2QJKB

Crystal structure analysis of mutant rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
256
Chain Sequence
b'AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
total genus 65
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjkB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjkB02
2BLFB 3NWVA 2BCCD 1I8OA 2GIWA 2N3YA 1YIQA 1CIHA 1AYGA 5AURA 1CCHA 1CRCA 4N0KA 2FRCA 2B11B 4WQBA 3WC8A 3PXTA 1FJ0A 2YIUB 2PCCB 2DGEA 1OAEA 1YEAA 1E8EA 1NTZD 2O3JA 3H1KD 3L75D 3ZOOA 1IZL0 3RLMA 3OA8B 4DY9A 3GG2A 1CSVA 4IL6V 2YK3A 3HQ9A 5B6QA 1M70A 2C1DB 3H1ID 2ORLA 1AKKA 1CRGA 4V2KA 1EB7A 1C2NA 3GW6A 3WFDC 1LS9A 2YCCA 5GTHV 3PLNA 1YTCA 2I8FA 1CSUA 1QN2A 1H33A 2N18B 3A0BV 2BH4X 4U3FD 5C0ZA 1H9XA 1NTKD 3SWSA 3ZIYA 1J3SA 5CIHB 4J20A 4KMGA 2ZONG 5CIEB 3NBTA 2CE1A 1C7MA 4A7PA 2FYUD 3BCCD 3A0HV 2KS1A 1CTJA 1EZVD 1DW3A 1DW2A 1U75B 2C9XB 2OZ1A 1PPJD 1CEDA 4D6TD 4H0KA 2KNCB 1C6SA 1I54A 4FA4A 4P4QB 2OZ1B 4EIFA 3CX5D 1RAQA 5EXQA 3L72D 1HZVA 1K3HA 1CTZA 3KZIV 1N90A 1QL3A 1VYDA 2BCNB 2C8SA 2N9IA 3PH2B 5CIGB 1CCRA 3A9FA 1WEJF 1IQCA 5KLIB 451CA 1ZZHA 1M6ZA 3CX5W 3X39A 4PD4D 5CIBB 3MK7C 1FI9A 5TISV 2BH5X 2B12B 1L9JC 5B66V 1A56A 3H1HD 1CIGA 3M97X 4FA1A 1QL4A 1KYOD 3SJLA 1CRJA 1LFMA 1N50A 3SLEA 4WQ7A 3PHLA 2ZXYA 4O1WA 4WQCA 3OCDB 2C1VA 1QYZA 3WFBC 4AAOA 1GQ1A 3ORVA 1KYOW 4JCGA 1H31B 1M60A 3OA8A 4K3IA 1N9CA 1F1FA 1JDLA 1KX2A 3H1JD 1C6OA 2QJKB 1GJQA 2C1DA 1CIFA 1GU2A 2A06D 2BGVX 5DFSA 1I5TA 2AI5A 5E79V 1FI3A 1FOCA 1C2RA 3HQ8A 1CYCA 1CSWA 1KB9D 1WVEC 5CYTR 3ZOWA 3DP5A 1SQVD 1NTMD 3SVWA 4FANA 1SQBD 1SQXD 4YE1A 1CTYA 1I8PA 4WQ8A 3SXTA 1C52A 2N18C 1NMLA 1CRHA 1YNRA 5CIFB 3CYTI 5KAFV 1SQPD 1FHBA 1U74B 1H32B 1L0ND 3O20A 3CU4A 4XYDB 2Y0EA 4AAMA 1I55A 1YCCA 2FYNB 2MHMA 1BGYD 1I6EA 4UB6V 2CE0A 3L4MA 4AALA 1DW1A 3ZOYA 2PACA 1CHJA 1BE3D 1P84D 4FAVA 1FI7A 2N9YB 5KLVD 1I6DA 3C2CA 1HROA 3TDKA 1KV9A 2JQRA 3DR0A 2L91A 4AANA 1CNOA 1NIRA 2CA3B 4WQAA 1HJ5A 1NNOA 1ZRTD 1BCCD 1HRCA 4GYDA 1CXAA 2HV4A 1DIQC 1CO6A 1C75A 3TGUD 1CYJA 4PJ0V 1L0LD 3FWLA 3H1LD 3L73D 2GB8B 5C9MA 2QG4A 2BPBB 3ITKA 351CA 3NBSA 1IRWA 1BL9A 5CIDB 3OCDA 4MU8A 1SQQD 4RSZA 2AXTV 1GKSA 3CP5A 1RZ6A 2GC4D 1CC5A 1DW0A 1H31A 4Q5PA 2XTSB 4FA9A 1HJ4A 2ZBOA 5DJQB 2N3BA 2IBZD 155CA 2K9JB 4FA5A 2JWAA 1CRIA 3PXWA 5KAIV 2YQBA 1B7VA 3L4OA 2Q3EA 2LIRA 1KX7A 4WQ9A 1PP9D 3PRJA 1H33B 1H1OA 2ZOOA 4EICA 1A8CA 1GDVA 3KHUA 1N15A 3CWBD 1RAPA 3RN0A 3ZBMA 4PWAA 1H9YA 1CORA 2AIUA 3HQ7A 2QJYB 2Y0CA 4LJIA 3PTZA 1E29A 1CHHA 2C1UA 1CYIA 1HJ3A 1HZUA 4QAOA 1CRYA 4GEDB 3PXSA 1L9BC 2MTAC 5IY51 2B0ZB 4RJTA 1S5LV 4UB8V 5DF5A 2CA4B 2V08A 1LC1A 4L3GA 3RMZA 2CXBA 1H32A 1C6RA 2V07A 1K3GA 1DVHA 3WFEC 3TYIA 3O1YA 5GTIV 1CIEA 1LC2A 2C2CA 3L74D 1CSXA 5TJHA 5KKZB 4XXLA 1HCMA 2N9JA 2FWLA 2ZZS1 1HH7A 3O0RC 5B5EV 1YEBA 4EDFA 3JBTB 1A2SA 4EIEA 1OCDA 1GIWA 2RMZA 4Y5RA 3WFCC 1YICA 2D0SA 1DIIC 1NU1D 1DT1A 1ETPA 1MZ4A 1AOQA 3CXHD 3L71D 2QJPB 3WUIA 1FCDC 2B10B 3HQ6A 4WQDA 3TF5A 3VYMA 4L3HA 3L70D 1NMIA 1S6VB 1KIBA 4H0JA 1W5CT 3VRDA 2LITA 2VHDA 4L1QA 3CXHW 3VMAA 4PW9B 2D0WA 4FB1A 3VNWA 3ZOXA 4NFGB 1MG3D 4O1QA 1R0QA 3O5CA 1COTA 2EXVA 3MK7B 1CXCA 4WQEA 1MG2D 5CICB 3WU2V 1AOFA 2B4ZA 3DMIA 5H2FV 1CHIA 1IRVA 1LMSA 3ZCFA 1DVVA 1F1CA 1KB0A 1W2LA 2PCBB 1YFCA 2GC7D 2RN0A 3RN1A 4AX3A 2DVHA 1RZ5A 2L4DA 1IO3A 1QKSA 4EIDA 1E2RA 2Y0DA 5DJQC 2JTIB
chains in the Genus database with same CATH superfamily
2BLFB 3NWVA 5AW7B 4B86A 2Y9YA 3A2AA 2N3YA 2FXMA 2QM8A 3SWYA 4H13B 1X22A 2CK3H 1H88A 1CCHA 4N0KA 3D70A 4WY4C 3WUTA 2D2CD 2DGEA 1OAEA 1YEAA 1NTZK 2QJYC 2KZJA 1J1DB 4H0LD 3MUDC 4ZKPA 1HJ0A 2QE7H 3Q2YA 3H25A 2A45H 5GTHE 2ORLA 3H1KJ 4IFFA 1AKKA 2I8DA 3RK2D 3R2PA 4BXLA 1SQVK 1C2NA 1FZGA 5GTHV 1YTCA 2I8FA 1CSUA 1QN2A 2BH4X 2H43A 1KD1Q 2JR8A 2P7JA 5CIHB 2B87B 3U1AA 5CIEB 1ZXGA 3NBTA 1YJWP 2ZYAA 1E79H 1CTJA 1NTKJ 5APVA 4XE5B 1LP1B 1PPJD 1CEDA 2V7QJ 4D6TD 2FYUJ 3OJAB 3KZIE 3RGUA 4P4QB 1DEBA 1N73A 1NTKE 1L0NJ 1USDA 1T3JA 3KZIV 1VYDA 2BCNB 2FYUE 1NTKG 2KYVA 3A9FA 1EZVE 3L72J 3CX5W 2FYUG 1L0NE 5TISE 1VQMP 1EZVG 3IAOA 3MIWA 2N1TD 1L0NG 5B66E 2O01H 3L72E 5TISV 1PGQA 2WVRA 2WMMA 1L0LK 3VTPC 1IJDB 3EFFK 5B66V 1A56A 1LTJB 3L72G 5DJUB 3RL0D 2ZVNB 2E75D 3CMEP 2W6BA 1GZLA 1QL4A 4RO0A 1KYOD 3H1HJ 1M57D 1CRJA 1OVVA 2JEEA 5CMZA 1AQ5A 1N50A 3SLEA 3CL3D 3GHGC 2ZXYA 3HE4B 4WQCA 4IL6X 3OCDB 1QYZA 1LGHB 3D6YA 4H13C 3B4SA 3V4WA 3H1HE 2G8YA 3V2PA 1N7LA 3CCVP 3ORVA 1FE6A 3A7OA 4K3IA 3AEBC 1N9CA 1F1FA 5E79E 3H1HG 1JDLA 2JKVA 1C6OA 2QJKB 2C1DA 1J1DC 1USEA 5DFSA 1I5TA 2JWDA 5E79V 1PV3A 2FBWC 2E74B 5CBOA 1M7LA 3HQ8A 2E5YA 3UIAA 1CSWA 1WVEC 3ZOWA 3E1IA 4I6MC 1SQXK 2LR2A 4YE1A 2WPVB 1VF5B 1I8PA 1X8YA 3FWNA 1SQVJ 5CIFB 2FFDB 4IFDK 4OGQD 1EC5A 3CI9A 3U59A 3KZIH 1H32B 4H44B 3S9OA 1L0ND 1ZV8A 3HE5A 3CU4A 1VQPP 1IFNA 1QEXA 4HJGH 1SQPJ 2FYNB 2MHMA 2R5DA 1VPCA 3G4SP 2OYHB 4AALA 4KJMA 1G2CB 1NU1K 1Q2NA 2N9YB 2VRSA 1N7SA 5TISH 1SQPE 5CCGA 1YTZT 2N9BA 1GL2A 4JYBA 4R4MA 2E42A 1UIXA 4EOTA 5B66H 1N7SB 4WQAA 3TNUB 1SQPG 1L2PA 1SFCD 4LGDE 2C0WA 1ZRTD 1CXAA 1NVOA 1CO6A 3TGUD 3H1LD 1H89A 1LTJC 2WSFH 5EFWB 3VMXA 2AXTE 3VMYA 1IK9A 1MFTA 2YKOA 1L0LJ 3NBSA 1BL9A 5CIDB 3M9BA 1ZW0A 1SQQD 3NFQA 4RSZA 2AXTV 5APXA 3CP5A 2GC4D 1L4AB 4EYYQ 3F5HA 4K3AA 3KQGA 1LT9B 3A3YB 2WWWA 1URQA 2ZT9D 2IBZD 155CA 1CRIA 1SVFA 1PIXA 3H32B 1URQB 3PJSK 1KX7A 1LTTC 3PRJA 2SPZA 2QJKC 3II6A 1KB9I 4EICA 2M5AB 1RAPA 2E74C 1H9YA 1CORA 1QLED 3CCEP 4AUWA 2Y0CA 1S5LE 2AEJA 1HZUA 3PXSA 1L9BC 1S5LV 1M1JB 3V2NA 1VF5C 2CA4B 1W5CE 1LC1A 2WPQA 5GTIE 1N86A 4L3GA 1WMKA 1DIPA 2V07A 3HRNA 2FFDC 1DVHA 3TYIA 1HH0A 3V6IA 5GTIV 3RBZA 2C2CA 4RKUJ 1A02J 1JO5A 1SP4A 1JOCA 4H44C 4ZKUA 3LW5J 5KKZB 2P58A 1HCMA 1PFIA 2XNXA 2ZZS1 1SLQA 3O0RC 1K73Q 2FYNC 3Q5SA 1A2SA 1OCDA 2RMZA 3L74J 3WFCC 3D6ZA 2D0SA 2OYHC 1OVUA 3S4RA 1DIIC 4RESB 2M3BA 1S9KE 1CW5A 3WUIA 4WQDA 1KZUB 3AEEC 3L74E 1NU1J 3BRVB 4L3HA 1ZR2A 1N7SC 1OMIA 2XV5A 1LNQA 2PFXA 3L74G 4L1QA 3CXHW 4PW9B 1EXIA 1EDKA 4NFGB 1KILA 4O1QA 2YXRB 1GDTA 1COTA 1KYOI 1KN7A 1CXCA 4WQEA 1MG2D 2NPSD 2E76C 3MTUE 1J1EC 3DMIA 3V2RA 1YQ3C 1IRVA 3ZCFA 4DJGA 1KB0A 5AVXB 2RN0A 1YFCA 2GC7D 2K9JA 3RN1A 1L4AC 1VQKP 5AVYB 1QKSA 3T97B 2JTIB 1YIQA 4WY4A 1URQC 1GW3A 5CCHD 1M56D 1K8AQ 1Q81Q 2M3EA 2FRCA 2W27A 2OYOA 2WSEJ 3B5NA 4L73A 3ABVC 2HYNA 2O3JA 3L75D 3B5NB 3L4FA 3ZOOA 1IZL0 1H0TA 3RLMA 1M1KQ 3HQ9A 1H0TB 5B6QA 3HUSA 5KJ7D 2Q3IA 1M1JC 4WB4A 1S9KD 3CCMP 1VQNP 3GW6A 1YQ4C 2WQYC 4ZMDA 4H13D 2E43A 2N18B 1NTKK 4U3FD 5C0ZA 3SWSA 2YMKA 3G71P 5KKZC 2AXCA 1HJBA 3R4YA 1C7MA 2ZONG 2FYUK 3LW5H 4A7PA 1WT6A 1MZ9A 1RF0C 3BCCD 2KS1A 3AEAC 4HKZH 1L0NK 5AW9B 1JEKA 1NTME 4H0KA 2KNCB 1I54A 4EIFA 1KTMA 2W6AA 1NTMG 2Q5UA 4W7ZA 4D6TJ 1P84H 2E5TA 1N90A 1QL3A 5CIGB 3CCSP 1DEEG 1IK7A 3RL0g 5KLIB 451CA 1M6ZA 2FXOA 3X39A 1PPJE 1VQ5P 1VQ6P 2HPCA 1KV4A 2IFMA 2CPSA 1PPJG 2GA1A 2XKMA 2WSCH 2B12B 1BGYG 3VN0A 5AVWB 1CIGA 2IBZI 3HD7B 3GHGA 2WZ7A 1VL2A 3M97X 1MUUA 4PV1D 2NRGA 3PHLA 2AEFA 3EQ2A 1RE3C 3RK3B 5APTA 3USSA 5AW2B 3FX0A 1FZAA 3WFBC 3LIDA 4AAOA 1X9VA 3N7NA 1GU4A 4JF7A 1H31B 2V4HA 2I1JA 2IZ0A 2JP3A 1NGMB 3H1JD 1FU1A 4R4LA 2WSEH 1YI2P 1KYOE 2K9YA 3VMZA 3AEDC 1JY3P 2KB7P 1GU2A 2BGVX 3B5NC 2CPBA 3OA7A 1FOSE 4XA4A 5AW8B 1CYCA 1KQFB 1KB9D 1JY2N 3DP5A 1NTMD 3HUSC 1ZLLA 3SVWA 2B87A 3KPEA 1SQBD 1YHQP 2YO2A 4MN4C 4WQ8A 5KAFE 2N18C 3CCUP 1FAVA 4KT0J 1RQVA 1LP1A 1SQPK 1GK4A 2J58A 5KAFV 3RBXA 1J2JB 1QGKB 1RE4C 1U7JA 4ASVA 1Y8AA 1HF9A 1IC2A 2O1JA 1JY3O 4UB6E 4DT0A 2E74D 2WPSA 2Y0EA 1MFZA 1I55A 1YCCA 1BGYD 3KDPB 2PGDA 1NJIQ 4UB6V 1ZR4A 3JCUH 1DW1A 3ZOYA 1YBKA 1QVFO 4GKGA 1ZOYC 3WU2H 3CXHH 5KLVD 1I6DA 3SSUA 1JTHB 1HROA 2ZXEB 5CBNA 3AEFC 2C9NY 5KLIC 3BASA 1NNOA 4IOIH 1BCCD 3W68A 1FDIA 4H44D 1HRCA 4GYDA 2ZXXA 1RH5B 3PH0A 1LTJA 1E5WA 3KYQA 1CYJA 2BASA 2OGUA 1N8RQ 1OVRA 4GOEA 2QG4A 3HD7C 3TGUJ 2BPBB 3CLQA 3HE4A 3OCDA 2D2CB 3H1LJ 1ZRTE 2QVAA 3HTKB 1GKSA 1RZ6A 3P7KA 1DW0A 1N7SD 3RK3C 1YTZI 4XFJA 2W90A 5CCGD 5APQA 3BVHA 1GL2D 3TGUE 4FA9A 1SQQJ 2HODB 3EFGA 4BWNA 2AEMA 4C7RA 2RKLA 4Y99B 2ZBOA 3H1LE 4OVNF 2JWAA 1G1JA 1AQTA 3TGUG 2KLUA 1HVVA 3H1LG 1RF1B 3L4OA 1VQ9P 2LIRA 4U7JA 5GTHH 1PP9D 1YYCA 3MGNA 1SQQE 2XZRA 1A8CA 1FZEA 2HR3A 2E76D 2ZYDA 4WBAA 3ZBMA 3CCQP 1SQQG 2B9BA 4UB8E 1E29A 1CHHA 1YJNP 2IBZE 2MTAC 3V4QA 5IY51 2B0ZB 4UB8V 1LTIC 2FFDA 2BCCE 2IBZG 2IPPA 2V08A 1WRGA 2IX7C 3RMZA 2W8ZA 1H32A 1KILE 1C6RA 2BCCG 1URQD 2L5GB 3QWOC 1K3GA 3O1YA 5B5EE 1CSXA 2XDJA 1PGOA 2B89A 2N9JA 2OYHA 2FWLA 1G2CA 5B5EV 1YEBA 2V7QH 4EIEA 1NWQA 1GIWA 2OYIB 4Y5RA 4AQRD 3TYYA 3C8VA 2BEQD 2N1TB 2OQQA 1GMJA 3WUVA 3L71D 3H1IG 1HTLC 2B10B 3TNUA 3TF5A 3CC7P 2FYZA 1IFIA 3VYMA 4W7YA 1OFCX 4ASWA 2J5UA 2W6JH 3L70D 1NMIA 1W5CT 1IZNB 2VHDA 3C1LA 1LWUB 3VMAA 4FB1A 1KQSO 2IDBA 2K1AA 2M0BA 4HH2A 1R0QA 4WVZA 1W2BO 5H2FE 5CICB 2Y9ZA 3Q5RA 2C0XA 1L4AA 2H88C 4N78E 5H2FV 2D2CC 1LT9A 1FJPA 1D7MA 1W2LA 5E79H 1IO3A 1R5LA 3H32A 1HUCA 1E2RA 1MV8A 2YKPA 4Y99C 1VQOP 3GLMA 2BCCD 1I8OA 5AVUB 3L36A 2M5AA 1CIHA 2A45I 5AURA 3G6EP 2XNDH 4JYCA 3FGAD 1KILD 2B11B 3V2QA 3IR9A 1FJ0A 2YIUB 2PCCB 4TLFA 4IL6E 4LC1A 1NTZD 1AVOA 1M1JA 4OGQB 1S1CX 3H6PA 3OA8B 3SWKA 4DY9A 3GG2A 1CSVA 4IL6V 2YK3A 4Z1MH 3H1ID 2ZAEB 3CCJP 2R44A 2KSJA 3L75J 3NMDA 3A0BE 4V2KA 1NTMK 3IF4A 5AW1B 1JUNA 2IYPA 1VQLP 2W83C 3B71A 1K05A 3A0BV 1RF0A 4WY4D 2NZ2A 3L75E 3A0HE 1KFMA 2LXBA 1NO4A 2CE1A 3L75G 1JB0J 1SFCB 3A0HV 3NXSA 4U3FJ 3B5ND 1DW3A 4DOJA 1DW2A 1U75B 2OZ1A 4I2LC 1LT1A 1C6SA 3BCCJ 1DD4A 2OZ1B 3CX5D 5EXQA 2I1KA 2LXCB 4U3FE 1EDJA 1KFNA 4N78D 1U57A 1K3HA 1CTZA 1AVYA 3JC22 4N6JA 2B88A 2BEZF 2JO1A 2C8SA 2N9IA 4U3FG 3BCCE 1KQGB 1LWUC 2JJLA 2MKVA 1YITP 4M3LA 3CC4P 1ZZHA 2AXTH 3A5TA 1HGZA 3BCCG 4PD4D 5CIBB 1K9MQ 4PJ0E 2ZT9B 2H89C 1T8ZA 4HB1A 3CCRP 3T97A 1RQUA 3M91A 1RE3A 1LT9C 3VOPA 2K37A 4N3YB 1T2KC 1LFMA 4WQ7A 1IFPA 4GOFA 2QA4P 1S5LH 2WTYA 4IL6H 3I55P 3M9HA 1GQ1A 1BDCA 1FZFA 1U7MA 1KYOW 4JCGA 1BSHA 3AE6C 3F89A 2YIUC 3O6QA 1JMMA 1GJQA 5GTIH 3CC2P 1CIFA 2AI5A 2J59M 3O6QB 2PP6A 1FI3A 2R3SA 4NPEA 4CPGA 1C2RA 3H1JJ 3AE9C 2QRXA 5CYTR 3VP9A 1BSNA 1IFJA 5AVTB 3ZDMA 3RK3D 2KP8A 1SQXD 4I7ZB 3GF7A 1CTYA 3H1JE 1MKMA 3SXTA 4YTPC 1NMLA 1RE4A 1NTMJ 1CRHA 2YXQB 3H1JG 1SQBJ 2YO3A 1FHBA 1SFCC 2KNCA 1KB9E 3VP8A 4XYDB 2A45G 2C9LY 2HG5D 4K35A 4AAMA 2P1JA 2Z5IA 1SQBE 3SFEC 3L4MA 2PACA 1CHJA 1SQBG 1BE3D 1P84D 1FI7A 1FZBA 2NPSB 1BGYJ 1NYHA 3TDKA 1KV9A 2JQRA 3DR0A 2KSEA 1HGVA 4IFMA 2ZYGA 1K04A 5AVVB 1CNOA 2LKMA 1NIRA 1BDDA 2XU6A 5KLVJ 1BGYE 2YMYA 2PAJA 2HV4A 2ZT9C 1DIQC 1C75A 3HD7A 4GIFA 1BCCJ 5K5GB 5KLVE 3CCLP 3L73D 1S2EA 2O01J 4NPFX 1X79B 3U1CA 5KLVG 351CA 4L75A 1SQQK 4MU8A 1NH4A 1BCCE 2WT7B 2KOGA 1CC5A 1BCCG 3M0DC 1H31A 1Q7YQ 1NKNA 3VYIA 3AE8C 5KAIE 2FY8A 5DJQB 2N3BA 1OW8A 3EWKA 3PXWA 5KAIV 2YQBA 4WQ9A 1H33B 1YIJP 2ZOOA 1GDVA 3CWBD 3RN0A 1FBMA 3CMAP 1JCDA 1PP9J 2HFED 4LJIA 1AA0A 1NAYA 1HJ3A 1JY2P 4QAOA 3IFMA 1JY3N 1CRYA 4RJTA 3GF3A 4I7ZC 3CPWO 2P67A 1PP9E 5AW6B 4NPDA 1KB9H 5AW5B 2ITAA 1AFOA 3IN6A 1PP9G 3WFEC 1LC2A 3CX5I 2Z5HA 1GTWA 1Z56A 4WWIA 1A02F 1GD2E 4OWFA 5C39A 3H1KE 5DJTB 4XXLA 1EQ7A 5BU5A 3D0WA 4EDFA 1DH3A 3JBTB 3H1KG 1JTHA 3I56P 1YICA 1JY2O 1MZ4A 1EDIA 3CXHD 1VQ8P 1VF5D 3B8EB 2QJPB 2NPSC 4PD4I 1S3JA 1JMBA 3M9QA 2QIWA 4HYTB 3AE7C 1QL1A 5AVQB 2K88A 3L71J 2ZJSE 1Y9BA 1S6VB 1KIBA 1DD3A 3VRDA 2LITA 1N73B 4PV1B 2D0WA 5KTBA 3L70J 1JM0A 3ZOXA 3L71E 3KXDA 2GM4A 4O9BA 1S4XA 2Q1KA 3AE3C 3MK7B 3GMAA 1XTGB 5CCHC 3HTKA 3L71G 3L70E 2B4ZA 3W67A 1ZMEC 1LTGC 2WSFJ 2HODA 5KAIH 2G3AA 1GW4A 2KK7A 4H0LB 2JDIH 3L70G 2PCBB 4JBZA 1CZQA 2L4DA 2Q7CA 1FZCA 3Q5PA 1FDMA 1RF1A 1KYOH 2Y0DA 3RK2B 3Q1MA 5DJQC 5KJ7C 3G9RA 1FZCB 2GIWA 1S5LX 2R3CA 1AYGA 2MJZA 1CRCA 1W2EA 2K3RA 1PL5A 2BCCJ 4WQBA 3WC8A 3PXTA 3NTNA 5L8RJ 2Q6QA 1FS0E 1E8EA 3H1KD 5KAFH 2YKQA 1L4AD 2ZVOB 4L76A 3MP7B 1T2KD 1M70A 2C1DB 1NTZJ 4YXDC 2RH0A 1CRGA 3PP5A 4UB6H 1EB7A 3WFDC 1LS9A 2YCCA 4YXWH 3PLNA 2HLOA 1NHLA 3H1IJ 1NAFA 4C46A 2QM7A 4I1LA 1NTZE 1H9XA 1NTKD 1GU5A 2H8PD 1J3SA 3ZIYA 1YJ9P 2OYIA 1QX8A 2IYOA 2GUVA 5AVZB 2A06E 1P84I 3TK1A 4J20A 4KMGA 2N1TA 1NTZG 1OXZA 2FYUD 2OARA 4DCKA 1OW6A 3H1IE 1EZVD 2A06G 3BATA 1M90Q 2C9XB 1SQVE 3L37A 2QJPC 1X0TA 2YNYA 4FA4A 3HE5B 1RAQA 1N2DC 1SQVG 2Q9IA 1LWUA 3L72D 3RL0B 1HZVA 1EDLA 3SWFA 2E75B 1NKZB 3PH2B 4JQ0D 1CCRA 1N73C 1KMIZ 4PV1C 1WEJF 3C9IA 1IQCA 1S72P 5BU8B 1M8OB 4OH8B 1GL2B 1LTBC 1Q90D 3CX5E 3MK7C 1FI9A 2BH5X 2IZ1A 1L9JC 3P32A 2FXPA 3H1HD 4EI2A 5APYA 4H0LC 1LTSC 2WPRA 1HWTC 1FDOA 3N4XA 2E76B 2R5BA 4FA1A 1OX3A 1J1EB 4PD4E 3SJLA 1R5SA 2WITA 1CSBA 4L74A 3RK2C 3M06A 1AJYA 1PGJA 1LJ2A 1FZCC 4O1WA 1RF1C 1T6AA 1Q86Q 2C1VA 2OTJP 5AVRB 4UB8H 1L0LE 1LTAC 2M8RA 3FXEA 3AE4C 3G3ZA 1M60A 3OA8A 2P2UA 1FOSF 1L0LG 1KX2A 3MD0A 2OTKE 2KLVA 2A06D 1FOCA 2KZIA 5CHXA 3I5CA 5B5EH 1HBWA 3AE5C 1PGPA 1OZHA 1SQVD 1JCCA 1Q82Q 1SQBK 2P10A 2WSSH 4FANA 1RHZB 1QL2A 1C52A 2KXPB 5CJ0A 1SFCA 1YNRA 1KORA 3P8CE 1SQXJ 3CXHI 3CYTI 5CJ4A 3JSVC 1SQPD 2OYIC 1U74B 3TSIA 3P8MC 2N1TC 3O20A 4GDOA 1FJKA 4LLHA 3RK3E 1CI6A 1T3UA 4DZOA 1I6EA 1SQXE 3E1RA 3O8ZA 1ZN5A 1CI6B 2CE0A 3MHVA 1SQXG 1PZQA 4YPCA 1RY3A 3RL0C 4FAVA 4JPZB 5AVSB 5KLVK 4ZNCA 2UWJE 1IFMA 2E75C 3C2CA 1SS1A 1IFDA 5H2FH 2KI7B 2L91A 4AANA 2POHA 3CX5H 1BE3J 2CA3B 1HJ5A 4GT1A 4TT3H 4GODA 5APSA 5CCGC 2KIKA 1GL2C 3L35A 1KQLA 3AECC 2O1KA 1BE3E 1P84E 3BRTB 1NU1E 4PJ0V 1L0LD 3FWLA 4PD4H 1H8AA 4KHXA 2GB8B 5C9MA 1BE3G 1KILB 1AV1A 1NU1G 2WSCJ 3ITKA 3AE1C 1IRWA 3S1KA 1G1IA 3M0DA 1R8EA 3L73J 4EIJA 5AW0B 2IFNA 1IO4A 2R32A 1NOHA 4Q5PA 2XTSB 1HJ4A 3AEGC 3L73E 2K9JB 4FA5A 3D71A 5APUA 3Q3DA 1B7VA 2Q3EA 3L73G 4OGQC 3HD7D 3P8CD 1H1OA 1XTCC 3A0BH 2DW3A 4WY4B 3KHUA 1N15A 4PWAA 3MUDA 4AYCA 2H7HA 5BVZA 2AIUA 3HQ7A 3MZWB 5AW4B 2QJYB 3PTZA 3AE2C 2C1UA 1CYIA 3A0HH 3CWBJ 4GEDB 3CD6P 3M0AA 1VDFA 1Y47A 2QSIA 3OW2O 2KUBA 5DF5A 3OAKA 5APWA 1VQ4P 1EZVI 5AW3B 2CXBA 3SFDC 2Z4EA 2OTLP 2O01N 3CWBE 3HUSB 1CIEA 3E7KA 3L74D 3CWBG 5TJHA 1EXJA 1GK6A 1HH7A 1UIIA 1KC8Q 2PRRA 2NPSA 3LIEA 1OWAA 1DX7A 1NU1D 1DT1A 1ETPA 1AOQA 2KS1B 2QEXP 1FCDC 3HQ6A 4Y28J 1VQ7P 4PJ0H 3WMM0 1OIPA 4BRYA 4H0JA 5M1BA 3FXDA 3V5BA 4BRYB 3VNWA 3JCUE 5CCHA 1FC2C 1MG3D 3WU2E 3CXHE 3O5CA 1JNMA 2EXVA 4D6TE 2ZFCA 2WT7A 2FKWB 3WU2V 1KILC 4C7NA 1AOFA 4D6TG 2HPCB 1CHIA 1LMSA 4C7NB 3WUUA 1DVVA 3K5BA 4QMAA 1F1CA 4W80A 5KJ7A 1ZP0C 1OW7A 4AX3A 2DVHA 1RZ5A 1QVGO 4EIDA 1TU3F 2GUSA 3GHGB 3QH9A 1H33A
chains in the Genus database with same CATH topology
2BLFB 3NWVA 2BCCD 1I8OA 2GIWA 2N3YA 1YIQA 1CIHA 1AYGA 5AURA 1CCHA 1CRCA 4N0KA 2FRCA 2B11B 4WQBA 3WC8A 3PXTA 1FJ0A 2YIUB 2PCCB 2DGEA 1OAEA 1YEAA 1E8EA 1NTZD 2O3JA 3H1KD 3L75D 3ZOOA 1IZL0 3RLMA 3OA8B 4DY9A 3GG2A 1CSVA 4IL6V 2YK3A 3HQ9A 5B6QA 1M70A 2C1DB 3H1ID 2ORLA 1AKKA 1CRGA 4V2KA 1EB7A 1C2NA 3GW6A 3WFDC 1LS9A 2YCCA 5GTHV 3PLNA 1YTCA 2I8FA 1CSUA 1QN2A 1H33A 2N18B 3A0BV 2BH4X 4U3FD 5C0ZA 1H9XA 1NTKD 3SWSA 3ZIYA 1J3SA 5CIHB 4J20A 4KMGA 2ZONG 5CIEB 3NBTA 2CE1A 1C7MA 4A7PA 2FYUD 3BCCD 3A0HV 2KS1A 1CTJA 1EZVD 1DW3A 1DW2A 1U75B 2C9XB 2OZ1A 1PPJD 1CEDA 4D6TD 4H0KA 2KNCB 1C6SA 1I54A 4FA4A 4P4QB 2OZ1B 4EIFA 3CX5D 1RAQA 5EXQA 3L72D 1HZVA 1K3HA 1CTZA 3KZIV 1N90A 1QL3A 1VYDA 2BCNB 2C8SA 2N9IA 3PH2B 5CIGB 1CCRA 3A9FA 1WEJF 1IQCA 5KLIB 451CA 1ZZHA 1M6ZA 3CX5W 3X39A 4PD4D 5CIBB 3MK7C 1FI9A 5TISV 2BH5X 2B12B 1L9JC 5B66V 1A56A 3H1HD 1CIGA 3M97X 4FA1A 1QL4A 1KYOD 3SJLA 1CRJA 1LFMA 1N50A 3SLEA 4WQ7A 3PHLA 2ZXYA 4O1WA 4WQCA 3OCDB 2C1VA 1QYZA 3WFBC 4AAOA 1GQ1A 3ORVA 1KYOW 4JCGA 1H31B 1M60A 3OA8A 4K3IA 1N9CA 1F1FA 1JDLA 1KX2A 3H1JD 1C6OA 2QJKB 1GJQA 2C1DA 1CIFA 1GU2A 2A06D 2BGVX 5DFSA 1I5TA 2AI5A 5E79V 1FI3A 1FOCA 1C2RA 3HQ8A 1CYCA 1CSWA 1KB9D 1WVEC 5CYTR 3ZOWA 3DP5A 1SQVD 1NTMD 3SVWA 4FANA 1SQBD 1SQXD 4YE1A 1CTYA 1I8PA 4WQ8A 3SXTA 1C52A 2N18C 1NMLA 1CRHA 1YNRA 5CIFB 3CYTI 5KAFV 1SQPD 1FHBA 1U74B 1H32B 1L0ND 3O20A 3CU4A 4XYDB 2Y0EA 4AAMA 1I55A 1YCCA 2FYNB 2MHMA 1BGYD 1I6EA 4UB6V 2CE0A 3L4MA 4AALA 1DW1A 3ZOYA 2PACA 1CHJA 1BE3D 1P84D 4FAVA 1FI7A 2N9YB 5KLVD 1I6DA 3C2CA 1HROA 3TDKA 1KV9A 2JQRA 3DR0A 2L91A 4AANA 1CNOA 1NIRA 2CA3B 4WQAA 1HJ5A 1NNOA 1ZRTD 1BCCD 1HRCA 4GYDA 1CXAA 2HV4A 1DIQC 1CO6A 1C75A 3TGUD 1CYJA 4PJ0V 1L0LD 3FWLA 3H1LD 3L73D 2GB8B 5C9MA 2QG4A 2BPBB 3ITKA 351CA 3NBSA 1IRWA 1BL9A 5CIDB 3OCDA 4MU8A 1SQQD 4RSZA 2AXTV 1GKSA 3CP5A 1RZ6A 2GC4D 1CC5A 1DW0A 1H31A 4Q5PA 2XTSB 4FA9A 1HJ4A 2ZBOA 5DJQB 2N3BA 2IBZD 155CA 2K9JB 4FA5A 2JWAA 1CRIA 3PXWA 5KAIV 2YQBA 1B7VA 3L4OA 2Q3EA 2LIRA 1KX7A 4WQ9A 1PP9D 3PRJA 1H33B 1H1OA 2ZOOA 4EICA 1A8CA 1GDVA 3KHUA 1N15A 3CWBD 1RAPA 3RN0A 3ZBMA 4PWAA 1H9YA 1CORA 2AIUA 3HQ7A 2QJYB 2Y0CA 4LJIA 3PTZA 1E29A 1CHHA 2C1UA 1CYIA 1HJ3A 1HZUA 4QAOA 1CRYA 4GEDB 3PXSA 1L9BC 2MTAC 5IY51 2B0ZB 4RJTA 1S5LV 4UB8V 5DF5A 2CA4B 2V08A 1LC1A 4L3GA 3RMZA 2CXBA 1H32A 1C6RA 2V07A 1K3GA 1DVHA 3WFEC 3TYIA 3O1YA 5GTIV 1CIEA 1LC2A 2C2CA 3L74D 1CSXA 5TJHA 5KKZB 4XXLA 1HCMA 2N9JA 2FWLA 2ZZS1 1HH7A 3O0RC 5B5EV 1YEBA 4EDFA 3JBTB 1A2SA 4EIEA 1OCDA 1GIWA 2RMZA 4Y5RA 3WFCC 1YICA 2D0SA 1DIIC 1NU1D 1DT1A 1ETPA 1MZ4A 1AOQA 3CXHD 3L71D 2QJPB 3WUIA 1FCDC 2B10B 3HQ6A 4WQDA 3TF5A 3VYMA 4L3HA 3L70D 1NMIA 1S6VB 1KIBA 4H0JA 1W5CT 3VRDA 2LITA 2VHDA 4L1QA 3CXHW 3VMAA 4PW9B 2D0WA 4FB1A 3VNWA 3ZOXA 4NFGB 1MG3D 4O1QA 1R0QA 3O5CA 1COTA 2EXVA 3MK7B 1CXCA 4WQEA 1MG2D 5CICB 3WU2V 1AOFA 2B4ZA 3DMIA 5H2FV 1CHIA 1IRVA 1LMSA 3ZCFA 1DVVA 1F1CA 1KB0A 1W2LA 2PCBB 1YFCA 2GC7D 2RN0A 3RN1A 4AX3A 2DVHA 1RZ5A 2L4DA 1IO3A 1QKSA 4EIDA 1E2RA 2Y0DA 5DJQC 2JTIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BLF B;  3NWV A;  2BCC D;  1I8O A;  2GIW A;  2N3Y A;  1YIQ A;  1CIH A;  1AYG A;  5AUR A;  1CCH A;  1CRC A;  4N0K A;  2FRC A;  2B11 B;  4WQB A;  3WC8 A;  3PXT A;  1FJ0 A;  2YIU B;  2PCC B;  2DGE A;  1OAE A;  1YEA A;  1E8E A;  1NTZ D;  2O3J A;  3H1K D;  3L75 D;  3ZOO A;  1IZL 0;  3RLM A;  3OA8 B;  4DY9 A;  3GG2 A;  1CSV A;  4IL6 V;  2YK3 A;  3HQ9 A;  5B6Q A;  1M70 A;  2C1D B;  3H1I D;  2ORL A;  1AKK A;  1CRG A;  4V2K A;  1EB7 A;  1C2N A;  3GW6 A;  3WFD C;  1LS9 A;  2YCC A;  5GTH V;  3PLN A;  1YTC A;  2I8F A;  1CSU A;  1QN2 A;  1H33 A;  2N18 B;  3A0B V;  2BH4 X;  4U3F D;  5C0Z A;  1H9X A;  1NTK D;  3SWS A;  3ZIY A;  1J3S A;  5CIH B;  4J20 A;  4KMG A;  2ZON G;  5CIE B;  3NBT A;  2CE1 A;  1C7M A;  4A7P A;  2FYU D;  3BCC D;  3A0H V;  2KS1 A;  1CTJ A;  1EZV D;  1DW3 A;  1DW2 A;  1U75 B;  2C9X B;  2OZ1 A;  1PPJ D;  1CED A;  4D6T D;  4H0K A;  2KNC B;  1C6S A;  1I54 A;  4FA4 A;  4P4Q B;  2OZ1 B;  4EIF A;  3CX5 D;  1RAQ A;  5EXQ A;  3L72 D;  1HZV A;  1K3H A;  1CTZ A;  3KZI V;  1N90 A;  1QL3 A;  1VYD A;  2BCN B;  2C8S A;  2N9I A;  3PH2 B;  5CIG B;  1CCR A;  3A9F A;  1WEJ F;  1IQC A;  5KLI B;  451C A;  1ZZH A;  1M6Z A;  3CX5 W;  3X39 A;  4PD4 D;  5CIB B;  3MK7 C;  1FI9 A;  5TIS V;  2BH5 X;  2B12 B;  1L9J C;  5B66 V;  1A56 A;  3H1H D;  1CIG A;  3M97 X;  4FA1 A;  1QL4 A;  1KYO D;  3SJL A;  1CRJ A;  1LFM A;  1N50 A;  3SLE A;  4WQ7 A;  3PHL A;  2ZXY A;  4O1W A;  4WQC A;  3OCD B;  2C1V A;  1QYZ A;  3WFB C;  4AAO A;  1GQ1 A;  3ORV A;  1KYO W;  4JCG A;  1H31 B;  1M60 A;  3OA8 A;  4K3I A;  1N9C A;  1F1F A;  1JDL A;  1KX2 A;  3H1J D;  1C6O A;  2QJK B;  1GJQ A;  2C1D A;  1CIF A;  1GU2 A;  2A06 D;  2BGV X;  5DFS A;  1I5T A;  2AI5 A;  5E79 V;  1FI3 A;  1FOC A;  1C2R A;  3HQ8 A;  1CYC A;  1CSW A;  1KB9 D;  1WVE C;  5CYT R;  3ZOW A;  3DP5 A;  1SQV D;  1NTM D;  3SVW A;  4FAN A;  1SQB D;  1SQX D;  4YE1 A;  1CTY A;  1I8P A;  4WQ8 A;  3SXT A;  1C52 A;  2N18 C;  1NML A;  1CRH A;  1YNR A;  5CIF B;  3CYT I;  5KAF V;  1SQP D;  1FHB A;  1U74 B;  1H32 B;  1L0N D;  3O20 A;  3CU4 A;  4XYD B;  2Y0E A;  4AAM A;  1I55 A;  1YCC A;  2FYN B;  2MHM A;  1BGY D;  1I6E A;  4UB6 V;  2CE0 A;  3L4M A;  4AAL A;  1DW1 A;  3ZOY A;  2PAC A;  1CHJ A;  1BE3 D;  1P84 D;  4FAV A;  1FI7 A;  2N9Y B;  5KLV D;  1I6D A;  3C2C A;  1HRO A;  3TDK A;  1KV9 A;  2JQR A;  3DR0 A;  2L91 A;  4AAN A;  1CNO A;  1NIR A;  2CA3 B;  4WQA A;  1HJ5 A;  1NNO A;  1ZRT D;  1BCC D;  1HRC A;  4GYD A;  1CXA A;  2HV4 A;  1DIQ C;  1CO6 A;  1C75 A;  3TGU D;  1CYJ A;  4PJ0 V;  1L0L D;  3FWL A;  3H1L D;  3L73 D;  2GB8 B;  5C9M A;  2QG4 A;  2BPB B;  3ITK A;  351C A;  3NBS A;  1IRW A;  1BL9 A;  5CID B;  3OCD A;  4MU8 A;  1SQQ D;  4RSZ A;  2AXT V;  1GKS A;  3CP5 A;  1RZ6 A;  2GC4 D;  1CC5 A;  1DW0 A;  1H31 A;  4Q5P A;  2XTS B;  4FA9 A;  1HJ4 A;  2ZBO A;  5DJQ B;  2N3B A;  2IBZ D;  155C A;  2K9J B;  4FA5 A;  2JWA A;  1CRI A;  3PXW A;  5KAI V;  2YQB A;  1B7V A;  3L4O A;  2Q3E A;  2LIR A;  1KX7 A;  4WQ9 A;  1PP9 D;  3PRJ A;  1H33 B;  1H1O A;  2ZOO A;  4EIC A;  1A8C A;  1GDV A;  3KHU A;  1N15 A;  3CWB D;  1RAP A;  3RN0 A;  3ZBM A;  4PWA A;  1H9Y A;  1COR A;  2AIU A;  3HQ7 A;  2QJY B;  2Y0C A;  4LJI A;  3PTZ A;  1E29 A;  1CHH A;  2C1U A;  1CYI A;  1HJ3 A;  1HZU A;  4QAO A;  1CRY A;  4GED B;  3PXS A;  1L9B C;  2MTA C;  5IY5 1;  2B0Z B;  4RJT A;  1S5L V;  4UB8 V;  5DF5 A;  2CA4 B;  2V08 A;  1LC1 A;  4L3G A;  3RMZ A;  2CXB A;  1H32 A;  1C6R A;  2V07 A;  1K3G A;  1DVH A;  3WFE C;  3TYI A;  3O1Y A;  5GTI V;  1CIE A;  1LC2 A;  2C2C A;  3L74 D;  1CSX A;  5TJH A;  5KKZ B;  4XXL A;  1HCM A;  2N9J A;  2FWL A;  2ZZS 1;  1HH7 A;  3O0R C;  5B5E V;  1YEB A;  4EDF A;  3JBT B;  1A2S A;  4EIE A;  1OCD A;  1GIW A;  2RMZ A;  4Y5R A;  3WFC C;  1YIC A;  2D0S A;  1DII C;  1NU1 D;  1DT1 A;  1ETP A;  1MZ4 A;  1AOQ A;  3CXH D;  3L71 D;  2QJP B;  3WUI A;  1FCD C;  2B10 B;  3HQ6 A;  4WQD A;  3TF5 A;  3VYM A;  4L3H A;  3L70 D;  1NMI A;  1S6V B;  1KIB A;  4H0J A;  1W5C T;  3VRD A;  2LIT A;  2VHD A;  4L1Q A;  3CXH W;  3VMA A;  4PW9 B;  2D0W A;  4FB1 A;  3VNW A;  3ZOX A;  4NFG B;  1MG3 D;  4O1Q A;  1R0Q A;  3O5C A;  1COT A;  2EXV A;  3MK7 B;  1CXC A;  4WQE A;  1MG2 D;  5CIC B;  3WU2 V;  1AOF A;  2B4Z A;  3DMI A;  5H2F V;  1CHI A;  1IRV A;  1LMS A;  3ZCF A;  1DVV A;  1F1C A;  1KB0 A;  1W2L A;  2PCB B;  1YFC A;  2GC7 D;  2RN0 A;  3RN1 A;  4AX3 A;  2DVH A;  1RZ5 A;  2L4D A;  1IO3 A;  1QKS A;  4EID A;  1E2R A;  2Y0D A;  5DJQ C;  2JTI B; 
#chains in the Genus database with same CATH topology
 2BLF B;  3NWV A;  5AW7 B;  4B86 A;  2Y9Y A;  3A2A A;  2N3Y A;  2FXM A;  2QM8 A;  3SWY A;  4H13 B;  1X22 A;  2CK3 H;  1H88 A;  1CCH A;  4N0K A;  3D70 A;  4WY4 C;  3WUT A;  2D2C D;  2DGE A;  1OAE A;  1YEA A;  1NTZ K;  2QJY C;  2KZJ A;  1J1D B;  4H0L D;  3MUD C;  4ZKP A;  1HJ0 A;  2QE7 H;  3Q2Y A;  3H25 A;  2A45 H;  5GTH E;  2ORL A;  3H1K J;  4IFF A;  1AKK A;  2I8D A;  3RK2 D;  3R2P A;  4BXL A;  1SQV K;  1C2N A;  1FZG A;  5GTH V;  1YTC A;  2I8F A;  1CSU A;  1QN2 A;  2BH4 X;  2H43 A;  1KD1 Q;  2JR8 A;  2P7J A;  5CIH B;  2B87 B;  3U1A A;  5CIE B;  1ZXG A;  3NBT A;  1YJW P;  2ZYA A;  1E79 H;  1CTJ A;  1NTK J;  5APV A;  4XE5 B;  1LP1 B;  1PPJ D;  1CED A;  2V7Q J;  4D6T D;  2FYU J;  3OJA B;  3KZI E;  3RGU A;  4P4Q B;  1DEB A;  1N73 A;  1NTK E;  1L0N J;  1USD A;  1T3J A;  3KZI V;  1VYD A;  2BCN B;  2FYU E;  1NTK G;  2KYV A;  3A9F A;  1EZV E;  3L72 J;  3CX5 W;  2FYU G;  1L0N E;  5TIS E;  1VQM P;  1EZV G;  3IAO A;  3MIW A;  2N1T D;  1L0N G;  5B66 E;  2O01 H;  3L72 E;  5TIS V;  1PGQ A;  2WVR A;  2WMM A;  1L0L K;  3VTP C;  1IJD B;  3EFF K;  5B66 V;  1A56 A;  1LTJ B;  3L72 G;  5DJU B;  3RL0 D;  2ZVN B;  2E75 D;  3CME P;  2W6B A;  1GZL A;  1QL4 A;  4RO0 A;  1KYO D;  3H1H J;  1M57 D;  1CRJ A;  1OVV A;  2JEE A;  5CMZ A;  1AQ5 A;  1N50 A;  3SLE A;  3CL3 D;  3GHG C;  2ZXY A;  3HE4 B;  4WQC A;  4IL6 X;  3OCD B;  1QYZ A;  1LGH B;  3D6Y A;  4H13 C;  3B4S A;  3V4W A;  3H1H E;  2G8Y A;  3V2P A;  1N7L A;  3CCV P;  3ORV A;  1FE6 A;  3A7O A;  4K3I A;  3AEB C;  1N9C A;  1F1F A;  5E79 E;  3H1H G;  1JDL A;  2JKV A;  1C6O A;  2QJK B;  2C1D A;  1J1D C;  1USE A;  5DFS A;  1I5T A;  2JWD A;  5E79 V;  1PV3 A;  2FBW C;  2E74 B;  5CBO A;  1M7L A;  3HQ8 A;  2E5Y A;  3UIA A;  1CSW A;  1WVE C;  3ZOW A;  3E1I A;  4I6M C;  1SQX K;  2LR2 A;  4YE1 A;  2WPV B;  1VF5 B;  1I8P A;  1X8Y A;  3FWN A;  1SQV J;  5CIF B;  2FFD B;  4IFD K;  4OGQ D;  1EC5 A;  3CI9 A;  3U59 A;  3KZI H;  1H32 B;  4H44 B;  3S9O A;  1L0N D;  1ZV8 A;  3HE5 A;  3CU4 A;  1VQP P;  1IFN A;  1QEX A;  4HJG H;  1SQP J;  2FYN B;  2MHM A;  2R5D A;  1VPC A;  3G4S P;  2OYH B;  4AAL A;  4KJM A;  1G2C B;  1NU1 K;  1Q2N A;  2N9Y B;  2VRS A;  1N7S A;  5TIS H;  1SQP E;  5CCG A;  1YTZ T;  2N9B A;  1GL2 A;  4JYB A;  4R4M A;  2E42 A;  1UIX A;  4EOT A;  5B66 H;  1N7S B;  4WQA A;  3TNU B;  1SQP G;  1L2P A;  1SFC D;  4LGD E;  2C0W A;  1ZRT D;  1CXA A;  1NVO A;  1CO6 A;  3TGU D;  3H1L D;  1H89 A;  1LTJ C;  2WSF H;  5EFW B;  3VMX A;  2AXT E;  3VMY A;  1IK9 A;  1MFT A;  2YKO A;  1L0L J;  3NBS A;  1BL9 A;  5CID B;  3M9B A;  1ZW0 A;  1SQQ D;  3NFQ A;  4RSZ A;  2AXT V;  5APX A;  3CP5 A;  2GC4 D;  1L4A B;  4EYY Q;  3F5H A;  4K3A A;  3KQG A;  1LT9 B;  3A3Y B;  2WWW A;  1URQ A;  2ZT9 D;  2IBZ D;  155C A;  1CRI A;  1SVF A;  1PIX A;  3H32 B;  1URQ B;  3PJS K;  1KX7 A;  1LTT C;  3PRJ A;  2SPZ A;  2QJK C;  3II6 A;  1KB9 I;  4EIC A;  2M5A B;  1RAP A;  2E74 C;  1H9Y A;  1COR A;  1QLE D;  3CCE P;  4AUW A;  2Y0C A;  1S5L E;  2AEJ A;  1HZU A;  3PXS A;  1L9B C;  1S5L V;  1M1J B;  3V2N A;  1VF5 C;  2CA4 B;  1W5C E;  1LC1 A;  2WPQ A;  5GTI E;  1N86 A;  4L3G A;  1WMK A;  1DIP A;  2V07 A;  3HRN A;  2FFD C;  1DVH A;  3TYI A;  1HH0 A;  3V6I A;  5GTI V;  3RBZ A;  2C2C A;  4RKU J;  1A02 J;  1JO5 A;  1SP4 A;  1JOC A;  4H44 C;  4ZKU A;  3LW5 J;  5KKZ B;  2P58 A;  1HCM A;  1PFI A;  2XNX A;  2ZZS 1;  1SLQ A;  3O0R C;  1K73 Q;  2FYN C;  3Q5S A;  1A2S A;  1OCD A;  2RMZ A;  3L74 J;  3WFC C;  3D6Z A;  2D0S A;  2OYH C;  1OVU A;  3S4R A;  1DII C;  4RES B;  2M3B A;  1S9K E;  1CW5 A;  3WUI A;  4WQD A;  1KZU B;  3AEE C;  3L74 E;  1NU1 J;  3BRV B;  4L3H A;  1ZR2 A;  1N7S C;  1OMI A;  2XV5 A;  1LNQ A;  2PFX A;  3L74 G;  4L1Q A;  3CXH W;  4PW9 B;  1EXI A;  1EDK A;  4NFG B;  1KIL A;  4O1Q A;  2YXR B;  1GDT A;  1COT A;  1KYO I;  1KN7 A;  1CXC A;  4WQE A;  1MG2 D;  2NPS D;  2E76 C;  3MTU E;  1J1E C;  3DMI A;  3V2R A;  1YQ3 C;  1IRV A;  3ZCF A;  4DJG A;  1KB0 A;  5AVX B;  2RN0 A;  1YFC A;  2GC7 D;  2K9J A;  3RN1 A;  1L4A C;  1VQK P;  5AVY B;  1QKS A;  3T97 B;  2JTI B;  1YIQ A;  4WY4 A;  1URQ C;  1GW3 A;  5CCH D;  1M56 D;  1K8A Q;  1Q81 Q;  2M3E A;  2FRC A;  2W27 A;  2OYO A;  2WSE J;  3B5N A;  4L73 A;  3ABV C;  2HYN A;  2O3J A;  3L75 D;  3B5N B;  3L4F A;  3ZOO A;  1IZL 0;  1H0T A;  3RLM A;  1M1K Q;  3HQ9 A;  1H0T B;  5B6Q A;  3HUS A;  5KJ7 D;  2Q3I A;  1M1J C;  4WB4 A;  1S9K D;  3CCM P;  1VQN P;  3GW6 A;  1YQ4 C;  2WQY C;  4ZMD A;  4H13 D;  2E43 A;  2N18 B;  1NTK K;  4U3F D;  5C0Z A;  3SWS A;  2YMK A;  3G71 P;  5KKZ C;  2AXC A;  1HJB A;  3R4Y A;  1C7M A;  2ZON G;  2FYU K;  3LW5 H;  4A7P A;  1WT6 A;  1MZ9 A;  1RF0 C;  3BCC D;  2KS1 A;  3AEA C;  4HKZ H;  1L0N K;  5AW9 B;  1JEK A;  1NTM E;  4H0K A;  2KNC B;  1I54 A;  4EIF A;  1KTM A;  2W6A A;  1NTM G;  2Q5U A;  4W7Z A;  4D6T J;  1P84 H;  2E5T A;  1N90 A;  1QL3 A;  5CIG B;  3CCS P;  1DEE G;  1IK7 A;  3RL0 g;  5KLI B;  451C A;  1M6Z A;  2FXO A;  3X39 A;  1PPJ E;  1VQ5 P;  1VQ6 P;  2HPC A;  1KV4 A;  2IFM A;  2CPS A;  1PPJ G;  2GA1 A;  2XKM A;  2WSC H;  2B12 B;  1BGY G;  3VN0 A;  5AVW B;  1CIG A;  2IBZ I;  3HD7 B;  3GHG A;  2WZ7 A;  1VL2 A;  3M97 X;  1MUU A;  4PV1 D;  2NRG A;  3PHL A;  2AEF A;  3EQ2 A;  1RE3 C;  3RK3 B;  5APT A;  3USS A;  5AW2 B;  3FX0 A;  1FZA A;  3WFB C;  3LID A;  4AAO A;  1X9V A;  3N7N A;  1GU4 A;  4JF7 A;  1H31 B;  2V4H A;  2I1J A;  2IZ0 A;  2JP3 A;  1NGM B;  3H1J D;  1FU1 A;  4R4L A;  2WSE H;  1YI2 P;  1KYO E;  2K9Y A;  3VMZ A;  3AED C;  1JY3 P;  2KB7 P;  1GU2 A;  2BGV X;  3B5N C;  2CPB A;  3OA7 A;  1FOS E;  4XA4 A;  5AW8 B;  1CYC A;  1KQF B;  1KB9 D;  1JY2 N;  3DP5 A;  1NTM D;  3HUS C;  1ZLL A;  3SVW A;  2B87 A;  3KPE A;  1SQB D;  1YHQ P;  2YO2 A;  4MN4 C;  4WQ8 A;  5KAF E;  2N18 C;  3CCU P;  1FAV A;  4KT0 J;  1RQV A;  1LP1 A;  1SQP K;  1GK4 A;  2J58 A;  5KAF V;  3RBX A;  1J2J B;  1QGK B;  1RE4 C;  1U7J A;  4ASV A;  1Y8A A;  1HF9 A;  1IC2 A;  2O1J A;  1JY3 O;  4UB6 E;  4DT0 A;  2E74 D;  2WPS A;  2Y0E A;  1MFZ A;  1I55 A;  1YCC A;  1BGY D;  3KDP B;  2PGD A;  1NJI Q;  4UB6 V;  1ZR4 A;  3JCU H;  1DW1 A;  3ZOY A;  1YBK A;  1QVF O;  4GKG A;  1ZOY C;  3WU2 H;  3CXH H;  5KLV D;  1I6D A;  3SSU A;  1JTH B;  1HRO A;  2ZXE B;  5CBN A;  3AEF C;  2C9N Y;  5KLI C;  3BAS A;  1NNO A;  4IOI H;  1BCC D;  3W68 A;  1FDI A;  4H44 D;  1HRC A;  4GYD A;  2ZXX A;  1RH5 B;  3PH0 A;  1LTJ A;  1E5W A;  3KYQ A;  1CYJ A;  2BAS A;  2OGU A;  1N8R Q;  1OVR A;  4GOE A;  2QG4 A;  3HD7 C;  3TGU J;  2BPB B;  3CLQ A;  3HE4 A;  3OCD A;  2D2C B;  3H1L J;  1ZRT E;  2QVA A;  3HTK B;  1GKS A;  1RZ6 A;  3P7K A;  1DW0 A;  1N7S D;  3RK3 C;  1YTZ I;  4XFJ A;  2W90 A;  5CCG D;  5APQ A;  3BVH A;  1GL2 D;  3TGU E;  4FA9 A;  1SQQ J;  2HOD B;  3EFG A;  4BWN A;  2AEM A;  4C7R A;  2RKL A;  4Y99 B;  2ZBO A;  3H1L E;  4OVN F;  2JWA A;  1G1J A;  1AQT A;  3TGU G;  2KLU A;  1HVV A;  3H1L G;  1RF1 B;  3L4O A;  1VQ9 P;  2LIR A;  4U7J A;  5GTH H;  1PP9 D;  1YYC A;  3MGN A;  1SQQ E;  2XZR A;  1A8C A;  1FZE A;  2HR3 A;  2E76 D;  2ZYD A;  4WBA A;  3ZBM A;  3CCQ P;  1SQQ G;  2B9B A;  4UB8 E;  1E29 A;  1CHH A;  1YJN P;  2IBZ E;  2MTA C;  3V4Q A;  5IY5 1;  2B0Z B;  4UB8 V;  1LTI C;  2FFD A;  2BCC E;  2IBZ G;  2IPP A;  2V08 A;  1WRG A;  2IX7 C;  3RMZ A;  2W8Z A;  1H32 A;  1KIL E;  1C6R A;  2BCC G;  1URQ D;  2L5G B;  3QWO C;  1K3G A;  3O1Y A;  5B5E E;  1CSX A;  2XDJ A;  1PGO A;  2B89 A;  2N9J A;  2OYH A;  2FWL A;  1G2C A;  5B5E V;  1YEB A;  2V7Q H;  4EIE A;  1NWQ A;  1GIW A;  2OYI B;  4Y5R A;  4AQR D;  3TYY A;  3C8V A;  2BEQ D;  2N1T B;  2OQQ A;  1GMJ A;  3WUV A;  3L71 D;  3H1I G;  1HTL C;  2B10 B;  3TNU A;  3TF5 A;  3CC7 P;  2FYZ A;  1IFI A;  3VYM A;  4W7Y A;  1OFC X;  4ASW A;  2J5U A;  2W6J H;  3L70 D;  1NMI A;  1W5C T;  1IZN B;  2VHD A;  3C1L A;  1LWU B;  3VMA A;  4FB1 A;  1KQS O;  2IDB A;  2K1A A;  2M0B A;  4HH2 A;  1R0Q A;  4WVZ A;  1W2B O;  5H2F E;  5CIC B;  2Y9Z A;  3Q5R A;  2C0X A;  1L4A A;  2H88 C;  4N78 E;  5H2F V;  2D2C C;  1LT9 A;  1FJP A;  1D7M A;  1W2L A;  5E79 H;  1IO3 A;  1R5L A;  3H32 A;  1HUC A;  1E2R A;  1MV8 A;  2YKP A;  4Y99 C;  1VQO P;  3GLM A;  2BCC D;  1I8O A;  5AVU B;  3L36 A;  2M5A A;  1CIH A;  2A45 I;  5AUR A;  3G6E P;  2XND H;  4JYC A;  3FGA D;  1KIL D;  2B11 B;  3V2Q A;  3IR9 A;  1FJ0 A;  2YIU B;  2PCC B;  4TLF A;  4IL6 E;  4LC1 A;  1NTZ D;  1AVO A;  1M1J A;  4OGQ B;  1S1C X;  3H6P A;  3OA8 B;  3SWK A;  4DY9 A;  3GG2 A;  1CSV A;  4IL6 V;  2YK3 A;  4Z1M H;  3H1I D;  2ZAE B;  3CCJ P;  2R44 A;  2KSJ A;  3L75 J;  3NMD A;  3A0B E;  4V2K A;  1NTM K;  3IF4 A;  5AW1 B;  1JUN A;  2IYP A;  1VQL P;  2W83 C;  3B71 A;  1K05 A;  3A0B V;  1RF0 A;  4WY4 D;  2NZ2 A;  3L75 E;  3A0H E;  1KFM A;  2LXB A;  1NO4 A;  2CE1 A;  3L75 G;  1JB0 J;  1SFC B;  3A0H V;  3NXS A;  4U3F J;  3B5N D;  1DW3 A;  4DOJ A;  1DW2 A;  1U75 B;  2OZ1 A;  4I2L C;  1LT1 A;  1C6S A;  3BCC J;  1DD4 A;  2OZ1 B;  3CX5 D;  5EXQ A;  2I1K A;  2LXC B;  4U3F E;  1EDJ A;  1KFN A;  4N78 D;  1U57 A;  1K3H A;  1CTZ A;  1AVY A;  3JC2 2;  4N6J A;  2B88 A;  2BEZ F;  2JO1 A;  2C8S A;  2N9I A;  4U3F G;  3BCC E;  1KQG B;  1LWU C;  2JJL A;  2MKV A;  1YIT P;  4M3L A;  3CC4 P;  1ZZH A;  2AXT H;  3A5T A;  1HGZ A;  3BCC G;  4PD4 D;  5CIB B;  1K9M Q;  4PJ0 E;  2ZT9 B;  2H89 C;  1T8Z A;  4HB1 A;  3CCR P;  3T97 A;  1RQU A;  3M91 A;  1RE3 A;  1LT9 C;  3VOP A;  2K37 A;  4N3Y B;  1T2K C;  1LFM A;  4WQ7 A;  1IFP A;  4GOF A;  2QA4 P;  1S5L H;  2WTY A;  4IL6 H;  3I55 P;  3M9H A;  1GQ1 A;  1BDC A;  1FZF A;  1U7M A;  1KYO W;  4JCG A;  1BSH A;  3AE6 C;  3F89 A;  2YIU C;  3O6Q A;  1JMM A;  1GJQ A;  5GTI H;  3CC2 P;  1CIF A;  2AI5 A;  2J59 M;  3O6Q B;  2PP6 A;  1FI3 A;  2R3S A;  4NPE A;  4CPG A;  1C2R A;  3H1J J;  3AE9 C;  2QRX A;  5CYT R;  3VP9 A;  1BSN A;  1IFJ A;  5AVT B;  3ZDM A;  3RK3 D;  2KP8 A;  1SQX D;  4I7Z B;  3GF7 A;  1CTY A;  3H1J E;  1MKM A;  3SXT A;  4YTP C;  1NML A;  1RE4 A;  1NTM J;  1CRH A;  2YXQ B;  3H1J G;  1SQB J;  2YO3 A;  1FHB A;  1SFC C;  2KNC A;  1KB9 E;  3VP8 A;  4XYD B;  2A45 G;  2C9L Y;  2HG5 D;  4K35 A;  4AAM A;  2P1J A;  2Z5I A;  1SQB E;  3SFE C;  3L4M A;  2PAC A;  1CHJ A;  1SQB G;  1BE3 D;  1P84 D;  1FI7 A;  1FZB A;  2NPS B;  1BGY J;  1NYH A;  3TDK A;  1KV9 A;  2JQR A;  3DR0 A;  2KSE A;  1HGV A;  4IFM A;  2ZYG A;  1K04 A;  5AVV B;  1CNO A;  2LKM A;  1NIR A;  1BDD A;  2XU6 A;  5KLV J;  1BGY E;  2YMY A;  2PAJ A;  2HV4 A;  2ZT9 C;  1DIQ C;  1C75 A;  3HD7 A;  4GIF A;  1BCC J;  5K5G B;  5KLV E;  3CCL P;  3L73 D;  1S2E A;  2O01 J;  4NPF X;  1X79 B;  3U1C A;  5KLV G;  351C A;  4L75 A;  1SQQ K;  4MU8 A;  1NH4 A;  1BCC E;  2WT7 B;  2KOG A;  1CC5 A;  1BCC G;  3M0D C;  1H31 A;  1Q7Y Q;  1NKN A;  3VYI A;  3AE8 C;  5KAI E;  2FY8 A;  5DJQ B;  2N3B A;  1OW8 A;  3EWK A;  3PXW A;  5KAI V;  2YQB A;  4WQ9 A;  1H33 B;  1YIJ P;  2ZOO A;  1GDV A;  3CWB D;  3RN0 A;  1FBM A;  3CMA P;  1JCD A;  1PP9 J;  2HFE D;  4LJI A;  1AA0 A;  1NAY A;  1HJ3 A;  1JY2 P;  4QAO A;  3IFM A;  1JY3 N;  1CRY A;  4RJT A;  3GF3 A;  4I7Z C;  3CPW O;  2P67 A;  1PP9 E;  5AW6 B;  4NPD A;  1KB9 H;  5AW5 B;  2ITA A;  1AFO A;  3IN6 A;  1PP9 G;  3WFE C;  1LC2 A;  3CX5 I;  2Z5H A;  1GTW A;  1Z56 A;  4WWI A;  1A02 F;  1GD2 E;  4OWF A;  5C39 A;  3H1K E;  5DJT B;  4XXL A;  1EQ7 A;  5BU5 A;  3D0W A;  4EDF A;  1DH3 A;  3JBT B;  3H1K G;  1JTH A;  3I56 P;  1YIC A;  1JY2 O;  1MZ4 A;  1EDI A;  3CXH D;  1VQ8 P;  1VF5 D;  3B8E B;  2QJP B;  2NPS C;  4PD4 I;  1S3J A;  1JMB A;  3M9Q A;  2QIW A;  4HYT B;  3AE7 C;  1QL1 A;  5AVQ B;  2K88 A;  3L71 J;  2ZJS E;  1Y9B A;  1S6V B;  1KIB A;  1DD3 A;  3VRD A;  2LIT A;  1N73 B;  4PV1 B;  2D0W A;  5KTB A;  3L70 J;  1JM0 A;  3ZOX A;  3L71 E;  3KXD A;  2GM4 A;  4O9B A;  1S4X A;  2Q1K A;  3AE3 C;  3MK7 B;  3GMA A;  1XTG B;  5CCH C;  3HTK A;  3L71 G;  3L70 E;  2B4Z A;  3W67 A;  1ZME C;  1LTG C;  2WSF J;  2HOD A;  5KAI H;  2G3A A;  1GW4 A;  2KK7 A;  4H0L B;  2JDI H;  3L70 G;  2PCB B;  4JBZ A;  1CZQ A;  2L4D A;  2Q7C A;  1FZC A;  3Q5P A;  1FDM A;  1RF1 A;  1KYO H;  2Y0D A;  3RK2 B;  3Q1M A;  5DJQ C;  5KJ7 C;  3G9R A;  1FZC B;  2GIW A;  1S5L X;  2R3C A;  1AYG A;  2MJZ A;  1CRC A;  1W2E A;  2K3R A;  1PL5 A;  2BCC J;  4WQB A;  3WC8 A;  3PXT A;  3NTN A;  5L8R J;  2Q6Q A;  1FS0 E;  1E8E A;  3H1K D;  5KAF H;  2YKQ A;  1L4A D;  2ZVO B;  4L76 A;  3MP7 B;  1T2K D;  1M70 A;  2C1D B;  1NTZ J;  4YXD C;  2RH0 A;  1CRG A;  3PP5 A;  4UB6 H;  1EB7 A;  3WFD C;  1LS9 A;  2YCC A;  4YXW H;  3PLN A;  2HLO A;  1NHL A;  3H1I J;  1NAF A;  4C46 A;  2QM7 A;  4I1L A;  1NTZ E;  1H9X A;  1NTK D;  1GU5 A;  2H8P D;  1J3S A;  3ZIY A;  1YJ9 P;  2OYI A;  1QX8 A;  2IYO A;  2GUV A;  5AVZ B;  2A06 E;  1P84 I;  3TK1 A;  4J20 A;  4KMG A;  2N1T A;  1NTZ G;  1OXZ A;  2FYU D;  2OAR A;  4DCK A;  1OW6 A;  3H1I E;  1EZV D;  2A06 G;  3BAT A;  1M90 Q;  2C9X B;  1SQV E;  3L37 A;  2QJP C;  1X0T A;  2YNY A;  4FA4 A;  3HE5 B;  1RAQ A;  1N2D C;  1SQV G;  2Q9I A;  1LWU A;  3L72 D;  3RL0 B;  1HZV A;  1EDL A;  3SWF A;  2E75 B;  1NKZ B;  3PH2 B;  4JQ0 D;  1CCR A;  1N73 C;  1KMI Z;  4PV1 C;  1WEJ F;  3C9I A;  1IQC A;  1S72 P;  5BU8 B;  1M8O B;  4OH8 B;  1GL2 B;  1LTB C;  1Q90 D;  3CX5 E;  3MK7 C;  1FI9 A;  2BH5 X;  2IZ1 A;  1L9J C;  3P32 A;  2FXP A;  3H1H D;  4EI2 A;  5APY A;  4H0L C;  1LTS C;  2WPR A;  1HWT C;  1FDO A;  3N4X A;  2E76 B;  2R5B A;  4FA1 A;  1OX3 A;  1J1E B;  4PD4 E;  3SJL A;  1R5S A;  2WIT A;  1CSB A;  4L74 A;  3RK2 C;  3M06 A;  1AJY A;  1PGJ A;  1LJ2 A;  1FZC C;  4O1W A;  1RF1 C;  1T6A A;  1Q86 Q;  2C1V A;  2OTJ P;  5AVR B;  4UB8 H;  1L0L E;  1LTA C;  2M8R A;  3FXE A;  3AE4 C;  3G3Z A;  1M60 A;  3OA8 A;  2P2U A;  1FOS F;  1L0L G;  1KX2 A;  3MD0 A;  2OTK E;  2KLV A;  2A06 D;  1FOC A;  2KZI A;  5CHX A;  3I5C A;  5B5E H;  1HBW A;  3AE5 C;  1PGP A;  1OZH A;  1SQV D;  1JCC A;  1Q82 Q;  1SQB K;  2P10 A;  2WSS H;  4FAN A;  1RHZ B;  1QL2 A;  1C52 A;  2KXP B;  5CJ0 A;  1SFC A;  1YNR A;  1KOR A;  3P8C E;  1SQX J;  3CXH I;  3CYT I;  5CJ4 A;  3JSV C;  1SQP D;  2OYI C;  1U74 B;  3TSI A;  3P8M C;  2N1T C;  3O20 A;  4GDO A;  1FJK A;  4LLH A;  3RK3 E;  1CI6 A;  1T3U A;  4DZO A;  1I6E A;  1SQX E;  3E1R A;  3O8Z A;  1ZN5 A;  1CI6 B;  2CE0 A;  3MHV A;  1SQX G;  1PZQ A;  4YPC A;  1RY3 A;  3RL0 C;  4FAV A;  4JPZ B;  5AVS B;  5KLV K;  4ZNC A;  2UWJ E;  1IFM A;  2E75 C;  3C2C A;  1SS1 A;  1IFD A;  5H2F H;  2KI7 B;  2L91 A;  4AAN A;  2POH A;  3CX5 H;  1BE3 J;  2CA3 B;  1HJ5 A;  4GT1 A;  4TT3 H;  4GOD A;  5APS A;  5CCG C;  2KIK A;  1GL2 C;  3L35 A;  1KQL A;  3AEC C;  2O1K A;  1BE3 E;  1P84 E;  3BRT B;  1NU1 E;  4PJ0 V;  1L0L D;  3FWL A;  4PD4 H;  1H8A A;  4KHX A;  2GB8 B;  5C9M A;  1BE3 G;  1KIL B;  1AV1 A;  1NU1 G;  2WSC J;  3ITK A;  3AE1 C;  1IRW A;  3S1K A;  1G1I A;  3M0D A;  1R8E A;  3L73 J;  4EIJ A;  5AW0 B;  2IFN A;  1IO4 A;  2R32 A;  1NOH A;  4Q5P A;  2XTS B;  1HJ4 A;  3AEG C;  3L73 E;  2K9J B;  4FA5 A;  3D71 A;  5APU A;  3Q3D A;  1B7V A;  2Q3E A;  3L73 G;  4OGQ C;  3HD7 D;  3P8C D;  1H1O A;  1XTC C;  3A0B H;  2DW3 A;  4WY4 B;  3KHU A;  1N15 A;  4PWA A;  3MUD A;  4AYC A;  2H7H A;  5BVZ A;  2AIU A;  3HQ7 A;  3MZW B;  5AW4 B;  2QJY B;  3PTZ A;  3AE2 C;  2C1U A;  1CYI A;  3A0H H;  3CWB J;  4GED B;  3CD6 P;  3M0A A;  1VDF A;  1Y47 A;  2QSI A;  3OW2 O;  2KUB A;  5DF5 A;  3OAK A;  5APW A;  1VQ4 P;  1EZV I;  5AW3 B;  2CXB A;  3SFD C;  2Z4E A;  2OTL P;  2O01 N;  3CWB E;  3HUS B;  1CIE A;  3E7K A;  3L74 D;  3CWB G;  5TJH A;  1EXJ A;  1GK6 A;  1HH7 A;  1UII A;  1KC8 Q;  2PRR A;  2NPS A;  3LIE A;  1OWA A;  1DX7 A;  1NU1 D;  1DT1 A;  1ETP A;  1AOQ A;  2KS1 B;  2QEX P;  1FCD C;  3HQ6 A;  4Y28 J;  1VQ7 P;  4PJ0 H;  3WMM 0;  1OIP A;  4BRY A;  4H0J A;  5M1B A;  3FXD A;  3V5B A;  4BRY B;  3VNW A;  3JCU E;  5CCH A;  1FC2 C;  1MG3 D;  3WU2 E;  3CXH E;  3O5C A;  1JNM A;  2EXV A;  4D6T E;  2ZFC A;  2WT7 A;  2FKW B;  3WU2 V;  1KIL C;  4C7N A;  1AOF A;  4D6T G;  2HPC B;  1CHI A;  1LMS A;  4C7N B;  3WUU A;  1DVV A;  3K5B A;  4QMA A;  1F1C A;  4W80 A;  5KJ7 A;  1ZP0 C;  1OW7 A;  4AX3 A;  2DVH A;  1RZ5 A;  1QVG O;  4EID A;  1TU3 F;  2GUS A;  3GHG B;  3QH9 A;  1H33 A; 
#chains in the Genus database with same CATH homology
 2BLF B;  3NWV A;  2BCC D;  1I8O A;  2GIW A;  2N3Y A;  1YIQ A;  1CIH A;  1AYG A;  5AUR A;  1CCH A;  1CRC A;  4N0K A;  2FRC A;  2B11 B;  4WQB A;  3WC8 A;  3PXT A;  1FJ0 A;  2YIU B;  2PCC B;  2DGE A;  1OAE A;  1YEA A;  1E8E A;  1NTZ D;  2O3J A;  3H1K D;  3L75 D;  3ZOO A;  1IZL 0;  3RLM A;  3OA8 B;  4DY9 A;  3GG2 A;  1CSV A;  4IL6 V;  2YK3 A;  3HQ9 A;  5B6Q A;  1M70 A;  2C1D B;  3H1I D;  2ORL A;  1AKK A;  1CRG A;  4V2K A;  1EB7 A;  1C2N A;  3GW6 A;  3WFD C;  1LS9 A;  2YCC A;  5GTH V;  3PLN A;  1YTC A;  2I8F A;  1CSU A;  1QN2 A;  1H33 A;  2N18 B;  3A0B V;  2BH4 X;  4U3F D;  5C0Z A;  1H9X A;  1NTK D;  3SWS A;  3ZIY A;  1J3S A;  5CIH B;  4J20 A;  4KMG A;  2ZON G;  5CIE B;  3NBT A;  2CE1 A;  1C7M A;  4A7P A;  2FYU D;  3BCC D;  3A0H V;  2KS1 A;  1CTJ A;  1EZV D;  1DW3 A;  1DW2 A;  1U75 B;  2C9X B;  2OZ1 A;  1PPJ D;  1CED A;  4D6T D;  4H0K A;  2KNC B;  1C6S A;  1I54 A;  4FA4 A;  4P4Q B;  2OZ1 B;  4EIF A;  3CX5 D;  1RAQ A;  5EXQ A;  3L72 D;  1HZV A;  1K3H A;  1CTZ A;  3KZI V;  1N90 A;  1QL3 A;  1VYD A;  2BCN B;  2C8S A;  2N9I A;  3PH2 B;  5CIG B;  1CCR A;  3A9F A;  1WEJ F;  1IQC A;  5KLI B;  451C A;  1ZZH A;  1M6Z A;  3CX5 W;  3X39 A;  4PD4 D;  5CIB B;  3MK7 C;  1FI9 A;  5TIS V;  2BH5 X;  2B12 B;  1L9J C;  5B66 V;  1A56 A;  3H1H D;  1CIG A;  3M97 X;  4FA1 A;  1QL4 A;  1KYO D;  3SJL A;  1CRJ A;  1LFM A;  1N50 A;  3SLE A;  4WQ7 A;  3PHL A;  2ZXY A;  4O1W A;  4WQC A;  3OCD B;  2C1V A;  1QYZ A;  3WFB C;  4AAO A;  1GQ1 A;  3ORV A;  1KYO W;  4JCG A;  1H31 B;  1M60 A;  3OA8 A;  4K3I A;  1N9C A;  1F1F A;  1JDL A;  1KX2 A;  3H1J D;  1C6O A;  2QJK B;  1GJQ A;  2C1D A;  1CIF A;  1GU2 A;  2A06 D;  2BGV X;  5DFS A;  1I5T A;  2AI5 A;  5E79 V;  1FI3 A;  1FOC A;  1C2R A;  3HQ8 A;  1CYC A;  1CSW A;  1KB9 D;  1WVE C;  5CYT R;  3ZOW A;  3DP5 A;  1SQV D;  1NTM D;  3SVW A;  4FAN A;  1SQB D;  1SQX D;  4YE1 A;  1CTY A;  1I8P A;  4WQ8 A;  3SXT A;  1C52 A;  2N18 C;  1NML A;  1CRH A;  1YNR A;  5CIF B;  3CYT I;  5KAF V;  1SQP D;  1FHB A;  1U74 B;  1H32 B;  1L0N D;  3O20 A;  3CU4 A;  4XYD B;  2Y0E A;  4AAM A;  1I55 A;  1YCC A;  2FYN B;  2MHM A;  1BGY D;  1I6E A;  4UB6 V;  2CE0 A;  3L4M A;  4AAL A;  1DW1 A;  3ZOY A;  2PAC A;  1CHJ A;  1BE3 D;  1P84 D;  4FAV A;  1FI7 A;  2N9Y B;  5KLV D;  1I6D A;  3C2C A;  1HRO A;  3TDK A;  1KV9 A;  2JQR A;  3DR0 A;  2L91 A;  4AAN A;  1CNO A;  1NIR A;  2CA3 B;  4WQA A;  1HJ5 A;  1NNO A;  1ZRT D;  1BCC D;  1HRC A;  4GYD A;  1CXA A;  2HV4 A;  1DIQ C;  1CO6 A;  1C75 A;  3TGU D;  1CYJ A;  4PJ0 V;  1L0L D;  3FWL A;  3H1L D;  3L73 D;  2GB8 B;  5C9M A;  2QG4 A;  2BPB B;  3ITK A;  351C A;  3NBS A;  1IRW A;  1BL9 A;  5CID B;  3OCD A;  4MU8 A;  1SQQ D;  4RSZ A;  2AXT V;  1GKS A;  3CP5 A;  1RZ6 A;  2GC4 D;  1CC5 A;  1DW0 A;  1H31 A;  4Q5P A;  2XTS B;  4FA9 A;  1HJ4 A;  2ZBO A;  5DJQ B;  2N3B A;  2IBZ D;  155C A;  2K9J B;  4FA5 A;  2JWA A;  1CRI A;  3PXW A;  5KAI V;  2YQB A;  1B7V A;  3L4O A;  2Q3E A;  2LIR A;  1KX7 A;  4WQ9 A;  1PP9 D;  3PRJ A;  1H33 B;  1H1O A;  2ZOO A;  4EIC A;  1A8C A;  1GDV A;  3KHU A;  1N15 A;  3CWB D;  1RAP A;  3RN0 A;  3ZBM A;  4PWA A;  1H9Y A;  1COR A;  2AIU A;  3HQ7 A;  2QJY B;  2Y0C A;  4LJI A;  3PTZ A;  1E29 A;  1CHH A;  2C1U A;  1CYI A;  1HJ3 A;  1HZU A;  4QAO A;  1CRY A;  4GED B;  3PXS A;  1L9B C;  2MTA C;  5IY5 1;  2B0Z B;  4RJT A;  1S5L V;  4UB8 V;  5DF5 A;  2CA4 B;  2V08 A;  1LC1 A;  4L3G A;  3RMZ A;  2CXB A;  1H32 A;  1C6R A;  2V07 A;  1K3G A;  1DVH A;  3WFE C;  3TYI A;  3O1Y A;  5GTI V;  1CIE A;  1LC2 A;  2C2C A;  3L74 D;  1CSX A;  5TJH A;  5KKZ B;  4XXL A;  1HCM A;  2N9J A;  2FWL A;  2ZZS 1;  1HH7 A;  3O0R C;  5B5E V;  1YEB A;  4EDF A;  3JBT B;  1A2S A;  4EIE A;  1OCD A;  1GIW A;  2RMZ A;  4Y5R A;  3WFC C;  1YIC A;  2D0S A;  1DII C;  1NU1 D;  1DT1 A;  1ETP A;  1MZ4 A;  1AOQ A;  3CXH D;  3L71 D;  2QJP B;  3WUI A;  1FCD C;  2B10 B;  3HQ6 A;  4WQD A;  3TF5 A;  3VYM A;  4L3H A;  3L70 D;  1NMI A;  1S6V B;  1KIB A;  4H0J A;  1W5C T;  3VRD A;  2LIT A;  2VHD A;  4L1Q A;  3CXH W;  3VMA A;  4PW9 B;  2D0W A;  4FB1 A;  3VNW A;  3ZOX A;  4NFG B;  1MG3 D;  4O1Q A;  1R0Q A;  3O5C A;  1COT A;  2EXV A;  3MK7 B;  1CXC A;  4WQE A;  1MG2 D;  5CIC B;  3WU2 V;  1AOF A;  2B4Z A;  3DMI A;  5H2F V;  1CHI A;  1IRV A;  1LMS A;  3ZCF A;  1DVV A;  1F1C A;  1KB0 A;  1W2L A;  2PCB B;  1YFC A;  2GC7 D;  2RN0 A;  3RN1 A;  4AX3 A;  2DVH A;  1RZ5 A;  2L4D A;  1IO3 A;  1QKS A;  4EID A;  1E2R A;  2Y0D A;  5DJQ C;  2JTI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...