2QJKB

Crystal structure analysis of mutant rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
total genus 65
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjkB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjkB02
1N9CA 2CE0A 1RZ6A 3CYTI 3WUIA 3L70D 3SJLA 5KKZB 1H31A 2RN0A 1F1FA 1L9BC 1QKSA 3X39A 451CA 1CYCA 4U3FD 1LFMA 1QL4A 1A56A 2OZ1A 4JCGA 2QJYB 4UB8V 3A9FA 3HQ6A 4EIDA 2ZZS1 1SQBD 3ZOYA 1IQCA 4L3GA 2GB8B 3CXHD 2D0SA 1YEBA 2N9YB 1J3SA 1H1OA 3SLEA 2N9JA 1ETPA 1N90A 2BPBB 1LS9A 5H2FV 1M60A 1LC1A 1MZ4A 1S6VB 4EIFA 3ZOOA 2JWAA 1H32A 2ZBOA 1SQXD 1FJ0A 1AOQA 1CEDA 4O1WA 1KV9A 4A7PA 1AYGA 1C2RA 1W5CT 2B11B 1GDVA 2MTAC 1I5TA 5GTIV 4RSZA 2PCCB 1MG2D 3L74D 5C0ZA 1AOFA 2D0WA 2FYNB 4WQDA 2B10B 2Y0DA 3KZIV 1KYOD 3L73D 1CHHA 3O1YA 2AIUA 5KLIB 4FA4A 3L71D 3A0HV 1HJ4A 3RN1A 2A06D 1QYZA 3OCDB 1E8EA 4WQBA 2XTSB 5IY51 1QN2A 1SQPD 2BH5X 3HQ9A 4PW9B 4PWAA 1CTZA 2C1DA 1R0QA 1YTCA 1ZRTD 1CHIA 4LJIA 4O1QA 3OCDA 4FA9A 1GU2A 2L91A 1CIHA 1IRWA 1I6EA 1EZVD 1GIWA 2C8SA 2IBZD 4H0JA 3L75D 1I8OA 4DY9A 1CSWA 2EXVA 2N3YA 1YICA 2FYUD 3WU2V 1AKKA 3SXTA 1N50A 4EIEA 3H1JD 2N3BA 4FAVA 1RAQA 1YIQA 1C6SA 2MHMA 1DVHA 5C9MA 2ORLA 2C2CA 3RLMA 1CCHA 1H33B 2ZONG 2ZOOA 1CRCA 3DP5A 1NU1D 5TJHA 1YFCA 3PTZA 2B0ZB 1C52A 5CIBB 2YCCA 1LMSA 2CA4B 2PACA 1NNOA 1DW3A 1YEAA 1K3GA 1CTYA 1BL9A 2YK3A 2ZXYA 5E79V 1GQ1A 1RAPA 4KMGA 1SQVD 4J20A 3NWVA 4H0KA 3ZBMA 2BGVX 1MG3D 1JDLA 3PLNA 5CIEB 2QJKB 1CYJA 1HRCA 3FWLA 1BE3D 3O0RC 1HJ3A 1H9YA 2VHDA 4RJTA 3MK7B 1FCDC 1I55A 1I54A 3VYMA 3RN0A 3MK7C 5CYTR 5AURA 3WFBC 3A0BV 2Q3EA 4GEDB 3CX5D 5B5EV 3PHLA 3TYIA 3PXTA 1C7MA 2CE1A 3NBTA 4XXLA 3WC8A 1CYIA 3VRDA 2C1UA 4P4QB 2KNCB 4FA5A 1I6DA 3CXHW 2KS1A 1FOCA 1FI3A 1B7VA 3WFEC 4FANA 3TGUD 1PP9D 4WQCA 1KX2A 3CWBD 1CIGA 1L9JC 2BLFB 2GC4D 1HZUA 1BCCD 1PPJD 3H1ID 3KHUA 1K3HA 4WQ8A 2JTIB 1CNOA 5CIFB 5CIHB 1I8PA 4QAOA 2GC7D 3WFDC 1W2LA 1CSVA 2N18B 4YE1A 4AAOA 2N18C 3PXWA 1HCMA 1HZVA 4UB6V 1E2RA 1CXAA 5CIDB 1ZZHA 2JQRA 3HQ7A 1CIEA 3C2CA 1KYOW 3H1HD 4L1QA 1E29A 2AXTV 5GTHV 1KB0A 1DW0A 3SWSA 2RMZA 4WQAA 2L4DA 1YCCA 2BCCD 1YNRA 1NTKD 3NBSA 4EDFA 1DVVA 4Y5RA 5DFSA 2CA3B 3CP5A 3TDKA 3VNWA 1S5LV 1GJQA 2BH4X 1KIBA 2PCBB 3L4MA 5B66V 1IRVA 4PJ0V 3RMZA 4WQ7A 1CORA 2LITA 351CA 3H1KD 5KAIV 5B6QA 1L0LD 1HJ5A 1H31B 3M97X 3VMAA 3JBTB 1H33A 2YQBA 5DJQB 2B12B 3ITKA 1WVEC 5TISV 1M6ZA 1CCRA 4GYDA 5DJQC 2V07A 4L3HA 2OZ1B 3WFCC 1DW2A 4AX3A 3ZIYA 1NTMD 1CRGA 2N9IA 5CICB 3DR0A 2C9XB 1HH7A 1DW1A 1NMIA 1OCDA 1CRJA 4PD4D 1C6OA 1NTZD 1WEJF 2QG4A 2BCNB 1HROA 1NMLA 2LIRA 1SQQD 1U75B 4NFGB 1IZL0 1VYDA 1CXCA 1A8CA 4WQEA 4AAMA 1H32B 3OA8B 1LC2A 3ZOWA 1F1CA 3O20A 2B4ZA 2AI5A 3PRJA 1RZ5A 2FRCA 1M70A 3OA8A 1A2SA 1CSXA 5DF5A 3O5CA 2DVHA 1FI7A 3GW6A 1KB9D 2YIUB 3TF5A 1NIRA 1KX7A 3DMIA 4XYDB 1CSUA 3SVWA 3ZOXA 3CX5W 2Y0EA 2GIWA 4D6TD 1COTA 4V2KA 1OAEA 1FI9A 3HQ8A 1CIFA 1H9XA 2C1DB 3L72D 4IL6V 155CA 1C75A 1P84D 2Y0CA 1DT1A 3PH2B 3PXSA 1U74B 3H1LD 5EXQA 1CTJA 1CO6A 2O3JA 1CHJA 4N0KA 4FB1A 3ZCFA 1C2NA 1GKSA 3L4OA 4MU8A 1EB7A 1CRIA 3GG2A 3CU4A 5CIGB 1N15A 4FA1A 1DIIC 1FHBA 1QL3A 1CC5A 2DGEA 4AANA 1L0ND 2CXBA 4Q5PA 4EICA 2K9JB 1DIQC 2HV4A 1CRYA 2C1VA 4AALA 5KAFV 2FWLA 1CRHA 3ORVA 4K3IA 2I8FA 1IO3A 4WQ9A 2V08A 5KLVD 1C6RA 1BGYD 2QJPB 3BCCD
chains in the Genus database with same CATH superfamily
3BASA 3MP7B 2BASA 1NKNA 1URQD 1MKMA 5KKZB 1H31A 2OYHC 5KAFE 1L9BC 3CCEP 3L74G 3HD7B 2C9LY 1QL4A 1LJ2A 3HD7C 2QJYB 4UB8V 2A06E 3L73G 1Y8AA 5CCHC 3ZOYA 2GB8B 1GD2E 2J58A 1OMIA 3NMDA 3OAKA 1PL5A 2N9YB 1P84I 1ETPA 2BPBB 1LS9A 3AE3C 5H2FV 1M60A 1MZ4A 2NPSA 1EZVE 2OQQA 3WUUA 1RH5B 4U3FJ 1SQXD 5APXA 1CEDA 3TNUB 4A7PA 3CX5H 1GDVA 1JMMA 4WY4C 2MTAC 3M9BA 1CI6A 2FYUG 4IL6X 3H1JE 1Q86Q 3MTUE 4ZMDA 3B8EB 2FYNB 2G3AA 2Y0DA 1ZW0A 1FZBA 3KZIV 2DW3A 2FYNC 2ZT9D 1CHHA 1HH0A 2OTLP 3L71D 1HJ4A 1NTZK 2W6AA 1HWTC 3D70A 5GTIE 1QYZA 1W2BO 1QN2A 5AW9B 3RBZA 1LTJB 1UIXA 1JY2O 2C1DA 2W8ZA 1T2KC 4LJIA 3G6EP 1GU2A 3A0HE 1QLED 1OXZA 2Q6QA 1GIWA 1KILB 2IBZD 1FU1A 3LIEA 3L75D 1CSWA 1JEKA 3I56P 2N3YA 4R4LA 1YICA 1GL2D 1DEBA 2D2CB 1SQPJ 3SXTA 4RESB 1BE3G 1RF0A 1RAQA 1OW7A 1S1CX 1FS0E 2W90A 1LT1A 1R5LA 1VQ6P 3L36A 4H44B 3V6IA 1JTHA 3L4FA 2B9BA 1HF9A 3RLMA 1WT6A 4GODA 1FZEA 3WU2E 1K9MQ 1H33B 3BRTB 2ZOOA 3SWYA 4DZOA 2H43A 4CPGA 1GW4A 1M1JB 2Q1KA 4WWIA 2E74B 2J59M 3TGUG 1AVYA 3CL3D 3PH0A 5CCGC 1DIPA 2OYHB 1VPCA 2E74C 2HYNA 1USEA 1DW3A 1YEAA 1K3GA 2YK3A 2P67A 4KMGA 2ZVNB 3C8VA 1SQVD 2BGVX 2PAJA 3PLNA 2P58A 1VQ4P 5CIEB 4I7ZC 1H0TA 1NU1J 3MK7B 1I55A 2YO3A 1YJNP 1RF1C 1I54A 2POHA 3MK7C 5AURA 4EYYQ 1GMJA 2BCCE 1CYIA 2C1UA 4FA5A 1I6DA 1NTKE 1ZOYC 2KS1A 3M91A 1FOCA 3V4WA 2IZ0A 1EDLA 1PP9D 1KX2A 3CWBD 3H1ID 2KNCA 1K3HA 3ZDMA 1KB9H 3PJSK 5CIFB 5CIHB 2G8YA 2K37A 4PJ0H 1S9KE 2M0BA 3WMM0 4C7NB 2Y9YA 1W2EA 5DJUB 1Q81Q 1PGPA 3M0DA 3CCLP 1ZZHA 1PGQA 2JQRA 3K5BA 4PV1B 1OVUA 2IYPA 3HUSB 3Q5SA 1LP1B 1U7JA 4PV1C 2B87A 1KYOW 1BCCJ 2WT7B 3HUSC 2M5AB 3IN6A 2OYOA 4JBZA 1DW0A 4K3AA 3SWSA 4PD4E 2K1AA 2FXOA 4WQAA 2HPCA 2L4DA 1RQUA 1NTZG 3H32A 1IJDB 5DFSA 3AEFC 1GTWA 1GJQA 2AXTE 1FDMA 4XA4A 5GTHE 1RE4C 5B5EH 4PJ0V 3CCRP 1FZFA 1YJWP 2K9YA 2KZIA 4IOIH 3H1HJ 4LC1A 1PGOA 3FGAD 1M90Q 1JCCA 1OW6A 1L0LD 1SQPK 3JCUE 1H31B 3M97X 5AVTB 1A02J 4N6JA 1YJ9P 2YQBA 2ZFCA 1X22A 4O9BA 5B66E 2QJPC 3ZIYA 5CICB 4BRYA 3DR0A 4GOEA 3G4SP 1NMIA 1L2PA 3L72E 1LNQA 3H1KJ 1P84E 2QG4A 4UB6H 1HROA 1SQQD 2N1TD 3H1LE 2H89C 1BDCA 4TT3H 2E76C 4C46A 4AAMA 3D6YA 2IX7C 1LC2A 1LTGC 2NPSC 1DD3A 2KP8A 2B4ZA 1NTMJ 2AI5A 3SWKA 5BU5A 1RZ5A 2K3RA 3AE5C 3EFGA 5EFWB 1A2SA 1CSXA 1NU1K 1UIIA 2P10A 1GDTA 2DVHA 1NKZB 2E75D 3GW6A 4DOJA 1DD4A 3CMEP 3AE6C 4OGQD 3G9RA 3DMIA 3D0WA 4XYDB 1CSUA 3CX5W 4D6TD 1M57D 3CPWO 2GUVA 1BGYE 2R5BA 2WZ7A 1OAEA 1YYCA 2WPVB 2C1DB 2AEJA 1S72P 155CA 3L70E 1C75A 1K05A 1EXIA 5AW2B 4YTPC 5EXQA 1E5WA 4JYBA 3VN0A 4HJGH 4Y28J 1GKSA 3OJAB 4U3FG 4IL6E 4MU8A 1CRIA 3GG2A 5AW1B 2XNDH 1GZLA 1SQBE 4FA1A 1M8OB 3QWOC 3D6ZA 1PGJA 2FKWB 2R44A 2QRXA 1ZR2A 3G3ZA 1AQ5A 3VOPA 1RF0C 1ZN5A 5BU8B 2C1VA 2FWLA 1CRHA 3QH9A 3ORVA 1N7SA 1IO3A 4WQ9A 2V08A 3W67A 3JSVC 3A3YB 3WUIA 3L74E 2RN0A 1F1FA 5KAIE 1JY3P 451CA 4L75A 1L0NJ 1G2CA 3L73E 1SLQA 4H13B 4JCGA 2JDIH 3BRVB 1WRGA 3A9FA 4H13C 3MZWB 3RL0D 2E5YA 2XV5A 5M1BA 1H0TB 5KTBA 5KLVJ 3CXHD 4H0LD 2D0SA 2R3CA 1YEBA 2Z4EA 2K88A 1SQPG 1H1OA 2ZYGA 1N90A 1KZUB 2BEQD 1LTSC 3RK2D 1ZXGA 2JWAA 2ZBOA 2QE7H 2KS1B 2D2CD 1KV9A 2ZYAA 1OVRA 1C2RA 2FYUE 2IDBA 5CMZA 3F89A 5C39A 1IK7A 4H44D 2W6JH 5C0ZA 2D0WA 1SFCD 1NTMK 1S3JA 3AE8C 2B10B 2ZXXA 2E43A 3O1YA 1YITP 1G1IA 3RN1A 3HRNA 2A06D 1SQXJ 1URQA 3OCDB 1E8EA 2XTSB 4PW9B 4PWAA 4XE5B 2YNYA 3M0DC 1R0QA 1LWUA 1NU1G 1CHIA 3NXSA 3ABVC 2R3SA 4O1QA 4FA9A 2FFDA 5BVZA 1IRWA 1EZVD 3CD6P 1QL1A 1L4AD 4H0JA 1I8OA 1EC5A 1VL2A 3L71J 3R2PA 4RO0A 1BE3E 1Q90D 3EQ2A 1AKKA 4YPCA 4W7ZA 2OYIA 2LKMA 3H1JD 2N3BA 3CLQA 2RH0A 1YI2P 1RE3A 2WMMA 1M7LA 1PV3A 2ZONG 2KIKA 3DP5A 1ZR4A 3TGUE 3L75J 2HODB 3PTZA 3KZIH 4BRYB 1DEEG 3R4YA 2YCCA 1IC2A 1PPJG 1BCCG 1R8EA 1HVVA 1LMSA 5KJ7C 3VP9A 1OX3A 1LT9A 2IFMA 2ZXYA 1KYOI 2V4HA 3MIWA 2WSFH 1RAPA 4JF7A 4J20A 3NWVA 3M9HA 1USDA 3BATA 2HG5D 1HTLC 2PP6A 3MGNA 4I2LC 2QJKB 3KQGA 1LTTC 1HRCA 3FWLA 1L0NK 3GLMA 1HJ3A 3HE5A 2QJKC 2VHDA 4HKZH 4JPZB 3AECC 1U57A 3GF7A 5E79E 2M3BA 4WY4B 5CYTR 2Q3EA 3TYIA 3PXTA 3RGUA 3H1HG 2Q7CA 4GT1A 1JY2P 4HYTB 1KMIZ 3VRDA 1GL2A 3KPEA 2CPBA 1SQVJ 1FI3A 3H6PA 1KQGB 1HZUA 3A0BE 4YXWH 2JTIB 1S5LH 2XKMA 3B5NA 4I6MC 1I8PA 4QAOA 2JWDA 3RK3B 1N86A 4L74A 3WFDC 1W2LA 3CI9A 2FXPA 1CSVA 2N18B 3RK3C 1KORA 3H1KG 2Q5UA 2Y9ZA 2E42A 4YE1A 2N18C 1HCMA 1HJ0A 1AA0A 3H25A 5CIDB 2HR3A 1PP9J 2ZAEB 1WMKA 3C2CA 5APUA 3CWBJ 3VMZA 3MUDA 3H1IJ 1SQXK 4L1QA 2W6BA 1MFTA 1NTMG 4MN4C 4UB6E 1NTZE 4DJGA 1FAVA 2BCCD 3FWNA 1NH4A 1NTKD 5APSA 3CP5A 1S5LV 2PCBB 1LTBC 3B5ND 2WQYC 3E7KA 2W83C 1YQ4C 3RK2C 2LXBA 1N7SC 5KAIV 1S9KD 3CX5I 2VRSA 1LTAC 1HJBA 2I1KA 4TLFA 1WVEC 5TISV 1FDOA 3KYQA 1M6ZA 1KD1Q 1CCRA 1G2CB 5AW0B 2V07A 2XNXA 1CRGA 2LR2A 2N9IA 4HB1A 4ZNCA 1KQFB 3AE2C 4I7ZB 1VF5D 2C9XB 1HH7A 2BEZF 1DH3A 1DW1A 1U7MA 2KXPB 1Y9BA 4NPEA 1RF1B 3U1AA 4PD4D 1C6OA 1VQPP 2BCNB 3L37A 2MKVA 1L0LJ 2LIRA 1GW3A 4NFGB 3CXHH 1VYDA 1CXCA 4WQEA 3V4QA 1KFNA 2WSFJ 3O6QB 2E5TA 1ZP0C 1QVGO 1M70A 3OA8A 2WWWA 2OGUA 3O5CA 2A45H 2AEFA 5APWA 2KYVA 1NWQA 1T8ZA 1Y47A 1SQQJ 3TF5A 1VQOP 1L0NG 3P8CE 3V2RA 1YQ3C 2GIWA 1SQVK 5AVQB 1URQB 1XTCC 4W80A 1IFPA 3P32A 2YKOA 1FI9A 3P8MC 1URQC 5KLVG 3L72D 1J1EC 3O8ZA 1LWUB 1P84D 1JNMA 1FZGA 3PH2B 5KLIC 4DCKA 2CPSA 1LWUC 3H1LD 3VYIA 1CTJA 4U3FE 1HBWA 5CJ0A 1CO6A 3W68A 2WSCJ 3HE4A 2PRRA 5CIGB 4D6TJ 3GMAA 1IZNB 4B86A 2N1TA 4N78E 2OYIB 1QL3A 4EIJA 1KFMA 1CC5A 5AVWB 2DGEA 4AANA 2OYIC 3I5CA 2J5UA 2CXBA 3AEDC 3CCMP 1RE3C 1D7MA 5KAFV 4M3LA 4K3IA 2PGDA 2IYOA 4YXDC 1SQXG 1BGYD 2QJPB 1H89A 4U7JA 3I55P 1N9CA 2CE0A 3CYTI 2WVRA 3L70D 1KTMA 1CZQA 1Q82Q 5CBNA 1AVOA 3OW2O 3A7OA 2ZT9B 5GTIH 1AJYA 3GHGA 3HTKA 1KB9I 1QKSA 1KYOE 1CYCA 2ZT9C 3MHVA 3PP5A 1LFMA 2GM4A 4NPDA 2OZ1A 1W5CE 2FBWC 1LT9C 5AW4B 4EIDA 2E76B 2ZZS1 3A0HH 1SQPE 1SQBD 3L71G 1OIPA 4L3GA 2NPSB 3HE5B 1SS1A 2R5DA 1OWAA 3AEEC 1ZRTE 2N9JA 4OWFA 2C0WA 2LXCB 5CJ4A 4UB8E 4WB4A 3S1KA 2HLOA 3M0AA 3ZOOA 1H32A 1CI6B 1AOQA 4O1WA 1L0LK 1IFDA 1W5CT 1VQ7P 1GL2C 2IBZG 4OVNF 2B11B 1JM0A 3L75G 2KSJA 1KC8Q 1S2EA 1I5TA 2ITAA 5H2FE 1OW8A 5GTIV 3WU2H 4RSZA 3L74D 3TNUA 1JO5A 3B5NC 3L73D 2YMYA 1VQNP 3OA7A 4FA4A 3A0HV 3HD7D 4BWNA 2O01H 3B71A 1NU1E 4WQBA 1SQQK 2BH5X 3HQ9A 1HGZA 5CCHD 1OZHA 1CTZA 2N9BA 2WSSH 2M8RA 1N8RQ 3JC22 4ASVA 1CIHA 3MUDC 1LTJA 1JY3N 5AVUB 4QMAA 4Y99B 3AE7C 1RY3A 4DY9A 1SQVG 2EXVA 2FYUD 4Y99C 1BDDA 3WU2V 3L35A 4WY4D 1KILA 1JTHB 1NGMB 1SQQE 1N50A 4EIEA 1FZAA 4FAVA 1PZQA 2MHMA 1DVHA 3CX5E 2K9JA 4DT0A 5C9MA 4WVZA 2C0XA 2XZRA 1NHLA 2WSEH 3VMYA 1G1JA 3KXDA 2YXQB 3U1CA 1CRCA 1SFCA 1PPJE 1BCCE 3FXEA 1YFCA 1PP9G 2B0ZB 3CWBG 5CHXA 5CIBB 2L5GB 2Z5IA 1IFJA 4JQ0D 1T2KD 3H1IG 3H1JJ 2PACA 1M1JA 1NNOA 4KHXA 1CTYA 4H0KA 5APYA 3BCCJ 4GOFA 1MFZA 1PIXA 1JDLA 4OH8B 1KILD 1CYJA 1BE3D 2KZJA 3O0RC 4PD4H 1H9YA 1KQLA 1NOHA 1CW5A 3H1HE 3C9IA 1L4AA 3VYMA 1YTZI 3WFBC 2CE1A 3SFDC 5AW7B 1XTGB 3NBTA 4XXLA 5GTHH 1J2JB 2KNCB 4P4QB 1T3JA 5AVVB 2IBZI 3CXHW 1K8AQ 1LGHB 1GU5A 2HFED 2P7JA 3TGUD 4AUWA 4KT0J 2ZJSE 1L9JC 2BLFB 2GC4D 3KHUA 3EWKA 3Q5RA 4W7YA 1CNOA 5CCGD 5B66H 3H1KE 2E74D 2YXRB 1VQLP 2GC7D 2NZ2A 2UWJE 1FE6A 1IK9A 2YKPA 1BSHA 3U59A 3RK3E 3CCSP 2GA1A 1IO4A 2B87B 3PXWA 1L0LG 1HZVA 4N3YB 1E2RA 1CXAA 1NJIQ 3S4RA 3HQ7A 1P84H 1CIEA 1NTME 2FY8A 2ZVOB 2HPCB 3CCJP 3H32B 2AXTV 3RL0g 2WPQA 5GTHV 2O01J 5AW6B 1LP1A 2RMZA 3EFFK 2WT7A 2N1TC 1YNRA 1EDKA 4EDFA 1SQQG 2CA3B 1N73A 1KIBA 2WPSA 3VTPC 5B66V 4GKGA 5L8RJ 3RMZA 4WQ7A 2LITA 351CA 2E75B 5B6QA 1KV4A 1IFIA 2I8DA 4ZKUA 2E75C 1KB9E 2B12B 2BCCJ 2OARA 4PJ0E 1NTKJ 3GHGC 4OGQC 2OZ1B 3WFCC 2AEMA 2Q3IA 2WSEJ 5KKZC 5AW5B 4PV1D 2QEXP 1NVOA 4D6TG 2YKQA 1NTZD 3T97A 2KSEA 4IL6H 2C9NY 2B88A 2QJYC 1U75B 1IZL0 1A8CA 3C1LA 5KLVK 1H32B 3NTNA 2YMKA 1T3UA 4GIFA 3O20A 1FC2C 2KK7A 2KI7B 2JJLA 1K73Q 3AE1C 1QVFO 5B5EE 1RHZB 1J1DB 1FBMA 1X79B 1L0NE 2P2UA 1J1DC 1QGKB 1ZV8A 1KX7A 4HH2A 4IFDK 2WSCH 5KAIH 2Y0EA 5KLVE 1COTA 3SSUA 1SP4A 3BCCE 4V2KA 3HQ8A 1CIFA 3CCVP 4IL6V 3WUVA 5TISH 3Q1MA 1DT1A 3IF4A 1U74B 5AVRB 1OFCX 2O3JA 2E76D 1CHJA 4N0KA 5APQA 3RL0B 2QA4P 1LTJC 1S5LX 3L4OA 2NPSD 4H0LB 1EB7A 3RL0C 1A02F 3CU4A 4H0LC 1DIIC 1FOSE 1X9VA 3L72J 1KILC 3RK2B 1N7SB 4Q5PA 4EICA 2K9JB 2O01N 3M06A 1FJPA 1R5SA 1CRYA 3H1LJ 3P8CD 1SQXE 1PFIA 2D2CC 2I8FA 2A45G 1SFCB 2QIWA 1RZ6A 4H44C 3SJLA 4ZKPA 1SFCC 1FZCA 1GK6A 1OVVA 2JO1A 4L73A 3X39A 1FDIA 4U3FD 3CCUP 1A56A 1M1JC 3L71E 3AE9C 3HQ6A 1VQ9P 2KOGA 1NTKK 1IQCA 3M9QA 2R32A 3CCQP 2A06G 1JMBA 1BGYJ 1Q2NA 1T6AA 4N78D 2PFXA 3AE4C 2O1KA 1J3SA 3II6A 3SLEA 1L4AB 5AW3B 3L70J 1QL2A 3FXDA 3UIAA 3V2PA 1LC1A 1S6VB 1L4AC 4EIFA 1JUNA 2JKVA 2QVAA 2IBZE 2M3EA 1FJ0A 3L75E 1EZVG 3RBXA 1M1KQ 1N2DC 1AYGA 3KDPB 2WTYA 1SQBJ 2PCCB 1MG2D 1CSBA 2IFNA 1AOFA 4WQDA 5KAFH 2V7QH 2GUSA 3H1JG 1KYOD 1J1EB 1YTZT 2CK3H 2AIUA 3CC2P 2W27A 1IFNA 5KLIB 4IFMA 3BCCG 1KN7A 4LGDE 1HUCA 3B4SA 4RKUJ 4H13D 2SPZA 5IY51 4EOTA 2FFDB 1SQPD 3S9OA 2FFDC 1YTCA 3A2AA 1ZRTD 3OCDA 3L74J 2L91A 5APVA 2OTJP 3USSA 1EDJA 1I6EA 5AVZB 1SQVE 2C8SA 3L73J 5E79H 2XDJA 2ZXEB 1N73B 3CXHI 3AEGC 1N73C 1YIQA 1M56D 1C6SA 2B89A 2ORLA 2C2CA 1VQ8P 5AVXB 3A0BH 1CCHA 4BXLA 1MZ9A 2MJZA 4EI2A 2A45I 3LW5H 1EXJA 3N7NA 1PP9E 1NU1D 2JP3A 2NRGA 3CWBE 5TJHA 1H8AA 2OYHA 3V2NA 1LT9B 1VDFA 2FYUJ 3WUTA 3H1IE 3E1RA 5K5GB 1C52A 3VP8A 4ASWA 2CA4B 2KUBA 3HD7A 3CC7P 1BL9A 5E79V 2HODA 4WBAA 1GQ1A 3D71A 3T97B 3ZBMA 1K04A 5KJ7A 1MG3D 5CCHA 1FOSF 1ZMEC 4Z1MH 4RJTA 1FCDC 1NAYA 1X8YA 3AEAC 3VMXA 1GL2B 3FX0A 3RN0A 3TK1A 1X0TA 3A0BV 4GEDB 3IFMA 3CX5D 5B5EV 3PHLA 4NPFX 4XFJA 1C7MA 1EZVI 3WC8A 2FXMA 1VQMP 4WY4A 1DX7A 1JB0J 3B5NB 1B7VA 3WFEC 1GU4A 4FANA 4WQCA 2BCCG 2QM7A 1CIGA 1NTKG 2WITA 1PPJD 1BCCD 1BE3J 4WQ8A 1MV8A 4AYCA 1RQVA 1E79H 5KJ7D 2Q9IA 1L0LE 1SQBK 3KZIE 5DJTB 5AVYB 3LIDA 1H88A 4AAOA 2XU6A 4UB6V 1GK4A 1VF5B 2JEEA 1FJKA 4IFFA 1YHQP 3TGUJ 2V7QJ 1NO4A 1VQ5P 1VF5C 1VQKP 1AV1A 3H1HD 1YIJP 1E29A 1KB0A 1NAFA 3GF3A 1AFOA 1YCCA 3NBSA 1DVVA 2Z5HA 1SVFA 4R4MA 4Y5RA 3TDKA 3VNWA 2BH4X 3L4MA 1IRVA 1CORA 3NFQA 5AW8B 2OTKE 2WPRA 1BSNA 3BVHA 3H1KD 3E1IA 3N4XA 1AQTA 1HJ5A 3VMAA 3Q2YA 1FZCB 3JBTB 1H33A 3RK3D 1S5LE 5DJQB 4K35A 3ITKA 1FZCC 4GYDA 5DJQC 2IPPA 4GDOA 4AQRD 4L3HA 1YBKA 5CCGA 1DW2A 4AX3A 1NTMD 4D6TE 3G71P 2H88C 2AXCA 3Q3DA 1OCDA 3MD0A 1S4XA 1CRJA 3LW5J 5TISE 3SFEC 3A5TA 2FYUK 2KLVA 1WEJF 1QEXA 4JYCA 1MUUA 1EDIA 4LLHA 1NMLA 3L72G 1HGVA 1RF1A 1JCDA 2YO2A 3H1LG 3OA8B 3ZOWA 1ZLLA 2AXTH 1F1CA 3CMAP 1JY3O 3PRJA 2FRCA 4I1LA 1N7SD 5DF5A 3Q5PA 3V5BA 3JCUH 1FI7A 1NTZJ 2FYZA 3O6QA 1KB9D 2IZ1A 2YIUB 3CC4P 4L76A 2YIUC 1NIRA 2QM8A 3V2QA 5CBOA 3SVWA 3ZOXA 4C7RA 5AVSB 3F5HA 1KYOH 2QSIA 2ZYDA 1IFMA 1H9XA 1JOCA 2JR8A 3IR9A 4C7NA 2H7HA 1BGYG 2RKLA 3IAOA 5APTA 2Y0CA 3PXSA 1LTIC 2KB7P 3L70G 3HE4B 1Q7YQ 4KJMA 4FB1A 3TSIA 2N1TB 3HUSA 1Z56A 3ZCFA 1C2NA 2KLUA 1N7LA 1N15A 4UB8H 2M5AA 3CXHE 1FHBA 3SWFA 1EQ7A 1TU3F 1SQBG 4PD4I 1KQSO 3P7KA 1KILE 1NYHA 1QX8A 2H8PD 1L0ND 1DIQC 2HV4A 2P1JA 1RE4A 4AALA 5H2FH 1JY2N 5KLVD 2O1JA 3TYYA 3GHGB 1C6RA 3HTKB 3AEBC 4OGQB 3BCCD 2I1JA
chains in the Genus database with same CATH topology
1N9CA 2CE0A 1RZ6A 3CYTI 3WUIA 3L70D 3SJLA 5KKZB 1H31A 2RN0A 1F1FA 1L9BC 1QKSA 3X39A 451CA 1CYCA 4U3FD 1LFMA 1QL4A 1A56A 2OZ1A 4JCGA 2QJYB 4UB8V 3A9FA 3HQ6A 4EIDA 2ZZS1 1SQBD 3ZOYA 1IQCA 4L3GA 2GB8B 3CXHD 2D0SA 1YEBA 2N9YB 1J3SA 1H1OA 3SLEA 2N9JA 1ETPA 1N90A 2BPBB 1LS9A 5H2FV 1M60A 1LC1A 1MZ4A 1S6VB 4EIFA 3ZOOA 2JWAA 1H32A 2ZBOA 1SQXD 1FJ0A 1AOQA 1CEDA 4O1WA 1KV9A 4A7PA 1AYGA 1C2RA 1W5CT 2B11B 1GDVA 2MTAC 1I5TA 5GTIV 4RSZA 2PCCB 1MG2D 3L74D 5C0ZA 1AOFA 2D0WA 2FYNB 4WQDA 2B10B 2Y0DA 3KZIV 1KYOD 3L73D 1CHHA 3O1YA 2AIUA 5KLIB 4FA4A 3L71D 3A0HV 1HJ4A 3RN1A 2A06D 1QYZA 3OCDB 1E8EA 4WQBA 2XTSB 5IY51 1QN2A 1SQPD 2BH5X 3HQ9A 4PW9B 4PWAA 1CTZA 2C1DA 1R0QA 1YTCA 1ZRTD 1CHIA 4LJIA 4O1QA 3OCDA 4FA9A 1GU2A 2L91A 1CIHA 1IRWA 1I6EA 1EZVD 1GIWA 2C8SA 2IBZD 4H0JA 3L75D 1I8OA 4DY9A 1CSWA 2EXVA 2N3YA 1YICA 2FYUD 3WU2V 1AKKA 3SXTA 1N50A 4EIEA 3H1JD 2N3BA 4FAVA 1RAQA 1YIQA 1C6SA 2MHMA 1DVHA 5C9MA 2ORLA 2C2CA 3RLMA 1CCHA 1H33B 2ZONG 2ZOOA 1CRCA 3DP5A 1NU1D 5TJHA 1YFCA 3PTZA 2B0ZB 1C52A 5CIBB 2YCCA 1LMSA 2CA4B 2PACA 1NNOA 1DW3A 1YEAA 1K3GA 1CTYA 1BL9A 2YK3A 2ZXYA 5E79V 1GQ1A 1RAPA 4KMGA 1SQVD 4J20A 3NWVA 4H0KA 3ZBMA 2BGVX 1MG3D 1JDLA 3PLNA 5CIEB 2QJKB 1CYJA 1HRCA 3FWLA 1BE3D 3O0RC 1HJ3A 1H9YA 2VHDA 4RJTA 3MK7B 1FCDC 1I55A 1I54A 3VYMA 3RN0A 3MK7C 5CYTR 5AURA 3WFBC 3A0BV 2Q3EA 4GEDB 3CX5D 5B5EV 3PHLA 3TYIA 3PXTA 1C7MA 2CE1A 3NBTA 4XXLA 3WC8A 1CYIA 3VRDA 2C1UA 4P4QB 2KNCB 4FA5A 1I6DA 3CXHW 2KS1A 1FOCA 1FI3A 1B7VA 3WFEC 4FANA 3TGUD 1PP9D 4WQCA 1KX2A 3CWBD 1CIGA 1L9JC 2BLFB 2GC4D 1HZUA 1BCCD 1PPJD 3H1ID 3KHUA 1K3HA 4WQ8A 2JTIB 1CNOA 5CIFB 5CIHB 1I8PA 4QAOA 2GC7D 3WFDC 1W2LA 1CSVA 2N18B 4YE1A 4AAOA 2N18C 3PXWA 1HCMA 1HZVA 4UB6V 1E2RA 1CXAA 5CIDB 1ZZHA 2JQRA 3HQ7A 1CIEA 3C2CA 1KYOW 3H1HD 4L1QA 1E29A 2AXTV 5GTHV 1KB0A 1DW0A 3SWSA 2RMZA 4WQAA 2L4DA 1YCCA 2BCCD 1YNRA 1NTKD 3NBSA 4EDFA 1DVVA 4Y5RA 5DFSA 2CA3B 3CP5A 3TDKA 3VNWA 1S5LV 1GJQA 2BH4X 1KIBA 2PCBB 3L4MA 5B66V 1IRVA 4PJ0V 3RMZA 4WQ7A 1CORA 2LITA 351CA 3H1KD 5KAIV 5B6QA 1L0LD 1HJ5A 1H31B 3M97X 3VMAA 3JBTB 1H33A 2YQBA 5DJQB 2B12B 3ITKA 1WVEC 5TISV 1M6ZA 1CCRA 4GYDA 5DJQC 2V07A 4L3HA 2OZ1B 3WFCC 1DW2A 4AX3A 3ZIYA 1NTMD 1CRGA 2N9IA 5CICB 3DR0A 2C9XB 1HH7A 1DW1A 1NMIA 1OCDA 1CRJA 4PD4D 1C6OA 1NTZD 1WEJF 2QG4A 2BCNB 1HROA 1NMLA 2LIRA 1SQQD 1U75B 4NFGB 1IZL0 1VYDA 1CXCA 1A8CA 4WQEA 4AAMA 1H32B 3OA8B 1LC2A 3ZOWA 1F1CA 3O20A 2B4ZA 2AI5A 3PRJA 1RZ5A 2FRCA 1M70A 3OA8A 1A2SA 1CSXA 5DF5A 3O5CA 2DVHA 1FI7A 3GW6A 1KB9D 2YIUB 3TF5A 1NIRA 1KX7A 3DMIA 4XYDB 1CSUA 3SVWA 3ZOXA 3CX5W 2Y0EA 2GIWA 4D6TD 1COTA 4V2KA 1OAEA 1FI9A 3HQ8A 1CIFA 1H9XA 2C1DB 3L72D 4IL6V 155CA 1C75A 1P84D 2Y0CA 1DT1A 3PH2B 3PXSA 1U74B 3H1LD 5EXQA 1CTJA 1CO6A 2O3JA 1CHJA 4N0KA 4FB1A 3ZCFA 1C2NA 1GKSA 3L4OA 4MU8A 1EB7A 1CRIA 3GG2A 3CU4A 5CIGB 1N15A 4FA1A 1DIIC 1FHBA 1QL3A 1CC5A 2DGEA 4AANA 1L0ND 2CXBA 4Q5PA 4EICA 2K9JB 1DIQC 2HV4A 1CRYA 2C1VA 4AALA 5KAFV 2FWLA 1CRHA 3ORVA 4K3IA 2I8FA 1IO3A 4WQ9A 2V08A 5KLVD 1C6RA 1BGYD 2QJPB 3BCCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9C A;  2CE0 A;  1RZ6 A;  3CYT I;  3WUI A;  3L70 D;  3SJL A;  5KKZ B;  1H31 A;  2RN0 A;  1F1F A;  1L9B C;  1QKS A;  3X39 A;  451C A;  1CYC A;  4U3F D;  1LFM A;  1QL4 A;  1A56 A;  2OZ1 A;  4JCG A;  2QJY B;  4UB8 V;  3A9F A;  3HQ6 A;  4EID A;  2ZZS 1;  1SQB D;  3ZOY A;  1IQC A;  4L3G A;  2GB8 B;  3CXH D;  2D0S A;  1YEB A;  2N9Y B;  1J3S A;  1H1O A;  3SLE A;  2N9J A;  1ETP A;  1N90 A;  2BPB B;  1LS9 A;  5H2F V;  1M60 A;  1LC1 A;  1MZ4 A;  1S6V B;  4EIF A;  3ZOO A;  2JWA A;  1H32 A;  2ZBO A;  1SQX D;  1FJ0 A;  1AOQ A;  1CED A;  4O1W A;  1KV9 A;  4A7P A;  1AYG A;  1C2R A;  1W5C T;  2B11 B;  1GDV A;  2MTA C;  1I5T A;  5GTI V;  4RSZ A;  2PCC B;  1MG2 D;  3L74 D;  5C0Z A;  1AOF A;  2D0W A;  2FYN B;  4WQD A;  2B10 B;  2Y0D A;  3KZI V;  1KYO D;  3L73 D;  1CHH A;  3O1Y A;  2AIU A;  5KLI B;  4FA4 A;  3L71 D;  3A0H V;  1HJ4 A;  3RN1 A;  2A06 D;  1QYZ A;  3OCD B;  1E8E A;  4WQB A;  2XTS B;  5IY5 1;  1QN2 A;  1SQP D;  2BH5 X;  3HQ9 A;  4PW9 B;  4PWA A;  1CTZ A;  2C1D A;  1R0Q A;  1YTC A;  1ZRT D;  1CHI A;  4LJI A;  4O1Q A;  3OCD A;  4FA9 A;  1GU2 A;  2L91 A;  1CIH A;  1IRW A;  1I6E A;  1EZV D;  1GIW A;  2C8S A;  2IBZ D;  4H0J A;  3L75 D;  1I8O A;  4DY9 A;  1CSW A;  2EXV A;  2N3Y A;  1YIC A;  2FYU D;  3WU2 V;  1AKK A;  3SXT A;  1N50 A;  4EIE A;  3H1J D;  2N3B A;  4FAV A;  1RAQ A;  1YIQ A;  1C6S A;  2MHM A;  1DVH A;  5C9M A;  2ORL A;  2C2C A;  3RLM A;  1CCH A;  1H33 B;  2ZON G;  2ZOO A;  1CRC A;  3DP5 A;  1NU1 D;  5TJH A;  1YFC A;  3PTZ A;  2B0Z B;  1C52 A;  5CIB B;  2YCC A;  1LMS A;  2CA4 B;  2PAC A;  1NNO A;  1DW3 A;  1YEA A;  1K3G A;  1CTY A;  1BL9 A;  2YK3 A;  2ZXY A;  5E79 V;  1GQ1 A;  1RAP A;  4KMG A;  1SQV D;  4J20 A;  3NWV A;  4H0K A;  3ZBM A;  2BGV X;  1MG3 D;  1JDL A;  3PLN A;  5CIE B;  2QJK B;  1CYJ A;  1HRC A;  3FWL A;  1BE3 D;  3O0R C;  1HJ3 A;  1H9Y A;  2VHD A;  4RJT A;  3MK7 B;  1FCD C;  1I55 A;  1I54 A;  3VYM A;  3RN0 A;  3MK7 C;  5CYT R;  5AUR A;  3WFB C;  3A0B V;  2Q3E A;  4GED B;  3CX5 D;  5B5E V;  3PHL A;  3TYI A;  3PXT A;  1C7M A;  2CE1 A;  3NBT A;  4XXL A;  3WC8 A;  1CYI A;  3VRD A;  2C1U A;  4P4Q B;  2KNC B;  4FA5 A;  1I6D A;  3CXH W;  2KS1 A;  1FOC A;  1FI3 A;  1B7V A;  3WFE C;  4FAN A;  3TGU D;  1PP9 D;  4WQC A;  1KX2 A;  3CWB D;  1CIG A;  1L9J C;  2BLF B;  2GC4 D;  1HZU A;  1BCC D;  1PPJ D;  3H1I D;  3KHU A;  1K3H A;  4WQ8 A;  2JTI B;  1CNO A;  5CIF B;  5CIH B;  1I8P A;  4QAO A;  2GC7 D;  3WFD C;  1W2L A;  1CSV A;  2N18 B;  4YE1 A;  4AAO A;  2N18 C;  3PXW A;  1HCM A;  1HZV A;  4UB6 V;  1E2R A;  1CXA A;  5CID B;  1ZZH A;  2JQR A;  3HQ7 A;  1CIE A;  3C2C A;  1KYO W;  3H1H D;  4L1Q A;  1E29 A;  2AXT V;  5GTH V;  1KB0 A;  1DW0 A;  3SWS A;  2RMZ A;  4WQA A;  2L4D A;  1YCC A;  2BCC D;  1YNR A;  1NTK D;  3NBS A;  4EDF A;  1DVV A;  4Y5R A;  5DFS A;  2CA3 B;  3CP5 A;  3TDK A;  3VNW A;  1S5L V;  1GJQ A;  2BH4 X;  1KIB A;  2PCB B;  3L4M A;  5B66 V;  1IRV A;  4PJ0 V;  3RMZ A;  4WQ7 A;  1COR A;  2LIT A;  351C A;  3H1K D;  5KAI V;  5B6Q A;  1L0L D;  1HJ5 A;  1H31 B;  3M97 X;  3VMA A;  3JBT B;  1H33 A;  2YQB A;  5DJQ B;  2B12 B;  3ITK A;  1WVE C;  5TIS V;  1M6Z A;  1CCR A;  4GYD A;  5DJQ C;  2V07 A;  4L3H A;  2OZ1 B;  3WFC C;  1DW2 A;  4AX3 A;  3ZIY A;  1NTM D;  1CRG A;  2N9I A;  5CIC B;  3DR0 A;  2C9X B;  1HH7 A;  1DW1 A;  1NMI A;  1OCD A;  1CRJ A;  4PD4 D;  1C6O A;  1NTZ D;  1WEJ F;  2QG4 A;  2BCN B;  1HRO A;  1NML A;  2LIR A;  1SQQ D;  1U75 B;  4NFG B;  1IZL 0;  1VYD A;  1CXC A;  1A8C A;  4WQE A;  4AAM A;  1H32 B;  3OA8 B;  1LC2 A;  3ZOW A;  1F1C A;  3O20 A;  2B4Z A;  2AI5 A;  3PRJ A;  1RZ5 A;  2FRC A;  1M70 A;  3OA8 A;  1A2S A;  1CSX A;  5DF5 A;  3O5C A;  2DVH A;  1FI7 A;  3GW6 A;  1KB9 D;  2YIU B;  3TF5 A;  1NIR A;  1KX7 A;  3DMI A;  4XYD B;  1CSU A;  3SVW A;  3ZOX A;  3CX5 W;  2Y0E A;  2GIW A;  4D6T D;  1COT A;  4V2K A;  1OAE A;  1FI9 A;  3HQ8 A;  1CIF A;  1H9X A;  2C1D B;  3L72 D;  4IL6 V;  155C A;  1C75 A;  1P84 D;  2Y0C A;  1DT1 A;  3PH2 B;  3PXS A;  1U74 B;  3H1L D;  5EXQ A;  1CTJ A;  1CO6 A;  2O3J A;  1CHJ A;  4N0K A;  4FB1 A;  3ZCF A;  1C2N A;  1GKS A;  3L4O A;  4MU8 A;  1EB7 A;  1CRI A;  3GG2 A;  3CU4 A;  5CIG B;  1N15 A;  4FA1 A;  1DII C;  1FHB A;  1QL3 A;  1CC5 A;  2DGE A;  4AAN A;  1L0N D;  2CXB A;  4Q5P A;  4EIC A;  2K9J B;  1DIQ C;  2HV4 A;  1CRY A;  2C1V A;  4AAL A;  5KAF V;  2FWL A;  1CRH A;  3ORV A;  4K3I A;  2I8F A;  1IO3 A;  4WQ9 A;  2V08 A;  5KLV D;  1C6R A;  1BGY D;  2QJP B;  3BCC D; 
#chains in the Genus database with same CATH topology
 3BAS A;  3MP7 B;  2BAS A;  1NKN A;  1URQ D;  1MKM A;  5KKZ B;  1H31 A;  2OYH C;  5KAF E;  1L9B C;  3CCE P;  3L74 G;  3HD7 B;  2C9L Y;  1QL4 A;  1LJ2 A;  3HD7 C;  2QJY B;  4UB8 V;  2A06 E;  3L73 G;  1Y8A A;  5CCH C;  3ZOY A;  2GB8 B;  1GD2 E;  2J58 A;  1OMI A;  3NMD A;  3OAK A;  1PL5 A;  2N9Y B;  1P84 I;  1ETP A;  2BPB B;  1LS9 A;  3AE3 C;  5H2F V;  1M60 A;  1MZ4 A;  2NPS A;  1EZV E;  2OQQ A;  3WUU A;  1RH5 B;  4U3F J;  1SQX D;  5APX A;  1CED A;  3TNU B;  4A7P A;  3CX5 H;  1GDV A;  1JMM A;  4WY4 C;  2MTA C;  3M9B A;  1CI6 A;  2FYU G;  4IL6 X;  3H1J E;  1Q86 Q;  3MTU E;  4ZMD A;  3B8E B;  2FYN B;  2G3A A;  2Y0D A;  1ZW0 A;  1FZB A;  3KZI V;  2DW3 A;  2FYN C;  2ZT9 D;  1CHH A;  1HH0 A;  2OTL P;  3L71 D;  1HJ4 A;  1NTZ K;  2W6A A;  1HWT C;  3D70 A;  5GTI E;  1QYZ A;  1W2B O;  1QN2 A;  5AW9 B;  3RBZ A;  1LTJ B;  1UIX A;  1JY2 O;  2C1D A;  2W8Z A;  1T2K C;  4LJI A;  3G6E P;  1GU2 A;  3A0H E;  1QLE D;  1OXZ A;  2Q6Q A;  1GIW A;  1KIL B;  2IBZ D;  1FU1 A;  3LIE A;  3L75 D;  1CSW A;  1JEK A;  3I56 P;  2N3Y A;  4R4L A;  1YIC A;  1GL2 D;  1DEB A;  2D2C B;  1SQP J;  3SXT A;  4RES B;  1BE3 G;  1RF0 A;  1RAQ A;  1OW7 A;  1S1C X;  1FS0 E;  2W90 A;  1LT1 A;  1R5L A;  1VQ6 P;  3L36 A;  4H44 B;  3V6I A;  1JTH A;  3L4F A;  2B9B A;  1HF9 A;  3RLM A;  1WT6 A;  4GOD A;  1FZE A;  3WU2 E;  1K9M Q;  1H33 B;  3BRT B;  2ZOO A;  3SWY A;  4DZO A;  2H43 A;  4CPG A;  1GW4 A;  1M1J B;  2Q1K A;  4WWI A;  2E74 B;  2J59 M;  3TGU G;  1AVY A;  3CL3 D;  3PH0 A;  5CCG C;  1DIP A;  2OYH B;  1VPC A;  2E74 C;  2HYN A;  1USE A;  1DW3 A;  1YEA A;  1K3G A;  2YK3 A;  2P67 A;  4KMG A;  2ZVN B;  3C8V A;  1SQV D;  2BGV X;  2PAJ A;  3PLN A;  2P58 A;  1VQ4 P;  5CIE B;  4I7Z C;  1H0T A;  1NU1 J;  3MK7 B;  1I55 A;  2YO3 A;  1YJN P;  1RF1 C;  1I54 A;  2POH A;  3MK7 C;  5AUR A;  4EYY Q;  1GMJ A;  2BCC E;  1CYI A;  2C1U A;  4FA5 A;  1I6D A;  1NTK E;  1ZOY C;  2KS1 A;  3M91 A;  1FOC A;  3V4W A;  2IZ0 A;  1EDL A;  1PP9 D;  1KX2 A;  3CWB D;  3H1I D;  2KNC A;  1K3H A;  3ZDM A;  1KB9 H;  3PJS K;  5CIF B;  5CIH B;  2G8Y A;  2K37 A;  4PJ0 H;  1S9K E;  2M0B A;  3WMM 0;  4C7N B;  2Y9Y A;  1W2E A;  5DJU B;  1Q81 Q;  1PGP A;  3M0D A;  3CCL P;  1ZZH A;  1PGQ A;  2JQR A;  3K5B A;  4PV1 B;  1OVU A;  2IYP A;  3HUS B;  3Q5S A;  1LP1 B;  1U7J A;  4PV1 C;  2B87 A;  1KYO W;  1BCC J;  2WT7 B;  3HUS C;  2M5A B;  3IN6 A;  2OYO A;  4JBZ A;  1DW0 A;  4K3A A;  3SWS A;  4PD4 E;  2K1A A;  2FXO A;  4WQA A;  2HPC A;  2L4D A;  1RQU A;  1NTZ G;  3H32 A;  1IJD B;  5DFS A;  3AEF C;  1GTW A;  1GJQ A;  2AXT E;  1FDM A;  4XA4 A;  5GTH E;  1RE4 C;  5B5E H;  4PJ0 V;  3CCR P;  1FZF A;  1YJW P;  2K9Y A;  2KZI A;  4IOI H;  3H1H J;  4LC1 A;  1PGO A;  3FGA D;  1M90 Q;  1JCC A;  1OW6 A;  1L0L D;  1SQP K;  3JCU E;  1H31 B;  3M97 X;  5AVT B;  1A02 J;  4N6J A;  1YJ9 P;  2YQB A;  2ZFC A;  1X22 A;  4O9B A;  5B66 E;  2QJP C;  3ZIY A;  5CIC B;  4BRY A;  3DR0 A;  4GOE A;  3G4S P;  1NMI A;  1L2P A;  3L72 E;  1LNQ A;  3H1K J;  1P84 E;  2QG4 A;  4UB6 H;  1HRO A;  1SQQ D;  2N1T D;  3H1L E;  2H89 C;  1BDC A;  4TT3 H;  2E76 C;  4C46 A;  4AAM A;  3D6Y A;  2IX7 C;  1LC2 A;  1LTG C;  2NPS C;  1DD3 A;  2KP8 A;  2B4Z A;  1NTM J;  2AI5 A;  3SWK A;  5BU5 A;  1RZ5 A;  2K3R A;  3AE5 C;  3EFG A;  5EFW B;  1A2S A;  1CSX A;  1NU1 K;  1UII A;  2P10 A;  1GDT A;  2DVH A;  1NKZ B;  2E75 D;  3GW6 A;  4DOJ A;  1DD4 A;  3CME P;  3AE6 C;  4OGQ D;  3G9R A;  3DMI A;  3D0W A;  4XYD B;  1CSU A;  3CX5 W;  4D6T D;  1M57 D;  3CPW O;  2GUV A;  1BGY E;  2R5B A;  2WZ7 A;  1OAE A;  1YYC A;  2WPV B;  2C1D B;  2AEJ A;  1S72 P;  155C A;  3L70 E;  1C75 A;  1K05 A;  1EXI A;  5AW2 B;  4YTP C;  5EXQ A;  1E5W A;  4JYB A;  3VN0 A;  4HJG H;  4Y28 J;  1GKS A;  3OJA B;  4U3F G;  4IL6 E;  4MU8 A;  1CRI A;  3GG2 A;  5AW1 B;  2XND H;  1GZL A;  1SQB E;  4FA1 A;  1M8O B;  3QWO C;  3D6Z A;  1PGJ A;  2FKW B;  2R44 A;  2QRX A;  1ZR2 A;  3G3Z A;  1AQ5 A;  3VOP A;  1RF0 C;  1ZN5 A;  5BU8 B;  2C1V A;  2FWL A;  1CRH A;  3QH9 A;  3ORV A;  1N7S A;  1IO3 A;  4WQ9 A;  2V08 A;  3W67 A;  3JSV C;  3A3Y B;  3WUI A;  3L74 E;  2RN0 A;  1F1F A;  5KAI E;  1JY3 P;  451C A;  4L75 A;  1L0N J;  1G2C A;  3L73 E;  1SLQ A;  4H13 B;  4JCG A;  2JDI H;  3BRV B;  1WRG A;  3A9F A;  4H13 C;  3MZW B;  3RL0 D;  2E5Y A;  2XV5 A;  5M1B A;  1H0T B;  5KTB A;  5KLV J;  3CXH D;  4H0L D;  2D0S A;  2R3C A;  1YEB A;  2Z4E A;  2K88 A;  1SQP G;  1H1O A;  2ZYG A;  1N90 A;  1KZU B;  2BEQ D;  1LTS C;  3RK2 D;  1ZXG A;  2JWA A;  2ZBO A;  2QE7 H;  2KS1 B;  2D2C D;  1KV9 A;  2ZYA A;  1OVR A;  1C2R A;  2FYU E;  2IDB A;  5CMZ A;  3F89 A;  5C39 A;  1IK7 A;  4H44 D;  2W6J H;  5C0Z A;  2D0W A;  1SFC D;  1NTM K;  1S3J A;  3AE8 C;  2B10 B;  2ZXX A;  2E43 A;  3O1Y A;  1YIT P;  1G1I A;  3RN1 A;  3HRN A;  2A06 D;  1SQX J;  1URQ A;  3OCD B;  1E8E A;  2XTS B;  4PW9 B;  4PWA A;  4XE5 B;  2YNY A;  3M0D C;  1R0Q A;  1LWU A;  1NU1 G;  1CHI A;  3NXS A;  3ABV C;  2R3S A;  4O1Q A;  4FA9 A;  2FFD A;  5BVZ A;  1IRW A;  1EZV D;  3CD6 P;  1QL1 A;  1L4A D;  4H0J A;  1I8O A;  1EC5 A;  1VL2 A;  3L71 J;  3R2P A;  4RO0 A;  1BE3 E;  1Q90 D;  3EQ2 A;  1AKK A;  4YPC A;  4W7Z A;  2OYI A;  2LKM A;  3H1J D;  2N3B A;  3CLQ A;  2RH0 A;  1YI2 P;  1RE3 A;  2WMM A;  1M7L A;  1PV3 A;  2ZON G;  2KIK A;  3DP5 A;  1ZR4 A;  3TGU E;  3L75 J;  2HOD B;  3PTZ A;  3KZI H;  4BRY B;  1DEE G;  3R4Y A;  2YCC A;  1IC2 A;  1PPJ G;  1BCC G;  1R8E A;  1HVV A;  1LMS A;  5KJ7 C;  3VP9 A;  1OX3 A;  1LT9 A;  2IFM A;  2ZXY A;  1KYO I;  2V4H A;  3MIW A;  2WSF H;  1RAP A;  4JF7 A;  4J20 A;  3NWV A;  3M9H A;  1USD A;  3BAT A;  2HG5 D;  1HTL C;  2PP6 A;  3MGN A;  4I2L C;  2QJK B;  3KQG A;  1LTT C;  1HRC A;  3FWL A;  1L0N K;  3GLM A;  1HJ3 A;  3HE5 A;  2QJK C;  2VHD A;  4HKZ H;  4JPZ B;  3AEC C;  1U57 A;  3GF7 A;  5E79 E;  2M3B A;  4WY4 B;  5CYT R;  2Q3E A;  3TYI A;  3PXT A;  3RGU A;  3H1H G;  2Q7C A;  4GT1 A;  1JY2 P;  4HYT B;  1KMI Z;  3VRD A;  1GL2 A;  3KPE A;  2CPB A;  1SQV J;  1FI3 A;  3H6P A;  1KQG B;  1HZU A;  3A0B E;  4YXW H;  2JTI B;  1S5L H;  2XKM A;  3B5N A;  4I6M C;  1I8P A;  4QAO A;  2JWD A;  3RK3 B;  1N86 A;  4L74 A;  3WFD C;  1W2L A;  3CI9 A;  2FXP A;  1CSV A;  2N18 B;  3RK3 C;  1KOR A;  3H1K G;  2Q5U A;  2Y9Z A;  2E42 A;  4YE1 A;  2N18 C;  1HCM A;  1HJ0 A;  1AA0 A;  3H25 A;  5CID B;  2HR3 A;  1PP9 J;  2ZAE B;  1WMK A;  3C2C A;  5APU A;  3CWB J;  3VMZ A;  3MUD A;  3H1I J;  1SQX K;  4L1Q A;  2W6B A;  1MFT A;  1NTM G;  4MN4 C;  4UB6 E;  1NTZ E;  4DJG A;  1FAV A;  2BCC D;  3FWN A;  1NH4 A;  1NTK D;  5APS A;  3CP5 A;  1S5L V;  2PCB B;  1LTB C;  3B5N D;  2WQY C;  3E7K A;  2W83 C;  1YQ4 C;  3RK2 C;  2LXB A;  1N7S C;  5KAI V;  1S9K D;  3CX5 I;  2VRS A;  1LTA C;  1HJB A;  2I1K A;  4TLF A;  1WVE C;  5TIS V;  1FDO A;  3KYQ A;  1M6Z A;  1KD1 Q;  1CCR A;  1G2C B;  5AW0 B;  2V07 A;  2XNX A;  1CRG A;  2LR2 A;  2N9I A;  4HB1 A;  4ZNC A;  1KQF B;  3AE2 C;  4I7Z B;  1VF5 D;  2C9X B;  1HH7 A;  2BEZ F;  1DH3 A;  1DW1 A;  1U7M A;  2KXP B;  1Y9B A;  4NPE A;  1RF1 B;  3U1A A;  4PD4 D;  1C6O A;  1VQP P;  2BCN B;  3L37 A;  2MKV A;  1L0L J;  2LIR A;  1GW3 A;  4NFG B;  3CXH H;  1VYD A;  1CXC A;  4WQE A;  3V4Q A;  1KFN A;  2WSF J;  3O6Q B;  2E5T A;  1ZP0 C;  1QVG O;  1M70 A;  3OA8 A;  2WWW A;  2OGU A;  3O5C A;  2A45 H;  2AEF A;  5APW A;  2KYV A;  1NWQ A;  1T8Z A;  1Y47 A;  1SQQ J;  3TF5 A;  1VQO P;  1L0N G;  3P8C E;  3V2R A;  1YQ3 C;  2GIW A;  1SQV K;  5AVQ B;  1URQ B;  1XTC C;  4W80 A;  1IFP A;  3P32 A;  2YKO A;  1FI9 A;  3P8M C;  1URQ C;  5KLV G;  3L72 D;  1J1E C;  3O8Z A;  1LWU B;  1P84 D;  1JNM A;  1FZG A;  3PH2 B;  5KLI C;  4DCK A;  2CPS A;  1LWU C;  3H1L D;  3VYI A;  1CTJ A;  4U3F E;  1HBW A;  5CJ0 A;  1CO6 A;  3W68 A;  2WSC J;  3HE4 A;  2PRR A;  5CIG B;  4D6T J;  3GMA A;  1IZN B;  4B86 A;  2N1T A;  4N78 E;  2OYI B;  1QL3 A;  4EIJ A;  1KFM A;  1CC5 A;  5AVW B;  2DGE A;  4AAN A;  2OYI C;  3I5C A;  2J5U A;  2CXB A;  3AED C;  3CCM P;  1RE3 C;  1D7M A;  5KAF V;  4M3L A;  4K3I A;  2PGD A;  2IYO A;  4YXD C;  1SQX G;  1BGY D;  2QJP B;  1H89 A;  4U7J A;  3I55 P;  1N9C A;  2CE0 A;  3CYT I;  2WVR A;  3L70 D;  1KTM A;  1CZQ A;  1Q82 Q;  5CBN A;  1AVO A;  3OW2 O;  3A7O A;  2ZT9 B;  5GTI H;  1AJY A;  3GHG A;  3HTK A;  1KB9 I;  1QKS A;  1KYO E;  1CYC A;  2ZT9 C;  3MHV A;  3PP5 A;  1LFM A;  2GM4 A;  4NPD A;  2OZ1 A;  1W5C E;  2FBW C;  1LT9 C;  5AW4 B;  4EID A;  2E76 B;  2ZZS 1;  3A0H H;  1SQP E;  1SQB D;  3L71 G;  1OIP A;  4L3G A;  2NPS B;  3HE5 B;  1SS1 A;  2R5D A;  1OWA A;  3AEE C;  1ZRT E;  2N9J A;  4OWF A;  2C0W A;  2LXC B;  5CJ4 A;  4UB8 E;  4WB4 A;  3S1K A;  2HLO A;  3M0A A;  3ZOO A;  1H32 A;  1CI6 B;  1AOQ A;  4O1W A;  1L0L K;  1IFD A;  1W5C T;  1VQ7 P;  1GL2 C;  2IBZ G;  4OVN F;  2B11 B;  1JM0 A;  3L75 G;  2KSJ A;  1KC8 Q;  1S2E A;  1I5T A;  2ITA A;  5H2F E;  1OW8 A;  5GTI V;  3WU2 H;  4RSZ A;  3L74 D;  3TNU A;  1JO5 A;  3B5N C;  3L73 D;  2YMY A;  1VQN P;  3OA7 A;  4FA4 A;  3A0H V;  3HD7 D;  4BWN A;  2O01 H;  3B71 A;  1NU1 E;  4WQB A;  1SQQ K;  2BH5 X;  3HQ9 A;  1HGZ A;  5CCH D;  1OZH A;  1CTZ A;  2N9B A;  2WSS H;  2M8R A;  1N8R Q;  3JC2 2;  4ASV A;  1CIH A;  3MUD C;  1LTJ A;  1JY3 N;  5AVU B;  4QMA A;  4Y99 B;  3AE7 C;  1RY3 A;  4DY9 A;  1SQV G;  2EXV A;  2FYU D;  4Y99 C;  1BDD A;  3WU2 V;  3L35 A;  4WY4 D;  1KIL A;  1JTH B;  1NGM B;  1SQQ E;  1N50 A;  4EIE A;  1FZA A;  4FAV A;  1PZQ A;  2MHM A;  1DVH A;  3CX5 E;  2K9J A;  4DT0 A;  5C9M A;  4WVZ A;  2C0X A;  2XZR A;  1NHL A;  2WSE H;  3VMY A;  1G1J A;  3KXD A;  2YXQ B;  3U1C A;  1CRC A;  1SFC A;  1PPJ E;  1BCC E;  3FXE A;  1YFC A;  1PP9 G;  2B0Z B;  3CWB G;  5CHX A;  5CIB B;  2L5G B;  2Z5I A;  1IFJ A;  4JQ0 D;  1T2K D;  3H1I G;  3H1J J;  2PAC A;  1M1J A;  1NNO A;  4KHX A;  1CTY A;  4H0K A;  5APY A;  3BCC J;  4GOF A;  1MFZ A;  1PIX A;  1JDL A;  4OH8 B;  1KIL D;  1CYJ A;  1BE3 D;  2KZJ A;  3O0R C;  4PD4 H;  1H9Y A;  1KQL A;  1NOH A;  1CW5 A;  3H1H E;  3C9I A;  1L4A A;  3VYM A;  1YTZ I;  3WFB C;  2CE1 A;  3SFD C;  5AW7 B;  1XTG B;  3NBT A;  4XXL A;  5GTH H;  1J2J B;  2KNC B;  4P4Q B;  1T3J A;  5AVV B;  2IBZ I;  3CXH W;  1K8A Q;  1LGH B;  1GU5 A;  2HFE D;  2P7J A;  3TGU D;  4AUW A;  4KT0 J;  2ZJS E;  1L9J C;  2BLF B;  2GC4 D;  3KHU A;  3EWK A;  3Q5R A;  4W7Y A;  1CNO A;  5CCG D;  5B66 H;  3H1K E;  2E74 D;  2YXR B;  1VQL P;  2GC7 D;  2NZ2 A;  2UWJ E;  1FE6 A;  1IK9 A;  2YKP A;  1BSH A;  3U59 A;  3RK3 E;  3CCS P;  2GA1 A;  1IO4 A;  2B87 B;  3PXW A;  1L0L G;  1HZV A;  4N3Y B;  1E2R A;  1CXA A;  1NJI Q;  3S4R A;  3HQ7 A;  1P84 H;  1CIE A;  1NTM E;  2FY8 A;  2ZVO B;  2HPC B;  3CCJ P;  3H32 B;  2AXT V;  3RL0 g;  2WPQ A;  5GTH V;  2O01 J;  5AW6 B;  1LP1 A;  2RMZ A;  3EFF K;  2WT7 A;  2N1T C;  1YNR A;  1EDK A;  4EDF A;  1SQQ G;  2CA3 B;  1N73 A;  1KIB A;  2WPS A;  3VTP C;  5B66 V;  4GKG A;  5L8R J;  3RMZ A;  4WQ7 A;  2LIT A;  351C A;  2E75 B;  5B6Q A;  1KV4 A;  1IFI A;  2I8D A;  4ZKU A;  2E75 C;  1KB9 E;  2B12 B;  2BCC J;  2OAR A;  4PJ0 E;  1NTK J;  3GHG C;  4OGQ C;  2OZ1 B;  3WFC C;  2AEM A;  2Q3I A;  2WSE J;  5KKZ C;  5AW5 B;  4PV1 D;  2QEX P;  1NVO A;  4D6T G;  2YKQ A;  1NTZ D;  3T97 A;  2KSE A;  4IL6 H;  2C9N Y;  2B88 A;  2QJY C;  1U75 B;  1IZL 0;  1A8C A;  3C1L A;  5KLV K;  1H32 B;  3NTN A;  2YMK A;  1T3U A;  4GIF A;  3O20 A;  1FC2 C;  2KK7 A;  2KI7 B;  2JJL A;  1K73 Q;  3AE1 C;  1QVF O;  5B5E E;  1RHZ B;  1J1D B;  1FBM A;  1X79 B;  1L0N E;  2P2U A;  1J1D C;  1QGK B;  1ZV8 A;  1KX7 A;  4HH2 A;  4IFD K;  2WSC H;  5KAI H;  2Y0E A;  5KLV E;  1COT A;  3SSU A;  1SP4 A;  3BCC E;  4V2K A;  3HQ8 A;  1CIF A;  3CCV P;  4IL6 V;  3WUV A;  5TIS H;  3Q1M A;  1DT1 A;  3IF4 A;  1U74 B;  5AVR B;  1OFC X;  2O3J A;  2E76 D;  1CHJ A;  4N0K A;  5APQ A;  3RL0 B;  2QA4 P;  1LTJ C;  1S5L X;  3L4O A;  2NPS D;  4H0L B;  1EB7 A;  3RL0 C;  1A02 F;  3CU4 A;  4H0L C;  1DII C;  1FOS E;  1X9V A;  3L72 J;  1KIL C;  3RK2 B;  1N7S B;  4Q5P A;  4EIC A;  2K9J B;  2O01 N;  3M06 A;  1FJP A;  1R5S A;  1CRY A;  3H1L J;  3P8C D;  1SQX E;  1PFI A;  2D2C C;  2I8F A;  2A45 G;  1SFC B;  2QIW A;  1RZ6 A;  4H44 C;  3SJL A;  4ZKP A;  1SFC C;  1FZC A;  1GK6 A;  1OVV A;  2JO1 A;  4L73 A;  3X39 A;  1FDI A;  4U3F D;  3CCU P;  1A56 A;  1M1J C;  3L71 E;  3AE9 C;  3HQ6 A;  1VQ9 P;  2KOG A;  1NTK K;  1IQC A;  3M9Q A;  2R32 A;  3CCQ P;  2A06 G;  1JMB A;  1BGY J;  1Q2N A;  1T6A A;  4N78 D;  2PFX A;  3AE4 C;  2O1K A;  1J3S A;  3II6 A;  3SLE A;  1L4A B;  5AW3 B;  3L70 J;  1QL2 A;  3FXD A;  3UIA A;  3V2P A;  1LC1 A;  1S6V B;  1L4A C;  4EIF A;  1JUN A;  2JKV A;  2QVA A;  2IBZ E;  2M3E A;  1FJ0 A;  3L75 E;  1EZV G;  3RBX A;  1M1K Q;  1N2D C;  1AYG A;  3KDP B;  2WTY A;  1SQB J;  2PCC B;  1MG2 D;  1CSB A;  2IFN A;  1AOF A;  4WQD A;  5KAF H;  2V7Q H;  2GUS A;  3H1J G;  1KYO D;  1J1E B;  1YTZ T;  2CK3 H;  2AIU A;  3CC2 P;  2W27 A;  1IFN A;  5KLI B;  4IFM A;  3BCC G;  1KN7 A;  4LGD E;  1HUC A;  3B4S A;  4RKU J;  4H13 D;  2SPZ A;  5IY5 1;  4EOT A;  2FFD B;  1SQP D;  3S9O A;  2FFD C;  1YTC A;  3A2A A;  1ZRT D;  3OCD A;  3L74 J;  2L91 A;  5APV A;  2OTJ P;  3USS A;  1EDJ A;  1I6E A;  5AVZ B;  1SQV E;  2C8S A;  3L73 J;  5E79 H;  2XDJ A;  2ZXE B;  1N73 B;  3CXH I;  3AEG C;  1N73 C;  1YIQ A;  1M56 D;  1C6S A;  2B89 A;  2ORL A;  2C2C A;  1VQ8 P;  5AVX B;  3A0B H;  1CCH A;  4BXL A;  1MZ9 A;  2MJZ A;  4EI2 A;  2A45 I;  3LW5 H;  1EXJ A;  3N7N A;  1PP9 E;  1NU1 D;  2JP3 A;  2NRG A;  3CWB E;  5TJH A;  1H8A A;  2OYH A;  3V2N A;  1LT9 B;  1VDF A;  2FYU J;  3WUT A;  3H1I E;  3E1R A;  5K5G B;  1C52 A;  3VP8 A;  4ASW A;  2CA4 B;  2KUB A;  3HD7 A;  3CC7 P;  1BL9 A;  5E79 V;  2HOD A;  4WBA A;  1GQ1 A;  3D71 A;  3T97 B;  3ZBM A;  1K04 A;  5KJ7 A;  1MG3 D;  5CCH A;  1FOS F;  1ZME C;  4Z1M H;  4RJT A;  1FCD C;  1NAY A;  1X8Y A;  3AEA C;  3VMX A;  1GL2 B;  3FX0 A;  3RN0 A;  3TK1 A;  1X0T A;  3A0B V;  4GED B;  3IFM A;  3CX5 D;  5B5E V;  3PHL A;  4NPF X;  4XFJ A;  1C7M A;  1EZV I;  3WC8 A;  2FXM A;  1VQM P;  4WY4 A;  1DX7 A;  1JB0 J;  3B5N B;  1B7V A;  3WFE C;  1GU4 A;  4FAN A;  4WQC A;  2BCC G;  2QM7 A;  1CIG A;  1NTK G;  2WIT A;  1PPJ D;  1BCC D;  1BE3 J;  4WQ8 A;  1MV8 A;  4AYC A;  1RQV A;  1E79 H;  5KJ7 D;  2Q9I A;  1L0L E;  1SQB K;  3KZI E;  5DJT B;  5AVY B;  3LID A;  1H88 A;  4AAO A;  2XU6 A;  4UB6 V;  1GK4 A;  1VF5 B;  2JEE A;  1FJK A;  4IFF A;  1YHQ P;  3TGU J;  2V7Q J;  1NO4 A;  1VQ5 P;  1VF5 C;  1VQK P;  1AV1 A;  3H1H D;  1YIJ P;  1E29 A;  1KB0 A;  1NAF A;  3GF3 A;  1AFO A;  1YCC A;  3NBS A;  1DVV A;  2Z5H A;  1SVF A;  4R4M A;  4Y5R A;  3TDK A;  3VNW A;  2BH4 X;  3L4M A;  1IRV A;  1COR A;  3NFQ A;  5AW8 B;  2OTK E;  2WPR A;  1BSN A;  3BVH A;  3H1K D;  3E1I A;  3N4X A;  1AQT A;  1HJ5 A;  3VMA A;  3Q2Y A;  1FZC B;  3JBT B;  1H33 A;  3RK3 D;  1S5L E;  5DJQ B;  4K35 A;  3ITK A;  1FZC C;  4GYD A;  5DJQ C;  2IPP A;  4GDO A;  4AQR D;  4L3H A;  1YBK A;  5CCG A;  1DW2 A;  4AX3 A;  1NTM D;  4D6T E;  3G71 P;  2H88 C;  2AXC A;  3Q3D A;  1OCD A;  3MD0 A;  1S4X A;  1CRJ A;  3LW5 J;  5TIS E;  3SFE C;  3A5T A;  2FYU K;  2KLV A;  1WEJ F;  1QEX A;  4JYC A;  1MUU A;  1EDI A;  4LLH A;  1NML A;  3L72 G;  1HGV A;  1RF1 A;  1JCD A;  2YO2 A;  3H1L G;  3OA8 B;  3ZOW A;  1ZLL A;  2AXT H;  1F1C A;  3CMA P;  1JY3 O;  3PRJ A;  2FRC A;  4I1L A;  1N7S D;  5DF5 A;  3Q5P A;  3V5B A;  3JCU H;  1FI7 A;  1NTZ J;  2FYZ A;  3O6Q A;  1KB9 D;  2IZ1 A;  2YIU B;  3CC4 P;  4L76 A;  2YIU C;  1NIR A;  2QM8 A;  3V2Q A;  5CBO A;  3SVW A;  3ZOX A;  4C7R A;  5AVS B;  3F5H A;  1KYO H;  2QSI A;  2ZYD A;  1IFM A;  1H9X A;  1JOC A;  2JR8 A;  3IR9 A;  4C7N A;  2H7H A;  1BGY G;  2RKL A;  3IAO A;  5APT A;  2Y0C A;  3PXS A;  1LTI C;  2KB7 P;  3L70 G;  3HE4 B;  1Q7Y Q;  4KJM A;  4FB1 A;  3TSI A;  2N1T B;  3HUS A;  1Z56 A;  3ZCF A;  1C2N A;  2KLU A;  1N7L A;  1N15 A;  4UB8 H;  2M5A A;  3CXH E;  1FHB A;  3SWF A;  1EQ7 A;  1TU3 F;  1SQB G;  4PD4 I;  1KQS O;  3P7K A;  1KIL E;  1NYH A;  1QX8 A;  2H8P D;  1L0N D;  1DIQ C;  2HV4 A;  2P1J A;  1RE4 A;  4AAL A;  5H2F H;  1JY2 N;  5KLV D;  2O1J A;  3TYY A;  3GHG B;  1C6R A;  3HTK B;  3AEB C;  4OGQ B;  3BCC D;  2I1J A; 
#chains in the Genus database with same CATH homology
 1N9C A;  2CE0 A;  1RZ6 A;  3CYT I;  3WUI A;  3L70 D;  3SJL A;  5KKZ B;  1H31 A;  2RN0 A;  1F1F A;  1L9B C;  1QKS A;  3X39 A;  451C A;  1CYC A;  4U3F D;  1LFM A;  1QL4 A;  1A56 A;  2OZ1 A;  4JCG A;  2QJY B;  4UB8 V;  3A9F A;  3HQ6 A;  4EID A;  2ZZS 1;  1SQB D;  3ZOY A;  1IQC A;  4L3G A;  2GB8 B;  3CXH D;  2D0S A;  1YEB A;  2N9Y B;  1J3S A;  1H1O A;  3SLE A;  2N9J A;  1ETP A;  1N90 A;  2BPB B;  1LS9 A;  5H2F V;  1M60 A;  1LC1 A;  1MZ4 A;  1S6V B;  4EIF A;  3ZOO A;  2JWA A;  1H32 A;  2ZBO A;  1SQX D;  1FJ0 A;  1AOQ A;  1CED A;  4O1W A;  1KV9 A;  4A7P A;  1AYG A;  1C2R A;  1W5C T;  2B11 B;  1GDV A;  2MTA C;  1I5T A;  5GTI V;  4RSZ A;  2PCC B;  1MG2 D;  3L74 D;  5C0Z A;  1AOF A;  2D0W A;  2FYN B;  4WQD A;  2B10 B;  2Y0D A;  3KZI V;  1KYO D;  3L73 D;  1CHH A;  3O1Y A;  2AIU A;  5KLI B;  4FA4 A;  3L71 D;  3A0H V;  1HJ4 A;  3RN1 A;  2A06 D;  1QYZ A;  3OCD B;  1E8E A;  4WQB A;  2XTS B;  5IY5 1;  1QN2 A;  1SQP D;  2BH5 X;  3HQ9 A;  4PW9 B;  4PWA A;  1CTZ A;  2C1D A;  1R0Q A;  1YTC A;  1ZRT D;  1CHI A;  4LJI A;  4O1Q A;  3OCD A;  4FA9 A;  1GU2 A;  2L91 A;  1CIH A;  1IRW A;  1I6E A;  1EZV D;  1GIW A;  2C8S A;  2IBZ D;  4H0J A;  3L75 D;  1I8O A;  4DY9 A;  1CSW A;  2EXV A;  2N3Y A;  1YIC A;  2FYU D;  3WU2 V;  1AKK A;  3SXT A;  1N50 A;  4EIE A;  3H1J D;  2N3B A;  4FAV A;  1RAQ A;  1YIQ A;  1C6S A;  2MHM A;  1DVH A;  5C9M A;  2ORL A;  2C2C A;  3RLM A;  1CCH A;  1H33 B;  2ZON G;  2ZOO A;  1CRC A;  3DP5 A;  1NU1 D;  5TJH A;  1YFC A;  3PTZ A;  2B0Z B;  1C52 A;  5CIB B;  2YCC A;  1LMS A;  2CA4 B;  2PAC A;  1NNO A;  1DW3 A;  1YEA A;  1K3G A;  1CTY A;  1BL9 A;  2YK3 A;  2ZXY A;  5E79 V;  1GQ1 A;  1RAP A;  4KMG A;  1SQV D;  4J20 A;  3NWV A;  4H0K A;  3ZBM A;  2BGV X;  1MG3 D;  1JDL A;  3PLN A;  5CIE B;  2QJK B;  1CYJ A;  1HRC A;  3FWL A;  1BE3 D;  3O0R C;  1HJ3 A;  1H9Y A;  2VHD A;  4RJT A;  3MK7 B;  1FCD C;  1I55 A;  1I54 A;  3VYM A;  3RN0 A;  3MK7 C;  5CYT R;  5AUR A;  3WFB C;  3A0B V;  2Q3E A;  4GED B;  3CX5 D;  5B5E V;  3PHL A;  3TYI A;  3PXT A;  1C7M A;  2CE1 A;  3NBT A;  4XXL A;  3WC8 A;  1CYI A;  3VRD A;  2C1U A;  4P4Q B;  2KNC B;  4FA5 A;  1I6D A;  3CXH W;  2KS1 A;  1FOC A;  1FI3 A;  1B7V A;  3WFE C;  4FAN A;  3TGU D;  1PP9 D;  4WQC A;  1KX2 A;  3CWB D;  1CIG A;  1L9J C;  2BLF B;  2GC4 D;  1HZU A;  1BCC D;  1PPJ D;  3H1I D;  3KHU A;  1K3H A;  4WQ8 A;  2JTI B;  1CNO A;  5CIF B;  5CIH B;  1I8P A;  4QAO A;  2GC7 D;  3WFD C;  1W2L A;  1CSV A;  2N18 B;  4YE1 A;  4AAO A;  2N18 C;  3PXW A;  1HCM A;  1HZV A;  4UB6 V;  1E2R A;  1CXA A;  5CID B;  1ZZH A;  2JQR A;  3HQ7 A;  1CIE A;  3C2C A;  1KYO W;  3H1H D;  4L1Q A;  1E29 A;  2AXT V;  5GTH V;  1KB0 A;  1DW0 A;  3SWS A;  2RMZ A;  4WQA A;  2L4D A;  1YCC A;  2BCC D;  1YNR A;  1NTK D;  3NBS A;  4EDF A;  1DVV A;  4Y5R A;  5DFS A;  2CA3 B;  3CP5 A;  3TDK A;  3VNW A;  1S5L V;  1GJQ A;  2BH4 X;  1KIB A;  2PCB B;  3L4M A;  5B66 V;  1IRV A;  4PJ0 V;  3RMZ A;  4WQ7 A;  1COR A;  2LIT A;  351C A;  3H1K D;  5KAI V;  5B6Q A;  1L0L D;  1HJ5 A;  1H31 B;  3M97 X;  3VMA A;  3JBT B;  1H33 A;  2YQB A;  5DJQ B;  2B12 B;  3ITK A;  1WVE C;  5TIS V;  1M6Z A;  1CCR A;  4GYD A;  5DJQ C;  2V07 A;  4L3H A;  2OZ1 B;  3WFC C;  1DW2 A;  4AX3 A;  3ZIY A;  1NTM D;  1CRG A;  2N9I A;  5CIC B;  3DR0 A;  2C9X B;  1HH7 A;  1DW1 A;  1NMI A;  1OCD A;  1CRJ A;  4PD4 D;  1C6O A;  1NTZ D;  1WEJ F;  2QG4 A;  2BCN B;  1HRO A;  1NML A;  2LIR A;  1SQQ D;  1U75 B;  4NFG B;  1IZL 0;  1VYD A;  1CXC A;  1A8C A;  4WQE A;  4AAM A;  1H32 B;  3OA8 B;  1LC2 A;  3ZOW A;  1F1C A;  3O20 A;  2B4Z A;  2AI5 A;  3PRJ A;  1RZ5 A;  2FRC A;  1M70 A;  3OA8 A;  1A2S A;  1CSX A;  5DF5 A;  3O5C A;  2DVH A;  1FI7 A;  3GW6 A;  1KB9 D;  2YIU B;  3TF5 A;  1NIR A;  1KX7 A;  3DMI A;  4XYD B;  1CSU A;  3SVW A;  3ZOX A;  3CX5 W;  2Y0E A;  2GIW A;  4D6T D;  1COT A;  4V2K A;  1OAE A;  1FI9 A;  3HQ8 A;  1CIF A;  1H9X A;  2C1D B;  3L72 D;  4IL6 V;  155C A;  1C75 A;  1P84 D;  2Y0C A;  1DT1 A;  3PH2 B;  3PXS A;  1U74 B;  3H1L D;  5EXQ A;  1CTJ A;  1CO6 A;  2O3J A;  1CHJ A;  4N0K A;  4FB1 A;  3ZCF A;  1C2N A;  1GKS A;  3L4O A;  4MU8 A;  1EB7 A;  1CRI A;  3GG2 A;  3CU4 A;  5CIG B;  1N15 A;  4FA1 A;  1DII C;  1FHB A;  1QL3 A;  1CC5 A;  2DGE A;  4AAN A;  1L0N D;  2CXB A;  4Q5P A;  4EIC A;  2K9J B;  1DIQ C;  2HV4 A;  1CRY A;  2C1V A;  4AAL A;  5KAF V;  2FWL A;  1CRH A;  3ORV A;  4K3I A;  2I8F A;  1IO3 A;  4WQ9 A;  2V08 A;  5KLV D;  1C6R A;  1BGY D;  2QJP B;  3BCC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...