A 1S5LH 2PP6A 4C7NA 1AYGA 1KYOD 4PV1D 3K5BA 3Q5PA 3L73E 1XTGB 2V08A 3OA7A 1RF1B 1OXZA 1LTSC 2QSIA 2GC7D 2L5GB 1CRCA 1S9KE 1G1IA 3AE7C 4KHXA 1C6OA 1ZXGA 3L70G 2CA4B 4B86A 5B5EV 5TISV 3LW5H 4ZKPA 1RHZB 2KUBA 2BH4X 5M1BA 3B5NB 3CC7P 4OWFA 1QLED 1YYCA 3RK2B 1SQXD 5CIGB 1JCCA 2AXTV 1VQMP 1HJBA 1OCDA 4WB4A 1CSWA 1FDIA 4U3FE 1URQD 1FI9A 4HYTB 1NGMB 2R32A 3L37A 1WRGA 1DD3A 4L76A 1NTZK 1NU1D 1NMIA 4IFMA 1LWUA 4PJ0V 2W83C 4NFGB 3SWFA 2QG4A 4C7RA 1CRIA 2FWLA 1USDA 1KFMA 1N86A 1NAFA 1SQVE 1RAQA 3L71E 1KILA 3GHGA 5APXA 2QJPC 1H8AA 3H1HE 1HGVA 1T2KD 4AYCA 2P7JA 2C1VA 2JQRA 4D6TD 1I8PA 1BE3G 1IFPA 3KZIE 3EQ2A 5BU5A 2CXBA 4Y5RA 2N9BA 2RH0A 1YFCA 1YI2P 1BGYJ 1PPJE 1Y8AA 1NU1K 1QX8A 2P10A 3A3YB 1FI3A 3L73J 1PGOA 3CCUP 2PRRA 3P32A 2XZRA 5L8RJ 1FJPA 2ZBOA 2C0WA 3TSIA 2WT7A 1M57D 1E5WA 1D7MA 1RQUA 2WPSA 3WU2E 4BWNA 1N15A 3H6PA 2ZONG 5APSA 1FZCC 1PGPA 4L73A 1KILD 4P4QB 3M91A 2K88A 2XDJA 1SQPD 1NTKG 4OVNF 2QJYB 1YBKA 2GUVA 2FFDA 4AQRD 1R0QA 3C1LA 5KLIC 3H25A 3OA8A 1MUUA 2WSFJ 2XTSB 1BL9A 4Q5PA 3WUTA 4PV1C 1UIXA 2JTIB 2VHDA 2OTLP 1SQBE 2E75D 1RF1A 5B6QA 1J3SA 1JY2P 3L70D 5DF5A 1SQQE 2B9BA 3WUIA 4WY4A 2Q9IA 5CYTR 3AEGC 1VQ5P 1BCCG 3RL0D 4ZKUA 1VQ4P 4WQ9A 4EICA 1QVFO 2HPCB 2I1KA 3V2NA 3HUSC 4K35A 1QGKB 5AVWB 1KQSO 2Z5IA 3PXTA 1SQVJ 1CTYA 5AVZB 3L71J 4N6JA 2O01N 1X79B 2XNDH 5AVTB 1OW8A 4TLFA 3B5NA 1MZ9A 3H1JD 1KB9H 4U3FD 1E8EA 1T6AA 3U59A 3L75G 1HVVA 3RK3E 1J1EC 3II6A 1MKMA 1KORA 1C6RA 1PZQA 5AW9B 1PIXA 2Y0DA 2WWWA 1DVHA 3VRDA 3AE8C 3ABVC 4AX3A 3L35A 3H1IG 2V7QJ 1GKSA 1CTZA 1B7VA 2N3YA 5CICB 1KQFB 1G2CB 5AW1B 1ZZHA 4W7ZA 3A9FA 4WY4D 3HQ6A 2IX7C 5H2FE 3QH9A 2QJPB 3H1HD 2QVAA 1YIQA 1GD2E 2D0WA 5CIDB 1BE3D 1CCHA 4V2KA 4FAVA 1JMBA 2V4HA 4FANA 1YCCA 1AOFA 1S5LX 1YTZI 1T2KC 3VYIA 1NMLA 1DEEG 3VMAA 1NTMG 3RK2D 1ZN5A 2PFXA 2N1TA 1G1JA 1YEAA 2UWJE 451CA 2B4ZA 1QL2A 3KXDA 1E29A 3JC22 4MN4C 1SQVK 3MIWA 3AEDC 2CE1A 1SQBJ 3MD0A 3NFQA 3VTPC 4DCKA 1L0LE 1SQQJ 3R4YA 5KAFE 1RE4C 1MFTA 1F1CA 1NTKD 2LIRA 2D2CD 1LTTC 4GODA 1PP9G 4WQ8A 3KDPB 2ZT9D 3GF7A 5GTHH 3GMAA 1GL2A 2K9YA 5KLIB 3S4RA 1KILC 1HCMA 1H89A 2FBWC 2L91A 3NWVA 3HQ9A 3CYTI 3W67A 4PV1B 3OCDB 3KYQA 3VP9A 1OW6A 3VMYA 4QAOA 2LITA 1A2SA 1KB9D 3O1YA 1S72P 4JF7A 4BXLA 2N1TD 1AV1A 3HTKA 1U7MA 1HJ4A 1VQLP 2PACA 1BCCD 2E75C 1KIBA 2D0SA 5E79E 1JNMA 1YNRA 4FA4A 1SP4A 1VF5C 2IYPA 4H13C 2K9JB 3CU4A 3AE1C 3HE4B 5APQA 3QWOC 3HUSB 3BASA 3RL0C 1GIWA 5GTIV 2E43A 3H1KE 1W2BO 2HPCA 3CXHH 3P8CD 4DZOA 1H0TB 3L75D 1C2RA 1J1EB 4FB1A 1GL2D 1VQOP 2ZVNB 3SJLA 1FJKA 5E79H 3IAOA 1SQQK 5TISE 1DIIC 2FFDC 4LC1A 1BDCA 3H1ID 2KLUA 5KAIH 3G3ZA 1NOHA 3ZOWA 4WQCA 3A5TA 3G4SP 1CCRA 1KYOI 5AW8B 4GKGA 3BCCE 4UB6E 3A0BH 1G2CA 1L0LJ 4WY4C 1HRCA 2ZXEB 4LLHA 1IQCA 1NTZG 2Q7CA 4DT0A 3IF4A 2FY8A 1H32A 3Q1MA 3L72G 2P2UA 1CIGA 2H89C 1NTMD 3M06A 1R8EA 4BRYB 1BSHA 3VNWA 3TDKA 1OW7A 4FA9A 1JY2N 2OZ1A 3VP8A 1VQPP 4WQ7A 4UB6H 3ZDMA 4JYCA 1MZ4A 1GZLA 4IL6H 1KN7A 1H9YA 1LWUB 1EB7A 1HJ3A 1ZR4A 1KV4A 1PP9D 1H1OA 2IYOA 1FZCA 4PWAA 1WT6A 2KOGA 3H1KJ 1KILB 2D2CC 3PXSA 1RF0C 5CBOA 1Z56A 1NAYA 3CXHD 5AVYB 2A06E 1C7MA 4UB8E 2XU6A 2E74D 3E7KA 2PCBB 5C0ZA 3RN0A 1EZVG 1ZLLA 2XV5A 4HH2A 2ZXYA 3OCDA 1ETPA 2MJZA 4W80A 2NPSD 2KS1A 1L0LK 1H33B 3MK7C 2C8SA 2YXQB 3TNUA 2E75B 2CPBA 2N1TC 3BRVB 3GLMA 3CL3D 2JO1A 4H13B 1CSUA 3RL0B 3CLQA 2K9JA 3WFEC 1SLQA 2JWAA 4UB8H 3HE4A 3HUSA 3BCCJ 1CEDA 1YHQP 2JP3A 4EI2A 2WMMA 3ZOYA 2JKVA 1VQ8P 4C46A 2G3AA 1H0TA 3HD7C 1FZEA 2IBZG 1CRHA 1I5TA 1FZGA 3CWBE 2N9YB 3EFGA 1FAVA 2FFDB 3AEBC 2POHA 3ZOOA 4LJIA 2JWDA 1M1KQ 1BGYE 3OA8B 1KX2A 1LTAC 2JDIH 2KZIA 1LTJC 2A45G 3OW2O 5B66E 4AAMA 3L73G 3USSA 1A8CA 4K3AA 3D6ZA 2ZOOA 2ZXXA 1NJIQ 3SVWA 2BLFB 3Q5SA 4XA4A 4WY4B 2BEZF 2HR3A 1FZAA 1QVGO 1NTZD 1T8ZA 2O3JA 3RL0g 3C2CA 1NVOA 3L74E 1L2PA 1VDFA 2M0BA 3ZOXA 3L72D 4KT0J 2KXPB 4U7JA 1YTZT 2RMZA 2A45H 1YIJP 5B66H 1N7LA 4XYDB 1JMMA 3L4FA 1A02F 1ZOYC 4NPFX 1IFDA 4BRYA 3E1IA 2GIWA 2B89A 3V6IA 2QIWA 1PL5A 1RAPA 4GT1A 3AE3C 3H1JG 2O1JA 4U3FG 1W5CT 1CYJA 1AKKA 3M0DC 1JY3P 3BVHA 1GMJA 3TYYA 2RN0A 1LMSA 1EXJA 2YQBA 1RE4A 4H44C 4HJGH 3TF5A 2BCCE 2D2CB 3PXWA 3HQ7A 2IDBA 2QM8A 2ZT9B 2WSFH 2Q3IA 1FC2C 1SQVG 1A56A 2KB7P 4Y99C 3L71G 1L9BC 3DMIA 3TGUE 4IFFA 4M3LA 3H1HG 1GJQA 4EYYQ 1EZVD 1H88A 4KMGA 1U7JA 2FXMA 3CC2P 3KPEA 3MK7B 2E74C 1DX7A 3CWBJ 2N1TB 2NPSC 1H33A 5CHXA 1PPJG 2ITAA 2ZYDA 4PD4D 3NMDA 2KP8A 2Q5UA 5DJQC 2YO2A 2O01J 2QJKB 1WVEC 1PFIA 1U74B 1QL3A 4WQDA 2M5AA 1L4AD 1CHJA 3MGNA 1CO6A 1FJ0A 4N78E 3L74J 1LJ2A 3V2QA 4NPDA 1OZHA 3KZIH 2IBZD 2YCCA 3PRJA 1Q81Q 3GG2A 2CPSA 3V4QA 1IFIA 3UIAA 1GL2B 1BGYD 4JQ0D 2V7QH 5KJ7D 1S4XA 4L74A 3L73D 1KQGB 2OYOA 4IL6X 3ZIYA 1E79H 2FYUE 4GDOA 3WC8A 5CIEB 2L4DA 3HTKB 3V2PA 1KC8Q 3T97A 1J2JB 1S9KD 1CI6B 3WU2H 1N7SD 3R2PA 2GM4A 2K37A 2E76D 1DEBA 1VF5D 1SQQG 2JEEA 1KB9I 3MHVA 4H13D 2YIUC 1S5LV 2G8YA 2YO3A 1K3HA 4EIEA 2V07A 2C9LY 4N3YB 1HZVA 2KK7A 2E42A 2R3SA 2BCCJ 4PW9B 2HODB 1EDLA 1U75B 1HTLC 3RMZA 3TGUJ 5KLVE 2VRSA 3JBTB 3RBZA 2W27A 4GOFA 1SFCA 1NIRA 3V2RA 4JBZA 1EQ7A 1CSXA 4OGQD 3HQ8A 1LTGC 2I8FA 1PV3A 1CIEA 5CMZA 3CPWO 1FDOA 3E1RA 1X8YA 3N4XA 1JB0J 5AW4B 4RESB 1I6EA 1OFCX 3MP7B 1KD1Q 2ZFCA 4RJTA 2C1UA 3D6YA 1SQVD 3M9QA 4L1QA 3L71D 4Y99B 1XTCC 4EIDA 2NZ2A 4J20A 1RF0A 3A0HE 5KKZC 2IFNA 2LXBA 3AE2C 1GQ1A 5EFWB 3U1CA 1K04A 3IFMA 1NNOA 1H32B 2E74B 3NTNA 2IPPA 1DW1A 2ZJSE 1DVVA 1HJ5A 2NPSB 1OX3A 1JOCA 1I6DA 1PPJD 4I1LA 2OZ1B 1SFCD 1K8AQ 1IK7A 2YKOA 5DJQB 3O0RC 2FYUJ 5H2FH 2J5UA 3H1LE 4TT3H 2QRXA 1JDLA 1LFMA 1A02J 1VQ7P 3CX5I 1PGJA 1EDKA 1FI7A 1L0LG 1L0NE 1KYOW 1M6ZA 2KIKA 2KNCB 1W2EA 1P84I 1X22A 1L4AC 2W6BA 1TU3F 1FZCB 1EC5A 1EDIA 1W5CE 2ZZS1 1HBWA 3CX5E 1AFOA 2NRGA 3CMEP 3HD7A 2E5TA 1CRGA 2OYHC 1I8OA 1NH4A 5CIBB 5KLVJ 1LTJA 5KJ7C 1JY3N 3KZIV 3P7KA 2BGVX 2EXVA 3M9BA 2KS1B 5BVZA 1SQBD 1YQ3C 1GU2A 3TNUB 1C52A 3H32A 1SQQD 4GOEA 4AUWA 2GA1A 3AEFC 4FA5A 2R3CA 4JYBA 5KAFH 2YIUB 1AQ5A 4CPGA 5C39A 1CI6A 1W2LA 4W7YA 1ZRTE 4WWIA 1N7SC 2E76C 3I55P 1USEA 3VOPA 4L3GA 2M3EA 1LTBC 1JCDA 3H1KG 4Y28J 3O6QB 1LC2A 4AANA 1JEKA 2HODA 3Q5RA 1LT9C 4XE5B 1CXAA 1RQVA 2FYUK 2YXRB 1EXIA 2CA3B 3HD7D 4EIJA 3RK3D 1YTCA 3I5CA 1SQBK 3KQGA 5K5GB 4ASVA 5CJ4A 1KQLA 2N9IA 5APUA 2JJLA 5B5EE 1AJYA 2MHMA 4OGQC 3M0DA 2AXCA 2WITA 2HYNA 4ZMDA 3O8ZA 3MUDC 3H1LJ 2B12B 5AW7B 3FXEA 5APVA 3DR0A 2R44A 2AXTE 3Q2YA 5KKZB 2K1AA 2PCCB 1IC2A 3BCCG 2PGDA 5KLVK 3N7NA 3S1KA 2ZYGA 1FS0E 1L0NJ 2WTYA 1VQ9P 1FHBA 1CSVA 4N0KA 2Q3EA 1CXCA 5B5EH 5TISH 1S2EA 2Y9ZA 1KYOE 4HKZH 1CIHA 5AVUB 4PJ0E 1FZFA 2KLVA 5CBNA 2BEQD 3MZWB 4YTPC 2NPSA 1R5LA 5DFSA 4JPZB 3WFCC 1N90A 2AXTH 1SFCC 2I1JA 3KHUA 2DVHA 1IFMA 4O9BA 1MV8A 2P67A 1L0LD 1AVOA 3PH2B 2HV4A 1KYOH 2HFED 1L4AB 1FU1A 4H44D 1M90Q 5AVQB 2KNCA 5CIFB 1SQXE 5H2FV 2OYHB 3O20A 1GW3A 2LXCB 3NXSA 3SWYA 5IY51 1IRWA 1AVYA 3O5CA 3M0AA 2C9XB 3VYMA 1GK4A 4O1QA 3G6EP 2A06G 4R4LA 3PLNA 2J58A 1DD4A 1NU1E 1VQKP 2W6AA 3FWLA 3NBSA 1QEXA 2Y9YA 1YEBA 3OAKA 3GW6A 3PHLA 3FXDA 1NHLA 1L0NK 1QL4A 1N7SB 5GTHV 2M8RA 2P1JA 2E76B 3WFBC 1VF5B 2E5YA 2IFMA 1JY3O 4OH8B 3H1KD 2FKWB 2B11B 3FWNA 1NO4A 3CC4P 2M5AB 4PD4I 1KZUB 4D6TE 5AW6B 4YXDC 1AA0A 3B71A 5CJ0A 2WQYC 3O6QA 1LC1A 1JUNA 2Z4EA 2QE7H 4GEDB 3PTZA 3RK3C 2C1DA 3CWBG 1IFNA 4OGQB 4I7ZC 1IK9A 5EXQA 4I2LC 1BGYG 3RN1A 5AW0B 4JCGA 3LIEA 1M56D 3WUVA 1DW2A
chains in the Genus database with same CATH topology
1HZUA 1CO6A 1FJ0A 1CRJA 3L4OA 2IBZD 2YCCA 3PRJA 2N18C 2GC4D 3BCCD 4EIFA 1YEAA 1RZ6A 4YE1A 3GG2A 4FA1A 5E79V 451CA 4AALA 2MTAC 2Y0CA 2B4ZA 1C75A 3H1LD 1BGYD 1N9CA 1E29A 1CNOA 1YICA 2CE1A 5KAIV 3L73D 3RLMA 1QKSA 2AIUA 3ZIYA 1L0ND 3WC8A 5CIEB 2L4DA 4L3HA 3CX5D 4AAOA 3A0BV 1F1CA 1NTKD 2LIRA 1CYCA 4WQ8A 155CA 3A0HV 1H9XA 1P84D 1S5LV 5KLIB 4H0KA 1HCMA 1K3HA 4GYDA 3NWVA 4EIEA 3HQ9A 1DIQC 2V07A 2L91A 3M97X 1I55A 1GDVA 1HZVA 3CYTI 3OCDB 2ORLA 4PW9B 4QAOA 2LITA 1A2SA 2FYNB 1KB9D 3O1YA 1K3GA 1U75B 3RMZA 4WQBA 1HJ4A 3JBTB 4UB6V 1MG3D 2PACA 1BCCD 4WQAA 1ZRTD 1H31A 1NIRA 1KIBA 2D0SA 1YNRA 4FA4A 3SLEA 2A06D 1CSXA 4IL6V 2K9JB 3HQ8A 1VYDA 3CU4A 1KB0A 2I8FA 1CIEA 1KX7A 1IO3A 2N9JA 1CC5A 1GIWA 1IZL0 5GTIV 3L4MA 2BCNB 1I6EA 4WQEA 2BPBB 1HROA 1I54A 3L75D 4RJTA 5KAFV 1L9JC 2C1UA 1C2RA 1FOCA 4FB1A 1SQVD 4L1QA 3L71D 5AURA 4EIDA 1DT1A 1COTA 1CRYA 4J20A 3SJLA 3ORVA 4EDFA 3SXTA 1GQ1A 1MG2D 1C6SA 1NNOA 1QN2A 1DIIC 3H1ID 1H32B 2AI5A 3ZOWA 4WQCA 1DW1A 1CYIA 1DVVA 1HJ5A 1I6DA 1PPJD 4DY9A 1CCRA 2OZ1B 3CP5A 1OAEA 3CWBD 2GB8B 2B10B 5DJQB 3O0RC 1HRCA 1DW0A 1F1FA 1JDLA 1IQCA 4UB8V 1LFMA 1AYGA 1KYOD 1H32A 2V08A 1CIGA 1NTMD 1FI7A 1RZ5A 1KYOW 1M6ZA 2N18B 1N50A 2KNCB 3VNWA 3TDKA 2GC7D 1M70A 4FA9A 4A7PA 2ZZS1 1CRCA 2OZ1A 1CIFA 1C6OA 3L74D 4WQ7A 1CRGA 1I8OA 2CA4B 3CX5W 3ZCFA 5B5EV 1MZ4A 5TISV 1CORA 5CIBB 3SWSA 1H9YA 1KV9A 3KZIV 4RSZA 2BH4X 2BGVX 1EB7A 2EXVA 1HJ3A 1SQBD 2B0ZB 1PP9D 1GU2A 2C2CA 1H1OA 1SQXD 1C52A 5CIGB 1SQQD 2AXTV 4FA5A 4PWAA 1OCDA 2YIUB 1W2LA 1CSWA 3PXSA 1FI9A 1CHIA 3CXHD 4O1WA 1C7MA 4L3GA 3WFDC 1NU1D 1NMIA 2PCBB 5B66V 3CXHW 4PJ0V 5C0ZA 4NFGB 1LC2A 3RN0A 4AANA 2QG4A 2ZXYA 3OCDA 1ETPA 2YK3A 1CRIA 2KS1A 1H33B 1CXAA 3MK7C 2C8SA 2BCCD 2CA3B 2FWLA 1LS9A 1YTCA 1RAQA 1CSUA 1C2NA 5C9MA 3TGUD 2N9IA 5TJHA 3WFEC 2MHMA 2JWAA 2C1VA 4H0JA 2JQRA 4D6TD 1I8PA 2DGEA 1CEDA 2CXBA 4Y5RA 3ZOYA 1WEJF 3NBTA 1YFCA 2B12B 3ITKA 4MU8A 3DR0A 1FI3A 1CRHA 1I5TA 5KKZB 2PCCB 3X39A 2N9YB 3ZOOA 4LJIA 1FHBA 3OA8B 1CSVA 1KX2A 4N0KA 2Q3EA 2ZBOA 1CXCA 2Y0EA 1CIHA 1HH7A 4AAMA 1A8CA 1CTJA 2ZOOA 1N15A 2FRCA 2ZONG 3SVWA 2BLFB 5DFSA 3WFCC 4P4QB 1N90A 1SQPD 1NTZD 2O3JA 3C2CA 3KHUA 2DVHA 2QJYB 3ZOXA 4XXLA 3ZBMA 1R0QA 3L72D 3OA8A 1L0LD 3PH2B 2FYUD 2XTSB 1BL9A 4Q5PA 2RMZA 2HV4A 1DW3A 1CHHA 1FCDC 4XYDB 2JTIB 2VHDA 1H31B 5B6QA 1J3SA 5CIFB 3L70D 2GIWA 5DF5A 5H2FV 1AOQA 3O20A 3WUIA 1RAPA 5CYTR 5IY51 1IRWA 3O5CA 1QYZA 2C9XB 3VYMA 4O1QA 1W5CT 4WQ9A 1CYJA 4EICA 1AKKA 3PLNA 2RN0A 3PXTA 3FWLA 1CTYA 1LMSA 2N3BA 2YQBA 3NBSA 5KLVD 1YEBA 3WU2V 3GW6A 3PHLA 1M60A 3H1JD 1E2RA 1QL4A 4U3FD 3TF5A 1E8EA 3PXWA 5GTHV 5CIHB 3HQ7A 3WFBC 1S6VB 2C1DB 1A56A 1C6RA 1L9BC 3DMIA 2Y0DA 1GJQA 3H1KD 1DVHA 1EZVD 3VRDA 2B11B 4KMGA 4AX3A 3DP5A 3MK7B 1IRVA 1GKSA 1CTZA 1B7VA 1LC1A 2N3YA 5CICB 3TYIA 1ZZHA 3A9FA 1H33A 3HQ6A 4GEDB 2QJPB 3H1HD 4PD4D 1YIQA 2D0WA 3PTZA 2C1DA 2BH5X 5CIDB 5DJQC 1BE3D 1CCHA 4V2KA 4FAVA 5EXQA 4FANA 2QJKB 1YCCA 1WVEC 1AOFA 2CE0A 1U74B 3RN1A 4JCGA 1QL3A 1NMLA 4WQDA 4K3IA 351CA 1CHJA 1DW2A 3VMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZU A;  1CO6 A;  1FJ0 A;  1CRJ A;  3L4O A;  2IBZ D;  2YCC A;  3PRJ A;  2N18 C;  2GC4 D;  3BCC D;  4EIF A;  1YEA A;  1RZ6 A;  4YE1 A;  3GG2 A;  4FA1 A;  5E79 V;  451C A;  4AAL A;  2MTA C;  2Y0C A;  2B4Z A;  1C75 A;  3H1L D;  1BGY D;  1N9C A;  1E29 A;  1CNO A;  1YIC A;  2CE1 A;  5KAI V;  3L73 D;  3RLM A;  1QKS A;  2AIU A;  3ZIY A;  1L0N D;  3WC8 A;  5CIE B;  2L4D A;  4L3H A;  3CX5 D;  4AAO A;  3A0B V;  1F1C A;  1NTK D;  2LIR A;  1CYC A;  4WQ8 A;  155C A;  3A0H V;  1H9X A;  1P84 D;  1S5L V;  5KLI B;  4H0K A;  1HCM A;  1K3H A;  4GYD A;  3NWV A;  4EIE A;  3HQ9 A;  1DIQ C;  2V07 A;  2L91 A;  3M97 X;  1I55 A;  1GDV A;  1HZV A;  3CYT I;  3OCD B;  2ORL A;  4PW9 B;  4QAO A;  2LIT A;  1A2S A;  2FYN B;  1KB9 D;  3O1Y A;  1K3G A;  1U75 B;  3RMZ A;  4WQB A;  1HJ4 A;  3JBT B;  4UB6 V;  1MG3 D;  2PAC A;  1BCC D;  4WQA A;  1ZRT D;  1H31 A;  1NIR A;  1KIB A;  2D0S A;  1YNR A;  4FA4 A;  3SLE A;  2A06 D;  1CSX A;  4IL6 V;  2K9J B;  3HQ8 A;  1VYD A;  3CU4 A;  1KB0 A;  2I8F A;  1CIE A;  1KX7 A;  1IO3 A;  2N9J A;  1CC5 A;  1GIW A;  1IZL 0;  5GTI V;  3L4M A;  2BCN B;  1I6E A;  4WQE A;  2BPB B;  1HRO A;  1I54 A;  3L75 D;  4RJT A;  5KAF V;  1L9J C;  2C1U A;  1C2R A;  1FOC A;  4FB1 A;  1SQV D;  4L1Q A;  3L71 D;  5AUR A;  4EID A;  1DT1 A;  1COT A;  1CRY A;  4J20 A;  3SJL A;  3ORV A;  4EDF A;  3SXT A;  1GQ1 A;  1MG2 D;  1C6S A;  1NNO A;  1QN2 A;  1DII C;  3H1I D;  1H32 B;  2AI5 A;  3ZOW A;  4WQC A;  1DW1 A;  1CYI A;  1DVV A;  1HJ5 A;  1I6D A;  1PPJ D;  4DY9 A;  1CCR A;  2OZ1 B;  3CP5 A;  1OAE A;  3CWB D;  2GB8 B;  2B10 B;  5DJQ B;  3O0R C;  1HRC A;  1DW0 A;  1F1F A;  1JDL A;  1IQC A;  4UB8 V;  1LFM A;  1AYG A;  1KYO D;  1H32 A;  2V08 A;  1CIG A;  1NTM D;  1FI7 A;  1RZ5 A;  1KYO W;  1M6Z A;  2N18 B;  1N50 A;  2KNC B;  3VNW A;  3TDK A;  2GC7 D;  1M70 A;  4FA9 A;  4A7P A;  2ZZS 1;  1CRC A;  2OZ1 A;  1CIF A;  1C6O A;  3L74 D;  4WQ7 A;  1CRG A;  1I8O A;  2CA4 B;  3CX5 W;  3ZCF A;  5B5E V;  1MZ4 A;  5TIS V;  1COR A;  5CIB B;  3SWS A;  1H9Y A;  1KV9 A;  3KZI V;  4RSZ A;  2BH4 X;  2BGV X;  1EB7 A;  2EXV A;  1HJ3 A;  1SQB D;  2B0Z B;  1PP9 D;  1GU2 A;  2C2C A;  1H1O A;  1SQX D;  1C52 A;  5CIG B;  1SQQ D;  2AXT V;  4FA5 A;  4PWA A;  1OCD A;  2YIU B;  1W2L A;  1CSW A;  3PXS A;  1FI9 A;  1CHI A;  3CXH D;  4O1W A;  1C7M A;  4L3G A;  3WFD C;  1NU1 D;  1NMI A;  2PCB B;  5B66 V;  3CXH W;  4PJ0 V;  5C0Z A;  4NFG B;  1LC2 A;  3RN0 A;  4AAN A;  2QG4 A;  2ZXY A;  3OCD A;  1ETP A;  2YK3 A;  1CRI A;  2KS1 A;  1H33 B;  1CXA A;  3MK7 C;  2C8S A;  2BCC D;  2CA3 B;  2FWL A;  1LS9 A;  1YTC A;  1RAQ A;  1CSU A;  1C2N A;  5C9M A;  3TGU D;  2N9I A;  5TJH A;  3WFE C;  2MHM A;  2JWA A;  2C1V A;  4H0J A;  2JQR A;  4D6T D;  1I8P A;  2DGE A;  1CED A;  2CXB A;  4Y5R A;  3ZOY A;  1WEJ F;  3NBT A;  1YFC A;  2B12 B;  3ITK A;  4MU8 A;  3DR0 A;  1FI3 A;  1CRH A;  1I5T A;  5KKZ B;  2PCC B;  3X39 A;  2N9Y B;  3ZOO A;  4LJI A;  1FHB A;  3OA8 B;  1CSV A;  1KX2 A;  4N0K A;  2Q3E A;  2ZBO A;  1CXC A;  2Y0E A;  1CIH A;  1HH7 A;  4AAM A;  1A8C A;  1CTJ A;  2ZOO A;  1N15 A;  2FRC A;  2ZON G;  3SVW A;  2BLF B;  5DFS A;  3WFC C;  4P4Q B;  1N90 A;  1SQP D;  1NTZ D;  2O3J A;  3C2C A;  3KHU A;  2DVH A;  2QJY B;  3ZOX A;  4XXL A;  3ZBM A;  1R0Q A;  3L72 D;  3OA8 A;  1L0L D;  3PH2 B;  2FYU D;  2XTS B;  1BL9 A;  4Q5P A;  2RMZ A;  2HV4 A;  1DW3 A;  1CHH A;  1FCD C;  4XYD B;  2JTI B;  2VHD A;  1H31 B;  5B6Q A;  1J3S A;  5CIF B;  3L70 D;  2GIW A;  5DF5 A;  5H2F V;  1AOQ A;  3O20 A;  3WUI A;  1RAP A;  5CYT R;  5IY5 1;  1IRW A;  3O5C A;  1QYZ A;  2C9X B;  3VYM A;  4O1Q A;  1W5C T;  4WQ9 A;  1CYJ A;  4EIC A;  1AKK A;  3PLN A;  2RN0 A;  3PXT A;  3FWL A;  1CTY A;  1LMS A;  2N3B A;  2YQB A;  3NBS A;  5KLV D;  1YEB A;  3WU2 V;  3GW6 A;  3PHL A;  1M60 A;  3H1J D;  1E2R A;  1QL4 A;  4U3F D;  3TF5 A;  1E8E A;  3PXW A;  5GTH V;  5CIH B;  3HQ7 A;  3WFB C;  1S6V B;  2C1D B;  1A56 A;  1C6R A;  1L9B C;  3DMI A;  2Y0D A;  1GJQ A;  3H1K D;  1DVH A;  1EZV D;  3VRD A;  2B11 B;  4KMG A;  4AX3 A;  3DP5 A;  3MK7 B;  1IRV A;  1GKS A;  1CTZ A;  1B7V A;  1LC1 A;  2N3Y A;  5CIC B;  3TYI A;  1ZZH A;  3A9F A;  1H33 A;  3HQ6 A;  4GED B;  2QJP B;  3H1H D;  4PD4 D;  1YIQ A;  2D0W A;  3PTZ A;  2C1D A;  2BH5 X;  5CID B;  5DJQ C;  1BE3 D;  1CCH A;  4V2K A;  4FAV A;  5EXQ A;  4FAN A;  2QJK B;  1YCC A;  1WVE C;  1AOF A;  2CE0 A;  1U74 B;  3RN1 A;  4JCG A;  1QL3 A;  1NML A;  4WQD A;  4K3I A;  351C A;  1CHJ A;  1DW2 A;  3VMA A; 
#chains in the Genus database with same CATH topology
 1HZU A;  1RE3 C;  3T97 B;  2N18 C;  2GC4 D;  2KI7 B;  3BCC D;  3FGA D;  1X9V A;  1LP1 B;  1SVF A;  3IR9 A;  5E79 V;  4AAL A;  2MTA C;  2Y0C A;  1KIL E;  1C75 A;  2LKM A;  1SQP E;  3HRN A;  1CW5 A;  2QJY C;  1Q2N A;  3L74 G;  5KAI V;  3RLM A;  1QKS A;  2AIU A;  1SQX J;  1YQ4 C;  3HE5 A;  1JO5 A;  4L3H A;  1LT1 A;  3A0B V;  1SFC B;  2O01 H;  3L70 E;  3PH0 A;  2QA4 P;  5APY A;  1NU1 J;  1ZP0 C;  5CCG C;  4GYD A;  1DIQ C;  1I55 A;  1GDV A;  1CZQ A;  1J1D C;  2KZJ A;  1YIT P;  1X0T A;  3AE6 C;  2ORL A;  1GTW A;  1IJD B;  2WSC J;  2OTK E;  1M1J C;  1JY2 O;  1T3J A;  1K3G A;  3C9I A;  1L4A A;  4WQB A;  4UB6 V;  3H1J E;  1MG3 D;  1K73 Q;  4WQA A;  2BCC G;  5DJT B;  2OYH A;  1QL1 A;  3SLE A;  4D6T J;  2A06 D;  4IL6 V;  1VYD A;  1PGQ A;  1KB0 A;  2I8D A;  3TGU G;  1HWT C;  3WMM 0;  1KX7 A;  2N9J A;  1RH5 B;  2WSE J;  1OVV A;  5KJ7 A;  3L4M A;  2MKV A;  5APT A;  4H0L D;  2BCN B;  2BPB B;  3OJA B;  5KTB A;  2H7H A;  2KSJ A;  2W6J H;  1L9J C;  1NKZ B;  1Y47 A;  1FOC A;  2B88 A;  3SSU A;  3F5H A;  1CRY A;  3I56 P;  1N7S A;  1SQX K;  3ORV A;  4EDF A;  3A2A A;  2Q6Q A;  1MG2 D;  1IO4 A;  3BAT A;  1QN2 A;  1BE3 E;  3B4S A;  1CSB A;  3LW5 J;  3VMZ A;  1SQP J;  1LT9 A;  1FBM A;  1FOS F;  1N73 C;  1DIP A;  1VPC A;  2WZ7 A;  3HD7 B;  1NYH A;  3VN0 A;  1OAE A;  3RK3 B;  3CWB D;  2B10 B;  4I7Z B;  1DW0 A;  1F1F A;  1HH0 A;  2WPR A;  4UB8 V;  5CCH A;  2LR2 A;  1LTJ B;  5GTI E;  3L70 J;  1RZ5 A;  1VQ6 P;  2FYU G;  2N18 B;  1N50 A;  2PAJ A;  2FXP A;  3MUD A;  4YXW H;  5DJU B;  1M70 A;  3H32 B;  1LNQ A;  4A7P A;  4RO0 A;  2SPZ A;  1CIF A;  1NTK E;  3Q3D A;  1SQB G;  3L74 D;  2O1K A;  1LP1 A;  3CX5 W;  4DOJ A;  3ZCF A;  1COR A;  2QEX P;  1MFZ A;  3SWS A;  2AEJ A;  1KV9 A;  3H1J J;  4RSZ A;  2YKP A;  1ZW0 A;  5GTI H;  2FYZ A;  4U3F J;  1KB9 E;  2B0Z B;  1WMK A;  2C2C A;  2OTJ P;  5KLV G;  1ZME C;  1BCC E;  3SFE C;  1FDM A;  2XNX A;  5CCH D;  4IFD K;  1CHI A;  1J1D B;  4O1W A;  4RKU J;  1NKN A;  1SQP K;  3WFD C;  3MTU E;  1BDD A;  1GDT A;  5B66 V;  3CXH W;  1M1J B;  3V4W A;  3AE5 C;  3CCM P;  2YK3 A;  3H1H J;  3P8C E;  4H44 B;  5BU8 B;  2WPQ A;  2BCC D;  3D71 A;  5AW2 B;  3L75 E;  1OIP A;  1LS9 A;  1BE3 J;  1VL2 A;  1C2N A;  2OYI C;  5C9M A;  3TGU D;  2ZAE B;  1URQ C;  4L75 A;  5TJH A;  2C9N Y;  4I6M C;  1IZN B;  4H0J A;  2DW3 A;  3P8M C;  3H1I E;  2DGE A;  2R5D A;  5AVS B;  1WEJ F;  2Q1K A;  3NBT A;  1FOS E;  4H0L C;  3C8V A;  3ITK A;  1AQT A;  4MU8 A;  2B87 B;  2OGU A;  2AEF A;  3FX0 A;  3X39 A;  3H1L G;  3A0H H;  2KSE A;  4KJM A;  2JR8 A;  2Y0E A;  1OVR A;  1HH7 A;  1NTK J;  1S3J A;  2IZ0 A;  3B5N D;  4N78 D;  1CTJ A;  1ZV8 A;  1NTM E;  3BRT B;  1N73 B;  2HG5 D;  1L0N G;  3JCU E;  2FRC A;  1YJN P;  1GU5 A;  3PP5 A;  4XFJ A;  2W8Z A;  2GUS A;  2H8P D;  5GTH E;  4DJG A;  4XXL A;  3ZBM A;  1P84 E;  3AE4 C;  4YPC A;  2FYU D;  1LWU C;  1Q7Y Q;  3S9O A;  1DW3 A;  3D70 A;  1BCC J;  1CHH A;  2K3R A;  1FCD C;  2WSS H;  4HB1 A;  2FXO A;  1RE3 A;  2FYN C;  2KYV A;  3JCU H;  1H31 B;  1PP9 E;  3CXH I;  3WUU A;  1AOQ A;  1JTH B;  1UII A;  3CX5 H;  3GHG C;  3V5B A;  1QYZ A;  3CMA P;  3A7O A;  3CXH E;  1KFN A;  3SFD C;  2QM7 A;  1P84 H;  1M7L A;  3L75 J;  1N8R Q;  3G71 P;  2N3B A;  5KLV D;  3WU2 V;  4IOI H;  1M60 A;  1E2R A;  2BAS A;  1OWA A;  2CK3 H;  5CIH B;  1SS1 A;  4WBA A;  5AW5 B;  3L36 A;  5APW A;  3H1I J;  3GF3 A;  1S6V B;  2C1D B;  1NWQ A;  1KTM A;  2J59 M;  3EFF K;  1NTK K;  5CCG A;  5AVR B;  5KAI E;  1FE6 A;  3RBX A;  5CCH C;  4Z1M H;  2W90 A;  1HF9 A;  1RY3 A;  5AW3 B;  3DP5 A;  3AEC C;  1IRV A;  1M1J A;  1U57 A;  1VQN P;  1LTI C;  3RGU A;  3A0B E;  1YJW P;  3TYI A;  2Z5H A;  2RKL A;  2OYI B;  3AE9 C;  1URQ B;  2XKM A;  3IN6 A;  2C0X A;  4C7N B;  3CCJ P;  2BH5 X;  1K05 A;  1NTM J;  4LGD E;  2CE0 A;  1FZB A;  3HE5 B;  4WVZ A;  5AVX B;  4H0L B;  4K3I A;  351C A;  3B8E B;  1T3U A;  1CRJ A;  3L4O A;  1HGZ A;  1RF1 C;  4EIF A;  1RZ6 A;  4YE1 A;  3CI9 A;  4FA1 A;  4ASW A;  2B87 A;  3H1L D;  5CCG D;  1N9C A;  1NTZ E;  4IL6 E;  1EDJ A;  1CNO A;  1GW4 A;  1YIC A;  1HJ0 A;  3CCL P;  2YKQ A;  1GU4 A;  3L72 E;  1PP9 J;  2YMY A;  4ZNC A;  3CCE P;  1L0N D;  2M3B A;  1LGH B;  2WVR A;  2YNY A;  1HUC A;  4NPE A;  4PJ0 H;  3U1A A;  3CX5 D;  3B5N C;  4AAO A;  1N73 A;  1OMI A;  3RK2 C;  3D0W A;  1CYC A;  1M8O B;  3CCV P;  1SQX G;  1IFJ A;  155C A;  3A0H V;  3AEE C;  2H88 C;  1ZR2 A;  1N2D C;  1H9X A;  1P84 D;  3CCQ P;  4H0K A;  3SWK A;  3M97 X;  3EWK A;  1Y9B A;  2FYN B;  1NU1 G;  1R5S A;  3CCR P;  3W68 A;  1Q90 D;  1NTM K;  3CD6 P;  3GHG B;  4EOT A;  1ZRT D;  1EZV I;  1H31 A;  2ZVO B;  1S1C X;  2ZT9 C;  1OVU A;  1JTH A;  2ZYA A;  3G9R A;  3LID A;  3TK1 A;  2OAR A;  1IO3 A;  1CC5 A;  2IZ1 A;  1IZL 0;  1EZV E;  2R5B A;  1Q82 Q;  2P58 A;  2OQQ A;  4WQE A;  4D6T G;  1LT9 B;  1HRO A;  1I54 A;  1Q86 Q;  5KAF V;  2H43 A;  1BSN A;  2YMK A;  5AUR A;  1DT1 A;  2AEM A;  1COT A;  4PD4 E;  3CCS P;  3SXT A;  1S5L E;  2WSC H;  1C6S A;  4GIF A;  2WT7 B;  2IBZ I;  2QJK C;  1YJ9 P;  3F89 A;  2AI5 A;  2HLO A;  3VMX A;  1GK6 A;  1CYI A;  5AVV B;  1DH3 A;  1NTZ J;  1KMI Z;  4DY9 A;  2A45 I;  2IBZ E;  3CP5 A;  2WPV B;  3M9H A;  4R4M A;  3JSV C;  3PJS K;  3L72 J;  2WSE H;  2GB8 B;  2OYI A;  1GL2 C;  3AEA C;  1URQ A;  4PD4 H;  4QMA A;  1SQP G;  1K9M Q;  1JM0 A;  1S5L H;  2PP6 A;  4C7N A;  1AYG A;  1KYO D;  4PV1 D;  3K5B A;  3Q5P A;  3L73 E;  1XTG B;  2V08 A;  3OA7 A;  1RF1 B;  1OXZ A;  1LTS C;  2QSI A;  2GC7 D;  2L5G B;  1CRC A;  1S9K E;  1G1I A;  3AE7 C;  4KHX A;  1C6O A;  1ZXG A;  3L70 G;  2CA4 B;  4B86 A;  5B5E V;  5TIS V;  3LW5 H;  4ZKP A;  1RHZ B;  2KUB A;  2BH4 X;  5M1B A;  3B5N B;  3CC7 P;  4OWF A;  1QLE D;  1YYC A;  3RK2 B;  1SQX D;  5CIG B;  1JCC A;  2AXT V;  1VQM P;  1HJB A;  1OCD A;  4WB4 A;  1CSW A;  1FDI A;  4U3F E;  1URQ D;  1FI9 A;  4HYT B;  1NGM B;  2R32 A;  3L37 A;  1WRG A;  1DD3 A;  4L76 A;  1NTZ K;  1NU1 D;  1NMI A;  4IFM A;  1LWU A;  4PJ0 V;  2W83 C;  4NFG B;  3SWF A;  2QG4 A;  4C7R A;  1CRI A;  2FWL A;  1USD A;  1KFM A;  1N86 A;  1NAF A;  1SQV E;  1RAQ A;  3L71 E;  1KIL A;  3GHG A;  5APX A;  2QJP C;  1H8A A;  3H1H E;  1HGV A;  1T2K D;  4AYC A;  2P7J A;  2C1V A;  2JQR A;  4D6T D;  1I8P A;  1BE3 G;  1IFP A;  3KZI E;  3EQ2 A;  5BU5 A;  2CXB A;  4Y5R A;  2N9B A;  2RH0 A;  1YFC A;  1YI2 P;  1BGY J;  1PPJ E;  1Y8A A;  1NU1 K;  1QX8 A;  2P10 A;  3A3Y B;  1FI3 A;  3L73 J;  1PGO A;  3CCU P;  2PRR A;  3P32 A;  2XZR A;  5L8R J;  1FJP A;  2ZBO A;  2C0W A;  3TSI A;  2WT7 A;  1M57 D;  1E5W A;  1D7M A;  1RQU A;  2WPS A;  3WU2 E;  4BWN A;  1N15 A;  3H6P A;  2ZON G;  5APS A;  1FZC C;  1PGP A;  4L73 A;  1KIL D;  4P4Q B;  3M91 A;  2K88 A;  2XDJ A;  1SQP D;  1NTK G;  4OVN F;  2QJY B;  1YBK A;  2GUV A;  2FFD A;  4AQR D;  1R0Q A;  3C1L A;  5KLI C;  3H25 A;  3OA8 A;  1MUU A;  2WSF J;  2XTS B;  1BL9 A;  4Q5P A;  3WUT A;  4PV1 C;  1UIX A;  2JTI B;  2VHD A;  2OTL P;  1SQB E;  2E75 D;  1RF1 A;  5B6Q A;  1J3S A;  1JY2 P;  3L70 D;  5DF5 A;  1SQQ E;  2B9B A;  3WUI A;  4WY4 A;  2Q9I A;  5CYT R;  3AEG C;  1VQ5 P;  1BCC G;  3RL0 D;  4ZKU A;  1VQ4 P;  4WQ9 A;  4EIC A;  1QVF O;  2HPC B;  2I1K A;  3V2N A;  3HUS C;  4K35 A;  1QGK B;  5AVW B;  1KQS O;  2Z5I A;  3PXT A;  1SQV J;  1CTY A;  5AVZ B;  3L71 J;  4N6J A;  2O01 N;  1X79 B;  2XND H;  5AVT B;  1OW8 A;  4TLF A;  3B5N A;  1MZ9 A;  3H1J D;  1KB9 H;  4U3F D;  1E8E A;  1T6A A;  3U59 A;  3L75 G;  1HVV A;  3RK3 E;  1J1E C;  3II6 A;  1MKM A;  1KOR A;  1C6R A;  1PZQ A;  5AW9 B;  1PIX A;  2Y0D A;  2WWW A;  1DVH A;  3VRD A;  3AE8 C;  3ABV C;  4AX3 A;  3L35 A;  3H1I G;  2V7Q J;  1GKS A;  1CTZ A;  1B7V A;  2N3Y A;  5CIC B;  1KQF B;  1G2C B;  5AW1 B;  1ZZH A;  4W7Z A;  3A9F A;  4WY4 D;  3HQ6 A;  2IX7 C;  5H2F E;  3QH9 A;  2QJP B;  3H1H D;  2QVA A;  1YIQ A;  1GD2 E;  2D0W A;  5CID B;  1BE3 D;  1CCH A;  4V2K A;  4FAV A;  1JMB A;  2V4H A;  4FAN A;  1YCC A;  1AOF A;  1S5L X;  1YTZ I;  1T2K C;  3VYI A;  1NML A;  1DEE G;  3VMA A;  1NTM G;  3RK2 D;  1ZN5 A;  2PFX A;  2N1T A;  1G1J A;  1YEA A;  2UWJ E;  451C A;  2B4Z A;  1QL2 A;  3KXD A;  1E29 A;  3JC2 2;  4MN4 C;  1SQV K;  3MIW A;  3AED C;  2CE1 A;  1SQB J;  3MD0 A;  3NFQ A;  3VTP C;  4DCK A;  1L0L E;  1SQQ J;  3R4Y A;  5KAF E;  1RE4 C;  1MFT A;  1F1C A;  1NTK D;  2LIR A;  2D2C D;  1LTT C;  4GOD A;  1PP9 G;  4WQ8 A;  3KDP B;  2ZT9 D;  3GF7 A;  5GTH H;  3GMA A;  1GL2 A;  2K9Y A;  5KLI B;  3S4R A;  1KIL C;  1HCM A;  1H89 A;  2FBW C;  2L91 A;  3NWV A;  3HQ9 A;  3CYT I;  3W67 A;  4PV1 B;  3OCD B;  3KYQ A;  3VP9 A;  1OW6 A;  3VMY A;  4QAO A;  2LIT A;  1A2S A;  1KB9 D;  3O1Y A;  1S72 P;  4JF7 A;  4BXL A;  2N1T D;  1AV1 A;  3HTK A;  1U7M A;  1HJ4 A;  1VQL P;  2PAC A;  1BCC D;  2E75 C;  1KIB A;  2D0S A;  5E79 E;  1JNM A;  1YNR A;  4FA4 A;  1SP4 A;  1VF5 C;  2IYP A;  4H13 C;  2K9J B;  3CU4 A;  3AE1 C;  3HE4 B;  5APQ A;  3QWO C;  3HUS B;  3BAS A;  3RL0 C;  1GIW A;  5GTI V;  2E43 A;  3H1K E;  1W2B O;  2HPC A;  3CXH H;  3P8C D;  4DZO A;  1H0T B;  3L75 D;  1C2R A;  1J1E B;  4FB1 A;  1GL2 D;  1VQO P;  2ZVN B;  3SJL A;  1FJK A;  5E79 H;  3IAO A;  1SQQ K;  5TIS E;  1DII C;  2FFD C;  4LC1 A;  1BDC A;  3H1I D;  2KLU A;  5KAI H;  3G3Z A;  1NOH A;  3ZOW A;  4WQC A;  3A5T A;  3G4S P;  1CCR A;  1KYO I;  5AW8 B;  4GKG A;  3BCC E;  4UB6 E;  3A0B H;  1G2C A;  1L0L J;  4WY4 C;  1HRC A;  2ZXE B;  4LLH A;  1IQC A;  1NTZ G;  2Q7C A;  4DT0 A;  3IF4 A;  2FY8 A;  1H32 A;  3Q1M A;  3L72 G;  2P2U A;  1CIG A;  2H89 C;  1NTM D;  3M06 A;  1R8E A;  4BRY B;  1BSH A;  3VNW A;  3TDK A;  1OW7 A;  4FA9 A;  1JY2 N;  2OZ1 A;  3VP8 A;  1VQP P;  4WQ7 A;  4UB6 H;  3ZDM A;  4JYC A;  1MZ4 A;  1GZL A;  4IL6 H;  1KN7 A;  1H9Y A;  1LWU B;  1EB7 A;  1HJ3 A;  1ZR4 A;  1KV4 A;  1PP9 D;  1H1O A;  2IYO A;  1FZC A;  4PWA A;  1WT6 A;  2KOG A;  3H1K J;  1KIL B;  2D2C C;  3PXS A;  1RF0 C;  5CBO A;  1Z56 A;  1NAY A;  3CXH D;  5AVY B;  2A06 E;  1C7M A;  4UB8 E;  2XU6 A;  2E74 D;  3E7K A;  2PCB B;  5C0Z A;  3RN0 A;  1EZV G;  1ZLL A;  2XV5 A;  4HH2 A;  2ZXY A;  3OCD A;  1ETP A;  2MJZ A;  4W80 A;  2NPS D;  2KS1 A;  1L0L K;  1H33 B;  3MK7 C;  2C8S A;  2YXQ B;  3TNU A;  2E75 B;  2CPB A;  2N1T C;  3BRV B;  3GLM A;  3CL3 D;  2JO1 A;  4H13 B;  1CSU A;  3RL0 B;  3CLQ A;  2K9J A;  3WFE C;  1SLQ A;  2JWA A;  4UB8 H;  3HE4 A;  3HUS A;  3BCC J;  1CED A;  1YHQ P;  2JP3 A;  4EI2 A;  2WMM A;  3ZOY A;  2JKV A;  1VQ8 P;  4C46 A;  2G3A A;  1H0T A;  3HD7 C;  1FZE A;  2IBZ G;  1CRH A;  1I5T A;  1FZG A;  3CWB E;  2N9Y B;  3EFG A;  1FAV A;  2FFD B;  3AEB C;  2POH A;  3ZOO A;  4LJI A;  2JWD A;  1M1K Q;  1BGY E;  3OA8 B;  1KX2 A;  1LTA C;  2JDI H;  2KZI A;  1LTJ C;  2A45 G;  3OW2 O;  5B66 E;  4AAM A;  3L73 G;  3USS A;  1A8C A;  4K3A A;  3D6Z A;  2ZOO A;  2ZXX A;  1NJI Q;  3SVW A;  2BLF B;  3Q5S A;  4XA4 A;  4WY4 B;  2BEZ F;  2HR3 A;  1FZA A;  1QVG O;  1NTZ D;  1T8Z A;  2O3J A;  3RL0 g;  3C2C A;  1NVO A;  3L74 E;  1L2P A;  1VDF A;  2M0B A;  3ZOX A;  3L72 D;  4KT0 J;  2KXP B;  4U7J A;  1YTZ T;  2RMZ A;  2A45 H;  1YIJ P;  5B66 H;  1N7L A;  4XYD B;  1JMM A;  3L4F A;  1A02 F;  1ZOY C;  4NPF X;  1IFD A;  4BRY A;  3E1I A;  2GIW A;  2B89 A;  3V6I A;  2QIW A;  1PL5 A;  1RAP A;  4GT1 A;  3AE3 C;  3H1J G;  2O1J A;  4U3F G;  1W5C T;  1CYJ A;  1AKK A;  3M0D C;  1JY3 P;  3BVH A;  1GMJ A;  3TYY A;  2RN0 A;  1LMS A;  1EXJ A;  2YQB A;  1RE4 A;  4H44 C;  4HJG H;  3TF5 A;  2BCC E;  2D2C B;  3PXW A;  3HQ7 A;  2IDB A;  2QM8 A;  2ZT9 B;  2WSF H;  2Q3I A;  1FC2 C;  1SQV G;  1A56 A;  2KB7 P;  4Y99 C;  3L71 G;  1L9B C;  3DMI A;  3TGU E;  4IFF A;  4M3L A;  3H1H G;  1GJQ A;  4EYY Q;  1EZV D;  1H88 A;  4KMG A;  1U7J A;  2FXM A;  3CC2 P;  3KPE A;  3MK7 B;  2E74 C;  1DX7 A;  3CWB J;  2N1T B;  2NPS C;  1H33 A;  5CHX A;  1PPJ G;  2ITA A;  2ZYD A;  4PD4 D;  3NMD A;  2KP8 A;  2Q5U A;  5DJQ C;  2YO2 A;  2O01 J;  2QJK B;  1WVE C;  1PFI A;  1U74 B;  1QL3 A;  4WQD A;  2M5A A;  1L4A D;  1CHJ A;  3MGN A;  1CO6 A;  1FJ0 A;  4N78 E;  3L74 J;  1LJ2 A;  3V2Q A;  4NPD A;  1OZH A;  3KZI H;  2IBZ D;  2YCC A;  3PRJ A;  1Q81 Q;  3GG2 A;  2CPS A;  3V4Q A;  1IFI A;  3UIA A;  1GL2 B;  1BGY D;  4JQ0 D;  2V7Q H;  5KJ7 D;  1S4X A;  4L74 A;  3L73 D;  1KQG B;  2OYO A;  4IL6 X;  3ZIY A;  1E79 H;  2FYU E;  4GDO A;  3WC8 A;  5CIE B;  2L4D A;  3HTK B;  3V2P A;  1KC8 Q;  3T97 A;  1J2J B;  1S9K D;  1CI6 B;  3WU2 H;  1N7S D;  3R2P A;  2GM4 A;  2K37 A;  2E76 D;  1DEB A;  1VF5 D;  1SQQ G;  2JEE A;  1KB9 I;  3MHV A;  4H13 D;  2YIU C;  1S5L V;  2G8Y A;  2YO3 A;  1K3H A;  4EIE A;  2V07 A;  2C9L Y;  4N3Y B;  1HZV A;  2KK7 A;  2E42 A;  2R3S A;  2BCC J;  4PW9 B;  2HOD B;  1EDL A;  1U75 B;  1HTL C;  3RMZ A;  3TGU J;  5KLV E;  2VRS A;  3JBT B;  3RBZ A;  2W27 A;  4GOF A;  1SFC A;  1NIR A;  3V2R A;  4JBZ A;  1EQ7 A;  1CSX A;  4OGQ D;  3HQ8 A;  1LTG C;  2I8F A;  1PV3 A;  1CIE A;  5CMZ A;  3CPW O;  1FDO A;  3E1R A;  1X8Y A;  3N4X A;  1JB0 J;  5AW4 B;  4RES B;  1I6E A;  1OFC X;  3MP7 B;  1KD1 Q;  2ZFC A;  4RJT A;  2C1U A;  3D6Y A;  1SQV D;  3M9Q A;  4L1Q A;  3L71 D;  4Y99 B;  1XTC C;  4EID A;  2NZ2 A;  4J20 A;  1RF0 A;  3A0H E;  5KKZ C;  2IFN A;  2LXB A;  3AE2 C;  1GQ1 A;  5EFW B;  3U1C A;  1K04 A;  3IFM A;  1NNO A;  1H32 B;  2E74 B;  3NTN A;  2IPP A;  1DW1 A;  2ZJS E;  1DVV A;  1HJ5 A;  2NPS B;  1OX3 A;  1JOC A;  1I6D A;  1PPJ D;  4I1L A;  2OZ1 B;  1SFC D;  1K8A Q;  1IK7 A;  2YKO A;  5DJQ B;  3O0R C;  2FYU J;  5H2F H;  2J5U A;  3H1L E;  4TT3 H;  2QRX A;  1JDL A;  1LFM A;  1A02 J;  1VQ7 P;  3CX5 I;  1PGJ A;  1EDK A;  1FI7 A;  1L0L G;  1L0N E;  1KYO W;  1M6Z A;  2KIK A;  2KNC B;  1W2E A;  1P84 I;  1X22 A;  1L4A C;  2W6B A;  1TU3 F;  1FZC B;  1EC5 A;  1EDI A;  1W5C E;  2ZZS 1;  1HBW A;  3CX5 E;  1AFO A;  2NRG A;  3CME P;  3HD7 A;  2E5T A;  1CRG A;  2OYH C;  1I8O A;  1NH4 A;  5CIB B;  5KLV J;  1LTJ A;  5KJ7 C;  1JY3 N;  3KZI V;  3P7K A;  2BGV X;  2EXV A;  3M9B A;  2KS1 B;  5BVZ A;  1SQB D;  1YQ3 C;  1GU2 A;  3TNU B;  1C52 A;  3H32 A;  1SQQ D;  4GOE A;  4AUW A;  2GA1 A;  3AEF C;  4FA5 A;  2R3C A;  4JYB A;  5KAF H;  2YIU B;  1AQ5 A;  4CPG A;  5C39 A;  1CI6 A;  1W2L A;  4W7Y A;  1ZRT E;  4WWI A;  1N7S C;  2E76 C;  3I55 P;  1USE A;  3VOP A;  4L3G A;  2M3E A;  1LTB C;  1JCD A;  3H1K G;  4Y28 J;  3O6Q B;  1LC2 A;  4AAN A;  1JEK A;  2HOD A;  3Q5R A;  1LT9 C;  4XE5 B;  1CXA A;  1RQV A;  2FYU K;  2YXR B;  1EXI A;  2CA3 B;  3HD7 D;  4EIJ A;  3RK3 D;  1YTC A;  3I5C A;  1SQB K;  3KQG A;  5K5G B;  4ASV A;  5CJ4 A;  1KQL A;  2N9I A;  5APU A;  2JJL A;  5B5E E;  1AJY A;  2MHM A;  4OGQ C;  3M0D A;  2AXC A;  2WIT A;  2HYN A;  4ZMD A;  3O8Z A;  3MUD C;  3H1L J;  2B12 B;  5AW7 B;  3FXE A;  5APV A;  3DR0 A;  2R44 A;  2AXT E;  3Q2Y A;  5KKZ B;  2K1A A;  2PCC B;  1IC2 A;  3BCC G;  2PGD A;  5KLV K;  3N7N A;  3S1K A;  2ZYG A;  1FS0 E;  1L0N J;  2WTY A;  1VQ9 P;  1FHB A;  1CSV A;  4N0K A;  2Q3E A;  1CXC A;  5B5E H;  5TIS H;  1S2E A;  2Y9Z A;  1KYO E;  4HKZ H;  1CIH A;  5AVU B;  4PJ0 E;  1FZF A;  2KLV A;  5CBN A;  2BEQ D;  3MZW B;  4YTP C;  2NPS A;  1R5L A;  5DFS A;  4JPZ B;  3WFC C;  1N90 A;  2AXT H;  1SFC C;  2I1J A;  3KHU A;  2DVH A;  1IFM A;  4O9B A;  1MV8 A;  2P67 A;  1L0L D;  1AVO A;  3PH2 B;  2HV4 A;  1KYO H;  2HFE D;  1L4A B;  1FU1 A;  4H44 D;  1M90 Q;  5AVQ B;  2KNC A;  5CIF B;  1SQX E;  5H2F V;  2OYH B;  3O20 A;  1GW3 A;  2LXC B;  3NXS A;  3SWY A;  5IY5 1;  1IRW A;  1AVY A;  3O5C A;  3M0A A;  2C9X B;  3VYM A;  1GK4 A;  4O1Q A;  3G6E P;  2A06 G;  4R4L A;  3PLN A;  2J58 A;  1DD4 A;  1NU1 E;  1VQK P;  2W6A A;  3FWL A;  3NBS A;  1QEX A;  2Y9Y A;  1YEB A;  3OAK A;  3GW6 A;  3PHL A;  3FXD A;  1NHL A;  1L0N K;  1QL4 A;  1N7S B;  5GTH V;  2M8R A;  2P1J A;  2E76 B;  3WFB C;  1VF5 B;  2E5Y A;  2IFM A;  1JY3 O;  4OH8 B;  3H1K D;  2FKW B;  2B11 B;  3FWN A;  1NO4 A;  3CC4 P;  2M5A B;  4PD4 I;  1KZU B;  4D6T E;  5AW6 B;  4YXD C;  1AA0 A;  3B71 A;  5CJ0 A;  2WQY C;  3O6Q A;  1LC1 A;  1JUN A;  2Z4E A;  2QE7 H;  4GED B;  3PTZ A;  3RK3 C;  2C1D A;  3CWB G;  1IFN A;  4OGQ B;  4I7Z C;  1IK9 A;  5EXQ A;  4I2L C;  1BGY G;  3RN1 A;  5AW0 B;  4JCG A;  3LIE A;  1M56 D;  3WUV A;  1DW2 A; 
#chains in the Genus database with same CATH homology
 1HZU A;  1CO6 A;  1FJ0 A;  1CRJ A;  3L4O A;  2IBZ D;  2YCC A;  3PRJ A;  2N18 C;  2GC4 D;  3BCC D;  4EIF A;  1YEA A;  1RZ6 A;  4YE1 A;  3GG2 A;  4FA1 A;  5E79 V;  451C A;  4AAL A;  2MTA C;  2Y0C A;  2B4Z A;  1C75 A;  3H1L D;  1BGY D;  1N9C A;  1E29 A;  1CNO A;  1YIC A;  2CE1 A;  5KAI V;  3L73 D;  3RLM A;  1QKS A;  2AIU A;  3ZIY A;  1L0N D;  3WC8 A;  5CIE B;  2L4D A;  4L3H A;  3CX5 D;  4AAO A;  3A0B V;  1F1C A;  1NTK D;  2LIR A;  1CYC A;  4WQ8 A;  155C A;  3A0H V;  1H9X A;  1P84 D;  1S5L V;  5KLI B;  4H0K A;  1HCM A;  1K3H A;  4GYD A;  3NWV A;  4EIE A;  3HQ9 A;  1DIQ C;  2V07 A;  2L91 A;  3M97 X;  1I55 A;  1GDV A;  1HZV A;  3CYT I;  3OCD B;  2ORL A;  4PW9 B;  4QAO A;  2LIT A;  1A2S A;  2FYN B;  1KB9 D;  3O1Y A;  1K3G A;  1U75 B;  3RMZ A;  4WQB A;  1HJ4 A;  3JBT B;  4UB6 V;  1MG3 D;  2PAC A;  1BCC D;  4WQA A;  1ZRT D;  1H31 A;  1NIR A;  1KIB A;  2D0S A;  1YNR A;  4FA4 A;  3SLE A;  2A06 D;  1CSX A;  4IL6 V;  2K9J B;  3HQ8 A;  1VYD A;  3CU4 A;  1KB0 A;  2I8F A;  1CIE A;  1KX7 A;  1IO3 A;  2N9J A;  1CC5 A;  1GIW A;  1IZL 0;  5GTI V;  3L4M A;  2BCN B;  1I6E A;  4WQE A;  2BPB B;  1HRO A;  1I54 A;  3L75 D;  4RJT A;  5KAF V;  1L9J C;  2C1U A;  1C2R A;  1FOC A;  4FB1 A;  1SQV D;  4L1Q A;  3L71 D;  5AUR A;  4EID A;  1DT1 A;  1COT A;  1CRY A;  4J20 A;  3SJL A;  3ORV A;  4EDF A;  3SXT A;  1GQ1 A;  1MG2 D;  1C6S A;  1NNO A;  1QN2 A;  1DII C;  3H1I D;  1H32 B;  2AI5 A;  3ZOW A;  4WQC A;  1DW1 A;  1CYI A;  1DVV A;  1HJ5 A;  1I6D A;  1PPJ D;  4DY9 A;  1CCR A;  2OZ1 B;  3CP5 A;  1OAE A;  3CWB D;  2GB8 B;  2B10 B;  5DJQ B;  3O0R C;  1HRC A;  1DW0 A;  1F1F A;  1JDL A;  1IQC A;  4UB8 V;  1LFM A;  1AYG A;  1KYO D;  1H32 A;  2V08 A;  1CIG A;  1NTM D;  1FI7 A;  1RZ5 A;  1KYO W;  1M6Z A;  2N18 B;  1N50 A;  2KNC B;  3VNW A;  3TDK A;  2GC7 D;  1M70 A;  4FA9 A;  4A7P A;  2ZZS 1;  1CRC A;  2OZ1 A;  1CIF A;  1C6O A;  3L74 D;  4WQ7 A;  1CRG A;  1I8O A;  2CA4 B;  3CX5 W;  3ZCF A;  5B5E V;  1MZ4 A;  5TIS V;  1COR A;  5CIB B;  3SWS A;  1H9Y A;  1KV9 A;  3KZI V;  4RSZ A;  2BH4 X;  2BGV X;  1EB7 A;  2EXV A;  1HJ3 A;  1SQB D;  2B0Z B;  1PP9 D;  1GU2 A;  2C2C A;  1H1O A;  1SQX D;  1C52 A;  5CIG B;  1SQQ D;  2AXT V;  4FA5 A;  4PWA A;  1OCD A;  2YIU B;  1W2L A;  1CSW A;  3PXS A;  1FI9 A;  1CHI A;  3CXH D;  4O1W A;  1C7M A;  4L3G A;  3WFD C;  1NU1 D;  1NMI A;  2PCB B;  5B66 V;  3CXH W;  4PJ0 V;  5C0Z A;  4NFG B;  1LC2 A;  3RN0 A;  4AAN A;  2QG4 A;  2ZXY A;  3OCD A;  1ETP A;  2YK3 A;  1CRI A;  2KS1 A;  1H33 B;  1CXA A;  3MK7 C;  2C8S A;  2BCC D;  2CA3 B;  2FWL A;  1LS9 A;  1YTC A;  1RAQ A;  1CSU A;  1C2N A;  5C9M A;  3TGU D;  2N9I A;  5TJH A;  3WFE C;  2MHM A;  2JWA A;  2C1V A;  4H0J A;  2JQR A;  4D6T D;  1I8P A;  2DGE A;  1CED A;  2CXB A;  4Y5R A;  3ZOY A;  1WEJ F;  3NBT A;  1YFC A;  2B12 B;  3ITK A;  4MU8 A;  3DR0 A;  1FI3 A;  1CRH A;  1I5T A;  5KKZ B;  2PCC B;  3X39 A;  2N9Y B;  3ZOO A;  4LJI A;  1FHB A;  3OA8 B;  1CSV A;  1KX2 A;  4N0K A;  2Q3E A;  2ZBO A;  1CXC A;  2Y0E A;  1CIH A;  1HH7 A;  4AAM A;  1A8C A;  1CTJ A;  2ZOO A;  1N15 A;  2FRC A;  2ZON G;  3SVW A;  2BLF B;  5DFS A;  3WFC C;  4P4Q B;  1N90 A;  1SQP D;  1NTZ D;  2O3J A;  3C2C A;  3KHU A;  2DVH A;  2QJY B;  3ZOX A;  4XXL A;  3ZBM A;  1R0Q A;  3L72 D;  3OA8 A;  1L0L D;  3PH2 B;  2FYU D;  2XTS B;  1BL9 A;  4Q5P A;  2RMZ A;  2HV4 A;  1DW3 A;  1CHH A;  1FCD C;  4XYD B;  2JTI B;  2VHD A;  1H31 B;  5B6Q A;  1J3S A;  5CIF B;  3L70 D;  2GIW A;  5DF5 A;  5H2F V;  1AOQ A;  3O20 A;  3WUI A;  1RAP A;  5CYT R;  5IY5 1;  1IRW A;  3O5C A;  1QYZ A;  2C9X B;  3VYM A;  4O1Q A;  1W5C T;  4WQ9 A;  1CYJ A;  4EIC A;  1AKK A;  3PLN A;  2RN0 A;  3PXT A;  3FWL A;  1CTY A;  1LMS A;  2N3B A;  2YQB A;  3NBS A;  5KLV D;  1YEB A;  3WU2 V;  3GW6 A;  3PHL A;  1M60 A;  3H1J D;  1E2R A;  1QL4 A;  4U3F D;  3TF5 A;  1E8E A;  3PXW A;  5GTH V;  5CIH B;  3HQ7 A;  3WFB C;  1S6V B;  2C1D B;  1A56 A;  1C6R A;  1L9B C;  3DMI A;  2Y0D A;  1GJQ A;  3H1K D;  1DVH A;  1EZV D;  3VRD A;  2B11 B;  4KMG A;  4AX3 A;  3DP5 A;  3MK7 B;  1IRV A;  1GKS A;  1CTZ A;  1B7V A;  1LC1 A;  2N3Y A;  5CIC B;  3TYI A;  1ZZH A;  3A9F A;  1H33 A;  3HQ6 A;  4GED B;  2QJP B;  3H1H D;  4PD4 D;  1YIQ A;  2D0W A;  3PTZ A;  2C1D A;  2BH5 X;  5CID B;  5DJQ C;  1BE3 D;  1CCH A;  4V2K A;  4FAV A;  5EXQ A;  4FAN A;  2QJK B;  1YCC A;  1WVE C;  1AOF A;  2CE0 A;  1U74 B;  3RN1 A;  4JCG A;  1QL3 A;  1NML A;  4WQD A;  4K3I A;  351C A;  1CHJ A;  1DW2 A;  3VMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...