2FYNB

Crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
256
structure length
256
Chain Sequence
b'AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 61
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2fynB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2fynB02
1YNRA 5KLVD 2C8SA 4O1QA 1OAEA 1K3HA 3HQ7A 451CA 4L3GA 4PWAA 1NTMD 3GG2A 1FCDC 1QYZA 1H31A 4EIFA 3SWSA 3DR0A 1RZ5A 3RLMA 3VNWA 3TF5A 1S5LV 2FWLA 3PH2B 3DP5A 3PLNA 1C6RA 1FOCA 1F1FA 2GIWA 4WQCA 1L0ND 2L91A 1R0QA 3NBTA 3PXSA 3RN1A 1N90A 2CA3B 5B6QA 4AAOA 4DY9A 1C75A 1NNOA 4WQ8A 1L0LD 1HCMA 1FJ0A 1YEAA 1B7VA 3A0BV 3L75D 2QG4A 3H1HD 1CRCA 1CCRA 3ITKA 3NBSA 3ZOYA 3CX5D 4JCGA 1MG2D 2ZOOA 1LC1A 4D6TD 3CXHD 1BCCD 4WQEA 1CRHA 4FA4A 1NMLA 2L4DA 1QKSA 2CE1A 3TYIA 1NU1D 3HQ6A 3PXWA 5CIFB 3HQ9A 4V2KA 1CRIA 1GQ1A 2AXTV 4UB8V 3WC8A 2B11B 3H1ID 3L72D 5DJQB 5KAFV 2Y0EA 2Y0DA 2ZBOA 1MG3D 3ZCFA 2XTSB 2N3BA 1IRWA 3KHUA 1YIQA 1CYCA 3CWBD 1AOQA 1E2RA 3VRDA 2Y0CA 2QJPB 3RMZA 2ORLA 4WQBA 1BL9A 2OZ1B 3WFCC 5B66V 4A7PA 3C2CA 1YFCA 3MK7C 1DIIC 3SXTA 1WEJF 2EXVA 3PTZA 1CTYA 1I6EA 1N50A 2C1VA 2LITA 1CHIA 1U75B 5CIGB 1RZ6A 2FYNB 3WU2V 3O5CA 2B12B 1I6DA 4FA1A 1CIEA 1H32B 1H9YA 2O3JA 1HH7A 2BCCD 1KIBA 1CEDA 5GTHV 2C1UA 1HJ3A 4U3FD 4K3IA 1P84D 4FB1A 1M60A 3OA8A 1SQPD 2KNCB 4N0KA 2PCCB 1H31B 2AIUA 4RJTA 1S6VB 4WQDA 4H0JA 2PCBB 1DIQC 1CO6A 1IQCA 1DVVA 1SQBD 4LJIA 1RAPA 1I54A 1W2LA 5GTIV 3TDKA 4FANA 4J20A 1CIFA 2YCCA 4O1WA 3CX5W 1NIRA 155CA 2BCNB 2RMZA 1YTCA 2YQBA 3CXHW 3ZOXA 1HRCA 3ZIYA 3ZOOA 2BLFB 1W5CT 4PD4D 2JTIB 3KZIV 1HZUA 1DW0A 1A2SA 2GC7D 2N9YB 1H33A 3DMIA 3CP5A 3PXTA 5DF5A 2FYUD 1CC5A 1GKSA 5H2FV 4RSZA 5CIDB 2ZZS1 4MU8A 3HQ8A 1GJQA 2FRCA 2CXBA 5AURA 2V07A 3WUIA 5C0ZA 2CA4B 2BPBB 1CYIA 1LS9A 1CCHA 1CTZA 1CYJA 4WQ9A 1EZVD 2Q3EA 1NTZD 1CRYA 2B0ZB 5C9MA 2QJYB 4P4QB 1CSXA 1M70A 1KX2A 2N9JA 1M6ZA 1AKKA 1ETPA 1QL3A 1KV9A 1C7MA 4EDFA 4YE1A 1IZL0 5EXQA 1C6SA 1J3SA 5DFSA 1K3GA 1ZZHA 1IRVA 3ORVA 4FAVA 2GC4D 1FI9A 1HJ4A 1DVHA 4WQAA 2KS1A 1I5TA 3VMAA 2K9JB 2ZONG 1CRJA 1LMSA 2DGEA 5KAIV 3FWLA 4PW9B 3CU4A 3MK7B 1BGYD 2C1DA 2N18C 2MTAC 3O20A 4XYDB 4AANA 4UB6V 1DT1A 2C9XB 3A0HV 1CHHA 1CRGA 3OCDA 2C2CA 3CYTI 3A9FA 1CSUA 2LIRA 2YK3A 4Y5RA 1C6OA 1CIHA 2V08A 2JQRA 1I55A 2MHMA 5DJQC 1E8EA 4WQ7A 1FI7A 1L9BC 1E29A 1LFMA 4Q5PA 3O1YA 1F1CA 2BH4X 1VYDA 3WFEC 2OZ1A 4AALA 5E79V 1N15A 3RN0A 1MZ4A 1IO3A 3TGUD 2JWAA 1HJ5A 5KLIB 1SQQD 1YEBA 1N9CA 1KYOW 2HV4A 3GW6A 3JBTB 2I8FA 3L70D 1H32A 1DW3A 1YICA 2A06D 3L71D 1C2RA 1I8PA 5CIEB 1H1OA 1PP9D 1GU2A 1YCCA 5CIHB 1DW2A 1EB7A 1KB0A 2BH5X 2DVHA 1H9XA 1H33B 1FI3A 3SJLA 1CORA 1KX7A 1KYOD 5B5EV 2GB8B 5CIBB 3SLEA 3L4OA 2AI5A 3L74D 4AAMA 4QAOA 2B10B 3L73D 1GIWA 1SQVD 1FHBA 1DW1A 5TISV 1C52A 4NFGB 1CHJA 2PACA 1CTJA 1AOFA 2N9IA 4L3HA 2D0WA 2N3YA 3H1JD 1AYGA 4GYDA 4FA5A 1QN2A 3M97X 5TJHA 3BCCD 5CICB 3WFDC 2ZXYA 1SQXD 2QJKB 2VHDA 1RAQA 3O0RC 1U74B 1HZVA 1PPJD 3PRJA 3PHLA 1BE3D 1CNOA 2N18B 2D0SA 4EICA 2C1DB 2RN0A 1JDLA 1OCDA 4EIEA 4H0KA 1QL4A 3OCDB 1I8OA 5IY51 4FA9A 1A8CA 3VYMA 1WVEC 4EIDA 351CA 1COTA 1GDVA 1L9JC 2B4ZA 1CSVA 4XXLA 4IL6V 3X39A 4GEDB 1CIGA 1LC2A 1CSWA 3H1KD 1ZRTD 2BGVX 4L1QA 2YIUB 4PJ0V 3SVWA 3OA8B 3H1LD 5CYTR 1NTKD 4KMGA 1CXAA 3ZOWA 1HROA 1CXCA 1KB9D 3WFBC 4AX3A 2IBZD 1A56A 1C2NA 2CE0A 5KKZB 3L4MA 3NWVA 3ZBMA 1NMIA
chains in the Genus database with same CATH superfamily
3CCSP 5KLVD 5AW1B 4O1QA 1OAEA 4PD4I 3G3ZA 1RF0C 3AEAC 2AXCA 1CW5A 5B66E 3TF5A 3HTKA 3PH2B 1XTCC 5CCHC 4N78D 4WQCA 1L0ND 2L91A 3RL0C 5AW5B 3L4FA 3PXSA 2CA3B 3TGUE 1Q2NA 5AVVB 4DY9A 1NNOA 2WQYC 1SQQE 1FJ0A 1Q81Q 4JF7A 1YEAA 1PPJG 3AE6C 2QG4A 3RL0g 3H1HD 2E75B 5KJ7C 3ZOYA 3CX5D 3M0AA 2ZOOA 1LC1A 2KS1B 3BCCJ 3A0HH 1YITP 1KYOE 1VF5C 5AW7B 2RKLA 1RF1C 1NMLA 1EQ7A 1M1JB 1AFOA 1MZ9A 2ZAEB 4DOJA 5KTBA 1JY2N 1N86A 1T2KD 1EDLA 1GQ1A 3IR9A 1JUNA 2Q9IA 2FBWC 3H1ID 4GT1A 3AE4C 1K9MQ 2E74D 2Y0DA 1LTTC 3VP8A 3L72J 1KD1Q 2PGDA 5E79H 1D7MA 1KQLA 4DT0A 5CCGC 3TK1A 1E2RA 3HUSB 1SFCA 2QJPB 2ORLA 4WQBA 2H8PD 1N73A 2IBZG 4OGQC 3C2CA 4WVZA 3SXTA 5APQA 1FZFA 4D6TE 3HRNA 5KLVG 3PP5A 1I6EA 1N8RQ 3NFQA 1PPJE 1J1EC 2FYNB 3BRTB 2B12B 3AEBC 2L5GB 1JB0J 1URQC 3VN0A 1USEA 5DJTB 1KIBA 5GTHV 2ZJSE 1H0TB 1HJ3A 1M60A 5B5EH 1WT6A 4U3FJ 1YI2P 1L0NG 1CO6A 1IFPA 1MKMA 1WRGA 3A0HE 1LWUC 2YO2A 4LJIA 1I54A 3CX5H 3U1CA 3AEGC 3CC7P 2BCNB 1HBWA 1YTCA 2YQBA 2ZYDA 3M9HA 1EDKA 3H25A 2YKPA 3ZIYA 4PD4D 1HZUA 2XKMA 2GC7D 3AE5C 1SQXK 2Q3IA 2FYZA 3W68A 1H33A 3DMIA 2IBZE 2D2CD 1GKSA 5H2FV 1L0LJ 1GTWA 5AW6B 5E79E 2CPBA 5KLVE 3G71P 1GJQA 2FRCA 3WUIA 3G6EP 1MV8A 2Z5HA 1FU1A 4WQ9A 2R32A 1NTZD 1CRYA 2SPZA 4P4QB 1BCCJ 1OW6A 3H1IG 4I6MC 2A45H 4UB8H 1ZN5A 1LTBC 1JTHB 4N78E 2E74B 3NMDA 2R5BA 4YPCA 4R4MA 4L76A 1J3SA 5DFSA 1LT9B 2M5AA 5B5EE 4C7NB 1RQVA 5K5GB 1HJ4A 5APYA 1I5TA 3VMAA 1S2EA 5AW9B 2O01J 3H1HE 2N1TC 1M1JC 1BGYD 1GL2A 1KB9I 3CX5E 2WSFJ 1N73C 4Y5RA 2ZT9C 1C6OA 2V08A 2JP3A 3V2PA 1KZUB 2VRSA 1JY2O 1A02J 1FI7A 1Q86Q 5AW8B 3GMAA 1F1CA 2BH4X 3P7KA 1VYDA 3HUSC 2KZIA 2BCCJ 2QJPC 2OZ1A 2M8RA 1S5LH 1KMIZ 3KDPB 3IFMA 4JPZB 1IO3A 1HJ5A 5KLIB 2KIKA 2K88A 1YEBA 2HV4A 3JBTB 2FYNC 2I8FA 3V2QA 3CMEP 1H32A 3P8CD 1DW3A 4H0LC 1C2RA 1KILD 3E7KA 1H1OA 1GU2A 3MGNA 4GKGA 2D2CB 2KNCA 1H9XA 1LTSC 1G2CA 3FXEA 3H32B 1NTZG 5CIBB 3L4OA 4AAMA 1T8ZA 1ZP0C 2QVAA 3L74J 5TISV 1S72P 4WWIA 1FZGA 1SQVJ 4OWFA 1CTJA 2N9IA 2R44A 4WY4A 2D0WA 1VQOP 1Q7YQ 2AXTH 2Q6QA 2K3RA 1E79H 2I1JA 5KAFH 1AYGA 3USSA 4GYDA 1YTZT 2HG5D 4U7JA 2WPSA 1GU5A 3E1RA 5M1BA 3BCCD 1BGYG 2QJKB 2M3EA 3B5NA 1GU4A 1U74B 2AEMA 1S5LE 3PHLA 3RGUA 4XFJA 2Q5UA 1FJPA 4EICA 2C1DB 4L75A 4EYYQ 1BE3J 1OIPA 4H0KA 2IPPA 3OCDB 1OVUA 3WU2H 1I8OA 5IY51 4FA9A 1L4AD 3GLMA 1WVEC 3M0DA 4EIDA 2ZVNB 3S9OA 2IFNA 1L9JC 1UIIA 1LT9C 5BU8B 3RK2D 2K9JA 1R8EA 1N7SC 1H89A 4PJ0V 3O8ZA 1M90Q 3CPWO 3AECC 2KSEA 3SVWA 3RK3E 2E76C 1VQMP 1SQXE 2W27A 3ZOWA 2IYOA 3NTNA 1CXCA 1Y8AA 2R5DA 1KB9D 1EDIA 3L37A 1PFIA 1KILB 2AXTE 1IK7A 2OGUA 3EFGA 5L8RJ 1VQ7P 2CE0A 1BGYE 3L4MA 3NWVA 1K3GA 2WVRA 5AVXB 1L0LK 3KZIH 5KAFE 3M91A 2BEZF 1QL1A 1LP1B 1RF0A 3L71J 1FAVA 4PWAA 2W6AA 3GG2A 3F89A 3SWSA 1EZVG 1RZ5A 1E5WA 3H1KE 2C9LY 3VNWA 5KLIC 1VQ5P 2FWLA 2J59M 3DP5A 1M56D 1Z56A 1ZOYC 4NPDA 3WU2E 2NPSD 3NBTA 3RN1A 1R5LA 3MD0A 2JO1A 3BCCG 1OFCX 1L0LD 1HCMA 2D2CC 2P10A 1UIXA 2KB7P 3ZDMA 1USDA 4TT3H 1JEKA 3CCMP 1NJIQ 2PP6A 3P8CE 2ZXXA 3BRVB 1CCRA 3L75J 3H1JJ 3ITKA 1KILE 2MJZA 1SS1A 1FC2C 4JCGA 2OYIB 1MG2D 4D6TD 1BCCD 2YKQA 3FWNA 1G1IA 1SLQA 1CRHA 4UB6H 5GTIE 2A45I 2HPCB 1VDFA 1L4AB 3MP7B 3A2AA 1PV3A 2OQQA 1CRIA 1KTMA 1NU1J 4QMAA 3RK2B 1KB9H 3KZIE 4RESB 3GHGB 4XA4A 1ZR2A 4KT0J 2B11B 2YXRB 3HE4A 3ZCFA 2XTSB 1IRWA 2IZ0A 2FFDB 1YIQA 2XV5A 3TGUG 5CCGA 1K05A 1SQQG 3VRDA 2Y0CA 3RMZA 3WFCC 1KN7A 5B66V 3VTPC 4A7PA 3BCCE 1FZCB 2EXVA 3PTZA 1GW3A 3EFFK 1U57A 3OW2O 3C8VA 2W6JH 3CCVP 3SSUA 4FA1A 4ZKUA 1CIEA 2B89A 3KQGA 2BCCD 4H13D 2GM4A 4K3IA 4FB1A 1NAYA 1T6AA 1VQKP 3OA8A 2ZXEB 2WPRA 4ZMDA 2WSCJ 4N0KA 1SQVK 5KAIE 1S6VB 1MFZA 1LWUA 1FS0E 3HTKB 1T3UA 4UB6E 1NTMJ 2NPSB 1L0LG 3OJAB 1YJ9P 1W2LA 4M3LA 1SQBJ 2QRXA 2YCCA 4GOEA 4OVNF 3CX5W 2RMZA 1HRCA 1KB9E 1Q90D 2J58A 2JTIB 1DW0A 1BSNA 1NHLA 2JKVA 1BCCG 2N9YB 4D6TG 3WUUA 2V7QJ 3PXTA 5DF5A 5EFWB 1CC5A 2WT7B 3AE8C 4U3FE 4MU8A 2W83C 2FYUJ 1ZXGA 2CA4B 1VL2A 2KOGA 1U7MA 1CYJA 1YQ4C 3D6YA 3L35A 2HODB 2O01H 3CCJP 2Q3EA 1AQTA 3V5BA 4OH8B 1FZEA 1IFIA 1VQ8P 2WSFH 2LR2A 2OTKE 1AKKA 1SVFA 1A02F 1PZQA 1K04A 1KV9A 1LTGC 1W2BO 4WB4A 4EDFA 4IL6H 5EXQA 1U7JA 4AYCA 1YIJP 1FOSF 3CCUP 4PV1C 3HE5B 1EC5A 1IK9A 1Q82Q 2W8ZA 1IFDA 2GC4D 4JYCA 2OYIC 1SP4A 2KS1A 1L0LE 3D71A 2IYPA 2ZONG 1AV1A 5AVZB 2JEEA 2WSEJ 2N1TA 1M1JA 3MK7B 2Q1KA 2N18C 2B88A 3O20A 5AW4B 1VQ9P 1DT1A 3A0HV 2M3BA 3EWKA 1J1DC 4DZOA 2BCCG 4EIJA 3A9FA 1CSUA 1N2DC 1BCCE 1GL2D 1CIHA 4H13B 3GHGC 4GIFA 2MHMA 1E8EA 5AVTB 3M9QA 4WQ7A 1PGOA 3I55P 1NOHA 4Q5PA 3A3YB 1OMIA 3HUSA 1PL5A 5BVZA 5E79V 1KFMA 3RN0A 1CI6B 1TU3F 1MZ4A 3CMAP 2QSIA 1L2PA 4MN4C 2XDJA 2QM7A 4EI2A 3SWFA 1OZHA 3L71D 3L70J 2YKOA 3H1HG 3A0BH 4IL6E 5H2FH 5CIHB 1KB0A 1H33B 1KX7A 3WMM0 5B5EV 4Y99B 3CC4P 4LLHA 1OXZA 4QAOA 2OTJP 4BRYA 2B87B 2BCCE 3BATA 1H88A 1GIWA 1FHBA 3CXHI 4NFGB 1CHJA 2PACA 5DJUB 1NVOA 1DD3A 3UIAA 5AVYB 2HLOA 3OA7A 2WMMA 4WY4D 3H1JD 2QIWA 4FA5A 5TJHA 3RK3D 2M5AB 2M0BA 2E75C 3G9RA 3WFDC 2ZXYA 2A45G 1SQXD 2MKVA 2PFXA 5APXA 1YYCA 3VMXA 3O0RC 2ITAA 2K37A 1R5SA 1QVGO 3B5ND 3U1AA 1FZBA 3HD7D 1SQVE 1OCDA 1GL2B 5CHXA 2Z5IA 3W67A 1JTHA 1YTZI 2PAJA 1S1CX 2PRRA 1JY2P 1COTA 2O1KA 3A0BE 1LT9A 5CJ4A 2FXMA 2B4ZA 4C7NA 2R3CA 1CSVA 1OVRA 1QL2A 4GEDB 1LC2A 1N7SA 3H1KD 1DEBA 1P84I 4L1QA 1LGHB 2YIUB 1NTMK 2KYVA 5CYTR 2E5YA 3L71G 2LXBA 1YJNP 1FBMA 1BE3E 3WFBC 1EXJA 2XNDH 1C2NA 5KKZB 1HH0A 2L4DA 1S9KE 4UB8E 1YNRA 3IF4A 3T97B 2FYUK 451CA 4L3GA 4ZKPA 1NTMD 1FCDC 2J5UA 1PP9J 3L36A 1H31A 2P2UA 3DR0A 3RLMA 1ZRTE 3AEDC 3GF7A 3PJSK 3ABVC 2KP8A 1IFJA 1S5LV 1JY3N 2IZ1A 1M8OB 2W6BA 3H1JG 4GDOA 3CCRP 1WMKA 1GK4A 2ZYAA 5CCHD 3L73J 3IN6A 1R0QA 4WY4B 3E1IA 1N90A 5B6QA 4AAOA 1L0NJ 1LTAC 3P8MC 1SQXG 2KLVA 2JDIH 5APTA 3RK3B 1JNMA 3JCUH 3F5HA 4Y99C 2OYHB 3L71E 3VYIA 2IFMA 5AVWB 2KZJA 4IFMA 5KJ7D 1ZR4A 1M7LA 3HD7B 3CXHD 4AQRD 1MFTA 5C39A 2YMKA 1T2KC 3TYIA 4JQ0D 3CCLP 2Y9YA 3HQ9A 4V2KA 3H1KG 2HFED 5APUA 2E43A 2AXTV 4IOIH 1QGKB 2E74C 2R3SA 5DJQB 3L72D 5KAFV 4KJMA 3KYQA 1T3JA 2ZBOA 1OX3A 3A7OA 1MG3D 3H1IJ 2KI7B 3KHUA 3H1JE 3L75E 1CYCA 2WSCH 1AOQA 2Q7CA 1DIIC 1WEJF 1CTYA 4OGQD 4I7ZB 3H1LJ 3O6QB 1H8AA 1IO4A 1HF9A 1RZ6A 1NTKJ 3WU2V 1PGQA 1I6DA 1IFMA 1NTMG 2AEJA 1H9YA 2BASA 3I5CA 1CEDA 1URQD 3JCUE 4U3FD 1P84D 1GMJA 2YIUC 2V7QH 2PCCB 4WQDA 4H0JA 1NO4A 1NGMB 1M1KQ 1DIQC 1IQCA 1DVVA 1RAPA 1KILA 5GTIV 4N6JA 3TDKA 4J20A 3M9BA 3CXHH 1LP1A 1VQPP 3ZOOA 2BLFB 1W5CT 1PGPA 4I2LC 3KZIV 2WWWA 2OYOA 3AE3C 1HJBA 1LTJB 5AURA 2V07A 1CYIA 1LS9A 1CTZA 1JY3P 2WSEH 1M57D 1RF1B 1DX7A 1NTME 2G3AA 1JY3O 1CSXA 1NTZJ 3LIDA 3L72G 2C0WA 1KX2A 2N9JA 1ETPA 3K5BA 3AE9C 3RK3C 1QL3A 2FY8A 1RE4C 1X22A 1QEXA 3S1KA 1G1JA 4ASVA 5CMZA 1X79B 2OYIA 1ZZHA 3ORVA 4FAVA 3TNUA 2QJKC 3HD7C 2UWJE 1VQNP 1CRJA 2FYUE 2DGEA 1KV4A 5KAIV 4OGQB 3CU4A 1L4AA 1P84H 3V4WA 4XYDB 4UB6V 2C9XB 2N1TD 3CWBJ 3JC22 1CRGA 4YXDC 1SFCD 1K73Q 3CXHE 3CI9A 4U3FG 1FDOA 3GHGA 4Z1MH 4HKZH 1LJ2A 2ZT9D 2QA4P 1URQB 5DJQC 4K3AA 1L9BC 4ASWA 2I1KA 2HR3A 1LFMA 3N7NA 3P32A 1DD4A 3CLQA 1RE3C 1NWQA 3G4SP 1NH4A 3H6PA 4AALA 1N15A 1CSBA 1FZCA 2GUVA 3L72E 4N3YB 3I56P 3WUVA 1SQPJ 1FJKA 1L0NK 1Y47A 3GW6A 5AW3B 3QH9A 1AJYA 3LIEA 3D6ZA 2ZFCA 1KILC 1S3JA 1AVYA 2IX7C 5CIEB 4H0LD 5AVUB 1PP9D 2I8DA 4TLFA 1YCCA 1DW2A 5BU5A 2BH5X 1HUCA 1FDIA 3M06A 2XZRA 2DVHA 3WUTA 4GOFA 3SJLA 1FI3A 2NZ2A 1GZLA 1BDDA 3SLEA 2FXOA 3L74D 2B10B 1OWAA 1GW4A 3L73D 2NPSA 2GA1A 1SQVD 1DW1A 1P84E 5AVSB 3FGAD 1X0TA 3FX0A 3L70E 1JMMA 1JCCA 2OARA 3MZWB 2A06E 2B9BA 3A5TA 4RKUJ 1KFNA 2WT7A 1QN2A 3M97X 4NPFX 3SWYA 5CICB 3BASA 1KQGB 1LTJC 1HZVA 3OAKA 1X9VA 2HODA 1CZQA 3PRJA 1BE3D 1EDJA 2N1TB 1NTKK 4XE5B 2D0SA 1SFCB 1JDLA 4EIEA 1N73B 2OTLP 1L4AC 1S9KD 2ZT9B 1KORA 4L74A 2H7HA 1A8CA 3VYMA 2LKMA 351CA 3HE5A 3R4YA 1HJ0A 1GDVA 5GTHH 3RK2C 1HVVA 4XXLA 1RH5B 4IL6V 2GUSA 3X39A 2YNYA 1CIGA 1CSWA 1ZRTD 2BGVX 1N7SD 2FFDC 1QLED 3V2NA 1VQLP 3H1LD 1JCDA 1VQ6P 1NTKD 1KC8Q 2E76D 4KMGA 3MUDC 1HROA 2JWDA 2P67A 1FZCC 4H44D 1ZV8A 1PP9G 4IFDK 3Q3DA 3TGUJ 4H0LB 1S5LX 2Y9ZA 1W5CE 1A56A 1FZAA 1SQQJ 4WBAA 1LTIC 2FKWB 2YMYA 3KXDA 3L74G 2C8SA 1W2EA 3L73G 1K3HA 2NRGA 1SQVG 1H0TA 3HQ7A 4RO0A 4HJGH 1CI6A 1QYZA 1VQ4P 3VMZA 2QM8A 4EIFA 4BRYB 1FOSE 3TSIA 1NTZK 4EOTA 2N9BA 1KQFB 2O1JA 1EZVI 3PLNA 1C6RA 1FOCA 1F1FA 2GIWA 2NPSC 2WTYA 5APWA 3Q1MA 1NU1K 5AVQB 1C75A 3LW5J 4WQ8A 1AVOA 3VOPA 5GTHE 1B7VA 5AW0B 3A0BV 3L75D 1BE3G 1CRCA 4O9BA 2B87A 4BWNA 3NBSA 3CL3D 3C1LA 3MTUE 1PP9E 1QX8A 3RBZA 4W7ZA 1IC2A 1DH3A 4WQEA 2C0XA 4FA4A 4D6TJ 4W80A 1RY3A 1QKSA 2CE1A 3L74E 1GK6A 1NU1D 3HQ6A 3PXWA 5CIFB 3L73E 1HGVA 1L0NE 3AE1C 4DJGA 3IAOA 3B71A 2W90A 4UB8V 3WC8A 3H1LG 2Y0EA 1NTKG 1FDMA 1ZMEC 5H2FE 1N7SB 2N3BA 4C7RA 2ZYGA 1SQPK 2KXPB 2E76B 3CWBD 5AVRB 4H44B 1SFCC 1BL9A 2OZ1B 2E5TA 1YFCA 3MK7C 1SQBK 3AE2C 1N50A 2C1VA 2LITA 1CHIA 1U75B 5CIGB 3AEEC 3O5CA 3S4RA 5CBNA 4H13C 1H32B 2IDBA 2O3JA 1HH7A 2YO3A 1VPCA 2C1UA 1KQSO 2O01N 3AEFC 2CK3H 2DW3A 4PD4H 1SQPD 2G8YA 2KNCB 3H1IE 1KYOI 5KLVJ 1G2CB 1H31B 2AIUA 4RJTA 3U59A 1AQ5A 5TISH 2PCBB 3MHVA 1DIPA 1SQBD 3N4XA 3R2PA 3JSVC 4FANA 4YTPC 1CIFA 3H1LE 3L75G 2WPQA 4O1WA 2Z4EA 1NTKE 3SWKA 3Q5PA 1NAFA 1NIRA 1LT1A 155CA 3T97A 1JMBA 3CXHW 3RL0D 3ZOXA 2C9NY 2KK7A 3RBXA 1A2SA 3SFEC 1LNQA 3CP5A 4JBZA 2FYUD 3H32A 4NPEA 4RSZA 5CIDB 3CCEP 2ZZS1 3CD6P 1OW7A 1J2JB 3HQ8A 1NU1G 2CXBA 5C0ZA 2BPBB 3B5NB 3H1HJ 1OW8A 1CCHA 3NXSA 1EZVD 3D70A 3FXDA 3B4SA 3PH0A 2B0ZB 5C9MA 2E42A 2QJYB 1JM0A 4ZNCA 3V6IA 1HTLC 5CJ0A 3Q5RA 1M70A 2H88C 1M6ZA 1VF5D 3TYYA 3BVHA 1RE4A 1C7MA 4YE1A 2YXQB 1IZL0 1IJDB 2K1AA 3CWBG 2OYHA 1C6SA 2K9YA 3EQ2A 4R4LA 2FXPA 4PV1D 4PJ0H 1IRVA 4PD4E 4HB1A 3HD7A 1FI9A 5APSA 1DVHA 4WQAA 2AEFA 2K9JB 2JJLA 1XTGB 4B86A 5TISE 1LMSA 1QVFO 3FWLA 4PW9B 2ZVOB 2C1DA 4K35A 2MTAC 4AANA 5CCGD 1SQQK 1FE6A 1CHHA 1GL2C 3OCDA 2C2CA 3CYTI 1DEEG 2LIRA 2YK3A 1NTZE 2P7JA 1RQUA 1K8AQ 2JQRA 3VMYA 1I55A 1NKZB 1AA0A 2IBZI 1SQPG 4HH2A 3CC2P 2JR8A 1E29A 1NU1E 2WZ7A 4C46A 3O1YA 1RE3A 1SQBG 3Q2YA 4IFFA 3WFEC 2H43A 4H44C 3VP9A 5GTIH 2V4HA 3TGUD 4AUWA 3II6A 4YXWH 2JWAA 3O6QA 2XNXA 1NYHA 1SQQD 1N9CA 1KYOW 5AW2B 3CWBE 2POHA 3L70D 3CCQP 3RL0B 1YICA 1EXIA 1YJWP 3SFDC 2A06D 2FYUG 2KUBA 1I8PA 5KKZC 1ZW0A 1NKNA 1EB7A 4LGDE 1X8YA 1CORA 4PJ0E 1KYOD 2P58A 2GB8B 1IZNB 2AI5A 2BEQD 5CCHA 3CX5I 1GDTA 1C52A 2LXCB 3MIWA 4DCKA 4I1LA 5CBOA 1SQPE 1JO5A 2WITA 4CPGA 1VF5B 1AOFA 4L3HA 3V4QA 1IFNA 2N3YA 4WY4C 1OVVA 4BXLA 2WPVB 1HGZA 1SQBE 3GF3A 1JOCA 1YBKA 1ZLLA 5KJ7A 4PV1B 3KPEA 4HYTB 2KLUA 4LC1A 5KAIH 1LTJA 2P1JA 2VHDA 1RAQA 2OYHC 3AE7C 3TNUB 1RHZB 1Y9BA 2E75D 3HE4B 4KHXA 3B5NC 1PPJD 1SQXJ 4IL6X 1RF1A 5B66H 1CNOA 3B8EB 1N7LA 1PIXA 4L73A 2N18B 2QJYC 1HWTC 3V2RA 2QEXP 1YHQP 1YQ3C 2RN0A 2HPCA 1J1DB 1S4XA 1QL4A 3C9IA 2RH0A 2CPSA 1BGYJ 2KSJA 1J1EB 1EZVE 3M0DC 5KLVK 3QWOC 4JYBA 2QE7H 4Y28J 3D0WA 2FFDA 3H1KJ 5APVA 4W7YA 3OA8B 1GD2E 2WSSH 3L70G 1MUUA 3MUDA 3Q5SA 1CXAA 2A06G 1KYOH 1BSHA 1BDCA 1LWUB 4I7ZC 2H89C 1PGJA 1URQA 4GODA 2XU6A 4AX3A 2IBZD 2HYNA 3LW5H 3ZBMA 1NMIA
chains in the Genus database with same CATH topology
1YNRA 5KLVD 2C8SA 4O1QA 1OAEA 1K3HA 3HQ7A 451CA 4L3GA 4PWAA 1NTMD 3GG2A 1FCDC 1QYZA 1H31A 4EIFA 3SWSA 3DR0A 1RZ5A 3RLMA 3VNWA 3TF5A 1S5LV 2FWLA 3PH2B 3DP5A 3PLNA 1C6RA 1FOCA 1F1FA 2GIWA 4WQCA 1L0ND 2L91A 1R0QA 3NBTA 3PXSA 3RN1A 1N90A 2CA3B 5B6QA 4AAOA 4DY9A 1C75A 1NNOA 4WQ8A 1L0LD 1HCMA 1FJ0A 1YEAA 1B7VA 3A0BV 3L75D 2QG4A 3H1HD 1CRCA 1CCRA 3ITKA 3NBSA 3ZOYA 3CX5D 4JCGA 1MG2D 2ZOOA 1LC1A 4D6TD 3CXHD 1BCCD 4WQEA 1CRHA 4FA4A 1NMLA 2L4DA 1QKSA 2CE1A 3TYIA 1NU1D 3HQ6A 3PXWA 5CIFB 3HQ9A 4V2KA 1CRIA 1GQ1A 2AXTV 4UB8V 3WC8A 2B11B 3H1ID 3L72D 5DJQB 5KAFV 2Y0EA 2Y0DA 2ZBOA 1MG3D 3ZCFA 2XTSB 2N3BA 1IRWA 3KHUA 1YIQA 1CYCA 3CWBD 1AOQA 1E2RA 3VRDA 2Y0CA 2QJPB 3RMZA 2ORLA 4WQBA 1BL9A 2OZ1B 3WFCC 5B66V 4A7PA 3C2CA 1YFCA 3MK7C 1DIIC 3SXTA 1WEJF 2EXVA 3PTZA 1CTYA 1I6EA 1N50A 2C1VA 2LITA 1CHIA 1U75B 5CIGB 1RZ6A 2FYNB 3WU2V 3O5CA 2B12B 1I6DA 4FA1A 1CIEA 1H32B 1H9YA 2O3JA 1HH7A 2BCCD 1KIBA 1CEDA 5GTHV 2C1UA 1HJ3A 4U3FD 4K3IA 1P84D 4FB1A 1M60A 3OA8A 1SQPD 2KNCB 4N0KA 2PCCB 1H31B 2AIUA 4RJTA 1S6VB 4WQDA 4H0JA 2PCBB 1DIQC 1CO6A 1IQCA 1DVVA 1SQBD 4LJIA 1RAPA 1I54A 1W2LA 5GTIV 3TDKA 4FANA 4J20A 1CIFA 2YCCA 4O1WA 3CX5W 1NIRA 155CA 2BCNB 2RMZA 1YTCA 2YQBA 3CXHW 3ZOXA 1HRCA 3ZIYA 3ZOOA 2BLFB 1W5CT 4PD4D 2JTIB 3KZIV 1HZUA 1DW0A 1A2SA 2GC7D 2N9YB 1H33A 3DMIA 3CP5A 3PXTA 5DF5A 2FYUD 1CC5A 1GKSA 5H2FV 4RSZA 5CIDB 2ZZS1 4MU8A 3HQ8A 1GJQA 2FRCA 2CXBA 5AURA 2V07A 3WUIA 5C0ZA 2CA4B 2BPBB 1CYIA 1LS9A 1CCHA 1CTZA 1CYJA 4WQ9A 1EZVD 2Q3EA 1NTZD 1CRYA 2B0ZB 5C9MA 2QJYB 4P4QB 1CSXA 1M70A 1KX2A 2N9JA 1M6ZA 1AKKA 1ETPA 1QL3A 1KV9A 1C7MA 4EDFA 4YE1A 1IZL0 5EXQA 1C6SA 1J3SA 5DFSA 1K3GA 1ZZHA 1IRVA 3ORVA 4FAVA 2GC4D 1FI9A 1HJ4A 1DVHA 4WQAA 2KS1A 1I5TA 3VMAA 2K9JB 2ZONG 1CRJA 1LMSA 2DGEA 5KAIV 3FWLA 4PW9B 3CU4A 3MK7B 1BGYD 2C1DA 2N18C 2MTAC 3O20A 4XYDB 4AANA 4UB6V 1DT1A 2C9XB 3A0HV 1CHHA 1CRGA 3OCDA 2C2CA 3CYTI 3A9FA 1CSUA 2LIRA 2YK3A 4Y5RA 1C6OA 1CIHA 2V08A 2JQRA 1I55A 2MHMA 5DJQC 1E8EA 4WQ7A 1FI7A 1L9BC 1E29A 1LFMA 4Q5PA 3O1YA 1F1CA 2BH4X 1VYDA 3WFEC 2OZ1A 4AALA 5E79V 1N15A 3RN0A 1MZ4A 1IO3A 3TGUD 2JWAA 1HJ5A 5KLIB 1SQQD 1YEBA 1N9CA 1KYOW 2HV4A 3GW6A 3JBTB 2I8FA 3L70D 1H32A 1DW3A 1YICA 2A06D 3L71D 1C2RA 1I8PA 5CIEB 1H1OA 1PP9D 1GU2A 1YCCA 5CIHB 1DW2A 1EB7A 1KB0A 2BH5X 2DVHA 1H9XA 1H33B 1FI3A 3SJLA 1CORA 1KX7A 1KYOD 5B5EV 2GB8B 5CIBB 3SLEA 3L4OA 2AI5A 3L74D 4AAMA 4QAOA 2B10B 3L73D 1GIWA 1SQVD 1FHBA 1DW1A 5TISV 1C52A 4NFGB 1CHJA 2PACA 1CTJA 1AOFA 2N9IA 4L3HA 2D0WA 2N3YA 3H1JD 1AYGA 4GYDA 4FA5A 1QN2A 3M97X 5TJHA 3BCCD 5CICB 3WFDC 2ZXYA 1SQXD 2QJKB 2VHDA 1RAQA 3O0RC 1U74B 1HZVA 1PPJD 3PRJA 3PHLA 1BE3D 1CNOA 2N18B 2D0SA 4EICA 2C1DB 2RN0A 1JDLA 1OCDA 4EIEA 4H0KA 1QL4A 3OCDB 1I8OA 5IY51 4FA9A 1A8CA 3VYMA 1WVEC 4EIDA 351CA 1COTA 1GDVA 1L9JC 2B4ZA 1CSVA 4XXLA 4IL6V 3X39A 4GEDB 1CIGA 1LC2A 1CSWA 3H1KD 1ZRTD 2BGVX 4L1QA 2YIUB 4PJ0V 3SVWA 3OA8B 3H1LD 5CYTR 1NTKD 4KMGA 1CXAA 3ZOWA 1HROA 1CXCA 1KB9D 3WFBC 4AX3A 2IBZD 1A56A 1C2NA 2CE0A 5KKZB 3L4MA 3NWVA 3ZBMA 1NMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNR A;  5KLV D;  2C8S A;  4O1Q A;  1OAE A;  1K3H A;  3HQ7 A;  451C A;  4L3G A;  4PWA A;  1NTM D;  3GG2 A;  1FCD C;  1QYZ A;  1H31 A;  4EIF A;  3SWS A;  3DR0 A;  1RZ5 A;  3RLM A;  3VNW A;  3TF5 A;  1S5L V;  2FWL A;  3PH2 B;  3DP5 A;  3PLN A;  1C6R A;  1FOC A;  1F1F A;  2GIW A;  4WQC A;  1L0N D;  2L91 A;  1R0Q A;  3NBT A;  3PXS A;  3RN1 A;  1N90 A;  2CA3 B;  5B6Q A;  4AAO A;  4DY9 A;  1C75 A;  1NNO A;  4WQ8 A;  1L0L D;  1HCM A;  1FJ0 A;  1YEA A;  1B7V A;  3A0B V;  3L75 D;  2QG4 A;  3H1H D;  1CRC A;  1CCR A;  3ITK A;  3NBS A;  3ZOY A;  3CX5 D;  4JCG A;  1MG2 D;  2ZOO A;  1LC1 A;  4D6T D;  3CXH D;  1BCC D;  4WQE A;  1CRH A;  4FA4 A;  1NML A;  2L4D A;  1QKS A;  2CE1 A;  3TYI A;  1NU1 D;  3HQ6 A;  3PXW A;  5CIF B;  3HQ9 A;  4V2K A;  1CRI A;  1GQ1 A;  2AXT V;  4UB8 V;  3WC8 A;  2B11 B;  3H1I D;  3L72 D;  5DJQ B;  5KAF V;  2Y0E A;  2Y0D A;  2ZBO A;  1MG3 D;  3ZCF A;  2XTS B;  2N3B A;  1IRW A;  3KHU A;  1YIQ A;  1CYC A;  3CWB D;  1AOQ A;  1E2R A;  3VRD A;  2Y0C A;  2QJP B;  3RMZ A;  2ORL A;  4WQB A;  1BL9 A;  2OZ1 B;  3WFC C;  5B66 V;  4A7P A;  3C2C A;  1YFC A;  3MK7 C;  1DII C;  3SXT A;  1WEJ F;  2EXV A;  3PTZ A;  1CTY A;  1I6E A;  1N50 A;  2C1V A;  2LIT A;  1CHI A;  1U75 B;  5CIG B;  1RZ6 A;  2FYN B;  3WU2 V;  3O5C A;  2B12 B;  1I6D A;  4FA1 A;  1CIE A;  1H32 B;  1H9Y A;  2O3J A;  1HH7 A;  2BCC D;  1KIB A;  1CED A;  5GTH V;  2C1U A;  1HJ3 A;  4U3F D;  4K3I A;  1P84 D;  4FB1 A;  1M60 A;  3OA8 A;  1SQP D;  2KNC B;  4N0K A;  2PCC B;  1H31 B;  2AIU A;  4RJT A;  1S6V B;  4WQD A;  4H0J A;  2PCB B;  1DIQ C;  1CO6 A;  1IQC A;  1DVV A;  1SQB D;  4LJI A;  1RAP A;  1I54 A;  1W2L A;  5GTI V;  3TDK A;  4FAN A;  4J20 A;  1CIF A;  2YCC A;  4O1W A;  3CX5 W;  1NIR A;  155C A;  2BCN B;  2RMZ A;  1YTC A;  2YQB A;  3CXH W;  3ZOX A;  1HRC A;  3ZIY A;  3ZOO A;  2BLF B;  1W5C T;  4PD4 D;  2JTI B;  3KZI V;  1HZU A;  1DW0 A;  1A2S A;  2GC7 D;  2N9Y B;  1H33 A;  3DMI A;  3CP5 A;  3PXT A;  5DF5 A;  2FYU D;  1CC5 A;  1GKS A;  5H2F V;  4RSZ A;  5CID B;  2ZZS 1;  4MU8 A;  3HQ8 A;  1GJQ A;  2FRC A;  2CXB A;  5AUR A;  2V07 A;  3WUI A;  5C0Z A;  2CA4 B;  2BPB B;  1CYI A;  1LS9 A;  1CCH A;  1CTZ A;  1CYJ A;  4WQ9 A;  1EZV D;  2Q3E A;  1NTZ D;  1CRY A;  2B0Z B;  5C9M A;  2QJY B;  4P4Q B;  1CSX A;  1M70 A;  1KX2 A;  2N9J A;  1M6Z A;  1AKK A;  1ETP A;  1QL3 A;  1KV9 A;  1C7M A;  4EDF A;  4YE1 A;  1IZL 0;  5EXQ A;  1C6S A;  1J3S A;  5DFS A;  1K3G A;  1ZZH A;  1IRV A;  3ORV A;  4FAV A;  2GC4 D;  1FI9 A;  1HJ4 A;  1DVH A;  4WQA A;  2KS1 A;  1I5T A;  3VMA A;  2K9J B;  2ZON G;  1CRJ A;  1LMS A;  2DGE A;  5KAI V;  3FWL A;  4PW9 B;  3CU4 A;  3MK7 B;  1BGY D;  2C1D A;  2N18 C;  2MTA C;  3O20 A;  4XYD B;  4AAN A;  4UB6 V;  1DT1 A;  2C9X B;  3A0H V;  1CHH A;  1CRG A;  3OCD A;  2C2C A;  3CYT I;  3A9F A;  1CSU A;  2LIR A;  2YK3 A;  4Y5R A;  1C6O A;  1CIH A;  2V08 A;  2JQR A;  1I55 A;  2MHM A;  5DJQ C;  1E8E A;  4WQ7 A;  1FI7 A;  1L9B C;  1E29 A;  1LFM A;  4Q5P A;  3O1Y A;  1F1C A;  2BH4 X;  1VYD A;  3WFE C;  2OZ1 A;  4AAL A;  5E79 V;  1N15 A;  3RN0 A;  1MZ4 A;  1IO3 A;  3TGU D;  2JWA A;  1HJ5 A;  5KLI B;  1SQQ D;  1YEB A;  1N9C A;  1KYO W;  2HV4 A;  3GW6 A;  3JBT B;  2I8F A;  3L70 D;  1H32 A;  1DW3 A;  1YIC A;  2A06 D;  3L71 D;  1C2R A;  1I8P A;  5CIE B;  1H1O A;  1PP9 D;  1GU2 A;  1YCC A;  5CIH B;  1DW2 A;  1EB7 A;  1KB0 A;  2BH5 X;  2DVH A;  1H9X A;  1H33 B;  1FI3 A;  3SJL A;  1COR A;  1KX7 A;  1KYO D;  5B5E V;  2GB8 B;  5CIB B;  3SLE A;  3L4O A;  2AI5 A;  3L74 D;  4AAM A;  4QAO A;  2B10 B;  3L73 D;  1GIW A;  1SQV D;  1FHB A;  1DW1 A;  5TIS V;  1C52 A;  4NFG B;  1CHJ A;  2PAC A;  1CTJ A;  1AOF A;  2N9I A;  4L3H A;  2D0W A;  2N3Y A;  3H1J D;  1AYG A;  4GYD A;  4FA5 A;  1QN2 A;  3M97 X;  5TJH A;  3BCC D;  5CIC B;  3WFD C;  2ZXY A;  1SQX D;  2QJK B;  2VHD A;  1RAQ A;  3O0R C;  1U74 B;  1HZV A;  1PPJ D;  3PRJ A;  3PHL A;  1BE3 D;  1CNO A;  2N18 B;  2D0S A;  4EIC A;  2C1D B;  2RN0 A;  1JDL A;  1OCD A;  4EIE A;  4H0K A;  1QL4 A;  3OCD B;  1I8O A;  5IY5 1;  4FA9 A;  1A8C A;  3VYM A;  1WVE C;  4EID A;  351C A;  1COT A;  1GDV A;  1L9J C;  2B4Z A;  1CSV A;  4XXL A;  4IL6 V;  3X39 A;  4GED B;  1CIG A;  1LC2 A;  1CSW A;  3H1K D;  1ZRT D;  2BGV X;  4L1Q A;  2YIU B;  4PJ0 V;  3SVW A;  3OA8 B;  3H1L D;  5CYT R;  1NTK D;  4KMG A;  1CXA A;  3ZOW A;  1HRO A;  1CXC A;  1KB9 D;  3WFB C;  4AX3 A;  2IBZ D;  1A56 A;  1C2N A;  2CE0 A;  5KKZ B;  3L4M A;  3NWV A;  3ZBM A;  1NMI A; 
#chains in the Genus database with same CATH topology
 3CCS P;  5KLV D;  5AW1 B;  4O1Q A;  1OAE A;  4PD4 I;  3G3Z A;  1RF0 C;  3AEA C;  2AXC A;  1CW5 A;  5B66 E;  3TF5 A;  3HTK A;  3PH2 B;  1XTC C;  5CCH C;  4N78 D;  4WQC A;  1L0N D;  2L91 A;  3RL0 C;  5AW5 B;  3L4F A;  3PXS A;  2CA3 B;  3TGU E;  1Q2N A;  5AVV B;  4DY9 A;  1NNO A;  2WQY C;  1SQQ E;  1FJ0 A;  1Q81 Q;  4JF7 A;  1YEA A;  1PPJ G;  3AE6 C;  2QG4 A;  3RL0 g;  3H1H D;  2E75 B;  5KJ7 C;  3ZOY A;  3CX5 D;  3M0A A;  2ZOO A;  1LC1 A;  2KS1 B;  3BCC J;  3A0H H;  1YIT P;  1KYO E;  1VF5 C;  5AW7 B;  2RKL A;  1RF1 C;  1NML A;  1EQ7 A;  1M1J B;  1AFO A;  1MZ9 A;  2ZAE B;  4DOJ A;  5KTB A;  1JY2 N;  1N86 A;  1T2K D;  1EDL A;  1GQ1 A;  3IR9 A;  1JUN A;  2Q9I A;  2FBW C;  3H1I D;  4GT1 A;  3AE4 C;  1K9M Q;  2E74 D;  2Y0D A;  1LTT C;  3VP8 A;  3L72 J;  1KD1 Q;  2PGD A;  5E79 H;  1D7M A;  1KQL A;  4DT0 A;  5CCG C;  3TK1 A;  1E2R A;  3HUS B;  1SFC A;  2QJP B;  2ORL A;  4WQB A;  2H8P D;  1N73 A;  2IBZ G;  4OGQ C;  3C2C A;  4WVZ A;  3SXT A;  5APQ A;  1FZF A;  4D6T E;  3HRN A;  5KLV G;  3PP5 A;  1I6E A;  1N8R Q;  3NFQ A;  1PPJ E;  1J1E C;  2FYN B;  3BRT B;  2B12 B;  3AEB C;  2L5G B;  1JB0 J;  1URQ C;  3VN0 A;  1USE A;  5DJT B;  1KIB A;  5GTH V;  2ZJS E;  1H0T B;  1HJ3 A;  1M60 A;  5B5E H;  1WT6 A;  4U3F J;  1YI2 P;  1L0N G;  1CO6 A;  1IFP A;  1MKM A;  1WRG A;  3A0H E;  1LWU C;  2YO2 A;  4LJI A;  1I54 A;  3CX5 H;  3U1C A;  3AEG C;  3CC7 P;  2BCN B;  1HBW A;  1YTC A;  2YQB A;  2ZYD A;  3M9H A;  1EDK A;  3H25 A;  2YKP A;  3ZIY A;  4PD4 D;  1HZU A;  2XKM A;  2GC7 D;  3AE5 C;  1SQX K;  2Q3I A;  2FYZ A;  3W68 A;  1H33 A;  3DMI A;  2IBZ E;  2D2C D;  1GKS A;  5H2F V;  1L0L J;  1GTW A;  5AW6 B;  5E79 E;  2CPB A;  5KLV E;  3G71 P;  1GJQ A;  2FRC A;  3WUI A;  3G6E P;  1MV8 A;  2Z5H A;  1FU1 A;  4WQ9 A;  2R32 A;  1NTZ D;  1CRY A;  2SPZ A;  4P4Q B;  1BCC J;  1OW6 A;  3H1I G;  4I6M C;  2A45 H;  4UB8 H;  1ZN5 A;  1LTB C;  1JTH B;  4N78 E;  2E74 B;  3NMD A;  2R5B A;  4YPC A;  4R4M A;  4L76 A;  1J3S A;  5DFS A;  1LT9 B;  2M5A A;  5B5E E;  4C7N B;  1RQV A;  5K5G B;  1HJ4 A;  5APY A;  1I5T A;  3VMA A;  1S2E A;  5AW9 B;  2O01 J;  3H1H E;  2N1T C;  1M1J C;  1BGY D;  1GL2 A;  1KB9 I;  3CX5 E;  2WSF J;  1N73 C;  4Y5R A;  2ZT9 C;  1C6O A;  2V08 A;  2JP3 A;  3V2P A;  1KZU B;  2VRS A;  1JY2 O;  1A02 J;  1FI7 A;  1Q86 Q;  5AW8 B;  3GMA A;  1F1C A;  2BH4 X;  3P7K A;  1VYD A;  3HUS C;  2KZI A;  2BCC J;  2QJP C;  2OZ1 A;  2M8R A;  1S5L H;  1KMI Z;  3KDP B;  3IFM A;  4JPZ B;  1IO3 A;  1HJ5 A;  5KLI B;  2KIK A;  2K88 A;  1YEB A;  2HV4 A;  3JBT B;  2FYN C;  2I8F A;  3V2Q A;  3CME P;  1H32 A;  3P8C D;  1DW3 A;  4H0L C;  1C2R A;  1KIL D;  3E7K A;  1H1O A;  1GU2 A;  3MGN A;  4GKG A;  2D2C B;  2KNC A;  1H9X A;  1LTS C;  1G2C A;  3FXE A;  3H32 B;  1NTZ G;  5CIB B;  3L4O A;  4AAM A;  1T8Z A;  1ZP0 C;  2QVA A;  3L74 J;  5TIS V;  1S72 P;  4WWI A;  1FZG A;  1SQV J;  4OWF A;  1CTJ A;  2N9I A;  2R44 A;  4WY4 A;  2D0W A;  1VQO P;  1Q7Y Q;  2AXT H;  2Q6Q A;  2K3R A;  1E79 H;  2I1J A;  5KAF H;  1AYG A;  3USS A;  4GYD A;  1YTZ T;  2HG5 D;  4U7J A;  2WPS A;  1GU5 A;  3E1R A;  5M1B A;  3BCC D;  1BGY G;  2QJK B;  2M3E A;  3B5N A;  1GU4 A;  1U74 B;  2AEM A;  1S5L E;  3PHL A;  3RGU A;  4XFJ A;  2Q5U A;  1FJP A;  4EIC A;  2C1D B;  4L75 A;  4EYY Q;  1BE3 J;  1OIP A;  4H0K A;  2IPP A;  3OCD B;  1OVU A;  3WU2 H;  1I8O A;  5IY5 1;  4FA9 A;  1L4A D;  3GLM A;  1WVE C;  3M0D A;  4EID A;  2ZVN B;  3S9O A;  2IFN A;  1L9J C;  1UII A;  1LT9 C;  5BU8 B;  3RK2 D;  2K9J A;  1R8E A;  1N7S C;  1H89 A;  4PJ0 V;  3O8Z A;  1M90 Q;  3CPW O;  3AEC C;  2KSE A;  3SVW A;  3RK3 E;  2E76 C;  1VQM P;  1SQX E;  2W27 A;  3ZOW A;  2IYO A;  3NTN A;  1CXC A;  1Y8A A;  2R5D A;  1KB9 D;  1EDI A;  3L37 A;  1PFI A;  1KIL B;  2AXT E;  1IK7 A;  2OGU A;  3EFG A;  5L8R J;  1VQ7 P;  2CE0 A;  1BGY E;  3L4M A;  3NWV A;  1K3G A;  2WVR A;  5AVX B;  1L0L K;  3KZI H;  5KAF E;  3M91 A;  2BEZ F;  1QL1 A;  1LP1 B;  1RF0 A;  3L71 J;  1FAV A;  4PWA A;  2W6A A;  3GG2 A;  3F89 A;  3SWS A;  1EZV G;  1RZ5 A;  1E5W A;  3H1K E;  2C9L Y;  3VNW A;  5KLI C;  1VQ5 P;  2FWL A;  2J59 M;  3DP5 A;  1M56 D;  1Z56 A;  1ZOY C;  4NPD A;  3WU2 E;  2NPS D;  3NBT A;  3RN1 A;  1R5L A;  3MD0 A;  2JO1 A;  3BCC G;  1OFC X;  1L0L D;  1HCM A;  2D2C C;  2P10 A;  1UIX A;  2KB7 P;  3ZDM A;  1USD A;  4TT3 H;  1JEK A;  3CCM P;  1NJI Q;  2PP6 A;  3P8C E;  2ZXX A;  3BRV B;  1CCR A;  3L75 J;  3H1J J;  3ITK A;  1KIL E;  2MJZ A;  1SS1 A;  1FC2 C;  4JCG A;  2OYI B;  1MG2 D;  4D6T D;  1BCC D;  2YKQ A;  3FWN A;  1G1I A;  1SLQ A;  1CRH A;  4UB6 H;  5GTI E;  2A45 I;  2HPC B;  1VDF A;  1L4A B;  3MP7 B;  3A2A A;  1PV3 A;  2OQQ A;  1CRI A;  1KTM A;  1NU1 J;  4QMA A;  3RK2 B;  1KB9 H;  3KZI E;  4RES B;  3GHG B;  4XA4 A;  1ZR2 A;  4KT0 J;  2B11 B;  2YXR B;  3HE4 A;  3ZCF A;  2XTS B;  1IRW A;  2IZ0 A;  2FFD B;  1YIQ A;  2XV5 A;  3TGU G;  5CCG A;  1K05 A;  1SQQ G;  3VRD A;  2Y0C A;  3RMZ A;  3WFC C;  1KN7 A;  5B66 V;  3VTP C;  4A7P A;  3BCC E;  1FZC B;  2EXV A;  3PTZ A;  1GW3 A;  3EFF K;  1U57 A;  3OW2 O;  3C8V A;  2W6J H;  3CCV P;  3SSU A;  4FA1 A;  4ZKU A;  1CIE A;  2B89 A;  3KQG A;  2BCC D;  4H13 D;  2GM4 A;  4K3I A;  4FB1 A;  1NAY A;  1T6A A;  1VQK P;  3OA8 A;  2ZXE B;  2WPR A;  4ZMD A;  2WSC J;  4N0K A;  1SQV K;  5KAI E;  1S6V B;  1MFZ A;  1LWU A;  1FS0 E;  3HTK B;  1T3U A;  4UB6 E;  1NTM J;  2NPS B;  1L0L G;  3OJA B;  1YJ9 P;  1W2L A;  4M3L A;  1SQB J;  2QRX A;  2YCC A;  4GOE A;  4OVN F;  3CX5 W;  2RMZ A;  1HRC A;  1KB9 E;  1Q90 D;  2J58 A;  2JTI B;  1DW0 A;  1BSN A;  1NHL A;  2JKV A;  1BCC G;  2N9Y B;  4D6T G;  3WUU A;  2V7Q J;  3PXT A;  5DF5 A;  5EFW B;  1CC5 A;  2WT7 B;  3AE8 C;  4U3F E;  4MU8 A;  2W83 C;  2FYU J;  1ZXG A;  2CA4 B;  1VL2 A;  2KOG A;  1U7M A;  1CYJ A;  1YQ4 C;  3D6Y A;  3L35 A;  2HOD B;  2O01 H;  3CCJ P;  2Q3E A;  1AQT A;  3V5B A;  4OH8 B;  1FZE A;  1IFI A;  1VQ8 P;  2WSF H;  2LR2 A;  2OTK E;  1AKK A;  1SVF A;  1A02 F;  1PZQ A;  1K04 A;  1KV9 A;  1LTG C;  1W2B O;  4WB4 A;  4EDF A;  4IL6 H;  5EXQ A;  1U7J A;  4AYC A;  1YIJ P;  1FOS F;  3CCU P;  4PV1 C;  3HE5 B;  1EC5 A;  1IK9 A;  1Q82 Q;  2W8Z A;  1IFD A;  2GC4 D;  4JYC A;  2OYI C;  1SP4 A;  2KS1 A;  1L0L E;  3D71 A;  2IYP A;  2ZON G;  1AV1 A;  5AVZ B;  2JEE A;  2WSE J;  2N1T A;  1M1J A;  3MK7 B;  2Q1K A;  2N18 C;  2B88 A;  3O20 A;  5AW4 B;  1VQ9 P;  1DT1 A;  3A0H V;  2M3B A;  3EWK A;  1J1D C;  4DZO A;  2BCC G;  4EIJ A;  3A9F A;  1CSU A;  1N2D C;  1BCC E;  1GL2 D;  1CIH A;  4H13 B;  3GHG C;  4GIF A;  2MHM A;  1E8E A;  5AVT B;  3M9Q A;  4WQ7 A;  1PGO A;  3I55 P;  1NOH A;  4Q5P A;  3A3Y B;  1OMI A;  3HUS A;  1PL5 A;  5BVZ A;  5E79 V;  1KFM A;  3RN0 A;  1CI6 B;  1TU3 F;  1MZ4 A;  3CMA P;  2QSI A;  1L2P A;  4MN4 C;  2XDJ A;  2QM7 A;  4EI2 A;  3SWF A;  1OZH A;  3L71 D;  3L70 J;  2YKO A;  3H1H G;  3A0B H;  4IL6 E;  5H2F H;  5CIH B;  1KB0 A;  1H33 B;  1KX7 A;  3WMM 0;  5B5E V;  4Y99 B;  3CC4 P;  4LLH A;  1OXZ A;  4QAO A;  2OTJ P;  4BRY A;  2B87 B;  2BCC E;  3BAT A;  1H88 A;  1GIW A;  1FHB A;  3CXH I;  4NFG B;  1CHJ A;  2PAC A;  5DJU B;  1NVO A;  1DD3 A;  3UIA A;  5AVY B;  2HLO A;  3OA7 A;  2WMM A;  4WY4 D;  3H1J D;  2QIW A;  4FA5 A;  5TJH A;  3RK3 D;  2M5A B;  2M0B A;  2E75 C;  3G9R A;  3WFD C;  2ZXY A;  2A45 G;  1SQX D;  2MKV A;  2PFX A;  5APX A;  1YYC A;  3VMX A;  3O0R C;  2ITA A;  2K37 A;  1R5S A;  1QVG O;  3B5N D;  3U1A A;  1FZB A;  3HD7 D;  1SQV E;  1OCD A;  1GL2 B;  5CHX A;  2Z5I A;  3W67 A;  1JTH A;  1YTZ I;  2PAJ A;  1S1C X;  2PRR A;  1JY2 P;  1COT A;  2O1K A;  3A0B E;  1LT9 A;  5CJ4 A;  2FXM A;  2B4Z A;  4C7N A;  2R3C A;  1CSV A;  1OVR A;  1QL2 A;  4GED B;  1LC2 A;  1N7S A;  3H1K D;  1DEB A;  1P84 I;  4L1Q A;  1LGH B;  2YIU B;  1NTM K;  2KYV A;  5CYT R;  2E5Y A;  3L71 G;  2LXB A;  1YJN P;  1FBM A;  1BE3 E;  3WFB C;  1EXJ A;  2XND H;  1C2N A;  5KKZ B;  1HH0 A;  2L4D A;  1S9K E;  4UB8 E;  1YNR A;  3IF4 A;  3T97 B;  2FYU K;  451C A;  4L3G A;  4ZKP A;  1NTM D;  1FCD C;  2J5U A;  1PP9 J;  3L36 A;  1H31 A;  2P2U A;  3DR0 A;  3RLM A;  1ZRT E;  3AED C;  3GF7 A;  3PJS K;  3ABV C;  2KP8 A;  1IFJ A;  1S5L V;  1JY3 N;  2IZ1 A;  1M8O B;  2W6B A;  3H1J G;  4GDO A;  3CCR P;  1WMK A;  1GK4 A;  2ZYA A;  5CCH D;  3L73 J;  3IN6 A;  1R0Q A;  4WY4 B;  3E1I A;  1N90 A;  5B6Q A;  4AAO A;  1L0N J;  1LTA C;  3P8M C;  1SQX G;  2KLV A;  2JDI H;  5APT A;  3RK3 B;  1JNM A;  3JCU H;  3F5H A;  4Y99 C;  2OYH B;  3L71 E;  3VYI A;  2IFM A;  5AVW B;  2KZJ A;  4IFM A;  5KJ7 D;  1ZR4 A;  1M7L A;  3HD7 B;  3CXH D;  4AQR D;  1MFT A;  5C39 A;  2YMK A;  1T2K C;  3TYI A;  4JQ0 D;  3CCL P;  2Y9Y A;  3HQ9 A;  4V2K A;  3H1K G;  2HFE D;  5APU A;  2E43 A;  2AXT V;  4IOI H;  1QGK B;  2E74 C;  2R3S A;  5DJQ B;  3L72 D;  5KAF V;  4KJM A;  3KYQ A;  1T3J A;  2ZBO A;  1OX3 A;  3A7O A;  1MG3 D;  3H1I J;  2KI7 B;  3KHU A;  3H1J E;  3L75 E;  1CYC A;  2WSC H;  1AOQ A;  2Q7C A;  1DII C;  1WEJ F;  1CTY A;  4OGQ D;  4I7Z B;  3H1L J;  3O6Q B;  1H8A A;  1IO4 A;  1HF9 A;  1RZ6 A;  1NTK J;  3WU2 V;  1PGQ A;  1I6D A;  1IFM A;  1NTM G;  2AEJ A;  1H9Y A;  2BAS A;  3I5C A;  1CED A;  1URQ D;  3JCU E;  4U3F D;  1P84 D;  1GMJ A;  2YIU C;  2V7Q H;  2PCC B;  4WQD A;  4H0J A;  1NO4 A;  1NGM B;  1M1K Q;  1DIQ C;  1IQC A;  1DVV A;  1RAP A;  1KIL A;  5GTI V;  4N6J A;  3TDK A;  4J20 A;  3M9B A;  3CXH H;  1LP1 A;  1VQP P;  3ZOO A;  2BLF B;  1W5C T;  1PGP A;  4I2L C;  3KZI V;  2WWW A;  2OYO A;  3AE3 C;  1HJB A;  1LTJ B;  5AUR A;  2V07 A;  1CYI A;  1LS9 A;  1CTZ A;  1JY3 P;  2WSE H;  1M57 D;  1RF1 B;  1DX7 A;  1NTM E;  2G3A A;  1JY3 O;  1CSX A;  1NTZ J;  3LID A;  3L72 G;  2C0W A;  1KX2 A;  2N9J A;  1ETP A;  3K5B A;  3AE9 C;  3RK3 C;  1QL3 A;  2FY8 A;  1RE4 C;  1X22 A;  1QEX A;  3S1K A;  1G1J A;  4ASV A;  5CMZ A;  1X79 B;  2OYI A;  1ZZH A;  3ORV A;  4FAV A;  3TNU A;  2QJK C;  3HD7 C;  2UWJ E;  1VQN P;  1CRJ A;  2FYU E;  2DGE A;  1KV4 A;  5KAI V;  4OGQ B;  3CU4 A;  1L4A A;  1P84 H;  3V4W A;  4XYD B;  4UB6 V;  2C9X B;  2N1T D;  3CWB J;  3JC2 2;  1CRG A;  4YXD C;  1SFC D;  1K73 Q;  3CXH E;  3CI9 A;  4U3F G;  1FDO A;  3GHG A;  4Z1M H;  4HKZ H;  1LJ2 A;  2ZT9 D;  2QA4 P;  1URQ B;  5DJQ C;  4K3A A;  1L9B C;  4ASW A;  2I1K A;  2HR3 A;  1LFM A;  3N7N A;  3P32 A;  1DD4 A;  3CLQ A;  1RE3 C;  1NWQ A;  3G4S P;  1NH4 A;  3H6P A;  4AAL A;  1N15 A;  1CSB A;  1FZC A;  2GUV A;  3L72 E;  4N3Y B;  3I56 P;  3WUV A;  1SQP J;  1FJK A;  1L0N K;  1Y47 A;  3GW6 A;  5AW3 B;  3QH9 A;  1AJY A;  3LIE A;  3D6Z A;  2ZFC A;  1KIL C;  1S3J A;  1AVY A;  2IX7 C;  5CIE B;  4H0L D;  5AVU B;  1PP9 D;  2I8D A;  4TLF A;  1YCC A;  1DW2 A;  5BU5 A;  2BH5 X;  1HUC A;  1FDI A;  3M06 A;  2XZR A;  2DVH A;  3WUT A;  4GOF A;  3SJL A;  1FI3 A;  2NZ2 A;  1GZL A;  1BDD A;  3SLE A;  2FXO A;  3L74 D;  2B10 B;  1OWA A;  1GW4 A;  3L73 D;  2NPS A;  2GA1 A;  1SQV D;  1DW1 A;  1P84 E;  5AVS B;  3FGA D;  1X0T A;  3FX0 A;  3L70 E;  1JMM A;  1JCC A;  2OAR A;  3MZW B;  2A06 E;  2B9B A;  3A5T A;  4RKU J;  1KFN A;  2WT7 A;  1QN2 A;  3M97 X;  4NPF X;  3SWY A;  5CIC B;  3BAS A;  1KQG B;  1LTJ C;  1HZV A;  3OAK A;  1X9V A;  2HOD A;  1CZQ A;  3PRJ A;  1BE3 D;  1EDJ A;  2N1T B;  1NTK K;  4XE5 B;  2D0S A;  1SFC B;  1JDL A;  4EIE A;  1N73 B;  2OTL P;  1L4A C;  1S9K D;  2ZT9 B;  1KOR A;  4L74 A;  2H7H A;  1A8C A;  3VYM A;  2LKM A;  351C A;  3HE5 A;  3R4Y A;  1HJ0 A;  1GDV A;  5GTH H;  3RK2 C;  1HVV A;  4XXL A;  1RH5 B;  4IL6 V;  2GUS A;  3X39 A;  2YNY A;  1CIG A;  1CSW A;  1ZRT D;  2BGV X;  1N7S D;  2FFD C;  1QLE D;  3V2N A;  1VQL P;  3H1L D;  1JCD A;  1VQ6 P;  1NTK D;  1KC8 Q;  2E76 D;  4KMG A;  3MUD C;  1HRO A;  2JWD A;  2P67 A;  1FZC C;  4H44 D;  1ZV8 A;  1PP9 G;  4IFD K;  3Q3D A;  3TGU J;  4H0L B;  1S5L X;  2Y9Z A;  1W5C E;  1A56 A;  1FZA A;  1SQQ J;  4WBA A;  1LTI C;  2FKW B;  2YMY A;  3KXD A;  3L74 G;  2C8S A;  1W2E A;  3L73 G;  1K3H A;  2NRG A;  1SQV G;  1H0T A;  3HQ7 A;  4RO0 A;  4HJG H;  1CI6 A;  1QYZ A;  1VQ4 P;  3VMZ A;  2QM8 A;  4EIF A;  4BRY B;  1FOS E;  3TSI A;  1NTZ K;  4EOT A;  2N9B A;  1KQF B;  2O1J A;  1EZV I;  3PLN A;  1C6R A;  1FOC A;  1F1F A;  2GIW A;  2NPS C;  2WTY A;  5APW A;  3Q1M A;  1NU1 K;  5AVQ B;  1C75 A;  3LW5 J;  4WQ8 A;  1AVO A;  3VOP A;  5GTH E;  1B7V A;  5AW0 B;  3A0B V;  3L75 D;  1BE3 G;  1CRC A;  4O9B A;  2B87 A;  4BWN A;  3NBS A;  3CL3 D;  3C1L A;  3MTU E;  1PP9 E;  1QX8 A;  3RBZ A;  4W7Z A;  1IC2 A;  1DH3 A;  4WQE A;  2C0X A;  4FA4 A;  4D6T J;  4W80 A;  1RY3 A;  1QKS A;  2CE1 A;  3L74 E;  1GK6 A;  1NU1 D;  3HQ6 A;  3PXW A;  5CIF B;  3L73 E;  1HGV A;  1L0N E;  3AE1 C;  4DJG A;  3IAO A;  3B71 A;  2W90 A;  4UB8 V;  3WC8 A;  3H1L G;  2Y0E A;  1NTK G;  1FDM A;  1ZME C;  5H2F E;  1N7S B;  2N3B A;  4C7R A;  2ZYG A;  1SQP K;  2KXP B;  2E76 B;  3CWB D;  5AVR B;  4H44 B;  1SFC C;  1BL9 A;  2OZ1 B;  2E5T A;  1YFC A;  3MK7 C;  1SQB K;  3AE2 C;  1N50 A;  2C1V A;  2LIT A;  1CHI A;  1U75 B;  5CIG B;  3AEE C;  3O5C A;  3S4R A;  5CBN A;  4H13 C;  1H32 B;  2IDB A;  2O3J A;  1HH7 A;  2YO3 A;  1VPC A;  2C1U A;  1KQS O;  2O01 N;  3AEF C;  2CK3 H;  2DW3 A;  4PD4 H;  1SQP D;  2G8Y A;  2KNC B;  3H1I E;  1KYO I;  5KLV J;  1G2C B;  1H31 B;  2AIU A;  4RJT A;  3U59 A;  1AQ5 A;  5TIS H;  2PCB B;  3MHV A;  1DIP A;  1SQB D;  3N4X A;  3R2P A;  3JSV C;  4FAN A;  4YTP C;  1CIF A;  3H1L E;  3L75 G;  2WPQ A;  4O1W A;  2Z4E A;  1NTK E;  3SWK A;  3Q5P A;  1NAF A;  1NIR A;  1LT1 A;  155C A;  3T97 A;  1JMB A;  3CXH W;  3RL0 D;  3ZOX A;  2C9N Y;  2KK7 A;  3RBX A;  1A2S A;  3SFE C;  1LNQ A;  3CP5 A;  4JBZ A;  2FYU D;  3H32 A;  4NPE A;  4RSZ A;  5CID B;  3CCE P;  2ZZS 1;  3CD6 P;  1OW7 A;  1J2J B;  3HQ8 A;  1NU1 G;  2CXB A;  5C0Z A;  2BPB B;  3B5N B;  3H1H J;  1OW8 A;  1CCH A;  3NXS A;  1EZV D;  3D70 A;  3FXD A;  3B4S A;  3PH0 A;  2B0Z B;  5C9M A;  2E42 A;  2QJY B;  1JM0 A;  4ZNC A;  3V6I A;  1HTL C;  5CJ0 A;  3Q5R A;  1M70 A;  2H88 C;  1M6Z A;  1VF5 D;  3TYY A;  3BVH A;  1RE4 A;  1C7M A;  4YE1 A;  2YXQ B;  1IZL 0;  1IJD B;  2K1A A;  3CWB G;  2OYH A;  1C6S A;  2K9Y A;  3EQ2 A;  4R4L A;  2FXP A;  4PV1 D;  4PJ0 H;  1IRV A;  4PD4 E;  4HB1 A;  3HD7 A;  1FI9 A;  5APS A;  1DVH A;  4WQA A;  2AEF A;  2K9J B;  2JJL A;  1XTG B;  4B86 A;  5TIS E;  1LMS A;  1QVF O;  3FWL A;  4PW9 B;  2ZVO B;  2C1D A;  4K35 A;  2MTA C;  4AAN A;  5CCG D;  1SQQ K;  1FE6 A;  1CHH A;  1GL2 C;  3OCD A;  2C2C A;  3CYT I;  1DEE G;  2LIR A;  2YK3 A;  1NTZ E;  2P7J A;  1RQU A;  1K8A Q;  2JQR A;  3VMY A;  1I55 A;  1NKZ B;  1AA0 A;  2IBZ I;  1SQP G;  4HH2 A;  3CC2 P;  2JR8 A;  1E29 A;  1NU1 E;  2WZ7 A;  4C46 A;  3O1Y A;  1RE3 A;  1SQB G;  3Q2Y A;  4IFF A;  3WFE C;  2H43 A;  4H44 C;  3VP9 A;  5GTI H;  2V4H A;  3TGU D;  4AUW A;  3II6 A;  4YXW H;  2JWA A;  3O6Q A;  2XNX A;  1NYH A;  1SQQ D;  1N9C A;  1KYO W;  5AW2 B;  3CWB E;  2POH A;  3L70 D;  3CCQ P;  3RL0 B;  1YIC A;  1EXI A;  1YJW P;  3SFD C;  2A06 D;  2FYU G;  2KUB A;  1I8P A;  5KKZ C;  1ZW0 A;  1NKN A;  1EB7 A;  4LGD E;  1X8Y A;  1COR A;  4PJ0 E;  1KYO D;  2P58 A;  2GB8 B;  1IZN B;  2AI5 A;  2BEQ D;  5CCH A;  3CX5 I;  1GDT A;  1C52 A;  2LXC B;  3MIW A;  4DCK A;  4I1L A;  5CBO A;  1SQP E;  1JO5 A;  2WIT A;  4CPG A;  1VF5 B;  1AOF A;  4L3H A;  3V4Q A;  1IFN A;  2N3Y A;  4WY4 C;  1OVV A;  4BXL A;  2WPV B;  1HGZ A;  1SQB E;  3GF3 A;  1JOC A;  1YBK A;  1ZLL A;  5KJ7 A;  4PV1 B;  3KPE A;  4HYT B;  2KLU A;  4LC1 A;  5KAI H;  1LTJ A;  2P1J A;  2VHD A;  1RAQ A;  2OYH C;  3AE7 C;  3TNU B;  1RHZ B;  1Y9B A;  2E75 D;  3HE4 B;  4KHX A;  3B5N C;  1PPJ D;  1SQX J;  4IL6 X;  1RF1 A;  5B66 H;  1CNO A;  3B8E B;  1N7L A;  1PIX A;  4L73 A;  2N18 B;  2QJY C;  1HWT C;  3V2R A;  2QEX P;  1YHQ P;  1YQ3 C;  2RN0 A;  2HPC A;  1J1D B;  1S4X A;  1QL4 A;  3C9I A;  2RH0 A;  2CPS A;  1BGY J;  2KSJ A;  1J1E B;  1EZV E;  3M0D C;  5KLV K;  3QWO C;  4JYB A;  2QE7 H;  4Y28 J;  3D0W A;  2FFD A;  3H1K J;  5APV A;  4W7Y A;  3OA8 B;  1GD2 E;  2WSS H;  3L70 G;  1MUU A;  3MUD A;  3Q5S A;  1CXA A;  2A06 G;  1KYO H;  1BSH A;  1BDC A;  1LWU B;  4I7Z C;  2H89 C;  1PGJ A;  1URQ A;  4GOD A;  2XU6 A;  4AX3 A;  2IBZ D;  2HYN A;  3LW5 H;  3ZBM A;  1NMI A; 
#chains in the Genus database with same CATH homology
 1YNR A;  5KLV D;  2C8S A;  4O1Q A;  1OAE A;  1K3H A;  3HQ7 A;  451C A;  4L3G A;  4PWA A;  1NTM D;  3GG2 A;  1FCD C;  1QYZ A;  1H31 A;  4EIF A;  3SWS A;  3DR0 A;  1RZ5 A;  3RLM A;  3VNW A;  3TF5 A;  1S5L V;  2FWL A;  3PH2 B;  3DP5 A;  3PLN A;  1C6R A;  1FOC A;  1F1F A;  2GIW A;  4WQC A;  1L0N D;  2L91 A;  1R0Q A;  3NBT A;  3PXS A;  3RN1 A;  1N90 A;  2CA3 B;  5B6Q A;  4AAO A;  4DY9 A;  1C75 A;  1NNO A;  4WQ8 A;  1L0L D;  1HCM A;  1FJ0 A;  1YEA A;  1B7V A;  3A0B V;  3L75 D;  2QG4 A;  3H1H D;  1CRC A;  1CCR A;  3ITK A;  3NBS A;  3ZOY A;  3CX5 D;  4JCG A;  1MG2 D;  2ZOO A;  1LC1 A;  4D6T D;  3CXH D;  1BCC D;  4WQE A;  1CRH A;  4FA4 A;  1NML A;  2L4D A;  1QKS A;  2CE1 A;  3TYI A;  1NU1 D;  3HQ6 A;  3PXW A;  5CIF B;  3HQ9 A;  4V2K A;  1CRI A;  1GQ1 A;  2AXT V;  4UB8 V;  3WC8 A;  2B11 B;  3H1I D;  3L72 D;  5DJQ B;  5KAF V;  2Y0E A;  2Y0D A;  2ZBO A;  1MG3 D;  3ZCF A;  2XTS B;  2N3B A;  1IRW A;  3KHU A;  1YIQ A;  1CYC A;  3CWB D;  1AOQ A;  1E2R A;  3VRD A;  2Y0C A;  2QJP B;  3RMZ A;  2ORL A;  4WQB A;  1BL9 A;  2OZ1 B;  3WFC C;  5B66 V;  4A7P A;  3C2C A;  1YFC A;  3MK7 C;  1DII C;  3SXT A;  1WEJ F;  2EXV A;  3PTZ A;  1CTY A;  1I6E A;  1N50 A;  2C1V A;  2LIT A;  1CHI A;  1U75 B;  5CIG B;  1RZ6 A;  2FYN B;  3WU2 V;  3O5C A;  2B12 B;  1I6D A;  4FA1 A;  1CIE A;  1H32 B;  1H9Y A;  2O3J A;  1HH7 A;  2BCC D;  1KIB A;  1CED A;  5GTH V;  2C1U A;  1HJ3 A;  4U3F D;  4K3I A;  1P84 D;  4FB1 A;  1M60 A;  3OA8 A;  1SQP D;  2KNC B;  4N0K A;  2PCC B;  1H31 B;  2AIU A;  4RJT A;  1S6V B;  4WQD A;  4H0J A;  2PCB B;  1DIQ C;  1CO6 A;  1IQC A;  1DVV A;  1SQB D;  4LJI A;  1RAP A;  1I54 A;  1W2L A;  5GTI V;  3TDK A;  4FAN A;  4J20 A;  1CIF A;  2YCC A;  4O1W A;  3CX5 W;  1NIR A;  155C A;  2BCN B;  2RMZ A;  1YTC A;  2YQB A;  3CXH W;  3ZOX A;  1HRC A;  3ZIY A;  3ZOO A;  2BLF B;  1W5C T;  4PD4 D;  2JTI B;  3KZI V;  1HZU A;  1DW0 A;  1A2S A;  2GC7 D;  2N9Y B;  1H33 A;  3DMI A;  3CP5 A;  3PXT A;  5DF5 A;  2FYU D;  1CC5 A;  1GKS A;  5H2F V;  4RSZ A;  5CID B;  2ZZS 1;  4MU8 A;  3HQ8 A;  1GJQ A;  2FRC A;  2CXB A;  5AUR A;  2V07 A;  3WUI A;  5C0Z A;  2CA4 B;  2BPB B;  1CYI A;  1LS9 A;  1CCH A;  1CTZ A;  1CYJ A;  4WQ9 A;  1EZV D;  2Q3E A;  1NTZ D;  1CRY A;  2B0Z B;  5C9M A;  2QJY B;  4P4Q B;  1CSX A;  1M70 A;  1KX2 A;  2N9J A;  1M6Z A;  1AKK A;  1ETP A;  1QL3 A;  1KV9 A;  1C7M A;  4EDF A;  4YE1 A;  1IZL 0;  5EXQ A;  1C6S A;  1J3S A;  5DFS A;  1K3G A;  1ZZH A;  1IRV A;  3ORV A;  4FAV A;  2GC4 D;  1FI9 A;  1HJ4 A;  1DVH A;  4WQA A;  2KS1 A;  1I5T A;  3VMA A;  2K9J B;  2ZON G;  1CRJ A;  1LMS A;  2DGE A;  5KAI V;  3FWL A;  4PW9 B;  3CU4 A;  3MK7 B;  1BGY D;  2C1D A;  2N18 C;  2MTA C;  3O20 A;  4XYD B;  4AAN A;  4UB6 V;  1DT1 A;  2C9X B;  3A0H V;  1CHH A;  1CRG A;  3OCD A;  2C2C A;  3CYT I;  3A9F A;  1CSU A;  2LIR A;  2YK3 A;  4Y5R A;  1C6O A;  1CIH A;  2V08 A;  2JQR A;  1I55 A;  2MHM A;  5DJQ C;  1E8E A;  4WQ7 A;  1FI7 A;  1L9B C;  1E29 A;  1LFM A;  4Q5P A;  3O1Y A;  1F1C A;  2BH4 X;  1VYD A;  3WFE C;  2OZ1 A;  4AAL A;  5E79 V;  1N15 A;  3RN0 A;  1MZ4 A;  1IO3 A;  3TGU D;  2JWA A;  1HJ5 A;  5KLI B;  1SQQ D;  1YEB A;  1N9C A;  1KYO W;  2HV4 A;  3GW6 A;  3JBT B;  2I8F A;  3L70 D;  1H32 A;  1DW3 A;  1YIC A;  2A06 D;  3L71 D;  1C2R A;  1I8P A;  5CIE B;  1H1O A;  1PP9 D;  1GU2 A;  1YCC A;  5CIH B;  1DW2 A;  1EB7 A;  1KB0 A;  2BH5 X;  2DVH A;  1H9X A;  1H33 B;  1FI3 A;  3SJL A;  1COR A;  1KX7 A;  1KYO D;  5B5E V;  2GB8 B;  5CIB B;  3SLE A;  3L4O A;  2AI5 A;  3L74 D;  4AAM A;  4QAO A;  2B10 B;  3L73 D;  1GIW A;  1SQV D;  1FHB A;  1DW1 A;  5TIS V;  1C52 A;  4NFG B;  1CHJ A;  2PAC A;  1CTJ A;  1AOF A;  2N9I A;  4L3H A;  2D0W A;  2N3Y A;  3H1J D;  1AYG A;  4GYD A;  4FA5 A;  1QN2 A;  3M97 X;  5TJH A;  3BCC D;  5CIC B;  3WFD C;  2ZXY A;  1SQX D;  2QJK B;  2VHD A;  1RAQ A;  3O0R C;  1U74 B;  1HZV A;  1PPJ D;  3PRJ A;  3PHL A;  1BE3 D;  1CNO A;  2N18 B;  2D0S A;  4EIC A;  2C1D B;  2RN0 A;  1JDL A;  1OCD A;  4EIE A;  4H0K A;  1QL4 A;  3OCD B;  1I8O A;  5IY5 1;  4FA9 A;  1A8C A;  3VYM A;  1WVE C;  4EID A;  351C A;  1COT A;  1GDV A;  1L9J C;  2B4Z A;  1CSV A;  4XXL A;  4IL6 V;  3X39 A;  4GED B;  1CIG A;  1LC2 A;  1CSW A;  3H1K D;  1ZRT D;  2BGV X;  4L1Q A;  2YIU B;  4PJ0 V;  3SVW A;  3OA8 B;  3H1L D;  5CYT R;  1NTK D;  4KMG A;  1CXA A;  3ZOW A;  1HRO A;  1CXC A;  1KB9 D;  3WFB C;  4AX3 A;  2IBZ D;  1A56 A;  1C2N A;  2CE0 A;  5KKZ B;  3L4M A;  3NWV A;  3ZBM A;  1NMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...