2QJKB

Crystal structure analysis of mutant rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
molecule keywords Cytochrome b
total genus 65
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjkB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjkB02
2C1VA 1FI7A 3OCDA 4O1QA 2XTSB 1QL4A 1YEAA 3PXWA 4EIDA 1N15A 1C75A 5DFSA 3H1HD 4LJIA 1U74B 2FWLA 1DW3A 4KMGA 1YTCA 1N90A 1CIEA 1CO6A 5KAIV 3SXTA 4FA4A 3H1KD 1QKSA 2PCBB 4WQEA 2C1UA 2BLFB 3DMIA 1L9BC 1PP9D 3VNWA 1N9CA 4UB8V 1YCCA 2BCCD 1FI3A 3A9FA 1H33B 4DY9A 4H0JA 1N50A 2QJYB 1BGYD 1CEDA 1DT1A 2D0SA 4WQBA 2QJPB 2O3JA 4O1WA 1C2NA 1H33A 1YEBA 1H9YA 2BCNB 2QG4A 1HZVA 1DIIC 1L9JC 1U75B 1C6OA 1F1FA 1CNOA 3WUIA 3HQ8A 3CXHD 3KZIV 4L1QA 3CP5A 4NFGB 2MHMA 1J3SA 1AKKA 1KX2A 5GTHV 4N0KA 2N18B 2VHDA 1I8OA 1W2LA 1NTKD 3MK7C 1COTA 1C2RA 2C1DB 2N9JA 1CRIA 1H31A 3MK7B 1I6EA 4GYDA 3CU4A 2CA3B 1LFMA 5IY51 1OAEA 1P84D 4MU8A 2Y0CA 1L0ND 1IO3A 1S5LV 3ZCFA 5C0ZA 1BL9A 1CSUA 1NMLA 1IRWA 2B11B 351CA 3VRDA 1CYJA 155CA 1SQVD 1GQ1A 3CX5D 4EIFA 2ORLA 3VYMA 2AIUA 1CTZA 5CIEB 2C9XB 2ZONG 1RZ5A 1W5CT 1E29A 4IL6V 1DW1A 5B6QA 1CRGA 2AXTV 2MTAC 1NNOA 1CHIA 1CYIA 4YE1A 4GEDB 1M60A 3L72D 1DW0A 4WQ7A 1C52A 3CYTI 3GG2A 1L0LD 1WVEC 3GW6A 1H1OA 4P4QB 1C6SA 2GC4D 5C9MA 2Y0DA 4EIEA 4XYDB 2RN0A 4FA5A 2CE1A 2JWAA 1C7MA 5B5EV 4WQ8A 1CXCA 1R0QA 2YCCA 3TYIA 1CXAA 4K3IA 5CIDB 5DJQC 5DF5A 4PW9B 1DVVA 5CIHB 1YNRA 1ZZHA 1ZRTD 2HV4A 3WFDC 1PPJD 3PHLA 1K3GA 3DP5A 4QAOA 2GIWA 3VMAA 3SVWA 1KX7A 2B4ZA 3O20A 2B0ZB 1HRCA 2LITA 2YIUB 3PH2B 2DGEA 1SQPD 3HQ9A 2ZOOA 1QN2A 2BPBB 3DR0A 3FWLA 1E2RA 1BE3D 5KLIB 2OZ1A 5E79V 1YICA 1I5TA 3ZOOA 1KB9D 2C8SA 4RJTA 1CIHA 1C6RA 1RAPA 3PLNA 5CYTR 1I54A 2KNCB 3L4OA 1OCDA 1H9XA 1HROA 2Y0EA 2LIRA 2KS1A 3ITKA 3L75D 4EICA 2N9IA 3L74D 2C1DA 2PACA 4EDFA 1KIBA 3OA8A 2Q3EA 3JBTB 3L73D 2K9JB 1MG3D 1GDVA 3WFCC 3WC8A 1HCMA 1HH7A 5TJHA 3ZOWA 1FI9A 5DJQB 2JTIB 1GIWA 2N18C 2N3YA 2EXVA 1VYDA 3CXHW 3ORVA 1B7VA 1I8PA 2C2CA 3WFBC 3KHUA 2L91A 3TDKA 1CHJA 1LC1A 4FAVA 4WQAA 2N9YB 1H31B 1RAQA 1BCCD 1H32A 4FB1A 3M97X 1CHHA 2V08A 3A0HV 3NBSA 4UB6V 5B66V 4JCGA 5TISV 4L3HA 3X39A 1E8EA 1YFCA 3ZBMA 5GTIV 1QL3A 4Y5RA 3PXTA 1CC5A 1KYOW 3NWVA 4AAOA 1NIRA 4XXLA 1JDLA 4H0KA 3BCCD 1CTJA 4WQ9A 3TF5A 1CCRA 1I55A 2N3BA 1CSWA 1AOFA 3OCDB 3RLMA 3ZIYA 1CRYA 4RSZA 1EB7A 3L70D 1FOCA 2CXBA 4D6TD 451CA 3A0BV 1MG2D 1I6DA 5H2FV 1SQXD 4L3GA 3L4MA 3TGUD 2BGVX 1S6VB 2YK3A 3ZOXA 4FA1A 1GJQA 1HZUA 5CIFB 4A7PA 2QJKB 5KKZB 1YIQA 4AANA 2BH4X 1LC2A 1GKSA 3WFEC 1CSVA 2FRCA 1LS9A 1RZ6A 2FYNB 4PJ0V 4Q5PA 3ZOYA 2A06D 3H1LD 1CSXA 1MZ4A 3SWSA 1HJ5A 3O0RC 1CTYA 2FYUD 1WEJF 1CRJA 4PD4D 2D0WA 3PXSA 1NU1D 2JQRA 3PRJA 1M70A 1NTMD 3SLEA 1EZVD 2L4DA 5CIBB 1IRVA 3PTZA 3HQ6A 2GC7D 1F1CA 3CWBD 3H1ID 3CX5W 1NMIA 1GU2A 2ZBOA 4AX3A 1CCHA 4AAMA 1CRHA 4FA9A 1IQCA 1H32B 1A8CA 3SJLA 4PWAA 2GB8B 1DIQC 1CIGA 4FANA 1CRCA 4WQCA 3OA8B 1ETPA 4J20A 1FHBA 1DVHA 2V07A 1KB0A 1NTZD 1QYZA 2AI5A 1LMSA 3L71D 5CIGB 1DW2A 1SQBD 1A2SA 4AALA 2BH5X 4V2KA 2DVHA 2B12B 3O5CA 2I8FA 3RN0A 3WU2V 2B10B 2RMZA 4U3FD 3RN1A 4WQDA 5EXQA 1HJ3A 1CYCA 1HJ4A 3NBTA 2ZXYA 3C2CA 3O1YA 3RMZA 1FJ0A 5CICB 5KLVD 1CIFA 1SQQD 2ZZS1 2OZ1B 1AOQA 1KYOD 1CORA 1A56A 2CE0A 2YQBA 3HQ7A 1AYGA 2CA4B 3H1JD 5AURA 1FCDC 1KV9A 2PCCB 1IZL0 5KAFV 1K3HA 2IBZD 1M6ZA
chains in the Genus database with same CATH superfamily
1DH3A 1FI7A 2XTSB 2N1TD 2ZJSE 2B88A 4HJGH 1UIIA 1OMIA 2FY8A 3FX0A 1J1DC 1PIXA 1RQVA 1CIEA 2IYOA 1CO6A 2ZXEB 1VF5D 1DX7A 1SQVE 2BEQD 1GL2D 1LTTC 4N6JA 3L74J 1PZQA 3IF4A 1QL2A 3H32B 4XFJA 1FI3A 1HGVA 1ZP0C 1OX3A 3EFFK 3D6ZA 4I6MC 1H33B 2XKMA 3V4WA 4DY9A 1PL5A 3LIEA 2QJKC 2WMMA 1NH4A 3GHGB 3AE1C 4JYCA 1FDIA 3VMXA 2JEEA 1VF5B 2KSJA 1QX8A 1JUNA 1T6AA 5AW3B 2BCNB 2QG4A 2JO1A 2G3AA 1PPJE 3FXEA 1CNOA 3WUIA 3HQ8A 3S1KA 5AVXB 3KZIV 3CMAP 1PGQA 2KK7A 2E76C 1AKKA 4N0KA 1N73B 4W7YA 3GF7A 1I8OA 1NTKD 2FFDB 2A45G 4L74A 2HFED 2KI7B 3RL0B 1COTA 4H0LD 2C1DB 1CRIA 3Q5SA 2D2CC 4GYDA 1KYOH 1HTLC 3L72E 2M5AB 1IO3A 3H1HE 4EIJA 4IL6X 1JY2N 3TGUE 3VN0A 1IO4A 4PV1D 2WSSH 1FAVA 1L0LJ 1EC5A 4EIFA 1SQPK 2ORLA 5CIEB 1FOSE 3C8VA 1KB9I 1DW1A 3CCRP 3T97A 3AE4C 3AEBC 1S5LX 2KLUA 2B9BA 4B86A 3C9IA 3M0DA 1JO5A 3GG2A 3V2PA 1SQVJ 5B5EH 5C9MA 1KFMA 1NAYA 3RL0g 2HG5D 2LR2A 4XYDB 2RN0A 1LTGC 2CE1A 3M06A 2A45I 4WQ8A 3TYIA 3B5NC 2KS1B 5AW2B 4YXWH 2Q1KA 3HTKA 4JBZA 1DVVA 1PGJA 2KYVA 2HV4A 4DJGA 5KLVK 3TSIA 3DP5A 1SFCD 2IFNA 2XU6A 1KX7A 2B0ZB 2KLVA 5CBOA 2DGEA 2G8YA 3AEEC 3NXSA 5B66E 5KLVG 1LP1A 4GDOA 3E7KA 3FWLA 2OYIB 2WTYA 1YTZT 3Q2YA 3HUSC 1SQPE 1A02J 2ZT9C 3ZOOA 2FFDC 2KOGA 4H13C 2JP3A 5GTHE 2KNCB 4L73A 1P84H 2QSIA 1MZ9A 1KYOE 1RHZB 2PP6A 1HROA 1FDOA 3RL0C 4EOTA 2Y0EA 2LIRA 1S5LH 3ITKA 2Q7CA 2Q3IA 2LXBA 3OW2O 1JY3O 4YTPC 1NWQA 3CI9A 2WPQA 4N3YB 1KIBA 5TISE 3L73D 1MG3D 3RK2B 3R2PA 1HH7A 4WBAA 1N8RQ 5AVVB 2PRRA 5TJHA 1VQMP 3SWYA 2QRXA 3CXHW 1I8PA 4TT3H 2L91A 3TDKA 2E5YA 1LC1A 1NTZK 4WQAA 1K04A 3F89A 1H31B 1SQPG 1RF1B 4U3FE 2O01J 3A0HV 3RL0D 2IBZI 1SQVK 2H8PD 4L3HA 3X39A 1KYOI 1E5WA 1E8EA 4OGQB 1URQC 1YFCA 3ZBMA 1CZQA 4H44D 3NWVA 1URQB 4XXLA 1FE6A 2VRSA 4K3AA 4WQ9A 2WT7A 1N7LA 1NTMG 2I1JA 1IK7A 4TLFA 4CPGA 2Z5HA 2WPRA 3ZIYA 2ITAA 3LW5H 1EB7A 4ASVA 1FOCA 2CXBA 3H1IG 2OTKE 3V5BA 5GTHH 4KHXA 4DCKA 3L4MA 3TGUD 2KZIA 4JYBA 1PV3A 3O6QA 3L74G 2YMKA 1LGHB 4H13B 4Z1MH 1A02F 1GKSA 1SQXE 1GL2B 1CSVA 4IOIH 1SQBK 2ZYGA 5DJUB 1T3UA 2P7JA 2N1TB 1VQ4P 2FYNB 4PJ0V 3AEAC 2A06D 5BU5A 1J2JB 1HJ5A 1CTYA 1SQQJ 5APTA 3AE3C 3SWKA 1CRJA 4PD4D 2D0WA 4UB6H 1HWTC 1M70A 3H1JE 2L4DA 4JPZB 5AW7B 5EFWB 5CIBB 1FU1A 5C39A 1NMIA 1CCHA 3JC22 5AVUB 1G1JA 3P8MC 1SQQK 4AUWA 1JNMA 3G9RA 2KB7P 1BGYG 3IR9A 1KMIZ 3H1KG 1HBWA 3JSVC 3CCLP 3D6YA 4WQCA 1GW3A 3OAKA 3M9QA 4H44B 4HKZH 1FHBA 2OYHA 1FOSF 3I56P 1L4AC 4I2LC 1KB0A 1QYZA 2K9YA 5AVYB 2HODA 4AALA 1LTBC 4U3FD 3RN1A 4YXDC 4WQDA 4LC1A 5EXQA 1NTME 4GODA 1SQBE 3HRNA 1CYCA 1HJ4A 3NBTA 2GA1A 2ZXYA 3M0AA 3C2CA 1NU1G 1OFCX 4UB6E 1ZOYC 1AOQA 4UB8E 4GT1A 1CORA 1A56A 2JWDA 5AURA 1FCDC 2WSEH 2PCCB 3KYQA 2KUBA 1EDLA 2IBZD 1M6ZA 5APSA 3A0HE 5CJ0A 3B5NB 1N7SC 2YNYA 3TNUB 1N15A 2GUVA 3CX5H 3N7NA 2OTJP 3B8EB 1FC2C 3H1KJ 4LJIA 1DD4A 1U74B 2FWLA 2IZ1A 3SFEC 2NPSA 3GF3A 1FZCA 4FA4A 4PV1C 3HD7C 2KNCA 4YPCA 4Y99B 4PD4H 2XDJA 3S9OA 3DMIA 1S5LE 4GOFA 1VQ9P 3G6EP 1HF9A 1PP9D 4XE5B 3AECC 2WT7B 1USDA 2BCCD 3A9FA 1SQBG 4GOEA 2ZAEB 3V2RA 4WY4C 1EZVE 2N1TA 1RF0C 2Z5IA 1DIPA 1N50A 2ZYDA 1BGYD 1CEDA 5KAFH 4PD4E 2D0SA 1BE3J 3KPEA 2QE7H 1NKNA 1H9YA 1Y9BA 1ZV8A 1HZVA 1WT6A 5KAIE 1U75B 1C6OA 3WUTA 2E43A 5AVSB 3G71P 3H1HG 1SP4A 2DW3A 3PP5A 1J3SA 3TGUG 3HE4A 1W2LA 2OYHB 1GL2A 1URQD 3ZDMA 5AW0B 2XNXA 2CA3B 3CCJP 5IY51 2HPCA 1EZVI 4MU8A 4DT0A 2Y0CA 1JTHB 1L0ND 4RESB 2W90A 5AW6B 5C0ZA 1MV8A 3L35A 1NMLA 3L73J 4MN4C 5CCHC 3CXHE 1SQVD 3CX5D 1SS1A 3L75J 3VYMA 1CTZA 3MHVA 1W5CT 1UIXA 1NU1K 2E76D 1EZVG 4BRYA 1VQ7P 2P10A 2UWJE 4WB4A 1CHIA 1SFCC 2H7HA 4YE1A 2CPBA 4XA4A 3L72D 1IFNA 3RK3C 2QJPC 1DW0A 2FBWC 5AW1B 3CYTI 1L0LD 1WVEC 2WSCH 1SQXK 3L75E 3GW6A 2WQYC 3JCUH 1C6SA 2GC4D 1SFCA 1HVVA 1L2PA 4EIEA 3HD7B 5AVQB 4FA5A 2JWAA 1C7MA 1SQPJ 3PJSK 3G4SP 1VQPP 2ZXXA 3NFQA 2YCCA 1CXAA 4K3IA 2OARA 2P2UA 4PW9B 2J58A 3WFDC 1PPJD 2HYNA 1ZN5A 3PHLA 2PFXA 3RGUA 1NYHA 3L71G 3L71E 5AW9B 2GIWA 4IL6H 3AEGC 1GL2C 2B4ZA 3L37A 2RKLA 2LITA 2YIUB 3PH2B 3D0WA 2R32A 2C0XA 3VYIA 3DR0A 1AVOA 1E2RA 4BWNA 3D71A 2PAJA 4I1LA 2C8SA 1KB9E 1AFOA 3EFGA 1CIHA 1L0NG 5CCHA 3M9BA 2D2CD 2E75B 3PLNA 2FFDA 2A06E 1I54A 3L4OA 1H9XA 1FZGA 2W8ZA 4AQRD 2YO3A 4O9BA 1K9MQ 2GM4A 2N9IA 5L8RJ 3KXDA 4RKUJ 4HH2A 1KN7A 3A3YB 2C1DA 2PACA 3CCEP 4C7NA 3JBTB 2K9JB 4PJ0E 3L70G 1GDVA 2W6JH 2JR8A 1HCMA 5CMZA 1KZUB 3ZOWA 1FI9A 1M1JA 5DJQB 2LXCB 2HODB 1VYDA 3ORVA 1TU3F 5GTIE 2B89A 4FAVA 1HH0A 2N9YB 2K1AA 1RAQA 1H32A 3MP7B 1IFIA 1LWUC 3UIAA 3L4FA 5TISV 2LKMA 2H89C 2JJLA 4D6TE 2R5DA 4NPDA 3GHGA 2PGDA 5GTIV 1QL3A 1D7MA 1CC5A 1WRGA 3CC2P 3RK2D 1NIRA 2QVAA 1M57D 4H0KA 1CTJA 1I55A 1LTIC 2N3BA 1EQ7A 4RSZA 4PV1B 3CWBE 4I7ZC 3A0BV 3H25A 4R4LA 1KB9H 3OJAB 1NAFA 3CCUP 1SQXD 4L3GA 3M91A 1CI6A 2W6BA 4NPEA 3ZOXA 3H1IJ 1SQVG 1GJQA 3VMZA 5CIFB 1L4AD 2P58A 5KKZB 1YIQA 2V7QH 4AANA 2I8DA 1RY3A 2FXOA 3LIDA 3H1JG 2XNDH 1EXIA 2JKVA 2FRCA 1LS9A 3A5TA 1GU5A 1NTMK 4KT0J 1JCDA 3ZOYA 2WITA 3SWSA 2J59M 1KORA 1L4AA 2HR3A 1OXZA 1FZCB 1NU1D 1JTHA 4H13D 4ZMDA 1GU4A 2OTLP 2V4HA 3CC7P 1JY2O 4HYTB 3MGNA 1SQBJ 1F1CA 5AW4B 3H32A 1HGZA 3MZWB 3CX5W 5BVZA 1GU2A 3USSA 1VQNP 1W5CE 4AX3A 2NZ2A 1LP1B 2ZT9D 1CRHA 2H88C 1Q82Q 3EWKA 1BSHA 4IFDK 1AV1A 3BCCE 1H32B 3SJLA 3CCQP 4GIFA 3L70J 4OGQC 4FANA 2OYIA 4JQ0D 4NPFX 3OA8B 4C7NB 2V07A 2AI5A 5CIGB 1LMSA 1AVYA 1SQBD 1A2SA 3BRVB 2DVHA 2B12B 5K5GB 3Q5RA 1DD3A 2AEFA 1KQLA 1XTGB 1YBKA 1H88A 1ZR2A 5M1BA 5CICB 2MJZA 2SPZA 1CIFA 2ZZS1 1AQTA 2K88A 1KYOD 2HLOA 2E76B 3I55P 2W27A 2YQBA 2CE0A 3P7KA 1KV9A 1SQQE 5KAFV 3AE2C 1NU1E 3IFMA 1QL4A 3CWBG 1PP9E 3PXWA 1C75A 1EXJA 1LTAC 1YIJP 3H1HD 4M3LA 4WY4D 2R3CA 3II6A 5AVRB 4ZKPA 1LTJB 1QKSA 3WMM0 1ZRTE 1N7SD 2K37A 2BLFB 2IYPA 1NTZG 3BATA 1W2EA 2KZJA 3GMAA 3CCMP 2V7QJ 1IFDA 1JY2P 5KTBA 4H0JA 1BSNA 2QJYB 1DT1A 1PFIA 2FYUE 3O6QB 1ZXGA 1IFMA 2NRGA 4O1WA 3CLQA 3I5CA 2QA4P 1DIIC 1PGPA 1L9JC 4W80A 1F1FA 3QWOC 1MKMA 2BEZF 1L0LG 1FJKA 4U3FG 4L1QA 3CP5A 1OVUA 4NFGB 2MHMA 1T8ZA 1BCCJ 2BCCJ 1E79H 4RO0A 1L4AB 2QEXP 1KILB 2Q6QA 1DEEG 2N18B 1U7MA 1N7SA 1K05A 2FYZA 5H2FH 5BU8B 1QVGO 1LFMA 1OAEA 1P84D 4OWFA 3ZCFA 1W2BO 1CSUA 3C1LA 4N78E 2A06G 2B11B 1OW6A 1RQUA 1LT9C 2XV5A 1RE3C 3SSUA 1T2KD 1NTKE 3WU2E 4BXLA 5AVZB 3L75G 2C9XB 5B6QA 1CRGA 2AXTV 2MTAC 1G2CB 1OIPA 1CYIA 1PP9G 2QM7A 1S1CX 3Q1MA 2N1TC 1JB0J 3H1LG 1VQ8P 1Q90D 4OH8B 1L0NJ 5B5EV 1CXCA 1NTZJ 1R0QA 4UB8H 1Q2NA 5DF5A 5CIHB 1YNRA 1ZZHA 1LTSC 1VPCA 3B5NA 1ZRTD 3L36A 1K3GA 1NTZE 1EDKA 4AYCA 3WUUA 2J5UA 2GUSA 5B5EE 3VMAA 3SVWA 3L74E 3EQ2A 1S2EA 1HRCA 3FGAD 1SQPD 3HQ9A 1GZLA 1YHQP 3QH9A 4H44C 4WY4A 3P32A 5AW8B 3W68A 1CW5A 3NMDA 3A0BE 3HD7D 1BE3D 5KLIB 1I5TA 1HJ0A 1NJIQ 2C9LY 3TNUA 5KLIC 1YI2P 1C6RA 1X22A 2IBZG 4JF7A 1GK6A 2QJYC 3HD7A 5CYTR 1GDTA 2WSFJ 1VL2A 2Z4EA 2XZRA 1QVFO 2KS1A 5H2FE 3L75D 4EICA 1LTJA 1PP9J 1LT9B 1KQFB 2WSCJ 3A7OA 1FDMA 4EDFA 3OA8A 2KSEA 1RF0A 3SFDC 1SLQA 4ASWA 2OYIC 3CX5E 3B5ND 4Y28J 1GIWA 2N18C 2EXVA 1B7VA 2C2CA 1NHLA 3AEFC 1JM0A 2WZ7A 5APQA 1YITP 1KILE 2E42A 3B4SA 1GK4A 1L0NK 1LT1A 2IPPA 4R4MA 2I1KA 3MUDA 1YJNP 3U1CA 4FB1A 1URQA 1CHHA 2V08A 4UB6V 5B66V 4JCGA 3KZIE 5KLVJ 1YJWP 1WMKA 2FXPA 3CCVP 2A45H 1T2KC 2M3BA 2YKQA 1GD2E 2ZT9B 4OVNF 3PXTA 1KYOW 4U3FJ 4AAOA 4C7RA 2N9BA 4PJ0H 1Y8AA 1KQGB 1BGYJ 3MD0A 5KAFE 3N4XA 2C9NY 1QLED 3CX5I 3OCDB 2AEJA 1ZR4A 3HTKB 3E1IA 1X8YA 451CA 3TYYA 1BGYE 1MG2D 3U59A 1I6DA 1KV4A 2YIUC 5KJ7C 5APXA 4FA1A 1BCCG 1YQ4C 1AQ5A 1SQQG 2WVRA 1LJ2A 1LC2A 2OQQA 1JY3N 1OZHA 3WFEC 1M1JC 1NTMJ 1NO4A 2NPSB 5CCGA 2YO2A 5CCHD 1RZ6A 2FYUJ 3L70E 4W7ZA 3H1JJ 3IN6A 2B87B 1CSXA 1MZ4A 4HB1A 3O0RC 2FYUD 1WEJF 2HPCB 1N73A 3GHGC 3WUVA 2IBZE 3M9HA 1BDDA 1NTMD 3FWNA 1P84I 1FZAA 3U1AA 1CSBA 2WSEJ 4U7JA 3PTZA 4QMAA 3VMYA 2WPVB 1U7JA 1J1DB 3JCUE 5AVTB 2ZBOA 1LWUB 1K73Q 3RK3B 1BE3E 1VQOP 4ZKUA 3AE8C 5KAIH 1IQCA 4WVZA 2WWWA 1RF1A 1YTZI 1S72P 4PWAA 3B71A 2GB8B 3S4RA 1QGKB 1DIQC 3TK1A 1S9KD 1CIGA 1MFZA 3L73E 4BRYB 1CRCA 1ETPA 1U57A 3CXHH 3KQGA 1NTZD 1VDFA 1Q81Q 1DW2A 3VTPC 4IFFA 3O5CA 3RN0A 3WU2V 1R5LA 2RMZA 1X79B 3F5HA 2FYUK 5CCGC 2IFMA 1KILD 2WPSA 3HUSA 5KLVD 1SVFA 1SQQD 1KTMA 3OA7A 5KJ7D 1IZNB 1OWAA 2CA4B 3H1JD 2QM8A 1LNQA 5CHXA 1IZL0 1K3HA 2C1VA 4O1QA 3OCDA 3G3ZA 1M1KQ 1YEAA 3A0HH 3MTUE 4EIDA 2M0BA 2POHA 5DFSA 1GTWA 4LGDE 1AJYA 1DW3A 4KMGA 1YTCA 4L76A 1N90A 2WSFH 3RBZA 2KP8A 1J1EB 5KAIV 3SXTA 3H1KD 2PCBB 1RF1C 4WQEA 1IJDB 2C1UA 4H0LC 1J1EC 5GTIH 2R5BA 4N78D 1NTKJ 1L9BC 1YQ3C 1L0LE 3CL3D 2IDBA 1IK9A 3VNWA 1HJBA 1N9CA 4UB8V 1FZCC 1CI6B 1YCCA 2E74C 2BASA 3H1LE 1SFCB 1ZW0A 1JY3P 2Y9YA 2YXQB 3M0DC 4WQBA 3AEDC 1DEBA 2CPSA 2QJPB 2O3JA 1C2NA 1H33A 1YEBA 2AXTH 1FZEA 2H43A 1L0NE 3LW5J 2ZVOB 1FZFA 1M8OB 3HUSB 3CXHD 2ZVNB 3P8CE 1SQXG 1M56D 1ZLLA 2YKOA 1KX2A 5GTHV 1OW7A 2VHDA 1MUUA 3MK7C 3H1KE 3H6PA 1C2RA 2N9JA 1H31A 3MK7B 1I6EA 3CU4A 4IL6E 2O01H 3MUDC 1VF5C 3HE4B 2CK3H 5E79H 1S5LV 2M8RA 2YKPA 1BL9A 4EI2A 1G2CA 1IRWA 351CA 3VRDA 1CYJA 1JOCA 155CA 1H0TA 1GQ1A 2Q9IA 2E75C 3IAOA 2W6AA 3MIWA 3Q3DA 5KKZC 2AIUA 2ZONG 1RZ5A 1E29A 2Q5UA 4L75A 3BRTB 4GKGA 3KDPB 4IL6V 3HE5B 1VQLP 3ABVC 1BE3G 1NNOA 1Z56A 2BCCE 4WY4B 1IFJA 1G1IA 4GEDB 1M60A 1P84E 3A2AA 3VP8A 2ZYAA 4WQ7A 1C52A 2JDIH 4K35A 1LTJC 4C46A 3K5BA 1H1OA 4P4QB 2Y0DA 2AXCA 2B87A 3V6IA 2C0WA 1NTKG 5CIDB 2IZ0A 5DJQC 1KC8Q 2OYOA 3AE7C 3TGUJ 2E74B 3CXHI 2R3SA 2AEMA 2P1JA 1OVRA 1YJ9P 1T3JA 2NPSC 4QAOA 1JMMA 2Y9ZA 1H89A 3R4YA 2OYHC 3O20A 1Y47A 3CWBJ 2O01N 3AE9C 2ZOOA 1M90Q 1QN2A 2BPBB 1X9VA 3AE5C 3V2NA 3CPWO 2OZ1A 5E79V 1YICA 1KB9D 3L72G 1LT9A 4RJTA 4D6TG 1RAPA 1USEA 1N7SB 2KIKA 2FYNC 1OCDA 1KILC 1FBMA 5DJTB 5CCGD 5CBNA 5TISH 5KLVE 1Q86Q 3L74D 3W67A 4LLHA 4I7ZB 2L5GB 2Q3EA 1FZBA 3T97B 4Y99C 3WFCC 3Q5PA 3WC8A 3FXDA 1PPJG 4ZNCA 1OVVA 1NOHA 1VQ5P 1AA0A 1S4XA 2JTIB 3BVHA 2N3YA 3WFBC 3KHUA 3KZIH 4OGQD 1CHJA 2AXTE 2IX7C 4D6TJ 3E1RA 1R5SA 5B66H 5APUA 1BCCD 3CD6P 3M97X 4DZOA 4KJMA 3NBSA 1JEKA 1HUCA 3RK2C 2W83C 1BDCA 2YXRB 3RBXA 2BCCG 1LWUA 1JCCA 4Y5RA 2FYUG 1EDIA 2P67A 1JDLA 5AVWB 3SWFA 3BCCD 3L71J 3TF5A 1L0LK 1CCRA 3BASA 1M7LA 1CSWA 3L73G 1NTKK 1AOFA 3D70A 1MFTA 1RE3A 3RLMA 1KFNA 1CRYA 3L70D 3PH0A 4D6TD 1N86A 1N2DC 5APWA 3P8CD 5H2FV 3GLMA 5APYA 1NGMB 2BGVX 1RE4A 1S6VB 2YK3A 3A0BH 1K8AQ 1HZUA 4A7PA 1IFPA 2QJKB 3H1HJ 2BH4X 2RH0A 1S3JA 2M5AA 3WU2H 1Q7YQ 3HE5A 2KXPB 1GMJA 3CMEP 1H8AA 4Q5PA 1RH5B 3H1LD 3RK3D 2FXMA 2E5TA 1KQSO 1NKZB 5APVA 2K3RA 2MKVA 1NVOA 2O1JA 3PXSA 2JQRA 3PRJA 3SLEA 1EZVD 3V4QA 5CJ4A 1BCCE 1IRVA 1VQKP 3HQ6A 2GC7D 3CWBD 3H1ID 1QEXA 5AW5B 3NTNA 2OGUA 3O8ZA 1FS0E 1OW8A 4AAMA 1IC2A 1SQXJ 4FA9A 2D2CB 2E75D 2O1KA 1GW4A 1XTCC 1A8CA 3BCCG 4DOJA 2NPSD 1EDJA 1PGOA 4WWIA 3CCSP 1X0TA 3V2QA 4IFMA 5KJ7A 1R8EA 1RE4C 4J20A 2R44A 1N73C 3H1IE 1DVHA 3AE6C 1KILA 3BCCJ 3L71D 3VOPA 2ZFCA 2M3EA 2YMYA 2BH5X 1KD1Q 4V2KA 5E79E 2I8FA 2B10B 2E74D 1M1JB 1ZMEC 1HJ3A 4H0LB 3VP9A 3O1YA 3RMZA 1JMBA 1FJ0A 1NU1J 1YYCA 3CC4P 3L72J 1H0TB 1FJPA 2OZ1B 3RK3E 2K9JA 3H1LJ 4PD4I 3HQ7A 4EYYQ 2QIWA 1AYGA 1S9KE 2FKWB 1VQ6P 1QL1A
chains in the Genus database with same CATH topology
2C1VA 1FI7A 3OCDA 4O1QA 2XTSB 1QL4A 1YEAA 3PXWA 4EIDA 1N15A 1C75A 5DFSA 3H1HD 4LJIA 1U74B 2FWLA 1DW3A 4KMGA 1YTCA 1N90A 1CIEA 1CO6A 5KAIV 3SXTA 4FA4A 3H1KD 1QKSA 2PCBB 4WQEA 2C1UA 2BLFB 3DMIA 1L9BC 1PP9D 3VNWA 1N9CA 4UB8V 1YCCA 2BCCD 1FI3A 3A9FA 1H33B 4DY9A 4H0JA 1N50A 2QJYB 1BGYD 1CEDA 1DT1A 2D0SA 4WQBA 2QJPB 2O3JA 4O1WA 1C2NA 1H33A 1YEBA 1H9YA 2BCNB 2QG4A 1HZVA 1DIIC 1L9JC 1U75B 1C6OA 1F1FA 1CNOA 3WUIA 3HQ8A 3CXHD 3KZIV 4L1QA 3CP5A 4NFGB 2MHMA 1J3SA 1AKKA 1KX2A 5GTHV 4N0KA 2N18B 2VHDA 1I8OA 1W2LA 1NTKD 3MK7C 1COTA 1C2RA 2C1DB 2N9JA 1CRIA 1H31A 3MK7B 1I6EA 4GYDA 3CU4A 2CA3B 1LFMA 5IY51 1OAEA 1P84D 4MU8A 2Y0CA 1L0ND 1IO3A 1S5LV 3ZCFA 5C0ZA 1BL9A 1CSUA 1NMLA 1IRWA 2B11B 351CA 3VRDA 1CYJA 155CA 1SQVD 1GQ1A 3CX5D 4EIFA 2ORLA 3VYMA 2AIUA 1CTZA 5CIEB 2C9XB 2ZONG 1RZ5A 1W5CT 1E29A 4IL6V 1DW1A 5B6QA 1CRGA 2AXTV 2MTAC 1NNOA 1CHIA 1CYIA 4YE1A 4GEDB 1M60A 3L72D 1DW0A 4WQ7A 1C52A 3CYTI 3GG2A 1L0LD 1WVEC 3GW6A 1H1OA 4P4QB 1C6SA 2GC4D 5C9MA 2Y0DA 4EIEA 4XYDB 2RN0A 4FA5A 2CE1A 2JWAA 1C7MA 5B5EV 4WQ8A 1CXCA 1R0QA 2YCCA 3TYIA 1CXAA 4K3IA 5CIDB 5DJQC 5DF5A 4PW9B 1DVVA 5CIHB 1YNRA 1ZZHA 1ZRTD 2HV4A 3WFDC 1PPJD 3PHLA 1K3GA 3DP5A 4QAOA 2GIWA 3VMAA 3SVWA 1KX7A 2B4ZA 3O20A 2B0ZB 1HRCA 2LITA 2YIUB 3PH2B 2DGEA 1SQPD 3HQ9A 2ZOOA 1QN2A 2BPBB 3DR0A 3FWLA 1E2RA 1BE3D 5KLIB 2OZ1A 5E79V 1YICA 1I5TA 3ZOOA 1KB9D 2C8SA 4RJTA 1CIHA 1C6RA 1RAPA 3PLNA 5CYTR 1I54A 2KNCB 3L4OA 1OCDA 1H9XA 1HROA 2Y0EA 2LIRA 2KS1A 3ITKA 3L75D 4EICA 2N9IA 3L74D 2C1DA 2PACA 4EDFA 1KIBA 3OA8A 2Q3EA 3JBTB 3L73D 2K9JB 1MG3D 1GDVA 3WFCC 3WC8A 1HCMA 1HH7A 5TJHA 3ZOWA 1FI9A 5DJQB 2JTIB 1GIWA 2N18C 2N3YA 2EXVA 1VYDA 3CXHW 3ORVA 1B7VA 1I8PA 2C2CA 3WFBC 3KHUA 2L91A 3TDKA 1CHJA 1LC1A 4FAVA 4WQAA 2N9YB 1H31B 1RAQA 1BCCD 1H32A 4FB1A 3M97X 1CHHA 2V08A 3A0HV 3NBSA 4UB6V 5B66V 4JCGA 5TISV 4L3HA 3X39A 1E8EA 1YFCA 3ZBMA 5GTIV 1QL3A 4Y5RA 3PXTA 1CC5A 1KYOW 3NWVA 4AAOA 1NIRA 4XXLA 1JDLA 4H0KA 3BCCD 1CTJA 4WQ9A 3TF5A 1CCRA 1I55A 2N3BA 1CSWA 1AOFA 3OCDB 3RLMA 3ZIYA 1CRYA 4RSZA 1EB7A 3L70D 1FOCA 2CXBA 4D6TD 451CA 3A0BV 1MG2D 1I6DA 5H2FV 1SQXD 4L3GA 3L4MA 3TGUD 2BGVX 1S6VB 2YK3A 3ZOXA 4FA1A 1GJQA 1HZUA 5CIFB 4A7PA 2QJKB 5KKZB 1YIQA 4AANA 2BH4X 1LC2A 1GKSA 3WFEC 1CSVA 2FRCA 1LS9A 1RZ6A 2FYNB 4PJ0V 4Q5PA 3ZOYA 2A06D 3H1LD 1CSXA 1MZ4A 3SWSA 1HJ5A 3O0RC 1CTYA 2FYUD 1WEJF 1CRJA 4PD4D 2D0WA 3PXSA 1NU1D 2JQRA 3PRJA 1M70A 1NTMD 3SLEA 1EZVD 2L4DA 5CIBB 1IRVA 3PTZA 3HQ6A 2GC7D 1F1CA 3CWBD 3H1ID 3CX5W 1NMIA 1GU2A 2ZBOA 4AX3A 1CCHA 4AAMA 1CRHA 4FA9A 1IQCA 1H32B 1A8CA 3SJLA 4PWAA 2GB8B 1DIQC 1CIGA 4FANA 1CRCA 4WQCA 3OA8B 1ETPA 4J20A 1FHBA 1DVHA 2V07A 1KB0A 1NTZD 1QYZA 2AI5A 1LMSA 3L71D 5CIGB 1DW2A 1SQBD 1A2SA 4AALA 2BH5X 4V2KA 2DVHA 2B12B 3O5CA 2I8FA 3RN0A 3WU2V 2B10B 2RMZA 4U3FD 3RN1A 4WQDA 5EXQA 1HJ3A 1CYCA 1HJ4A 3NBTA 2ZXYA 3C2CA 3O1YA 3RMZA 1FJ0A 5CICB 5KLVD 1CIFA 1SQQD 2ZZS1 2OZ1B 1AOQA 1KYOD 1CORA 1A56A 2CE0A 2YQBA 3HQ7A 1AYGA 2CA4B 3H1JD 5AURA 1FCDC 1KV9A 2PCCB 1IZL0 5KAFV 1K3HA 2IBZD 1M6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C1V A;  1FI7 A;  3OCD A;  4O1Q A;  2XTS B;  1QL4 A;  1YEA A;  3PXW A;  4EID A;  1N15 A;  1C75 A;  5DFS A;  3H1H D;  4LJI A;  1U74 B;  2FWL A;  1DW3 A;  4KMG A;  1YTC A;  1N90 A;  1CIE A;  1CO6 A;  5KAI V;  3SXT A;  4FA4 A;  3H1K D;  1QKS A;  2PCB B;  4WQE A;  2C1U A;  2BLF B;  3DMI A;  1L9B C;  1PP9 D;  3VNW A;  1N9C A;  4UB8 V;  1YCC A;  2BCC D;  1FI3 A;  3A9F A;  1H33 B;  4DY9 A;  4H0J A;  1N50 A;  2QJY B;  1BGY D;  1CED A;  1DT1 A;  2D0S A;  4WQB A;  2QJP B;  2O3J A;  4O1W A;  1C2N A;  1H33 A;  1YEB A;  1H9Y A;  2BCN B;  2QG4 A;  1HZV A;  1DII C;  1L9J C;  1U75 B;  1C6O A;  1F1F A;  1CNO A;  3WUI A;  3HQ8 A;  3CXH D;  3KZI V;  4L1Q A;  3CP5 A;  4NFG B;  2MHM A;  1J3S A;  1AKK A;  1KX2 A;  5GTH V;  4N0K A;  2N18 B;  2VHD A;  1I8O A;  1W2L A;  1NTK D;  3MK7 C;  1COT A;  1C2R A;  2C1D B;  2N9J A;  1CRI A;  1H31 A;  3MK7 B;  1I6E A;  4GYD A;  3CU4 A;  2CA3 B;  1LFM A;  5IY5 1;  1OAE A;  1P84 D;  4MU8 A;  2Y0C A;  1L0N D;  1IO3 A;  1S5L V;  3ZCF A;  5C0Z A;  1BL9 A;  1CSU A;  1NML A;  1IRW A;  2B11 B;  351C A;  3VRD A;  1CYJ A;  155C A;  1SQV D;  1GQ1 A;  3CX5 D;  4EIF A;  2ORL A;  3VYM A;  2AIU A;  1CTZ A;  5CIE B;  2C9X B;  2ZON G;  1RZ5 A;  1W5C T;  1E29 A;  4IL6 V;  1DW1 A;  5B6Q A;  1CRG A;  2AXT V;  2MTA C;  1NNO A;  1CHI A;  1CYI A;  4YE1 A;  4GED B;  1M60 A;  3L72 D;  1DW0 A;  4WQ7 A;  1C52 A;  3CYT I;  3GG2 A;  1L0L D;  1WVE C;  3GW6 A;  1H1O A;  4P4Q B;  1C6S A;  2GC4 D;  5C9M A;  2Y0D A;  4EIE A;  4XYD B;  2RN0 A;  4FA5 A;  2CE1 A;  2JWA A;  1C7M A;  5B5E V;  4WQ8 A;  1CXC A;  1R0Q A;  2YCC A;  3TYI A;  1CXA A;  4K3I A;  5CID B;  5DJQ C;  5DF5 A;  4PW9 B;  1DVV A;  5CIH B;  1YNR A;  1ZZH A;  1ZRT D;  2HV4 A;  3WFD C;  1PPJ D;  3PHL A;  1K3G A;  3DP5 A;  4QAO A;  2GIW A;  3VMA A;  3SVW A;  1KX7 A;  2B4Z A;  3O20 A;  2B0Z B;  1HRC A;  2LIT A;  2YIU B;  3PH2 B;  2DGE A;  1SQP D;  3HQ9 A;  2ZOO A;  1QN2 A;  2BPB B;  3DR0 A;  3FWL A;  1E2R A;  1BE3 D;  5KLI B;  2OZ1 A;  5E79 V;  1YIC A;  1I5T A;  3ZOO A;  1KB9 D;  2C8S A;  4RJT A;  1CIH A;  1C6R A;  1RAP A;  3PLN A;  5CYT R;  1I54 A;  2KNC B;  3L4O A;  1OCD A;  1H9X A;  1HRO A;  2Y0E A;  2LIR A;  2KS1 A;  3ITK A;  3L75 D;  4EIC A;  2N9I A;  3L74 D;  2C1D A;  2PAC A;  4EDF A;  1KIB A;  3OA8 A;  2Q3E A;  3JBT B;  3L73 D;  2K9J B;  1MG3 D;  1GDV A;  3WFC C;  3WC8 A;  1HCM A;  1HH7 A;  5TJH A;  3ZOW A;  1FI9 A;  5DJQ B;  2JTI B;  1GIW A;  2N18 C;  2N3Y A;  2EXV A;  1VYD A;  3CXH W;  3ORV A;  1B7V A;  1I8P A;  2C2C A;  3WFB C;  3KHU A;  2L91 A;  3TDK A;  1CHJ A;  1LC1 A;  4FAV A;  4WQA A;  2N9Y B;  1H31 B;  1RAQ A;  1BCC D;  1H32 A;  4FB1 A;  3M97 X;  1CHH A;  2V08 A;  3A0H V;  3NBS A;  4UB6 V;  5B66 V;  4JCG A;  5TIS V;  4L3H A;  3X39 A;  1E8E A;  1YFC A;  3ZBM A;  5GTI V;  1QL3 A;  4Y5R A;  3PXT A;  1CC5 A;  1KYO W;  3NWV A;  4AAO A;  1NIR A;  4XXL A;  1JDL A;  4H0K A;  3BCC D;  1CTJ A;  4WQ9 A;  3TF5 A;  1CCR A;  1I55 A;  2N3B A;  1CSW A;  1AOF A;  3OCD B;  3RLM A;  3ZIY A;  1CRY A;  4RSZ A;  1EB7 A;  3L70 D;  1FOC A;  2CXB A;  4D6T D;  451C A;  3A0B V;  1MG2 D;  1I6D A;  5H2F V;  1SQX D;  4L3G A;  3L4M A;  3TGU D;  2BGV X;  1S6V B;  2YK3 A;  3ZOX A;  4FA1 A;  1GJQ A;  1HZU A;  5CIF B;  4A7P A;  2QJK B;  5KKZ B;  1YIQ A;  4AAN A;  2BH4 X;  1LC2 A;  1GKS A;  3WFE C;  1CSV A;  2FRC A;  1LS9 A;  1RZ6 A;  2FYN B;  4PJ0 V;  4Q5P A;  3ZOY A;  2A06 D;  3H1L D;  1CSX A;  1MZ4 A;  3SWS A;  1HJ5 A;  3O0R C;  1CTY A;  2FYU D;  1WEJ F;  1CRJ A;  4PD4 D;  2D0W A;  3PXS A;  1NU1 D;  2JQR A;  3PRJ A;  1M70 A;  1NTM D;  3SLE A;  1EZV D;  2L4D A;  5CIB B;  1IRV A;  3PTZ A;  3HQ6 A;  2GC7 D;  1F1C A;  3CWB D;  3H1I D;  3CX5 W;  1NMI A;  1GU2 A;  2ZBO A;  4AX3 A;  1CCH A;  4AAM A;  1CRH A;  4FA9 A;  1IQC A;  1H32 B;  1A8C A;  3SJL A;  4PWA A;  2GB8 B;  1DIQ C;  1CIG A;  4FAN A;  1CRC A;  4WQC A;  3OA8 B;  1ETP A;  4J20 A;  1FHB A;  1DVH A;  2V07 A;  1KB0 A;  1NTZ D;  1QYZ A;  2AI5 A;  1LMS A;  3L71 D;  5CIG B;  1DW2 A;  1SQB D;  1A2S A;  4AAL A;  2BH5 X;  4V2K A;  2DVH A;  2B12 B;  3O5C A;  2I8F A;  3RN0 A;  3WU2 V;  2B10 B;  2RMZ A;  4U3F D;  3RN1 A;  4WQD A;  5EXQ A;  1HJ3 A;  1CYC A;  1HJ4 A;  3NBT A;  2ZXY A;  3C2C A;  3O1Y A;  3RMZ A;  1FJ0 A;  5CIC B;  5KLV D;  1CIF A;  1SQQ D;  2ZZS 1;  2OZ1 B;  1AOQ A;  1KYO D;  1COR A;  1A56 A;  2CE0 A;  2YQB A;  3HQ7 A;  1AYG A;  2CA4 B;  3H1J D;  5AUR A;  1FCD C;  1KV9 A;  2PCC B;  1IZL 0;  5KAF V;  1K3H A;  2IBZ D;  1M6Z A; 
#chains in the Genus database with same CATH topology
 1DH3 A;  1FI7 A;  2XTS B;  2N1T D;  2ZJS E;  2B88 A;  4HJG H;  1UII A;  1OMI A;  2FY8 A;  3FX0 A;  1J1D C;  1PIX A;  1RQV A;  1CIE A;  2IYO A;  1CO6 A;  2ZXE B;  1VF5 D;  1DX7 A;  1SQV E;  2BEQ D;  1GL2 D;  1LTT C;  4N6J A;  3L74 J;  1PZQ A;  3IF4 A;  1QL2 A;  3H32 B;  4XFJ A;  1FI3 A;  1HGV A;  1ZP0 C;  1OX3 A;  3EFF K;  3D6Z A;  4I6M C;  1H33 B;  2XKM A;  3V4W A;  4DY9 A;  1PL5 A;  3LIE A;  2QJK C;  2WMM A;  1NH4 A;  3GHG B;  3AE1 C;  4JYC A;  1FDI A;  3VMX A;  2JEE A;  1VF5 B;  2KSJ A;  1QX8 A;  1JUN A;  1T6A A;  5AW3 B;  2BCN B;  2QG4 A;  2JO1 A;  2G3A A;  1PPJ E;  3FXE A;  1CNO A;  3WUI A;  3HQ8 A;  3S1K A;  5AVX B;  3KZI V;  3CMA P;  1PGQ A;  2KK7 A;  2E76 C;  1AKK A;  4N0K A;  1N73 B;  4W7Y A;  3GF7 A;  1I8O A;  1NTK D;  2FFD B;  2A45 G;  4L74 A;  2HFE D;  2KI7 B;  3RL0 B;  1COT A;  4H0L D;  2C1D B;  1CRI A;  3Q5S A;  2D2C C;  4GYD A;  1KYO H;  1HTL C;  3L72 E;  2M5A B;  1IO3 A;  3H1H E;  4EIJ A;  4IL6 X;  1JY2 N;  3TGU E;  3VN0 A;  1IO4 A;  4PV1 D;  2WSS H;  1FAV A;  1L0L J;  1EC5 A;  4EIF A;  1SQP K;  2ORL A;  5CIE B;  1FOS E;  3C8V A;  1KB9 I;  1DW1 A;  3CCR P;  3T97 A;  3AE4 C;  3AEB C;  1S5L X;  2KLU A;  2B9B A;  4B86 A;  3C9I A;  3M0D A;  1JO5 A;  3GG2 A;  3V2P A;  1SQV J;  5B5E H;  5C9M A;  1KFM A;  1NAY A;  3RL0 g;  2HG5 D;  2LR2 A;  4XYD B;  2RN0 A;  1LTG C;  2CE1 A;  3M06 A;  2A45 I;  4WQ8 A;  3TYI A;  3B5N C;  2KS1 B;  5AW2 B;  4YXW H;  2Q1K A;  3HTK A;  4JBZ A;  1DVV A;  1PGJ A;  2KYV A;  2HV4 A;  4DJG A;  5KLV K;  3TSI A;  3DP5 A;  1SFC D;  2IFN A;  2XU6 A;  1KX7 A;  2B0Z B;  2KLV A;  5CBO A;  2DGE A;  2G8Y A;  3AEE C;  3NXS A;  5B66 E;  5KLV G;  1LP1 A;  4GDO A;  3E7K A;  3FWL A;  2OYI B;  2WTY A;  1YTZ T;  3Q2Y A;  3HUS C;  1SQP E;  1A02 J;  2ZT9 C;  3ZOO A;  2FFD C;  2KOG A;  4H13 C;  2JP3 A;  5GTH E;  2KNC B;  4L73 A;  1P84 H;  2QSI A;  1MZ9 A;  1KYO E;  1RHZ B;  2PP6 A;  1HRO A;  1FDO A;  3RL0 C;  4EOT A;  2Y0E A;  2LIR A;  1S5L H;  3ITK A;  2Q7C A;  2Q3I A;  2LXB A;  3OW2 O;  1JY3 O;  4YTP C;  1NWQ A;  3CI9 A;  2WPQ A;  4N3Y B;  1KIB A;  5TIS E;  3L73 D;  1MG3 D;  3RK2 B;  3R2P A;  1HH7 A;  4WBA A;  1N8R Q;  5AVV B;  2PRR A;  5TJH A;  1VQM P;  3SWY A;  2QRX A;  3CXH W;  1I8P A;  4TT3 H;  2L91 A;  3TDK A;  2E5Y A;  1LC1 A;  1NTZ K;  4WQA A;  1K04 A;  3F89 A;  1H31 B;  1SQP G;  1RF1 B;  4U3F E;  2O01 J;  3A0H V;  3RL0 D;  2IBZ I;  1SQV K;  2H8P D;  4L3H A;  3X39 A;  1KYO I;  1E5W A;  1E8E A;  4OGQ B;  1URQ C;  1YFC A;  3ZBM A;  1CZQ A;  4H44 D;  3NWV A;  1URQ B;  4XXL A;  1FE6 A;  2VRS A;  4K3A A;  4WQ9 A;  2WT7 A;  1N7L A;  1NTM G;  2I1J A;  1IK7 A;  4TLF A;  4CPG A;  2Z5H A;  2WPR A;  3ZIY A;  2ITA A;  3LW5 H;  1EB7 A;  4ASV A;  1FOC A;  2CXB A;  3H1I G;  2OTK E;  3V5B A;  5GTH H;  4KHX A;  4DCK A;  3L4M A;  3TGU D;  2KZI A;  4JYB A;  1PV3 A;  3O6Q A;  3L74 G;  2YMK A;  1LGH B;  4H13 B;  4Z1M H;  1A02 F;  1GKS A;  1SQX E;  1GL2 B;  1CSV A;  4IOI H;  1SQB K;  2ZYG A;  5DJU B;  1T3U A;  2P7J A;  2N1T B;  1VQ4 P;  2FYN B;  4PJ0 V;  3AEA C;  2A06 D;  5BU5 A;  1J2J B;  1HJ5 A;  1CTY A;  1SQQ J;  5APT A;  3AE3 C;  3SWK A;  1CRJ A;  4PD4 D;  2D0W A;  4UB6 H;  1HWT C;  1M70 A;  3H1J E;  2L4D A;  4JPZ B;  5AW7 B;  5EFW B;  5CIB B;  1FU1 A;  5C39 A;  1NMI A;  1CCH A;  3JC2 2;  5AVU B;  1G1J A;  3P8M C;  1SQQ K;  4AUW A;  1JNM A;  3G9R A;  2KB7 P;  1BGY G;  3IR9 A;  1KMI Z;  3H1K G;  1HBW A;  3JSV C;  3CCL P;  3D6Y A;  4WQC A;  1GW3 A;  3OAK A;  3M9Q A;  4H44 B;  4HKZ H;  1FHB A;  2OYH A;  1FOS F;  3I56 P;  1L4A C;  4I2L C;  1KB0 A;  1QYZ A;  2K9Y A;  5AVY B;  2HOD A;  4AAL A;  1LTB C;  4U3F D;  3RN1 A;  4YXD C;  4WQD A;  4LC1 A;  5EXQ A;  1NTM E;  4GOD A;  1SQB E;  3HRN A;  1CYC A;  1HJ4 A;  3NBT A;  2GA1 A;  2ZXY A;  3M0A A;  3C2C A;  1NU1 G;  1OFC X;  4UB6 E;  1ZOY C;  1AOQ A;  4UB8 E;  4GT1 A;  1COR A;  1A56 A;  2JWD A;  5AUR A;  1FCD C;  2WSE H;  2PCC B;  3KYQ A;  2KUB A;  1EDL A;  2IBZ D;  1M6Z A;  5APS A;  3A0H E;  5CJ0 A;  3B5N B;  1N7S C;  2YNY A;  3TNU B;  1N15 A;  2GUV A;  3CX5 H;  3N7N A;  2OTJ P;  3B8E B;  1FC2 C;  3H1K J;  4LJI A;  1DD4 A;  1U74 B;  2FWL A;  2IZ1 A;  3SFE C;  2NPS A;  3GF3 A;  1FZC A;  4FA4 A;  4PV1 C;  3HD7 C;  2KNC A;  4YPC A;  4Y99 B;  4PD4 H;  2XDJ A;  3S9O A;  3DMI A;  1S5L E;  4GOF A;  1VQ9 P;  3G6E P;  1HF9 A;  1PP9 D;  4XE5 B;  3AEC C;  2WT7 B;  1USD A;  2BCC D;  3A9F A;  1SQB G;  4GOE A;  2ZAE B;  3V2R A;  4WY4 C;  1EZV E;  2N1T A;  1RF0 C;  2Z5I A;  1DIP A;  1N50 A;  2ZYD A;  1BGY D;  1CED A;  5KAF H;  4PD4 E;  2D0S A;  1BE3 J;  3KPE A;  2QE7 H;  1NKN A;  1H9Y A;  1Y9B A;  1ZV8 A;  1HZV A;  1WT6 A;  5KAI E;  1U75 B;  1C6O A;  3WUT A;  2E43 A;  5AVS B;  3G71 P;  3H1H G;  1SP4 A;  2DW3 A;  3PP5 A;  1J3S A;  3TGU G;  3HE4 A;  1W2L A;  2OYH B;  1GL2 A;  1URQ D;  3ZDM A;  5AW0 B;  2XNX A;  2CA3 B;  3CCJ P;  5IY5 1;  2HPC A;  1EZV I;  4MU8 A;  4DT0 A;  2Y0C A;  1JTH B;  1L0N D;  4RES B;  2W90 A;  5AW6 B;  5C0Z A;  1MV8 A;  3L35 A;  1NML A;  3L73 J;  4MN4 C;  5CCH C;  3CXH E;  1SQV D;  3CX5 D;  1SS1 A;  3L75 J;  3VYM A;  1CTZ A;  3MHV A;  1W5C T;  1UIX A;  1NU1 K;  2E76 D;  1EZV G;  4BRY A;  1VQ7 P;  2P10 A;  2UWJ E;  4WB4 A;  1CHI A;  1SFC C;  2H7H A;  4YE1 A;  2CPB A;  4XA4 A;  3L72 D;  1IFN A;  3RK3 C;  2QJP C;  1DW0 A;  2FBW C;  5AW1 B;  3CYT I;  1L0L D;  1WVE C;  2WSC H;  1SQX K;  3L75 E;  3GW6 A;  2WQY C;  3JCU H;  1C6S A;  2GC4 D;  1SFC A;  1HVV A;  1L2P A;  4EIE A;  3HD7 B;  5AVQ B;  4FA5 A;  2JWA A;  1C7M A;  1SQP J;  3PJS K;  3G4S P;  1VQP P;  2ZXX A;  3NFQ A;  2YCC A;  1CXA A;  4K3I A;  2OAR A;  2P2U A;  4PW9 B;  2J58 A;  3WFD C;  1PPJ D;  2HYN A;  1ZN5 A;  3PHL A;  2PFX A;  3RGU A;  1NYH A;  3L71 G;  3L71 E;  5AW9 B;  2GIW A;  4IL6 H;  3AEG C;  1GL2 C;  2B4Z A;  3L37 A;  2RKL A;  2LIT A;  2YIU B;  3PH2 B;  3D0W A;  2R32 A;  2C0X A;  3VYI A;  3DR0 A;  1AVO A;  1E2R A;  4BWN A;  3D71 A;  2PAJ A;  4I1L A;  2C8S A;  1KB9 E;  1AFO A;  3EFG A;  1CIH A;  1L0N G;  5CCH A;  3M9B A;  2D2C D;  2E75 B;  3PLN A;  2FFD A;  2A06 E;  1I54 A;  3L4O A;  1H9X A;  1FZG A;  2W8Z A;  4AQR D;  2YO3 A;  4O9B A;  1K9M Q;  2GM4 A;  2N9I A;  5L8R J;  3KXD A;  4RKU J;  4HH2 A;  1KN7 A;  3A3Y B;  2C1D A;  2PAC A;  3CCE P;  4C7N A;  3JBT B;  2K9J B;  4PJ0 E;  3L70 G;  1GDV A;  2W6J H;  2JR8 A;  1HCM A;  5CMZ A;  1KZU B;  3ZOW A;  1FI9 A;  1M1J A;  5DJQ B;  2LXC B;  2HOD B;  1VYD A;  3ORV A;  1TU3 F;  5GTI E;  2B89 A;  4FAV A;  1HH0 A;  2N9Y B;  2K1A A;  1RAQ A;  1H32 A;  3MP7 B;  1IFI A;  1LWU C;  3UIA A;  3L4F A;  5TIS V;  2LKM A;  2H89 C;  2JJL A;  4D6T E;  2R5D A;  4NPD A;  3GHG A;  2PGD A;  5GTI V;  1QL3 A;  1D7M A;  1CC5 A;  1WRG A;  3CC2 P;  3RK2 D;  1NIR A;  2QVA A;  1M57 D;  4H0K A;  1CTJ A;  1I55 A;  1LTI C;  2N3B A;  1EQ7 A;  4RSZ A;  4PV1 B;  3CWB E;  4I7Z C;  3A0B V;  3H25 A;  4R4L A;  1KB9 H;  3OJA B;  1NAF A;  3CCU P;  1SQX D;  4L3G A;  3M91 A;  1CI6 A;  2W6B A;  4NPE A;  3ZOX A;  3H1I J;  1SQV G;  1GJQ A;  3VMZ A;  5CIF B;  1L4A D;  2P58 A;  5KKZ B;  1YIQ A;  2V7Q H;  4AAN A;  2I8D A;  1RY3 A;  2FXO A;  3LID A;  3H1J G;  2XND H;  1EXI A;  2JKV A;  2FRC A;  1LS9 A;  3A5T A;  1GU5 A;  1NTM K;  4KT0 J;  1JCD A;  3ZOY A;  2WIT A;  3SWS A;  2J59 M;  1KOR A;  1L4A A;  2HR3 A;  1OXZ A;  1FZC B;  1NU1 D;  1JTH A;  4H13 D;  4ZMD A;  1GU4 A;  2OTL P;  2V4H A;  3CC7 P;  1JY2 O;  4HYT B;  3MGN A;  1SQB J;  1F1C A;  5AW4 B;  3H32 A;  1HGZ A;  3MZW B;  3CX5 W;  5BVZ A;  1GU2 A;  3USS A;  1VQN P;  1W5C E;  4AX3 A;  2NZ2 A;  1LP1 B;  2ZT9 D;  1CRH A;  2H88 C;  1Q82 Q;  3EWK A;  1BSH A;  4IFD K;  1AV1 A;  3BCC E;  1H32 B;  3SJL A;  3CCQ P;  4GIF A;  3L70 J;  4OGQ C;  4FAN A;  2OYI A;  4JQ0 D;  4NPF X;  3OA8 B;  4C7N B;  2V07 A;  2AI5 A;  5CIG B;  1LMS A;  1AVY A;  1SQB D;  1A2S A;  3BRV B;  2DVH A;  2B12 B;  5K5G B;  3Q5R A;  1DD3 A;  2AEF A;  1KQL A;  1XTG B;  1YBK A;  1H88 A;  1ZR2 A;  5M1B A;  5CIC B;  2MJZ A;  2SPZ A;  1CIF A;  2ZZS 1;  1AQT A;  2K88 A;  1KYO D;  2HLO A;  2E76 B;  3I55 P;  2W27 A;  2YQB A;  2CE0 A;  3P7K A;  1KV9 A;  1SQQ E;  5KAF V;  3AE2 C;  1NU1 E;  3IFM A;  1QL4 A;  3CWB G;  1PP9 E;  3PXW A;  1C75 A;  1EXJ A;  1LTA C;  1YIJ P;  3H1H D;  4M3L A;  4WY4 D;  2R3C A;  3II6 A;  5AVR B;  4ZKP A;  1LTJ B;  1QKS A;  3WMM 0;  1ZRT E;  1N7S D;  2K37 A;  2BLF B;  2IYP A;  1NTZ G;  3BAT A;  1W2E A;  2KZJ A;  3GMA A;  3CCM P;  2V7Q J;  1IFD A;  1JY2 P;  5KTB A;  4H0J A;  1BSN A;  2QJY B;  1DT1 A;  1PFI A;  2FYU E;  3O6Q B;  1ZXG A;  1IFM A;  2NRG A;  4O1W A;  3CLQ A;  3I5C A;  2QA4 P;  1DII C;  1PGP A;  1L9J C;  4W80 A;  1F1F A;  3QWO C;  1MKM A;  2BEZ F;  1L0L G;  1FJK A;  4U3F G;  4L1Q A;  3CP5 A;  1OVU A;  4NFG B;  2MHM A;  1T8Z A;  1BCC J;  2BCC J;  1E79 H;  4RO0 A;  1L4A B;  2QEX P;  1KIL B;  2Q6Q A;  1DEE G;  2N18 B;  1U7M A;  1N7S A;  1K05 A;  2FYZ A;  5H2F H;  5BU8 B;  1QVG O;  1LFM A;  1OAE A;  1P84 D;  4OWF A;  3ZCF A;  1W2B O;  1CSU A;  3C1L A;  4N78 E;  2A06 G;  2B11 B;  1OW6 A;  1RQU A;  1LT9 C;  2XV5 A;  1RE3 C;  3SSU A;  1T2K D;  1NTK E;  3WU2 E;  4BXL A;  5AVZ B;  3L75 G;  2C9X B;  5B6Q A;  1CRG A;  2AXT V;  2MTA C;  1G2C B;  1OIP A;  1CYI A;  1PP9 G;  2QM7 A;  1S1C X;  3Q1M A;  2N1T C;  1JB0 J;  3H1L G;  1VQ8 P;  1Q90 D;  4OH8 B;  1L0N J;  5B5E V;  1CXC A;  1NTZ J;  1R0Q A;  4UB8 H;  1Q2N A;  5DF5 A;  5CIH B;  1YNR A;  1ZZH A;  1LTS C;  1VPC A;  3B5N A;  1ZRT D;  3L36 A;  1K3G A;  1NTZ E;  1EDK A;  4AYC A;  3WUU A;  2J5U A;  2GUS A;  5B5E E;  3VMA A;  3SVW A;  3L74 E;  3EQ2 A;  1S2E A;  1HRC A;  3FGA D;  1SQP D;  3HQ9 A;  1GZL A;  1YHQ P;  3QH9 A;  4H44 C;  4WY4 A;  3P32 A;  5AW8 B;  3W68 A;  1CW5 A;  3NMD A;  3A0B E;  3HD7 D;  1BE3 D;  5KLI B;  1I5T A;  1HJ0 A;  1NJI Q;  2C9L Y;  3TNU A;  5KLI C;  1YI2 P;  1C6R A;  1X22 A;  2IBZ G;  4JF7 A;  1GK6 A;  2QJY C;  3HD7 A;  5CYT R;  1GDT A;  2WSF J;  1VL2 A;  2Z4E A;  2XZR A;  1QVF O;  2KS1 A;  5H2F E;  3L75 D;  4EIC A;  1LTJ A;  1PP9 J;  1LT9 B;  1KQF B;  2WSC J;  3A7O A;  1FDM A;  4EDF A;  3OA8 A;  2KSE A;  1RF0 A;  3SFD C;  1SLQ A;  4ASW A;  2OYI C;  3CX5 E;  3B5N D;  4Y28 J;  1GIW A;  2N18 C;  2EXV A;  1B7V A;  2C2C A;  1NHL A;  3AEF C;  1JM0 A;  2WZ7 A;  5APQ A;  1YIT P;  1KIL E;  2E42 A;  3B4S A;  1GK4 A;  1L0N K;  1LT1 A;  2IPP A;  4R4M A;  2I1K A;  3MUD A;  1YJN P;  3U1C A;  4FB1 A;  1URQ A;  1CHH A;  2V08 A;  4UB6 V;  5B66 V;  4JCG A;  3KZI E;  5KLV J;  1YJW P;  1WMK A;  2FXP A;  3CCV P;  2A45 H;  1T2K C;  2M3B A;  2YKQ A;  1GD2 E;  2ZT9 B;  4OVN F;  3PXT A;  1KYO W;  4U3F J;  4AAO A;  4C7R A;  2N9B A;  4PJ0 H;  1Y8A A;  1KQG B;  1BGY J;  3MD0 A;  5KAF E;  3N4X A;  2C9N Y;  1QLE D;  3CX5 I;  3OCD B;  2AEJ A;  1ZR4 A;  3HTK B;  3E1I A;  1X8Y A;  451C A;  3TYY A;  1BGY E;  1MG2 D;  3U59 A;  1I6D A;  1KV4 A;  2YIU C;  5KJ7 C;  5APX A;  4FA1 A;  1BCC G;  1YQ4 C;  1AQ5 A;  1SQQ G;  2WVR A;  1LJ2 A;  1LC2 A;  2OQQ A;  1JY3 N;  1OZH A;  3WFE C;  1M1J C;  1NTM J;  1NO4 A;  2NPS B;  5CCG A;  2YO2 A;  5CCH D;  1RZ6 A;  2FYU J;  3L70 E;  4W7Z A;  3H1J J;  3IN6 A;  2B87 B;  1CSX A;  1MZ4 A;  4HB1 A;  3O0R C;  2FYU D;  1WEJ F;  2HPC B;  1N73 A;  3GHG C;  3WUV A;  2IBZ E;  3M9H A;  1BDD A;  1NTM D;  3FWN A;  1P84 I;  1FZA A;  3U1A A;  1CSB A;  2WSE J;  4U7J A;  3PTZ A;  4QMA A;  3VMY A;  2WPV B;  1U7J A;  1J1D B;  3JCU E;  5AVT B;  2ZBO A;  1LWU B;  1K73 Q;  3RK3 B;  1BE3 E;  1VQO P;  4ZKU A;  3AE8 C;  5KAI H;  1IQC A;  4WVZ A;  2WWW A;  1RF1 A;  1YTZ I;  1S72 P;  4PWA A;  3B71 A;  2GB8 B;  3S4R A;  1QGK B;  1DIQ C;  3TK1 A;  1S9K D;  1CIG A;  1MFZ A;  3L73 E;  4BRY B;  1CRC A;  1ETP A;  1U57 A;  3CXH H;  3KQG A;  1NTZ D;  1VDF A;  1Q81 Q;  1DW2 A;  3VTP C;  4IFF A;  3O5C A;  3RN0 A;  3WU2 V;  1R5L A;  2RMZ A;  1X79 B;  3F5H A;  2FYU K;  5CCG C;  2IFM A;  1KIL D;  2WPS A;  3HUS A;  5KLV D;  1SVF A;  1SQQ D;  1KTM A;  3OA7 A;  5KJ7 D;  1IZN B;  1OWA A;  2CA4 B;  3H1J D;  2QM8 A;  1LNQ A;  5CHX A;  1IZL 0;  1K3H A;  2C1V A;  4O1Q A;  3OCD A;  3G3Z A;  1M1K Q;  1YEA A;  3A0H H;  3MTU E;  4EID A;  2M0B A;  2POH A;  5DFS A;  1GTW A;  4LGD E;  1AJY A;  1DW3 A;  4KMG A;  1YTC A;  4L76 A;  1N90 A;  2WSF H;  3RBZ A;  2KP8 A;  1J1E B;  5KAI V;  3SXT A;  3H1K D;  2PCB B;  1RF1 C;  4WQE A;  1IJD B;  2C1U A;  4H0L C;  1J1E C;  5GTI H;  2R5B A;  4N78 D;  1NTK J;  1L9B C;  1YQ3 C;  1L0L E;  3CL3 D;  2IDB A;  1IK9 A;  3VNW A;  1HJB A;  1N9C A;  4UB8 V;  1FZC C;  1CI6 B;  1YCC A;  2E74 C;  2BAS A;  3H1L E;  1SFC B;  1ZW0 A;  1JY3 P;  2Y9Y A;  2YXQ B;  3M0D C;  4WQB A;  3AED C;  1DEB A;  2CPS A;  2QJP B;  2O3J A;  1C2N A;  1H33 A;  1YEB A;  2AXT H;  1FZE A;  2H43 A;  1L0N E;  3LW5 J;  2ZVO B;  1FZF A;  1M8O B;  3HUS B;  3CXH D;  2ZVN B;  3P8C E;  1SQX G;  1M56 D;  1ZLL A;  2YKO A;  1KX2 A;  5GTH V;  1OW7 A;  2VHD A;  1MUU A;  3MK7 C;  3H1K E;  3H6P A;  1C2R A;  2N9J A;  1H31 A;  3MK7 B;  1I6E A;  3CU4 A;  4IL6 E;  2O01 H;  3MUD C;  1VF5 C;  3HE4 B;  2CK3 H;  5E79 H;  1S5L V;  2M8R A;  2YKP A;  1BL9 A;  4EI2 A;  1G2C A;  1IRW A;  351C A;  3VRD A;  1CYJ A;  1JOC A;  155C A;  1H0T A;  1GQ1 A;  2Q9I A;  2E75 C;  3IAO A;  2W6A A;  3MIW A;  3Q3D A;  5KKZ C;  2AIU A;  2ZON G;  1RZ5 A;  1E29 A;  2Q5U A;  4L75 A;  3BRT B;  4GKG A;  3KDP B;  4IL6 V;  3HE5 B;  1VQL P;  3ABV C;  1BE3 G;  1NNO A;  1Z56 A;  2BCC E;  4WY4 B;  1IFJ A;  1G1I A;  4GED B;  1M60 A;  1P84 E;  3A2A A;  3VP8 A;  2ZYA A;  4WQ7 A;  1C52 A;  2JDI H;  4K35 A;  1LTJ C;  4C46 A;  3K5B A;  1H1O A;  4P4Q B;  2Y0D A;  2AXC A;  2B87 A;  3V6I A;  2C0W A;  1NTK G;  5CID B;  2IZ0 A;  5DJQ C;  1KC8 Q;  2OYO A;  3AE7 C;  3TGU J;  2E74 B;  3CXH I;  2R3S A;  2AEM A;  2P1J A;  1OVR A;  1YJ9 P;  1T3J A;  2NPS C;  4QAO A;  1JMM A;  2Y9Z A;  1H89 A;  3R4Y A;  2OYH C;  3O20 A;  1Y47 A;  3CWB J;  2O01 N;  3AE9 C;  2ZOO A;  1M90 Q;  1QN2 A;  2BPB B;  1X9V A;  3AE5 C;  3V2N A;  3CPW O;  2OZ1 A;  5E79 V;  1YIC A;  1KB9 D;  3L72 G;  1LT9 A;  4RJT A;  4D6T G;  1RAP A;  1USE A;  1N7S B;  2KIK A;  2FYN C;  1OCD A;  1KIL C;  1FBM A;  5DJT B;  5CCG D;  5CBN A;  5TIS H;  5KLV E;  1Q86 Q;  3L74 D;  3W67 A;  4LLH A;  4I7Z B;  2L5G B;  2Q3E A;  1FZB A;  3T97 B;  4Y99 C;  3WFC C;  3Q5P A;  3WC8 A;  3FXD A;  1PPJ G;  4ZNC A;  1OVV A;  1NOH A;  1VQ5 P;  1AA0 A;  1S4X A;  2JTI B;  3BVH A;  2N3Y A;  3WFB C;  3KHU A;  3KZI H;  4OGQ D;  1CHJ A;  2AXT E;  2IX7 C;  4D6T J;  3E1R A;  1R5S A;  5B66 H;  5APU A;  1BCC D;  3CD6 P;  3M97 X;  4DZO A;  4KJM A;  3NBS A;  1JEK A;  1HUC A;  3RK2 C;  2W83 C;  1BDC A;  2YXR B;  3RBX A;  2BCC G;  1LWU A;  1JCC A;  4Y5R A;  2FYU G;  1EDI A;  2P67 A;  1JDL A;  5AVW B;  3SWF A;  3BCC D;  3L71 J;  3TF5 A;  1L0L K;  1CCR A;  3BAS A;  1M7L A;  1CSW A;  3L73 G;  1NTK K;  1AOF A;  3D70 A;  1MFT A;  1RE3 A;  3RLM A;  1KFN A;  1CRY A;  3L70 D;  3PH0 A;  4D6T D;  1N86 A;  1N2D C;  5APW A;  3P8C D;  5H2F V;  3GLM A;  5APY A;  1NGM B;  2BGV X;  1RE4 A;  1S6V B;  2YK3 A;  3A0B H;  1K8A Q;  1HZU A;  4A7P A;  1IFP A;  2QJK B;  3H1H J;  2BH4 X;  2RH0 A;  1S3J A;  2M5A A;  3WU2 H;  1Q7Y Q;  3HE5 A;  2KXP B;  1GMJ A;  3CME P;  1H8A A;  4Q5P A;  1RH5 B;  3H1L D;  3RK3 D;  2FXM A;  2E5T A;  1KQS O;  1NKZ B;  5APV A;  2K3R A;  2MKV A;  1NVO A;  2O1J A;  3PXS A;  2JQR A;  3PRJ A;  3SLE A;  1EZV D;  3V4Q A;  5CJ4 A;  1BCC E;  1IRV A;  1VQK P;  3HQ6 A;  2GC7 D;  3CWB D;  3H1I D;  1QEX A;  5AW5 B;  3NTN A;  2OGU A;  3O8Z A;  1FS0 E;  1OW8 A;  4AAM A;  1IC2 A;  1SQX J;  4FA9 A;  2D2C B;  2E75 D;  2O1K A;  1GW4 A;  1XTC C;  1A8C A;  3BCC G;  4DOJ A;  2NPS D;  1EDJ A;  1PGO A;  4WWI A;  3CCS P;  1X0T A;  3V2Q A;  4IFM A;  5KJ7 A;  1R8E A;  1RE4 C;  4J20 A;  2R44 A;  1N73 C;  3H1I E;  1DVH A;  3AE6 C;  1KIL A;  3BCC J;  3L71 D;  3VOP A;  2ZFC A;  2M3E A;  2YMY A;  2BH5 X;  1KD1 Q;  4V2K A;  5E79 E;  2I8F A;  2B10 B;  2E74 D;  1M1J B;  1ZME C;  1HJ3 A;  4H0L B;  3VP9 A;  3O1Y A;  3RMZ A;  1JMB A;  1FJ0 A;  1NU1 J;  1YYC A;  3CC4 P;  3L72 J;  1H0T B;  1FJP A;  2OZ1 B;  3RK3 E;  2K9J A;  3H1L J;  4PD4 I;  3HQ7 A;  4EYY Q;  2QIW A;  1AYG A;  1S9K E;  2FKW B;  1VQ6 P;  1QL1 A; 
#chains in the Genus database with same CATH homology
 2C1V A;  1FI7 A;  3OCD A;  4O1Q A;  2XTS B;  1QL4 A;  1YEA A;  3PXW A;  4EID A;  1N15 A;  1C75 A;  5DFS A;  3H1H D;  4LJI A;  1U74 B;  2FWL A;  1DW3 A;  4KMG A;  1YTC A;  1N90 A;  1CIE A;  1CO6 A;  5KAI V;  3SXT A;  4FA4 A;  3H1K D;  1QKS A;  2PCB B;  4WQE A;  2C1U A;  2BLF B;  3DMI A;  1L9B C;  1PP9 D;  3VNW A;  1N9C A;  4UB8 V;  1YCC A;  2BCC D;  1FI3 A;  3A9F A;  1H33 B;  4DY9 A;  4H0J A;  1N50 A;  2QJY B;  1BGY D;  1CED A;  1DT1 A;  2D0S A;  4WQB A;  2QJP B;  2O3J A;  4O1W A;  1C2N A;  1H33 A;  1YEB A;  1H9Y A;  2BCN B;  2QG4 A;  1HZV A;  1DII C;  1L9J C;  1U75 B;  1C6O A;  1F1F A;  1CNO A;  3WUI A;  3HQ8 A;  3CXH D;  3KZI V;  4L1Q A;  3CP5 A;  4NFG B;  2MHM A;  1J3S A;  1AKK A;  1KX2 A;  5GTH V;  4N0K A;  2N18 B;  2VHD A;  1I8O A;  1W2L A;  1NTK D;  3MK7 C;  1COT A;  1C2R A;  2C1D B;  2N9J A;  1CRI A;  1H31 A;  3MK7 B;  1I6E A;  4GYD A;  3CU4 A;  2CA3 B;  1LFM A;  5IY5 1;  1OAE A;  1P84 D;  4MU8 A;  2Y0C A;  1L0N D;  1IO3 A;  1S5L V;  3ZCF A;  5C0Z A;  1BL9 A;  1CSU A;  1NML A;  1IRW A;  2B11 B;  351C A;  3VRD A;  1CYJ A;  155C A;  1SQV D;  1GQ1 A;  3CX5 D;  4EIF A;  2ORL A;  3VYM A;  2AIU A;  1CTZ A;  5CIE B;  2C9X B;  2ZON G;  1RZ5 A;  1W5C T;  1E29 A;  4IL6 V;  1DW1 A;  5B6Q A;  1CRG A;  2AXT V;  2MTA C;  1NNO A;  1CHI A;  1CYI A;  4YE1 A;  4GED B;  1M60 A;  3L72 D;  1DW0 A;  4WQ7 A;  1C52 A;  3CYT I;  3GG2 A;  1L0L D;  1WVE C;  3GW6 A;  1H1O A;  4P4Q B;  1C6S A;  2GC4 D;  5C9M A;  2Y0D A;  4EIE A;  4XYD B;  2RN0 A;  4FA5 A;  2CE1 A;  2JWA A;  1C7M A;  5B5E V;  4WQ8 A;  1CXC A;  1R0Q A;  2YCC A;  3TYI A;  1CXA A;  4K3I A;  5CID B;  5DJQ C;  5DF5 A;  4PW9 B;  1DVV A;  5CIH B;  1YNR A;  1ZZH A;  1ZRT D;  2HV4 A;  3WFD C;  1PPJ D;  3PHL A;  1K3G A;  3DP5 A;  4QAO A;  2GIW A;  3VMA A;  3SVW A;  1KX7 A;  2B4Z A;  3O20 A;  2B0Z B;  1HRC A;  2LIT A;  2YIU B;  3PH2 B;  2DGE A;  1SQP D;  3HQ9 A;  2ZOO A;  1QN2 A;  2BPB B;  3DR0 A;  3FWL A;  1E2R A;  1BE3 D;  5KLI B;  2OZ1 A;  5E79 V;  1YIC A;  1I5T A;  3ZOO A;  1KB9 D;  2C8S A;  4RJT A;  1CIH A;  1C6R A;  1RAP A;  3PLN A;  5CYT R;  1I54 A;  2KNC B;  3L4O A;  1OCD A;  1H9X A;  1HRO A;  2Y0E A;  2LIR A;  2KS1 A;  3ITK A;  3L75 D;  4EIC A;  2N9I A;  3L74 D;  2C1D A;  2PAC A;  4EDF A;  1KIB A;  3OA8 A;  2Q3E A;  3JBT B;  3L73 D;  2K9J B;  1MG3 D;  1GDV A;  3WFC C;  3WC8 A;  1HCM A;  1HH7 A;  5TJH A;  3ZOW A;  1FI9 A;  5DJQ B;  2JTI B;  1GIW A;  2N18 C;  2N3Y A;  2EXV A;  1VYD A;  3CXH W;  3ORV A;  1B7V A;  1I8P A;  2C2C A;  3WFB C;  3KHU A;  2L91 A;  3TDK A;  1CHJ A;  1LC1 A;  4FAV A;  4WQA A;  2N9Y B;  1H31 B;  1RAQ A;  1BCC D;  1H32 A;  4FB1 A;  3M97 X;  1CHH A;  2V08 A;  3A0H V;  3NBS A;  4UB6 V;  5B66 V;  4JCG A;  5TIS V;  4L3H A;  3X39 A;  1E8E A;  1YFC A;  3ZBM A;  5GTI V;  1QL3 A;  4Y5R A;  3PXT A;  1CC5 A;  1KYO W;  3NWV A;  4AAO A;  1NIR A;  4XXL A;  1JDL A;  4H0K A;  3BCC D;  1CTJ A;  4WQ9 A;  3TF5 A;  1CCR A;  1I55 A;  2N3B A;  1CSW A;  1AOF A;  3OCD B;  3RLM A;  3ZIY A;  1CRY A;  4RSZ A;  1EB7 A;  3L70 D;  1FOC A;  2CXB A;  4D6T D;  451C A;  3A0B V;  1MG2 D;  1I6D A;  5H2F V;  1SQX D;  4L3G A;  3L4M A;  3TGU D;  2BGV X;  1S6V B;  2YK3 A;  3ZOX A;  4FA1 A;  1GJQ A;  1HZU A;  5CIF B;  4A7P A;  2QJK B;  5KKZ B;  1YIQ A;  4AAN A;  2BH4 X;  1LC2 A;  1GKS A;  3WFE C;  1CSV A;  2FRC A;  1LS9 A;  1RZ6 A;  2FYN B;  4PJ0 V;  4Q5P A;  3ZOY A;  2A06 D;  3H1L D;  1CSX A;  1MZ4 A;  3SWS A;  1HJ5 A;  3O0R C;  1CTY A;  2FYU D;  1WEJ F;  1CRJ A;  4PD4 D;  2D0W A;  3PXS A;  1NU1 D;  2JQR A;  3PRJ A;  1M70 A;  1NTM D;  3SLE A;  1EZV D;  2L4D A;  5CIB B;  1IRV A;  3PTZ A;  3HQ6 A;  2GC7 D;  1F1C A;  3CWB D;  3H1I D;  3CX5 W;  1NMI A;  1GU2 A;  2ZBO A;  4AX3 A;  1CCH A;  4AAM A;  1CRH A;  4FA9 A;  1IQC A;  1H32 B;  1A8C A;  3SJL A;  4PWA A;  2GB8 B;  1DIQ C;  1CIG A;  4FAN A;  1CRC A;  4WQC A;  3OA8 B;  1ETP A;  4J20 A;  1FHB A;  1DVH A;  2V07 A;  1KB0 A;  1NTZ D;  1QYZ A;  2AI5 A;  1LMS A;  3L71 D;  5CIG B;  1DW2 A;  1SQB D;  1A2S A;  4AAL A;  2BH5 X;  4V2K A;  2DVH A;  2B12 B;  3O5C A;  2I8F A;  3RN0 A;  3WU2 V;  2B10 B;  2RMZ A;  4U3F D;  3RN1 A;  4WQD A;  5EXQ A;  1HJ3 A;  1CYC A;  1HJ4 A;  3NBT A;  2ZXY A;  3C2C A;  3O1Y A;  3RMZ A;  1FJ0 A;  5CIC B;  5KLV D;  1CIF A;  1SQQ D;  2ZZS 1;  2OZ1 B;  1AOQ A;  1KYO D;  1COR A;  1A56 A;  2CE0 A;  2YQB A;  3HQ7 A;  1AYG A;  2CA4 B;  3H1J D;  5AUR A;  1FCD C;  1KV9 A;  2PCC B;  1IZL 0;  5KAF V;  1K3H A;  2IBZ D;  1M6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...