2QJKB

Crystal structure analysis of mutant rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
molecule keywords Cytochrome b
total genus 65
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjkB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjkB02
3O1YA 3VRDA 3SWSA 1HJ3A 1BCCD 2O3JA 2VHDA 1CCRA 5KLVD 1YIQA 155CA 1KYOD 1YICA 1CIEA 5GTIV 3OA8B 3CWBD 2PACA 1BE3D 1C6OA 1YNRA 2CA3B 4PD4D 4Q5PA 1NMIA 1CIHA 5DJQB 1ZRTD 1KIBA 1YCCA 3PLNA 2D0SA 3OCDB 3TGUD 1CTYA 1HZVA 5EXQA 1RZ5A 1KB0A 1E29A 2QG4A 1GJQA 3OA8A 3WFDC 5CYTR 2B0ZB 3RLMA 1QYZA 2C1DA 1DT1A 1FJ0A 2PCBB 2BCCD 3L70D 1CIGA 3DP5A 4H0JA 4O1QA 1DIIC 1LFMA 1NTMD 1CSUA 1C7MA 3CXHW 4LJIA 2JQRA 1IO3A 2GB8B 1FI3A 1QN2A 4AANA 1CYCA 1EZVD 2I8FA 3WFCC 3M97X 3PXTA 3H1HD 3DMIA 3PXSA 1ETPA 1YEAA 4DY9A 1CHHA 1OAEA 1CO6A 1P84D 4WQ9A 1YTCA 2DGEA 2BCNB 4FA5A 3PXWA 4FB1A 1CNOA 2C1UA 1AYGA 5CICB 3NBSA 5C9MA 3L72D 2PCCB 4AAMA 5CIBB 2Y0DA 4UB6V 2ZOOA 4EIFA 1I55A 1KV9A 3H1JD 4P4QB 5H2FV 1K3HA 4L3HA 4EICA 1BL9A 1SQXD 2AI5A 1WVEC 1KB9D 4AX3A 1C6SA 1AKKA 2N9IA 2RN0A 2QJPB 1IRVA 2YK3A 4L3GA 3CX5D 1CIFA 3GG2A 1I6EA 3WC8A 1QL4A 3TDKA 1BGYD 1HH7A 1U75B 2K9JB 1IZL0 2FRCA 1S6VB 1PP9D 1CXCA 1QL3A 1H9XA 2N3BA 1L0LD 3ZOWA 1FI9A 1CRIA 1CXAA 2Q3EA 1NNOA 1I5TA 2ZONG 5KAFV 3RN0A 3GW6A 4NFGB 3C2CA 1A56A 1LS9A 3FWLA 4AAOA 2ZBOA 4EDFA 1CEDA 1MG2D 4K3IA 1N50A 1W5CT 1CHIA 1YFCA 2BH5X 4V2KA 2OZ1A 1LMSA 4YE1A 3SXTA 4N0KA 5DJQC 1E2RA 1RAQA 3PH2B 2CE0A 1LC1A 3A9FA 5KAIV 2DVHA 1B7VA 1DVVA 1NTKD 1C2RA 1KYOW 1CRJA 4L1QA 2YQBA 5KLIB 4WQAA 5C0ZA 4WQBA 1CRCA 3TF5A 1IQCA 1PPJD 1H32B 4WQDA 1H33B 351CA 2YIUB 1SQVD 3A0HV 1RZ6A 2CE1A 2N9JA 3HQ6A 1CSWA 1WEJF 4O1WA 1L9JC 3SLEA 2KNCB 3ZCFA 3L4MA 1OCDA 2YCCA 1F1CA 1CORA 2ORLA 3CXHD 2C1VA 3ZOYA 1E8EA 3L71D 1J3SA 3RN1A 3WFEC 2V08A 3PTZA 3VNWA 2Y0EA 4U3FD 3O5CA 3SJLA 1CC5A 1NMLA 451CA 4IL6V 1DW1A 1S5LV 2B12B 4GYDA 3ZOXA 1N9CA 3HQ7A 2BPBB 1NU1D 3WUIA 3CP5A 5IY51 3MK7C 4RSZA 2QJKB 4WQ7A 4J20A 1HJ4A 1KX2A 3H1KD 1AOFA 2KS1A 2LIRA 2C2CA 4GEDB 1C52A 3WFBC 2L4DA 1GQ1A 3SVWA 2A06D 1M6ZA 4FA4A 1YEBA 2D0WA 2JTIB 2BH4X 2B11B 4PWAA 1CHJA 1H32A 2BGVX 3O20A 3JBTB 3L75D 5B66V 3NBTA 1COTA 5B6QA 2AXTV 1MZ4A 1H9YA 3CU4A 2JWAA 2C1DB 1M70A 2LITA 1CTZA 3RMZA 2FYUD 3TYIA 1H31A 3MK7B 1ZZHA 4WQCA 2L91A 4EIEA 3HQ8A 3ZOOA 2CXBA 2MHMA 4FA1A 2QJYB 3CYTI 3O0RC 1CYJA 2GC4D 4UB8V 1DW2A 5E79V 1VYDA 1HROA 2HV4A 3ZIYA 3DR0A 3PHLA 1C2NA 1HZUA 1W2LA 2Y0CA 5KKZB 2V07A 4EIDA 1FHBA 1HCMA 1L9BC 2MTAC 3KHUA 1AOQA 2GIWA 5CIHB 1I8PA 2BLFB 5DF5A 3L4OA 5CIEB 3BCCD 5B5EV 1CRYA 1HJ5A 1I8OA 1R0QA 4JCGA 4PW9B 5TISV 1H33A 2B4ZA 4QAOA 1K3GA 1F1FA 2N3YA 1DW0A 1CSVA 2FWLA 1NTZD 4WQ8A 2N9YB 1SQBD 2ZXYA 3L74D 4RJTA 1LC2A 2C8SA 3A0BV 4XYDB 1NIRA 1CCHA 1JDLA 1DW3A 5DFSA 4FAVA 1H31B 4AALA 1RAPA 1N90A 3HQ9A 1DIQC 2ZZS1 4XXLA 3VMAA 2FYNB 2CA4B 4WQEA 5GTHV 1I54A 3H1ID 1QKSA 4H0KA 1L0ND 1GKSA 3NWVA 3X39A 3ORVA 1N15A 1C6RA 3CX5W 3PRJA 2XTSB 3OCDA 4A7PA 4PJ0V 1FCDC 4FA9A 1I6DA 1DVHA 3VYMA 1CRGA 3H1LD 1M60A 1SQQD 2AIUA 3WU2V 1KX7A 1GU2A 1CYIA 1SQPD 3L73D 1A2SA 2EXVA 2C9XB 2OZ1B 1GIWA 1CTJA 2RMZA 4KMGA 1FI7A 5TJHA 2IBZD 4Y5RA 1C75A 5AURA 5CIGB 4MU8A 1U74B 1CSXA 3ITKA 1H1OA 2GC7D 2N18C 1GDVA 1HRCA 1IRWA 5CIFB 4FANA 1FOCA 3ZBMA 2N18B 3KZIV 4D6TD 1EB7A 2B10B 1MG3D 1CRHA 5CIDB 1A8CA
chains in the Genus database with same CATH superfamily
3VRDA 2E74B 3KQGA 1S5LX 1NOHA 2O3JA 3AE7C 5KLVD 1SQVK 1YIQA 3A0BE 4OWFA 3CWBD 3USSA 1SQXK 2H43A 2CA3B 4PD4D 1Q81Q 2C0WA 2WSCH 3LIDA 1PGJA 2KIKA 2E75B 3OCDB 1VL2A 1RZ5A 5B5EH 1SQBK 3M0DC 1N86A 5KJ7A 2QM8A 1LT9B 2WSCJ 2MJZA 3GHGB 2Q6QA 4IL6H 5M1BA 5K5GB 2AEMA 1PGOA 1N8RQ 3CWBJ 1NU1K 4GT1A 1R5SA 1RE3A 1DIIC 1FOSE 3CX5H 1C7MA 1J2JB 1OIPA 3CMEP 2JQRA 2XNXA 1RHZB 1IO3A 1QN2A 4AANA 1KYOH 1LJ2A 1KTMA 3WFCC 1YJ9P 1NYHA 1ETPA 1LWUB 4DY9A 1CHHA 1CI6B 4H44B 1L0LE 2YKOA 2DGEA 4L74A 3CCMP 1PIXA 2N1TC 4FB1A 1AYGA 5CICB 3NBSA 5H2FE 1MKMA 2Y0DA 2ZVNB 1YIJP 1I55A 5H2FV 4H44C 4HH2A 5B66H 3QWOC 4W80A 2P1JA 1NTMJ 4L73A 1X9VA 1JO5A 1AKKA 1EDLA 2QJPB 3HRNA 1CIFA 3GG2A 3VP9A 1G1IA 2QE7H 1K8AQ 4RO0A 2P10A 1EZVE 1U75B 1DEBA 2Z5HA 1S6VB 2KLVA 3RBZA 2N3BA 1GL2C 2QA4P 1N73B 2V4HA 2NPSC 2ZXXA 3M9BA 1CRIA 4IFDK 1CXAA 1I5TA 5KAFV 1MFTA 1RF0A 1L0LK 1JMMA 1NU1G 3C2CA 3HE4B 1A56A 1JEKA 3CCSP 3H1JE 3M9HA 1W2BO 4K3IA 2Q1KA 1VQPP 1CHIA 4AQRD 1NGMB 2RKLA 1FDMA 1KV4A 2A06G 3L71G 2FBWC 4H13D 3T97B 1RAQA 3PH2B 3CX5E 1L0LJ 1LC1A 5KAIV 3WUTA 3L71J 4L1QA 5KLIB 4Y99B 5C0ZA 1NWQA 4BXLA 4ZKUA 1S5LE 4WQDA 351CA 3CPWO 2YIUB 1VDFA 2R3SA 3A0HV 4YXDC 2RH0A 2OGUA 1SFCD 1NTZK 1QL2A 2W6BA 2YCCA 4H0LB 4QMAA 2KYVA 1X8YA 2WQYC 4WY4C 3M9QA 4W7ZA 5AW0B 1SQVJ 1HTLC 2I1KA 1NMLA 1DW1A 2E74D 3NFQA 2BPBB 2FFDA 1LWUC 2HFED 1RF0C 1Q7YQ 2BEQD 3V4WA 1NHLA 2OYHB 3PP5A 4WQ7A 1N7SA 1SQVE 3P8CE 3H1KD 3S4RA 3E1IA 5KAIH 1E79H 1C52A 3WFBC 2L4DA 3MUDC 3H1IG 4FA4A 1YEBA 2D0WA 2GA1A 1L4AA 1BGYG 1H32A 1OZHA 2L5GB 4H13B 3L75D 5B66V 3NBTA 3AE8C 2KS1B 5CCGA 1MZ4A 1BGYJ 1JCCA 3CI9A 2QJYC 1HGVA 2JWAA 1ZR4A 1A02J 1YJWP 1M70A 2LITA 1CTZA 4U3FE 1VQ7P 2D2CB 1XTCC 2FYUD 1X22A 3TYIA 1URQB 3MK7B 3RK2B 3W68A 2GUSA 2L91A 1NU1E 4EIEA 2JR8A 1D7MA 2MHMA 4PJ0H 3CC7P 2QJYB 3O0RC 1CYJA 3H32B 1T2KD 3VP8A 1BCCJ 3JCUH 2YXQB 2M5AB 3K5BA 1C2NA 1RE4A 2Y0CA 3VN0A 1OW8A 1T8ZA 5APQA 2V7QJ 1OWAA 1FHBA 2QIWA 5AW2B 2ZFCA 3IAOA 1ZOYC 2K9YA 3D71A 3H1IE 3WU2E 5DF5A 3TYYA 3L4OA 4YXWH 1G2CA 1CW5A 3BCCD 1OW6A 2Q5UA 2CPBA 3V5BA 1FZEA 2FFDC 3OAKA 1FDIA 3B5NB 2IZ1A 1K3GA 1RF1A 3FXDA 3H1LE 3L70G 3GMAA 5E79H 1DW0A 1SQPE 4WQ8A 1SQBD 4B86A 1M1JB 1NKNA 1OX3A 3H6PA 3AEBC 3CCRP 2WPQA 3A0BV 4PV1C 2HPCA 1DIPA 1EDKA 3CCVP 2UWJE 2Z4EA 1CCHA 1IK7A 3II6A 4FAVA 1SQBJ 4AALA 1RAPA 3VMAA 2FYNB 3EFFK 2VRSA 3NWVA 1KN7A 5GTHH 3TSIA 3CX5W 1GK4A 3S1KA 5C39A 2OTJP 1PP9J 1BCCE 4PJ0V 1KQGB 4A7PA 1VQNP 2FY8A 5KLVE 1I6DA 1EXJA 3M0DA 3AEFC 1EC5A 1BE3E 3TK1A 2E76B 1PP9G 3WU2V 4C46A 3OA7A 2KZJA 3L72J 4N78D 2OYIA 4KMGA 1FI7A 4WY4B 2IBZD 2IYOA 5AURA 2K37A 1CSXA 2AXTE 3ITKA 3B71A 1VQ6P 1HRCA 5CIFB 2YNYA 1DEEG 1U7JA 1YJNP 2N18B 1VQLP 3RGUA 2QEXP 4PV1D 5CIDB 1A8CA 4L76A 1OW7A 4BWNA 2B88A 2FYZA 1NAFA 3AEGC 1CCRA 2WSEH 155CA 1YICA 1N7SD 5APYA 1ZLLA 2PACA 1YNRA 2JO1A 3IFMA 1CIHA 1KYOI 4IL6E 1LT1A 2FYNC 3R2PA 1S1CX 4WB4A 3TGUD 1M90Q 1YTZI 3M06A 1L4AC 1E29A 2Q9IA 1GJQA 2B0ZB 5AVYB 2YKPA 5AW5B 3DP5A 1BSNA 2KUBA 1RH5B 5CCGC 2E42A 3MHVA 4ASVA 1M56D 3NMDA 2GB8B 1FI3A 2M0BA 3O8ZA 3WU2H 1CYCA 1EZVD 5AW8B 2KI7B 3M97X 2PAJA 1H8AA 1S2EA 1VF5B 4TLFA 1OAEA 1P84D 2JWDA 1SQQK 1YTCA 3CC4P 2BASA 4FA5A 3PXWA 2B89A 1VQKP 5AVQB 1H0TB 1VQ4P 5C9MA 3CCLP 5KLVG 5CIBB 4UB6V 2K88A 4N6JA 3G71P 2ZOOA 1JY2N 2I1JA 1FJPA 1XTGB 3MIWA 3AE6C 3HUSA 2N1TB 1M1KQ 1BL9A 1KQLA 2H8PD 1WVEC 2BCCG 3A0BH 1YHQP 2OTLP 2RN0A 1FAVA 2A45G 1I6EA 1QL4A 1KFNA 4UB8H 3TNUB 2FRCA 1CXCA 4DZOA 1P84E 1LTIC 2B87B 3ZOWA 1SQPG 2D2CD 1PL5A 2Z5IA 1SQQG 2W6JH 1OVUA 3BASA 1NNOA 2ZONG 1BE3G 2C9LY 2FXMA 1L0NG 3RN0A 1JY2O 4NFGB 4AAOA 1W2EA 4EDFA 1CEDA 1M1JA 2IFNA 3FXEA 2OYOA 5BU5A 4JPZB 1SQXE 3KPEA 2BH5X 4ZNCA 4V2KA 2A45H 4YE1A 4N0KA 1E2RA 5DJTB 1S9KE 3TGUG 4HKZH 2DVHA 4PV1B 2P2UA 1DVVA 1NTKD 4C7RA 3GHGA 1OXZA 1CRJA 1M57D 4H13C 1G2CB 4WQAA 4WQBA 3FWNA 1IQCA 2E74C 1H32B 5CJ4A 1DD3A 3F89A 1SQVG 1SQVD 5KLVK 4LC1A 4MN4C 3CC2P 1ZXGA 3SWYA 2FXOA 4L75A 2ZYDA 3Q5PA 2KNCB 4OGQC 4EOTA 1EQ7A 1OCDA 1F1CA 1S4XA 3AECC 2NPSD 3HTKB 3KZIH 1FZBA 4Z1MH 3EQ2A 5GTIH 3RN1A 3WFEC 5KKZC 3PTZA 4PD4I 1FZCA 3VNWA 2B9BA 3O5CA 3SJLA 1DX7A 2JDIH 1CC5A 5CHXA 4HYTB 2IYPA 2WSFH 3A3YB 2B12B 2Q3IA 1KB9I 1SQPK 3HTKA 1N2DC 2WWWA 3WUIA 4IL6X 1KILE 1IFPA 5IY51 2YMYA 3H1KG 4DCKA 2HG5D 2XU6A 4J20A 1HJ4A 2LIRA 2K1AA 3LIEA 1SLQA 2A06D 1LTJA 1M6ZA 2Y9ZA 1ZMEC 4JQ0D 4PWAA 1CHJA 2BGVX 3L35A 1KD1Q 3MUDA 1YI2P 1COTA 3L71E 5B6QA 2G8YA 1KMIZ 1FBMA 2ITAA 1Q82Q 2B87A 5APVA 2C1DB 3IN6A 3GLMA 2PP6A 4WBAA 1RQUA 3I56P 1ZZHA 4WQCA 2AEFA 3HE4A 3P7KA 4O9BA 1KILD 2R5DA 5AW7B 1Y47A 2KZIA 5CCHC 2N1TA 3BCCJ 5E79V 1N7SC 1VYDA 1YQ4C 3A5TA 1J1DC 3CCUP 1HROA 3CX5I 3PHLA 1USDA 3HE5A 1HZUA 1W2LA 3BCCG 1GDTA 3AE3C 5AW6B 4YTPC 5KAFH 1N7SB 3BRVB 1HJ5A 1I8OA 1GD2E 3U1CA 1R0QA 4JCGA 2C0XA 1H33A 4WY4A 3CXHI 3D6YA 1NJIQ 5TISE 1SQQE 1NO4A 1K05A 2ZVOB 1JCDA 4RJTA 1DD4A 1VQ9P 3L75J 4NPFX 1NIRA 1GMJA 5B66E 1JDLA 1GL2A 4I1LA 1AVYA 3L75G 4GOFA 1IO4A 3HQ9A 3WMM0 4WQEA 5CCHD 1KQSO 1I54A 3H1ID 5AVTB 3RK3D 1QKSA 1L0ND 1GKSA 1SP4A 3X39A 3G6EP 1C6RA 3PRJA 2XTSB 1LTTC 1X0TA 2KB7P 1KILA 2OARA 1QGKB 2N1TD 4BRYB 2AIUA 2FXPA 1N73C 1WMKA 1KX7A 2LXBA 1CYIA 1L0LG 1SQBE 2EXVA 1GIWA 1CTJA 1U57A 1M7LA 2KSJA 3L36A 4EYYQ 1FC2C 1T2KC 1IZNB 3E7KA 3B5NC 3UIAA 2N18C 1NTKG 2QSIA 3N7NA 4R4LA 1JTHA 3R4YA 1IK9A 4D6TJ 1NTKJ 1FOCA 1HJBA 2WPSA 3CMAP 2BCCE 1URQA 1JUNA 1EB7A 1BSHA 1GW4A 1ZW0A 1MFZA 3FGAD 2PRRA 3O1YA 2OQQA 3P8MC 1HJ3A 5E79E 1KYOD 2P58A 4DOJA 3OA8B 1BE3D 1C6OA 1KQFB 1KORA 4ZKPA 1NMIA 5EFWB 4TT3H 5DJQB 3B5ND 1EZVG 1PV3A 1H89A 4N78E 3AEEC 1ZRTD 1L4AB 4I2LC 1KIBA 3PLNA 3VMXA 3KYQA 2GM4A 4OGQD 3E1RA 2D2CC 2QG4A 5AVRB 3CLQA 3OA8A 1UIIA 4M3LA 3L74J 1QYZA 3RK3B 1E5WA 2PCBB 1Q86Q 2YXRB 2BCCD 3NXSA 3L70D 4RKUJ 1FDOA 3TNUA 2P67A 4H0JA 2O01N 4O1QA 1T6AA 3CXHW 3W67A 3H32A 4LJIA 5KLVJ 3RL0g 3Q1MA 1KB9H 4RESB 3CWBE 5B5EE 1KC8Q 2IFMA 2OYHC 2E75C 3H1HD 3DMIA 3PXSA 1YEAA 1AA0A 4WQ9A 1Q90D 1R8EA 2GUVA 2WPVB 1FZAA 1S3JA 2C1UA 1LNQA 1NH4A 2PCCB 4AAMA 4WY4D 2M3BA 1K3HA 1JY3P 5GTIE 2FYUG 3H1LG 3L70E 4L3HA 1AFOA 2E76D 2R5BA 2JP3A 1SQQJ 4AX3A 5CJ0A 2W6AA 2N9IA 1EXIA 1L0NJ 2YK3A 1RY3A 3CX5D 3JCUE 1VQ8P 4I7ZB 1BGYD 1NTKE 1MZ9A 3H1HJ 2KP8A 1K04A 4PJ0E 5H2FH 1PP9D 1QL3A 3L70J 2ZT9C 1PPJE 3L73G 5KAFE 4UB6E 2ZT9B 3MGNA 2DW3A 2Q3EA 3GW6A 1KILB 1QL1A 3FWLA 3AEDC 2IZ0A 2W8ZA 1HJ0A 2K3RA 1UIXA 4JYBA 1W5CT 4JYCA 2QJKC 1L2PA 2WZ7A 2ZXEB 2Y9YA 1KB9E 3CXHH 1LMSA 3HE5B 3WUVA 3JSVC 3KZIE 1CSBA 4N3YB 1L0NK 4OVNF 3KDPB 2HR3A 1K73Q 3OW2O 3V2RA 3U59A 3A9FA 1B7VA 3BATA 2H89C 3NTNA 3V2QA 5CMZA 1FZGA 2IBZG 5BVZA 5APTA 2KK7A 1NAYA 4EIJA 1FZCC 1H33B 2ZJSE 1RZ6A 2N9JA 3HQ6A 1VF5D 1CSWA 1QVGO 1LP1B 3RL0B 1BDDA 1L9JC 3SLEA 3AEAC 1Q2NA 3ZCFA 3B4SA 3RL0C 5KTBA 1JM0A 1FZFA 1RE4C 3ZOYA 2AXTH 3L75E 3L71D 1WRGA 1J3SA 2P7JA 4HJGH 1FJKA 4IOIH 2V08A 2H7HA 2J5UA 1GL2B 3G9RA 2Y0EA 4GYDA 1LTSC 3ZOXA 4KJMA 4LGDE 2HODA 1NU1D 1OVRA 3GF3A 3H25A 2PGDA 3Q5RA 4RSZA 2QJKB 2FKWB 5BU8B 1IJDB 1VQ5P 2KS1A 1AOFA 2C2CA 4GEDB 1KFMA 1LTAC 3AE2C 3PJSK 2WPRA 3V2NA 3SVWA 5KJ7C 3EWKA 5KJ7D 2WSFJ 2BH4X 3BRTB 3JBTB 3CXHE 2FYUK 4OH8B 3BCCE 2AXTV 2Q7CA 3CU4A 2AXCA 5L8RJ 2OYIC 4I7ZC 1H0TA 1HH0A 2IBZI 4NPDA 2WVRA 1ZN5A 1AJYA 2CXBA 4HB1A 1AQ5A 1DW2A 1FZCB 4YPCA 3G4SP 1S5LH 3ABVC 1HBWA 2HV4A 3ZIYA 1YBKA 2M3EA 2KXPB 2WT7B 1SQXJ 3D0WA 5KKZB 2V07A 5AVVB 2A06E 3HUSC 1JMBA 3C8VA 2MTAC 1GU4A 3KHUA 3H1JJ 2HLOA 5CIHB 3A0HE 4GODA 1SQXG 3VMZA 5CIEB 5B5EV 5CBOA 3H1JG 4PW9B 2HPCB 5CCHA 1LGHB 5DJUB 2B4ZA 4QAOA 2LKMA 2FYUE 1GW3A 3I5CA 1CSVA 2XDJA 1Z56A 2FWLA 3Q2YA 2ZXYA 3L74D 1R5LA 1CZQA 2C8SA 2J58A 3B5NA 4U7JA 2BCCJ 3SFDC 1DW3A 5DFSA 5CBNA 1H31B 4GKGA 1YTZT 1DIQC 3HD7D 4I6MC 3JC22 2ZZS1 3C9IA 4BRYA 4XXLA 1SFCA 5GTHV 3CCEP 2MKVA 2YO3A 1AVOA 4H0KA 2FFDB 1Y8AA 3AE4C 3KXDA 1JNMA 2O01H 4EI2A 3I55P 1PGPA 2KLUA 4FA9A 2IPPA 1RF1C 3MP7B 2WSEJ 1OFCX 1BE3J 4CPGA 4D6TG 1LP1A 4PD4E 3SSUA 1JTHB 3D70A 1GU2A 3L73D 1J1EB 5AVWB 1A2SA 2C9XB 2OZ1B 3OJAB 3PH0A 1MUUA 2YKQA 5TJHA 2LXCB 3O6QA 4KHXA 1H1OA 2GC7D 2QVAA 1IFJA 1GDVA 4LLHA 1SS1A 1IRWA 2K9JA 4FANA 2NZ2A 3KZIV 4WWIA 1T3UA 1MG3D 3RK3E 1N73A 4K35A 1RE3C 1EDIA 1L0NE 2WTYA 2XNDH 1NTME 2CK3H 3SWSA 4NPEA 1BCCD 4H44D 2VHDA 2W83C 1LTGC 1PZQA 1CIEA 5GTIV 1H88A 3H1IJ 1PGQA 2R44A 3GHGC 3RK3C 1LT9C 4Q5PA 1GU5A 1YCCA 2D0SA 2E43A 1CTYA 3HD7B 1HZVA 4JBZA 5EXQA 1KB0A 2WSSH 3WFDC 5CYTR 2XZRA 3RLMA 1NTKK 5APWA 2V7QH 2C1DA 1DT1A 1JY3N 1FJ0A 1JOCA 3LW5H 1J1EC 3AE5C 3S9OA 4D6TE 1CIGA 3G3ZA 5APUA 1LTBC 1BCCG 1NVOA 1LFMA 1NTMD 1CSUA 3H1KJ 2ZYGA 1FS0E 1M8OB 1YITP 1W5CE 5CCGD 2J59M 1T3JA 2I8FA 3PXTA 1ZR2A 2IDBA 1CO6A 1TU3F 3CWBG 4IFFA 3A2AA 2BCNB 5AVXB 5AW9B 3VYIA 1HGZA 1CNOA 1EDJA 3V2PA 4UB8E 1JY2P 2LR2A 4K3AA 3L72D 2ZAEB 1L4AD 4EIFA 3H1JD 1KV9A 4P4QB 1CI6A 1SVFA 2C9NY 2OYHA 2I8DA 3L73J 3HD7A 4EICA 1SQXD 4ASWA 3RK2C 2AI5A 1URQC 2M5AA 2QM7A 4Y28J 1KB9D 1LT9A 1YYCA 3Q3DA 1C6SA 1S9KD 1IFMA 3CCJP 1IRVA 4L3GA 3WC8A 3TDKA 1U7MA 1HH7A 1VPCA 2K9JB 1IZL0 2H88C 3H1HE 1ZP0C 1H9XA 4PD4H 1L0LD 5KAIE 2QRXA 1SQBG 2HYNA 1FI9A 1RF1B 1NTMG 2NRGA 4XFJA 4DT0A 3L72E 2E5TA 1LS9A 2ZBOA 4XE5B 1VF5C 3L4FA 4R4MA 1MG2D 1N50A 1HUCA 4U3FG 1YFCA 3N4XA 2O1JA 2OZ1A 1KILC 2OYIB 1FE6A 1URQD 3SXTA 2SPZA 2BEZF 5DJQC 4U3FJ 1IFNA 3VOPA 2CE0A 2W27A 1BGYE 1C2RA 1KYOW 2AEJA 1NU1J 2YQBA 2R32A 5AVUB 1PP9E 1CRCA 5AW3B 4H0LC 1J1DB 3TF5A 2G3AA 1PPJD 2JKVA 1EZVI 3CCQP 1GTWA 3P8CD 3H1KE 2CE1A 4GOEA 1P84I 2QJPC 1WEJF 1N7LA 1HWTC 4O1WA 1WT6A 1LTJC 3L4MA 3V4QA 1FOSF 1CORA 1HVVA 2ORLA 3AE9C 4WVZA 1KZUB 3CXHD 2C1VA 5APSA 1E8EA 4XA4A 3SWFA 1OMIA 1G1JA 2WMMA 3SFEC 2O01J 5TISH 2OTKE 2PFXA 2CPSA 5AVSB 4U3FD 451CA 3GF7A 4IL6V 1S5LV 3P32A 1N9CA 2WT7A 3HQ7A 3Q5SA 3V6IA 3CP5A 1QVFO 1JB0J 3MK7C 3SWKA 1NTMK 1QEXA 1NTZG 1KX2A 1VQMP 2R3CA 2NPSA 4C7NB 3L37A 3EFGA 3LW5J 4DJGA 1GQ1A 1NTZJ 1AV1A 3VTPC 2JTIB 2B11B 3VMYA 1DH3A 4AUWA 3O20A 3RBXA 3BVHA 3A7OA 3RL0D 1LWUA 1VQOP 1H9YA 2E75D 1USEA 2KOGA 1LTJB 4OGQB 3RMZA 3L74G 2ZT9D 1HF9A 1H31A 1NTZE 3HQ8A 3ZOOA 1NKZB 3L74E 3CD6P 4FA1A 3ZDMA 3CYTI 2GC4D 4UB8V 2JEEA 1P84H 4GDOA 3DR0A 1IC2A 4IFMA 1YQ3C 1ZV8A 3D6ZA 2E76C 4EIDA 1MV8A 1HCMA 1L9BC 2M8RA 3CL3D 1AOQA 3M0AA 2GIWA 5AW4B 3MZWB 1I8PA 2BLFB 3MTUE 4W7YA 1SQPJ 2YO2A 1CRYA 5AVZB 2FYUJ 2ZYAA 2O1KA 3WUUA 5TISV 4AYCA 1BDCA 1A02F 4GIFA 1F1FA 2YIUC 3A0HH 3F5HA 5APXA 2N3YA 2XV5A 1NTZD 3L73E 2N9YB 1SFCB 3H1LJ 1LC2A 3H1HG 2IBZE 2A45I 4XYDB 1SFCC 1GZLA 1IFDA 1M1JC 1RQVA 1JY3O 1FU1A 2E5YA 2N9BA 1N90A 3QH9A 1X79B 2WITA 1GK6A 2JJLA 1IFIA 2YMKA 2CA4B 2W90A 1PFIA 2HODB 3HD7C 3TGUJ 3ORVA 1N15A 3IR9A 1Y9BA 3U1AA 3OCDA 2IX7C 3O6QB 1FCDC 1KYOE 1DVHA 4UB6H 3VYMA 1CRGA 3H1LD 1M60A 1SQQD 3C1LA 2NPSB 4C7NA 3HUSB 2POHA 4KT0J 1SQPD 2KNCA 1QX8A 3FX0A 4JF7A 1ZRTE 3AE1C 1PPJG 2RMZA 3TGUE 4Y5RA 1C75A 5CIGB 3T97A 4MU8A 1U74B 1AQTA 5GTHE 4H0LD 1S72P 1K9MQ 3M91A 5AW1B 3MD0A 2KSEA 3IF4A 1QLED 3ZBMA 1GL2D 4D6TD 2B10B 1OVVA 4Y99C 3B8EB 1CRHA 2XKMA 3L72G 5KLIC 4ZMDA 3RK2D
chains in the Genus database with same CATH topology
3O1YA 3VRDA 3SWSA 1HJ3A 1BCCD 2O3JA 2VHDA 1CCRA 5KLVD 1YIQA 155CA 1KYOD 1YICA 1CIEA 5GTIV 3OA8B 3CWBD 2PACA 1BE3D 1C6OA 1YNRA 2CA3B 4PD4D 4Q5PA 1NMIA 1CIHA 5DJQB 1ZRTD 1KIBA 1YCCA 3PLNA 2D0SA 3OCDB 3TGUD 1CTYA 1HZVA 5EXQA 1RZ5A 1KB0A 1E29A 2QG4A 1GJQA 3OA8A 3WFDC 5CYTR 2B0ZB 3RLMA 1QYZA 2C1DA 1DT1A 1FJ0A 2PCBB 2BCCD 3L70D 1CIGA 3DP5A 4H0JA 4O1QA 1DIIC 1LFMA 1NTMD 1CSUA 1C7MA 3CXHW 4LJIA 2JQRA 1IO3A 2GB8B 1FI3A 1QN2A 4AANA 1CYCA 1EZVD 2I8FA 3WFCC 3M97X 3PXTA 3H1HD 3DMIA 3PXSA 1ETPA 1YEAA 4DY9A 1CHHA 1OAEA 1CO6A 1P84D 4WQ9A 1YTCA 2DGEA 2BCNB 4FA5A 3PXWA 4FB1A 1CNOA 2C1UA 1AYGA 5CICB 3NBSA 5C9MA 3L72D 2PCCB 4AAMA 5CIBB 2Y0DA 4UB6V 2ZOOA 4EIFA 1I55A 1KV9A 3H1JD 4P4QB 5H2FV 1K3HA 4L3HA 4EICA 1BL9A 1SQXD 2AI5A 1WVEC 1KB9D 4AX3A 1C6SA 1AKKA 2N9IA 2RN0A 2QJPB 1IRVA 2YK3A 4L3GA 3CX5D 1CIFA 3GG2A 1I6EA 3WC8A 1QL4A 3TDKA 1BGYD 1HH7A 1U75B 2K9JB 1IZL0 2FRCA 1S6VB 1PP9D 1CXCA 1QL3A 1H9XA 2N3BA 1L0LD 3ZOWA 1FI9A 1CRIA 1CXAA 2Q3EA 1NNOA 1I5TA 2ZONG 5KAFV 3RN0A 3GW6A 4NFGB 3C2CA 1A56A 1LS9A 3FWLA 4AAOA 2ZBOA 4EDFA 1CEDA 1MG2D 4K3IA 1N50A 1W5CT 1CHIA 1YFCA 2BH5X 4V2KA 2OZ1A 1LMSA 4YE1A 3SXTA 4N0KA 5DJQC 1E2RA 1RAQA 3PH2B 2CE0A 1LC1A 3A9FA 5KAIV 2DVHA 1B7VA 1DVVA 1NTKD 1C2RA 1KYOW 1CRJA 4L1QA 2YQBA 5KLIB 4WQAA 5C0ZA 4WQBA 1CRCA 3TF5A 1IQCA 1PPJD 1H32B 4WQDA 1H33B 351CA 2YIUB 1SQVD 3A0HV 1RZ6A 2CE1A 2N9JA 3HQ6A 1CSWA 1WEJF 4O1WA 1L9JC 3SLEA 2KNCB 3ZCFA 3L4MA 1OCDA 2YCCA 1F1CA 1CORA 2ORLA 3CXHD 2C1VA 3ZOYA 1E8EA 3L71D 1J3SA 3RN1A 3WFEC 2V08A 3PTZA 3VNWA 2Y0EA 4U3FD 3O5CA 3SJLA 1CC5A 1NMLA 451CA 4IL6V 1DW1A 1S5LV 2B12B 4GYDA 3ZOXA 1N9CA 3HQ7A 2BPBB 1NU1D 3WUIA 3CP5A 5IY51 3MK7C 4RSZA 2QJKB 4WQ7A 4J20A 1HJ4A 1KX2A 3H1KD 1AOFA 2KS1A 2LIRA 2C2CA 4GEDB 1C52A 3WFBC 2L4DA 1GQ1A 3SVWA 2A06D 1M6ZA 4FA4A 1YEBA 2D0WA 2JTIB 2BH4X 2B11B 4PWAA 1CHJA 1H32A 2BGVX 3O20A 3JBTB 3L75D 5B66V 3NBTA 1COTA 5B6QA 2AXTV 1MZ4A 1H9YA 3CU4A 2JWAA 2C1DB 1M70A 2LITA 1CTZA 3RMZA 2FYUD 3TYIA 1H31A 3MK7B 1ZZHA 4WQCA 2L91A 4EIEA 3HQ8A 3ZOOA 2CXBA 2MHMA 4FA1A 2QJYB 3CYTI 3O0RC 1CYJA 2GC4D 4UB8V 1DW2A 5E79V 1VYDA 1HROA 2HV4A 3ZIYA 3DR0A 3PHLA 1C2NA 1HZUA 1W2LA 2Y0CA 5KKZB 2V07A 4EIDA 1FHBA 1HCMA 1L9BC 2MTAC 3KHUA 1AOQA 2GIWA 5CIHB 1I8PA 2BLFB 5DF5A 3L4OA 5CIEB 3BCCD 5B5EV 1CRYA 1HJ5A 1I8OA 1R0QA 4JCGA 4PW9B 5TISV 1H33A 2B4ZA 4QAOA 1K3GA 1F1FA 2N3YA 1DW0A 1CSVA 2FWLA 1NTZD 4WQ8A 2N9YB 1SQBD 2ZXYA 3L74D 4RJTA 1LC2A 2C8SA 3A0BV 4XYDB 1NIRA 1CCHA 1JDLA 1DW3A 5DFSA 4FAVA 1H31B 4AALA 1RAPA 1N90A 3HQ9A 1DIQC 2ZZS1 4XXLA 3VMAA 2FYNB 2CA4B 4WQEA 5GTHV 1I54A 3H1ID 1QKSA 4H0KA 1L0ND 1GKSA 3NWVA 3X39A 3ORVA 1N15A 1C6RA 3CX5W 3PRJA 2XTSB 3OCDA 4A7PA 4PJ0V 1FCDC 4FA9A 1I6DA 1DVHA 3VYMA 1CRGA 3H1LD 1M60A 1SQQD 2AIUA 3WU2V 1KX7A 1GU2A 1CYIA 1SQPD 3L73D 1A2SA 2EXVA 2C9XB 2OZ1B 1GIWA 1CTJA 2RMZA 4KMGA 1FI7A 5TJHA 2IBZD 4Y5RA 1C75A 5AURA 5CIGB 4MU8A 1U74B 1CSXA 3ITKA 1H1OA 2GC7D 2N18C 1GDVA 1HRCA 1IRWA 5CIFB 4FANA 1FOCA 3ZBMA 2N18B 3KZIV 4D6TD 1EB7A 2B10B 1MG3D 1CRHA 5CIDB 1A8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O1Y A;  3VRD A;  3SWS A;  1HJ3 A;  1BCC D;  2O3J A;  2VHD A;  1CCR A;  5KLV D;  1YIQ A;  155C A;  1KYO D;  1YIC A;  1CIE A;  5GTI V;  3OA8 B;  3CWB D;  2PAC A;  1BE3 D;  1C6O A;  1YNR A;  2CA3 B;  4PD4 D;  4Q5P A;  1NMI A;  1CIH A;  5DJQ B;  1ZRT D;  1KIB A;  1YCC A;  3PLN A;  2D0S A;  3OCD B;  3TGU D;  1CTY A;  1HZV A;  5EXQ A;  1RZ5 A;  1KB0 A;  1E29 A;  2QG4 A;  1GJQ A;  3OA8 A;  3WFD C;  5CYT R;  2B0Z B;  3RLM A;  1QYZ A;  2C1D A;  1DT1 A;  1FJ0 A;  2PCB B;  2BCC D;  3L70 D;  1CIG A;  3DP5 A;  4H0J A;  4O1Q A;  1DII C;  1LFM A;  1NTM D;  1CSU A;  1C7M A;  3CXH W;  4LJI A;  2JQR A;  1IO3 A;  2GB8 B;  1FI3 A;  1QN2 A;  4AAN A;  1CYC A;  1EZV D;  2I8F A;  3WFC C;  3M97 X;  3PXT A;  3H1H D;  3DMI A;  3PXS A;  1ETP A;  1YEA A;  4DY9 A;  1CHH A;  1OAE A;  1CO6 A;  1P84 D;  4WQ9 A;  1YTC A;  2DGE A;  2BCN B;  4FA5 A;  3PXW A;  4FB1 A;  1CNO A;  2C1U A;  1AYG A;  5CIC B;  3NBS A;  5C9M A;  3L72 D;  2PCC B;  4AAM A;  5CIB B;  2Y0D A;  4UB6 V;  2ZOO A;  4EIF A;  1I55 A;  1KV9 A;  3H1J D;  4P4Q B;  5H2F V;  1K3H A;  4L3H A;  4EIC A;  1BL9 A;  1SQX D;  2AI5 A;  1WVE C;  1KB9 D;  4AX3 A;  1C6S A;  1AKK A;  2N9I A;  2RN0 A;  2QJP B;  1IRV A;  2YK3 A;  4L3G A;  3CX5 D;  1CIF A;  3GG2 A;  1I6E A;  3WC8 A;  1QL4 A;  3TDK A;  1BGY D;  1HH7 A;  1U75 B;  2K9J B;  1IZL 0;  2FRC A;  1S6V B;  1PP9 D;  1CXC A;  1QL3 A;  1H9X A;  2N3B A;  1L0L D;  3ZOW A;  1FI9 A;  1CRI A;  1CXA A;  2Q3E A;  1NNO A;  1I5T A;  2ZON G;  5KAF V;  3RN0 A;  3GW6 A;  4NFG B;  3C2C A;  1A56 A;  1LS9 A;  3FWL A;  4AAO A;  2ZBO A;  4EDF A;  1CED A;  1MG2 D;  4K3I A;  1N50 A;  1W5C T;  1CHI A;  1YFC A;  2BH5 X;  4V2K A;  2OZ1 A;  1LMS A;  4YE1 A;  3SXT A;  4N0K A;  5DJQ C;  1E2R A;  1RAQ A;  3PH2 B;  2CE0 A;  1LC1 A;  3A9F A;  5KAI V;  2DVH A;  1B7V A;  1DVV A;  1NTK D;  1C2R A;  1KYO W;  1CRJ A;  4L1Q A;  2YQB A;  5KLI B;  4WQA A;  5C0Z A;  4WQB A;  1CRC A;  3TF5 A;  1IQC A;  1PPJ D;  1H32 B;  4WQD A;  1H33 B;  351C A;  2YIU B;  1SQV D;  3A0H V;  1RZ6 A;  2CE1 A;  2N9J A;  3HQ6 A;  1CSW A;  1WEJ F;  4O1W A;  1L9J C;  3SLE A;  2KNC B;  3ZCF A;  3L4M A;  1OCD A;  2YCC A;  1F1C A;  1COR A;  2ORL A;  3CXH D;  2C1V A;  3ZOY A;  1E8E A;  3L71 D;  1J3S A;  3RN1 A;  3WFE C;  2V08 A;  3PTZ A;  3VNW A;  2Y0E A;  4U3F D;  3O5C A;  3SJL A;  1CC5 A;  1NML A;  451C A;  4IL6 V;  1DW1 A;  1S5L V;  2B12 B;  4GYD A;  3ZOX A;  1N9C A;  3HQ7 A;  2BPB B;  1NU1 D;  3WUI A;  3CP5 A;  5IY5 1;  3MK7 C;  4RSZ A;  2QJK B;  4WQ7 A;  4J20 A;  1HJ4 A;  1KX2 A;  3H1K D;  1AOF A;  2KS1 A;  2LIR A;  2C2C A;  4GED B;  1C52 A;  3WFB C;  2L4D A;  1GQ1 A;  3SVW A;  2A06 D;  1M6Z A;  4FA4 A;  1YEB A;  2D0W A;  2JTI B;  2BH4 X;  2B11 B;  4PWA A;  1CHJ A;  1H32 A;  2BGV X;  3O20 A;  3JBT B;  3L75 D;  5B66 V;  3NBT A;  1COT A;  5B6Q A;  2AXT V;  1MZ4 A;  1H9Y A;  3CU4 A;  2JWA A;  2C1D B;  1M70 A;  2LIT A;  1CTZ A;  3RMZ A;  2FYU D;  3TYI A;  1H31 A;  3MK7 B;  1ZZH A;  4WQC A;  2L91 A;  4EIE A;  3HQ8 A;  3ZOO A;  2CXB A;  2MHM A;  4FA1 A;  2QJY B;  3CYT I;  3O0R C;  1CYJ A;  2GC4 D;  4UB8 V;  1DW2 A;  5E79 V;  1VYD A;  1HRO A;  2HV4 A;  3ZIY A;  3DR0 A;  3PHL A;  1C2N A;  1HZU A;  1W2L A;  2Y0C A;  5KKZ B;  2V07 A;  4EID A;  1FHB A;  1HCM A;  1L9B C;  2MTA C;  3KHU A;  1AOQ A;  2GIW A;  5CIH B;  1I8P A;  2BLF B;  5DF5 A;  3L4O A;  5CIE B;  3BCC D;  5B5E V;  1CRY A;  1HJ5 A;  1I8O A;  1R0Q A;  4JCG A;  4PW9 B;  5TIS V;  1H33 A;  2B4Z A;  4QAO A;  1K3G A;  1F1F A;  2N3Y A;  1DW0 A;  1CSV A;  2FWL A;  1NTZ D;  4WQ8 A;  2N9Y B;  1SQB D;  2ZXY A;  3L74 D;  4RJT A;  1LC2 A;  2C8S A;  3A0B V;  4XYD B;  1NIR A;  1CCH A;  1JDL A;  1DW3 A;  5DFS A;  4FAV A;  1H31 B;  4AAL A;  1RAP A;  1N90 A;  3HQ9 A;  1DIQ C;  2ZZS 1;  4XXL A;  3VMA A;  2FYN B;  2CA4 B;  4WQE A;  5GTH V;  1I54 A;  3H1I D;  1QKS A;  4H0K A;  1L0N D;  1GKS A;  3NWV A;  3X39 A;  3ORV A;  1N15 A;  1C6R A;  3CX5 W;  3PRJ A;  2XTS B;  3OCD A;  4A7P A;  4PJ0 V;  1FCD C;  4FA9 A;  1I6D A;  1DVH A;  3VYM A;  1CRG A;  3H1L D;  1M60 A;  1SQQ D;  2AIU A;  3WU2 V;  1KX7 A;  1GU2 A;  1CYI A;  1SQP D;  3L73 D;  1A2S A;  2EXV A;  2C9X B;  2OZ1 B;  1GIW A;  1CTJ A;  2RMZ A;  4KMG A;  1FI7 A;  5TJH A;  2IBZ D;  4Y5R A;  1C75 A;  5AUR A;  5CIG B;  4MU8 A;  1U74 B;  1CSX A;  3ITK A;  1H1O A;  2GC7 D;  2N18 C;  1GDV A;  1HRC A;  1IRW A;  5CIF B;  4FAN A;  1FOC A;  3ZBM A;  2N18 B;  3KZI V;  4D6T D;  1EB7 A;  2B10 B;  1MG3 D;  1CRH A;  5CID B;  1A8C A; 
#chains in the Genus database with same CATH topology
 3VRD A;  2E74 B;  3KQG A;  1S5L X;  1NOH A;  2O3J A;  3AE7 C;  5KLV D;  1SQV K;  1YIQ A;  3A0B E;  4OWF A;  3CWB D;  3USS A;  1SQX K;  2H43 A;  2CA3 B;  4PD4 D;  1Q81 Q;  2C0W A;  2WSC H;  3LID A;  1PGJ A;  2KIK A;  2E75 B;  3OCD B;  1VL2 A;  1RZ5 A;  5B5E H;  1SQB K;  3M0D C;  1N86 A;  5KJ7 A;  2QM8 A;  1LT9 B;  2WSC J;  2MJZ A;  3GHG B;  2Q6Q A;  4IL6 H;  5M1B A;  5K5G B;  2AEM A;  1PGO A;  1N8R Q;  3CWB J;  1NU1 K;  4GT1 A;  1R5S A;  1RE3 A;  1DII C;  1FOS E;  3CX5 H;  1C7M A;  1J2J B;  1OIP A;  3CME P;  2JQR A;  2XNX A;  1RHZ B;  1IO3 A;  1QN2 A;  4AAN A;  1KYO H;  1LJ2 A;  1KTM A;  3WFC C;  1YJ9 P;  1NYH A;  1ETP A;  1LWU B;  4DY9 A;  1CHH A;  1CI6 B;  4H44 B;  1L0L E;  2YKO A;  2DGE A;  4L74 A;  3CCM P;  1PIX A;  2N1T C;  4FB1 A;  1AYG A;  5CIC B;  3NBS A;  5H2F E;  1MKM A;  2Y0D A;  2ZVN B;  1YIJ P;  1I55 A;  5H2F V;  4H44 C;  4HH2 A;  5B66 H;  3QWO C;  4W80 A;  2P1J A;  1NTM J;  4L73 A;  1X9V A;  1JO5 A;  1AKK A;  1EDL A;  2QJP B;  3HRN A;  1CIF A;  3GG2 A;  3VP9 A;  1G1I A;  2QE7 H;  1K8A Q;  4RO0 A;  2P10 A;  1EZV E;  1U75 B;  1DEB A;  2Z5H A;  1S6V B;  2KLV A;  3RBZ A;  2N3B A;  1GL2 C;  2QA4 P;  1N73 B;  2V4H A;  2NPS C;  2ZXX A;  3M9B A;  1CRI A;  4IFD K;  1CXA A;  1I5T A;  5KAF V;  1MFT A;  1RF0 A;  1L0L K;  1JMM A;  1NU1 G;  3C2C A;  3HE4 B;  1A56 A;  1JEK A;  3CCS P;  3H1J E;  3M9H A;  1W2B O;  4K3I A;  2Q1K A;  1VQP P;  1CHI A;  4AQR D;  1NGM B;  2RKL A;  1FDM A;  1KV4 A;  2A06 G;  3L71 G;  2FBW C;  4H13 D;  3T97 B;  1RAQ A;  3PH2 B;  3CX5 E;  1L0L J;  1LC1 A;  5KAI V;  3WUT A;  3L71 J;  4L1Q A;  5KLI B;  4Y99 B;  5C0Z A;  1NWQ A;  4BXL A;  4ZKU A;  1S5L E;  4WQD A;  351C A;  3CPW O;  2YIU B;  1VDF A;  2R3S A;  3A0H V;  4YXD C;  2RH0 A;  2OGU A;  1SFC D;  1NTZ K;  1QL2 A;  2W6B A;  2YCC A;  4H0L B;  4QMA A;  2KYV A;  1X8Y A;  2WQY C;  4WY4 C;  3M9Q A;  4W7Z A;  5AW0 B;  1SQV J;  1HTL C;  2I1K A;  1NML A;  1DW1 A;  2E74 D;  3NFQ A;  2BPB B;  2FFD A;  1LWU C;  2HFE D;  1RF0 C;  1Q7Y Q;  2BEQ D;  3V4W A;  1NHL A;  2OYH B;  3PP5 A;  4WQ7 A;  1N7S A;  1SQV E;  3P8C E;  3H1K D;  3S4R A;  3E1I A;  5KAI H;  1E79 H;  1C52 A;  3WFB C;  2L4D A;  3MUD C;  3H1I G;  4FA4 A;  1YEB A;  2D0W A;  2GA1 A;  1L4A A;  1BGY G;  1H32 A;  1OZH A;  2L5G B;  4H13 B;  3L75 D;  5B66 V;  3NBT A;  3AE8 C;  2KS1 B;  5CCG A;  1MZ4 A;  1BGY J;  1JCC A;  3CI9 A;  2QJY C;  1HGV A;  2JWA A;  1ZR4 A;  1A02 J;  1YJW P;  1M70 A;  2LIT A;  1CTZ A;  4U3F E;  1VQ7 P;  2D2C B;  1XTC C;  2FYU D;  1X22 A;  3TYI A;  1URQ B;  3MK7 B;  3RK2 B;  3W68 A;  2GUS A;  2L91 A;  1NU1 E;  4EIE A;  2JR8 A;  1D7M A;  2MHM A;  4PJ0 H;  3CC7 P;  2QJY B;  3O0R C;  1CYJ A;  3H32 B;  1T2K D;  3VP8 A;  1BCC J;  3JCU H;  2YXQ B;  2M5A B;  3K5B A;  1C2N A;  1RE4 A;  2Y0C A;  3VN0 A;  1OW8 A;  1T8Z A;  5APQ A;  2V7Q J;  1OWA A;  1FHB A;  2QIW A;  5AW2 B;  2ZFC A;  3IAO A;  1ZOY C;  2K9Y A;  3D71 A;  3H1I E;  3WU2 E;  5DF5 A;  3TYY A;  3L4O A;  4YXW H;  1G2C A;  1CW5 A;  3BCC D;  1OW6 A;  2Q5U A;  2CPB A;  3V5B A;  1FZE A;  2FFD C;  3OAK A;  1FDI A;  3B5N B;  2IZ1 A;  1K3G A;  1RF1 A;  3FXD A;  3H1L E;  3L70 G;  3GMA A;  5E79 H;  1DW0 A;  1SQP E;  4WQ8 A;  1SQB D;  4B86 A;  1M1J B;  1NKN A;  1OX3 A;  3H6P A;  3AEB C;  3CCR P;  2WPQ A;  3A0B V;  4PV1 C;  2HPC A;  1DIP A;  1EDK A;  3CCV P;  2UWJ E;  2Z4E A;  1CCH A;  1IK7 A;  3II6 A;  4FAV A;  1SQB J;  4AAL A;  1RAP A;  3VMA A;  2FYN B;  3EFF K;  2VRS A;  3NWV A;  1KN7 A;  5GTH H;  3TSI A;  3CX5 W;  1GK4 A;  3S1K A;  5C39 A;  2OTJ P;  1PP9 J;  1BCC E;  4PJ0 V;  1KQG B;  4A7P A;  1VQN P;  2FY8 A;  5KLV E;  1I6D A;  1EXJ A;  3M0D A;  3AEF C;  1EC5 A;  1BE3 E;  3TK1 A;  2E76 B;  1PP9 G;  3WU2 V;  4C46 A;  3OA7 A;  2KZJ A;  3L72 J;  4N78 D;  2OYI A;  4KMG A;  1FI7 A;  4WY4 B;  2IBZ D;  2IYO A;  5AUR A;  2K37 A;  1CSX A;  2AXT E;  3ITK A;  3B71 A;  1VQ6 P;  1HRC A;  5CIF B;  2YNY A;  1DEE G;  1U7J A;  1YJN P;  2N18 B;  1VQL P;  3RGU A;  2QEX P;  4PV1 D;  5CID B;  1A8C A;  4L76 A;  1OW7 A;  4BWN A;  2B88 A;  2FYZ A;  1NAF A;  3AEG C;  1CCR A;  2WSE H;  155C A;  1YIC A;  1N7S D;  5APY A;  1ZLL A;  2PAC A;  1YNR A;  2JO1 A;  3IFM A;  1CIH A;  1KYO I;  4IL6 E;  1LT1 A;  2FYN C;  3R2P A;  1S1C X;  4WB4 A;  3TGU D;  1M90 Q;  1YTZ I;  3M06 A;  1L4A C;  1E29 A;  2Q9I A;  1GJQ A;  2B0Z B;  5AVY B;  2YKP A;  5AW5 B;  3DP5 A;  1BSN A;  2KUB A;  1RH5 B;  5CCG C;  2E42 A;  3MHV A;  4ASV A;  1M56 D;  3NMD A;  2GB8 B;  1FI3 A;  2M0B A;  3O8Z A;  3WU2 H;  1CYC A;  1EZV D;  5AW8 B;  2KI7 B;  3M97 X;  2PAJ A;  1H8A A;  1S2E A;  1VF5 B;  4TLF A;  1OAE A;  1P84 D;  2JWD A;  1SQQ K;  1YTC A;  3CC4 P;  2BAS A;  4FA5 A;  3PXW A;  2B89 A;  1VQK P;  5AVQ B;  1H0T B;  1VQ4 P;  5C9M A;  3CCL P;  5KLV G;  5CIB B;  4UB6 V;  2K88 A;  4N6J A;  3G71 P;  2ZOO A;  1JY2 N;  2I1J A;  1FJP A;  1XTG B;  3MIW A;  3AE6 C;  3HUS A;  2N1T B;  1M1K Q;  1BL9 A;  1KQL A;  2H8P D;  1WVE C;  2BCC G;  3A0B H;  1YHQ P;  2OTL P;  2RN0 A;  1FAV A;  2A45 G;  1I6E A;  1QL4 A;  1KFN A;  4UB8 H;  3TNU B;  2FRC A;  1CXC A;  4DZO A;  1P84 E;  1LTI C;  2B87 B;  3ZOW A;  1SQP G;  2D2C D;  1PL5 A;  2Z5I A;  1SQQ G;  2W6J H;  1OVU A;  3BAS A;  1NNO A;  2ZON G;  1BE3 G;  2C9L Y;  2FXM A;  1L0N G;  3RN0 A;  1JY2 O;  4NFG B;  4AAO A;  1W2E A;  4EDF A;  1CED A;  1M1J A;  2IFN A;  3FXE A;  2OYO A;  5BU5 A;  4JPZ B;  1SQX E;  3KPE A;  2BH5 X;  4ZNC A;  4V2K A;  2A45 H;  4YE1 A;  4N0K A;  1E2R A;  5DJT B;  1S9K E;  3TGU G;  4HKZ H;  2DVH A;  4PV1 B;  2P2U A;  1DVV A;  1NTK D;  4C7R A;  3GHG A;  1OXZ A;  1CRJ A;  1M57 D;  4H13 C;  1G2C B;  4WQA A;  4WQB A;  3FWN A;  1IQC A;  2E74 C;  1H32 B;  5CJ4 A;  1DD3 A;  3F89 A;  1SQV G;  1SQV D;  5KLV K;  4LC1 A;  4MN4 C;  3CC2 P;  1ZXG A;  3SWY A;  2FXO A;  4L75 A;  2ZYD A;  3Q5P A;  2KNC B;  4OGQ C;  4EOT A;  1EQ7 A;  1OCD A;  1F1C A;  1S4X A;  3AEC C;  2NPS D;  3HTK B;  3KZI H;  1FZB A;  4Z1M H;  3EQ2 A;  5GTI H;  3RN1 A;  3WFE C;  5KKZ C;  3PTZ A;  4PD4 I;  1FZC A;  3VNW A;  2B9B A;  3O5C A;  3SJL A;  1DX7 A;  2JDI H;  1CC5 A;  5CHX A;  4HYT B;  2IYP A;  2WSF H;  3A3Y B;  2B12 B;  2Q3I A;  1KB9 I;  1SQP K;  3HTK A;  1N2D C;  2WWW A;  3WUI A;  4IL6 X;  1KIL E;  1IFP A;  5IY5 1;  2YMY A;  3H1K G;  4DCK A;  2HG5 D;  2XU6 A;  4J20 A;  1HJ4 A;  2LIR A;  2K1A A;  3LIE A;  1SLQ A;  2A06 D;  1LTJ A;  1M6Z A;  2Y9Z A;  1ZME C;  4JQ0 D;  4PWA A;  1CHJ A;  2BGV X;  3L35 A;  1KD1 Q;  3MUD A;  1YI2 P;  1COT A;  3L71 E;  5B6Q A;  2G8Y A;  1KMI Z;  1FBM A;  2ITA A;  1Q82 Q;  2B87 A;  5APV A;  2C1D B;  3IN6 A;  3GLM A;  2PP6 A;  4WBA A;  1RQU A;  3I56 P;  1ZZH A;  4WQC A;  2AEF A;  3HE4 A;  3P7K A;  4O9B A;  1KIL D;  2R5D A;  5AW7 B;  1Y47 A;  2KZI A;  5CCH C;  2N1T A;  3BCC J;  5E79 V;  1N7S C;  1VYD A;  1YQ4 C;  3A5T A;  1J1D C;  3CCU P;  1HRO A;  3CX5 I;  3PHL A;  1USD A;  3HE5 A;  1HZU A;  1W2L A;  3BCC G;  1GDT A;  3AE3 C;  5AW6 B;  4YTP C;  5KAF H;  1N7S B;  3BRV B;  1HJ5 A;  1I8O A;  1GD2 E;  3U1C A;  1R0Q A;  4JCG A;  2C0X A;  1H33 A;  4WY4 A;  3CXH I;  3D6Y A;  1NJI Q;  5TIS E;  1SQQ E;  1NO4 A;  1K05 A;  2ZVO B;  1JCD A;  4RJT A;  1DD4 A;  1VQ9 P;  3L75 J;  4NPF X;  1NIR A;  1GMJ A;  5B66 E;  1JDL A;  1GL2 A;  4I1L A;  1AVY A;  3L75 G;  4GOF A;  1IO4 A;  3HQ9 A;  3WMM 0;  4WQE A;  5CCH D;  1KQS O;  1I54 A;  3H1I D;  5AVT B;  3RK3 D;  1QKS A;  1L0N D;  1GKS A;  1SP4 A;  3X39 A;  3G6E P;  1C6R A;  3PRJ A;  2XTS B;  1LTT C;  1X0T A;  2KB7 P;  1KIL A;  2OAR A;  1QGK B;  2N1T D;  4BRY B;  2AIU A;  2FXP A;  1N73 C;  1WMK A;  1KX7 A;  2LXB A;  1CYI A;  1L0L G;  1SQB E;  2EXV A;  1GIW A;  1CTJ A;  1U57 A;  1M7L A;  2KSJ A;  3L36 A;  4EYY Q;  1FC2 C;  1T2K C;  1IZN B;  3E7K A;  3B5N C;  3UIA A;  2N18 C;  1NTK G;  2QSI A;  3N7N A;  4R4L A;  1JTH A;  3R4Y A;  1IK9 A;  4D6T J;  1NTK J;  1FOC A;  1HJB A;  2WPS A;  3CMA P;  2BCC E;  1URQ A;  1JUN A;  1EB7 A;  1BSH A;  1GW4 A;  1ZW0 A;  1MFZ A;  3FGA D;  2PRR A;  3O1Y A;  2OQQ A;  3P8M C;  1HJ3 A;  5E79 E;  1KYO D;  2P58 A;  4DOJ A;  3OA8 B;  1BE3 D;  1C6O A;  1KQF B;  1KOR A;  4ZKP A;  1NMI A;  5EFW B;  4TT3 H;  5DJQ B;  3B5N D;  1EZV G;  1PV3 A;  1H89 A;  4N78 E;  3AEE C;  1ZRT D;  1L4A B;  4I2L C;  1KIB A;  3PLN A;  3VMX A;  3KYQ A;  2GM4 A;  4OGQ D;  3E1R A;  2D2C C;  2QG4 A;  5AVR B;  3CLQ A;  3OA8 A;  1UII A;  4M3L A;  3L74 J;  1QYZ A;  3RK3 B;  1E5W A;  2PCB B;  1Q86 Q;  2YXR B;  2BCC D;  3NXS A;  3L70 D;  4RKU J;  1FDO A;  3TNU A;  2P67 A;  4H0J A;  2O01 N;  4O1Q A;  1T6A A;  3CXH W;  3W67 A;  3H32 A;  4LJI A;  5KLV J;  3RL0 g;  3Q1M A;  1KB9 H;  4RES B;  3CWB E;  5B5E E;  1KC8 Q;  2IFM A;  2OYH C;  2E75 C;  3H1H D;  3DMI A;  3PXS A;  1YEA A;  1AA0 A;  4WQ9 A;  1Q90 D;  1R8E A;  2GUV A;  2WPV B;  1FZA A;  1S3J A;  2C1U A;  1LNQ A;  1NH4 A;  2PCC B;  4AAM A;  4WY4 D;  2M3B A;  1K3H A;  1JY3 P;  5GTI E;  2FYU G;  3H1L G;  3L70 E;  4L3H A;  1AFO A;  2E76 D;  2R5B A;  2JP3 A;  1SQQ J;  4AX3 A;  5CJ0 A;  2W6A A;  2N9I A;  1EXI A;  1L0N J;  2YK3 A;  1RY3 A;  3CX5 D;  3JCU E;  1VQ8 P;  4I7Z B;  1BGY D;  1NTK E;  1MZ9 A;  3H1H J;  2KP8 A;  1K04 A;  4PJ0 E;  5H2F H;  1PP9 D;  1QL3 A;  3L70 J;  2ZT9 C;  1PPJ E;  3L73 G;  5KAF E;  4UB6 E;  2ZT9 B;  3MGN A;  2DW3 A;  2Q3E A;  3GW6 A;  1KIL B;  1QL1 A;  3FWL A;  3AED C;  2IZ0 A;  2W8Z A;  1HJ0 A;  2K3R A;  1UIX A;  4JYB A;  1W5C T;  4JYC A;  2QJK C;  1L2P A;  2WZ7 A;  2ZXE B;  2Y9Y A;  1KB9 E;  3CXH H;  1LMS A;  3HE5 B;  3WUV A;  3JSV C;  3KZI E;  1CSB A;  4N3Y B;  1L0N K;  4OVN F;  3KDP B;  2HR3 A;  1K73 Q;  3OW2 O;  3V2R A;  3U59 A;  3A9F A;  1B7V A;  3BAT A;  2H89 C;  3NTN A;  3V2Q A;  5CMZ A;  1FZG A;  2IBZ G;  5BVZ A;  5APT A;  2KK7 A;  1NAY A;  4EIJ A;  1FZC C;  1H33 B;  2ZJS E;  1RZ6 A;  2N9J A;  3HQ6 A;  1VF5 D;  1CSW A;  1QVG O;  1LP1 B;  3RL0 B;  1BDD A;  1L9J C;  3SLE A;  3AEA C;  1Q2N A;  3ZCF A;  3B4S A;  3RL0 C;  5KTB A;  1JM0 A;  1FZF A;  1RE4 C;  3ZOY A;  2AXT H;  3L75 E;  3L71 D;  1WRG A;  1J3S A;  2P7J A;  4HJG H;  1FJK A;  4IOI H;  2V08 A;  2H7H A;  2J5U A;  1GL2 B;  3G9R A;  2Y0E A;  4GYD A;  1LTS C;  3ZOX A;  4KJM A;  4LGD E;  2HOD A;  1NU1 D;  1OVR A;  3GF3 A;  3H25 A;  2PGD A;  3Q5R A;  4RSZ A;  2QJK B;  2FKW B;  5BU8 B;  1IJD B;  1VQ5 P;  2KS1 A;  1AOF A;  2C2C A;  4GED B;  1KFM A;  1LTA C;  3AE2 C;  3PJS K;  2WPR A;  3V2N A;  3SVW A;  5KJ7 C;  3EWK A;  5KJ7 D;  2WSF J;  2BH4 X;  3BRT B;  3JBT B;  3CXH E;  2FYU K;  4OH8 B;  3BCC E;  2AXT V;  2Q7C A;  3CU4 A;  2AXC A;  5L8R J;  2OYI C;  4I7Z C;  1H0T A;  1HH0 A;  2IBZ I;  4NPD A;  2WVR A;  1ZN5 A;  1AJY A;  2CXB A;  4HB1 A;  1AQ5 A;  1DW2 A;  1FZC B;  4YPC A;  3G4S P;  1S5L H;  3ABV C;  1HBW A;  2HV4 A;  3ZIY A;  1YBK A;  2M3E A;  2KXP B;  2WT7 B;  1SQX J;  3D0W A;  5KKZ B;  2V07 A;  5AVV B;  2A06 E;  3HUS C;  1JMB A;  3C8V A;  2MTA C;  1GU4 A;  3KHU A;  3H1J J;  2HLO A;  5CIH B;  3A0H E;  4GOD A;  1SQX G;  3VMZ A;  5CIE B;  5B5E V;  5CBO A;  3H1J G;  4PW9 B;  2HPC B;  5CCH A;  1LGH B;  5DJU B;  2B4Z A;  4QAO A;  2LKM A;  2FYU E;  1GW3 A;  3I5C A;  1CSV A;  2XDJ A;  1Z56 A;  2FWL A;  3Q2Y A;  2ZXY A;  3L74 D;  1R5L A;  1CZQ A;  2C8S A;  2J58 A;  3B5N A;  4U7J A;  2BCC J;  3SFD C;  1DW3 A;  5DFS A;  5CBN A;  1H31 B;  4GKG A;  1YTZ T;  1DIQ C;  3HD7 D;  4I6M C;  3JC2 2;  2ZZS 1;  3C9I A;  4BRY A;  4XXL A;  1SFC A;  5GTH V;  3CCE P;  2MKV A;  2YO3 A;  1AVO A;  4H0K A;  2FFD B;  1Y8A A;  3AE4 C;  3KXD A;  1JNM A;  2O01 H;  4EI2 A;  3I55 P;  1PGP A;  2KLU A;  4FA9 A;  2IPP A;  1RF1 C;  3MP7 B;  2WSE J;  1OFC X;  1BE3 J;  4CPG A;  4D6T G;  1LP1 A;  4PD4 E;  3SSU A;  1JTH B;  3D70 A;  1GU2 A;  3L73 D;  1J1E B;  5AVW B;  1A2S A;  2C9X B;  2OZ1 B;  3OJA B;  3PH0 A;  1MUU A;  2YKQ A;  5TJH A;  2LXC B;  3O6Q A;  4KHX A;  1H1O A;  2GC7 D;  2QVA A;  1IFJ A;  1GDV A;  4LLH A;  1SS1 A;  1IRW A;  2K9J A;  4FAN A;  2NZ2 A;  3KZI V;  4WWI A;  1T3U A;  1MG3 D;  3RK3 E;  1N73 A;  4K35 A;  1RE3 C;  1EDI A;  1L0N E;  2WTY A;  2XND H;  1NTM E;  2CK3 H;  3SWS A;  4NPE A;  1BCC D;  4H44 D;  2VHD A;  2W83 C;  1LTG C;  1PZQ A;  1CIE A;  5GTI V;  1H88 A;  3H1I J;  1PGQ A;  2R44 A;  3GHG C;  3RK3 C;  1LT9 C;  4Q5P A;  1GU5 A;  1YCC A;  2D0S A;  2E43 A;  1CTY A;  3HD7 B;  1HZV A;  4JBZ A;  5EXQ A;  1KB0 A;  2WSS H;  3WFD C;  5CYT R;  2XZR A;  3RLM A;  1NTK K;  5APW A;  2V7Q H;  2C1D A;  1DT1 A;  1JY3 N;  1FJ0 A;  1JOC A;  3LW5 H;  1J1E C;  3AE5 C;  3S9O A;  4D6T E;  1CIG A;  3G3Z A;  5APU A;  1LTB C;  1BCC G;  1NVO A;  1LFM A;  1NTM D;  1CSU A;  3H1K J;  2ZYG A;  1FS0 E;  1M8O B;  1YIT P;  1W5C E;  5CCG D;  2J59 M;  1T3J A;  2I8F A;  3PXT A;  1ZR2 A;  2IDB A;  1CO6 A;  1TU3 F;  3CWB G;  4IFF A;  3A2A A;  2BCN B;  5AVX B;  5AW9 B;  3VYI A;  1HGZ A;  1CNO A;  1EDJ A;  3V2P A;  4UB8 E;  1JY2 P;  2LR2 A;  4K3A A;  3L72 D;  2ZAE B;  1L4A D;  4EIF A;  3H1J D;  1KV9 A;  4P4Q B;  1CI6 A;  1SVF A;  2C9N Y;  2OYH A;  2I8D A;  3L73 J;  3HD7 A;  4EIC A;  1SQX D;  4ASW A;  3RK2 C;  2AI5 A;  1URQ C;  2M5A A;  2QM7 A;  4Y28 J;  1KB9 D;  1LT9 A;  1YYC A;  3Q3D A;  1C6S A;  1S9K D;  1IFM A;  3CCJ P;  1IRV A;  4L3G A;  3WC8 A;  3TDK A;  1U7M A;  1HH7 A;  1VPC A;  2K9J B;  1IZL 0;  2H88 C;  3H1H E;  1ZP0 C;  1H9X A;  4PD4 H;  1L0L D;  5KAI E;  2QRX A;  1SQB G;  2HYN A;  1FI9 A;  1RF1 B;  1NTM G;  2NRG A;  4XFJ A;  4DT0 A;  3L72 E;  2E5T A;  1LS9 A;  2ZBO A;  4XE5 B;  1VF5 C;  3L4F A;  4R4M A;  1MG2 D;  1N50 A;  1HUC A;  4U3F G;  1YFC A;  3N4X A;  2O1J A;  2OZ1 A;  1KIL C;  2OYI B;  1FE6 A;  1URQ D;  3SXT A;  2SPZ A;  2BEZ F;  5DJQ C;  4U3F J;  1IFN A;  3VOP A;  2CE0 A;  2W27 A;  1BGY E;  1C2R A;  1KYO W;  2AEJ A;  1NU1 J;  2YQB A;  2R32 A;  5AVU B;  1PP9 E;  1CRC A;  5AW3 B;  4H0L C;  1J1D B;  3TF5 A;  2G3A A;  1PPJ D;  2JKV A;  1EZV I;  3CCQ P;  1GTW A;  3P8C D;  3H1K E;  2CE1 A;  4GOE A;  1P84 I;  2QJP C;  1WEJ F;  1N7L A;  1HWT C;  4O1W A;  1WT6 A;  1LTJ C;  3L4M A;  3V4Q A;  1FOS F;  1COR A;  1HVV A;  2ORL A;  3AE9 C;  4WVZ A;  1KZU B;  3CXH D;  2C1V A;  5APS A;  1E8E A;  4XA4 A;  3SWF A;  1OMI A;  1G1J A;  2WMM A;  3SFE C;  2O01 J;  5TIS H;  2OTK E;  2PFX A;  2CPS A;  5AVS B;  4U3F D;  451C A;  3GF7 A;  4IL6 V;  1S5L V;  3P32 A;  1N9C A;  2WT7 A;  3HQ7 A;  3Q5S A;  3V6I A;  3CP5 A;  1QVF O;  1JB0 J;  3MK7 C;  3SWK A;  1NTM K;  1QEX A;  1NTZ G;  1KX2 A;  1VQM P;  2R3C A;  2NPS A;  4C7N B;  3L37 A;  3EFG A;  3LW5 J;  4DJG A;  1GQ1 A;  1NTZ J;  1AV1 A;  3VTP C;  2JTI B;  2B11 B;  3VMY A;  1DH3 A;  4AUW A;  3O20 A;  3RBX A;  3BVH A;  3A7O A;  3RL0 D;  1LWU A;  1VQO P;  1H9Y A;  2E75 D;  1USE A;  2KOG A;  1LTJ B;  4OGQ B;  3RMZ A;  3L74 G;  2ZT9 D;  1HF9 A;  1H31 A;  1NTZ E;  3HQ8 A;  3ZOO A;  1NKZ B;  3L74 E;  3CD6 P;  4FA1 A;  3ZDM A;  3CYT I;  2GC4 D;  4UB8 V;  2JEE A;  1P84 H;  4GDO A;  3DR0 A;  1IC2 A;  4IFM A;  1YQ3 C;  1ZV8 A;  3D6Z A;  2E76 C;  4EID A;  1MV8 A;  1HCM A;  1L9B C;  2M8R A;  3CL3 D;  1AOQ A;  3M0A A;  2GIW A;  5AW4 B;  3MZW B;  1I8P A;  2BLF B;  3MTU E;  4W7Y A;  1SQP J;  2YO2 A;  1CRY A;  5AVZ B;  2FYU J;  2ZYA A;  2O1K A;  3WUU A;  5TIS V;  4AYC A;  1BDC A;  1A02 F;  4GIF A;  1F1F A;  2YIU C;  3A0H H;  3F5H A;  5APX A;  2N3Y A;  2XV5 A;  1NTZ D;  3L73 E;  2N9Y B;  1SFC B;  3H1L J;  1LC2 A;  3H1H G;  2IBZ E;  2A45 I;  4XYD B;  1SFC C;  1GZL A;  1IFD A;  1M1J C;  1RQV A;  1JY3 O;  1FU1 A;  2E5Y A;  2N9B A;  1N90 A;  3QH9 A;  1X79 B;  2WIT A;  1GK6 A;  2JJL A;  1IFI A;  2YMK A;  2CA4 B;  2W90 A;  1PFI A;  2HOD B;  3HD7 C;  3TGU J;  3ORV A;  1N15 A;  3IR9 A;  1Y9B A;  3U1A A;  3OCD A;  2IX7 C;  3O6Q B;  1FCD C;  1KYO E;  1DVH A;  4UB6 H;  3VYM A;  1CRG A;  3H1L D;  1M60 A;  1SQQ D;  3C1L A;  2NPS B;  4C7N A;  3HUS B;  2POH A;  4KT0 J;  1SQP D;  2KNC A;  1QX8 A;  3FX0 A;  4JF7 A;  1ZRT E;  3AE1 C;  1PPJ G;  2RMZ A;  3TGU E;  4Y5R A;  1C75 A;  5CIG B;  3T97 A;  4MU8 A;  1U74 B;  1AQT A;  5GTH E;  4H0L D;  1S72 P;  1K9M Q;  3M91 A;  5AW1 B;  3MD0 A;  2KSE A;  3IF4 A;  1QLE D;  3ZBM A;  1GL2 D;  4D6T D;  2B10 B;  1OVV A;  4Y99 C;  3B8E B;  1CRH A;  2XKM A;  3L72 G;  5KLI C;  4ZMD A;  3RK2 D; 
#chains in the Genus database with same CATH homology
 3O1Y A;  3VRD A;  3SWS A;  1HJ3 A;  1BCC D;  2O3J A;  2VHD A;  1CCR A;  5KLV D;  1YIQ A;  155C A;  1KYO D;  1YIC A;  1CIE A;  5GTI V;  3OA8 B;  3CWB D;  2PAC A;  1BE3 D;  1C6O A;  1YNR A;  2CA3 B;  4PD4 D;  4Q5P A;  1NMI A;  1CIH A;  5DJQ B;  1ZRT D;  1KIB A;  1YCC A;  3PLN A;  2D0S A;  3OCD B;  3TGU D;  1CTY A;  1HZV A;  5EXQ A;  1RZ5 A;  1KB0 A;  1E29 A;  2QG4 A;  1GJQ A;  3OA8 A;  3WFD C;  5CYT R;  2B0Z B;  3RLM A;  1QYZ A;  2C1D A;  1DT1 A;  1FJ0 A;  2PCB B;  2BCC D;  3L70 D;  1CIG A;  3DP5 A;  4H0J A;  4O1Q A;  1DII C;  1LFM A;  1NTM D;  1CSU A;  1C7M A;  3CXH W;  4LJI A;  2JQR A;  1IO3 A;  2GB8 B;  1FI3 A;  1QN2 A;  4AAN A;  1CYC A;  1EZV D;  2I8F A;  3WFC C;  3M97 X;  3PXT A;  3H1H D;  3DMI A;  3PXS A;  1ETP A;  1YEA A;  4DY9 A;  1CHH A;  1OAE A;  1CO6 A;  1P84 D;  4WQ9 A;  1YTC A;  2DGE A;  2BCN B;  4FA5 A;  3PXW A;  4FB1 A;  1CNO A;  2C1U A;  1AYG A;  5CIC B;  3NBS A;  5C9M A;  3L72 D;  2PCC B;  4AAM A;  5CIB B;  2Y0D A;  4UB6 V;  2ZOO A;  4EIF A;  1I55 A;  1KV9 A;  3H1J D;  4P4Q B;  5H2F V;  1K3H A;  4L3H A;  4EIC A;  1BL9 A;  1SQX D;  2AI5 A;  1WVE C;  1KB9 D;  4AX3 A;  1C6S A;  1AKK A;  2N9I A;  2RN0 A;  2QJP B;  1IRV A;  2YK3 A;  4L3G A;  3CX5 D;  1CIF A;  3GG2 A;  1I6E A;  3WC8 A;  1QL4 A;  3TDK A;  1BGY D;  1HH7 A;  1U75 B;  2K9J B;  1IZL 0;  2FRC A;  1S6V B;  1PP9 D;  1CXC A;  1QL3 A;  1H9X A;  2N3B A;  1L0L D;  3ZOW A;  1FI9 A;  1CRI A;  1CXA A;  2Q3E A;  1NNO A;  1I5T A;  2ZON G;  5KAF V;  3RN0 A;  3GW6 A;  4NFG B;  3C2C A;  1A56 A;  1LS9 A;  3FWL A;  4AAO A;  2ZBO A;  4EDF A;  1CED A;  1MG2 D;  4K3I A;  1N50 A;  1W5C T;  1CHI A;  1YFC A;  2BH5 X;  4V2K A;  2OZ1 A;  1LMS A;  4YE1 A;  3SXT A;  4N0K A;  5DJQ C;  1E2R A;  1RAQ A;  3PH2 B;  2CE0 A;  1LC1 A;  3A9F A;  5KAI V;  2DVH A;  1B7V A;  1DVV A;  1NTK D;  1C2R A;  1KYO W;  1CRJ A;  4L1Q A;  2YQB A;  5KLI B;  4WQA A;  5C0Z A;  4WQB A;  1CRC A;  3TF5 A;  1IQC A;  1PPJ D;  1H32 B;  4WQD A;  1H33 B;  351C A;  2YIU B;  1SQV D;  3A0H V;  1RZ6 A;  2CE1 A;  2N9J A;  3HQ6 A;  1CSW A;  1WEJ F;  4O1W A;  1L9J C;  3SLE A;  2KNC B;  3ZCF A;  3L4M A;  1OCD A;  2YCC A;  1F1C A;  1COR A;  2ORL A;  3CXH D;  2C1V A;  3ZOY A;  1E8E A;  3L71 D;  1J3S A;  3RN1 A;  3WFE C;  2V08 A;  3PTZ A;  3VNW A;  2Y0E A;  4U3F D;  3O5C A;  3SJL A;  1CC5 A;  1NML A;  451C A;  4IL6 V;  1DW1 A;  1S5L V;  2B12 B;  4GYD A;  3ZOX A;  1N9C A;  3HQ7 A;  2BPB B;  1NU1 D;  3WUI A;  3CP5 A;  5IY5 1;  3MK7 C;  4RSZ A;  2QJK B;  4WQ7 A;  4J20 A;  1HJ4 A;  1KX2 A;  3H1K D;  1AOF A;  2KS1 A;  2LIR A;  2C2C A;  4GED B;  1C52 A;  3WFB C;  2L4D A;  1GQ1 A;  3SVW A;  2A06 D;  1M6Z A;  4FA4 A;  1YEB A;  2D0W A;  2JTI B;  2BH4 X;  2B11 B;  4PWA A;  1CHJ A;  1H32 A;  2BGV X;  3O20 A;  3JBT B;  3L75 D;  5B66 V;  3NBT A;  1COT A;  5B6Q A;  2AXT V;  1MZ4 A;  1H9Y A;  3CU4 A;  2JWA A;  2C1D B;  1M70 A;  2LIT A;  1CTZ A;  3RMZ A;  2FYU D;  3TYI A;  1H31 A;  3MK7 B;  1ZZH A;  4WQC A;  2L91 A;  4EIE A;  3HQ8 A;  3ZOO A;  2CXB A;  2MHM A;  4FA1 A;  2QJY B;  3CYT I;  3O0R C;  1CYJ A;  2GC4 D;  4UB8 V;  1DW2 A;  5E79 V;  1VYD A;  1HRO A;  2HV4 A;  3ZIY A;  3DR0 A;  3PHL A;  1C2N A;  1HZU A;  1W2L A;  2Y0C A;  5KKZ B;  2V07 A;  4EID A;  1FHB A;  1HCM A;  1L9B C;  2MTA C;  3KHU A;  1AOQ A;  2GIW A;  5CIH B;  1I8P A;  2BLF B;  5DF5 A;  3L4O A;  5CIE B;  3BCC D;  5B5E V;  1CRY A;  1HJ5 A;  1I8O A;  1R0Q A;  4JCG A;  4PW9 B;  5TIS V;  1H33 A;  2B4Z A;  4QAO A;  1K3G A;  1F1F A;  2N3Y A;  1DW0 A;  1CSV A;  2FWL A;  1NTZ D;  4WQ8 A;  2N9Y B;  1SQB D;  2ZXY A;  3L74 D;  4RJT A;  1LC2 A;  2C8S A;  3A0B V;  4XYD B;  1NIR A;  1CCH A;  1JDL A;  1DW3 A;  5DFS A;  4FAV A;  1H31 B;  4AAL A;  1RAP A;  1N90 A;  3HQ9 A;  1DIQ C;  2ZZS 1;  4XXL A;  3VMA A;  2FYN B;  2CA4 B;  4WQE A;  5GTH V;  1I54 A;  3H1I D;  1QKS A;  4H0K A;  1L0N D;  1GKS A;  3NWV A;  3X39 A;  3ORV A;  1N15 A;  1C6R A;  3CX5 W;  3PRJ A;  2XTS B;  3OCD A;  4A7P A;  4PJ0 V;  1FCD C;  4FA9 A;  1I6D A;  1DVH A;  3VYM A;  1CRG A;  3H1L D;  1M60 A;  1SQQ D;  2AIU A;  3WU2 V;  1KX7 A;  1GU2 A;  1CYI A;  1SQP D;  3L73 D;  1A2S A;  2EXV A;  2C9X B;  2OZ1 B;  1GIW A;  1CTJ A;  2RMZ A;  4KMG A;  1FI7 A;  5TJH A;  2IBZ D;  4Y5R A;  1C75 A;  5AUR A;  5CIG B;  4MU8 A;  1U74 B;  1CSX A;  3ITK A;  1H1O A;  2GC7 D;  2N18 C;  1GDV A;  1HRC A;  1IRW A;  5CIF B;  4FAN A;  1FOC A;  3ZBM A;  2N18 B;  3KZI V;  4D6T D;  1EB7 A;  2B10 B;  1MG3 D;  1CRH A;  5CID B;  1A8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...