2FYNB

Crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 61
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2fynB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2fynB02
1CHJA 1IRVA 2Q3EA 1GKSA 1L0LD 4FA9A 1LC1A 3H1ID 4UB8V 1I6DA 5KAFV 1KX7A 1M6ZA 1GQ1A 1I55A 3PLNA 3WFBC 1MZ4A 4FANA 1DW0A 1KB9D 4PWAA 3HQ6A 5KAIV 2BCNB 3SVWA 1P84D 5DF5A 5H2FV 1K3GA 2C1DB 4KMGA 1I5TA 3OA8A 4EIDA 1FOCA 5TISV 5CIEB 4A7PA 4DY9A 3PH2B 1NMIA 2QG4A 1W5CT 1FHBA 3CU4A 5DFSA 5C9MA 1CTJA 4JCGA 2DVHA 1B7VA 4EICA 1CRYA 2N9IA 2N9JA 2FRCA 1HCMA 1ZZHA 1GIWA 451CA 1CXCA 2RN0A 1CHHA 1CTYA 2MHMA 1QL4A 3PRJA 1N15A 1EB7A 5KKZB 1I54A 1OCDA 2AIUA 3ZIYA 2JQRA 1W2LA 1H1OA 1AKKA 2C1DA 4L1QA 1CCRA 1CIHA 1U75B 1N90A 3CXHW 1RZ6A 1E29A 1L0ND 4K3IA 3PHLA 3L4OA 5CIGB 2ZZS1 1BGYD 1YFCA 3H1KD 3NBSA 1S5LV 2YQBA 2D0SA 2CXBA 1H32B 1LC2A 2BH5X 2BCCD 4UB6V 1CIEA 1A8CA 3SLEA 3X39A 3WFCC 2PCBB 2PCCB 3NBTA 4D6TD 1LS9A 1CNOA 1A56A 2B12B 3C2CA 1KYOD 1CXAA 1PPJD 4WQAA 2QJPB 1M60A 3WFDC 3ORVA 1H33B 3TGUD 2N18C 1IQCA 1CYJA 1F1CA 4PD4D 3KZIV 1CIGA 1CRCA 3TF5A 1PP9D 1S6VB 1DIQC 3L4MA 2C8SA 2FYNB 2CA4B 3L70D 1HROA 1HJ3A 1CCHA 1ZRTD 5B66V 3ZOYA 3OCDB 3PXWA 4RJTA 2B10B 3CP5A 1FI7A 1H32A 2AI5A 1AOFA 1HZUA 2N3YA 4GEDB 2FWLA 1CTZA 1ETPA 3CWBD 2N18B 2PACA 5EXQA 2ORLA 351CA 3M97X 1CC5A 3ZBMA 3L74D 5DJQC 2JTIB 1A2SA 3HQ9A 4U3FD 1NU1D 1H33A 2LITA 3O5CA 5B5EV 1GDVA 2ZOOA 3O20A 1CEDA 3TDKA 3ITKA 4AALA 1YCCA 1VYDA 1DIIC 5IY51 1HZVA 4AAOA 4PW9B 1NMLA 4XXLA 1IZL0 2CE1A 2B0ZB 1BL9A 2KS1A 1DW2A 1I6EA 2Y0DA 1YNRA 1H9XA 4LJIA 2D0WA 1H31B 3OCDA 3ZOWA 1QL3A 1CSUA 1FCDC 2QJKB 3GG2A 1FI3A 1CSVA 1HH7A 4EIFA 2RMZA 2A06D 3DMIA 1FI9A 5GTHV 4WQ8A 5DJQB 3CXHD 3L72D 3H1HD 4J20A 4QAOA 3O0RC 2KNCB 4IL6V 1EZVD 2ZXYA 3L73D 4O1WA 4Q5PA 1DVVA 3WFEC 3HQ7A 4EIEA 2CA3B 3JBTB 1RAQA 1M70A 1CIFA 3A0HV 4WQBA 5B6QA 1YEBA 2YK3A 3RLMA 1J3SA 1C2NA 4WQEA 2N9YB 2V07A 2OZ1B 1IRWA 4WQDA 3NWVA 2BLFB 1SQVD 1SQPD 1C2RA 2BH4X 4H0JA 1AYGA 4MU8A 4FAVA 2L91A 2I8FA 3PXTA 3RN0A 1CRIA 2FYUD 1H31A 1MG3D 1L9BC 1SQBD 1YICA 2XTSB 1C52A 1CRJA 4O1QA 3WUIA 3RN1A 1SQQD 3L71D 1C7MA 3SXTA 1CRGA 5CIBB 3ZCFA 4Y5RA 1NTKD 2ZONG 4FA5A 2GC4D 3HQ8A 3GW6A 1K3HA 2ZBOA 3WU2V 2V08A 2B4ZA 4L3HA 4WQ9A 3VYMA 5CIHB 1AOQA 1HJ5A 5KLIB 4L3GA 5CICB 1C6OA 2OZ1A 3CX5D 2Y0EA 1QYZA 4NFGB 3MK7B 3FWLA 4AANA 3A0BV 1LFMA 3L75D 1LMSA 5KLVD 4V2KA 3TYIA 2BPBB 4AAMA 1FJ0A 2C1UA 1I8OA 1DVHA 3CX5W 1C75A 3CYTI 4EDFA 155CA 1COTA 3SWSA 2CE0A 3H1JD 2AXTV 2N3BA 1WVEC 5TJHA 4FA4A 2O3JA 1YEAA 1WEJF 4AX3A 2MTAC 5E79V 1E8EA 1CYIA 2YIUB 3H1LD 1GJQA 4N0KA 4RSZA 1C6SA 1C6RA 2C2CA 2VHDA 1KX2A 3KHUA 3BCCD 1I8PA 1NTMD 1E2RA 3ZOOA 2Y0CA 1QN2A 1F1FA 4FA1A 4WQCA 1IO3A 1SQXD 1YTCA 1KIBA 1N9CA 4FB1A 1NTZD 1L9JC 2LIRA 2DGEA 1CSXA 2BGVX 3A9FA 2QJYB 1DW3A 5CIDB 1BCCD 2JWAA 2GIWA 3O1YA 1N50A 3VRDA 2C1VA 4GYDA 5CIFB 3PXSA 1BE3D 1HRCA 1NNOA 4XYDB 2IBZD 1CO6A 2HV4A 3VMAA 5C0ZA 3VNWA 1GU2A 1U74B 3MK7C 4YE1A 2GC7D 1DT1A 4PJ0V 5CYTR 3PTZA 5GTIV 1RAPA 4H0KA 1JDLA 2YCCA 1CSWA 2C9XB 1NIRA 3ZOXA 1HJ4A 3DR0A 1OAEA 3RMZA 1R0QA 5AURA 1CRHA 1YIQA 3OA8B 1CORA 2B11B 1CYCA 2K9JB 1MG2D 2GB8B 1KV9A 1RZ5A 1CHIA 4P4QB 2EXVA 4WQ7A 1KB0A 1KYOW 3SJLA 1QKSA 3WC8A 3DP5A 1DW1A 2L4DA 1H9YA
chains in the Genus database with same CATH superfamily
2Q3EA 1BSHA 4D6TG 5B66H 3A5TA 1NH4A 4PV1B 1KQGB 1I6DA 1IFJA 1M6ZA 1I55A 3PLNA 1MZ4A 2J58A 4FANA 3JCUH 1KB9D 2B87A 2KSJA 1BGYJ 1FJPA 3SVWA 5H2FV 1EDKA 1MFTA 3RL0g 3VMZA 1I5TA 3R4YA 1FOCA 5TISV 3EFFK 2MKVA 2YXRB 3PH2B 2IPPA 2ZAEB 5AVWB 1YI2P 2CK3H 2FFDA 1M1JC 1NKZB 3OA7A 2QG4A 2E76B 1EDJA 5DFSA 1RH5B 1SFCB 4JCGA 2DVHA 3A3YB 4EICA 1NAFA 1PP9J 3V2RA 4WVZA 3CCVP 1GIWA 2GUVA 1KQFB 1NU1G 2RN0A 1M1KQ 3PRJA 1L0NE 1S5LE 3U1CA 3H1KE 2P7JA 3PJSK 2QM7A 3VOPA 2QIWA 1W2LA 3H1IJ 1PGJA 4L1QA 4YTPC 3CWBJ 2ZZS1 3NBSA 4D6TE 3L74J 4UB6V 3RK2D 2E75B 3SLEA 1X79B 1HTLC 2PCCB 3EFGA 3NBTA 3SWKA 1A56A 1R8EA 3H1HG 2B12B 1PPJD 3AEDC 4PV1D 1K05A 1H33B 3L73G 2OYIA 2OYHC 2G8YA 5CCHC 1LTGC 3KZIV 2JDIH 4PJ0H 3TNUB 3I5CA 5CCHD 1N7SB 1URQB 4CPGA 3I56P 1M1JA 3WU2H 1H32A 1KILA 1MZ9A 1LGHB 1HZUA 2N3YA 1SFCC 2HG5D 5B5EE 2FWLA 2E76D 2N18B 1NU1E 4GKGA 2ORLA 1JY2P 1SFCD 3A0BH 1RQVA 1NTKG 3HQ9A 1H8AA 3VMYA 3O20A 1H0TB 4D6TJ 3PP5A 1FS0E 5KAFH 3V4WA 1DIIC 3LW5H 2AXTH 1LTIC 4PW9B 1NMLA 1IFIA 4XXLA 2A45G 1NO4A 3L71J 5K5GB 2KS1A 1I6EA 1YNRA 1H9XA 4LJIA 3CCRP 3H1HE 2FYZA 1NHLA 4IL6E 3AE1C 1NKNA 1CSUA 2WVRA 1FI3A 1CSVA 1WRGA 3L73E 2JEEA 3V4QA 4J20A 2OYHA 1KTMA 2ZXYA 3H1JG 1DVVA 3E7KA 2CA3B 1M7LA 3WUVA 4KT0J 5AW3B 3T97A 4WQBA 5B6QA 1SQPE 1SQVE 1N7SC 1GL2B 3JSVC 1C2NA 1URQC 2WPQA 2N9YB 2WTYA 2V07A 1SLQA 4WQDA 1N7SD 2FYUE 4AYCA 1URQD 2BH4X 1NU1J 1AYGA 3LW5J 1PFIA 1JUNA 1PIXA 3L37A 3W68A 4Y28J 2I8FA 1OMIA 1NTKE 4Z1MH 2XTSB 4NPDA 1C52A 1EZVI 1SQQD 2JWDA 3H1LJ 3BATA 1G2CB 1YIJP 1JY3O 2M0BA 2ZBOA 3C1LA 2B4ZA 2B89A 4WQ9A 5CIHB 1AOQA 4DZOA 2PRRA 1LWUC 5KLIB 4L3GA 3L73J 1C6OA 3S1KA 3CX5D 4OH8B 1NTZJ 4AANA 1LMSA 1S9KE 2ZXEB 3O6QA 1JOCA 1Y47A 1FJ0A 5AW9B 1I8OA 3H1JE 1ZR2A 3CC2P 155CA 5TISE 2HFED 1A02J 2N3BA 1VQKP 1WVEC 3FWNA 3II6A 4JBZA 1YEAA 2MTAC 2WZ7A 3AEFC 1FZGA 4IOIH 1KB9H 2R44A 1OVRA 5H2FH 4RKUJ 3CI9A 1NJIQ 4N78E 1DH3A 5AVYB 1SQXE 1S1CX 3KHUA 1T2KC 2M8RA 3AE2C 1I8PA 1NTMD 1E2RA 4AUWA 1T2KD 1IO3A 1OWAA 1GDTA 1L9JC 2V7QJ 2LIRA 2WQYC 1OVUA 5KLVK 2WSEJ 4XFJA 1VQLP 2H7HA 1BCCD 2XZRA 3VN0A 1L0LK 3O1YA 1LT9A 3AE8C 4GYDA 2Z5IA 2J5UA 1LWUA 5GTIE 3PXSA 1GTWA 2IBZD 1CO6A 3AE9C 1S4XA 5AW2B 1MUUA 2KK7A 2HODA 3VNWA 1RE4A 3A0HH 1AV1A 4PJ0V 1QL2A 3GF7A 4TLFA 1HH0A 3AEGC 4UB6H 2YCCA 2B87B 3L35A 3M0AA 2WT7A 2LXBA 1NIRA 3ZOXA 3M9BA 4WY4C 1YIQA 3MP7B 1CORA 1UIXA 1CYCA 1MG2D 4WWIA 1CZQA 2VRSA 3G3ZA 1RZ5A 3U1AA 4P4QB 4WQ7A 2FFDB 1BGYG 3DP5A 2L4DA 1JY2N 2G3AA 1CHJA 1GKSA 3ZDMA 1JNMA 1L0LD 3Q3DA 1P84E 1YHQP 4H13B 5KAFV 1KX7A 1IK7A 1JY3P 1SS1A 3TGUG 2O1JA 2IZ1A 1DW0A 4JYBA 5KAIV 1M8OB 2ZYDA 1K3GA 1PP9G 3HE5A 2A45I 4KMGA 1QGKB 2KUBA 1FDIA 2D2CB 1W2BO 1KFNA 2K9JA 5BU8B 5AW4B 5CCGC 1Q90D 2ZJSE 1MKMA 2GM4A 1T3JA 1LTTC 2AEJA 1AQTA 1CTJA 4WB4A 3CWBG 5CHXA 1TU3F 4U7JA 2OYIB 3Q1MA 1QLED 3B4SA 3L74G 3AEAC 4WY4A 1OW6A 3CMAP 1LTJC 2W27A 1CXCA 3AE5C 1M57D 1CHHA 1CTYA 2MHMA 1EB7A 1I54A 1BGYE 1WT6A 2P1JA 2JQRA 1LTSC 2C1DA 1K04A 1MV8A 1G1IA 1M1JB 1RZ6A 3L4OA 2FFDC 3FX0A 4C7NA 2YQBA 1Y9BA 2OTLP 1H32B 1DEEG 1KILB 3L4FA 2BCCD 2R5BA 1CIEA 1E79H 4R4LA 2PFXA 3HRNA 3WFCC 2N1TC 2Z4EA 2A06G 1T3UA 3TGUE 4HYTB 3VP9A 1CNOA 3L72G 3EQ2A 3C2CA 2N1TD 1KYOD 4WQAA 1DX7A 1PP9E 2OTKE 1EZVG 3ORVA 2L5GB 1IFDA 2YNYA 2H43A 4GODA 4AQRD 1CYJA 5B66E 4I2LC 4NPFX 1VQMP 4PD4D 1Z56A 4GOFA 3D6ZA 1ZRTE 1VQ8P 3HUSC 2C0WA 3GHGA 2OQQA 1FJKA 5APYA 2W6JH 3VMXA 3L70D 1XTCC 1HROA 3ZOYA 3CC7P 5CCGA 3CWBE 4OWFA 3Q2YA 1KMIZ 1HVVA 5BU5A 2AI5A 4OVNF 3TSIA 3L74E 3W67A 1CTZA 3D0WA 1VL2A 2OYHB 2PACA 1VDFA 3L71G 2YXQB 2OYIC 1FOSF 3CX5H 1LTJA 5DJQC 1EC5A 3M06A 2WITA 1YQ3C 1PL5A 2KYVA 4U3FD 3H32A 3T97B 3O5CA 1HJ0A 2KSEA 3BASA 3G71P 1ZN5A 1YCCA 2WSSH 1VYDA 1SQBK 1HZVA 2CE1A 3TGUJ 1JO5A 2B0ZB 4N6JA 2A06E 1DW2A 2QE7H 2JO1A 1KILC 3L72E 2N1TA 3OCDA 2K88A 4Y99B 1USEA 5KLVG 3GG2A 1KILD 2Y9ZA 1EZVE 1P84I 1CI6A 5GTHV 2AEMA 3CXHD 3CPWO 2ZVOB 4QAOA 2KLVA 1J1EB 3WFEC 1QEXA 3FGAD 2QM8A 3TYYA 2QRXA 1LJ2A 3USSA 3HUSA 1CIFA 1PGQA 3A0HV 1YEBA 3H1LG 3G6EP 4WQEA 4EIJA 3M9HA 1L2PA 4QMAA 1IO4A 2BLFB 1R5SA 4PJ0E 3AEBC 4H0JA 1OXZA 4RO0A 1JMBA 4MU8A 1AVYA 1RHZB 2BASA 1DD3A 2L91A 3O6QB 3HE4A 3L71E 3PXTA 3LIDA 1CRIA 1NGMB 2WPVB 1H31A 1L9BC 2H8PD 1SQBD 5AW7B 4MN4C 3WU2E 4O1QA 1JTHA 4L75A 5CBNA 4I1LA 2C9NY 3SXTA 1NTZG 1FE6A 2B88A 2KNCA 1E5WA 1RE3C 2ITAA 1KC8Q 1ZLLA 3RK3C 2V08A 1LTBC 2C9LY 3L72J 3VYMA 3A0BE 2R3SA 3RK3D 2P58A 1HJ5A 5APWA 5CICB 5KLVE 2OZ1A 4DOJA 3VP8A 2Y0EA 1QYZA 1PZQA 4NFGB 3B5NC 5KAFE 3CCEP 3L75D 4Y99C 2AXTE 1D7MA 2BPBB 3B5ND 1BCCJ 1HF9A 4JQ0D 2Q7CA 2KZJA 1C75A 4BRYA 3IAOA 4TT3H 1J1EC 1X9VA 1LP1A 3H1LE 1VQ4P 1LT9B 3ABVC 3VTPC 1U57A 4AX3A 1LWUB 1SQQK 5KAIH 2H88C 3CCLP 1GJQA 3D70A 2YMKA 3Q5RA 1PGPA 2HODB 3MUDA 4RSZA 3L70G 4EOTA 1YTZT 1T8ZA 3BCCD 1NTZE 2WT7B 2CPBA 2Y0CA 1F1FA 1RF1C 4EI2A 3M91A 4FA1A 4WQCA 4ZKUA 1KIBA 4XA4A 2KIKA 1HGVA 1RE3A 1CSXA 3HD7A 2E5TA 2BGVX 2QJYB 1RY3A 5KLVJ 1GK6A 5CIDB 1WMKA 1FU1A 2AEFA 2JWAA 2IFNA 3H25A 1EQ7A 1KD1Q 2GIWA 1W2EA 2C1VA 1L0LJ 1BE3D 4ASVA 1K73Q 1HRCA 2HV4A 3B5NA 5C0ZA 1CW5A 2WPRA 1GU2A 2XV5A 1U74B 4YXWH 4YE1A 1J1DC 5AW8B 1DT1A 3F89A 1USDA 3V2QA 4H0KA 1JDLA 5DJUB 2E42A 1CSWA 2I8DA 1ZV8A 3KQGA 1Y8AA 1HJ4A 2NPSA 3DR0A 1OAEA 3HE5B 1R0QA 1S5LX 5AVQB 5AVUB 2B11B 1IFMA 1NTMK 1LT9C 2P2UA 2K9JB 2N9BA 2GB8B 1KYOH 4N3YB 5AVSB 3SWFA 3NXSA 1KYOW 3SJLA 2E43A 1QKSA 4PD4H 4BXLA 1RE4C 1H9YA 1Q86Q 2KP8A 3P8CD 3NTNA 2YKOA 4HKZH 2B9BA 1IRVA 2C0XA 1KB9E 1BDCA 5H2FE 1RF1A 2NRGA 1J2JB 3N4XA 5APVA 1AJYA 1PPJG 3H1ID 4UB8V 4WY4B 1GQ1A 3HTKA 1L0NK 3WFBC 4DT0A 2HR3A 1N86A 4C46A 3AEEC 1YQ4C 3HQ6A 3KYQA 2BCNB 1EDLA 2H89C 5AVXB 3FXEA 2QJYC 2C1DB 5C39A 2BCCJ 2M3BA 3OA8A 4EIDA 3V5BA 4KHXA 4C7NB 5KKZC 5CIEB 4W7YA 4A7PA 2YO3A 5KJ7A 2R32A 1JMMA 1NMIA 3TK1A 4ZMDA 1VPCA 3CU4A 3RBXA 5E79H 5C9MA 4LLHA 2LR2A 1DEBA 1CRYA 1OX3A 4C7RA 2N9IA 2N9JA 1L4AA 1VQPP 2FRCA 1HCMA 1ZZHA 3CCJP 3A0HE 3L70J 4R4MA 5GTHH 2QJPC 1QL4A 1N15A 2HLOA 4JYCA 3GHGB 4L74A 2AIUA 1W5CE 3CXHH 4UB6E 1YJ9P 3U59A 1H1OA 1AKKA 2IYOA 1CIHA 1U75B 3CXHW 1E29A 1L0ND 4K3IA 1FOSE 2XKMA 2K1AA 1YFCA 3H1KD 3IR9A 1S5LV 2IFMA 1LC2A 3SFEC 4IL6X 1GD2E 1K8AQ 2HPCA 1PPJE 1A8CA 2PCBB 4L73A 4U3FJ 2YKQA 3KZIE 2P10A 4D6TD 1U7MA 1QVGO 1OFCX 1LTJB 1CXAA 2M5AA 1IC2A 3WFDC 3H32B 1IQCA 2ZYAA 4WY4D 3TF5A 1S6VB 4IFFA 2WSFH 2WSCH 1FZCA 3L4MA 1KN7A 2C8SA 2FYNB 2CA4B 1CCHA 1OW7A 2N1TB 3OCDB 2B10B 3CP5A 2ZFCA 5AVRB 1A02F 1FI7A 1CI6B 1KYOI 4DCKA 4GEDB 1ETPA 1DIPA 1SQQG 1N73A 3AE6C 351CA 3M97X 3P7KA 1ZXGA 1ZW0A 3V6IA 4ASWA 2UWJE 2JTIB 1A2SA 1SQVK 1SQPK 3HUSB 2OGUA 1NU1D 2LITA 5B5EV 1CSBA 1IFPA 1CEDA 3NMDA 3GHGC 1VQ9P 3ITKA 1LNQA 4AALA 1HWTC 2FYUK 1T6AA 5IY51 2WMMA 1SQBJ 3IN6A 4LGDE 1NAYA 2WSCJ 4H0LB 3HE4B 5AW6B 2D0WA 5CCGD 1NTKK 1H31B 1AQ5A 1KB9I 1FCDC 2QJKB 1JTHB 2IZ0A 1FI9A 4WQ8A 5DJQB 3H1HD 1S3JA 5KTBA 2KNCB 2I1KA 4IL6V 3L73D 4O1WA 2KB7P 1N8RQ 3JBTB 1AVOA 1RAQA 4B86A 2E74B 3L75J 3RLMA 2Q1KA 4RESB 3CC4P 5AW0B 2FYNC 2OZ1B 3RL0B 1VF5C 4I7ZC 1HBWA 3Q5SA 1SQVD 1SQPD 1C2RA 4OGQB 1IK9A 1YJNP 3KXDA 1SQQE 3QWOC 3IF4A 3R2PA 1NTMG 2FYUD 1Q7YQ 1YICA 1HJBA 1CRJA 2W83C 3WUIA 4BRYB 1K9MQ 1EXJA 2QA4P 1LP1B 2HYNA 1CRGA 5APQA 1GU4A 1H88A 1Q81Q 3ZCFA 1ZMEC 1NTKD 2ZONG 2GC4D 3HQ8A 5EFWB 1BCCG 3JCUE 3H6PA 2KS1B 1JY2O 3CX5E 3BCCJ 2OARA 4W7ZA 3P8MC 2IBZG 1SQXK 2QVAA 2YIUC 1L0NG 4H0LC 2PGDA 2LXCB 3FWLA 1LFMA 4H0LD 1HGZA 2QJKC 2O1KA 2C1UA 3EWKA 3AE7C 3CX5W 1VQOP 3CYTI 3HD7B 3WMM0 3RK3B 1S9KD 1BE3J 3LIEA 1COTA 3QH9A 3H1JD 4UB8H 5CMZA 3MZWB 2Z5HA 5TJHA 1BDDA 1H89A 2O3JA 1WEJF 5E79V 2E74C 1SQQJ 2E74D 3B5NB 3RL0C 4WBAA 2QEXP 1NTME 5APTA 1C6RA 4OGQC 3RL0D 2I1JA 2KOGA 2VHDA 1Q2NA 2JP3A 1L0LG 1PGOA 2XDJA 5AW1B 4N78D 4OGQD 2ZVNB 1QN2A 1N2DC 2NPSB 1SQXD 1AFOA 2O01N 3G4SP 1N9CA 1BCCE 2KZIA 1DD4A 3OJAB 1MFZA 4M3LA 3CLQA 1OW8A 1X0TA 1SVFA 2POHA 4YXDC 2IBZE 2V4HA 4I6MC 5CIFB 3C8VA 3MUDC 1JM0A 1PV3A 4XYDB 3WUUA 4IFMA 3WUTA 4NPEA 3RK2C 1RF1B 2XNDH 3PH0A 2IDBA 5CYTR 4BWNA 1S5LH 5GTIV 3HTKB 1RAPA 2JR8A 2Q6QA 3M0DC 4PV1C 4L76A 1YYCA 2YO2A 5BVZA 1FZFA 3HD7C 1R5LA 4ZKPA 1CRHA 2GA1A 3OA8B 2CPSA 3BVHA 1JEKA 3HD7D 2KI7B 1NTMJ 1VQ6P 1FAVA 1JY3N 5AW5B 3WC8A 1S72P 1NWQA 3E1RA 1L0LE 1J1DB 5AVTB 2O01H 2BCCG 3A2AA 2WWWA 2KLUA 1FC2C 1SQPG 1SQVG 5KAIE 2W8ZA 1L4AB 1QX8A 2Y9YA 2E76C 4FA9A 1LC1A 1ZR4A 2FYUG 2NPSC 2W90A 2OYOA 5APSA 1L0NJ 3L36A 4PWAA 4KJMA 3H1KJ 3UIAA 2NPSD 1P84D 5DF5A 2KXPB 3M9QA 3CX5I 2FXMA 1EXIA 4DY9A 5B5EH 4K3AA 2HPCB 2NZ2A 1QVFO 2Q9IA 5L8RJ 1W5CT 1FHBA 2O01J 1B7VA 2M5AB 3AECC 5DJTB 2E75C 5CBOA 1KORA 3M0DA 3MD0A 3FXDA 2RH0A 2FBWC 2E75D 3B71A 2FY8A 2Q5UA 451CA 4H44B 4HH2A 4U3FG 5CJ0A 5M1BA 2XU6A 3C9IA 5KKZB 2M3EA 5CCHA 1OCDA 1FZCB 2JJLA 4K35A 3ZIYA 3BRTB 4IL6H 2K37A 5KJ7C 1CCRA 2BCCE 1N90A 3PHLA 5CIGB 3SFDC 1BGYD 2PP6A 5KJ7D 2D0SA 2CXBA 1XTGB 2BH5X 3MTUE 1OVVA 1X22A 1KYOE 3X39A 1L4AC 1N73B 1LS9A 1IJDB 4ZNCA 4PD4E 1JB0J 1SFCA 2DW3A 1L4AD 2QJPB 4GIFA 1M60A 2PAJA 3TGUD 2N18C 1SQXG 1F1CA 3NFQA 1CIGA 1IFNA 1CRCA 1VQNP 1FBMA 2WPSA 2IBZI 3L70E 1PP9D 1DIQC 1NOHA 3O8ZA 3VYIA 3KPEA 4GT1A 1YJWP 3CCUP 1ZRTD 1HJ3A 5B66V 3CL3D 3H1HJ 3CMEP 3V2NA 3PXWA 2QSIA 4RJTA 2SPZA 1AOFA 5AVZB 1SQBG 2IYPA 3CWBD 4U3FE 2A45H 5EXQA 1NVOA 1IZNB 1CC5A 3ZBMA 3L74D 2V7QH 1M90Q 5APXA 2R5DA 5E79E 4H44C 2WSEH 3RBZA 1H33A 1SQPJ 1SQVJ 3N7NA 3K5BA 1GDVA 2ZOOA 4H44D 3TDKA 2YMYA 1FZCC 3OW2O 3TNUA 2FYUJ 4AAOA 1N7SA 1QL1A 4HB1A 1U7JA 1IZL0 1URQA 5GTHE 3GLMA 1GL2C 1KILE 1BL9A 2Y0DA 3CXHE 2Q3IA 3L75G 1GL2D 1NTKJ 2P67A 2ZT9B 4W80A 3ZOWA 5TISH 1QL3A 1HH7A 4EIFA 2RMZA 2A06D 1N73C 3DMIA 3L72D 1VQ5P 3O0RC 1N7LA 1EZVD 4Q5PA 2LKMA 3GMAA 3HQ7A 4EIEA 1FDMA 2MJZA 1M70A 3IFMA 3B8EB 2YK3A 1JCDA 1J3SA 1H0TA 3V2PA 1RF0C 1IRWA 3NWVA 1NU1K 2JKVA 1SQBE 4HJGH 3E1IA 3D71A 4FAVA 5KLIC 2FXPA 3CCMP 3RN0A 3BCCG 3H1JJ 5AVVB 1MG3D 1GK4A 3G9RA 1S2EA 1YITP 3RN1A 3L71D 1C7MA 1G1JA 4GOEA 5CIBB 1AA0A 1LTAC 4Y5RA 5GTIH 4JPZB 2R3CA 4FA5A 2OTJP 3RK3E 3GW6A 1K3HA 1VQ7P 1GW4A 3WU2V 1VF5B 4I7ZB 4L3HA 2K3RA 1UIIA 1BE3G 1EDIA 3SSUA 1GL2A 3L75E 1SQXJ 3KZIH 2YKPA 1NTZK 3MK7B 3A0BV 2ZT9C 5KLVD 1SP4A 4V2KA 3TYIA 4PD4I 4AAMA 2ZT9D 3GF3A 2E5YA 3SWYA 1DVHA 4O9BA 2XNXA 2J59M 4EDFA 3SWSA 2CE0A 1YBKA 3MGNA 1G2CA 2AXTV 2RKLA 1FZAA 4FA4A 3S4RA 2AXCA 2GUSA 2BEQD 5APUA 1E8EA 1CYIA 2YIUB 3F5HA 1NYHA 2WSFJ 1RF0A 1KFMA 3H1LD 3CCSP 2BEZF 4DJGA 1JCCA 4LC1A 3BCCE 1P84H 4N0KA 4JF7A 1C6SA 1BSNA 2C2CA 3RGUA 1KX2A 4YPCA 2FKWB 3CCQP 3ZOOA 3H1IG 1M56D 3KDPB 3BRVB 1YTCA 4FB1A 3AE4C 3CD6P 2K9YA 1NTZD 4EYYQ 1KQSO 1ZP0C 2DGEA 3A9FA 2ZXXA 1FZBA 4IFDK 1DW3A 1BE3E 1FDOA 4XE5B 1HUCA 1N50A 3VRDA 1GU5A 1FZEA 3Q5PA 2FXOA 3P32A 1VF5D 1X8YA 1LT1A 1KQLA 1NNOA 1GW3A 3CXHI 3VMAA 1GZLA 3MK7C 5CJ4A 3I55P 2IX7C 2GC7D 3PTZA 2W6BA 1KV4A 2C9XB 1OIPA 3S9OA 1GMJA 1OZHA 1RQUA 3RMZA 4H13C 5AURA 3A7OA 3OAKA 4GDOA 3MIWA 1Q82Q 3D6YA 1ZOYC 4H13D 1KV9A 1CHIA 1YTZI 3P8CE 2EXVA 3MHVA 1KZUB 1KB0A 3H1KG 3RK2B 2D2CC 2ZYGA 4UB8E 3JC22 1DW1A 3AE3C 2W6AA 3H1IE 2D2CD
chains in the Genus database with same CATH topology
1CHJA 1IRVA 2Q3EA 1GKSA 1L0LD 4FA9A 1LC1A 3H1ID 4UB8V 1I6DA 5KAFV 1KX7A 1M6ZA 1GQ1A 1I55A 3PLNA 3WFBC 1MZ4A 4FANA 1DW0A 1KB9D 4PWAA 3HQ6A 5KAIV 2BCNB 3SVWA 1P84D 5DF5A 5H2FV 1K3GA 2C1DB 4KMGA 1I5TA 3OA8A 4EIDA 1FOCA 5TISV 5CIEB 4A7PA 4DY9A 3PH2B 1NMIA 2QG4A 1W5CT 1FHBA 3CU4A 5DFSA 5C9MA 1CTJA 4JCGA 2DVHA 1B7VA 4EICA 1CRYA 2N9IA 2N9JA 2FRCA 1HCMA 1ZZHA 1GIWA 451CA 1CXCA 2RN0A 1CHHA 1CTYA 2MHMA 1QL4A 3PRJA 1N15A 1EB7A 5KKZB 1I54A 1OCDA 2AIUA 3ZIYA 2JQRA 1W2LA 1H1OA 1AKKA 2C1DA 4L1QA 1CCRA 1CIHA 1U75B 1N90A 3CXHW 1RZ6A 1E29A 1L0ND 4K3IA 3PHLA 3L4OA 5CIGB 2ZZS1 1BGYD 1YFCA 3H1KD 3NBSA 1S5LV 2YQBA 2D0SA 2CXBA 1H32B 1LC2A 2BH5X 2BCCD 4UB6V 1CIEA 1A8CA 3SLEA 3X39A 3WFCC 2PCBB 2PCCB 3NBTA 4D6TD 1LS9A 1CNOA 1A56A 2B12B 3C2CA 1KYOD 1CXAA 1PPJD 4WQAA 2QJPB 1M60A 3WFDC 3ORVA 1H33B 3TGUD 2N18C 1IQCA 1CYJA 1F1CA 4PD4D 3KZIV 1CIGA 1CRCA 3TF5A 1PP9D 1S6VB 1DIQC 3L4MA 2C8SA 2FYNB 2CA4B 3L70D 1HROA 1HJ3A 1CCHA 1ZRTD 5B66V 3ZOYA 3OCDB 3PXWA 4RJTA 2B10B 3CP5A 1FI7A 1H32A 2AI5A 1AOFA 1HZUA 2N3YA 4GEDB 2FWLA 1CTZA 1ETPA 3CWBD 2N18B 2PACA 5EXQA 2ORLA 351CA 3M97X 1CC5A 3ZBMA 3L74D 5DJQC 2JTIB 1A2SA 3HQ9A 4U3FD 1NU1D 1H33A 2LITA 3O5CA 5B5EV 1GDVA 2ZOOA 3O20A 1CEDA 3TDKA 3ITKA 4AALA 1YCCA 1VYDA 1DIIC 5IY51 1HZVA 4AAOA 4PW9B 1NMLA 4XXLA 1IZL0 2CE1A 2B0ZB 1BL9A 2KS1A 1DW2A 1I6EA 2Y0DA 1YNRA 1H9XA 4LJIA 2D0WA 1H31B 3OCDA 3ZOWA 1QL3A 1CSUA 1FCDC 2QJKB 3GG2A 1FI3A 1CSVA 1HH7A 4EIFA 2RMZA 2A06D 3DMIA 1FI9A 5GTHV 4WQ8A 5DJQB 3CXHD 3L72D 3H1HD 4J20A 4QAOA 3O0RC 2KNCB 4IL6V 1EZVD 2ZXYA 3L73D 4O1WA 4Q5PA 1DVVA 3WFEC 3HQ7A 4EIEA 2CA3B 3JBTB 1RAQA 1M70A 1CIFA 3A0HV 4WQBA 5B6QA 1YEBA 2YK3A 3RLMA 1J3SA 1C2NA 4WQEA 2N9YB 2V07A 2OZ1B 1IRWA 4WQDA 3NWVA 2BLFB 1SQVD 1SQPD 1C2RA 2BH4X 4H0JA 1AYGA 4MU8A 4FAVA 2L91A 2I8FA 3PXTA 3RN0A 1CRIA 2FYUD 1H31A 1MG3D 1L9BC 1SQBD 1YICA 2XTSB 1C52A 1CRJA 4O1QA 3WUIA 3RN1A 1SQQD 3L71D 1C7MA 3SXTA 1CRGA 5CIBB 3ZCFA 4Y5RA 1NTKD 2ZONG 4FA5A 2GC4D 3HQ8A 3GW6A 1K3HA 2ZBOA 3WU2V 2V08A 2B4ZA 4L3HA 4WQ9A 3VYMA 5CIHB 1AOQA 1HJ5A 5KLIB 4L3GA 5CICB 1C6OA 2OZ1A 3CX5D 2Y0EA 1QYZA 4NFGB 3MK7B 3FWLA 4AANA 3A0BV 1LFMA 3L75D 1LMSA 5KLVD 4V2KA 3TYIA 2BPBB 4AAMA 1FJ0A 2C1UA 1I8OA 1DVHA 3CX5W 1C75A 3CYTI 4EDFA 155CA 1COTA 3SWSA 2CE0A 3H1JD 2AXTV 2N3BA 1WVEC 5TJHA 4FA4A 2O3JA 1YEAA 1WEJF 4AX3A 2MTAC 5E79V 1E8EA 1CYIA 2YIUB 3H1LD 1GJQA 4N0KA 4RSZA 1C6SA 1C6RA 2C2CA 2VHDA 1KX2A 3KHUA 3BCCD 1I8PA 1NTMD 1E2RA 3ZOOA 2Y0CA 1QN2A 1F1FA 4FA1A 4WQCA 1IO3A 1SQXD 1YTCA 1KIBA 1N9CA 4FB1A 1NTZD 1L9JC 2LIRA 2DGEA 1CSXA 2BGVX 3A9FA 2QJYB 1DW3A 5CIDB 1BCCD 2JWAA 2GIWA 3O1YA 1N50A 3VRDA 2C1VA 4GYDA 5CIFB 3PXSA 1BE3D 1HRCA 1NNOA 4XYDB 2IBZD 1CO6A 2HV4A 3VMAA 5C0ZA 3VNWA 1GU2A 1U74B 3MK7C 4YE1A 2GC7D 1DT1A 4PJ0V 5CYTR 3PTZA 5GTIV 1RAPA 4H0KA 1JDLA 2YCCA 1CSWA 2C9XB 1NIRA 3ZOXA 1HJ4A 3DR0A 1OAEA 3RMZA 1R0QA 5AURA 1CRHA 1YIQA 3OA8B 1CORA 2B11B 1CYCA 2K9JB 1MG2D 2GB8B 1KV9A 1RZ5A 1CHIA 4P4QB 2EXVA 4WQ7A 1KB0A 1KYOW 3SJLA 1QKSA 3WC8A 3DP5A 1DW1A 2L4DA 1H9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHJ A;  1IRV A;  2Q3E A;  1GKS A;  1L0L D;  4FA9 A;  1LC1 A;  3H1I D;  4UB8 V;  1I6D A;  5KAF V;  1KX7 A;  1M6Z A;  1GQ1 A;  1I55 A;  3PLN A;  3WFB C;  1MZ4 A;  4FAN A;  1DW0 A;  1KB9 D;  4PWA A;  3HQ6 A;  5KAI V;  2BCN B;  3SVW A;  1P84 D;  5DF5 A;  5H2F V;  1K3G A;  2C1D B;  4KMG A;  1I5T A;  3OA8 A;  4EID A;  1FOC A;  5TIS V;  5CIE B;  4A7P A;  4DY9 A;  3PH2 B;  1NMI A;  2QG4 A;  1W5C T;  1FHB A;  3CU4 A;  5DFS A;  5C9M A;  1CTJ A;  4JCG A;  2DVH A;  1B7V A;  4EIC A;  1CRY A;  2N9I A;  2N9J A;  2FRC A;  1HCM A;  1ZZH A;  1GIW A;  451C A;  1CXC A;  2RN0 A;  1CHH A;  1CTY A;  2MHM A;  1QL4 A;  3PRJ A;  1N15 A;  1EB7 A;  5KKZ B;  1I54 A;  1OCD A;  2AIU A;  3ZIY A;  2JQR A;  1W2L A;  1H1O A;  1AKK A;  2C1D A;  4L1Q A;  1CCR A;  1CIH A;  1U75 B;  1N90 A;  3CXH W;  1RZ6 A;  1E29 A;  1L0N D;  4K3I A;  3PHL A;  3L4O A;  5CIG B;  2ZZS 1;  1BGY D;  1YFC A;  3H1K D;  3NBS A;  1S5L V;  2YQB A;  2D0S A;  2CXB A;  1H32 B;  1LC2 A;  2BH5 X;  2BCC D;  4UB6 V;  1CIE A;  1A8C A;  3SLE A;  3X39 A;  3WFC C;  2PCB B;  2PCC B;  3NBT A;  4D6T D;  1LS9 A;  1CNO A;  1A56 A;  2B12 B;  3C2C A;  1KYO D;  1CXA A;  1PPJ D;  4WQA A;  2QJP B;  1M60 A;  3WFD C;  3ORV A;  1H33 B;  3TGU D;  2N18 C;  1IQC A;  1CYJ A;  1F1C A;  4PD4 D;  3KZI V;  1CIG A;  1CRC A;  3TF5 A;  1PP9 D;  1S6V B;  1DIQ C;  3L4M A;  2C8S A;  2FYN B;  2CA4 B;  3L70 D;  1HRO A;  1HJ3 A;  1CCH A;  1ZRT D;  5B66 V;  3ZOY A;  3OCD B;  3PXW A;  4RJT A;  2B10 B;  3CP5 A;  1FI7 A;  1H32 A;  2AI5 A;  1AOF A;  1HZU A;  2N3Y A;  4GED B;  2FWL A;  1CTZ A;  1ETP A;  3CWB D;  2N18 B;  2PAC A;  5EXQ A;  2ORL A;  351C A;  3M97 X;  1CC5 A;  3ZBM A;  3L74 D;  5DJQ C;  2JTI B;  1A2S A;  3HQ9 A;  4U3F D;  1NU1 D;  1H33 A;  2LIT A;  3O5C A;  5B5E V;  1GDV A;  2ZOO A;  3O20 A;  1CED A;  3TDK A;  3ITK A;  4AAL A;  1YCC A;  1VYD A;  1DII C;  5IY5 1;  1HZV A;  4AAO A;  4PW9 B;  1NML A;  4XXL A;  1IZL 0;  2CE1 A;  2B0Z B;  1BL9 A;  2KS1 A;  1DW2 A;  1I6E A;  2Y0D A;  1YNR A;  1H9X A;  4LJI A;  2D0W A;  1H31 B;  3OCD A;  3ZOW A;  1QL3 A;  1CSU A;  1FCD C;  2QJK B;  3GG2 A;  1FI3 A;  1CSV A;  1HH7 A;  4EIF A;  2RMZ A;  2A06 D;  3DMI A;  1FI9 A;  5GTH V;  4WQ8 A;  5DJQ B;  3CXH D;  3L72 D;  3H1H D;  4J20 A;  4QAO A;  3O0R C;  2KNC B;  4IL6 V;  1EZV D;  2ZXY A;  3L73 D;  4O1W A;  4Q5P A;  1DVV A;  3WFE C;  3HQ7 A;  4EIE A;  2CA3 B;  3JBT B;  1RAQ A;  1M70 A;  1CIF A;  3A0H V;  4WQB A;  5B6Q A;  1YEB A;  2YK3 A;  3RLM A;  1J3S A;  1C2N A;  4WQE A;  2N9Y B;  2V07 A;  2OZ1 B;  1IRW A;  4WQD A;  3NWV A;  2BLF B;  1SQV D;  1SQP D;  1C2R A;  2BH4 X;  4H0J A;  1AYG A;  4MU8 A;  4FAV A;  2L91 A;  2I8F A;  3PXT A;  3RN0 A;  1CRI A;  2FYU D;  1H31 A;  1MG3 D;  1L9B C;  1SQB D;  1YIC A;  2XTS B;  1C52 A;  1CRJ A;  4O1Q A;  3WUI A;  3RN1 A;  1SQQ D;  3L71 D;  1C7M A;  3SXT A;  1CRG A;  5CIB B;  3ZCF A;  4Y5R A;  1NTK D;  2ZON G;  4FA5 A;  2GC4 D;  3HQ8 A;  3GW6 A;  1K3H A;  2ZBO A;  3WU2 V;  2V08 A;  2B4Z A;  4L3H A;  4WQ9 A;  3VYM A;  5CIH B;  1AOQ A;  1HJ5 A;  5KLI B;  4L3G A;  5CIC B;  1C6O A;  2OZ1 A;  3CX5 D;  2Y0E A;  1QYZ A;  4NFG B;  3MK7 B;  3FWL A;  4AAN A;  3A0B V;  1LFM A;  3L75 D;  1LMS A;  5KLV D;  4V2K A;  3TYI A;  2BPB B;  4AAM A;  1FJ0 A;  2C1U A;  1I8O A;  1DVH A;  3CX5 W;  1C75 A;  3CYT I;  4EDF A;  155C A;  1COT A;  3SWS A;  2CE0 A;  3H1J D;  2AXT V;  2N3B A;  1WVE C;  5TJH A;  4FA4 A;  2O3J A;  1YEA A;  1WEJ F;  4AX3 A;  2MTA C;  5E79 V;  1E8E A;  1CYI A;  2YIU B;  3H1L D;  1GJQ A;  4N0K A;  4RSZ A;  1C6S A;  1C6R A;  2C2C A;  2VHD A;  1KX2 A;  3KHU A;  3BCC D;  1I8P A;  1NTM D;  1E2R A;  3ZOO A;  2Y0C A;  1QN2 A;  1F1F A;  4FA1 A;  4WQC A;  1IO3 A;  1SQX D;  1YTC A;  1KIB A;  1N9C A;  4FB1 A;  1NTZ D;  1L9J C;  2LIR A;  2DGE A;  1CSX A;  2BGV X;  3A9F A;  2QJY B;  1DW3 A;  5CID B;  1BCC D;  2JWA A;  2GIW A;  3O1Y A;  1N50 A;  3VRD A;  2C1V A;  4GYD A;  5CIF B;  3PXS A;  1BE3 D;  1HRC A;  1NNO A;  4XYD B;  2IBZ D;  1CO6 A;  2HV4 A;  3VMA A;  5C0Z A;  3VNW A;  1GU2 A;  1U74 B;  3MK7 C;  4YE1 A;  2GC7 D;  1DT1 A;  4PJ0 V;  5CYT R;  3PTZ A;  5GTI V;  1RAP A;  4H0K A;  1JDL A;  2YCC A;  1CSW A;  2C9X B;  1NIR A;  3ZOX A;  1HJ4 A;  3DR0 A;  1OAE A;  3RMZ A;  1R0Q A;  5AUR A;  1CRH A;  1YIQ A;  3OA8 B;  1COR A;  2B11 B;  1CYC A;  2K9J B;  1MG2 D;  2GB8 B;  1KV9 A;  1RZ5 A;  1CHI A;  4P4Q B;  2EXV A;  4WQ7 A;  1KB0 A;  1KYO W;  3SJL A;  1QKS A;  3WC8 A;  3DP5 A;  1DW1 A;  2L4D A;  1H9Y A; 
#chains in the Genus database with same CATH topology
 2Q3E A;  1BSH A;  4D6T G;  5B66 H;  3A5T A;  1NH4 A;  4PV1 B;  1KQG B;  1I6D A;  1IFJ A;  1M6Z A;  1I55 A;  3PLN A;  1MZ4 A;  2J58 A;  4FAN A;  3JCU H;  1KB9 D;  2B87 A;  2KSJ A;  1BGY J;  1FJP A;  3SVW A;  5H2F V;  1EDK A;  1MFT A;  3RL0 g;  3VMZ A;  1I5T A;  3R4Y A;  1FOC A;  5TIS V;  3EFF K;  2MKV A;  2YXR B;  3PH2 B;  2IPP A;  2ZAE B;  5AVW B;  1YI2 P;  2CK3 H;  2FFD A;  1M1J C;  1NKZ B;  3OA7 A;  2QG4 A;  2E76 B;  1EDJ A;  5DFS A;  1RH5 B;  1SFC B;  4JCG A;  2DVH A;  3A3Y B;  4EIC A;  1NAF A;  1PP9 J;  3V2R A;  4WVZ A;  3CCV P;  1GIW A;  2GUV A;  1KQF B;  1NU1 G;  2RN0 A;  1M1K Q;  3PRJ A;  1L0N E;  1S5L E;  3U1C A;  3H1K E;  2P7J A;  3PJS K;  2QM7 A;  3VOP A;  2QIW A;  1W2L A;  3H1I J;  1PGJ A;  4L1Q A;  4YTP C;  3CWB J;  2ZZS 1;  3NBS A;  4D6T E;  3L74 J;  4UB6 V;  3RK2 D;  2E75 B;  3SLE A;  1X79 B;  1HTL C;  2PCC B;  3EFG A;  3NBT A;  3SWK A;  1A56 A;  1R8E A;  3H1H G;  2B12 B;  1PPJ D;  3AED C;  4PV1 D;  1K05 A;  1H33 B;  3L73 G;  2OYI A;  2OYH C;  2G8Y A;  5CCH C;  1LTG C;  3KZI V;  2JDI H;  4PJ0 H;  3TNU B;  3I5C A;  5CCH D;  1N7S B;  1URQ B;  4CPG A;  3I56 P;  1M1J A;  3WU2 H;  1H32 A;  1KIL A;  1MZ9 A;  1LGH B;  1HZU A;  2N3Y A;  1SFC C;  2HG5 D;  5B5E E;  2FWL A;  2E76 D;  2N18 B;  1NU1 E;  4GKG A;  2ORL A;  1JY2 P;  1SFC D;  3A0B H;  1RQV A;  1NTK G;  3HQ9 A;  1H8A A;  3VMY A;  3O20 A;  1H0T B;  4D6T J;  3PP5 A;  1FS0 E;  5KAF H;  3V4W A;  1DII C;  3LW5 H;  2AXT H;  1LTI C;  4PW9 B;  1NML A;  1IFI A;  4XXL A;  2A45 G;  1NO4 A;  3L71 J;  5K5G B;  2KS1 A;  1I6E A;  1YNR A;  1H9X A;  4LJI A;  3CCR P;  3H1H E;  2FYZ A;  1NHL A;  4IL6 E;  3AE1 C;  1NKN A;  1CSU A;  2WVR A;  1FI3 A;  1CSV A;  1WRG A;  3L73 E;  2JEE A;  3V4Q A;  4J20 A;  2OYH A;  1KTM A;  2ZXY A;  3H1J G;  1DVV A;  3E7K A;  2CA3 B;  1M7L A;  3WUV A;  4KT0 J;  5AW3 B;  3T97 A;  4WQB A;  5B6Q A;  1SQP E;  1SQV E;  1N7S C;  1GL2 B;  3JSV C;  1C2N A;  1URQ C;  2WPQ A;  2N9Y B;  2WTY A;  2V07 A;  1SLQ A;  4WQD A;  1N7S D;  2FYU E;  4AYC A;  1URQ D;  2BH4 X;  1NU1 J;  1AYG A;  3LW5 J;  1PFI A;  1JUN A;  1PIX A;  3L37 A;  3W68 A;  4Y28 J;  2I8F A;  1OMI A;  1NTK E;  4Z1M H;  2XTS B;  4NPD A;  1C52 A;  1EZV I;  1SQQ D;  2JWD A;  3H1L J;  3BAT A;  1G2C B;  1YIJ P;  1JY3 O;  2M0B A;  2ZBO A;  3C1L A;  2B4Z A;  2B89 A;  4WQ9 A;  5CIH B;  1AOQ A;  4DZO A;  2PRR A;  1LWU C;  5KLI B;  4L3G A;  3L73 J;  1C6O A;  3S1K A;  3CX5 D;  4OH8 B;  1NTZ J;  4AAN A;  1LMS A;  1S9K E;  2ZXE B;  3O6Q A;  1JOC A;  1Y47 A;  1FJ0 A;  5AW9 B;  1I8O A;  3H1J E;  1ZR2 A;  3CC2 P;  155C A;  5TIS E;  2HFE D;  1A02 J;  2N3B A;  1VQK P;  1WVE C;  3FWN A;  3II6 A;  4JBZ A;  1YEA A;  2MTA C;  2WZ7 A;  3AEF C;  1FZG A;  4IOI H;  1KB9 H;  2R44 A;  1OVR A;  5H2F H;  4RKU J;  3CI9 A;  1NJI Q;  4N78 E;  1DH3 A;  5AVY B;  1SQX E;  1S1C X;  3KHU A;  1T2K C;  2M8R A;  3AE2 C;  1I8P A;  1NTM D;  1E2R A;  4AUW A;  1T2K D;  1IO3 A;  1OWA A;  1GDT A;  1L9J C;  2V7Q J;  2LIR A;  2WQY C;  1OVU A;  5KLV K;  2WSE J;  4XFJ A;  1VQL P;  2H7H A;  1BCC D;  2XZR A;  3VN0 A;  1L0L K;  3O1Y A;  1LT9 A;  3AE8 C;  4GYD A;  2Z5I A;  2J5U A;  1LWU A;  5GTI E;  3PXS A;  1GTW A;  2IBZ D;  1CO6 A;  3AE9 C;  1S4X A;  5AW2 B;  1MUU A;  2KK7 A;  2HOD A;  3VNW A;  1RE4 A;  3A0H H;  1AV1 A;  4PJ0 V;  1QL2 A;  3GF7 A;  4TLF A;  1HH0 A;  3AEG C;  4UB6 H;  2YCC A;  2B87 B;  3L35 A;  3M0A A;  2WT7 A;  2LXB A;  1NIR A;  3ZOX A;  3M9B A;  4WY4 C;  1YIQ A;  3MP7 B;  1COR A;  1UIX A;  1CYC A;  1MG2 D;  4WWI A;  1CZQ A;  2VRS A;  3G3Z A;  1RZ5 A;  3U1A A;  4P4Q B;  4WQ7 A;  2FFD B;  1BGY G;  3DP5 A;  2L4D A;  1JY2 N;  2G3A A;  1CHJ A;  1GKS A;  3ZDM A;  1JNM A;  1L0L D;  3Q3D A;  1P84 E;  1YHQ P;  4H13 B;  5KAF V;  1KX7 A;  1IK7 A;  1JY3 P;  1SS1 A;  3TGU G;  2O1J A;  2IZ1 A;  1DW0 A;  4JYB A;  5KAI V;  1M8O B;  2ZYD A;  1K3G A;  1PP9 G;  3HE5 A;  2A45 I;  4KMG A;  1QGK B;  2KUB A;  1FDI A;  2D2C B;  1W2B O;  1KFN A;  2K9J A;  5BU8 B;  5AW4 B;  5CCG C;  1Q90 D;  2ZJS E;  1MKM A;  2GM4 A;  1T3J A;  1LTT C;  2AEJ A;  1AQT A;  1CTJ A;  4WB4 A;  3CWB G;  5CHX A;  1TU3 F;  4U7J A;  2OYI B;  3Q1M A;  1QLE D;  3B4S A;  3L74 G;  3AEA C;  4WY4 A;  1OW6 A;  3CMA P;  1LTJ C;  2W27 A;  1CXC A;  3AE5 C;  1M57 D;  1CHH A;  1CTY A;  2MHM A;  1EB7 A;  1I54 A;  1BGY E;  1WT6 A;  2P1J A;  2JQR A;  1LTS C;  2C1D A;  1K04 A;  1MV8 A;  1G1I A;  1M1J B;  1RZ6 A;  3L4O A;  2FFD C;  3FX0 A;  4C7N A;  2YQB A;  1Y9B A;  2OTL P;  1H32 B;  1DEE G;  1KIL B;  3L4F A;  2BCC D;  2R5B A;  1CIE A;  1E79 H;  4R4L A;  2PFX A;  3HRN A;  3WFC C;  2N1T C;  2Z4E A;  2A06 G;  1T3U A;  3TGU E;  4HYT B;  3VP9 A;  1CNO A;  3L72 G;  3EQ2 A;  3C2C A;  2N1T D;  1KYO D;  4WQA A;  1DX7 A;  1PP9 E;  2OTK E;  1EZV G;  3ORV A;  2L5G B;  1IFD A;  2YNY A;  2H43 A;  4GOD A;  4AQR D;  1CYJ A;  5B66 E;  4I2L C;  4NPF X;  1VQM P;  4PD4 D;  1Z56 A;  4GOF A;  3D6Z A;  1ZRT E;  1VQ8 P;  3HUS C;  2C0W A;  3GHG A;  2OQQ A;  1FJK A;  5APY A;  2W6J H;  3VMX A;  3L70 D;  1XTC C;  1HRO A;  3ZOY A;  3CC7 P;  5CCG A;  3CWB E;  4OWF A;  3Q2Y A;  1KMI Z;  1HVV A;  5BU5 A;  2AI5 A;  4OVN F;  3TSI A;  3L74 E;  3W67 A;  1CTZ A;  3D0W A;  1VL2 A;  2OYH B;  2PAC A;  1VDF A;  3L71 G;  2YXQ B;  2OYI C;  1FOS F;  3CX5 H;  1LTJ A;  5DJQ C;  1EC5 A;  3M06 A;  2WIT A;  1YQ3 C;  1PL5 A;  2KYV A;  4U3F D;  3H32 A;  3T97 B;  3O5C A;  1HJ0 A;  2KSE A;  3BAS A;  3G71 P;  1ZN5 A;  1YCC A;  2WSS H;  1VYD A;  1SQB K;  1HZV A;  2CE1 A;  3TGU J;  1JO5 A;  2B0Z B;  4N6J A;  2A06 E;  1DW2 A;  2QE7 H;  2JO1 A;  1KIL C;  3L72 E;  2N1T A;  3OCD A;  2K88 A;  4Y99 B;  1USE A;  5KLV G;  3GG2 A;  1KIL D;  2Y9Z A;  1EZV E;  1P84 I;  1CI6 A;  5GTH V;  2AEM A;  3CXH D;  3CPW O;  2ZVO B;  4QAO A;  2KLV A;  1J1E B;  3WFE C;  1QEX A;  3FGA D;  2QM8 A;  3TYY A;  2QRX A;  1LJ2 A;  3USS A;  3HUS A;  1CIF A;  1PGQ A;  3A0H V;  1YEB A;  3H1L G;  3G6E P;  4WQE A;  4EIJ A;  3M9H A;  1L2P A;  4QMA A;  1IO4 A;  2BLF B;  1R5S A;  4PJ0 E;  3AEB C;  4H0J A;  1OXZ A;  4RO0 A;  1JMB A;  4MU8 A;  1AVY A;  1RHZ B;  2BAS A;  1DD3 A;  2L91 A;  3O6Q B;  3HE4 A;  3L71 E;  3PXT A;  3LID A;  1CRI A;  1NGM B;  2WPV B;  1H31 A;  1L9B C;  2H8P D;  1SQB D;  5AW7 B;  4MN4 C;  3WU2 E;  4O1Q A;  1JTH A;  4L75 A;  5CBN A;  4I1L A;  2C9N Y;  3SXT A;  1NTZ G;  1FE6 A;  2B88 A;  2KNC A;  1E5W A;  1RE3 C;  2ITA A;  1KC8 Q;  1ZLL A;  3RK3 C;  2V08 A;  1LTB C;  2C9L Y;  3L72 J;  3VYM A;  3A0B E;  2R3S A;  3RK3 D;  2P58 A;  1HJ5 A;  5APW A;  5CIC B;  5KLV E;  2OZ1 A;  4DOJ A;  3VP8 A;  2Y0E A;  1QYZ A;  1PZQ A;  4NFG B;  3B5N C;  5KAF E;  3CCE P;  3L75 D;  4Y99 C;  2AXT E;  1D7M A;  2BPB B;  3B5N D;  1BCC J;  1HF9 A;  4JQ0 D;  2Q7C A;  2KZJ A;  1C75 A;  4BRY A;  3IAO A;  4TT3 H;  1J1E C;  1X9V A;  1LP1 A;  3H1L E;  1VQ4 P;  1LT9 B;  3ABV C;  3VTP C;  1U57 A;  4AX3 A;  1LWU B;  1SQQ K;  5KAI H;  2H88 C;  3CCL P;  1GJQ A;  3D70 A;  2YMK A;  3Q5R A;  1PGP A;  2HOD B;  3MUD A;  4RSZ A;  3L70 G;  4EOT A;  1YTZ T;  1T8Z A;  3BCC D;  1NTZ E;  2WT7 B;  2CPB A;  2Y0C A;  1F1F A;  1RF1 C;  4EI2 A;  3M91 A;  4FA1 A;  4WQC A;  4ZKU A;  1KIB A;  4XA4 A;  2KIK A;  1HGV A;  1RE3 A;  1CSX A;  3HD7 A;  2E5T A;  2BGV X;  2QJY B;  1RY3 A;  5KLV J;  1GK6 A;  5CID B;  1WMK A;  1FU1 A;  2AEF A;  2JWA A;  2IFN A;  3H25 A;  1EQ7 A;  1KD1 Q;  2GIW A;  1W2E A;  2C1V A;  1L0L J;  1BE3 D;  4ASV A;  1K73 Q;  1HRC A;  2HV4 A;  3B5N A;  5C0Z A;  1CW5 A;  2WPR A;  1GU2 A;  2XV5 A;  1U74 B;  4YXW H;  4YE1 A;  1J1D C;  5AW8 B;  1DT1 A;  3F89 A;  1USD A;  3V2Q A;  4H0K A;  1JDL A;  5DJU B;  2E42 A;  1CSW A;  2I8D A;  1ZV8 A;  3KQG A;  1Y8A A;  1HJ4 A;  2NPS A;  3DR0 A;  1OAE A;  3HE5 B;  1R0Q A;  1S5L X;  5AVQ B;  5AVU B;  2B11 B;  1IFM A;  1NTM K;  1LT9 C;  2P2U A;  2K9J B;  2N9B A;  2GB8 B;  1KYO H;  4N3Y B;  5AVS B;  3SWF A;  3NXS A;  1KYO W;  3SJL A;  2E43 A;  1QKS A;  4PD4 H;  4BXL A;  1RE4 C;  1H9Y A;  1Q86 Q;  2KP8 A;  3P8C D;  3NTN A;  2YKO A;  4HKZ H;  2B9B A;  1IRV A;  2C0X A;  1KB9 E;  1BDC A;  5H2F E;  1RF1 A;  2NRG A;  1J2J B;  3N4X A;  5APV A;  1AJY A;  1PPJ G;  3H1I D;  4UB8 V;  4WY4 B;  1GQ1 A;  3HTK A;  1L0N K;  3WFB C;  4DT0 A;  2HR3 A;  1N86 A;  4C46 A;  3AEE C;  1YQ4 C;  3HQ6 A;  3KYQ A;  2BCN B;  1EDL A;  2H89 C;  5AVX B;  3FXE A;  2QJY C;  2C1D B;  5C39 A;  2BCC J;  2M3B A;  3OA8 A;  4EID A;  3V5B A;  4KHX A;  4C7N B;  5KKZ C;  5CIE B;  4W7Y A;  4A7P A;  2YO3 A;  5KJ7 A;  2R32 A;  1JMM A;  1NMI A;  3TK1 A;  4ZMD A;  1VPC A;  3CU4 A;  3RBX A;  5E79 H;  5C9M A;  4LLH A;  2LR2 A;  1DEB A;  1CRY A;  1OX3 A;  4C7R A;  2N9I A;  2N9J A;  1L4A A;  1VQP P;  2FRC A;  1HCM A;  1ZZH A;  3CCJ P;  3A0H E;  3L70 J;  4R4M A;  5GTH H;  2QJP C;  1QL4 A;  1N15 A;  2HLO A;  4JYC A;  3GHG B;  4L74 A;  2AIU A;  1W5C E;  3CXH H;  4UB6 E;  1YJ9 P;  3U59 A;  1H1O A;  1AKK A;  2IYO A;  1CIH A;  1U75 B;  3CXH W;  1E29 A;  1L0N D;  4K3I A;  1FOS E;  2XKM A;  2K1A A;  1YFC A;  3H1K D;  3IR9 A;  1S5L V;  2IFM A;  1LC2 A;  3SFE C;  4IL6 X;  1GD2 E;  1K8A Q;  2HPC A;  1PPJ E;  1A8C A;  2PCB B;  4L73 A;  4U3F J;  2YKQ A;  3KZI E;  2P10 A;  4D6T D;  1U7M A;  1QVG O;  1OFC X;  1LTJ B;  1CXA A;  2M5A A;  1IC2 A;  3WFD C;  3H32 B;  1IQC A;  2ZYA A;  4WY4 D;  3TF5 A;  1S6V B;  4IFF A;  2WSF H;  2WSC H;  1FZC A;  3L4M A;  1KN7 A;  2C8S A;  2FYN B;  2CA4 B;  1CCH A;  1OW7 A;  2N1T B;  3OCD B;  2B10 B;  3CP5 A;  2ZFC A;  5AVR B;  1A02 F;  1FI7 A;  1CI6 B;  1KYO I;  4DCK A;  4GED B;  1ETP A;  1DIP A;  1SQQ G;  1N73 A;  3AE6 C;  351C A;  3M97 X;  3P7K A;  1ZXG A;  1ZW0 A;  3V6I A;  4ASW A;  2UWJ E;  2JTI B;  1A2S A;  1SQV K;  1SQP K;  3HUS B;  2OGU A;  1NU1 D;  2LIT A;  5B5E V;  1CSB A;  1IFP A;  1CED A;  3NMD A;  3GHG C;  1VQ9 P;  3ITK A;  1LNQ A;  4AAL A;  1HWT C;  2FYU K;  1T6A A;  5IY5 1;  2WMM A;  1SQB J;  3IN6 A;  4LGD E;  1NAY A;  2WSC J;  4H0L B;  3HE4 B;  5AW6 B;  2D0W A;  5CCG D;  1NTK K;  1H31 B;  1AQ5 A;  1KB9 I;  1FCD C;  2QJK B;  1JTH B;  2IZ0 A;  1FI9 A;  4WQ8 A;  5DJQ B;  3H1H D;  1S3J A;  5KTB A;  2KNC B;  2I1K A;  4IL6 V;  3L73 D;  4O1W A;  2KB7 P;  1N8R Q;  3JBT B;  1AVO A;  1RAQ A;  4B86 A;  2E74 B;  3L75 J;  3RLM A;  2Q1K A;  4RES B;  3CC4 P;  5AW0 B;  2FYN C;  2OZ1 B;  3RL0 B;  1VF5 C;  4I7Z C;  1HBW A;  3Q5S A;  1SQV D;  1SQP D;  1C2R A;  4OGQ B;  1IK9 A;  1YJN P;  3KXD A;  1SQQ E;  3QWO C;  3IF4 A;  3R2P A;  1NTM G;  2FYU D;  1Q7Y Q;  1YIC A;  1HJB A;  1CRJ A;  2W83 C;  3WUI A;  4BRY B;  1K9M Q;  1EXJ A;  2QA4 P;  1LP1 B;  2HYN A;  1CRG A;  5APQ A;  1GU4 A;  1H88 A;  1Q81 Q;  3ZCF A;  1ZME C;  1NTK D;  2ZON G;  2GC4 D;  3HQ8 A;  5EFW B;  1BCC G;  3JCU E;  3H6P A;  2KS1 B;  1JY2 O;  3CX5 E;  3BCC J;  2OAR A;  4W7Z A;  3P8M C;  2IBZ G;  1SQX K;  2QVA A;  2YIU C;  1L0N G;  4H0L C;  2PGD A;  2LXC B;  3FWL A;  1LFM A;  4H0L D;  1HGZ A;  2QJK C;  2O1K A;  2C1U A;  3EWK A;  3AE7 C;  3CX5 W;  1VQO P;  3CYT I;  3HD7 B;  3WMM 0;  3RK3 B;  1S9K D;  1BE3 J;  3LIE A;  1COT A;  3QH9 A;  3H1J D;  4UB8 H;  5CMZ A;  3MZW B;  2Z5H A;  5TJH A;  1BDD A;  1H89 A;  2O3J A;  1WEJ F;  5E79 V;  2E74 C;  1SQQ J;  2E74 D;  3B5N B;  3RL0 C;  4WBA A;  2QEX P;  1NTM E;  5APT A;  1C6R A;  4OGQ C;  3RL0 D;  2I1J A;  2KOG A;  2VHD A;  1Q2N A;  2JP3 A;  1L0L G;  1PGO A;  2XDJ A;  5AW1 B;  4N78 D;  4OGQ D;  2ZVN B;  1QN2 A;  1N2D C;  2NPS B;  1SQX D;  1AFO A;  2O01 N;  3G4S P;  1N9C A;  1BCC E;  2KZI A;  1DD4 A;  3OJA B;  1MFZ A;  4M3L A;  3CLQ A;  1OW8 A;  1X0T A;  1SVF A;  2POH A;  4YXD C;  2IBZ E;  2V4H A;  4I6M C;  5CIF B;  3C8V A;  3MUD C;  1JM0 A;  1PV3 A;  4XYD B;  3WUU A;  4IFM A;  3WUT A;  4NPE A;  3RK2 C;  1RF1 B;  2XND H;  3PH0 A;  2IDB A;  5CYT R;  4BWN A;  1S5L H;  5GTI V;  3HTK B;  1RAP A;  2JR8 A;  2Q6Q A;  3M0D C;  4PV1 C;  4L76 A;  1YYC A;  2YO2 A;  5BVZ A;  1FZF A;  3HD7 C;  1R5L A;  4ZKP A;  1CRH A;  2GA1 A;  3OA8 B;  2CPS A;  3BVH A;  1JEK A;  3HD7 D;  2KI7 B;  1NTM J;  1VQ6 P;  1FAV A;  1JY3 N;  5AW5 B;  3WC8 A;  1S72 P;  1NWQ A;  3E1R A;  1L0L E;  1J1D B;  5AVT B;  2O01 H;  2BCC G;  3A2A A;  2WWW A;  2KLU A;  1FC2 C;  1SQP G;  1SQV G;  5KAI E;  2W8Z A;  1L4A B;  1QX8 A;  2Y9Y A;  2E76 C;  4FA9 A;  1LC1 A;  1ZR4 A;  2FYU G;  2NPS C;  2W90 A;  2OYO A;  5APS A;  1L0N J;  3L36 A;  4PWA A;  4KJM A;  3H1K J;  3UIA A;  2NPS D;  1P84 D;  5DF5 A;  2KXP B;  3M9Q A;  3CX5 I;  2FXM A;  1EXI A;  4DY9 A;  5B5E H;  4K3A A;  2HPC B;  2NZ2 A;  1QVF O;  2Q9I A;  5L8R J;  1W5C T;  1FHB A;  2O01 J;  1B7V A;  2M5A B;  3AEC C;  5DJT B;  2E75 C;  5CBO A;  1KOR A;  3M0D A;  3MD0 A;  3FXD A;  2RH0 A;  2FBW C;  2E75 D;  3B71 A;  2FY8 A;  2Q5U A;  451C A;  4H44 B;  4HH2 A;  4U3F G;  5CJ0 A;  5M1B A;  2XU6 A;  3C9I A;  5KKZ B;  2M3E A;  5CCH A;  1OCD A;  1FZC B;  2JJL A;  4K35 A;  3ZIY A;  3BRT B;  4IL6 H;  2K37 A;  5KJ7 C;  1CCR A;  2BCC E;  1N90 A;  3PHL A;  5CIG B;  3SFD C;  1BGY D;  2PP6 A;  5KJ7 D;  2D0S A;  2CXB A;  1XTG B;  2BH5 X;  3MTU E;  1OVV A;  1X22 A;  1KYO E;  3X39 A;  1L4A C;  1N73 B;  1LS9 A;  1IJD B;  4ZNC A;  4PD4 E;  1JB0 J;  1SFC A;  2DW3 A;  1L4A D;  2QJP B;  4GIF A;  1M60 A;  2PAJ A;  3TGU D;  2N18 C;  1SQX G;  1F1C A;  3NFQ A;  1CIG A;  1IFN A;  1CRC A;  1VQN P;  1FBM A;  2WPS A;  2IBZ I;  3L70 E;  1PP9 D;  1DIQ C;  1NOH A;  3O8Z A;  3VYI A;  3KPE A;  4GT1 A;  1YJW P;  3CCU P;  1ZRT D;  1HJ3 A;  5B66 V;  3CL3 D;  3H1H J;  3CME P;  3V2N A;  3PXW A;  2QSI A;  4RJT A;  2SPZ A;  1AOF A;  5AVZ B;  1SQB G;  2IYP A;  3CWB D;  4U3F E;  2A45 H;  5EXQ A;  1NVO A;  1IZN B;  1CC5 A;  3ZBM A;  3L74 D;  2V7Q H;  1M90 Q;  5APX A;  2R5D A;  5E79 E;  4H44 C;  2WSE H;  3RBZ A;  1H33 A;  1SQP J;  1SQV J;  3N7N A;  3K5B A;  1GDV A;  2ZOO A;  4H44 D;  3TDK A;  2YMY A;  1FZC C;  3OW2 O;  3TNU A;  2FYU J;  4AAO A;  1N7S A;  1QL1 A;  4HB1 A;  1U7J A;  1IZL 0;  1URQ A;  5GTH E;  3GLM A;  1GL2 C;  1KIL E;  1BL9 A;  2Y0D A;  3CXH E;  2Q3I A;  3L75 G;  1GL2 D;  1NTK J;  2P67 A;  2ZT9 B;  4W80 A;  3ZOW A;  5TIS H;  1QL3 A;  1HH7 A;  4EIF A;  2RMZ A;  2A06 D;  1N73 C;  3DMI A;  3L72 D;  1VQ5 P;  3O0R C;  1N7L A;  1EZV D;  4Q5P A;  2LKM A;  3GMA A;  3HQ7 A;  4EIE A;  1FDM A;  2MJZ A;  1M70 A;  3IFM A;  3B8E B;  2YK3 A;  1JCD A;  1J3S A;  1H0T A;  3V2P A;  1RF0 C;  1IRW A;  3NWV A;  1NU1 K;  2JKV A;  1SQB E;  4HJG H;  3E1I A;  3D71 A;  4FAV A;  5KLI C;  2FXP A;  3CCM P;  3RN0 A;  3BCC G;  3H1J J;  5AVV B;  1MG3 D;  1GK4 A;  3G9R A;  1S2E A;  1YIT P;  3RN1 A;  3L71 D;  1C7M A;  1G1J A;  4GOE A;  5CIB B;  1AA0 A;  1LTA C;  4Y5R A;  5GTI H;  4JPZ B;  2R3C A;  4FA5 A;  2OTJ P;  3RK3 E;  3GW6 A;  1K3H A;  1VQ7 P;  1GW4 A;  3WU2 V;  1VF5 B;  4I7Z B;  4L3H A;  2K3R A;  1UII A;  1BE3 G;  1EDI A;  3SSU A;  1GL2 A;  3L75 E;  1SQX J;  3KZI H;  2YKP A;  1NTZ K;  3MK7 B;  3A0B V;  2ZT9 C;  5KLV D;  1SP4 A;  4V2K A;  3TYI A;  4PD4 I;  4AAM A;  2ZT9 D;  3GF3 A;  2E5Y A;  3SWY A;  1DVH A;  4O9B A;  2XNX A;  2J59 M;  4EDF A;  3SWS A;  2CE0 A;  1YBK A;  3MGN A;  1G2C A;  2AXT V;  2RKL A;  1FZA A;  4FA4 A;  3S4R A;  2AXC A;  2GUS A;  2BEQ D;  5APU A;  1E8E A;  1CYI A;  2YIU B;  3F5H A;  1NYH A;  2WSF J;  1RF0 A;  1KFM A;  3H1L D;  3CCS P;  2BEZ F;  4DJG A;  1JCC A;  4LC1 A;  3BCC E;  1P84 H;  4N0K A;  4JF7 A;  1C6S A;  1BSN A;  2C2C A;  3RGU A;  1KX2 A;  4YPC A;  2FKW B;  3CCQ P;  3ZOO A;  3H1I G;  1M56 D;  3KDP B;  3BRV B;  1YTC A;  4FB1 A;  3AE4 C;  3CD6 P;  2K9Y A;  1NTZ D;  4EYY Q;  1KQS O;  1ZP0 C;  2DGE A;  3A9F A;  2ZXX A;  1FZB A;  4IFD K;  1DW3 A;  1BE3 E;  1FDO A;  4XE5 B;  1HUC A;  1N50 A;  3VRD A;  1GU5 A;  1FZE A;  3Q5P A;  2FXO A;  3P32 A;  1VF5 D;  1X8Y A;  1LT1 A;  1KQL A;  1NNO A;  1GW3 A;  3CXH I;  3VMA A;  1GZL A;  3MK7 C;  5CJ4 A;  3I55 P;  2IX7 C;  2GC7 D;  3PTZ A;  2W6B A;  1KV4 A;  2C9X B;  1OIP A;  3S9O A;  1GMJ A;  1OZH A;  1RQU A;  3RMZ A;  4H13 C;  5AUR A;  3A7O A;  3OAK A;  4GDO A;  3MIW A;  1Q82 Q;  3D6Y A;  1ZOY C;  4H13 D;  1KV9 A;  1CHI A;  1YTZ I;  3P8C E;  2EXV A;  3MHV A;  1KZU B;  1KB0 A;  3H1K G;  3RK2 B;  2D2C C;  2ZYG A;  4UB8 E;  3JC2 2;  1DW1 A;  3AE3 C;  2W6A A;  3H1I E;  2D2C D; 
#chains in the Genus database with same CATH homology
 1CHJ A;  1IRV A;  2Q3E A;  1GKS A;  1L0L D;  4FA9 A;  1LC1 A;  3H1I D;  4UB8 V;  1I6D A;  5KAF V;  1KX7 A;  1M6Z A;  1GQ1 A;  1I55 A;  3PLN A;  3WFB C;  1MZ4 A;  4FAN A;  1DW0 A;  1KB9 D;  4PWA A;  3HQ6 A;  5KAI V;  2BCN B;  3SVW A;  1P84 D;  5DF5 A;  5H2F V;  1K3G A;  2C1D B;  4KMG A;  1I5T A;  3OA8 A;  4EID A;  1FOC A;  5TIS V;  5CIE B;  4A7P A;  4DY9 A;  3PH2 B;  1NMI A;  2QG4 A;  1W5C T;  1FHB A;  3CU4 A;  5DFS A;  5C9M A;  1CTJ A;  4JCG A;  2DVH A;  1B7V A;  4EIC A;  1CRY A;  2N9I A;  2N9J A;  2FRC A;  1HCM A;  1ZZH A;  1GIW A;  451C A;  1CXC A;  2RN0 A;  1CHH A;  1CTY A;  2MHM A;  1QL4 A;  3PRJ A;  1N15 A;  1EB7 A;  5KKZ B;  1I54 A;  1OCD A;  2AIU A;  3ZIY A;  2JQR A;  1W2L A;  1H1O A;  1AKK A;  2C1D A;  4L1Q A;  1CCR A;  1CIH A;  1U75 B;  1N90 A;  3CXH W;  1RZ6 A;  1E29 A;  1L0N D;  4K3I A;  3PHL A;  3L4O A;  5CIG B;  2ZZS 1;  1BGY D;  1YFC A;  3H1K D;  3NBS A;  1S5L V;  2YQB A;  2D0S A;  2CXB A;  1H32 B;  1LC2 A;  2BH5 X;  2BCC D;  4UB6 V;  1CIE A;  1A8C A;  3SLE A;  3X39 A;  3WFC C;  2PCB B;  2PCC B;  3NBT A;  4D6T D;  1LS9 A;  1CNO A;  1A56 A;  2B12 B;  3C2C A;  1KYO D;  1CXA A;  1PPJ D;  4WQA A;  2QJP B;  1M60 A;  3WFD C;  3ORV A;  1H33 B;  3TGU D;  2N18 C;  1IQC A;  1CYJ A;  1F1C A;  4PD4 D;  3KZI V;  1CIG A;  1CRC A;  3TF5 A;  1PP9 D;  1S6V B;  1DIQ C;  3L4M A;  2C8S A;  2FYN B;  2CA4 B;  3L70 D;  1HRO A;  1HJ3 A;  1CCH A;  1ZRT D;  5B66 V;  3ZOY A;  3OCD B;  3PXW A;  4RJT A;  2B10 B;  3CP5 A;  1FI7 A;  1H32 A;  2AI5 A;  1AOF A;  1HZU A;  2N3Y A;  4GED B;  2FWL A;  1CTZ A;  1ETP A;  3CWB D;  2N18 B;  2PAC A;  5EXQ A;  2ORL A;  351C A;  3M97 X;  1CC5 A;  3ZBM A;  3L74 D;  5DJQ C;  2JTI B;  1A2S A;  3HQ9 A;  4U3F D;  1NU1 D;  1H33 A;  2LIT A;  3O5C A;  5B5E V;  1GDV A;  2ZOO A;  3O20 A;  1CED A;  3TDK A;  3ITK A;  4AAL A;  1YCC A;  1VYD A;  1DII C;  5IY5 1;  1HZV A;  4AAO A;  4PW9 B;  1NML A;  4XXL A;  1IZL 0;  2CE1 A;  2B0Z B;  1BL9 A;  2KS1 A;  1DW2 A;  1I6E A;  2Y0D A;  1YNR A;  1H9X A;  4LJI A;  2D0W A;  1H31 B;  3OCD A;  3ZOW A;  1QL3 A;  1CSU A;  1FCD C;  2QJK B;  3GG2 A;  1FI3 A;  1CSV A;  1HH7 A;  4EIF A;  2RMZ A;  2A06 D;  3DMI A;  1FI9 A;  5GTH V;  4WQ8 A;  5DJQ B;  3CXH D;  3L72 D;  3H1H D;  4J20 A;  4QAO A;  3O0R C;  2KNC B;  4IL6 V;  1EZV D;  2ZXY A;  3L73 D;  4O1W A;  4Q5P A;  1DVV A;  3WFE C;  3HQ7 A;  4EIE A;  2CA3 B;  3JBT B;  1RAQ A;  1M70 A;  1CIF A;  3A0H V;  4WQB A;  5B6Q A;  1YEB A;  2YK3 A;  3RLM A;  1J3S A;  1C2N A;  4WQE A;  2N9Y B;  2V07 A;  2OZ1 B;  1IRW A;  4WQD A;  3NWV A;  2BLF B;  1SQV D;  1SQP D;  1C2R A;  2BH4 X;  4H0J A;  1AYG A;  4MU8 A;  4FAV A;  2L91 A;  2I8F A;  3PXT A;  3RN0 A;  1CRI A;  2FYU D;  1H31 A;  1MG3 D;  1L9B C;  1SQB D;  1YIC A;  2XTS B;  1C52 A;  1CRJ A;  4O1Q A;  3WUI A;  3RN1 A;  1SQQ D;  3L71 D;  1C7M A;  3SXT A;  1CRG A;  5CIB B;  3ZCF A;  4Y5R A;  1NTK D;  2ZON G;  4FA5 A;  2GC4 D;  3HQ8 A;  3GW6 A;  1K3H A;  2ZBO A;  3WU2 V;  2V08 A;  2B4Z A;  4L3H A;  4WQ9 A;  3VYM A;  5CIH B;  1AOQ A;  1HJ5 A;  5KLI B;  4L3G A;  5CIC B;  1C6O A;  2OZ1 A;  3CX5 D;  2Y0E A;  1QYZ A;  4NFG B;  3MK7 B;  3FWL A;  4AAN A;  3A0B V;  1LFM A;  3L75 D;  1LMS A;  5KLV D;  4V2K A;  3TYI A;  2BPB B;  4AAM A;  1FJ0 A;  2C1U A;  1I8O A;  1DVH A;  3CX5 W;  1C75 A;  3CYT I;  4EDF A;  155C A;  1COT A;  3SWS A;  2CE0 A;  3H1J D;  2AXT V;  2N3B A;  1WVE C;  5TJH A;  4FA4 A;  2O3J A;  1YEA A;  1WEJ F;  4AX3 A;  2MTA C;  5E79 V;  1E8E A;  1CYI A;  2YIU B;  3H1L D;  1GJQ A;  4N0K A;  4RSZ A;  1C6S A;  1C6R A;  2C2C A;  2VHD A;  1KX2 A;  3KHU A;  3BCC D;  1I8P A;  1NTM D;  1E2R A;  3ZOO A;  2Y0C A;  1QN2 A;  1F1F A;  4FA1 A;  4WQC A;  1IO3 A;  1SQX D;  1YTC A;  1KIB A;  1N9C A;  4FB1 A;  1NTZ D;  1L9J C;  2LIR A;  2DGE A;  1CSX A;  2BGV X;  3A9F A;  2QJY B;  1DW3 A;  5CID B;  1BCC D;  2JWA A;  2GIW A;  3O1Y A;  1N50 A;  3VRD A;  2C1V A;  4GYD A;  5CIF B;  3PXS A;  1BE3 D;  1HRC A;  1NNO A;  4XYD B;  2IBZ D;  1CO6 A;  2HV4 A;  3VMA A;  5C0Z A;  3VNW A;  1GU2 A;  1U74 B;  3MK7 C;  4YE1 A;  2GC7 D;  1DT1 A;  4PJ0 V;  5CYT R;  3PTZ A;  5GTI V;  1RAP A;  4H0K A;  1JDL A;  2YCC A;  1CSW A;  2C9X B;  1NIR A;  3ZOX A;  1HJ4 A;  3DR0 A;  1OAE A;  3RMZ A;  1R0Q A;  5AUR A;  1CRH A;  1YIQ A;  3OA8 B;  1COR A;  2B11 B;  1CYC A;  2K9J B;  1MG2 D;  2GB8 B;  1KV9 A;  1RZ5 A;  1CHI A;  4P4Q B;  2EXV A;  4WQ7 A;  1KB0 A;  1KYO W;  3SJL A;  1QKS A;  3WC8 A;  3DP5 A;  1DW1 A;  2L4D A;  1H9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...