3M97X

Structure of the soluble domain of cytochrome c552 with its flexible linker segment from paracoccus denitrificans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
118
Chain Sequence
MGHGAEGEEHADFATVLASADPAAGEKVFGKCKACHKLDGNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTPEALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLEGQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c-552
publication title Structure at 1.5 A resolution of cytochrome c(552) with its flexible linker segment, a membrane-anchored protein from Paracoccus denitrificans.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 29
structure length 118
sequence length 140
ec nomenclature
pdb deposition date 2010-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3m97X00
4EICA 2N18B 3ZOXA 3WFDC 1W2LA 3CYTI 1CEDA 1L0LD 3O0RC 3NBTA 2XTSB 1CYJA 2MTAC 3H1JD 2N9JA 4AAMA 1NNOA 3A0HV 4GYDA 3O5CA 4EIDA 1OCDA 3PXSA 4L3HA 1AKKA 3CX5D 3RN0A 1LS9A 2AXTV 3NWVA 2MHMA 3SXTA 1I55A 1HROA 3TGUD 1CRHA 1L9BC 2CA3B 3A9FA 1U75B 1H33B 4L1QA 1H9XA 1K3HA 2ZZS1 5DFSA 1NMIA 1KB9D 2AIUA 1DT1A 351CA 4IL6V 3VRDA 1DVVA 1LC1A 3M97X 1ETPA 1H9YA 1N15A 2DGEA 4PD4D 1HJ3A 1A2SA 2PACA 3L75D 3PXWA 1M60A 1DW1A 1LFMA 1BE3D 1DVHA 1NMLA 2BPBB 3SWSA 1DW2A 4FANA 3RMZA 4FA5A 3C2CA 4H0KA 4UB6V 1FOCA 1CYIA 2D0WA 2YK3A 1DIIC 2CXBA 1IRWA 1QKSA 1FCDC 2D0SA 3DMIA 5B6QA 1I54A 1N50A 4LJIA 3TYIA 3ZOYA 1YCCA 2I8FA 2OZ1A 1NIRA 1YICA 1BL9A 4K3IA 1H31B 4EIFA 2LIRA 4WQBA 2YCCA 1CO6A 1KIBA 4N0KA 4XYDB 4FB1A 2N18C 1MZ4A 2FWLA 2VHDA 4P4QB 1B7VA 1CSWA 3OCDB 4NFGB 1CIGA 4XXLA 1FI7A 3ZCFA 1MG3D 1MG2D 3O20A 2BH5X 1HRCA 1SQBD 1RAPA 2YIUB 1H32A 1RZ6A 5TISV 1YFCA 1BCCD 4JCGA 1HJ5A 3H1HD 1C75A 3L4OA 2PCCB 1PP9D 5CIBB 1CXAA 3VNWA 1CHIA 4WQAA 1HCMA 2CA4B 1R0QA 4WQ7A 4Y5RA 2ZOOA 5C0ZA 5CIEB 2GC7D 3CXHW 2C1DB 1C52A 4RSZA 4UB8V 4Q5PA 2JTIB 2FYUD 5KAIV 1HZVA 2LITA 3H1ID 3MK7B 5B5EV 3HQ8A 3RLMA 1NTKD 1CORA 3OA8B 2B4ZA 5CIGB 1C6RA 1GJQA 1NTZD 5KLVD 3SLEA 1CCHA 4O1WA 155CA 1CHJA 2B12B 3WUIA 1EB7A 5IY51 5KLIB 1WVEC 1CSXA 1KV9A 4FA1A 1CTYA 4WQ8A 1KX2A 1EZVD 2BCNB 1HZUA 1CRJA 1KB0A 3PH2B 1I8OA 2IBZD 5KKZB 2QJKB 3CU4A 1NTMD 4PWAA 2BH4X 2C8SA 3VYMA 2GC4D 5AURA 5C9MA 2FYNB 4MU8A 1H33A 3JBTB 4J20A 1GDVA 1YEAA 3ZBMA 3SJLA 451CA 2QJPB 1LC2A 4U3FD 3WFBC 1CRGA 1W5CT 1H1OA 3L4MA 4PW9B 3SVWA 1KYOW 1U74B 1I5TA 2V07A 4QAOA 4FA9A 1M6ZA 1FJ0A 2BLFB 5GTIV 2C1UA 3CX5W 5CYTR 3HQ6A 1L0ND 2JQRA 4D6TD 1QL3A 2C1VA 1CRCA 1E29A 1A56A 2BGVX 1RZ5A 1IZL0 2EXVA 2CE1A 1FHBA 5EXQA 1CRYA 4WQ9A 2C2CA 1HH7A 1H31A 4WQCA 1E8EA 3WC8A 3MK7C 3A0BV 1CSVA 5DJQB 1CTZA 1CIHA 1AOFA 2A06D 5E79V 3OCDA 1F1FA 2ORLA 3CWBD 1YEBA 4KMGA 1GQ1A 1RAQA 1P84D 1VYDA 1CXCA 1KYOD 1N9CA 1LMSA 4FA4A 1FI9A 1C6SA 1J3SA 2B0ZB 3ZOOA 3H1LD 1ZZHA 3BCCD 1CSUA 5CIDB 1CYCA 1K3GA 1C6OA 1JDLA 1A8CA 3HQ9A 1I8PA 3L73D 4FAVA 3DR0A 1SQXD 4O1QA 3X39A 3O1YA 1QL4A 1PPJD 1SQVD 1S6VB 2L4DA 1CC5A 3L70D 2C1DA 5B66V 1YTCA 1DW0A 1N90A 1F1CA 1C2RA 5GTHV 3OA8A 1SQQD 2AI5A 3ZOWA 4L3GA 1GKSA 2CE0A 1GU2A 3HQ7A 1YIQA 4AANA 1IQCA 3NBSA 3L74D 5CIFB 3L71D 1OAEA 1CNOA 4WQEA 3H1KD 5CICB 1NU1D 3PXTA 4DY9A 3WU2V 3RN1A 1WEJF 3DP5A 2GB8B 4GEDB 1BGYD 5DF5A 2OZ1B 5CIHB 4EIEA 1M70A 2B10B 4AX3A 1AYGA 4AALA 3KZIV 1DIQC 2B11B 2N9IA 1IRVA 3CXHD 1L9JC 1CRIA 2ZXYA 1C7MA 4WQDA 3WFCC 1CIFA 2FRCA 2ZBOA 2N3BA 4PJ0V 1COTA 5H2FV 2C9XB 1QYZA 1CHHA 5DJQC 2PCBB 3CP5A 4H0JA 1I6EA 1GIWA 1H32B 4V2KA 1YNRA 1CCRA 4AAOA 1I6DA 2N3YA 2DVHA 2V08A 1E2RA 2YQBA 3ORVA 1IO3A 3WFEC 1ZRTD 2QJYB 1CTJA 1S5LV 5KAFV 1HJ4A 2BCCD 2ZONG 1KX7A 1SQPD 1AOQA 1FI3A 1CIEA 2HV4A 3ZIYA 1C2NA 1QN2A 4YE1A 1DW3A 2GIWA 3L72D
chains in the Genus database with same CATH superfamily
4EICA 2N18B 3ZOXA 3WFDC 1W2LA 3CYTI 1CEDA 1L0LD 3O0RC 3NBTA 2XTSB 1CYJA 2MTAC 3H1JD 2N9JA 4AAMA 1NNOA 3A0HV 4GYDA 3O5CA 4EIDA 1OCDA 3PXSA 4L3HA 1AKKA 3CX5D 3RN0A 1LS9A 2AXTV 3NWVA 2MHMA 3SXTA 1I55A 1HROA 3TGUD 1CRHA 1L9BC 2CA3B 3A9FA 1U75B 1H33B 4L1QA 1H9XA 1K3HA 2ZZS1 5DFSA 1NMIA 1KB9D 2AIUA 1DT1A 351CA 4IL6V 3VRDA 1DVVA 1LC1A 3M97X 1ETPA 1H9YA 1N15A 2DGEA 4PD4D 1HJ3A 1A2SA 2PACA 3L75D 3PXWA 1M60A 1DW1A 1LFMA 1BE3D 1DVHA 1NMLA 2BPBB 3SWSA 1DW2A 4FANA 3RMZA 4FA5A 3C2CA 4H0KA 4UB6V 1FOCA 1CYIA 2D0WA 2YK3A 1DIIC 2CXBA 1IRWA 1QKSA 1FCDC 2D0SA 3DMIA 5B6QA 1I54A 1N50A 4LJIA 3TYIA 3ZOYA 1YCCA 2I8FA 2OZ1A 1NIRA 1YICA 1BL9A 4K3IA 1H31B 4EIFA 2LIRA 4WQBA 2YCCA 1CO6A 1KIBA 4N0KA 4XYDB 4FB1A 2N18C 1MZ4A 2FWLA 2VHDA 4P4QB 1B7VA 1CSWA 3OCDB 4NFGB 1CIGA 4XXLA 1FI7A 3ZCFA 1MG3D 1MG2D 3O20A 2BH5X 1HRCA 1SQBD 1RAPA 2YIUB 1H32A 1RZ6A 5TISV 1YFCA 1BCCD 4JCGA 1HJ5A 3H1HD 1C75A 3L4OA 2PCCB 1PP9D 5CIBB 1CXAA 3VNWA 1CHIA 4WQAA 1HCMA 2CA4B 1R0QA 4WQ7A 4Y5RA 2ZOOA 5C0ZA 5CIEB 2GC7D 3CXHW 2C1DB 1C52A 4RSZA 4UB8V 4Q5PA 2JTIB 2FYUD 5KAIV 1HZVA 2LITA 3H1ID 3MK7B 5B5EV 3HQ8A 3RLMA 1NTKD 1CORA 3OA8B 2B4ZA 5CIGB 1C6RA 1GJQA 1NTZD 5KLVD 3SLEA 1CCHA 4O1WA 155CA 1CHJA 2B12B 3WUIA 1EB7A 5IY51 5KLIB 1WVEC 1CSXA 1KV9A 4FA1A 1CTYA 4WQ8A 1KX2A 1EZVD 2BCNB 1HZUA 1CRJA 1KB0A 3PH2B 1I8OA 2IBZD 5KKZB 2QJKB 3CU4A 1NTMD 4PWAA 2BH4X 2C8SA 3VYMA 2GC4D 5AURA 5C9MA 2FYNB 4MU8A 1H33A 3JBTB 4J20A 1GDVA 1YEAA 3ZBMA 3SJLA 451CA 2QJPB 1LC2A 4U3FD 3WFBC 1CRGA 1W5CT 1H1OA 3L4MA 4PW9B 3SVWA 1KYOW 1U74B 1I5TA 2V07A 4QAOA 4FA9A 1M6ZA 1FJ0A 2BLFB 5GTIV 2C1UA 3CX5W 5CYTR 3HQ6A 1L0ND 2JQRA 4D6TD 1QL3A 2C1VA 1CRCA 1E29A 1A56A 2BGVX 1RZ5A 1IZL0 2EXVA 2CE1A 1FHBA 5EXQA 1CRYA 4WQ9A 2C2CA 1HH7A 1H31A 4WQCA 1E8EA 3WC8A 3MK7C 3A0BV 1CSVA 5DJQB 1CTZA 1CIHA 1AOFA 2A06D 5E79V 3OCDA 1F1FA 2ORLA 3CWBD 1YEBA 4KMGA 1GQ1A 1RAQA 1P84D 1VYDA 1CXCA 1KYOD 1N9CA 1LMSA 4FA4A 1FI9A 1C6SA 1J3SA 2B0ZB 3ZOOA 3H1LD 1ZZHA 3BCCD 1CSUA 5CIDB 1CYCA 1K3GA 1C6OA 1JDLA 1A8CA 3HQ9A 1I8PA 3L73D 4FAVA 3DR0A 1SQXD 4O1QA 3X39A 3O1YA 1QL4A 1PPJD 1SQVD 1S6VB 2L4DA 1CC5A 3L70D 2C1DA 5B66V 1YTCA 1DW0A 1N90A 1F1CA 1C2RA 5GTHV 3OA8A 1SQQD 2AI5A 3ZOWA 4L3GA 1GKSA 2CE0A 1GU2A 3HQ7A 1YIQA 4AANA 1IQCA 3NBSA 3L74D 5CIFB 3L71D 1OAEA 1CNOA 4WQEA 3H1KD 5CICB 1NU1D 3PXTA 4DY9A 3WU2V 3RN1A 1WEJF 3DP5A 2GB8B 4GEDB 1BGYD 5DF5A 2OZ1B 5CIHB 4EIEA 1M70A 2B10B 4AX3A 1AYGA 4AALA 3KZIV 1DIQC 2B11B 2N9IA 1IRVA 3CXHD 3D0WA 1L9JC 1CRIA 2ZXYA 1C7MA 4WQDA 3WFCC 1CIFA 2FRCA 2ZBOA 2N3BA 4PJ0V 1COTA 5H2FV 2C9XB 1QYZA 1CHHA 5DJQC 2PCBB 3CP5A 4H0JA 1I6EA 1GIWA 1H32B 4V2KA 1YNRA 1CCRA 4AAOA 1I6DA 2N3YA 2DVHA 2V08A 1E2RA 2YQBA 3ORVA 1IO3A 3WFEC 1ZRTD 2QJYB 1CTJA 1S5LV 5KAFV 1HJ4A 2BCCD 2ZONG 1KX7A 1SQPD 1AOQA 1FI3A 1CIEA 2HV4A 3ZIYA 1C2NA 1QN2A 4YE1A 1DW3A 2GIWA 3L72D
chains in the Genus database with same CATH topology
4EICA 2N18B 3ZOXA 3WFDC 1W2LA 3CYTI 1CEDA 1L0LD 3O0RC 3NBTA 2XTSB 1CYJA 2MTAC 3H1JD 2N9JA 4AAMA 1NNOA 3A0HV 4GYDA 3O5CA 4EIDA 1OCDA 3PXSA 4L3HA 1AKKA 3CX5D 3RN0A 1LS9A 2AXTV 3NWVA 2MHMA 3SXTA 1I55A 1HROA 3TGUD 1CRHA 1L9BC 2CA3B 3A9FA 1U75B 1H33B 4L1QA 1H9XA 1K3HA 2ZZS1 5DFSA 1NMIA 1KB9D 2AIUA 1DT1A 351CA 4IL6V 3VRDA 1DVVA 1LC1A 3M97X 1ETPA 1H9YA 1N15A 2DGEA 4PD4D 1HJ3A 1A2SA 2PACA 3L75D 3PXWA 1M60A 1DW1A 1LFMA 1BE3D 1DVHA 1NMLA 2BPBB 3SWSA 1DW2A 4FANA 3RMZA 4FA5A 3C2CA 4H0KA 4UB6V 1FOCA 1CYIA 2D0WA 2YK3A 1DIIC 2CXBA 1IRWA 1QKSA 1FCDC 2D0SA 3DMIA 5B6QA 1I54A 1N50A 4LJIA 3TYIA 3ZOYA 1YCCA 2I8FA 2OZ1A 1NIRA 1YICA 1BL9A 4K3IA 1H31B 4EIFA 2LIRA 4WQBA 2YCCA 1CO6A 1KIBA 4N0KA 4XYDB 4FB1A 2N18C 1MZ4A 2FWLA 2VHDA 4P4QB 1B7VA 1CSWA 3OCDB 4NFGB 1CIGA 4XXLA 1FI7A 3ZCFA 1MG3D 1MG2D 3O20A 2BH5X 1HRCA 1SQBD 1RAPA 2YIUB 1H32A 1RZ6A 5TISV 1YFCA 1BCCD 4JCGA 1HJ5A 3H1HD 1C75A 3L4OA 2PCCB 1PP9D 5CIBB 1CXAA 3VNWA 1CHIA 4WQAA 1HCMA 2CA4B 1R0QA 4WQ7A 4Y5RA 2ZOOA 5C0ZA 5CIEB 2GC7D 3CXHW 2C1DB 1C52A 4RSZA 4UB8V 4Q5PA 2JTIB 2FYUD 5KAIV 1HZVA 2LITA 3H1ID 3MK7B 5B5EV 3HQ8A 3RLMA 1NTKD 1CORA 3OA8B 2B4ZA 5CIGB 1C6RA 1GJQA 1NTZD 5KLVD 3SLEA 1CCHA 4O1WA 155CA 1CHJA 2B12B 3WUIA 1EB7A 5IY51 5KLIB 1WVEC 1CSXA 1KV9A 4FA1A 1CTYA 4WQ8A 1KX2A 1EZVD 2BCNB 1HZUA 1CRJA 1KB0A 3PH2B 1I8OA 2IBZD 5KKZB 2QJKB 3CU4A 1NTMD 4PWAA 2BH4X 2C8SA 3VYMA 2GC4D 5AURA 5C9MA 2FYNB 4MU8A 1H33A 3JBTB 4J20A 1GDVA 1YEAA 3ZBMA 3SJLA 451CA 2QJPB 1LC2A 4U3FD 3WFBC 1CRGA 1W5CT 1H1OA 3L4MA 4PW9B 3SVWA 1KYOW 1U74B 1I5TA 2V07A 4QAOA 4FA9A 1M6ZA 1FJ0A 2BLFB 5GTIV 2C1UA 3CX5W 5CYTR 3HQ6A 1L0ND 2JQRA 4D6TD 1QL3A 2C1VA 1CRCA 1E29A 1A56A 2BGVX 1RZ5A 1IZL0 2EXVA 2CE1A 1FHBA 5EXQA 1CRYA 4WQ9A 2C2CA 1HH7A 1H31A 4WQCA 1E8EA 3WC8A 3MK7C 3A0BV 1CSVA 5DJQB 1CTZA 1CIHA 1AOFA 2A06D 5E79V 3OCDA 1F1FA 2ORLA 3CWBD 1YEBA 4KMGA 1GQ1A 1RAQA 1P84D 1VYDA 1CXCA 1KYOD 1N9CA 1LMSA 4FA4A 1FI9A 1C6SA 1J3SA 2B0ZB 3ZOOA 3H1LD 1ZZHA 3BCCD 1CSUA 5CIDB 1CYCA 1K3GA 1C6OA 1JDLA 1A8CA 3HQ9A 1I8PA 3L73D 4FAVA 3DR0A 1SQXD 4O1QA 3X39A 3O1YA 1QL4A 1PPJD 1SQVD 1S6VB 2L4DA 1CC5A 3L70D 2C1DA 5B66V 1YTCA 1DW0A 1N90A 1F1CA 1C2RA 5GTHV 3OA8A 1SQQD 2AI5A 3ZOWA 4L3GA 1GKSA 2CE0A 1GU2A 3HQ7A 1YIQA 4AANA 1IQCA 3NBSA 3L74D 5CIFB 3L71D 1OAEA 1CNOA 4WQEA 3H1KD 5CICB 1NU1D 3PXTA 4DY9A 3WU2V 3RN1A 1WEJF 3DP5A 2GB8B 4GEDB 1BGYD 5DF5A 2OZ1B 5CIHB 4EIEA 1M70A 2B10B 4AX3A 1AYGA 4AALA 3KZIV 1DIQC 2B11B 2N9IA 1IRVA 3CXHD 1L9JC 1CRIA 2ZXYA 1C7MA 4WQDA 3WFCC 1CIFA 2FRCA 2ZBOA 2N3BA 4PJ0V 1COTA 5H2FV 2C9XB 1QYZA 1CHHA 5DJQC 2PCBB 3CP5A 4H0JA 1I6EA 1GIWA 1H32B 4V2KA 1YNRA 1CCRA 4AAOA 1I6DA 2N3YA 2DVHA 2V08A 1E2RA 2YQBA 3ORVA 1IO3A 3WFEC 1ZRTD 2QJYB 1CTJA 1S5LV 5KAFV 1HJ4A 2BCCD 2ZONG 1KX7A 1SQPD 1AOQA 1FI3A 1CIEA 2HV4A 3ZIYA 1C2NA 1QN2A 4YE1A 1DW3A 2GIWA 3L72D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EIC A;  2N18 B;  3ZOX A;  3WFD C;  1W2L A;  3CYT I;  1CED A;  1L0L D;  3O0R C;  3NBT A;  2XTS B;  1CYJ A;  2MTA C;  3H1J D;  2N9J A;  4AAM A;  1NNO A;  3A0H V;  4GYD A;  3O5C A;  4EID A;  1OCD A;  3PXS A;  4L3H A;  1AKK A;  3CX5 D;  3RN0 A;  1LS9 A;  2AXT V;  3NWV A;  2MHM A;  3SXT A;  1I55 A;  1HRO A;  3TGU D;  1CRH A;  1L9B C;  2CA3 B;  3A9F A;  1U75 B;  1H33 B;  4L1Q A;  1H9X A;  1K3H A;  2ZZS 1;  5DFS A;  1NMI A;  1KB9 D;  2AIU A;  1DT1 A;  351C A;  4IL6 V;  3VRD A;  1DVV A;  1LC1 A;  3M97 X;  1ETP A;  1H9Y A;  1N15 A;  2DGE A;  4PD4 D;  1HJ3 A;  1A2S A;  2PAC A;  3L75 D;  3PXW A;  1M60 A;  1DW1 A;  1LFM A;  1BE3 D;  1DVH A;  1NML A;  2BPB B;  3SWS A;  1DW2 A;  4FAN A;  3RMZ A;  4FA5 A;  3C2C A;  4H0K A;  4UB6 V;  1FOC A;  1CYI A;  2D0W A;  2YK3 A;  1DII C;  2CXB A;  1IRW A;  1QKS A;  1FCD C;  2D0S A;  3DMI A;  5B6Q A;  1I54 A;  1N50 A;  4LJI A;  3TYI A;  3ZOY A;  1YCC A;  2I8F A;  2OZ1 A;  1NIR A;  1YIC A;  1BL9 A;  4K3I A;  1H31 B;  4EIF A;  2LIR A;  4WQB A;  2YCC A;  1CO6 A;  1KIB A;  4N0K A;  4XYD B;  4FB1 A;  2N18 C;  1MZ4 A;  2FWL A;  2VHD A;  4P4Q B;  1B7V A;  1CSW A;  3OCD B;  4NFG B;  1CIG A;  4XXL A;  1FI7 A;  3ZCF A;  1MG3 D;  1MG2 D;  3O20 A;  2BH5 X;  1HRC A;  1SQB D;  1RAP A;  2YIU B;  1H32 A;  1RZ6 A;  5TIS V;  1YFC A;  1BCC D;  4JCG A;  1HJ5 A;  3H1H D;  1C75 A;  3L4O A;  2PCC B;  1PP9 D;  5CIB B;  1CXA A;  3VNW A;  1CHI A;  4WQA A;  1HCM A;  2CA4 B;  1R0Q A;  4WQ7 A;  4Y5R A;  2ZOO A;  5C0Z A;  5CIE B;  2GC7 D;  3CXH W;  2C1D B;  1C52 A;  4RSZ A;  4UB8 V;  4Q5P A;  2JTI B;  2FYU D;  5KAI V;  1HZV A;  2LIT A;  3H1I D;  3MK7 B;  5B5E V;  3HQ8 A;  3RLM A;  1NTK D;  1COR A;  3OA8 B;  2B4Z A;  5CIG B;  1C6R A;  1GJQ A;  1NTZ D;  5KLV D;  3SLE A;  1CCH A;  4O1W A;  155C A;  1CHJ A;  2B12 B;  3WUI A;  1EB7 A;  5IY5 1;  5KLI B;  1WVE C;  1CSX A;  1KV9 A;  4FA1 A;  1CTY A;  4WQ8 A;  1KX2 A;  1EZV D;  2BCN B;  1HZU A;  1CRJ A;  1KB0 A;  3PH2 B;  1I8O A;  2IBZ D;  5KKZ B;  2QJK B;  3CU4 A;  1NTM D;  4PWA A;  2BH4 X;  2C8S A;  3VYM A;  2GC4 D;  5AUR A;  5C9M A;  2FYN B;  4MU8 A;  1H33 A;  3JBT B;  4J20 A;  1GDV A;  1YEA A;  3ZBM A;  3SJL A;  451C A;  2QJP B;  1LC2 A;  4U3F D;  3WFB C;  1CRG A;  1W5C T;  1H1O A;  3L4M A;  4PW9 B;  3SVW A;  1KYO W;  1U74 B;  1I5T A;  2V07 A;  4QAO A;  4FA9 A;  1M6Z A;  1FJ0 A;  2BLF B;  5GTI V;  2C1U A;  3CX5 W;  5CYT R;  3HQ6 A;  1L0N D;  2JQR A;  4D6T D;  1QL3 A;  2C1V A;  1CRC A;  1E29 A;  1A56 A;  2BGV X;  1RZ5 A;  1IZL 0;  2EXV A;  2CE1 A;  1FHB A;  5EXQ A;  1CRY A;  4WQ9 A;  2C2C A;  1HH7 A;  1H31 A;  4WQC A;  1E8E A;  3WC8 A;  3MK7 C;  3A0B V;  1CSV A;  5DJQ B;  1CTZ A;  1CIH A;  1AOF A;  2A06 D;  5E79 V;  3OCD A;  1F1F A;  2ORL A;  3CWB D;  1YEB A;  4KMG A;  1GQ1 A;  1RAQ A;  1P84 D;  1VYD A;  1CXC A;  1KYO D;  1N9C A;  1LMS A;  4FA4 A;  1FI9 A;  1C6S A;  1J3S A;  2B0Z B;  3ZOO A;  3H1L D;  1ZZH A;  3BCC D;  1CSU A;  5CID B;  1CYC A;  1K3G A;  1C6O A;  1JDL A;  1A8C A;  3HQ9 A;  1I8P A;  3L73 D;  4FAV A;  3DR0 A;  1SQX D;  4O1Q A;  3X39 A;  3O1Y A;  1QL4 A;  1PPJ D;  1SQV D;  1S6V B;  2L4D A;  1CC5 A;  3L70 D;  2C1D A;  5B66 V;  1YTC A;  1DW0 A;  1N90 A;  1F1C A;  1C2R A;  5GTH V;  3OA8 A;  1SQQ D;  2AI5 A;  3ZOW A;  4L3G A;  1GKS A;  2CE0 A;  1GU2 A;  3HQ7 A;  1YIQ A;  4AAN A;  1IQC A;  3NBS A;  3L74 D;  5CIF B;  3L71 D;  1OAE A;  1CNO A;  4WQE A;  3H1K D;  5CIC B;  1NU1 D;  3PXT A;  4DY9 A;  3WU2 V;  3RN1 A;  1WEJ F;  3DP5 A;  2GB8 B;  4GED B;  1BGY D;  5DF5 A;  2OZ1 B;  5CIH B;  4EIE A;  1M70 A;  2B10 B;  4AX3 A;  1AYG A;  4AAL A;  3KZI V;  1DIQ C;  2B11 B;  2N9I A;  1IRV A;  3CXH D;  1L9J C;  1CRI A;  2ZXY A;  1C7M A;  4WQD A;  3WFC C;  1CIF A;  2FRC A;  2ZBO A;  2N3B A;  4PJ0 V;  1COT A;  5H2F V;  2C9X B;  1QYZ A;  1CHH A;  5DJQ C;  2PCB B;  3CP5 A;  4H0J A;  1I6E A;  1GIW A;  1H32 B;  4V2K A;  1YNR A;  1CCR A;  4AAO A;  1I6D A;  2N3Y A;  2DVH A;  2V08 A;  1E2R A;  2YQB A;  3ORV A;  1IO3 A;  3WFE C;  1ZRT D;  2QJY B;  1CTJ A;  1S5L V;  5KAF V;  1HJ4 A;  2BCC D;  2ZON G;  1KX7 A;  1SQP D;  1AOQ A;  1FI3 A;  1CIE A;  2HV4 A;  3ZIY A;  1C2N A;  1QN2 A;  4YE1 A;  1DW3 A;  2GIW A;  3L72 D; 
#chains in the Genus database with same CATH topology
 4EIC A;  2N18 B;  3ZOX A;  3WFD C;  1W2L A;  3CYT I;  1CED A;  1L0L D;  3O0R C;  3NBT A;  2XTS B;  1CYJ A;  2MTA C;  3H1J D;  2N9J A;  4AAM A;  1NNO A;  3A0H V;  4GYD A;  3O5C A;  4EID A;  1OCD A;  3PXS A;  4L3H A;  1AKK A;  3CX5 D;  3RN0 A;  1LS9 A;  2AXT V;  3NWV A;  2MHM A;  3SXT A;  1I55 A;  1HRO A;  3TGU D;  1CRH A;  1L9B C;  2CA3 B;  3A9F A;  1U75 B;  1H33 B;  4L1Q A;  1H9X A;  1K3H A;  2ZZS 1;  5DFS A;  1NMI A;  1KB9 D;  2AIU A;  1DT1 A;  351C A;  4IL6 V;  3VRD A;  1DVV A;  1LC1 A;  3M97 X;  1ETP A;  1H9Y A;  1N15 A;  2DGE A;  4PD4 D;  1HJ3 A;  1A2S A;  2PAC A;  3L75 D;  3PXW A;  1M60 A;  1DW1 A;  1LFM A;  1BE3 D;  1DVH A;  1NML A;  2BPB B;  3SWS A;  1DW2 A;  4FAN A;  3RMZ A;  4FA5 A;  3C2C A;  4H0K A;  4UB6 V;  1FOC A;  1CYI A;  2D0W A;  2YK3 A;  1DII C;  2CXB A;  1IRW A;  1QKS A;  1FCD C;  2D0S A;  3DMI A;  5B6Q A;  1I54 A;  1N50 A;  4LJI A;  3TYI A;  3ZOY A;  1YCC A;  2I8F A;  2OZ1 A;  1NIR A;  1YIC A;  1BL9 A;  4K3I A;  1H31 B;  4EIF A;  2LIR A;  4WQB A;  2YCC A;  1CO6 A;  1KIB A;  4N0K A;  4XYD B;  4FB1 A;  2N18 C;  1MZ4 A;  2FWL A;  2VHD A;  4P4Q B;  1B7V A;  1CSW A;  3OCD B;  4NFG B;  1CIG A;  4XXL A;  1FI7 A;  3ZCF A;  1MG3 D;  1MG2 D;  3O20 A;  2BH5 X;  1HRC A;  1SQB D;  1RAP A;  2YIU B;  1H32 A;  1RZ6 A;  5TIS V;  1YFC A;  1BCC D;  4JCG A;  1HJ5 A;  3H1H D;  1C75 A;  3L4O A;  2PCC B;  1PP9 D;  5CIB B;  1CXA A;  3VNW A;  1CHI A;  4WQA A;  1HCM A;  2CA4 B;  1R0Q A;  4WQ7 A;  4Y5R A;  2ZOO A;  5C0Z A;  5CIE B;  2GC7 D;  3CXH W;  2C1D B;  1C52 A;  4RSZ A;  4UB8 V;  4Q5P A;  2JTI B;  2FYU D;  5KAI V;  1HZV A;  2LIT A;  3H1I D;  3MK7 B;  5B5E V;  3HQ8 A;  3RLM A;  1NTK D;  1COR A;  3OA8 B;  2B4Z A;  5CIG B;  1C6R A;  1GJQ A;  1NTZ D;  5KLV D;  3SLE A;  1CCH A;  4O1W A;  155C A;  1CHJ A;  2B12 B;  3WUI A;  1EB7 A;  5IY5 1;  5KLI B;  1WVE C;  1CSX A;  1KV9 A;  4FA1 A;  1CTY A;  4WQ8 A;  1KX2 A;  1EZV D;  2BCN B;  1HZU A;  1CRJ A;  1KB0 A;  3PH2 B;  1I8O A;  2IBZ D;  5KKZ B;  2QJK B;  3CU4 A;  1NTM D;  4PWA A;  2BH4 X;  2C8S A;  3VYM A;  2GC4 D;  5AUR A;  5C9M A;  2FYN B;  4MU8 A;  1H33 A;  3JBT B;  4J20 A;  1GDV A;  1YEA A;  3ZBM A;  3SJL A;  451C A;  2QJP B;  1LC2 A;  4U3F D;  3WFB C;  1CRG A;  1W5C T;  1H1O A;  3L4M A;  4PW9 B;  3SVW A;  1KYO W;  1U74 B;  1I5T A;  2V07 A;  4QAO A;  4FA9 A;  1M6Z A;  1FJ0 A;  2BLF B;  5GTI V;  2C1U A;  3CX5 W;  5CYT R;  3HQ6 A;  1L0N D;  2JQR A;  4D6T D;  1QL3 A;  2C1V A;  1CRC A;  1E29 A;  1A56 A;  2BGV X;  1RZ5 A;  1IZL 0;  2EXV A;  2CE1 A;  1FHB A;  5EXQ A;  1CRY A;  4WQ9 A;  2C2C A;  1HH7 A;  1H31 A;  4WQC A;  1E8E A;  3WC8 A;  3MK7 C;  3A0B V;  1CSV A;  5DJQ B;  1CTZ A;  1CIH A;  1AOF A;  2A06 D;  5E79 V;  3OCD A;  1F1F A;  2ORL A;  3CWB D;  1YEB A;  4KMG A;  1GQ1 A;  1RAQ A;  1P84 D;  1VYD A;  1CXC A;  1KYO D;  1N9C A;  1LMS A;  4FA4 A;  1FI9 A;  1C6S A;  1J3S A;  2B0Z B;  3ZOO A;  3H1L D;  1ZZH A;  3BCC D;  1CSU A;  5CID B;  1CYC A;  1K3G A;  1C6O A;  1JDL A;  1A8C A;  3HQ9 A;  1I8P A;  3L73 D;  4FAV A;  3DR0 A;  1SQX D;  4O1Q A;  3X39 A;  3O1Y A;  1QL4 A;  1PPJ D;  1SQV D;  1S6V B;  2L4D A;  1CC5 A;  3L70 D;  2C1D A;  5B66 V;  1YTC A;  1DW0 A;  1N90 A;  1F1C A;  1C2R A;  5GTH V;  3OA8 A;  1SQQ D;  2AI5 A;  3ZOW A;  4L3G A;  1GKS A;  2CE0 A;  1GU2 A;  3HQ7 A;  1YIQ A;  4AAN A;  1IQC A;  3NBS A;  3L74 D;  5CIF B;  3L71 D;  1OAE A;  1CNO A;  4WQE A;  3H1K D;  5CIC B;  1NU1 D;  3PXT A;  4DY9 A;  3WU2 V;  3RN1 A;  1WEJ F;  3DP5 A;  2GB8 B;  4GED B;  1BGY D;  5DF5 A;  2OZ1 B;  5CIH B;  4EIE A;  1M70 A;  2B10 B;  4AX3 A;  1AYG A;  4AAL A;  3KZI V;  1DIQ C;  2B11 B;  2N9I A;  1IRV A;  3CXH D;  3D0W A;  1L9J C;  1CRI A;  2ZXY A;  1C7M A;  4WQD A;  3WFC C;  1CIF A;  2FRC A;  2ZBO A;  2N3B A;  4PJ0 V;  1COT A;  5H2F V;  2C9X B;  1QYZ A;  1CHH A;  5DJQ C;  2PCB B;  3CP5 A;  4H0J A;  1I6E A;  1GIW A;  1H32 B;  4V2K A;  1YNR A;  1CCR A;  4AAO A;  1I6D A;  2N3Y A;  2DVH A;  2V08 A;  1E2R A;  2YQB A;  3ORV A;  1IO3 A;  3WFE C;  1ZRT D;  2QJY B;  1CTJ A;  1S5L V;  5KAF V;  1HJ4 A;  2BCC D;  2ZON G;  1KX7 A;  1SQP D;  1AOQ A;  1FI3 A;  1CIE A;  2HV4 A;  3ZIY A;  1C2N A;  1QN2 A;  4YE1 A;  1DW3 A;  2GIW A;  3L72 D; 
#chains in the Genus database with same CATH homology
 4EIC A;  2N18 B;  3ZOX A;  3WFD C;  1W2L A;  3CYT I;  1CED A;  1L0L D;  3O0R C;  3NBT A;  2XTS B;  1CYJ A;  2MTA C;  3H1J D;  2N9J A;  4AAM A;  1NNO A;  3A0H V;  4GYD A;  3O5C A;  4EID A;  1OCD A;  3PXS A;  4L3H A;  1AKK A;  3CX5 D;  3RN0 A;  1LS9 A;  2AXT V;  3NWV A;  2MHM A;  3SXT A;  1I55 A;  1HRO A;  3TGU D;  1CRH A;  1L9B C;  2CA3 B;  3A9F A;  1U75 B;  1H33 B;  4L1Q A;  1H9X A;  1K3H A;  2ZZS 1;  5DFS A;  1NMI A;  1KB9 D;  2AIU A;  1DT1 A;  351C A;  4IL6 V;  3VRD A;  1DVV A;  1LC1 A;  3M97 X;  1ETP A;  1H9Y A;  1N15 A;  2DGE A;  4PD4 D;  1HJ3 A;  1A2S A;  2PAC A;  3L75 D;  3PXW A;  1M60 A;  1DW1 A;  1LFM A;  1BE3 D;  1DVH A;  1NML A;  2BPB B;  3SWS A;  1DW2 A;  4FAN A;  3RMZ A;  4FA5 A;  3C2C A;  4H0K A;  4UB6 V;  1FOC A;  1CYI A;  2D0W A;  2YK3 A;  1DII C;  2CXB A;  1IRW A;  1QKS A;  1FCD C;  2D0S A;  3DMI A;  5B6Q A;  1I54 A;  1N50 A;  4LJI A;  3TYI A;  3ZOY A;  1YCC A;  2I8F A;  2OZ1 A;  1NIR A;  1YIC A;  1BL9 A;  4K3I A;  1H31 B;  4EIF A;  2LIR A;  4WQB A;  2YCC A;  1CO6 A;  1KIB A;  4N0K A;  4XYD B;  4FB1 A;  2N18 C;  1MZ4 A;  2FWL A;  2VHD A;  4P4Q B;  1B7V A;  1CSW A;  3OCD B;  4NFG B;  1CIG A;  4XXL A;  1FI7 A;  3ZCF A;  1MG3 D;  1MG2 D;  3O20 A;  2BH5 X;  1HRC A;  1SQB D;  1RAP A;  2YIU B;  1H32 A;  1RZ6 A;  5TIS V;  1YFC A;  1BCC D;  4JCG A;  1HJ5 A;  3H1H D;  1C75 A;  3L4O A;  2PCC B;  1PP9 D;  5CIB B;  1CXA A;  3VNW A;  1CHI A;  4WQA A;  1HCM A;  2CA4 B;  1R0Q A;  4WQ7 A;  4Y5R A;  2ZOO A;  5C0Z A;  5CIE B;  2GC7 D;  3CXH W;  2C1D B;  1C52 A;  4RSZ A;  4UB8 V;  4Q5P A;  2JTI B;  2FYU D;  5KAI V;  1HZV A;  2LIT A;  3H1I D;  3MK7 B;  5B5E V;  3HQ8 A;  3RLM A;  1NTK D;  1COR A;  3OA8 B;  2B4Z A;  5CIG B;  1C6R A;  1GJQ A;  1NTZ D;  5KLV D;  3SLE A;  1CCH A;  4O1W A;  155C A;  1CHJ A;  2B12 B;  3WUI A;  1EB7 A;  5IY5 1;  5KLI B;  1WVE C;  1CSX A;  1KV9 A;  4FA1 A;  1CTY A;  4WQ8 A;  1KX2 A;  1EZV D;  2BCN B;  1HZU A;  1CRJ A;  1KB0 A;  3PH2 B;  1I8O A;  2IBZ D;  5KKZ B;  2QJK B;  3CU4 A;  1NTM D;  4PWA A;  2BH4 X;  2C8S A;  3VYM A;  2GC4 D;  5AUR A;  5C9M A;  2FYN B;  4MU8 A;  1H33 A;  3JBT B;  4J20 A;  1GDV A;  1YEA A;  3ZBM A;  3SJL A;  451C A;  2QJP B;  1LC2 A;  4U3F D;  3WFB C;  1CRG A;  1W5C T;  1H1O A;  3L4M A;  4PW9 B;  3SVW A;  1KYO W;  1U74 B;  1I5T A;  2V07 A;  4QAO A;  4FA9 A;  1M6Z A;  1FJ0 A;  2BLF B;  5GTI V;  2C1U A;  3CX5 W;  5CYT R;  3HQ6 A;  1L0N D;  2JQR A;  4D6T D;  1QL3 A;  2C1V A;  1CRC A;  1E29 A;  1A56 A;  2BGV X;  1RZ5 A;  1IZL 0;  2EXV A;  2CE1 A;  1FHB A;  5EXQ A;  1CRY A;  4WQ9 A;  2C2C A;  1HH7 A;  1H31 A;  4WQC A;  1E8E A;  3WC8 A;  3MK7 C;  3A0B V;  1CSV A;  5DJQ B;  1CTZ A;  1CIH A;  1AOF A;  2A06 D;  5E79 V;  3OCD A;  1F1F A;  2ORL A;  3CWB D;  1YEB A;  4KMG A;  1GQ1 A;  1RAQ A;  1P84 D;  1VYD A;  1CXC A;  1KYO D;  1N9C A;  1LMS A;  4FA4 A;  1FI9 A;  1C6S A;  1J3S A;  2B0Z B;  3ZOO A;  3H1L D;  1ZZH A;  3BCC D;  1CSU A;  5CID B;  1CYC A;  1K3G A;  1C6O A;  1JDL A;  1A8C A;  3HQ9 A;  1I8P A;  3L73 D;  4FAV A;  3DR0 A;  1SQX D;  4O1Q A;  3X39 A;  3O1Y A;  1QL4 A;  1PPJ D;  1SQV D;  1S6V B;  2L4D A;  1CC5 A;  3L70 D;  2C1D A;  5B66 V;  1YTC A;  1DW0 A;  1N90 A;  1F1C A;  1C2R A;  5GTH V;  3OA8 A;  1SQQ D;  2AI5 A;  3ZOW A;  4L3G A;  1GKS A;  2CE0 A;  1GU2 A;  3HQ7 A;  1YIQ A;  4AAN A;  1IQC A;  3NBS A;  3L74 D;  5CIF B;  3L71 D;  1OAE A;  1CNO A;  4WQE A;  3H1K D;  5CIC B;  1NU1 D;  3PXT A;  4DY9 A;  3WU2 V;  3RN1 A;  1WEJ F;  3DP5 A;  2GB8 B;  4GED B;  1BGY D;  5DF5 A;  2OZ1 B;  5CIH B;  4EIE A;  1M70 A;  2B10 B;  4AX3 A;  1AYG A;  4AAL A;  3KZI V;  1DIQ C;  2B11 B;  2N9I A;  1IRV A;  3CXH D;  1L9J C;  1CRI A;  2ZXY A;  1C7M A;  4WQD A;  3WFC C;  1CIF A;  2FRC A;  2ZBO A;  2N3B A;  4PJ0 V;  1COT A;  5H2F V;  2C9X B;  1QYZ A;  1CHH A;  5DJQ C;  2PCB B;  3CP5 A;  4H0J A;  1I6E A;  1GIW A;  1H32 B;  4V2K A;  1YNR A;  1CCR A;  4AAO A;  1I6D A;  2N3Y A;  2DVH A;  2V08 A;  1E2R A;  2YQB A;  3ORV A;  1IO3 A;  3WFE C;  1ZRT D;  2QJY B;  1CTJ A;  1S5L V;  5KAF V;  1HJ4 A;  2BCC D;  2ZON G;  1KX7 A;  1SQP D;  1AOQ A;  1FI3 A;  1CIE A;  2HV4 A;  3ZIY A;  1C2N A;  1QN2 A;  4YE1 A;  1DW3 A;  2GIW A;  3L72 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...