2QJKB

Crystal structure analysis of mutant rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
total genus 65
structure length 256
sequence length 256
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjkB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjkB02
3NWVA 1ZRTD 1CIHA 1J3SA 1MZ4A 3WFEC 3OA8B 3HQ6A 2B4ZA 1H31B 2PCCB 2RN0A 3WU2V 2KS1A 1E8EA 1CTJA 2ZZS1 3NBTA 3L4OA 4PD4D 3PHLA 2DGEA 3ITKA 3A0HV 5GTIV 1L9BC 3CP5A 1AYGA 1CYCA 1BGYD 5CIHB 3CXHD 5KAIV 3SJLA 1H9XA 3L75D 4LJIA 2O3JA 2GC7D 3HQ8A 4EIDA 2RMZA 3DP5A 1FI3A 5TISV 1SQQD 4FANA 4WQBA 3DR0A 5IY51 3WFBC 3CXHW 2AIUA 3X39A 4WQCA 1CIEA 2V08A 1I8PA 5DJQB 3VNWA 1CO6A 2YQBA 3DMIA 1C6OA 1YFCA 4WQ9A 1A56A 3CYTI 1KX7A 1YEAA 2PCBB 1I5TA 4WQ8A 1KYOW 4FA4A 2HV4A 1HZVA 1ETPA 2GIWA 2ZOOA 4FB1A 1SQPD 3H1HD 3VRDA 5GTHV 2YCCA 1VYDA 1C52A 1OAEA 1L9JC 1I55A 2N9IA 3MK7B 1CRCA 1GKSA 4N0KA 1KB0A 1CYJA 5DJQC 1HJ4A 4AANA 3L4MA 3SWSA 2Y0EA 3RLMA 3PXTA 5KLIB 1N15A 1LMSA 3GW6A 3OCDB 4D6TD 1DW1A 3WUIA 2C1DA 5CIBB 1DT1A 1S5LV 1DW3A 4KMGA 5DFSA 1AOQA 4L3HA 1KX2A 4GYDA 1U74B 3CU4A 3H1KD 4XXLA 4O1QA 1H33B 4NFGB 4FA1A 1CHHA 1FOCA 1NU1D 1PP9D 5KAFV 2CA4B 3L72D 3RMZA 5CIFB 2B0ZB 3A9FA 1NTZD 1CCHA 4L1QA 351CA 1H9YA 1CSUA 1SQVD 2B10B 3JBTB 5CIGB 1NIRA 1SQXD 2JQRA 1N9CA 1IO3A 2YIUB 2N18B 1HJ3A 2QJPB 4PWAA 1KB9D 2OZ1B 4FAVA 4UB6V 4O1WA 1FHBA 2MHMA 2BPBB 2KNCB 3L70D 3WC8A 2CXBA 4P4QB 3BCCD 1QL4A 1BL9A 2V07A 1CXCA 1CRYA 3OA8A 1H32B 2BLFB 4JCGA 2N18C 4Q5PA 1C75A 4FA9A 1FCDC 3ZCFA 1CRGA 3L71D 1F1CA 5CYTR 3GG2A 2ORLA 4L3GA 4PJ0V 1CNOA 4XYDB 1WVEC 3VMAA 5TJHA 1CSVA 2L4DA 1JDLA 3ZOOA 4EIFA 1CSXA 4U3FD 1HCMA 1YTCA 2ZBOA 1EZVD 1GDVA 4WQEA 2FYNB 2B12B 1HRCA 1PPJD 1CRJA 1CHIA 3CWBD 4DY9A 1QL3A 2N3BA 3H1JD 3ORVA 1S6VB 1C2NA 1CTYA 4Y5RA 4MU8A 2Y0CA 1DIQC 3RN0A 1COTA 1M60A 1CORA 4EICA 1DW0A 1BE3D 1I6DA 1CRHA 2C8SA 1FI9A 1E29A 2XTSB 1NNOA 2I8FA 1DVVA 4WQAA 3HQ7A 2FRCA 2N3YA 5E79V 2K9JB 3ZBMA 3FWLA 1NMIA 2CA3B 3MK7C 3OCDA 4V2KA 4FA5A 2JWAA 4AALA 1QYZA 1N90A 1YICA 4WQ7A 3VYMA 1DW2A 1K3HA 1CSWA 2AI5A 3ZOWA 1QN2A 3ZOXA 2N9JA 3H1LD 2B11B 1GIWA 1H33A 1B7VA 2FWLA 1DVHA 2AXTV 1I8OA 4AAMA 1WEJF 2BCNB 1FI7A 1RAPA 451CA 4AAOA 1HJ5A 1MG3D 3PLNA 1YIQA 2BH4X 3TF5A 1RZ5A 1H1OA 4YE1A 5CIDB 1IRWA 1OCDA 3PXWA 2IBZD 1LC1A 4WQDA 1NMLA 3TDKA 3L73D 2VHDA 1FJ0A 1M6ZA 3WFDC 1KIBA 1I6EA 4IL6V 5B5EV 1BCCD 4RSZA 5H2FV 3NBSA 2OZ1A 3SLEA 5KKZB 1CCRA 1H31A 3ZIYA 1YCCA 3C2CA 1L0LD 1CC5A 5B66V 2EXVA 2MTAC 1MG2D 2GC4D 4GEDB 1CHJA 1M70A 4UB8V 3L74D 5CICB 4EIEA 1AOFA 3KZIV 2BCCD 2LIRA 5DF5A 1H32A 4K3IA 2LITA 1AKKA 4H0KA 1LS9A 3ZOYA 3O1YA 1C7MA 1C6SA 4J20A 1HROA 1HH7A 5EXQA 4H0JA 3O20A 1NTMD 2D0WA 1KYOD 2C1VA 155CA 3RN1A 2Q3EA 2YK3A 4AX3A 3PXSA 1C6RA 1A8CA 1C2RA 1LFMA 5KLVD 2DVHA 1K3GA 1I54A 1CEDA 2BH5X 3PRJA 1RAQA 1DIIC 1GU2A 1CIFA 2GB8B 2CE1A 2ZXYA 1EB7A 5C0ZA 2C1DB 3SVWA 4RJTA 1R0QA 1L0ND 2L91A 2C1UA 1GJQA 2QJYB 1CIGA 4A7PA 2PACA 2D0SA 2FYUD 5B6QA 2JTIB 3H1ID 2QJKB 2Y0DA 1NTKD 1W2LA 5CIEB 3CX5D 3TGUD 2C2CA 1U75B 4PW9B 1SQBD 3M97X 3TYIA 1RZ6A 1CXAA 2N9YB 2A06D 3O0RC 1W5CT 1YEBA 3KHUA 3SXTA 2QG4A 1HZUA 1E2RA 3HQ9A 3O5CA 1CRIA 3CX5W 2CE0A 2C9XB 2ZONG 1IZL0 1N50A 1CYIA 1CTZA 5AURA 3PH2B 1P84D 1KV9A 1QKSA 1YNRA 2BGVX 1LC2A 3WFCC 1F1FA 1A2SA 4EDFA 3PTZA 1GQ1A 5C9MA 1IRVA 1ZZHA 4QAOA 3A0BV 1IQCA
chains in the Genus database with same CATH superfamily
1BDCA 1L0NK 1CIHA 1MZ4A 3CLQA 1J1EC 1GU4A 2PCCB 3WU2V 2KS1A 4I1LA 3KDPB 3H32A 1LWUA 3M9HA 2OARA 2OYOA 2ZZS1 3NBTA 1PP9E 3KPEA 4PD4D 4NPEA 2RH0A 4ASVA 2KB7P 2WSSH 1CYCA 3HTKA 4H13B 3L75D 3CC4P 3G71P 4PD4H 1VQLP 2ZAEB 1QLED 2IFNA 1PGQA 1FZGA 3HQ8A 4FANA 1JCCA 2J5UA 5IY51 3WFBC 1GW4A 1NTKJ 3X39A 1Q2NA 1L0NG 4RKUJ 2R3SA 3VNWA 1R5LA 2YQBA 3DMIA 5AVVB 1C6OA 1YFCA 4WQ9A 3RK2C 1KX7A 2L5GB 2PRRA 1KYOW 3BCCE 2HV4A 1HZVA 4FB1A 3H1HD 3VRDA 5GTHV 2A06G 2I1KA 3OA7A 2YCCA 1E5WA 3RK2D 1C52A 1H88A 1L9JC 1JY3N 1KORA 2LKMA 2Y0EA 3PXTA 1EDKA 4PV1D 1LMSA 3AE6C 1NU1J 3WUIA 2C1DA 1NHLA 4JPZB 1DW3A 5DFSA 3MIWA 1KC8Q 2HPCA 4U3FE 1URQB 1QX8A 1U74B 2M3EA 2E76C 4XXLA 3FX0A 5DJUB 3ABVC 4O1QA 4OVNF 1IO4A 4NFGB 1FOCA 1N86A 5KAFV 3L72D 1IFIA 3RMZA 5CIFB 2E76D 2B0ZB 1NTZD 1SQPK 1PV3A 4L1QA 2IYPA 1H9YA 3RK3D 3H6PA 2BEQD 2WVRA 1NIRA 3LW5H 1AVOA 1FBMA 4GDOA 1N7SB 3AEFC 2RKLA 4DCKA 1N73B 5AW5B 1KILD 3O8ZA 1FHBA 4PJ0E 2KNCB 3WC8A 2C9NY 4P4QB 1YHQP 2ZT9B 1SQBE 1JUNA 1JMBA 5AVUB 1CRYA 3OA8A 1YJNP 4JBZA 1EZVG 4JCGA 2YIUC 1SQPG 3NXSA 3CMAP 4IFFA 3ZCFA 5AW1B 1OIPA 4L3GA 4WVZA 2IZ0A 2OQQA 1GK4A 1EXIA 1WVEC 3S9OA 1EZVD 4D6TG 5CCHD 1KD1Q 3RBXA 2B12B 1Q90D 2M8RA 1JB0J 1BCCE 1LP1A 1CRJA 1IQCA 4LC1A 3CWBD 1L0LE 3H1KG 1C2NA 4MU8A 3WU2H 1SS1A 3RK3B 1EDJA 3RN0A 1CORA 3L74E 3T97B 2E5TA 3NFQA 1LTJB 1CRHA 2C8SA 2K9YA 1FI9A 1JO5A 2J58A 1SQXJ 2YKQA 1CSBA 2KIKA 4K35A 4OGQB 1HGVA 5E79V 3AEDC 2K9JB 1YTZT 1JTHA 4KJMA 3SFEC 1NMIA 1NKNA 1Z56A 3OCDA 3CC7P 4FA5A 5CJ4A 2OYIA 3TNUA 2IBZG 3L70G 3W67A 2YMKA 1JY2O 2N9JA 4C7RA 1GTWA 4I2LC 2OGUA 1P84I 1VQ6P 1FI7A 1VQ7P 4AAOA 2W6BA 5GTHH 1IK9A 1VL2A 2K88A 1X8YA 5CCGD 1L0NE 2I8DA 1G2CA 3KZIE 2OYHA 3L71G 2IBZD 3L73D 2VHDA 1M6ZA 2H89C 1VF5C 1CI6A 1KIBA 1CZQA 4XA4A 5H2FV 2A06E 1NTMJ 1T8ZA 5APVA 1N2DC 1HWTC 3C1LA 1YCCA 3C2CA 3H1JJ 1NTKK 1K73Q 1VF5D 2GC4D 2WZ7A 2AEMA 2KSJA 1CHJA 1PGOA 4TT3H 1J1DC 2A45G 4MN4C 4EIEA 3GHGB 4YXDC 4O9BA 2LIRA 2AEJA 1FOSF 4H0KA 4IFDK 3AE1C 2ZXEB 1BE3G 3VP9A 1OX3A 3MP7B 1IFPA 2XDJA 4EI2A 4OWFA 4H0JA 4ZKUA 3H1IJ 1S4XA 4JF7A 2KP8A 1HBWA 1EXJA 3RN1A 1KQFB 5AW3B 1C2RA 1NU1K 4W80A 1FDOA 1NTKG 2BH5X 1RAQA 2A45H 5AVTB 2GB8B 4BRYB 3ZDMA 1EB7A 3D0WA 5B5EH 1RQVA 3SVWA 2C1UA 2N1TC 1HF9A 2GA1A 3IF4A 4A7PA 1VQMP 1FZCC 2PACA 3MGNA 4WY4B 3IAOA 4ZKPA 4W7ZA 2QJKB 1M8OB 1NTKD 2HYNA 3MZWB 5CIEB 4UB8H 5CCGA 2DW3A 2C2CA 2XU6A 1U75B 4PW9B 3M97X 3SWYA 2JJLA 2M5AA 2H88C 2PP6A 3O0RC 1W5CT 4XE5B 3AEAC 1LT9B 1SQQK 1NU1G 2CE0A 1SQPE 2D2CB 2NPSC 1IZL0 2Z5HA 3WU2E 2ZYAA 3PH2B 1RF0C 1M1JC 3HD7C 3PTZA 5C9MA 1IRVA 1ZZHA 4QAOA 4D6TE 1NU1D 3L35A 2BCCG 1ZRTD 3WFEC 3HD7D 1H31B 2HR3A 3H1KE 4GODA 3CL3D 1SQQG 4K3AA 5KLVJ 1E79H 1N8RQ 4JYCA 3B5ND 3L4OA 2P1JA 1AA0A 1L9BC 3CP5A 1LWUC 3VMXA 2CK3H 2HG5D 5GTHE 2C0XA 2J59M 2O3JA 4L73A 5KKZC 1SQVE 2FYUJ 4H44C 1SQQD 1VQ9P 3CXHW 2AIUA 4WQCA 1KB9E 1I8PA 1CO6A 1X22A 3B4SA 3CYTI 3HUSA 1SVFA 1FZEA 2I1JA 3L70E 1KYOH 4WQ8A 1IJDB 3CI9A 1JY2N 4N6JA 4YPCA 3TGUG 4FA4A 1FZCA 1OXZA 5H2FH 2E74C 3EFFK 2WPQA 1W2BO 3MK7B 1CRCA 1GKSA 1FAVA 5KAFE 5AVWB 1CYJA 1S9KD 4H13D 4AANA 2FKWB 3L71E 5KLIB 3V2RA 1N15A 3GW6A 1S3JA 2HODB 1QVFO 1FZAA 1AOQA 3MD0A 1L4AB 1MFZA 3V2QA 4L3HA 5KAIH 3CPWO 3CU4A 2Q9IA 5AVRB 2R5DA 1RF0A 1CHHA 2E75B 5TISH 1M1JA 1NKZB 2CA4B 3HD7A 5AVSB 1GL2D 2YKPA 1USDA 5EFWB 1WT6A 1BGYJ 2IDBA 1CCHA 1NO4A 2FY8A 3B5NA 3HRNA 1ZR4A 1BE3E 3I56P 3JBTB 3C9IA 1URQC 2WT7A 1CW5A 1SQXD 2JQRA 1HJ3A 2QJPB 4WB4A 3L75G 1IK7A 2OZ1B 1R8EA 4AUWA 3V6IA 4YTPC 2N9BA 1A02J 4XFJA 1URQD 1R5SA 3H32B 5AW2B 2CXBA 4Y28J 3Q3DA 1VQ5P 1BL9A 1BSNA 1H0TA 2HFED 1Y47A 2IX7C 1S5LH 3OJAB 1IFJA 1H32B 2YMYA 3MTUE 3I55P 1C75A 3VOPA 1M56D 1N7SC 3H1HG 1EDIA 2YXQB 1N73C 4HB1A 4JYBA 2V7QJ 3BRVB 1F1CA 3GG2A 3BRTB 5CMZA 3V5BA 1NTZK 1DEEG 1DEBA 3VMAA 3W68A 1N7SD 1CSVA 2L4DA 3ZOOA 2ZT9C 3AE2C 5C39A 3WMM0 3Q5RA 4W7YA 3F89A 1GDVA 5AW9B 5E79E 2FYNB 1ZRTE 1GL2B 2KUBA 4PV1C 1PPJD 1PP9J 5AVYB 2ZT9D 4ZMDA 1TU3F 1CHIA 2W6JH 1OW8A 1JOCA 3H1JD 3ORVA 2VRSA 4UB6H 2CPBA 1GD2E 4EICA 3L72G 2AEFA 1GW3A 1E29A 2BCCE 3VMYA 3KXDA 1NTZG 1DVVA 1IFMA 1EDLA 4WQAA 2R3CA 4LLHA 3H1LG 2HPCB 2NZ2A 3S1KA 3FWLA 5AW6B 2CA3B 1SQQE 2XNXA 3RK3C 2JWAA 1KYOE 3BCCJ 3A2AA 2QVAA 4C7NB 1SFCB 3VYMA 1DW2A 3RL0B 1K3HA 2AI5A 1RE4C 1URQA 1NH4A 1QN2A 1S5LX 2OYIC 1KILC 5H2FE 1RHZB 3H1LD 4CPGA 1B7VA 2MJZA 1HTLC 1I8OA 1J1EB 1DD4A 1RAPA 2E42A 1MUUA 1K04A 1HJ5A 1MG3D 2OTKE 1RZ5A 1H1OA 4YE1A 5CIDB 1OCDA 4OGQD 3PXWA 1NMLA 4U3FJ 2G3AA 2GUSA 3O6QB 3CX5E 3WFDC 2IPPA 3TGUE 2OYHC 5B5EV 3AEEC 1N7SA 3NBSA 1N73A 3SLEA 1GMJA 4HKZH 4M3LA 1CC5A 2KNCA 1W2EA 2ZFCA 4GEDB 2W6AA 3F5HA 3V2NA 4UB8V 3BASA 1AOFA 3CWBG 1YTZI 5CCHC 5DF5A 1GK6A 2H8PD 1KMIZ 1C7MA 3SSUA 4J20A 1T6AA 4GKGA 3JC22 2O01J 1XTGB 1FU1A 2P2UA 2D0WA 3RL0g 2C1VA 5KTBA 155CA 1A02F 1SQBJ 1AQ5A 2Q3EA 3PXSA 1C6RA 1LFMA 5KLVD 2DVHA 3CCEP 1S5LE 3M91A 3A7OA 1K3GA 1CEDA 3PRJA 1GU2A 1CIFA 4PD4E 3D6YA 2ZVNB 3P8CD 5C0ZA 3V4WA 3SWFA 3AE9C 3L75E 1Q82Q 3PP5A 4N3YB 4N78D 2FYUD 3T97A 2ZYGA 1LTJA 2Y0DA 3PJSK 3NMDA 1L2PA 1RE4A 1KILA 1RZ6A 1CXAA 1BCCJ 1KFNA 3L73G 1IFNA 4I7ZC 2QG4A 1UIIA 2K9JA 5CCGC 4YXWH 1E2RA 1L0LJ 1CRIA 1RF1C 2P10A 1AFOA 3H1HE 2ZONG 1GZLA 1N50A 1PGJA 1CYIA 3G3ZA 3L74J 5AURA 2QJKC 1P84D 1QKSA 4Y99C 1YNRA 2UWJE 2BGVX 1OW6A 3CCMP 1QGKB 2BASA 1P84H 3KYQA 3RGUA 1KB9I 4WY4D 3A0BV 1WMKA 1NVOA 3NWVA 2ZXXA 3E1RA 1AVYA 2W27A 1VQKP 3HQ6A 2B4ZA 4R4MA 2WSCH 2RN0A 4WWIA 1E8EA 5CCHA 1ZXGA 3A3YB 2E5YA 4KHXA 1LGHB 1LT1A 2D2CD 3L72E 2YO2A 3R2PA 2KZIA 1BGYD 5CIHB 3CXHD 1NTZE 1HJBA 5KAIV 4Z1MH 3Q5SA 3FGAD 3H1LE 1H8AA 1L0NJ 3BVHA 4LJIA 3M0DC 3RK3E 3CCQP 2Q1KA 1ZR2A 2GC7D 4EIDA 4AYCA 2RMZA 3DP5A 1FI3A 5TISV 3CC2P 3CXHH 4WQBA 3DR0A 2OTJP 2LXCB 3HE5B 3GHGA 5L8RJ 1CIEA 2WSEJ 3G6EP 5DJQB 1KILE 2ZJSE 3FWNA 3B71A 2PCBB 4RESB 2KSEA 2A45I 2ZOOA 2GIWA 1LTBC 3HUSC 1VYDA 1FC2C 1QEXA 3AE7C 1S2EA 2SPZA 3EFGA 2QIWA 1HJ4A 1JY2P 2P58A 2WWWA 5BU8B 3L4MA 2W90A 1NWQA 3EWKA 3RLMA 3SWKA 4BRYA 1MZ9A 1DW1A 5CIBB 1RF1A 1ZV8A 1DT1A 1S5LV 2LXBA 4KMGA 3M9BA 1HUCA 2WMMA 4WBAA 1S1CX 2R44A 3P32A 3AEGC 1EZVE 5APTA 1H33B 3FXDA 2QJYC 1LTGC 1PP9D 3OAKA 2B89A 1T2KD 1K8AQ 2Z5IA 2NRGA 3CWBE 3CCRP 1M1KQ 4IFMA 1PIXA 2R32A 2PAJA 351CA 1CSUA 1JCDA 1L4AC 4DT0A 3U1CA 1IO3A 2N18B 3B5NC 1X9VA 1SP4A 4UB6V 4R4LA 5APXA 1L4AD 2ZYDA 3Q1MA 2BPBB 3IN6A 1FZBA 3BCCD 1SQPJ 3D71A 2E75D 3M0DA 1YI2P 5AW4B 1CXCA 3TYYA 4GT1A 3IR9A 3CD6P 3M9QA 1JMMA 2BLFB 4Q5PA 3M0AA 2Q3IA 3VTPC 2AXCA 1KQLA 2ORLA 2H43A 2M3BA 1ZMEC 4D6TJ 1P84E 3JCUH 2O1JA 2IBZE 4EIFA 1NAFA 4U3FD 3L73E 4U7JA 1SQXK 3U1AA 1KYOI 1Q7YQ 3H1KJ 1VQPP 3AECC 4WQEA 4H13C 3A0BH 2Q7CA 2N1TB 5AVZB 3HE4B 1QL3A 2N3BA 2C9LY 1CTYA 1KQGB 2P7JA 1VQ8P 2Y0CA 5KJ7C 1GU5A 1ZN5A 1COTA 1M60A 2JDIH 1DW0A 1I6DA 5APWA 2Q5UA 1SQVJ 2B87B 2H7HA 1JY3P 2XNDH 3LIEA 2I8FA 2KZJA 1YJ9P 3CXHE 3HQ7A 2FYNC 4H0LB 2FXOA 2NPSB 1GL2C 5KJ7D 2QA4P 3CX5I 1K9MQ 1RH5B 1SQXG 3P7KA 3L70J 1HVVA 2K37A 1FDIA 2IZ1A 4AALA 1QYZA 2JO1A 2HODA 1YICA 4PJ0H 1IZNB 4GIFA 1L4AA 3ZOWA 5B5EE 1VQ4P 1AQTA 1MKMA 1GIWA 1UIXA 1NTMK 3R4YA 2KXPB 2GM4A 2GUVA 1DVHA 3UIAA 4AAMA 2P67A 2BCNB 3L71J 2FFDB 451CA 3L4FA 3OW2O 3PLNA 1YIQA 4DJGA 2BH4X 2FBWC 4UB8E 1H89A 2KS1B 2WTYA 3L74G 1NGMB 1SFCC 1AJYA 2WPSA 3RL0C 5BVZA 1LWUB 3RBZA 1NTKE 1I6EA 1YQ4C 1HGZA 4RO0A 5AW7B 1BCCD 3VYIA 1QVGO 3WUTA 2OZ1A 1H0TB 5KKZB 3ZIYA 1SFCD 1L0LD 4H44B 3HTKB 3RL0D 5B66V 1OMIA 2G8YA 1YBKA 4PD4I 1NTMG 1M70A 1SLQA 1PPJG 3V2PA 3L74D 5CICB 1BE3J 2FFDA 4OH8B 1JM0A 3H1JG 1FE6A 2JKVA 1H32A 4K3IA 1LTTC 1AKKA 3O1YA 2KLUA 1C6SA 2JWDA 3P8MC 1NU1E 1HROA 1HH7A 2E74B 1XTCC 3E1IA 2AXTH 3O20A 3AE4C 1NTMD 5KJ7A 1OZHA 2O1KA 4AX3A 1S72P 3H1IG 1FJKA 1DIIC 1U57A 1GL2A 2CE1A 1M90Q 1Y9BA 4IL6H 2C1DB 5K5GB 1OWAA 3JSVC 4RJTA 3MUDC 1G1IA 1L0ND 2L91A 1CIGA 1FOSE 2KI7B 3JCUE 2JTIB 3H1ID 2QM7A 3SFDC 2O01N 1W2LA 2KOGA 3KZIH 1LJ2A 2A06D 3A0BE 1J2JB 1LTJC 1YEBA 2Q6QA 3KHUA 2MKVA 3SXTA 3WUUA 2YNYA 2WSEH 3D70A 3HQ9A 4LGDE 3CX5W 3IFMA 1EC5A 2W8ZA 4OGQC 2PGDA 1Q81Q 1CTZA 5BU5A 2XZRA 4C7NA 1SFCA 5APQA 5KLVK 1RE3C 2BCCJ 1KV9A 1NAYA 1S9KE 1BDDA 3WFCC 3MHVA 1F1FA 1A2SA 4EDFA 1EQ7A 1GQ1A 5KAIE 1QL2A 1YITP 1SQQJ 2Y9ZA 2IFMA 3PH0A 1J3SA 1ZW0A 2FYUK 5TISE 3OA8B 3U59A 2POHA 4BWNA 5DJTB 2OTLP 1RQUA 2E43A 1CTJA 3FXEA 3O6QA 3GF7A 2WSFJ 3RK2B 3GMAA 3TK1A 3PHLA 3USSA 2DGEA 3ITKA 3A0HV 5GTIV 4I6MC 1DX7A 1AYGA 1LNQA 1WRGA 4IL6X 5KLVG 3SJLA 1H9XA 2IYOA 1IC2A 4L76A 4PV1B 1FDMA 1VQOP 4GOEA 1M7LA 2QEXP 1SQXE 1USEA 1OW7A 3VN0A 3I5CA 2V08A 1LP1B 1JEKA 3TGUJ 1EZVI 1A56A 1KN7A 2FYUG 1SQVK 3GHGC 1YEAA 1YJWP 2XKMA 1I5TA 1FZFA 3MUDA 1ETPA 1SQPD 3L37A 3CCJP 3BATA 2K1AA 1OAEA 2W83C 2E76B 3AE3C 3Q2YA 1I55A 2N9IA 4N0KA 4AQRD 1KB0A 1D7MA 5DJQC 5B66H 2QE7H 3SWSA 1JTHB 4TLFA 3OCDB 3WUVA 2FXMA 2HLOA 4D6TD 4EYYQ 2OYIB 1KILB 3KQGA 2AXTE 2ZVOB 3TNUB 1VDFA 2JR8A 1KX2A 4GYDA 1SQVG 5APUA 3H1KD 1RE3A 4UB6E 3NTNA 2JEEA 4FA1A 1NTME 3EQ2A 1PPJE 4WY4C 4DOJA 3QWOC 3H1JE 2QSIA 3Q5PA 1KTMA 4IL6E 3A9FA 1M57D 1G2CB 2OYHB 3L75J 2KK7A 5APYA 2B9BA 1K05A 1SQVD 2B10B 4EIJA 5CIGB 1LT9C 1CI6B 1N9CA 2YIUB 1BGYG 3TSIA 4PWAA 2IBZI 2D2CC 1KB9D 2WQYC 1GDTA 4FAVA 1X79B 3M06A 4O1WA 2KLVA 1DIPA 3GLMA 2FYZA 2MHMA 3H1IE 3LIDA 3L70D 1KB9H 1VPCA 1PFIA 2C0WA 5AW0B 1QL4A 3H1HJ 2V07A 2QM8A 1KV4A 3C8VA 3D6ZA 3II6A 2N18C 2Y9YA 4FA9A 3CCVP 1HJ0A 1YQ3C 1FCDC 2M0BA 3VP8A 1PZQA 1CRGA 3L71D 5M1BA 2KYVA 3QH9A 5CYTR 3CXHI 1HH0A 4PJ0V 5KAFH 2YO3A 2V4HA 1CNOA 4XYDB 2BEZF 5TJHA 1JDLA 1CSXA 1FS0E 1HCMA 3AE5C 1YTCA 2ZBOA 4NPFX 3CCLP 1HRCA 3HE5A 1ZOYC 2FXPA 1FJPA 3L72J 1MV8A 2WITA 4DY9A 1S6VB 4Y5RA 3B8EB 1NTZJ 1DIQC 3LW5J 1OFCX 1PP9G 1BSHA 3H1LJ 3A5TA 1BE3D 1DD3A 3G9RA 2XTSB 4I7ZB 1NNOA 1Y8AA 1RF1B 2K3RA 2V7QH 2YXRB 2M5AB 3A0HH 5GTIH 5CHXA 1T2KC 2FRCA 2N3YA 3AE8C 1IFDA 3ZBMA 4WY4A 4DZOA 1AV1A 4NPDA 3MK7C 4V2KA 4Y99B 3L36A 1N90A 4WQ7A 2N1TD 5KLIC 1YIJP 1KQSO 1CSWA 1LT9A 1VF5B 3V4QA 5KLVE 1OVRA 5APSA 3ZOXA 3BCCG 2B11B 1ZP0C 1H33A 2FWLA 4H0LC 2AXTV 3P8CE 5B66E 1WEJF 4JQ0D 1JY3O 4EOTA 1LTAC 3TF5A 3CCSP 1IRWA 2E75C 2Z4EA 4N78E 2YKOA 1J1DB 4H0LD 4WQDA 1LC1A 2FYUE 2NPSD 3TDKA 5CBNA 1LTSC 1FJ0A 3S4RA 4IL6V 4RSZA 2XV5A 1T3JA 4U3FG 1CCRA 1NOHA 4KT0J 1H31A 4B86A 2FFDC 1NJIQ 3CWBJ 5E79H 2ITAA 2EXVA 3K5BA 2MTAC 2QJPC 1MG2D 1U7MA 1VQNP 5CJ0A 2CPSA 1SQBK 1T3UA 5AW8B 3KZIV 2JP3A 2BCCD 1PGPA 1KZUB 2LITA 3HUSB 1LS9A 3AEBC 3ZOYA 4GOFA 1MFTA 1KFMA 1YYCA 2WPRA 1JNMA 2LR2A 4HJGH 5EXQA 4QMAA 1DH3A 1FZCB 1KYOD 2PFXA 2B88A 5AVQB 2YK3A 1A8CA 3G4SP 1OVVA 4H44D 1U7JA 1ZLLA 1I54A 4HYTB 1SQBG 2N1TA 2ZXYA 1L0LK 3HE4A 4C46A 1BGYE 2WPVB 1R0QA 2WSFH 3N4XA 3E7KA 3H25A 2QJYB 1GJQA 4L75A 3CCUP 2D0SA 3GF3A 5B6QA 3L73J 3VMZA 2R5BA 2B87A 3CX5D 1M1JB 2WSCJ 2E74D 1W5CE 3TGUD 4HH2A 5AVXB 1SQBD 4L74A 3TYIA 1RY3A 3HD7B 2N9YB 3CMEP 4BXLA 1PL5A 2NPSA 2O01H 1HZUA 3CX5H 1G1JA 3O5CA 5CBOA 1OVUA 1X0TA 3B5NB 2C9XB 1BCCG 4IOIH 2WT7B 1QL1A 1L0LG 1Q86Q 1LC2A 1LTIC 3N7NA 3A0HE 5GTIE 1NYHA 2QRXA 4ASWA 4ZNCA 1N7LA
chains in the Genus database with same CATH topology
3NWVA 1ZRTD 1CIHA 1J3SA 1MZ4A 3WFEC 3OA8B 3HQ6A 2B4ZA 1H31B 2PCCB 2RN0A 3WU2V 2KS1A 1E8EA 1CTJA 2ZZS1 3NBTA 3L4OA 4PD4D 3PHLA 2DGEA 3ITKA 3A0HV 5GTIV 1L9BC 3CP5A 1AYGA 1CYCA 1BGYD 5CIHB 3CXHD 5KAIV 3SJLA 1H9XA 3L75D 4LJIA 2O3JA 2GC7D 3HQ8A 4EIDA 2RMZA 3DP5A 1FI3A 5TISV 1SQQD 4FANA 4WQBA 3DR0A 5IY51 3WFBC 3CXHW 2AIUA 3X39A 4WQCA 1CIEA 2V08A 1I8PA 5DJQB 3VNWA 1CO6A 2YQBA 3DMIA 1C6OA 1YFCA 4WQ9A 1A56A 3CYTI 1KX7A 1YEAA 2PCBB 1I5TA 4WQ8A 1KYOW 4FA4A 2HV4A 1HZVA 1ETPA 2GIWA 2ZOOA 4FB1A 1SQPD 3H1HD 3VRDA 5GTHV 2YCCA 1VYDA 1C52A 1OAEA 1L9JC 1I55A 2N9IA 3MK7B 1CRCA 1GKSA 4N0KA 1KB0A 1CYJA 5DJQC 1HJ4A 4AANA 3L4MA 3SWSA 2Y0EA 3RLMA 3PXTA 5KLIB 1N15A 1LMSA 3GW6A 3OCDB 4D6TD 1DW1A 3WUIA 2C1DA 5CIBB 1DT1A 1S5LV 1DW3A 4KMGA 5DFSA 1AOQA 4L3HA 1KX2A 4GYDA 1U74B 3CU4A 3H1KD 4XXLA 4O1QA 1H33B 4NFGB 4FA1A 1CHHA 1FOCA 1NU1D 1PP9D 5KAFV 2CA4B 3L72D 3RMZA 5CIFB 2B0ZB 3A9FA 1NTZD 1CCHA 4L1QA 351CA 1H9YA 1CSUA 1SQVD 2B10B 3JBTB 5CIGB 1NIRA 1SQXD 2JQRA 1N9CA 1IO3A 2YIUB 2N18B 1HJ3A 2QJPB 4PWAA 1KB9D 2OZ1B 4FAVA 4UB6V 4O1WA 1FHBA 2MHMA 2BPBB 2KNCB 3L70D 3WC8A 2CXBA 4P4QB 3BCCD 1QL4A 1BL9A 2V07A 1CXCA 1CRYA 3OA8A 1H32B 2BLFB 4JCGA 2N18C 4Q5PA 1C75A 4FA9A 1FCDC 3ZCFA 1CRGA 3L71D 1F1CA 5CYTR 3GG2A 2ORLA 4L3GA 4PJ0V 1CNOA 4XYDB 1WVEC 3VMAA 5TJHA 1CSVA 2L4DA 1JDLA 3ZOOA 4EIFA 1CSXA 4U3FD 1HCMA 1YTCA 2ZBOA 1EZVD 1GDVA 4WQEA 2FYNB 2B12B 1HRCA 1PPJD 1CRJA 1CHIA 3CWBD 4DY9A 1QL3A 2N3BA 3H1JD 3ORVA 1S6VB 1C2NA 1CTYA 4Y5RA 4MU8A 2Y0CA 1DIQC 3RN0A 1COTA 1M60A 1CORA 4EICA 1DW0A 1BE3D 1I6DA 1CRHA 2C8SA 1FI9A 1E29A 2XTSB 1NNOA 2I8FA 1DVVA 4WQAA 3HQ7A 2FRCA 2N3YA 5E79V 2K9JB 3ZBMA 3FWLA 1NMIA 2CA3B 3MK7C 3OCDA 4V2KA 4FA5A 2JWAA 4AALA 1QYZA 1N90A 1YICA 4WQ7A 3VYMA 1DW2A 1K3HA 1CSWA 2AI5A 3ZOWA 1QN2A 3ZOXA 2N9JA 3H1LD 2B11B 1GIWA 1H33A 1B7VA 2FWLA 1DVHA 2AXTV 1I8OA 4AAMA 1WEJF 2BCNB 1FI7A 1RAPA 451CA 4AAOA 1HJ5A 1MG3D 3PLNA 1YIQA 2BH4X 3TF5A 1RZ5A 1H1OA 4YE1A 5CIDB 1IRWA 1OCDA 3PXWA 2IBZD 1LC1A 4WQDA 1NMLA 3TDKA 3L73D 2VHDA 1FJ0A 1M6ZA 3WFDC 1KIBA 1I6EA 4IL6V 5B5EV 1BCCD 4RSZA 5H2FV 3NBSA 2OZ1A 3SLEA 5KKZB 1CCRA 1H31A 3ZIYA 1YCCA 3C2CA 1L0LD 1CC5A 5B66V 2EXVA 2MTAC 1MG2D 2GC4D 4GEDB 1CHJA 1M70A 4UB8V 3L74D 5CICB 4EIEA 1AOFA 3KZIV 2BCCD 2LIRA 5DF5A 1H32A 4K3IA 2LITA 1AKKA 4H0KA 1LS9A 3ZOYA 3O1YA 1C7MA 1C6SA 4J20A 1HROA 1HH7A 5EXQA 4H0JA 3O20A 1NTMD 2D0WA 1KYOD 2C1VA 155CA 3RN1A 2Q3EA 2YK3A 4AX3A 3PXSA 1C6RA 1A8CA 1C2RA 1LFMA 5KLVD 2DVHA 1K3GA 1I54A 1CEDA 2BH5X 3PRJA 1RAQA 1DIIC 1GU2A 1CIFA 2GB8B 2CE1A 2ZXYA 1EB7A 5C0ZA 2C1DB 3SVWA 4RJTA 1R0QA 1L0ND 2L91A 2C1UA 1GJQA 2QJYB 1CIGA 4A7PA 2PACA 2D0SA 2FYUD 5B6QA 2JTIB 3H1ID 2QJKB 2Y0DA 1NTKD 1W2LA 5CIEB 3CX5D 3TGUD 2C2CA 1U75B 4PW9B 1SQBD 3M97X 3TYIA 1RZ6A 1CXAA 2N9YB 2A06D 3O0RC 1W5CT 1YEBA 3KHUA 3SXTA 2QG4A 1HZUA 1E2RA 3HQ9A 3O5CA 1CRIA 3CX5W 2CE0A 2C9XB 2ZONG 1IZL0 1N50A 1CYIA 1CTZA 5AURA 3PH2B 1P84D 1KV9A 1QKSA 1YNRA 2BGVX 1LC2A 3WFCC 1F1FA 1A2SA 4EDFA 3PTZA 1GQ1A 5C9MA 1IRVA 1ZZHA 4QAOA 3A0BV 1IQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NWV A;  1ZRT D;  1CIH A;  1J3S A;  1MZ4 A;  3WFE C;  3OA8 B;  3HQ6 A;  2B4Z A;  1H31 B;  2PCC B;  2RN0 A;  3WU2 V;  2KS1 A;  1E8E A;  1CTJ A;  2ZZS 1;  3NBT A;  3L4O A;  4PD4 D;  3PHL A;  2DGE A;  3ITK A;  3A0H V;  5GTI V;  1L9B C;  3CP5 A;  1AYG A;  1CYC A;  1BGY D;  5CIH B;  3CXH D;  5KAI V;  3SJL A;  1H9X A;  3L75 D;  4LJI A;  2O3J A;  2GC7 D;  3HQ8 A;  4EID A;  2RMZ A;  3DP5 A;  1FI3 A;  5TIS V;  1SQQ D;  4FAN A;  4WQB A;  3DR0 A;  5IY5 1;  3WFB C;  3CXH W;  2AIU A;  3X39 A;  4WQC A;  1CIE A;  2V08 A;  1I8P A;  5DJQ B;  3VNW A;  1CO6 A;  2YQB A;  3DMI A;  1C6O A;  1YFC A;  4WQ9 A;  1A56 A;  3CYT I;  1KX7 A;  1YEA A;  2PCB B;  1I5T A;  4WQ8 A;  1KYO W;  4FA4 A;  2HV4 A;  1HZV A;  1ETP A;  2GIW A;  2ZOO A;  4FB1 A;  1SQP D;  3H1H D;  3VRD A;  5GTH V;  2YCC A;  1VYD A;  1C52 A;  1OAE A;  1L9J C;  1I55 A;  2N9I A;  3MK7 B;  1CRC A;  1GKS A;  4N0K A;  1KB0 A;  1CYJ A;  5DJQ C;  1HJ4 A;  4AAN A;  3L4M A;  3SWS A;  2Y0E A;  3RLM A;  3PXT A;  5KLI B;  1N15 A;  1LMS A;  3GW6 A;  3OCD B;  4D6T D;  1DW1 A;  3WUI A;  2C1D A;  5CIB B;  1DT1 A;  1S5L V;  1DW3 A;  4KMG A;  5DFS A;  1AOQ A;  4L3H A;  1KX2 A;  4GYD A;  1U74 B;  3CU4 A;  3H1K D;  4XXL A;  4O1Q A;  1H33 B;  4NFG B;  4FA1 A;  1CHH A;  1FOC A;  1NU1 D;  1PP9 D;  5KAF V;  2CA4 B;  3L72 D;  3RMZ A;  5CIF B;  2B0Z B;  3A9F A;  1NTZ D;  1CCH A;  4L1Q A;  351C A;  1H9Y A;  1CSU A;  1SQV D;  2B10 B;  3JBT B;  5CIG B;  1NIR A;  1SQX D;  2JQR A;  1N9C A;  1IO3 A;  2YIU B;  2N18 B;  1HJ3 A;  2QJP B;  4PWA A;  1KB9 D;  2OZ1 B;  4FAV A;  4UB6 V;  4O1W A;  1FHB A;  2MHM A;  2BPB B;  2KNC B;  3L70 D;  3WC8 A;  2CXB A;  4P4Q B;  3BCC D;  1QL4 A;  1BL9 A;  2V07 A;  1CXC A;  1CRY A;  3OA8 A;  1H32 B;  2BLF B;  4JCG A;  2N18 C;  4Q5P A;  1C75 A;  4FA9 A;  1FCD C;  3ZCF A;  1CRG A;  3L71 D;  1F1C A;  5CYT R;  3GG2 A;  2ORL A;  4L3G A;  4PJ0 V;  1CNO A;  4XYD B;  1WVE C;  3VMA A;  5TJH A;  1CSV A;  2L4D A;  1JDL A;  3ZOO A;  4EIF A;  1CSX A;  4U3F D;  1HCM A;  1YTC A;  2ZBO A;  1EZV D;  1GDV A;  4WQE A;  2FYN B;  2B12 B;  1HRC A;  1PPJ D;  1CRJ A;  1CHI A;  3CWB D;  4DY9 A;  1QL3 A;  2N3B A;  3H1J D;  3ORV A;  1S6V B;  1C2N A;  1CTY A;  4Y5R A;  4MU8 A;  2Y0C A;  1DIQ C;  3RN0 A;  1COT A;  1M60 A;  1COR A;  4EIC A;  1DW0 A;  1BE3 D;  1I6D A;  1CRH A;  2C8S A;  1FI9 A;  1E29 A;  2XTS B;  1NNO A;  2I8F A;  1DVV A;  4WQA A;  3HQ7 A;  2FRC A;  2N3Y A;  5E79 V;  2K9J B;  3ZBM A;  3FWL A;  1NMI A;  2CA3 B;  3MK7 C;  3OCD A;  4V2K A;  4FA5 A;  2JWA A;  4AAL A;  1QYZ A;  1N90 A;  1YIC A;  4WQ7 A;  3VYM A;  1DW2 A;  1K3H A;  1CSW A;  2AI5 A;  3ZOW A;  1QN2 A;  3ZOX A;  2N9J A;  3H1L D;  2B11 B;  1GIW A;  1H33 A;  1B7V A;  2FWL A;  1DVH A;  2AXT V;  1I8O A;  4AAM A;  1WEJ F;  2BCN B;  1FI7 A;  1RAP A;  451C A;  4AAO A;  1HJ5 A;  1MG3 D;  3PLN A;  1YIQ A;  2BH4 X;  3TF5 A;  1RZ5 A;  1H1O A;  4YE1 A;  5CID B;  1IRW A;  1OCD A;  3PXW A;  2IBZ D;  1LC1 A;  4WQD A;  1NML A;  3TDK A;  3L73 D;  2VHD A;  1FJ0 A;  1M6Z A;  3WFD C;  1KIB A;  1I6E A;  4IL6 V;  5B5E V;  1BCC D;  4RSZ A;  5H2F V;  3NBS A;  2OZ1 A;  3SLE A;  5KKZ B;  1CCR A;  1H31 A;  3ZIY A;  1YCC A;  3C2C A;  1L0L D;  1CC5 A;  5B66 V;  2EXV A;  2MTA C;  1MG2 D;  2GC4 D;  4GED B;  1CHJ A;  1M70 A;  4UB8 V;  3L74 D;  5CIC B;  4EIE A;  1AOF A;  3KZI V;  2BCC D;  2LIR A;  5DF5 A;  1H32 A;  4K3I A;  2LIT A;  1AKK A;  4H0K A;  1LS9 A;  3ZOY A;  3O1Y A;  1C7M A;  1C6S A;  4J20 A;  1HRO A;  1HH7 A;  5EXQ A;  4H0J A;  3O20 A;  1NTM D;  2D0W A;  1KYO D;  2C1V A;  155C A;  3RN1 A;  2Q3E A;  2YK3 A;  4AX3 A;  3PXS A;  1C6R A;  1A8C A;  1C2R A;  1LFM A;  5KLV D;  2DVH A;  1K3G A;  1I54 A;  1CED A;  2BH5 X;  3PRJ A;  1RAQ A;  1DII C;  1GU2 A;  1CIF A;  2GB8 B;  2CE1 A;  2ZXY A;  1EB7 A;  5C0Z A;  2C1D B;  3SVW A;  4RJT A;  1R0Q A;  1L0N D;  2L91 A;  2C1U A;  1GJQ A;  2QJY B;  1CIG A;  4A7P A;  2PAC A;  2D0S A;  2FYU D;  5B6Q A;  2JTI B;  3H1I D;  2QJK B;  2Y0D A;  1NTK D;  1W2L A;  5CIE B;  3CX5 D;  3TGU D;  2C2C A;  1U75 B;  4PW9 B;  1SQB D;  3M97 X;  3TYI A;  1RZ6 A;  1CXA A;  2N9Y B;  2A06 D;  3O0R C;  1W5C T;  1YEB A;  3KHU A;  3SXT A;  2QG4 A;  1HZU A;  1E2R A;  3HQ9 A;  3O5C A;  1CRI A;  3CX5 W;  2CE0 A;  2C9X B;  2ZON G;  1IZL 0;  1N50 A;  1CYI A;  1CTZ A;  5AUR A;  3PH2 B;  1P84 D;  1KV9 A;  1QKS A;  1YNR A;  2BGV X;  1LC2 A;  3WFC C;  1F1F A;  1A2S A;  4EDF A;  3PTZ A;  1GQ1 A;  5C9M A;  1IRV A;  1ZZH A;  4QAO A;  3A0B V;  1IQC A; 
#chains in the Genus database with same CATH topology
 1BDC A;  1L0N K;  1CIH A;  1MZ4 A;  3CLQ A;  1J1E C;  1GU4 A;  2PCC B;  3WU2 V;  2KS1 A;  4I1L A;  3KDP B;  3H32 A;  1LWU A;  3M9H A;  2OAR A;  2OYO A;  2ZZS 1;  3NBT A;  1PP9 E;  3KPE A;  4PD4 D;  4NPE A;  2RH0 A;  4ASV A;  2KB7 P;  2WSS H;  1CYC A;  3HTK A;  4H13 B;  3L75 D;  3CC4 P;  3G71 P;  4PD4 H;  1VQL P;  2ZAE B;  1QLE D;  2IFN A;  1PGQ A;  1FZG A;  3HQ8 A;  4FAN A;  1JCC A;  2J5U A;  5IY5 1;  3WFB C;  1GW4 A;  1NTK J;  3X39 A;  1Q2N A;  1L0N G;  4RKU J;  2R3S A;  3VNW A;  1R5L A;  2YQB A;  3DMI A;  5AVV B;  1C6O A;  1YFC A;  4WQ9 A;  3RK2 C;  1KX7 A;  2L5G B;  2PRR A;  1KYO W;  3BCC E;  2HV4 A;  1HZV A;  4FB1 A;  3H1H D;  3VRD A;  5GTH V;  2A06 G;  2I1K A;  3OA7 A;  2YCC A;  1E5W A;  3RK2 D;  1C52 A;  1H88 A;  1L9J C;  1JY3 N;  1KOR A;  2LKM A;  2Y0E A;  3PXT A;  1EDK A;  4PV1 D;  1LMS A;  3AE6 C;  1NU1 J;  3WUI A;  2C1D A;  1NHL A;  4JPZ B;  1DW3 A;  5DFS A;  3MIW A;  1KC8 Q;  2HPC A;  4U3F E;  1URQ B;  1QX8 A;  1U74 B;  2M3E A;  2E76 C;  4XXL A;  3FX0 A;  5DJU B;  3ABV C;  4O1Q A;  4OVN F;  1IO4 A;  4NFG B;  1FOC A;  1N86 A;  5KAF V;  3L72 D;  1IFI A;  3RMZ A;  5CIF B;  2E76 D;  2B0Z B;  1NTZ D;  1SQP K;  1PV3 A;  4L1Q A;  2IYP A;  1H9Y A;  3RK3 D;  3H6P A;  2BEQ D;  2WVR A;  1NIR A;  3LW5 H;  1AVO A;  1FBM A;  4GDO A;  1N7S B;  3AEF C;  2RKL A;  4DCK A;  1N73 B;  5AW5 B;  1KIL D;  3O8Z A;  1FHB A;  4PJ0 E;  2KNC B;  3WC8 A;  2C9N Y;  4P4Q B;  1YHQ P;  2ZT9 B;  1SQB E;  1JUN A;  1JMB A;  5AVU B;  1CRY A;  3OA8 A;  1YJN P;  4JBZ A;  1EZV G;  4JCG A;  2YIU C;  1SQP G;  3NXS A;  3CMA P;  4IFF A;  3ZCF A;  5AW1 B;  1OIP A;  4L3G A;  4WVZ A;  2IZ0 A;  2OQQ A;  1GK4 A;  1EXI A;  1WVE C;  3S9O A;  1EZV D;  4D6T G;  5CCH D;  1KD1 Q;  3RBX A;  2B12 B;  1Q90 D;  2M8R A;  1JB0 J;  1BCC E;  1LP1 A;  1CRJ A;  1IQC A;  4LC1 A;  3CWB D;  1L0L E;  3H1K G;  1C2N A;  4MU8 A;  3WU2 H;  1SS1 A;  3RK3 B;  1EDJ A;  3RN0 A;  1COR A;  3L74 E;  3T97 B;  2E5T A;  3NFQ A;  1LTJ B;  1CRH A;  2C8S A;  2K9Y A;  1FI9 A;  1JO5 A;  2J58 A;  1SQX J;  2YKQ A;  1CSB A;  2KIK A;  4K35 A;  4OGQ B;  1HGV A;  5E79 V;  3AED C;  2K9J B;  1YTZ T;  1JTH A;  4KJM A;  3SFE C;  1NMI A;  1NKN A;  1Z56 A;  3OCD A;  3CC7 P;  4FA5 A;  5CJ4 A;  2OYI A;  3TNU A;  2IBZ G;  3L70 G;  3W67 A;  2YMK A;  1JY2 O;  2N9J A;  4C7R A;  1GTW A;  4I2L C;  2OGU A;  1P84 I;  1VQ6 P;  1FI7 A;  1VQ7 P;  4AAO A;  2W6B A;  5GTH H;  1IK9 A;  1VL2 A;  2K88 A;  1X8Y A;  5CCG D;  1L0N E;  2I8D A;  1G2C A;  3KZI E;  2OYH A;  3L71 G;  2IBZ D;  3L73 D;  2VHD A;  1M6Z A;  2H89 C;  1VF5 C;  1CI6 A;  1KIB A;  1CZQ A;  4XA4 A;  5H2F V;  2A06 E;  1NTM J;  1T8Z A;  5APV A;  1N2D C;  1HWT C;  3C1L A;  1YCC A;  3C2C A;  3H1J J;  1NTK K;  1K73 Q;  1VF5 D;  2GC4 D;  2WZ7 A;  2AEM A;  2KSJ A;  1CHJ A;  1PGO A;  4TT3 H;  1J1D C;  2A45 G;  4MN4 C;  4EIE A;  3GHG B;  4YXD C;  4O9B A;  2LIR A;  2AEJ A;  1FOS F;  4H0K A;  4IFD K;  3AE1 C;  2ZXE B;  1BE3 G;  3VP9 A;  1OX3 A;  3MP7 B;  1IFP A;  2XDJ A;  4EI2 A;  4OWF A;  4H0J A;  4ZKU A;  3H1I J;  1S4X A;  4JF7 A;  2KP8 A;  1HBW A;  1EXJ A;  3RN1 A;  1KQF B;  5AW3 B;  1C2R A;  1NU1 K;  4W80 A;  1FDO A;  1NTK G;  2BH5 X;  1RAQ A;  2A45 H;  5AVT B;  2GB8 B;  4BRY B;  3ZDM A;  1EB7 A;  3D0W A;  5B5E H;  1RQV A;  3SVW A;  2C1U A;  2N1T C;  1HF9 A;  2GA1 A;  3IF4 A;  4A7P A;  1VQM P;  1FZC C;  2PAC A;  3MGN A;  4WY4 B;  3IAO A;  4ZKP A;  4W7Z A;  2QJK B;  1M8O B;  1NTK D;  2HYN A;  3MZW B;  5CIE B;  4UB8 H;  5CCG A;  2DW3 A;  2C2C A;  2XU6 A;  1U75 B;  4PW9 B;  3M97 X;  3SWY A;  2JJL A;  2M5A A;  2H88 C;  2PP6 A;  3O0R C;  1W5C T;  4XE5 B;  3AEA C;  1LT9 B;  1SQQ K;  1NU1 G;  2CE0 A;  1SQP E;  2D2C B;  2NPS C;  1IZL 0;  2Z5H A;  3WU2 E;  2ZYA A;  3PH2 B;  1RF0 C;  1M1J C;  3HD7 C;  3PTZ A;  5C9M A;  1IRV A;  1ZZH A;  4QAO A;  4D6T E;  1NU1 D;  3L35 A;  2BCC G;  1ZRT D;  3WFE C;  3HD7 D;  1H31 B;  2HR3 A;  3H1K E;  4GOD A;  3CL3 D;  1SQQ G;  4K3A A;  5KLV J;  1E79 H;  1N8R Q;  4JYC A;  3B5N D;  3L4O A;  2P1J A;  1AA0 A;  1L9B C;  3CP5 A;  1LWU C;  3VMX A;  2CK3 H;  2HG5 D;  5GTH E;  2C0X A;  2J59 M;  2O3J A;  4L73 A;  5KKZ C;  1SQV E;  2FYU J;  4H44 C;  1SQQ D;  1VQ9 P;  3CXH W;  2AIU A;  4WQC A;  1KB9 E;  1I8P A;  1CO6 A;  1X22 A;  3B4S A;  3CYT I;  3HUS A;  1SVF A;  1FZE A;  2I1J A;  3L70 E;  1KYO H;  4WQ8 A;  1IJD B;  3CI9 A;  1JY2 N;  4N6J A;  4YPC A;  3TGU G;  4FA4 A;  1FZC A;  1OXZ A;  5H2F H;  2E74 C;  3EFF K;  2WPQ A;  1W2B O;  3MK7 B;  1CRC A;  1GKS A;  1FAV A;  5KAF E;  5AVW B;  1CYJ A;  1S9K D;  4H13 D;  4AAN A;  2FKW B;  3L71 E;  5KLI B;  3V2R A;  1N15 A;  3GW6 A;  1S3J A;  2HOD B;  1QVF O;  1FZA A;  1AOQ A;  3MD0 A;  1L4A B;  1MFZ A;  3V2Q A;  4L3H A;  5KAI H;  3CPW O;  3CU4 A;  2Q9I A;  5AVR B;  2R5D A;  1RF0 A;  1CHH A;  2E75 B;  5TIS H;  1M1J A;  1NKZ B;  2CA4 B;  3HD7 A;  5AVS B;  1GL2 D;  2YKP A;  1USD A;  5EFW B;  1WT6 A;  1BGY J;  2IDB A;  1CCH A;  1NO4 A;  2FY8 A;  3B5N A;  3HRN A;  1ZR4 A;  1BE3 E;  3I56 P;  3JBT B;  3C9I A;  1URQ C;  2WT7 A;  1CW5 A;  1SQX D;  2JQR A;  1HJ3 A;  2QJP B;  4WB4 A;  3L75 G;  1IK7 A;  2OZ1 B;  1R8E A;  4AUW A;  3V6I A;  4YTP C;  2N9B A;  1A02 J;  4XFJ A;  1URQ D;  1R5S A;  3H32 B;  5AW2 B;  2CXB A;  4Y28 J;  3Q3D A;  1VQ5 P;  1BL9 A;  1BSN A;  1H0T A;  2HFE D;  1Y47 A;  2IX7 C;  1S5L H;  3OJA B;  1IFJ A;  1H32 B;  2YMY A;  3MTU E;  3I55 P;  1C75 A;  3VOP A;  1M56 D;  1N7S C;  3H1H G;  1EDI A;  2YXQ B;  1N73 C;  4HB1 A;  4JYB A;  2V7Q J;  3BRV B;  1F1C A;  3GG2 A;  3BRT B;  5CMZ A;  3V5B A;  1NTZ K;  1DEE G;  1DEB A;  3VMA A;  3W68 A;  1N7S D;  1CSV A;  2L4D A;  3ZOO A;  2ZT9 C;  3AE2 C;  5C39 A;  3WMM 0;  3Q5R A;  4W7Y A;  3F89 A;  1GDV A;  5AW9 B;  5E79 E;  2FYN B;  1ZRT E;  1GL2 B;  2KUB A;  4PV1 C;  1PPJ D;  1PP9 J;  5AVY B;  2ZT9 D;  4ZMD A;  1TU3 F;  1CHI A;  2W6J H;  1OW8 A;  1JOC A;  3H1J D;  3ORV A;  2VRS A;  4UB6 H;  2CPB A;  1GD2 E;  4EIC A;  3L72 G;  2AEF A;  1GW3 A;  1E29 A;  2BCC E;  3VMY A;  3KXD A;  1NTZ G;  1DVV A;  1IFM A;  1EDL A;  4WQA A;  2R3C A;  4LLH A;  3H1L G;  2HPC B;  2NZ2 A;  3S1K A;  3FWL A;  5AW6 B;  2CA3 B;  1SQQ E;  2XNX A;  3RK3 C;  2JWA A;  1KYO E;  3BCC J;  3A2A A;  2QVA A;  4C7N B;  1SFC B;  3VYM A;  1DW2 A;  3RL0 B;  1K3H A;  2AI5 A;  1RE4 C;  1URQ A;  1NH4 A;  1QN2 A;  1S5L X;  2OYI C;  1KIL C;  5H2F E;  1RHZ B;  3H1L D;  4CPG A;  1B7V A;  2MJZ A;  1HTL C;  1I8O A;  1J1E B;  1DD4 A;  1RAP A;  2E42 A;  1MUU A;  1K04 A;  1HJ5 A;  1MG3 D;  2OTK E;  1RZ5 A;  1H1O A;  4YE1 A;  5CID B;  1OCD A;  4OGQ D;  3PXW A;  1NML A;  4U3F J;  2G3A A;  2GUS A;  3O6Q B;  3CX5 E;  3WFD C;  2IPP A;  3TGU E;  2OYH C;  5B5E V;  3AEE C;  1N7S A;  3NBS A;  1N73 A;  3SLE A;  1GMJ A;  4HKZ H;  4M3L A;  1CC5 A;  2KNC A;  1W2E A;  2ZFC A;  4GED B;  2W6A A;  3F5H A;  3V2N A;  4UB8 V;  3BAS A;  1AOF A;  3CWB G;  1YTZ I;  5CCH C;  5DF5 A;  1GK6 A;  2H8P D;  1KMI Z;  1C7M A;  3SSU A;  4J20 A;  1T6A A;  4GKG A;  3JC2 2;  2O01 J;  1XTG B;  1FU1 A;  2P2U A;  2D0W A;  3RL0 g;  2C1V A;  5KTB A;  155C A;  1A02 F;  1SQB J;  1AQ5 A;  2Q3E A;  3PXS A;  1C6R A;  1LFM A;  5KLV D;  2DVH A;  3CCE P;  1S5L E;  3M91 A;  3A7O A;  1K3G A;  1CED A;  3PRJ A;  1GU2 A;  1CIF A;  4PD4 E;  3D6Y A;  2ZVN B;  3P8C D;  5C0Z A;  3V4W A;  3SWF A;  3AE9 C;  3L75 E;  1Q82 Q;  3PP5 A;  4N3Y B;  4N78 D;  2FYU D;  3T97 A;  2ZYG A;  1LTJ A;  2Y0D A;  3PJS K;  3NMD A;  1L2P A;  1RE4 A;  1KIL A;  1RZ6 A;  1CXA A;  1BCC J;  1KFN A;  3L73 G;  1IFN A;  4I7Z C;  2QG4 A;  1UII A;  2K9J A;  5CCG C;  4YXW H;  1E2R A;  1L0L J;  1CRI A;  1RF1 C;  2P10 A;  1AFO A;  3H1H E;  2ZON G;  1GZL A;  1N50 A;  1PGJ A;  1CYI A;  3G3Z A;  3L74 J;  5AUR A;  2QJK C;  1P84 D;  1QKS A;  4Y99 C;  1YNR A;  2UWJ E;  2BGV X;  1OW6 A;  3CCM P;  1QGK B;  2BAS A;  1P84 H;  3KYQ A;  3RGU A;  1KB9 I;  4WY4 D;  3A0B V;  1WMK A;  1NVO A;  3NWV A;  2ZXX A;  3E1R A;  1AVY A;  2W27 A;  1VQK P;  3HQ6 A;  2B4Z A;  4R4M A;  2WSC H;  2RN0 A;  4WWI A;  1E8E A;  5CCH A;  1ZXG A;  3A3Y B;  2E5Y A;  4KHX A;  1LGH B;  1LT1 A;  2D2C D;  3L72 E;  2YO2 A;  3R2P A;  2KZI A;  1BGY D;  5CIH B;  3CXH D;  1NTZ E;  1HJB A;  5KAI V;  4Z1M H;  3Q5S A;  3FGA D;  3H1L E;  1H8A A;  1L0N J;  3BVH A;  4LJI A;  3M0D C;  3RK3 E;  3CCQ P;  2Q1K A;  1ZR2 A;  2GC7 D;  4EID A;  4AYC A;  2RMZ A;  3DP5 A;  1FI3 A;  5TIS V;  3CC2 P;  3CXH H;  4WQB A;  3DR0 A;  2OTJ P;  2LXC B;  3HE5 B;  3GHG A;  5L8R J;  1CIE A;  2WSE J;  3G6E P;  5DJQ B;  1KIL E;  2ZJS E;  3FWN A;  3B71 A;  2PCB B;  4RES B;  2KSE A;  2A45 I;  2ZOO A;  2GIW A;  1LTB C;  3HUS C;  1VYD A;  1FC2 C;  1QEX A;  3AE7 C;  1S2E A;  2SPZ A;  3EFG A;  2QIW A;  1HJ4 A;  1JY2 P;  2P58 A;  2WWW A;  5BU8 B;  3L4M A;  2W90 A;  1NWQ A;  3EWK A;  3RLM A;  3SWK A;  4BRY A;  1MZ9 A;  1DW1 A;  5CIB B;  1RF1 A;  1ZV8 A;  1DT1 A;  1S5L V;  2LXB A;  4KMG A;  3M9B A;  1HUC A;  2WMM A;  4WBA A;  1S1C X;  2R44 A;  3P32 A;  3AEG C;  1EZV E;  5APT A;  1H33 B;  3FXD A;  2QJY C;  1LTG C;  1PP9 D;  3OAK A;  2B89 A;  1T2K D;  1K8A Q;  2Z5I A;  2NRG A;  3CWB E;  3CCR P;  1M1K Q;  4IFM A;  1PIX A;  2R32 A;  2PAJ A;  351C A;  1CSU A;  1JCD A;  1L4A C;  4DT0 A;  3U1C A;  1IO3 A;  2N18 B;  3B5N C;  1X9V A;  1SP4 A;  4UB6 V;  4R4L A;  5APX A;  1L4A D;  2ZYD A;  3Q1M A;  2BPB B;  3IN6 A;  1FZB A;  3BCC D;  1SQP J;  3D71 A;  2E75 D;  3M0D A;  1YI2 P;  5AW4 B;  1CXC A;  3TYY A;  4GT1 A;  3IR9 A;  3CD6 P;  3M9Q A;  1JMM A;  2BLF B;  4Q5P A;  3M0A A;  2Q3I A;  3VTP C;  2AXC A;  1KQL A;  2ORL A;  2H43 A;  2M3B A;  1ZME C;  4D6T J;  1P84 E;  3JCU H;  2O1J A;  2IBZ E;  4EIF A;  1NAF A;  4U3F D;  3L73 E;  4U7J A;  1SQX K;  3U1A A;  1KYO I;  1Q7Y Q;  3H1K J;  1VQP P;  3AEC C;  4WQE A;  4H13 C;  3A0B H;  2Q7C A;  2N1T B;  5AVZ B;  3HE4 B;  1QL3 A;  2N3B A;  2C9L Y;  1CTY A;  1KQG B;  2P7J A;  1VQ8 P;  2Y0C A;  5KJ7 C;  1GU5 A;  1ZN5 A;  1COT A;  1M60 A;  2JDI H;  1DW0 A;  1I6D A;  5APW A;  2Q5U A;  1SQV J;  2B87 B;  2H7H A;  1JY3 P;  2XND H;  3LIE A;  2I8F A;  2KZJ A;  1YJ9 P;  3CXH E;  3HQ7 A;  2FYN C;  4H0L B;  2FXO A;  2NPS B;  1GL2 C;  5KJ7 D;  2QA4 P;  3CX5 I;  1K9M Q;  1RH5 B;  1SQX G;  3P7K A;  3L70 J;  1HVV A;  2K37 A;  1FDI A;  2IZ1 A;  4AAL A;  1QYZ A;  2JO1 A;  2HOD A;  1YIC A;  4PJ0 H;  1IZN B;  4GIF A;  1L4A A;  3ZOW A;  5B5E E;  1VQ4 P;  1AQT A;  1MKM A;  1GIW A;  1UIX A;  1NTM K;  3R4Y A;  2KXP B;  2GM4 A;  2GUV A;  1DVH A;  3UIA A;  4AAM A;  2P67 A;  2BCN B;  3L71 J;  2FFD B;  451C A;  3L4F A;  3OW2 O;  3PLN A;  1YIQ A;  4DJG A;  2BH4 X;  2FBW C;  4UB8 E;  1H89 A;  2KS1 B;  2WTY A;  3L74 G;  1NGM B;  1SFC C;  1AJY A;  2WPS A;  3RL0 C;  5BVZ A;  1LWU B;  3RBZ A;  1NTK E;  1I6E A;  1YQ4 C;  1HGZ A;  4RO0 A;  5AW7 B;  1BCC D;  3VYI A;  1QVG O;  3WUT A;  2OZ1 A;  1H0T B;  5KKZ B;  3ZIY A;  1SFC D;  1L0L D;  4H44 B;  3HTK B;  3RL0 D;  5B66 V;  1OMI A;  2G8Y A;  1YBK A;  4PD4 I;  1NTM G;  1M70 A;  1SLQ A;  1PPJ G;  3V2P A;  3L74 D;  5CIC B;  1BE3 J;  2FFD A;  4OH8 B;  1JM0 A;  3H1J G;  1FE6 A;  2JKV A;  1H32 A;  4K3I A;  1LTT C;  1AKK A;  3O1Y A;  2KLU A;  1C6S A;  2JWD A;  3P8M C;  1NU1 E;  1HRO A;  1HH7 A;  2E74 B;  1XTC C;  3E1I A;  2AXT H;  3O20 A;  3AE4 C;  1NTM D;  5KJ7 A;  1OZH A;  2O1K A;  4AX3 A;  1S72 P;  3H1I G;  1FJK A;  1DII C;  1U57 A;  1GL2 A;  2CE1 A;  1M90 Q;  1Y9B A;  4IL6 H;  2C1D B;  5K5G B;  1OWA A;  3JSV C;  4RJT A;  3MUD C;  1G1I A;  1L0N D;  2L91 A;  1CIG A;  1FOS E;  2KI7 B;  3JCU E;  2JTI B;  3H1I D;  2QM7 A;  3SFD C;  2O01 N;  1W2L A;  2KOG A;  3KZI H;  1LJ2 A;  2A06 D;  3A0B E;  1J2J B;  1LTJ C;  1YEB A;  2Q6Q A;  3KHU A;  2MKV A;  3SXT A;  3WUU A;  2YNY A;  2WSE H;  3D70 A;  3HQ9 A;  4LGD E;  3CX5 W;  3IFM A;  1EC5 A;  2W8Z A;  4OGQ C;  2PGD A;  1Q81 Q;  1CTZ A;  5BU5 A;  2XZR A;  4C7N A;  1SFC A;  5APQ A;  5KLV K;  1RE3 C;  2BCC J;  1KV9 A;  1NAY A;  1S9K E;  1BDD A;  3WFC C;  3MHV A;  1F1F A;  1A2S A;  4EDF A;  1EQ7 A;  1GQ1 A;  5KAI E;  1QL2 A;  1YIT P;  1SQQ J;  2Y9Z A;  2IFM A;  3PH0 A;  1J3S A;  1ZW0 A;  2FYU K;  5TIS E;  3OA8 B;  3U59 A;  2POH A;  4BWN A;  5DJT B;  2OTL P;  1RQU A;  2E43 A;  1CTJ A;  3FXE A;  3O6Q A;  3GF7 A;  2WSF J;  3RK2 B;  3GMA A;  3TK1 A;  3PHL A;  3USS A;  2DGE A;  3ITK A;  3A0H V;  5GTI V;  4I6M C;  1DX7 A;  1AYG A;  1LNQ A;  1WRG A;  4IL6 X;  5KLV G;  3SJL A;  1H9X A;  2IYO A;  1IC2 A;  4L76 A;  4PV1 B;  1FDM A;  1VQO P;  4GOE A;  1M7L A;  2QEX P;  1SQX E;  1USE A;  1OW7 A;  3VN0 A;  3I5C A;  2V08 A;  1LP1 B;  1JEK A;  3TGU J;  1EZV I;  1A56 A;  1KN7 A;  2FYU G;  1SQV K;  3GHG C;  1YEA A;  1YJW P;  2XKM A;  1I5T A;  1FZF A;  3MUD A;  1ETP A;  1SQP D;  3L37 A;  3CCJ P;  3BAT A;  2K1A A;  1OAE A;  2W83 C;  2E76 B;  3AE3 C;  3Q2Y A;  1I55 A;  2N9I A;  4N0K A;  4AQR D;  1KB0 A;  1D7M A;  5DJQ C;  5B66 H;  2QE7 H;  3SWS A;  1JTH B;  4TLF A;  3OCD B;  3WUV A;  2FXM A;  2HLO A;  4D6T D;  4EYY Q;  2OYI B;  1KIL B;  3KQG A;  2AXT E;  2ZVO B;  3TNU B;  1VDF A;  2JR8 A;  1KX2 A;  4GYD A;  1SQV G;  5APU A;  3H1K D;  1RE3 A;  4UB6 E;  3NTN A;  2JEE A;  4FA1 A;  1NTM E;  3EQ2 A;  1PPJ E;  4WY4 C;  4DOJ A;  3QWO C;  3H1J E;  2QSI A;  3Q5P A;  1KTM A;  4IL6 E;  3A9F A;  1M57 D;  1G2C B;  2OYH B;  3L75 J;  2KK7 A;  5APY A;  2B9B A;  1K05 A;  1SQV D;  2B10 B;  4EIJ A;  5CIG B;  1LT9 C;  1CI6 B;  1N9C A;  2YIU B;  1BGY G;  3TSI A;  4PWA A;  2IBZ I;  2D2C C;  1KB9 D;  2WQY C;  1GDT A;  4FAV A;  1X79 B;  3M06 A;  4O1W A;  2KLV A;  1DIP A;  3GLM A;  2FYZ A;  2MHM A;  3H1I E;  3LID A;  3L70 D;  1KB9 H;  1VPC A;  1PFI A;  2C0W A;  5AW0 B;  1QL4 A;  3H1H J;  2V07 A;  2QM8 A;  1KV4 A;  3C8V A;  3D6Z A;  3II6 A;  2N18 C;  2Y9Y A;  4FA9 A;  3CCV P;  1HJ0 A;  1YQ3 C;  1FCD C;  2M0B A;  3VP8 A;  1PZQ A;  1CRG A;  3L71 D;  5M1B A;  2KYV A;  3QH9 A;  5CYT R;  3CXH I;  1HH0 A;  4PJ0 V;  5KAF H;  2YO3 A;  2V4H A;  1CNO A;  4XYD B;  2BEZ F;  5TJH A;  1JDL A;  1CSX A;  1FS0 E;  1HCM A;  3AE5 C;  1YTC A;  2ZBO A;  4NPF X;  3CCL P;  1HRC A;  3HE5 A;  1ZOY C;  2FXP A;  1FJP A;  3L72 J;  1MV8 A;  2WIT A;  4DY9 A;  1S6V B;  4Y5R A;  3B8E B;  1NTZ J;  1DIQ C;  3LW5 J;  1OFC X;  1PP9 G;  1BSH A;  3H1L J;  3A5T A;  1BE3 D;  1DD3 A;  3G9R A;  2XTS B;  4I7Z B;  1NNO A;  1Y8A A;  1RF1 B;  2K3R A;  2V7Q H;  2YXR B;  2M5A B;  3A0H H;  5GTI H;  5CHX A;  1T2K C;  2FRC A;  2N3Y A;  3AE8 C;  1IFD A;  3ZBM A;  4WY4 A;  4DZO A;  1AV1 A;  4NPD A;  3MK7 C;  4V2K A;  4Y99 B;  3L36 A;  1N90 A;  4WQ7 A;  2N1T D;  5KLI C;  1YIJ P;  1KQS O;  1CSW A;  1LT9 A;  1VF5 B;  3V4Q A;  5KLV E;  1OVR A;  5APS A;  3ZOX A;  3BCC G;  2B11 B;  1ZP0 C;  1H33 A;  2FWL A;  4H0L C;  2AXT V;  3P8C E;  5B66 E;  1WEJ F;  4JQ0 D;  1JY3 O;  4EOT A;  1LTA C;  3TF5 A;  3CCS P;  1IRW A;  2E75 C;  2Z4E A;  4N78 E;  2YKO A;  1J1D B;  4H0L D;  4WQD A;  1LC1 A;  2FYU E;  2NPS D;  3TDK A;  5CBN A;  1LTS C;  1FJ0 A;  3S4R A;  4IL6 V;  4RSZ A;  2XV5 A;  1T3J A;  4U3F G;  1CCR A;  1NOH A;  4KT0 J;  1H31 A;  4B86 A;  2FFD C;  1NJI Q;  3CWB J;  5E79 H;  2ITA A;  2EXV A;  3K5B A;  2MTA C;  2QJP C;  1MG2 D;  1U7M A;  1VQN P;  5CJ0 A;  2CPS A;  1SQB K;  1T3U A;  5AW8 B;  3KZI V;  2JP3 A;  2BCC D;  1PGP A;  1KZU B;  2LIT A;  3HUS B;  1LS9 A;  3AEB C;  3ZOY A;  4GOF A;  1MFT A;  1KFM A;  1YYC A;  2WPR A;  1JNM A;  2LR2 A;  4HJG H;  5EXQ A;  4QMA A;  1DH3 A;  1FZC B;  1KYO D;  2PFX A;  2B88 A;  5AVQ B;  2YK3 A;  1A8C A;  3G4S P;  1OVV A;  4H44 D;  1U7J A;  1ZLL A;  1I54 A;  4HYT B;  1SQB G;  2N1T A;  2ZXY A;  1L0L K;  3HE4 A;  4C46 A;  1BGY E;  2WPV B;  1R0Q A;  2WSF H;  3N4X A;  3E7K A;  3H25 A;  2QJY B;  1GJQ A;  4L75 A;  3CCU P;  2D0S A;  3GF3 A;  5B6Q A;  3L73 J;  3VMZ A;  2R5B A;  2B87 A;  3CX5 D;  1M1J B;  2WSC J;  2E74 D;  1W5C E;  3TGU D;  4HH2 A;  5AVX B;  1SQB D;  4L74 A;  3TYI A;  1RY3 A;  3HD7 B;  2N9Y B;  3CME P;  4BXL A;  1PL5 A;  2NPS A;  2O01 H;  1HZU A;  3CX5 H;  1G1J A;  3O5C A;  5CBO A;  1OVU A;  1X0T A;  3B5N B;  2C9X B;  1BCC G;  4IOI H;  2WT7 B;  1QL1 A;  1L0L G;  1Q86 Q;  1LC2 A;  1LTI C;  3N7N A;  3A0H E;  5GTI E;  1NYH A;  2QRX A;  4ASW A;  4ZNC A;  1N7L A; 
#chains in the Genus database with same CATH homology
 3NWV A;  1ZRT D;  1CIH A;  1J3S A;  1MZ4 A;  3WFE C;  3OA8 B;  3HQ6 A;  2B4Z A;  1H31 B;  2PCC B;  2RN0 A;  3WU2 V;  2KS1 A;  1E8E A;  1CTJ A;  2ZZS 1;  3NBT A;  3L4O A;  4PD4 D;  3PHL A;  2DGE A;  3ITK A;  3A0H V;  5GTI V;  1L9B C;  3CP5 A;  1AYG A;  1CYC A;  1BGY D;  5CIH B;  3CXH D;  5KAI V;  3SJL A;  1H9X A;  3L75 D;  4LJI A;  2O3J A;  2GC7 D;  3HQ8 A;  4EID A;  2RMZ A;  3DP5 A;  1FI3 A;  5TIS V;  1SQQ D;  4FAN A;  4WQB A;  3DR0 A;  5IY5 1;  3WFB C;  3CXH W;  2AIU A;  3X39 A;  4WQC A;  1CIE A;  2V08 A;  1I8P A;  5DJQ B;  3VNW A;  1CO6 A;  2YQB A;  3DMI A;  1C6O A;  1YFC A;  4WQ9 A;  1A56 A;  3CYT I;  1KX7 A;  1YEA A;  2PCB B;  1I5T A;  4WQ8 A;  1KYO W;  4FA4 A;  2HV4 A;  1HZV A;  1ETP A;  2GIW A;  2ZOO A;  4FB1 A;  1SQP D;  3H1H D;  3VRD A;  5GTH V;  2YCC A;  1VYD A;  1C52 A;  1OAE A;  1L9J C;  1I55 A;  2N9I A;  3MK7 B;  1CRC A;  1GKS A;  4N0K A;  1KB0 A;  1CYJ A;  5DJQ C;  1HJ4 A;  4AAN A;  3L4M A;  3SWS A;  2Y0E A;  3RLM A;  3PXT A;  5KLI B;  1N15 A;  1LMS A;  3GW6 A;  3OCD B;  4D6T D;  1DW1 A;  3WUI A;  2C1D A;  5CIB B;  1DT1 A;  1S5L V;  1DW3 A;  4KMG A;  5DFS A;  1AOQ A;  4L3H A;  1KX2 A;  4GYD A;  1U74 B;  3CU4 A;  3H1K D;  4XXL A;  4O1Q A;  1H33 B;  4NFG B;  4FA1 A;  1CHH A;  1FOC A;  1NU1 D;  1PP9 D;  5KAF V;  2CA4 B;  3L72 D;  3RMZ A;  5CIF B;  2B0Z B;  3A9F A;  1NTZ D;  1CCH A;  4L1Q A;  351C A;  1H9Y A;  1CSU A;  1SQV D;  2B10 B;  3JBT B;  5CIG B;  1NIR A;  1SQX D;  2JQR A;  1N9C A;  1IO3 A;  2YIU B;  2N18 B;  1HJ3 A;  2QJP B;  4PWA A;  1KB9 D;  2OZ1 B;  4FAV A;  4UB6 V;  4O1W A;  1FHB A;  2MHM A;  2BPB B;  2KNC B;  3L70 D;  3WC8 A;  2CXB A;  4P4Q B;  3BCC D;  1QL4 A;  1BL9 A;  2V07 A;  1CXC A;  1CRY A;  3OA8 A;  1H32 B;  2BLF B;  4JCG A;  2N18 C;  4Q5P A;  1C75 A;  4FA9 A;  1FCD C;  3ZCF A;  1CRG A;  3L71 D;  1F1C A;  5CYT R;  3GG2 A;  2ORL A;  4L3G A;  4PJ0 V;  1CNO A;  4XYD B;  1WVE C;  3VMA A;  5TJH A;  1CSV A;  2L4D A;  1JDL A;  3ZOO A;  4EIF A;  1CSX A;  4U3F D;  1HCM A;  1YTC A;  2ZBO A;  1EZV D;  1GDV A;  4WQE A;  2FYN B;  2B12 B;  1HRC A;  1PPJ D;  1CRJ A;  1CHI A;  3CWB D;  4DY9 A;  1QL3 A;  2N3B A;  3H1J D;  3ORV A;  1S6V B;  1C2N A;  1CTY A;  4Y5R A;  4MU8 A;  2Y0C A;  1DIQ C;  3RN0 A;  1COT A;  1M60 A;  1COR A;  4EIC A;  1DW0 A;  1BE3 D;  1I6D A;  1CRH A;  2C8S A;  1FI9 A;  1E29 A;  2XTS B;  1NNO A;  2I8F A;  1DVV A;  4WQA A;  3HQ7 A;  2FRC A;  2N3Y A;  5E79 V;  2K9J B;  3ZBM A;  3FWL A;  1NMI A;  2CA3 B;  3MK7 C;  3OCD A;  4V2K A;  4FA5 A;  2JWA A;  4AAL A;  1QYZ A;  1N90 A;  1YIC A;  4WQ7 A;  3VYM A;  1DW2 A;  1K3H A;  1CSW A;  2AI5 A;  3ZOW A;  1QN2 A;  3ZOX A;  2N9J A;  3H1L D;  2B11 B;  1GIW A;  1H33 A;  1B7V A;  2FWL A;  1DVH A;  2AXT V;  1I8O A;  4AAM A;  1WEJ F;  2BCN B;  1FI7 A;  1RAP A;  451C A;  4AAO A;  1HJ5 A;  1MG3 D;  3PLN A;  1YIQ A;  2BH4 X;  3TF5 A;  1RZ5 A;  1H1O A;  4YE1 A;  5CID B;  1IRW A;  1OCD A;  3PXW A;  2IBZ D;  1LC1 A;  4WQD A;  1NML A;  3TDK A;  3L73 D;  2VHD A;  1FJ0 A;  1M6Z A;  3WFD C;  1KIB A;  1I6E A;  4IL6 V;  5B5E V;  1BCC D;  4RSZ A;  5H2F V;  3NBS A;  2OZ1 A;  3SLE A;  5KKZ B;  1CCR A;  1H31 A;  3ZIY A;  1YCC A;  3C2C A;  1L0L D;  1CC5 A;  5B66 V;  2EXV A;  2MTA C;  1MG2 D;  2GC4 D;  4GED B;  1CHJ A;  1M70 A;  4UB8 V;  3L74 D;  5CIC B;  4EIE A;  1AOF A;  3KZI V;  2BCC D;  2LIR A;  5DF5 A;  1H32 A;  4K3I A;  2LIT A;  1AKK A;  4H0K A;  1LS9 A;  3ZOY A;  3O1Y A;  1C7M A;  1C6S A;  4J20 A;  1HRO A;  1HH7 A;  5EXQ A;  4H0J A;  3O20 A;  1NTM D;  2D0W A;  1KYO D;  2C1V A;  155C A;  3RN1 A;  2Q3E A;  2YK3 A;  4AX3 A;  3PXS A;  1C6R A;  1A8C A;  1C2R A;  1LFM A;  5KLV D;  2DVH A;  1K3G A;  1I54 A;  1CED A;  2BH5 X;  3PRJ A;  1RAQ A;  1DII C;  1GU2 A;  1CIF A;  2GB8 B;  2CE1 A;  2ZXY A;  1EB7 A;  5C0Z A;  2C1D B;  3SVW A;  4RJT A;  1R0Q A;  1L0N D;  2L91 A;  2C1U A;  1GJQ A;  2QJY B;  1CIG A;  4A7P A;  2PAC A;  2D0S A;  2FYU D;  5B6Q A;  2JTI B;  3H1I D;  2QJK B;  2Y0D A;  1NTK D;  1W2L A;  5CIE B;  3CX5 D;  3TGU D;  2C2C A;  1U75 B;  4PW9 B;  1SQB D;  3M97 X;  3TYI A;  1RZ6 A;  1CXA A;  2N9Y B;  2A06 D;  3O0R C;  1W5C T;  1YEB A;  3KHU A;  3SXT A;  2QG4 A;  1HZU A;  1E2R A;  3HQ9 A;  3O5C A;  1CRI A;  3CX5 W;  2CE0 A;  2C9X B;  2ZON G;  1IZL 0;  1N50 A;  1CYI A;  1CTZ A;  5AUR A;  3PH2 B;  1P84 D;  1KV9 A;  1QKS A;  1YNR A;  2BGV X;  1LC2 A;  3WFC C;  1F1F A;  1A2S A;  4EDF A;  3PTZ A;  1GQ1 A;  5C9M A;  1IRV A;  1ZZH A;  4QAO A;  3A0B V;  1IQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...