2QJKB

Crystal structure analysis of mutant rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Cytochrome b
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 65
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjkB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjkB02
3SLEA 2AI5A 3H1LD 4FANA 4IL6V 2D0SA 3WC8A 3WU2V 3PTZA 1YFCA 1OCDA 3CXHD 3WFDC 1QN2A 3PXWA 4UB6V 4L3GA 4FB1A 1AYGA 3L72D 3ZOWA 1MG3D 1CORA 351CA 2BH4X 2N18C 1BGYD 3X39A 5TJHA 3H1JD 1QL4A 1C6RA 3VRDA 1RZ6A 3L70D 4EIEA 1P84D 2L91A 3SWSA 2FRCA 2MHMA 2PCCB 1CEDA 5EXQA 4DY9A 1FI7A 2Y0EA 4O1QA 1COTA 1CCRA 2C1DA 3PXSA 3NWVA 1H1OA 5TISV 1KX2A 1ETPA 1HZUA 4QAOA 3HQ8A 3SJLA 1GU2A 1OAEA 1YCCA 4WQ7A 1KYOD 4AALA 4XXLA 3A0BV 2GIWA 2RN0A 2QJYB 1M6ZA 2VHDA 1A8CA 2PACA 5GTIV 1AOFA 4AAOA 1CRYA 1N50A 5DJQC 5DJQB 4H0JA 4L1QA 1CIHA 1YTCA 3H1KD 1RAPA 3PHLA 3HQ9A 3SVWA 3WUIA 1HZVA 3KHUA 2Q3EA 451CA 4WQBA 1N15A 5KAFV 1VYDA 4WQ8A 3RMZA 3ZOYA 1FOCA 1H33A 5GTHV 2YK3A 1SQVD 3DP5A 1NNOA 1HH7A 2BLFB 2N3YA 4WQAA 1QKSA 3NBTA 1FI3A 4GEDB 1ZZHA 1H31A 1JDLA 1IRVA 1M60A 4WQCA 2CA4B 1E8EA 1CHIA 3A0HV 1GIWA 1U74B 1CTZA 4EICA 1CSXA 5KKZB 3NBSA 4PWAA 4XYDB 5CIBB 1DT1A 5AURA 1C6SA 1LFMA 1S5LV 1IRWA 1C2NA 3CX5D 1IQCA 1H32A 1M70A 4AAMA 3HQ7A 2N9JA 1KB0A 1I6DA 2Y0DA 1I6EA 2ZOOA 3ZOXA 3VYMA 1E29A 2BH5X 3OA8A 4RJTA 4AX3A 1WVEC 1CYCA 1CIEA 2OZ1B 2MTAC 1N9CA 1CYJA 1C2RA 5B5EV 2YQBA 2YCCA 3FWLA 1B7VA 4FAVA 3CWBD 2V08A 4JCGA 3O0RC 1HJ3A 3JBTB 3KZIV 3WFEC 1GJQA 4J20A 4EIFA 1I8OA 1S6VB 1PPJD 2C9XB 1FI9A 2HV4A 1PP9D 2CE0A 1CYIA 3CU4A 2ZXYA 4V2KA 3ZBMA 1IO3A 3PRJA 2N3BA 3PH2B 1C52A 3H1ID 5CYTR 2CXBA 3H1HD 2FWLA 5KLVD 1L0LD 2B0ZB 1CRHA 3OCDB 1RAQA 5DF5A 4PD4D 5C0ZA 1HJ4A 2QG4A 1R0QA 4N0KA 2EXVA 4FA4A 2C8SA 1CSVA 2CE1A 4Y5RA 2GC4D 2QJPB 1HROA 4AANA 1W5CT 5CIEB 1H9YA 3L75D 1LC1A 2L4DA 1SQQD 2FYNB 1KB9D 1HCMA 4GYDA 1DW1A 4Q5PA 4U3FD 5B66V 3CXHW 5KLIB 1W2LA 1BCCD 5CIFB 2FYUD 2PCBB 2QJKB 5CIGB 2DVHA 1CRJA 3OA8B 1HRCA 4K3IA 3L4OA 1KX7A 2JWAA 3ZCFA 1BE3D 4RSZA 3MK7C 2N9IA 3MK7B 3DR0A 5CICB 1LC2A 5C9MA 2KS1A 3ORVA 1YEAA 2CA3B 2GC7D 2ORLA 1NMIA 2DGEA 2XTSB 1AKKA 5CIHB 4O1WA 5H2FV 2B4ZA 2AXTV 1IZL0 1L0ND 4LJIA 4YE1A 2IBZD 2C1DB 2LITA 4WQDA 4PJ0V 3GW6A 1LMSA 4PW9B 1KYOW 5IY51 4H0KA 3ZOOA 1MZ4A 2Y0CA 3WFCC 4EDFA 5E79V 2RMZA 3DMIA 2K9JB 2D0WA 3A9FA 2ZZS1 2BGVX 3GG2A 4A7PA 1BL9A 1SQXD 5DFSA 1F1FA 1EB7A 3RN0A 3TDKA 2C1UA 1MG2D 1WEJF 1NMLA 4EIDA 1RZ5A 1CIGA 1DW3A 1CIFA 3TF5A 1CRGA 5CIDB 1KV9A 2N18B 1NIRA 2ZBOA 1C6OA 1YICA 1LS9A 3HQ6A 1C7MA 1NTKD 1L9BC 1U75B 1YEBA 1N90A 1K3HA 2AIUA 1GQ1A 4L3HA 1K3GA 1FHBA 1CC5A 1H33B 3L71D 3O5CA 1I54A 2C2CA 3RLMA 1NU1D 4UB8V 1E2RA 1H31B 1CXAA 2BCNB 2OZ1A 2LIRA 5B6QA 2V07A 3SXTA 3CX5W 3PLNA 1SQPD 3VMAA 2KNCB 1GKSA 5KAIV 2B11B 2N9YB 3RN1A 1CHJA 1DIIC 3L73D 1AOQA 1QYZA 1CO6A 4KMGA 4NFGB 1H32B 2B10B 1FCDC 3ITKA 3ZIYA 2I8FA 1DW2A 1CTJA 2GB8B 1CRIA 1CRCA 4FA1A 4FA9A 1I5TA 3CP5A 3C2CA 155CA 1CSUA 1CHHA 1YNRA 2B12B 1CSWA 1GDVA 2BCCD 3BCCD 4WQEA 4FA5A 1A2SA 3PXTA 2ZONG 3TYIA 2BPBB 1NTZD 1SQBD 3VNWA 1L9JC 1ZRTD 1CCHA 3OCDA 2A06D 3M97X 4P4QB 2YIUB 4MU8A 1CTYA 3L4MA 2JQRA 3CYTI 1QL3A 1CNOA 1YIQA 4WQ9A 1DIQC 1I55A 1DVHA 4D6TD 1C75A 1J3SA 1A56A 3WFBC 2O3JA 1FJ0A 3O1YA 1DVVA 1I8PA 1H9XA 2JTIB 1HJ5A 1EZVD 3TGUD 3L74D 1CXCA 3O20A 1F1CA 1DW0A 2C1VA 1NTMD 1KIBA
chains in the Genus database with same CATH superfamily
3SLEA 2AI5A 4H44D 1PGOA 1LP1B 3WU2E 4FANA 2KSJA 3WC8A 1FC2C 1N7LA 3G4SP 2PAJA 3L70E 1P84E 3CXHD 2O01H 4OH8B 4UB6V 1KORA 3U1AA 1IFIA 3ZOWA 1MG3D 1CW5A 1MKMA 351CA 3AE1C 1BGYD 5TJHA 3H1JD 1QL4A 1SS1A 2OTLP 2A45G 1LGHB 3SWSA 4WY4B 2FRCA 3CLQA 4PD4I 2YKQA 3V6IA 1KYOH 2QRXA 1BE3G 1KFMA 2Z5IA 4UB8H 5TISH 3P8CD 3GHGA 1FI7A 1AFOA 2JEEA 3S4RA 1COTA 2C1DA 3PXSA 3NWVA 1KX2A 2H7HA 1FZBA 3SJLA 1M56D 3A0BH 2P1JA 5GTIH 3S1KA 1RF1C 1DD3A 2GIWA 2QJYB 2M5AB 2C0XA 1LWUB 1KFNA 2PACA 4N3YB 4AAOA 1N2DC 2NPSB 4JBZA 2GM4A 1YTCA 1RAPA 3WUIA 3KHUA 4I7ZB 2N9BA 5CCHD 2L5GB 2KZIA 1G1JA 3RMZA 3ZOYA 4YTPC 2YK3A 1L4AA 3V2QA 1YQ3C 2QSIA 3H25A 3A0HH 2N3YA 1GL2A 1BGYG 3U59A 1QKSA 3CI9A 4GEDB 3CX5E 1H31A 3EFGA 2CA4B 1LT9B 1PGQA 1CTZA 4EICA 1E5WA 5KKZC 3NBSA 1NOHA 3MGNA 1S5LE 1LFMA 3RK3C 3CXHE 2ZXXA 1IQCA 1OVVA 2N9JA 4PV1D 1N7SC 3EQ2A 2PRRA 1I6EA 2ZOOA 2D2CC 3CD6P 2VRSA 1VDFA 3L73G 1FZGA 5B5EE 1N9CA 3N7NA 2O1KA 3P8CE 3HUSC 4H13D 2QVAA 2E75C 3CWBD 2V08A 1SFCC 3V2PA 3O0RC 2WZ7A 2P10A 4L74A 2ZJSE 1NTKJ 3WFEC 2HODA 3BCCG 1I8OA 5APYA 1XTGB 3OAKA 4HYTB 1S6VB 1PPJD 4XFJA 1FI9A 5KLVJ 1PP9D 4PD4E 1EQ7A 4C7RA 1IO3A 4NPDA 2G3AA 1KB9I 1MFZA 2B87A 5CJ4A 3HD7D 5KLVD 1CRHA 3OCDB 1RAQA 3V2NA 1KQSO 4ZKUA 3H32A 4C7NA 2K3RA 1R0QA 4N0KA 1R5SA 4FA4A 2C8SA 3TGUG 2CE1A 3L74G 4Y5RA 2GC4D 3B4SA 1HROA 1JM0A 3Q5SA 1HGVA 1W5CT 2L4DA 2ZYDA 1KB9D 1J1DC 1BDCA 4O9BA 3B71A 2DW3A 2J59M 3L4FA 5B66V 1BCCD 2Q6QA 1LTGC 1M8OB 1FZCB 2QJKB 3M0DC 3CCRP 3V4QA 1CRJA 1NTZJ 1MZ9A 1HRCA 1SQBJ 2E74D 4BRYA 4RSZA 5AVTB 1W5CE 1LC2A 4DOJA 2YO2A 4TLFA 2E76C 1HJBA 3ORVA 1VQLP 1VQ8P 1VQPP 2XTSB 4D6TJ 4W80A 4YXDC 2KSEA 1RF1A 2IYOA 1AKKA 2K9YA 1MV8A 3T97A 1HWTC 1HH0A 1LTIC 5APSA 1JY2N 5CCGC 1KILC 2I1KA 4WQDA 1IJDB 1LT1A 3GW6A 4PW9B 2LR2A 2OYIA 3AE5C 5IY51 1FZFA 1MZ4A 2Y0CA 4DCKA 2K9JB 1YQ4C 2B87B 2HLOA 4IFDK 3TYYA 3A9FA 1OW6A 1XTCC 1AVYA 5AVWB 1AV1A 2IZ1A 1JO5A 1SFCD 1NTKE 3CCQP 2C1UA 4JYCA 3H1KG 1S2EA 1WEJF 3KZIE 1KTMA 1NYHA 1DIPA 1NTKK 1RZ5A 1CIGA 1DW3A 5KLVE 1TU3F 5CIDB 2W6JH 3M0AA 4WWIA 3TNUB 1YICA 1C7MA 2HR3A 1BCCG 4Y99B 1N90A 2V4HA 1K3HA 1HGZA 3HE5B 3I55P 1FDMA 4DT0A 1CC5A 1NU1J 4M3LA 1PIXA 3L71D 1JY3P 4HJGH 5M1BA 1VPCA 3JSVC 1N7SA 1NU1D 3CCUP 2XZRA 5KAIH 2Z4EA 4KJMA 4MN4C 2OZ1A 5B6QA 3RL0D 2FFDC 3VTPC 2B11B 1G2CB 3HUSA 4IL6X 1QYZA 1USDA 1K8AQ 2B10B 1FZAA 2XV5A 4DJGA 2I8FA 3LIDA 4W7ZA 1CTJA 1LTJC 1NTZE 2QM8A 1SQBE 1GK6A 2QA4P 1I5TA 3CP5A 4JF7A 2OYIB 155CA 2W8ZA 2OQQA 1PGPA 1JMBA 1NTZK 2ZVOB 1SQVJ 1SQBK 4FA5A 1PL5A 3F89A 2ZONG 3TYIA 4R4LA 5AW7B 1S3JA 1EZVI 1L9JC 1M1JC 1ZRTD 4D6TE 3B5NB 2AEFA 1CI6B 2YIUC 3L4MA 2JQRA 2WSFH 1QL3A 1CNOA 1YIQA 1OW7A 1QVFO 4IFFA 2AXTE 4WQ9A 1I55A 3H1IG 3F5HA 1KILD 3WFBC 3H1LE 2Q9IA 1YJNP 2N1TD 1I8PA 1HJ5A 1EZVD 1RE4C 2R5DA 3RK3B 5AW4B 3USSA 2NZ2A 1NTMD 1HJ0A 1P84I 5CMZA 1YITP 3L72E 4H44C 1OX3A 3M0DA 1ZP0C 2WITA 4UB6E 1OCDA 3I56P 2YKOA 4CPGA 1SQQG 3L70J 1AYGA 3VOPA 3X39A 3NFQA 3VRDA 1RZ6A 3L70D 4EIEA 2E75B 1P84D 1NU1E 2FYUG 1IZNB 4I2LC 2MHMA 2KXPB 2PCCB 1NU1K 3M91A 1CEDA 1OWAA 4EI2A 3HTKA 1JNMA 4O1QA 5CCGA 1CCRA 1KILA 5TISV 3AE2C 4R4MA 1ETPA 1HZUA 1YCCA 3D6ZA 4WQ7A 1FJPA 1R5LA 1OMIA 3A0BV 2MJZA 3M9BA 2VHDA 1T3JA 2IBZG 3L75J 5GTIV 2NPSD 1Q2NA 2FKWB 5DJQC 1GW3A 1CIHA 3VP8A 1Q7YQ 1SQVE 3PHLA 2OYHC 1HZVA 1T3UA 2Z5HA 3IAOA 1SQXG 451CA 3WUTA 4WQBA 1KN7A 3Q2YA 1N15A 5KAFV 1SQVK 1HTLC 1VYDA 2J5UA 5CCHC 2O01N 4H0LB 1H33A 2XNDH 3CX5I 3DP5A 2BLFB 3NBTA 1FI3A 1BDDA 3OJAB 1IRVA 4WQCA 3BRTB 3A0HV 2IYPA 1U74B 1CSXA 4HH2A 3G3ZA 2FFDA 2M8RA 3V2RA 2WSEJ 1RF0C 1UIIA 3CX5D 1H32A 4LC1A 3HTKB 4PV1C 4IL6E 1KQLA 1KB0A 1LTJA 1SVFA 2W90A 3GF7A 1E29A 2BH5X 1QL2A 2M3EA 4RJTA 2PP6A 1WVEC 1T8ZA 2QM7A 2V7QH 3SWFA 2AXCA 1CYJA 1C2RA 2YCCA 1CSBA 1M1JA 4H13C 2OTJP 1B7VA 4JCGA 2KOGA 1NJIQ 3JBTB 2BCCG 4EIFA 4JYBA 1L0LE 4BXLA 3H1HJ 2LKMA 3KXDA 3NMDA 1URQB 1JMMA 1ZW0A 3PRJA 3PH2B 1C52A 1L0LK 1FDOA 2Q1KA 3SWYA 2XDJA 1RE4A 3O6QA 3H1HD 4EIJA 2FWLA 1JEKA 3HD7C 2B0ZB 1KB9H 2AEJA 3CCEP 1H0TA 1MFTA 3L75E 3WMM0 3KQGA 5DF5A 3HE4B 4PD4D 3CL3D 3II6A 1L2PA 3Q5RA 1H88A 5C0ZA 5AW6B 1JY3O 3OW2O 3L73J 2JJLA 2KZJA 3C9IA 2QJPB 5CIEB 5KAFH 1R8EA 2WSCJ 3G71P 2FYNB 3CC7P 1HCMA 2JO1A 5B66E 1BE3E 5KLIB 3RBXA 2PGDA 3H6PA 5GTHE 1N73C 1FOSE 5CIFB 3BCCJ 1IFPA 2XU6A 2WWWA 1KQGB 1PGJA 4W7YA 4K3IA 3L4OA 2O1JA 3H1JG 2E74C 1KX7A 4OVNF 3JCUH 4AUWA 2N9IA 3MK7B 1IFNA 1EXJA 2CA3B 4RO0A 2ORLA 2KB7P 2DGEA 1NVOA 5APTA 1L0NJ 2J58A 5CJ0A 1PV3A 5H2FV 3L74J 2BEZF 3GHGB 1L0ND 4YE1A 5AVVB 1HBWA 2C1DB 2LITA 3RK2B 4PJ0V 1KYOW 1KC8Q 3ZOOA 3WUVA 2OYHA 3O6QB 2H88C 4EDFA 5E79V 5AW9B 2FY8A 3N4XA 2WSSH 1VF5D 5CCHA 2ZZS1 3GG2A 2OARA 1H0TB 4H44B 1JB0J 2JR8A 2R3SA 3FWNA 1F1FA 1MG2D 1J1EB 4N78E 4I6MC 3H1HE 1VQOP 1VQ7P 1NIRA 2ZBOA 2O01J 3VMXA 1NTKD 1U75B 2QIWA 1NKZB 2AIUA 2R44A 1RF0A 1FHBA 3P8MC 1RQUA 1L4AB 5AVXB 3O5CA 4OGQC 1KD1Q 4GIFA 1GL2B 3JC22 1SQPJ 3L73E 2FXOA 1E2RA 1H31B 3C8VA 3SXTA 1VQNP 2P58A 3PLNA 1SQPD 1HUCA 3RL0C 1VQ4P 2XKMA 1DH3A 2SPZA 5KAIV 2OGUA 2N9YB 3RN1A 1IFDA 5AW8B 1DIIC 2UWJE 3LIEA 3H1KJ 3BCCE 2B88A 4GOEA 1OIPA 1X0TA 2H8PD 1NAFA 1KZUB 1JTHA 4FA1A 1OZHA 3C2CA 4L76A 2A06E 1GU4A 3FGAD 4AYCA 2R5BA 1Q82Q 2E5YA 3V4WA 3CWBG 2IX7C 2ZT9B 1NTZD 3L36A 5KJ7D 1SQBD 1L0NE 1OXZA 3HD7A 5H2FH 1DD4A 3S9OA 3M97X 4P4QB 1KMIZ 1CTYA 1KV4A 3L74E 2OTKE 1PPJG 1NWQA 1L0NK 2HODB 1NKNA 1PP9G 2M0BA 4PJ0H 4WB4A 3FX0A 3L35A 4N6JA 2GUSA 4D6TD 1C75A 3IF4A 5E79H 1FJ0A 2G8YA 3O1YA 5KLVG 2N1TC 3H1LJ 1AQTA 2FBWC 3WU2H 3A2AA 4QMAA 1OFCX 3H32B 4C7NB 3H1LD 1N73A 1P84H 3MTUE 3L72J 3PTZA 5C39A 1YFCA 3WFDC 1K9MQ 4JPZB 4L3GA 1EXIA 4FB1A 3L72D 4GT1A 1CORA 2BH4X 2ITAA 3LW5H 1PFIA 1C6RA 3O8ZA 2HPCA 2L91A 3CC2P 1SQPE 4OGQD 3H1IJ 4DY9A 1JCCA 1KYOE 2GUVA 1S9KE 4UB8E 5TISE 4BRYB 1SQPK 5AVQB 3M9HA 1H1OA 2HFED 1LNQA 1M7LA 1USEA 3CCLP 1NO4A 3H1KE 3NTNA 3A0BE 4XXLA 5KTBA 1YTZT 1Y8AA 2QJYC 1GU5A 1RF1B 1LWUC 1AVOA 1JY2O 4XA4A 5GTIE 1D7MA 1A8CA 1SFCA 1K05A 1AOFA 3T97B 3CMEP 1SQQJ 2NPSC 1SP4A 4H0JA 2ZXEB 2YKPA 4U3FJ 5CHXA 5DJTB 1LTAC 1FZEA 2YXQB 1QEXA 3Q5PA 3HQ9A 3SVWA 4I7ZC 2Q3EA 2FXMA 1KQFB 3Q3DA 1U7MA 3CC4P 3HRNA 4H0LD 1JCDA 1X8YA 1X79B 4ASVA 4K35A 1SQVD 1JUNA 2C9NY 3CX5H 1IK9A 3RK3E 1VQKP 1VL2A 1E8EA 3A0HE 1LT9C 1CHIA 3MIWA 1Z56A 1GIWA 2W6BA 1S5LH 3BATA 2IFMA 3CXHH 5KKZB 3L71G 4PWAA 4XYDB 5CIBB 3EFFK 3KDPB 1DT1A 5AURA 5AW0B 1C2NA 4BWNA 1HVVA 1NU1G 4K3AA 2ZVNB 1YI2P 1N7SB 2Y0DA 4RESB 3ZOXA 1LTTC 3CCSP 2D2CB 3VYMA 5B5EH 3OA8A 5CBNA 2IPPA 2OZ1B 3AE4C 2MTAC 3SFEC 4HKZH 1Y47A 2E42A 3FWLA 3HUSB 1VQ6P 1GW4A 4WY4D 4FAVA 1SFCB 1HJ3A 3H1IE 3KZIV 1GJQA 4PD4H 4TT3H 5APVA 2WPRA 4L73A 1M1KQ 1URQD 2HV4A 1CYIA 2BEQD 2ZXYA 1L0LJ 4V2KA 3ZBMA 2KLUA 2R32A 1SQVG 3GLMA 2N3BA 4OWFA 2CPSA 5CYTR 2N1TA 3IN6A 2M3BA 1L0LD 3E1IA 1LP1A 3U1CA 1LJ2A 1SQQE 3QWOC 2A45I 4U3FE 2EXVA 1CSVA 1SQQK 1EZVG 1OVRA 4AANA 1GK4A 1NTMG 4AQRD 1H9YA 3L75D 5AVYB 3KPEA 1UIXA 1IO4A 1NHLA 1J1DB 2FYZA 1DW1A 2WTYA 3CXHW 2BCCJ 1BE3J 1FZCC 2QJKC 3OA7A 5CIGB 3FXEA 3OA8B 2JKVA 2LXBA 2JWAA 3ZCFA 1BE3D 1FAVA 3EWKA 2XNXA 3L70G 1Q86Q 3DR0A 5CICB 1ZLLA 1EDKA 5BU5A 3VMYA 2E76B 4Y28J 2KNCA 1H89A 2KS1A 1RHZB 2GC7D 2IBZE 4C46A 3A5TA 5H2FE 1LWUA 1FU1A 5CIHB 4O1WA 2NPSA 3P32A 2AXTV 1IZL0 1EDLA 4LJIA 3RK2D 1RE3C 1JY3N 1SQXE 1KILB 1LMSA 2WSFJ 1T2KD 4H0KA 3WFCC 5CBOA 1SQXK 2RMZA 3AEDC 3DMIA 4ZKPA 4GOFA 4YXWH 2D0WA 1VF5C 1K73Q 3CCJP 1ZXGA 1GTWA 3KZIH 1QGKB 2K1AA 1MUUA 3R2PA 1EB7A 1GDTA 3RN0A 1BGYJ 3UIAA 3L75G 3H1JJ 4GKGA 3D70A 4EIDA 3AEFC 1CIFA 1GD2E 3TF5A 1LT9A 1CRGA 1KV9A 1AA0A 1IFMA 3M06A 1C6OA 4NPEA 1LS9A 3HQ6A 4Y99C 2H43A 3G6EP 2KLVA 1YEBA 4N78D 2Q7CA 2K88A 1QX8A 3M9QA 4L3HA 4NPFX 1X22A 1L4AD 1H33B 1JY2P 3G9RA 1GL2D 1OVUA 5APXA 2RH0A 3RLMA 3AEGC 3KYQA 2I1JA 5BU8B 1CXAA 5AVRB 2LIRA 3CCVP 2KNCB 5KAIE 2KS1B 2FFDB 1Y9BA 3L73D 1AOQA 1X9VA 3TK1A 1H32B 2OYOA 1FCDC 2BCCE 1QVGO 1DW2A 4KT0J 2AEMA 3SWKA 3IFMA 1LTJB 1CRIA 1S4XA 2OYIC 3W67A 3V5BA 2RKLA 3E1RA 1CHHA 2JP3A 1M57D 5APQA 1YNRA 2B12B 1CSWA 3BCCD 4HB1A 1A2SA 3MHVA 2ZT9D 1NH4A 1ZR4A 2BPBB 3W68A 4B86A 5KJ7C 1M1JB 2WPVB 2FXPA 3B5NC 3OCDA 2A06D 2YIUB 2AXTH 4MU8A 2BASA 4GODA 1T6AA 3CYTI 2E43A 2C0WA 1FOSF 3PJSK 3TGUJ 1DIQC 1HF9A 3R4YA 3H1HG 2O3JA 2P67A 1DVVA 2ZAEB 1H9XA 3A3YB 3TGUD 3L74D 3D71A 1NGMB 2JDIH 3P7KA 1VQ9P 1BGYE 1LTSC 4UB6H 3H1JE 1FZCA 4IL6V 2D0SA 3WU2V 1WMKA 1WRGA 1QN2A 3PXWA 3C1LA 3AE7C 2YMYA 3CWBJ 2C9LY 2N18C 3AECC 1U57A 3VYIA 1H8AA 3IR9A 2V7QJ 1KYOI 3AEBC 1PP9J 4IFMA 4LLHA 2W27A 3WUUA 2B89A 5EXQA 1EC5A 1E79H 1A02J 2Y0EA 2W83C 1G1IA 1RE3A 2YO3A 3GMAA 3QH9A 3AEAC 2A06G 4GDOA 4WVZA 4QAOA 4JQ0D 3HQ8A 1GU2A 2K9JA 1OAEA 1KYOD 2KIKA 4AALA 4IOIH 5EFWB 1S9KD 1QLED 2LXCB 2RN0A 1L0NG 1M6ZA 1CRYA 1N50A 5DJQB 4XE5B 2NRGA 4L1QA 3GF3A 1Q81Q 1ZMEC 3A7OA 3H1KD 4ZNCA 1BCCJ 2OYHB 3TNUA 1S1CX 2YNYA 1YTZI 3MUDC 2Y9ZA 3HE5A 1BSNA 4WQ8A 4H0LC 5L8RJ 1N86A 1FOCA 3B5ND 5GTHV 1W2BO 1NNOA 2WPQA 1QL1A 1HH7A 3BASA 4WQAA 5APUA 3TGUE 1YJWP 1WT6A 1NTKG 1ZZHA 1JDLA 1M60A 3RBZA 2B9BA 3SFDC 2E5TA 2ZYAA 5AVUB 4ASWA 3AE3C 1FDIA 1S72P 1C6SA 1G2CA 3RK3D 3D0WA 3E7KA 1S5LV 1IRWA 4LGDE 2ZFCA 1M70A 4AAMA 3HQ7A 4IL6H 5AW5B 2KI7B 2QE7H 4PV1B 1N7SD 1I6DA 2D2CD 1SQPG 1LTBC 3CWBE 4AX3A 1CYCA 3CMAP 1CIEA 1FS0E 2WQYC 1M90Q 1ZN5A 2R3CA 5B5EV 2YQBA 2ZYGA 1VF5B 2E75D 5KJ7A 3CPWO 1PPJE 4H13B 3B5NA 5APWA 2MKVA 1PP9E 1CI6A 4WY4C 4L75A 1FBMA 3AE6C 5AW1B 1ZV8A 2WT7A 1JTHB 1IFJA 4J20A 3NXSA 2QEXP 1EDJA 1OW8A 1GMJA 2Q3IA 2WMMA 1J2JB 2C9XB 2Y9YA 1NTZG 1AJYA 3L71J 2CE0A 3CU4A 1SQBG 1URQC 5KLVK 3H1ID 2CXBA 4WBAA 4RKUJ 1CZQA 1W2EA 2KYVA 3RGUA 3HD7B 3PH0A 1EDIA 4EYYQ 1BSHA 1KB9E 4D6TG 3VMZA 1HJ4A 2A45H 2QG4A 1DEBA 2I8DA 1A02F 1IK7A 2QJPC 1BCCE 1LC1A 5B66H 1SQQD 2FYNC 3BRVB 5AVZB 4GYDA 2FYUJ 2HYNA 3H1LG 5KAFE 4Q5PA 5GTHH 4U3FD 2YMKA 5KLIC 1W2LA 1FJKA 1N73B 2FYUD 1U7JA 2PCBB 1ZR2A 4DZOA 2DVHA 3L72G 1RQVA 3AEEC 1Q90D 1NAYA 1FE6A 2E74B 2IBZI 3D6YA 3MK7C 2WSEH 3JCUE 2E76D 5C9MA 4U7JA 1YEAA 1NMIA 2HPCB 2GA1A 2HG5D 3I5CA 2WT7B 2YXRB 2B4ZA 2PFXA 3GHGC 4EOTA 1DX7A 5CCGD 1NTMJ 2K37A 2IBZD 3RK2C 2IZ0A 3FXDA 2W6AA 1T2KC 1SQXJ 3MUDA 5AW3B 1ZOYC 2BGVX 4A7PA 1BL9A 1SQXD 5DFSA 2KP8A 3BVHA 5AVSB 3RL0g 1YYCA 3TDKA 5AW2B 1J1EC 1GZLA 2CK3H 3K5BA 1NMLA 1YJ9P 3TSIA 3ABVC 3L71E 4U3FG 2H89C 1AQ5A 5K5GB 2N18B 2KUBA 1N8RQ 1L9BC 1VQMP 1GQ1A 2WVRA 2WPSA 1K3GA 3LW5J 1L4AC 1IC2A 1I54A 4OGQB 1GL2C 3MD0A 1K04A 2C2CA 2Q5UA 2JWDA 3B8EB 2WSCH 4ZMDA 4UB8V 1RY3A 2BCNB 1S5LX 2V07A 3L37A 3CX5W 4YPCA 3VMAA 3RL0B 1GKSA 2FYUE 4I1LA 1CHJA 1DEEG 2IDBA 1SLQA 1CO6A 3SSUA 4KMGA 3AE8C 4NFGB 2FYUK 4WY4A 4Z1MH 3ITKA 4KHXA 3ZIYA 1JOCA 2GB8B 5DJUB 1CRCA 4FA9A 1ZRTE 1VQ5P 1CSUA 2CPBA 2BCCD 1GDVA 1URQA 3VP9A 1RH5B 4WQEA 3PXTA 2ZT9C 3VNWA 3MZWB 1KILE 1CCHA 1YHQP 1YBKA 2POHA 3HE4A 2IFNA 1EZVE 2M5AA 1NTME 3AE9C 3CXHI 3MP7B 3Q1MA 1DVHA 1J3SA 4PJ0E 1A56A 1PZQA 2P7JA 3PP5A 1NTMK 2JTIB 1L0LG 2N1TB 3ZDMA 5E79E 1CXCA 3O20A 1F1CA 1YIJP 3CCMP 1DW0A 2C1VA 3VN0A 1KIBA 5BVZA 2KK7A 2P2UA
chains in the Genus database with same CATH topology
3SLEA 2AI5A 3H1LD 4FANA 4IL6V 2D0SA 3WC8A 3WU2V 3PTZA 1YFCA 1OCDA 3CXHD 3WFDC 1QN2A 3PXWA 4UB6V 4L3GA 4FB1A 1AYGA 3L72D 3ZOWA 1MG3D 1CORA 351CA 2BH4X 2N18C 1BGYD 3X39A 5TJHA 3H1JD 1QL4A 1C6RA 3VRDA 1RZ6A 3L70D 4EIEA 1P84D 2L91A 3SWSA 2FRCA 2MHMA 2PCCB 1CEDA 5EXQA 4DY9A 1FI7A 2Y0EA 4O1QA 1COTA 1CCRA 2C1DA 3PXSA 3NWVA 1H1OA 5TISV 1KX2A 1ETPA 1HZUA 4QAOA 3HQ8A 3SJLA 1GU2A 1OAEA 1YCCA 4WQ7A 1KYOD 4AALA 4XXLA 3A0BV 2GIWA 2RN0A 2QJYB 1M6ZA 2VHDA 1A8CA 2PACA 5GTIV 1AOFA 4AAOA 1CRYA 1N50A 5DJQC 5DJQB 4H0JA 4L1QA 1CIHA 1YTCA 3H1KD 1RAPA 3PHLA 3HQ9A 3SVWA 3WUIA 1HZVA 3KHUA 2Q3EA 451CA 4WQBA 1N15A 5KAFV 1VYDA 4WQ8A 3RMZA 3ZOYA 1FOCA 1H33A 5GTHV 2YK3A 1SQVD 3DP5A 1NNOA 1HH7A 2BLFB 2N3YA 4WQAA 1QKSA 3NBTA 1FI3A 4GEDB 1ZZHA 1H31A 1JDLA 1IRVA 1M60A 4WQCA 2CA4B 1E8EA 1CHIA 3A0HV 1GIWA 1U74B 1CTZA 4EICA 1CSXA 5KKZB 3NBSA 4PWAA 4XYDB 5CIBB 1DT1A 5AURA 1C6SA 1LFMA 1S5LV 1IRWA 1C2NA 3CX5D 1IQCA 1H32A 1M70A 4AAMA 3HQ7A 2N9JA 1KB0A 1I6DA 2Y0DA 1I6EA 2ZOOA 3ZOXA 3VYMA 1E29A 2BH5X 3OA8A 4RJTA 4AX3A 1WVEC 1CYCA 1CIEA 2OZ1B 2MTAC 1N9CA 1CYJA 1C2RA 5B5EV 2YQBA 2YCCA 3FWLA 1B7VA 4FAVA 3CWBD 2V08A 4JCGA 3O0RC 1HJ3A 3JBTB 3KZIV 3WFEC 1GJQA 4J20A 4EIFA 1I8OA 1S6VB 1PPJD 2C9XB 1FI9A 2HV4A 1PP9D 2CE0A 1CYIA 3CU4A 2ZXYA 4V2KA 3ZBMA 1IO3A 3PRJA 2N3BA 3PH2B 1C52A 3H1ID 5CYTR 2CXBA 3H1HD 2FWLA 5KLVD 1L0LD 2B0ZB 1CRHA 3OCDB 1RAQA 5DF5A 4PD4D 5C0ZA 1HJ4A 2QG4A 1R0QA 4N0KA 2EXVA 4FA4A 2C8SA 1CSVA 2CE1A 4Y5RA 2GC4D 2QJPB 1HROA 4AANA 1W5CT 5CIEB 1H9YA 3L75D 1LC1A 2L4DA 1SQQD 2FYNB 1KB9D 1HCMA 4GYDA 1DW1A 4Q5PA 4U3FD 5B66V 3CXHW 5KLIB 1W2LA 1BCCD 5CIFB 2FYUD 2PCBB 2QJKB 5CIGB 2DVHA 1CRJA 3OA8B 1HRCA 4K3IA 3L4OA 1KX7A 2JWAA 3ZCFA 1BE3D 4RSZA 3MK7C 2N9IA 3MK7B 3DR0A 5CICB 1LC2A 5C9MA 2KS1A 3ORVA 1YEAA 2CA3B 2GC7D 2ORLA 1NMIA 2DGEA 2XTSB 1AKKA 5CIHB 4O1WA 5H2FV 2B4ZA 2AXTV 1IZL0 1L0ND 4LJIA 4YE1A 2IBZD 2C1DB 2LITA 4WQDA 4PJ0V 3GW6A 1LMSA 4PW9B 1KYOW 5IY51 4H0KA 3ZOOA 1MZ4A 2Y0CA 3WFCC 4EDFA 5E79V 2RMZA 3DMIA 2K9JB 2D0WA 3A9FA 2ZZS1 2BGVX 3GG2A 4A7PA 1BL9A 1SQXD 5DFSA 1F1FA 1EB7A 3RN0A 3TDKA 2C1UA 1MG2D 1WEJF 1NMLA 4EIDA 1RZ5A 1CIGA 1DW3A 1CIFA 3TF5A 1CRGA 5CIDB 1KV9A 2N18B 1NIRA 2ZBOA 1C6OA 1YICA 1LS9A 3HQ6A 1C7MA 1NTKD 1L9BC 1U75B 1YEBA 1N90A 1K3HA 2AIUA 1GQ1A 4L3HA 1K3GA 1FHBA 1CC5A 1H33B 3L71D 3O5CA 1I54A 2C2CA 3RLMA 1NU1D 4UB8V 1E2RA 1H31B 1CXAA 2BCNB 2OZ1A 2LIRA 5B6QA 2V07A 3SXTA 3CX5W 3PLNA 1SQPD 3VMAA 2KNCB 1GKSA 5KAIV 2B11B 2N9YB 3RN1A 1CHJA 1DIIC 3L73D 1AOQA 1QYZA 1CO6A 4KMGA 4NFGB 1H32B 2B10B 1FCDC 3ITKA 3ZIYA 2I8FA 1DW2A 1CTJA 2GB8B 1CRIA 1CRCA 4FA1A 4FA9A 1I5TA 3CP5A 3C2CA 155CA 1CSUA 1CHHA 1YNRA 2B12B 1CSWA 1GDVA 2BCCD 3BCCD 4WQEA 4FA5A 1A2SA 3PXTA 2ZONG 3TYIA 2BPBB 1NTZD 1SQBD 3VNWA 1L9JC 1ZRTD 1CCHA 3OCDA 2A06D 3M97X 4P4QB 2YIUB 4MU8A 1CTYA 3L4MA 2JQRA 3CYTI 1QL3A 1CNOA 1YIQA 4WQ9A 1DIQC 1I55A 1DVHA 4D6TD 1C75A 1J3SA 1A56A 3WFBC 2O3JA 1FJ0A 3O1YA 1DVVA 1I8PA 1H9XA 2JTIB 1HJ5A 1EZVD 3TGUD 3L74D 1CXCA 3O20A 1F1CA 1DW0A 2C1VA 1NTMD 1KIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SLE A;  2AI5 A;  3H1L D;  4FAN A;  4IL6 V;  2D0S A;  3WC8 A;  3WU2 V;  3PTZ A;  1YFC A;  1OCD A;  3CXH D;  3WFD C;  1QN2 A;  3PXW A;  4UB6 V;  4L3G A;  4FB1 A;  1AYG A;  3L72 D;  3ZOW A;  1MG3 D;  1COR A;  351C A;  2BH4 X;  2N18 C;  1BGY D;  3X39 A;  5TJH A;  3H1J D;  1QL4 A;  1C6R A;  3VRD A;  1RZ6 A;  3L70 D;  4EIE A;  1P84 D;  2L91 A;  3SWS A;  2FRC A;  2MHM A;  2PCC B;  1CED A;  5EXQ A;  4DY9 A;  1FI7 A;  2Y0E A;  4O1Q A;  1COT A;  1CCR A;  2C1D A;  3PXS A;  3NWV A;  1H1O A;  5TIS V;  1KX2 A;  1ETP A;  1HZU A;  4QAO A;  3HQ8 A;  3SJL A;  1GU2 A;  1OAE A;  1YCC A;  4WQ7 A;  1KYO D;  4AAL A;  4XXL A;  3A0B V;  2GIW A;  2RN0 A;  2QJY B;  1M6Z A;  2VHD A;  1A8C A;  2PAC A;  5GTI V;  1AOF A;  4AAO A;  1CRY A;  1N50 A;  5DJQ C;  5DJQ B;  4H0J A;  4L1Q A;  1CIH A;  1YTC A;  3H1K D;  1RAP A;  3PHL A;  3HQ9 A;  3SVW A;  3WUI A;  1HZV A;  3KHU A;  2Q3E A;  451C A;  4WQB A;  1N15 A;  5KAF V;  1VYD A;  4WQ8 A;  3RMZ A;  3ZOY A;  1FOC A;  1H33 A;  5GTH V;  2YK3 A;  1SQV D;  3DP5 A;  1NNO A;  1HH7 A;  2BLF B;  2N3Y A;  4WQA A;  1QKS A;  3NBT A;  1FI3 A;  4GED B;  1ZZH A;  1H31 A;  1JDL A;  1IRV A;  1M60 A;  4WQC A;  2CA4 B;  1E8E A;  1CHI A;  3A0H V;  1GIW A;  1U74 B;  1CTZ A;  4EIC A;  1CSX A;  5KKZ B;  3NBS A;  4PWA A;  4XYD B;  5CIB B;  1DT1 A;  5AUR A;  1C6S A;  1LFM A;  1S5L V;  1IRW A;  1C2N A;  3CX5 D;  1IQC A;  1H32 A;  1M70 A;  4AAM A;  3HQ7 A;  2N9J A;  1KB0 A;  1I6D A;  2Y0D A;  1I6E A;  2ZOO A;  3ZOX A;  3VYM A;  1E29 A;  2BH5 X;  3OA8 A;  4RJT A;  4AX3 A;  1WVE C;  1CYC A;  1CIE A;  2OZ1 B;  2MTA C;  1N9C A;  1CYJ A;  1C2R A;  5B5E V;  2YQB A;  2YCC A;  3FWL A;  1B7V A;  4FAV A;  3CWB D;  2V08 A;  4JCG A;  3O0R C;  1HJ3 A;  3JBT B;  3KZI V;  3WFE C;  1GJQ A;  4J20 A;  4EIF A;  1I8O A;  1S6V B;  1PPJ D;  2C9X B;  1FI9 A;  2HV4 A;  1PP9 D;  2CE0 A;  1CYI A;  3CU4 A;  2ZXY A;  4V2K A;  3ZBM A;  1IO3 A;  3PRJ A;  2N3B A;  3PH2 B;  1C52 A;  3H1I D;  5CYT R;  2CXB A;  3H1H D;  2FWL A;  5KLV D;  1L0L D;  2B0Z B;  1CRH A;  3OCD B;  1RAQ A;  5DF5 A;  4PD4 D;  5C0Z A;  1HJ4 A;  2QG4 A;  1R0Q A;  4N0K A;  2EXV A;  4FA4 A;  2C8S A;  1CSV A;  2CE1 A;  4Y5R A;  2GC4 D;  2QJP B;  1HRO A;  4AAN A;  1W5C T;  5CIE B;  1H9Y A;  3L75 D;  1LC1 A;  2L4D A;  1SQQ D;  2FYN B;  1KB9 D;  1HCM A;  4GYD A;  1DW1 A;  4Q5P A;  4U3F D;  5B66 V;  3CXH W;  5KLI B;  1W2L A;  1BCC D;  5CIF B;  2FYU D;  2PCB B;  2QJK B;  5CIG B;  2DVH A;  1CRJ A;  3OA8 B;  1HRC A;  4K3I A;  3L4O A;  1KX7 A;  2JWA A;  3ZCF A;  1BE3 D;  4RSZ A;  3MK7 C;  2N9I A;  3MK7 B;  3DR0 A;  5CIC B;  1LC2 A;  5C9M A;  2KS1 A;  3ORV A;  1YEA A;  2CA3 B;  2GC7 D;  2ORL A;  1NMI A;  2DGE A;  2XTS B;  1AKK A;  5CIH B;  4O1W A;  5H2F V;  2B4Z A;  2AXT V;  1IZL 0;  1L0N D;  4LJI A;  4YE1 A;  2IBZ D;  2C1D B;  2LIT A;  4WQD A;  4PJ0 V;  3GW6 A;  1LMS A;  4PW9 B;  1KYO W;  5IY5 1;  4H0K A;  3ZOO A;  1MZ4 A;  2Y0C A;  3WFC C;  4EDF A;  5E79 V;  2RMZ A;  3DMI A;  2K9J B;  2D0W A;  3A9F A;  2ZZS 1;  2BGV X;  3GG2 A;  4A7P A;  1BL9 A;  1SQX D;  5DFS A;  1F1F A;  1EB7 A;  3RN0 A;  3TDK A;  2C1U A;  1MG2 D;  1WEJ F;  1NML A;  4EID A;  1RZ5 A;  1CIG A;  1DW3 A;  1CIF A;  3TF5 A;  1CRG A;  5CID B;  1KV9 A;  2N18 B;  1NIR A;  2ZBO A;  1C6O A;  1YIC A;  1LS9 A;  3HQ6 A;  1C7M A;  1NTK D;  1L9B C;  1U75 B;  1YEB A;  1N90 A;  1K3H A;  2AIU A;  1GQ1 A;  4L3H A;  1K3G A;  1FHB A;  1CC5 A;  1H33 B;  3L71 D;  3O5C A;  1I54 A;  2C2C A;  3RLM A;  1NU1 D;  4UB8 V;  1E2R A;  1H31 B;  1CXA A;  2BCN B;  2OZ1 A;  2LIR A;  5B6Q A;  2V07 A;  3SXT A;  3CX5 W;  3PLN A;  1SQP D;  3VMA A;  2KNC B;  1GKS A;  5KAI V;  2B11 B;  2N9Y B;  3RN1 A;  1CHJ A;  1DII C;  3L73 D;  1AOQ A;  1QYZ A;  1CO6 A;  4KMG A;  4NFG B;  1H32 B;  2B10 B;  1FCD C;  3ITK A;  3ZIY A;  2I8F A;  1DW2 A;  1CTJ A;  2GB8 B;  1CRI A;  1CRC A;  4FA1 A;  4FA9 A;  1I5T A;  3CP5 A;  3C2C A;  155C A;  1CSU A;  1CHH A;  1YNR A;  2B12 B;  1CSW A;  1GDV A;  2BCC D;  3BCC D;  4WQE A;  4FA5 A;  1A2S A;  3PXT A;  2ZON G;  3TYI A;  2BPB B;  1NTZ D;  1SQB D;  3VNW A;  1L9J C;  1ZRT D;  1CCH A;  3OCD A;  2A06 D;  3M97 X;  4P4Q B;  2YIU B;  4MU8 A;  1CTY A;  3L4M A;  2JQR A;  3CYT I;  1QL3 A;  1CNO A;  1YIQ A;  4WQ9 A;  1DIQ C;  1I55 A;  1DVH A;  4D6T D;  1C75 A;  1J3S A;  1A56 A;  3WFB C;  2O3J A;  1FJ0 A;  3O1Y A;  1DVV A;  1I8P A;  1H9X A;  2JTI B;  1HJ5 A;  1EZV D;  3TGU D;  3L74 D;  1CXC A;  3O20 A;  1F1C A;  1DW0 A;  2C1V A;  1NTM D;  1KIB A; 
#chains in the Genus database with same CATH topology
 3SLE A;  2AI5 A;  4H44 D;  1PGO A;  1LP1 B;  3WU2 E;  4FAN A;  2KSJ A;  3WC8 A;  1FC2 C;  1N7L A;  3G4S P;  2PAJ A;  3L70 E;  1P84 E;  3CXH D;  2O01 H;  4OH8 B;  4UB6 V;  1KOR A;  3U1A A;  1IFI A;  3ZOW A;  1MG3 D;  1CW5 A;  1MKM A;  351C A;  3AE1 C;  1BGY D;  5TJH A;  3H1J D;  1QL4 A;  1SS1 A;  2OTL P;  2A45 G;  1LGH B;  3SWS A;  4WY4 B;  2FRC A;  3CLQ A;  4PD4 I;  2YKQ A;  3V6I A;  1KYO H;  2QRX A;  1BE3 G;  1KFM A;  2Z5I A;  4UB8 H;  5TIS H;  3P8C D;  3GHG A;  1FI7 A;  1AFO A;  2JEE A;  3S4R A;  1COT A;  2C1D A;  3PXS A;  3NWV A;  1KX2 A;  2H7H A;  1FZB A;  3SJL A;  1M56 D;  3A0B H;  2P1J A;  5GTI H;  3S1K A;  1RF1 C;  1DD3 A;  2GIW A;  2QJY B;  2M5A B;  2C0X A;  1LWU B;  1KFN A;  2PAC A;  4N3Y B;  4AAO A;  1N2D C;  2NPS B;  4JBZ A;  2GM4 A;  1YTC A;  1RAP A;  3WUI A;  3KHU A;  4I7Z B;  2N9B A;  5CCH D;  2L5G B;  2KZI A;  1G1J A;  3RMZ A;  3ZOY A;  4YTP C;  2YK3 A;  1L4A A;  3V2Q A;  1YQ3 C;  2QSI A;  3H25 A;  3A0H H;  2N3Y A;  1GL2 A;  1BGY G;  3U59 A;  1QKS A;  3CI9 A;  4GED B;  3CX5 E;  1H31 A;  3EFG A;  2CA4 B;  1LT9 B;  1PGQ A;  1CTZ A;  4EIC A;  1E5W A;  5KKZ C;  3NBS A;  1NOH A;  3MGN A;  1S5L E;  1LFM A;  3RK3 C;  3CXH E;  2ZXX A;  1IQC A;  1OVV A;  2N9J A;  4PV1 D;  1N7S C;  3EQ2 A;  2PRR A;  1I6E A;  2ZOO A;  2D2C C;  3CD6 P;  2VRS A;  1VDF A;  3L73 G;  1FZG A;  5B5E E;  1N9C A;  3N7N A;  2O1K A;  3P8C E;  3HUS C;  4H13 D;  2QVA A;  2E75 C;  3CWB D;  2V08 A;  1SFC C;  3V2P A;  3O0R C;  2WZ7 A;  2P10 A;  4L74 A;  2ZJS E;  1NTK J;  3WFE C;  2HOD A;  3BCC G;  1I8O A;  5APY A;  1XTG B;  3OAK A;  4HYT B;  1S6V B;  1PPJ D;  4XFJ A;  1FI9 A;  5KLV J;  1PP9 D;  4PD4 E;  1EQ7 A;  4C7R A;  1IO3 A;  4NPD A;  2G3A A;  1KB9 I;  1MFZ A;  2B87 A;  5CJ4 A;  3HD7 D;  5KLV D;  1CRH A;  3OCD B;  1RAQ A;  3V2N A;  1KQS O;  4ZKU A;  3H32 A;  4C7N A;  2K3R A;  1R0Q A;  4N0K A;  1R5S A;  4FA4 A;  2C8S A;  3TGU G;  2CE1 A;  3L74 G;  4Y5R A;  2GC4 D;  3B4S A;  1HRO A;  1JM0 A;  3Q5S A;  1HGV A;  1W5C T;  2L4D A;  2ZYD A;  1KB9 D;  1J1D C;  1BDC A;  4O9B A;  3B71 A;  2DW3 A;  2J59 M;  3L4F A;  5B66 V;  1BCC D;  2Q6Q A;  1LTG C;  1M8O B;  1FZC B;  2QJK B;  3M0D C;  3CCR P;  3V4Q A;  1CRJ A;  1NTZ J;  1MZ9 A;  1HRC A;  1SQB J;  2E74 D;  4BRY A;  4RSZ A;  5AVT B;  1W5C E;  1LC2 A;  4DOJ A;  2YO2 A;  4TLF A;  2E76 C;  1HJB A;  3ORV A;  1VQL P;  1VQ8 P;  1VQP P;  2XTS B;  4D6T J;  4W80 A;  4YXD C;  2KSE A;  1RF1 A;  2IYO A;  1AKK A;  2K9Y A;  1MV8 A;  3T97 A;  1HWT C;  1HH0 A;  1LTI C;  5APS A;  1JY2 N;  5CCG C;  1KIL C;  2I1K A;  4WQD A;  1IJD B;  1LT1 A;  3GW6 A;  4PW9 B;  2LR2 A;  2OYI A;  3AE5 C;  5IY5 1;  1FZF A;  1MZ4 A;  2Y0C A;  4DCK A;  2K9J B;  1YQ4 C;  2B87 B;  2HLO A;  4IFD K;  3TYY A;  3A9F A;  1OW6 A;  1XTC C;  1AVY A;  5AVW B;  1AV1 A;  2IZ1 A;  1JO5 A;  1SFC D;  1NTK E;  3CCQ P;  2C1U A;  4JYC A;  3H1K G;  1S2E A;  1WEJ F;  3KZI E;  1KTM A;  1NYH A;  1DIP A;  1NTK K;  1RZ5 A;  1CIG A;  1DW3 A;  5KLV E;  1TU3 F;  5CID B;  2W6J H;  3M0A A;  4WWI A;  3TNU B;  1YIC A;  1C7M A;  2HR3 A;  1BCC G;  4Y99 B;  1N90 A;  2V4H A;  1K3H A;  1HGZ A;  3HE5 B;  3I55 P;  1FDM A;  4DT0 A;  1CC5 A;  1NU1 J;  4M3L A;  1PIX A;  3L71 D;  1JY3 P;  4HJG H;  5M1B A;  1VPC A;  3JSV C;  1N7S A;  1NU1 D;  3CCU P;  2XZR A;  5KAI H;  2Z4E A;  4KJM A;  4MN4 C;  2OZ1 A;  5B6Q A;  3RL0 D;  2FFD C;  3VTP C;  2B11 B;  1G2C B;  3HUS A;  4IL6 X;  1QYZ A;  1USD A;  1K8A Q;  2B10 B;  1FZA A;  2XV5 A;  4DJG A;  2I8F A;  3LID A;  4W7Z A;  1CTJ A;  1LTJ C;  1NTZ E;  2QM8 A;  1SQB E;  1GK6 A;  2QA4 P;  1I5T A;  3CP5 A;  4JF7 A;  2OYI B;  155C A;  2W8Z A;  2OQQ A;  1PGP A;  1JMB A;  1NTZ K;  2ZVO B;  1SQV J;  1SQB K;  4FA5 A;  1PL5 A;  3F89 A;  2ZON G;  3TYI A;  4R4L A;  5AW7 B;  1S3J A;  1EZV I;  1L9J C;  1M1J C;  1ZRT D;  4D6T E;  3B5N B;  2AEF A;  1CI6 B;  2YIU C;  3L4M A;  2JQR A;  2WSF H;  1QL3 A;  1CNO A;  1YIQ A;  1OW7 A;  1QVF O;  4IFF A;  2AXT E;  4WQ9 A;  1I55 A;  3H1I G;  3F5H A;  1KIL D;  3WFB C;  3H1L E;  2Q9I A;  1YJN P;  2N1T D;  1I8P A;  1HJ5 A;  1EZV D;  1RE4 C;  2R5D A;  3RK3 B;  5AW4 B;  3USS A;  2NZ2 A;  1NTM D;  1HJ0 A;  1P84 I;  5CMZ A;  1YIT P;  3L72 E;  4H44 C;  1OX3 A;  3M0D A;  1ZP0 C;  2WIT A;  4UB6 E;  1OCD A;  3I56 P;  2YKO A;  4CPG A;  1SQQ G;  3L70 J;  1AYG A;  3VOP A;  3X39 A;  3NFQ A;  3VRD A;  1RZ6 A;  3L70 D;  4EIE A;  2E75 B;  1P84 D;  1NU1 E;  2FYU G;  1IZN B;  4I2L C;  2MHM A;  2KXP B;  2PCC B;  1NU1 K;  3M91 A;  1CED A;  1OWA A;  4EI2 A;  3HTK A;  1JNM A;  4O1Q A;  5CCG A;  1CCR A;  1KIL A;  5TIS V;  3AE2 C;  4R4M A;  1ETP A;  1HZU A;  1YCC A;  3D6Z A;  4WQ7 A;  1FJP A;  1R5L A;  1OMI A;  3A0B V;  2MJZ A;  3M9B A;  2VHD A;  1T3J A;  2IBZ G;  3L75 J;  5GTI V;  2NPS D;  1Q2N A;  2FKW B;  5DJQ C;  1GW3 A;  1CIH A;  3VP8 A;  1Q7Y Q;  1SQV E;  3PHL A;  2OYH C;  1HZV A;  1T3U A;  2Z5H A;  3IAO A;  1SQX G;  451C A;  3WUT A;  4WQB A;  1KN7 A;  3Q2Y A;  1N15 A;  5KAF V;  1SQV K;  1HTL C;  1VYD A;  2J5U A;  5CCH C;  2O01 N;  4H0L B;  1H33 A;  2XND H;  3CX5 I;  3DP5 A;  2BLF B;  3NBT A;  1FI3 A;  1BDD A;  3OJA B;  1IRV A;  4WQC A;  3BRT B;  3A0H V;  2IYP A;  1U74 B;  1CSX A;  4HH2 A;  3G3Z A;  2FFD A;  2M8R A;  3V2R A;  2WSE J;  1RF0 C;  1UII A;  3CX5 D;  1H32 A;  4LC1 A;  3HTK B;  4PV1 C;  4IL6 E;  1KQL A;  1KB0 A;  1LTJ A;  1SVF A;  2W90 A;  3GF7 A;  1E29 A;  2BH5 X;  1QL2 A;  2M3E A;  4RJT A;  2PP6 A;  1WVE C;  1T8Z A;  2QM7 A;  2V7Q H;  3SWF A;  2AXC A;  1CYJ A;  1C2R A;  2YCC A;  1CSB A;  1M1J A;  4H13 C;  2OTJ P;  1B7V A;  4JCG A;  2KOG A;  1NJI Q;  3JBT B;  2BCC G;  4EIF A;  4JYB A;  1L0L E;  4BXL A;  3H1H J;  2LKM A;  3KXD A;  3NMD A;  1URQ B;  1JMM A;  1ZW0 A;  3PRJ A;  3PH2 B;  1C52 A;  1L0L K;  1FDO A;  2Q1K A;  3SWY A;  2XDJ A;  1RE4 A;  3O6Q A;  3H1H D;  4EIJ A;  2FWL A;  1JEK A;  3HD7 C;  2B0Z B;  1KB9 H;  2AEJ A;  3CCE P;  1H0T A;  1MFT A;  3L75 E;  3WMM 0;  3KQG A;  5DF5 A;  3HE4 B;  4PD4 D;  3CL3 D;  3II6 A;  1L2P A;  3Q5R A;  1H88 A;  5C0Z A;  5AW6 B;  1JY3 O;  3OW2 O;  3L73 J;  2JJL A;  2KZJ A;  3C9I A;  2QJP B;  5CIE B;  5KAF H;  1R8E A;  2WSC J;  3G71 P;  2FYN B;  3CC7 P;  1HCM A;  2JO1 A;  5B66 E;  1BE3 E;  5KLI B;  3RBX A;  2PGD A;  3H6P A;  5GTH E;  1N73 C;  1FOS E;  5CIF B;  3BCC J;  1IFP A;  2XU6 A;  2WWW A;  1KQG B;  1PGJ A;  4W7Y A;  4K3I A;  3L4O A;  2O1J A;  3H1J G;  2E74 C;  1KX7 A;  4OVN F;  3JCU H;  4AUW A;  2N9I A;  3MK7 B;  1IFN A;  1EXJ A;  2CA3 B;  4RO0 A;  2ORL A;  2KB7 P;  2DGE A;  1NVO A;  5APT A;  1L0N J;  2J58 A;  5CJ0 A;  1PV3 A;  5H2F V;  3L74 J;  2BEZ F;  3GHG B;  1L0N D;  4YE1 A;  5AVV B;  1HBW A;  2C1D B;  2LIT A;  3RK2 B;  4PJ0 V;  1KYO W;  1KC8 Q;  3ZOO A;  3WUV A;  2OYH A;  3O6Q B;  2H88 C;  4EDF A;  5E79 V;  5AW9 B;  2FY8 A;  3N4X A;  2WSS H;  1VF5 D;  5CCH A;  2ZZS 1;  3GG2 A;  2OAR A;  1H0T B;  4H44 B;  1JB0 J;  2JR8 A;  2R3S A;  3FWN A;  1F1F A;  1MG2 D;  1J1E B;  4N78 E;  4I6M C;  3H1H E;  1VQO P;  1VQ7 P;  1NIR A;  2ZBO A;  2O01 J;  3VMX A;  1NTK D;  1U75 B;  2QIW A;  1NKZ B;  2AIU A;  2R44 A;  1RF0 A;  1FHB A;  3P8M C;  1RQU A;  1L4A B;  5AVX B;  3O5C A;  4OGQ C;  1KD1 Q;  4GIF A;  1GL2 B;  3JC2 2;  1SQP J;  3L73 E;  2FXO A;  1E2R A;  1H31 B;  3C8V A;  3SXT A;  1VQN P;  2P58 A;  3PLN A;  1SQP D;  1HUC A;  3RL0 C;  1VQ4 P;  2XKM A;  1DH3 A;  2SPZ A;  5KAI V;  2OGU A;  2N9Y B;  3RN1 A;  1IFD A;  5AW8 B;  1DII C;  2UWJ E;  3LIE A;  3H1K J;  3BCC E;  2B88 A;  4GOE A;  1OIP A;  1X0T A;  2H8P D;  1NAF A;  1KZU B;  1JTH A;  4FA1 A;  1OZH A;  3C2C A;  4L76 A;  2A06 E;  1GU4 A;  3FGA D;  4AYC A;  2R5B A;  1Q82 Q;  2E5Y A;  3V4W A;  3CWB G;  2IX7 C;  2ZT9 B;  1NTZ D;  3L36 A;  5KJ7 D;  1SQB D;  1L0N E;  1OXZ A;  3HD7 A;  5H2F H;  1DD4 A;  3S9O A;  3M97 X;  4P4Q B;  1KMI Z;  1CTY A;  1KV4 A;  3L74 E;  2OTK E;  1PPJ G;  1NWQ A;  1L0N K;  2HOD B;  1NKN A;  1PP9 G;  2M0B A;  4PJ0 H;  4WB4 A;  3FX0 A;  3L35 A;  4N6J A;  2GUS A;  4D6T D;  1C75 A;  3IF4 A;  5E79 H;  1FJ0 A;  2G8Y A;  3O1Y A;  5KLV G;  2N1T C;  3H1L J;  1AQT A;  2FBW C;  3WU2 H;  3A2A A;  4QMA A;  1OFC X;  3H32 B;  4C7N B;  3H1L D;  1N73 A;  1P84 H;  3MTU E;  3L72 J;  3PTZ A;  5C39 A;  1YFC A;  3WFD C;  1K9M Q;  4JPZ B;  4L3G A;  1EXI A;  4FB1 A;  3L72 D;  4GT1 A;  1COR A;  2BH4 X;  2ITA A;  3LW5 H;  1PFI A;  1C6R A;  3O8Z A;  2HPC A;  2L91 A;  3CC2 P;  1SQP E;  4OGQ D;  3H1I J;  4DY9 A;  1JCC A;  1KYO E;  2GUV A;  1S9K E;  4UB8 E;  5TIS E;  4BRY B;  1SQP K;  5AVQ B;  3M9H A;  1H1O A;  2HFE D;  1LNQ A;  1M7L A;  1USE A;  3CCL P;  1NO4 A;  3H1K E;  3NTN A;  3A0B E;  4XXL A;  5KTB A;  1YTZ T;  1Y8A A;  2QJY C;  1GU5 A;  1RF1 B;  1LWU C;  1AVO A;  1JY2 O;  4XA4 A;  5GTI E;  1D7M A;  1A8C A;  1SFC A;  1K05 A;  1AOF A;  3T97 B;  3CME P;  1SQQ J;  2NPS C;  1SP4 A;  4H0J A;  2ZXE B;  2YKP A;  4U3F J;  5CHX A;  5DJT B;  1LTA C;  1FZE A;  2YXQ B;  1QEX A;  3Q5P A;  3HQ9 A;  3SVW A;  4I7Z C;  2Q3E A;  2FXM A;  1KQF B;  3Q3D A;  1U7M A;  3CC4 P;  3HRN A;  4H0L D;  1JCD A;  1X8Y A;  1X79 B;  4ASV A;  4K35 A;  1SQV D;  1JUN A;  2C9N Y;  3CX5 H;  1IK9 A;  3RK3 E;  1VQK P;  1VL2 A;  1E8E A;  3A0H E;  1LT9 C;  1CHI A;  3MIW A;  1Z56 A;  1GIW A;  2W6B A;  1S5L H;  3BAT A;  2IFM A;  3CXH H;  5KKZ B;  3L71 G;  4PWA A;  4XYD B;  5CIB B;  3EFF K;  3KDP B;  1DT1 A;  5AUR A;  5AW0 B;  1C2N A;  4BWN A;  1HVV A;  1NU1 G;  4K3A A;  2ZVN B;  1YI2 P;  1N7S B;  2Y0D A;  4RES B;  3ZOX A;  1LTT C;  3CCS P;  2D2C B;  3VYM A;  5B5E H;  3OA8 A;  5CBN A;  2IPP A;  2OZ1 B;  3AE4 C;  2MTA C;  3SFE C;  4HKZ H;  1Y47 A;  2E42 A;  3FWL A;  3HUS B;  1VQ6 P;  1GW4 A;  4WY4 D;  4FAV A;  1SFC B;  1HJ3 A;  3H1I E;  3KZI V;  1GJQ A;  4PD4 H;  4TT3 H;  5APV A;  2WPR A;  4L73 A;  1M1K Q;  1URQ D;  2HV4 A;  1CYI A;  2BEQ D;  2ZXY A;  1L0L J;  4V2K A;  3ZBM A;  2KLU A;  2R32 A;  1SQV G;  3GLM A;  2N3B A;  4OWF A;  2CPS A;  5CYT R;  2N1T A;  3IN6 A;  2M3B A;  1L0L D;  3E1I A;  1LP1 A;  3U1C A;  1LJ2 A;  1SQQ E;  3QWO C;  2A45 I;  4U3F E;  2EXV A;  1CSV A;  1SQQ K;  1EZV G;  1OVR A;  4AAN A;  1GK4 A;  1NTM G;  4AQR D;  1H9Y A;  3L75 D;  5AVY B;  3KPE A;  1UIX A;  1IO4 A;  1NHL A;  1J1D B;  2FYZ A;  1DW1 A;  2WTY A;  3CXH W;  2BCC J;  1BE3 J;  1FZC C;  2QJK C;  3OA7 A;  5CIG B;  3FXE A;  3OA8 B;  2JKV A;  2LXB A;  2JWA A;  3ZCF A;  1BE3 D;  1FAV A;  3EWK A;  2XNX A;  3L70 G;  1Q86 Q;  3DR0 A;  5CIC B;  1ZLL A;  1EDK A;  5BU5 A;  3VMY A;  2E76 B;  4Y28 J;  2KNC A;  1H89 A;  2KS1 A;  1RHZ B;  2GC7 D;  2IBZ E;  4C46 A;  3A5T A;  5H2F E;  1LWU A;  1FU1 A;  5CIH B;  4O1W A;  2NPS A;  3P32 A;  2AXT V;  1IZL 0;  1EDL A;  4LJI A;  3RK2 D;  1RE3 C;  1JY3 N;  1SQX E;  1KIL B;  1LMS A;  2WSF J;  1T2K D;  4H0K A;  3WFC C;  5CBO A;  1SQX K;  2RMZ A;  3AED C;  3DMI A;  4ZKP A;  4GOF A;  4YXW H;  2D0W A;  1VF5 C;  1K73 Q;  3CCJ P;  1ZXG A;  1GTW A;  3KZI H;  1QGK B;  2K1A A;  1MUU A;  3R2P A;  1EB7 A;  1GDT A;  3RN0 A;  1BGY J;  3UIA A;  3L75 G;  3H1J J;  4GKG A;  3D70 A;  4EID A;  3AEF C;  1CIF A;  1GD2 E;  3TF5 A;  1LT9 A;  1CRG A;  1KV9 A;  1AA0 A;  1IFM A;  3M06 A;  1C6O A;  4NPE A;  1LS9 A;  3HQ6 A;  4Y99 C;  2H43 A;  3G6E P;  2KLV A;  1YEB A;  4N78 D;  2Q7C A;  2K88 A;  1QX8 A;  3M9Q A;  4L3H A;  4NPF X;  1X22 A;  1L4A D;  1H33 B;  1JY2 P;  3G9R A;  1GL2 D;  1OVU A;  5APX A;  2RH0 A;  3RLM A;  3AEG C;  3KYQ A;  2I1J A;  5BU8 B;  1CXA A;  5AVR B;  2LIR A;  3CCV P;  2KNC B;  5KAI E;  2KS1 B;  2FFD B;  1Y9B A;  3L73 D;  1AOQ A;  1X9V A;  3TK1 A;  1H32 B;  2OYO A;  1FCD C;  2BCC E;  1QVG O;  1DW2 A;  4KT0 J;  2AEM A;  3SWK A;  3IFM A;  1LTJ B;  1CRI A;  1S4X A;  2OYI C;  3W67 A;  3V5B A;  2RKL A;  3E1R A;  1CHH A;  2JP3 A;  1M57 D;  5APQ A;  1YNR A;  2B12 B;  1CSW A;  3BCC D;  4HB1 A;  1A2S A;  3MHV A;  2ZT9 D;  1NH4 A;  1ZR4 A;  2BPB B;  3W68 A;  4B86 A;  5KJ7 C;  1M1J B;  2WPV B;  2FXP A;  3B5N C;  3OCD A;  2A06 D;  2YIU B;  2AXT H;  4MU8 A;  2BAS A;  4GOD A;  1T6A A;  3CYT I;  2E43 A;  2C0W A;  1FOS F;  3PJS K;  3TGU J;  1DIQ C;  1HF9 A;  3R4Y A;  3H1H G;  2O3J A;  2P67 A;  1DVV A;  2ZAE B;  1H9X A;  3A3Y B;  3TGU D;  3L74 D;  3D71 A;  1NGM B;  2JDI H;  3P7K A;  1VQ9 P;  1BGY E;  1LTS C;  4UB6 H;  3H1J E;  1FZC A;  4IL6 V;  2D0S A;  3WU2 V;  1WMK A;  1WRG A;  1QN2 A;  3PXW A;  3C1L A;  3AE7 C;  2YMY A;  3CWB J;  2C9L Y;  2N18 C;  3AEC C;  1U57 A;  3VYI A;  1H8A A;  3IR9 A;  2V7Q J;  1KYO I;  3AEB C;  1PP9 J;  4IFM A;  4LLH A;  2W27 A;  3WUU A;  2B89 A;  5EXQ A;  1EC5 A;  1E79 H;  1A02 J;  2Y0E A;  2W83 C;  1G1I A;  1RE3 A;  2YO3 A;  3GMA A;  3QH9 A;  3AEA C;  2A06 G;  4GDO A;  4WVZ A;  4QAO A;  4JQ0 D;  3HQ8 A;  1GU2 A;  2K9J A;  1OAE A;  1KYO D;  2KIK A;  4AAL A;  4IOI H;  5EFW B;  1S9K D;  1QLE D;  2LXC B;  2RN0 A;  1L0N G;  1M6Z A;  1CRY A;  1N50 A;  5DJQ B;  4XE5 B;  2NRG A;  4L1Q A;  3GF3 A;  1Q81 Q;  1ZME C;  3A7O A;  3H1K D;  4ZNC A;  1BCC J;  2OYH B;  3TNU A;  1S1C X;  2YNY A;  1YTZ I;  3MUD C;  2Y9Z A;  3HE5 A;  1BSN A;  4WQ8 A;  4H0L C;  5L8R J;  1N86 A;  1FOC A;  3B5N D;  5GTH V;  1W2B O;  1NNO A;  2WPQ A;  1QL1 A;  1HH7 A;  3BAS A;  4WQA A;  5APU A;  3TGU E;  1YJW P;  1WT6 A;  1NTK G;  1ZZH A;  1JDL A;  1M60 A;  3RBZ A;  2B9B A;  3SFD C;  2E5T A;  2ZYA A;  5AVU B;  4ASW A;  3AE3 C;  1FDI A;  1S72 P;  1C6S A;  1G2C A;  3RK3 D;  3D0W A;  3E7K A;  1S5L V;  1IRW A;  4LGD E;  2ZFC A;  1M70 A;  4AAM A;  3HQ7 A;  4IL6 H;  5AW5 B;  2KI7 B;  2QE7 H;  4PV1 B;  1N7S D;  1I6D A;  2D2C D;  1SQP G;  1LTB C;  3CWB E;  4AX3 A;  1CYC A;  3CMA P;  1CIE A;  1FS0 E;  2WQY C;  1M90 Q;  1ZN5 A;  2R3C A;  5B5E V;  2YQB A;  2ZYG A;  1VF5 B;  2E75 D;  5KJ7 A;  3CPW O;  1PPJ E;  4H13 B;  3B5N A;  5APW A;  2MKV A;  1PP9 E;  1CI6 A;  4WY4 C;  4L75 A;  1FBM A;  3AE6 C;  5AW1 B;  1ZV8 A;  2WT7 A;  1JTH B;  1IFJ A;  4J20 A;  3NXS A;  2QEX P;  1EDJ A;  1OW8 A;  1GMJ A;  2Q3I A;  2WMM A;  1J2J B;  2C9X B;  2Y9Y A;  1NTZ G;  1AJY A;  3L71 J;  2CE0 A;  3CU4 A;  1SQB G;  1URQ C;  5KLV K;  3H1I D;  2CXB A;  4WBA A;  4RKU J;  1CZQ A;  1W2E A;  2KYV A;  3RGU A;  3HD7 B;  3PH0 A;  1EDI A;  4EYY Q;  1BSH A;  1KB9 E;  4D6T G;  3VMZ A;  1HJ4 A;  2A45 H;  2QG4 A;  1DEB A;  2I8D A;  1A02 F;  1IK7 A;  2QJP C;  1BCC E;  1LC1 A;  5B66 H;  1SQQ D;  2FYN C;  3BRV B;  5AVZ B;  4GYD A;  2FYU J;  2HYN A;  3H1L G;  5KAF E;  4Q5P A;  5GTH H;  4U3F D;  2YMK A;  5KLI C;  1W2L A;  1FJK A;  1N73 B;  2FYU D;  1U7J A;  2PCB B;  1ZR2 A;  4DZO A;  2DVH A;  3L72 G;  1RQV A;  3AEE C;  1Q90 D;  1NAY A;  1FE6 A;  2E74 B;  2IBZ I;  3D6Y A;  3MK7 C;  2WSE H;  3JCU E;  2E76 D;  5C9M A;  4U7J A;  1YEA A;  1NMI A;  2HPC B;  2GA1 A;  2HG5 D;  3I5C A;  2WT7 B;  2YXR B;  2B4Z A;  2PFX A;  3GHG C;  4EOT A;  1DX7 A;  5CCG D;  1NTM J;  2K37 A;  2IBZ D;  3RK2 C;  2IZ0 A;  3FXD A;  2W6A A;  1T2K C;  1SQX J;  3MUD A;  5AW3 B;  1ZOY C;  2BGV X;  4A7P A;  1BL9 A;  1SQX D;  5DFS A;  2KP8 A;  3BVH A;  5AVS B;  3RL0 g;  1YYC A;  3TDK A;  5AW2 B;  1J1E C;  1GZL A;  2CK3 H;  3K5B A;  1NML A;  1YJ9 P;  3TSI A;  3ABV C;  3L71 E;  4U3F G;  2H89 C;  1AQ5 A;  5K5G B;  2N18 B;  2KUB A;  1N8R Q;  1L9B C;  1VQM P;  1GQ1 A;  2WVR A;  2WPS A;  1K3G A;  3LW5 J;  1L4A C;  1IC2 A;  1I54 A;  4OGQ B;  1GL2 C;  3MD0 A;  1K04 A;  2C2C A;  2Q5U A;  2JWD A;  3B8E B;  2WSC H;  4ZMD A;  4UB8 V;  1RY3 A;  2BCN B;  1S5L X;  2V07 A;  3L37 A;  3CX5 W;  4YPC A;  3VMA A;  3RL0 B;  1GKS A;  2FYU E;  4I1L A;  1CHJ A;  1DEE G;  2IDB A;  1SLQ A;  1CO6 A;  3SSU A;  4KMG A;  3AE8 C;  4NFG B;  2FYU K;  4WY4 A;  4Z1M H;  3ITK A;  4KHX A;  3ZIY A;  1JOC A;  2GB8 B;  5DJU B;  1CRC A;  4FA9 A;  1ZRT E;  1VQ5 P;  1CSU A;  2CPB A;  2BCC D;  1GDV A;  1URQ A;  3VP9 A;  1RH5 B;  4WQE A;  3PXT A;  2ZT9 C;  3VNW A;  3MZW B;  1KIL E;  1CCH A;  1YHQ P;  1YBK A;  2POH A;  3HE4 A;  2IFN A;  1EZV E;  2M5A A;  1NTM E;  3AE9 C;  3CXH I;  3MP7 B;  3Q1M A;  1DVH A;  1J3S A;  4PJ0 E;  1A56 A;  1PZQ A;  2P7J A;  3PP5 A;  1NTM K;  2JTI B;  1L0L G;  2N1T B;  3ZDM A;  5E79 E;  1CXC A;  3O20 A;  1F1C A;  1YIJ P;  3CCM P;  1DW0 A;  2C1V A;  3VN0 A;  1KIB A;  5BVZ A;  2KK7 A;  2P2U A; 
#chains in the Genus database with same CATH homology
 3SLE A;  2AI5 A;  3H1L D;  4FAN A;  4IL6 V;  2D0S A;  3WC8 A;  3WU2 V;  3PTZ A;  1YFC A;  1OCD A;  3CXH D;  3WFD C;  1QN2 A;  3PXW A;  4UB6 V;  4L3G A;  4FB1 A;  1AYG A;  3L72 D;  3ZOW A;  1MG3 D;  1COR A;  351C A;  2BH4 X;  2N18 C;  1BGY D;  3X39 A;  5TJH A;  3H1J D;  1QL4 A;  1C6R A;  3VRD A;  1RZ6 A;  3L70 D;  4EIE A;  1P84 D;  2L91 A;  3SWS A;  2FRC A;  2MHM A;  2PCC B;  1CED A;  5EXQ A;  4DY9 A;  1FI7 A;  2Y0E A;  4O1Q A;  1COT A;  1CCR A;  2C1D A;  3PXS A;  3NWV A;  1H1O A;  5TIS V;  1KX2 A;  1ETP A;  1HZU A;  4QAO A;  3HQ8 A;  3SJL A;  1GU2 A;  1OAE A;  1YCC A;  4WQ7 A;  1KYO D;  4AAL A;  4XXL A;  3A0B V;  2GIW A;  2RN0 A;  2QJY B;  1M6Z A;  2VHD A;  1A8C A;  2PAC A;  5GTI V;  1AOF A;  4AAO A;  1CRY A;  1N50 A;  5DJQ C;  5DJQ B;  4H0J A;  4L1Q A;  1CIH A;  1YTC A;  3H1K D;  1RAP A;  3PHL A;  3HQ9 A;  3SVW A;  3WUI A;  1HZV A;  3KHU A;  2Q3E A;  451C A;  4WQB A;  1N15 A;  5KAF V;  1VYD A;  4WQ8 A;  3RMZ A;  3ZOY A;  1FOC A;  1H33 A;  5GTH V;  2YK3 A;  1SQV D;  3DP5 A;  1NNO A;  1HH7 A;  2BLF B;  2N3Y A;  4WQA A;  1QKS A;  3NBT A;  1FI3 A;  4GED B;  1ZZH A;  1H31 A;  1JDL A;  1IRV A;  1M60 A;  4WQC A;  2CA4 B;  1E8E A;  1CHI A;  3A0H V;  1GIW A;  1U74 B;  1CTZ A;  4EIC A;  1CSX A;  5KKZ B;  3NBS A;  4PWA A;  4XYD B;  5CIB B;  1DT1 A;  5AUR A;  1C6S A;  1LFM A;  1S5L V;  1IRW A;  1C2N A;  3CX5 D;  1IQC A;  1H32 A;  1M70 A;  4AAM A;  3HQ7 A;  2N9J A;  1KB0 A;  1I6D A;  2Y0D A;  1I6E A;  2ZOO A;  3ZOX A;  3VYM A;  1E29 A;  2BH5 X;  3OA8 A;  4RJT A;  4AX3 A;  1WVE C;  1CYC A;  1CIE A;  2OZ1 B;  2MTA C;  1N9C A;  1CYJ A;  1C2R A;  5B5E V;  2YQB A;  2YCC A;  3FWL A;  1B7V A;  4FAV A;  3CWB D;  2V08 A;  4JCG A;  3O0R C;  1HJ3 A;  3JBT B;  3KZI V;  3WFE C;  1GJQ A;  4J20 A;  4EIF A;  1I8O A;  1S6V B;  1PPJ D;  2C9X B;  1FI9 A;  2HV4 A;  1PP9 D;  2CE0 A;  1CYI A;  3CU4 A;  2ZXY A;  4V2K A;  3ZBM A;  1IO3 A;  3PRJ A;  2N3B A;  3PH2 B;  1C52 A;  3H1I D;  5CYT R;  2CXB A;  3H1H D;  2FWL A;  5KLV D;  1L0L D;  2B0Z B;  1CRH A;  3OCD B;  1RAQ A;  5DF5 A;  4PD4 D;  5C0Z A;  1HJ4 A;  2QG4 A;  1R0Q A;  4N0K A;  2EXV A;  4FA4 A;  2C8S A;  1CSV A;  2CE1 A;  4Y5R A;  2GC4 D;  2QJP B;  1HRO A;  4AAN A;  1W5C T;  5CIE B;  1H9Y A;  3L75 D;  1LC1 A;  2L4D A;  1SQQ D;  2FYN B;  1KB9 D;  1HCM A;  4GYD A;  1DW1 A;  4Q5P A;  4U3F D;  5B66 V;  3CXH W;  5KLI B;  1W2L A;  1BCC D;  5CIF B;  2FYU D;  2PCB B;  2QJK B;  5CIG B;  2DVH A;  1CRJ A;  3OA8 B;  1HRC A;  4K3I A;  3L4O A;  1KX7 A;  2JWA A;  3ZCF A;  1BE3 D;  4RSZ A;  3MK7 C;  2N9I A;  3MK7 B;  3DR0 A;  5CIC B;  1LC2 A;  5C9M A;  2KS1 A;  3ORV A;  1YEA A;  2CA3 B;  2GC7 D;  2ORL A;  1NMI A;  2DGE A;  2XTS B;  1AKK A;  5CIH B;  4O1W A;  5H2F V;  2B4Z A;  2AXT V;  1IZL 0;  1L0N D;  4LJI A;  4YE1 A;  2IBZ D;  2C1D B;  2LIT A;  4WQD A;  4PJ0 V;  3GW6 A;  1LMS A;  4PW9 B;  1KYO W;  5IY5 1;  4H0K A;  3ZOO A;  1MZ4 A;  2Y0C A;  3WFC C;  4EDF A;  5E79 V;  2RMZ A;  3DMI A;  2K9J B;  2D0W A;  3A9F A;  2ZZS 1;  2BGV X;  3GG2 A;  4A7P A;  1BL9 A;  1SQX D;  5DFS A;  1F1F A;  1EB7 A;  3RN0 A;  3TDK A;  2C1U A;  1MG2 D;  1WEJ F;  1NML A;  4EID A;  1RZ5 A;  1CIG A;  1DW3 A;  1CIF A;  3TF5 A;  1CRG A;  5CID B;  1KV9 A;  2N18 B;  1NIR A;  2ZBO A;  1C6O A;  1YIC A;  1LS9 A;  3HQ6 A;  1C7M A;  1NTK D;  1L9B C;  1U75 B;  1YEB A;  1N90 A;  1K3H A;  2AIU A;  1GQ1 A;  4L3H A;  1K3G A;  1FHB A;  1CC5 A;  1H33 B;  3L71 D;  3O5C A;  1I54 A;  2C2C A;  3RLM A;  1NU1 D;  4UB8 V;  1E2R A;  1H31 B;  1CXA A;  2BCN B;  2OZ1 A;  2LIR A;  5B6Q A;  2V07 A;  3SXT A;  3CX5 W;  3PLN A;  1SQP D;  3VMA A;  2KNC B;  1GKS A;  5KAI V;  2B11 B;  2N9Y B;  3RN1 A;  1CHJ A;  1DII C;  3L73 D;  1AOQ A;  1QYZ A;  1CO6 A;  4KMG A;  4NFG B;  1H32 B;  2B10 B;  1FCD C;  3ITK A;  3ZIY A;  2I8F A;  1DW2 A;  1CTJ A;  2GB8 B;  1CRI A;  1CRC A;  4FA1 A;  4FA9 A;  1I5T A;  3CP5 A;  3C2C A;  155C A;  1CSU A;  1CHH A;  1YNR A;  2B12 B;  1CSW A;  1GDV A;  2BCC D;  3BCC D;  4WQE A;  4FA5 A;  1A2S A;  3PXT A;  2ZON G;  3TYI A;  2BPB B;  1NTZ D;  1SQB D;  3VNW A;  1L9J C;  1ZRT D;  1CCH A;  3OCD A;  2A06 D;  3M97 X;  4P4Q B;  2YIU B;  4MU8 A;  1CTY A;  3L4M A;  2JQR A;  3CYT I;  1QL3 A;  1CNO A;  1YIQ A;  4WQ9 A;  1DIQ C;  1I55 A;  1DVH A;  4D6T D;  1C75 A;  1J3S A;  1A56 A;  3WFB C;  2O3J A;  1FJ0 A;  3O1Y A;  1DVV A;  1I8P A;  1H9X A;  2JTI B;  1HJ5 A;  1EZV D;  3TGU D;  3L74 D;  1CXC A;  3O20 A;  1F1C A;  1DW0 A;  2C1V A;  1NTM D;  1KIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...