1NTKD

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 51
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntkD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntkD01
1CXAA 1CORA 2RN0A 4L1QA 1NTMD 2MTAC 1C6OA 1MG3D 3ZOWA 2B0ZB 3ITKA 2B12B 1CIGA 3A9FA 2N18B 1JDLA 3HQ7A 3SLEA 2C1VA 2V07A 2C8SA 3ZOOA 1KIBA 2JWAA 2N9YB 1CNOA 1HH7A 1N9CA 2AI5A 4PD4D 3NWVA 3TDKA 3HQ6A 3GG2A 3ZOYA 2A06D 4GYDA 1SQVD 4PJ0V 5EXQA 2XTSB 1IRVA 3L4MA 3H1JD 4WQ9A 3OCDA 2PCBB 1OAEA 2I8FA 1FI7A 3MK7B 1A2SA 3WUIA 1IQCA 1BGYD 3CWBD 2KNCB 1CRIA 3PTZA 3RN0A 3PHLA 1SQXD 2YK3A 2KS1A 4DY9A 3L75D 5KAFV 5DFSA 1IO3A 1CTJA 1CTZA 2B4ZA 2GC7D 2GC4D 2OZ1B 1HRCA 1DT1A 1C52A 2B11B 5DJQC 1NIRA 1I54A 2CXBA 3PXWA 1W5CT 4WQ7A 1KX2A 1C2RA 4WQAA 1IZL0 1K3GA 3PH2B 1CSXA 5TISV 3NBSA 1MG2D 1CXCA 1BL9A 3ZCFA 155CA 4XYDB 3SWSA 1LC1A 3HQ9A 2ZOOA 3O5CA 5H2FV 1CRJA 1DW2A 1M6ZA 1CRGA 2MHMA 2BCCD 1AYGA 5CIGB 1DVVA 2QG4A 1IRWA 1SQQD 3M97X 1RAPA 3L73D 3L70D 3OCDB 1NTZD 2Q3EA 1YCCA 1PP9D 1S5LV 1I6EA 3TYIA 1I8OA 1H33B 2QJPB 3KZIV 2CA3B 3O20A 1GQ1A 1I6DA 3JBTB 2AIUA 3RLMA 3H1KD 1GIWA 1GKSA 2CE1A 3WFBC 2V08A 3CU4A 1YNRA 5GTHV 5IY51 3WFEC 1HROA 1WVEC 2BPBB 1WEJF 1CEDA 3H1LD 1GJQA 1NTKD 4FANA 1FOCA 1CTYA 3TF5A 3OA8A 1E2RA 2C2CA 2FYNB 4MU8A 1ZZHA 1C6RA 3RMZA 1SQPD 4XXLA 3CXHD 4O1QA 1N50A 2PCCB 4EIEA 1M70A 1NMIA 2ZONG 2QJYB 4H0JA 5KLVD 3O1YA 2FWLA 3ZIYA 1H33A 2QJKB 3WC8A 1W2LA 4FAVA 2N9JA 1NMLA 4U3FD 1H32A 1A8CA 1LMSA 1R0QA 1QYZA 5CIBB 1LC2A 1KB9D 2LITA 2N3YA 4FA4A 1C75A 4L3HA 4LJIA 1F1CA 1ETPA 3L74D 3NBTA 1BCCD 3MK7C 1N15A 4A7PA 1L0LD 2JQRA 4PW9B 3SJLA 1RZ5A 1C2NA 4EIFA 1CIHA 3GW6A 2D0WA 3X39A 1YTCA 4AALA 3PXTA 2L4DA 5E79V 1DIQC 4EDFA 1QL4A 2LIRA 1HJ4A 1CHJA 2BH4X 4FA9A 4FA5A 3CXHW 2Y0DA 1YFCA 5DJQB 1EB7A 1CIFA 1FJ0A 1YICA 2ZZS1 1VYDA 1L9JC 4AAOA 3ORVA 1RZ6A 2GB8B 1CC5A 1U74B 4P4QB 2RMZA 1GU2A 2BCNB 3KHUA 4UB8V 1CYCA 3C2CA 1CHHA 1CYJA 1CSUA 2HV4A 1PPJD 3L4OA 2N18C 1H9YA 2CA4B 4JCGA 3VNWA 1H9XA 1EZVD 1ZRTD 1KYOD 3VRDA 2C1UA 1J3SA 1YIQA 1E29A 4AAMA 2ZBOA 5B6QA 5CIHB 1OCDA 4K3IA 1DW0A 1CRYA 2C1DB 4NFGB 1S6VB 2C1DA 2AXTV 3L72D 1KB0A 5CIFB 2EXVA 5CIEB 3A0HV 2ZXYA 3PLNA 5B5EV 1CCHA 1BE3D 4N0KA 1CCRA 1HJ5A 4Y5RA 3L71D 2DGEA 3CYTI 1QL3A 3PXSA 1CSVA 4V2KA 4RJTA 2PACA 1FI3A 1L9BC 2FRCA 3ZBMA 2VHDA 1CHIA 1AOFA 1K3HA 4Q5PA 3WFCC 1DIIC 1U75B 2N3BA 4L3GA 1B7VA 3PRJA 1AKKA 2CE0A 1L0ND 5KAIV 2N9IA 2ORLA 2D0SA 1SQBD 1FHBA 3BCCD 2OZ1A 1C7MA 1F1FA 1DW3A 1H1OA 3TGUD 1FI9A 2O3JA 2BH5X 3A0BV 2B10B 4D6TD 5C0ZA 1DVHA 1H31A 1KV9A 2IBZD 4WQ8A 2JTIB 4AX3A 1E8EA 1CSWA 1LFMA 2YCCA 1M60A 5CICB 2BLFB 1H32B 3WU2V 2Y0CA 2FYUD 1GDVA 1N90A 1CYIA 2DVHA 1NNOA 3CX5W 5KKZB 1A56A 3SVWA 4QAOA 3H1HD 4FB1A 1HZVA 2Y0EA 1KYOW 2C9XB 1HZUA 1P84D 2K9JB 1RAQA 3DP5A 4J20A 1C6SA 5GTIV 1MZ4A 4H0KA 1HCMA 3DR0A 1QN2A 1CRCA 4WQCA 1YEAA 1FCDC 4AANA 4KMGA 5KLIB 3RN1A 451CA 1COTA 3ZOXA 5B66V 3HQ8A 2YIUB 5AURA 4YE1A 3VMAA 4EICA 5C9MA 1I5TA 1CIEA 3CX5D 2L91A 4WQEA 5CIDB 1H31B 4O1WA 1CRHA 3H1ID 2YQBA 4FA1A 4UB6V 1CO6A 4GEDB 5CYTR 1DW1A 4EIDA 2GIWA 4RSZA 4PWAA 1KX7A 351CA 3DMIA 1QKSA 1I8PA 1LS9A 1HJ3A 1I55A 1YEBA 3OA8B 3WFDC 3O0RC 1NU1D 3VYMA 5TJHA 1AOQA 5DF5A 4WQDA 4IL6V 3SXTA 2BGVX 3CP5A 3FWLA 4WQBA
chains in the Genus database with same CATH superfamily
1CXAA 1CORA 4L1QA 3L70G 1YYCA 1C6OA 3ZOWA 3ITKA 3KXDA 1KMIZ 1CIGA 4AYCA 2G8YA 2NPSD 1KORA 3L75E 3SLEA 1G2CB 3CWBJ 3D71A 2AXTE 2OYOA 3TGUE 4GT1A 1QEXA 3Q2YA 2AXCA 2A06D 4GYDA 3L72E 2LXBA 5AVQB 4WQ9A 3H1JD 3CMEP 3OCDA 2P67A 1SQPK 1NU1J 1SQQG 4JQ0D 3WUIA 2YNYA 1BGYD 2AEMA 3CWBD 1L0LJ 3JCUH 3RL0g 2KNCB 2ZVOB 2J58A 3RN0A 3AE3C 3PHLA 2YK3A 2KS1A 4IFMA 3VP9A 2KS1B 3L75D 5KAFV 2M3EA 3CC7P 1IO3A 1CTJA 1CTZA 2GC7D 2A45H 2E75C 2OZ1B 1L4AA 1HRCA 1FDMA 1IFPA 2WPSA 5GTHE 2IZ1A 1K8AQ 1NTKK 2QSIA 2OYIA 1KX2A 1C2RA 4WQAA 2ZXEB 3L75J 3Q1MA 2RH0A 1LWUC 1T2KD 4K3AA 5GTHH 2PGDA 1E79H 1BL9A 1J1EC 3L36A 1BGYE 1LTJA 1LC1A 3O5CA 3CCVP 1KFNA 1PP9G 3USSA 3V4QA 1LP1A 1DW2A 1CRGA 1SQVJ 3H1IE 1SQQD 4DT0A 3JC22 1KTMA 2KIKA 1SQPE 3L71J 5CCGA 1YCCA 4N78E 3TYIA 1H33B 1SQPG 3KZIV 1JY3P 1GZLA 1S5LE 1OMIA 4HYTB 1QVFO 4I1LA 1UIXA 1JO5A 2FXOA 2KYVA 2QVAA 3MD0A 1S9KD 2B9BA 1GL2A 1BGYJ 3S4RA 5GTHV 2BPBB 1SQXE 3Q5RA 3FXDA 3JSVC 1GJQA 2A06G 1JCDA 4FANA 1QX8A 1FOCA 1PPJG 4OGQC 1FZCB 4UB6E 1EZVI 2H7HA 5AVWB 3V2RA 3D0WA 4H44C 2Q7CA 3AE6C 4U3FJ 2YKPA 4XXLA 3CXHD 1N50A 1VQ4P 3EFFK 1JM0A 1QLED 2J59M 2QJYB 1JMBA 2B87A 4ASVA 5B5EE 4H0JA 5KLVD 3CI9A 1VQLP 2NZ2A 3ZIYA 2KLUA 3A3YB 4C7NB 1IZNB 5BU5A 3WC8A 1SFCC 4FAVA 2N9JA 3O6QB 4WBAA 2FYUG 3L72J 1LMSA 1USEA 1M56D 2K3RA 2QEXP 2FYUE 2C9NY 3U1CA 3H1LG 2KK7A 1N15A 1HH0A 3P8CE 2JR8A 2IPPA 1NTZG 3B5ND 3M9BA 4Y28J 2XV5A 2PFXA 4CPGA 3PXTA 3L37A 2LIRA 1ZR2A 1CHJA 4FA5A 5E79E 2Y9ZA 2HFED 2O1JA 1FZAA 3CCMP 1RE4C 1CIFA 5AW4B 2KI7B 2WZ7A 1NTZK 4D6TJ 3Q3DA 2R3SA 1RZ6A 1DD4A 2GB8B 2IYOA 1VF5C 1HTLC 2L5GB 1NTKE 2QJKC 2P2UA 2FXPA 1CHHA 1FOSE 5AW6B 1CYJA 1CSUA 4DOJA 3OW2O 3PJSK 1ZR4A 1RQVA 1BDDA 1M7LA 2WSEJ 2PRRA 1DD3A 3RK3C 3RL0D 1Q82Q 2C1UA 2JO1A 2WT7A 2LR2A 1YIQA 4AAMA 2ZBOA 5KLVG 3CCRP 5B6QA 4I6MC 5CIHB 1GD2E 1DW0A 1CRYA 1DEBA 3RBZA 4NFGB 1JB0J 1BCCG 2FFDC 4I7ZB 2KLVA 3A0HV 3H32B 5CHXA 1GL2D 2LXCB 1YJ9P 5KJ7D 1AJYA 3SWKA 1SVFA 5APVA 1K04A 1VQMP 1BE3D 4N0KA 1JY2P 3CXHE 4Y5RA 2KSJA 1QL3A 3PXSA 1LT1A 4IFDK 5CCGC 2FRCA 1IFMA 1R8EA 2VHDA 1AOFA 2CK3H 2LKMA 1YBKA 4PJ0E 1ZLLA 2N3BA 1X0TA 1FZCC 2H88C 4L3GA 2IFMA 2R32A 4JBZA 1L0ND 2N9IA 3I55P 1FE6A 1FHBA 3N7NA 1BE3J 1F1FA 2CPBA 1H1OA 1BE3E 3BRVB 2O3JA 4D6TD 2B10B 3EQ2A 2YIUC 1H31A 1LJ2A 1JTHA 3PH0A 2ZT9C 5KLVK 4YTPC 2JTIB 1T3UA 2YCCA 1M60A 2NPSB 1A02F 2MKVA 1H32B 4ZKPA 2Y0CA 1GDVA 1NTKG 2Z5IA 5M1BA 1CYIA 3WU2H 1S4XA 3CX5W 2OYIC 1A56A 5AVTB 3H1HD 2HODB 4PD4E 1KN7A 1AQTA 1HZVA 2M5AA 1KD1Q 2WSCJ 2BCCE 5KJ7A 1EXJA 3CXHI 3DP5A 1BCCE 2OGUA 1NJIQ 1MZ4A 5KAFE 3C1LA 1KILC 1BSHA 3HD7C 2QM7A 4WQCA 1XTCC 3A0BH 1YITP 1NTMJ 1OW6A 2WTYA 2DW3A 1VF5B 5C9MA 4AUWA 1CIEA 1X22A 2L91A 2KXPB 5CIDB 3C8VA 2IBZI 3F89A 5AW3B 1NTMK 1CO6A 1EZVE 5CYTR 1DW1A 1KX7A 2WWWA 1N73A 2E74C 3ABVC 2AXTH 2POHA 1HJ3A 2O01H 5KKZC 2E76D 1HVVA 1H88A 1SQXK 4N6JA 2IBZE 2A45I 5TISE 2C9LY 2RN0A 3HRNA 1NTMD 1KQSO 1MG3D 4HB1A 3A0BE 3M91A 1NTZE 3H32A 3HQ7A 3ZOOA 2R5BA 1SQXG 2WVRA 3BCCJ 3P32A 3T97A 1CNOA 4GDOA 1N9CA 2Y9YA 3NWVA 3HQ6A 3GG2A 1YJWP 2ZAEB 1SQVD 1FS0E 1LGHB 1SS1A 1ZV8A 1M1KQ 1YHQP 2GUSA 4GIFA 2PCBB 1OAEA 1FI7A 3GLMA 3MK7B 1HBWA 4Y99C 1IQCA 1SFCA 2PAJA 3AE9C 3VN0A 3C9IA 5CJ0A 1OW7A 3RL0B 1RF1B 1BE3G 1KFMA 3NFQA 3TSIA 1NH4A 5EFWB 3CC4P 3LW5H 5AW1B 1M90Q 2K88A 1PFIA 1GL2B 4IL6H 2O01J 1Q2NA 2XZRA 3L74G 1NHLA 4IL6E 1VQNP 1S1CX 2ZYAA 5TISV 4RKUJ 3NBSA 1CW5A 3M9QA 1CZQA 5AW0B 2YXQB 3HD7D 4PV1D 4JYCA 3HQ9A 3A7OA 2ZOOA 1R5SA 1E5WA 5H2FV 1L0NG 1CRJA 4PJ0H 3GF3A 1FBMA 1IRWA 3M97X 1RAPA 3L70D 3B8EB 2IYPA 1GMJA 1PP9D 1N73C 1UIIA 2QJYC 1I8OA 2QJPB 3KQGA 2PP6A 1NU1G 3N4XA 2FBWC 1I6DA 2W27A 3T97B 2W6BA 3WUTA 2Q1KA 1L4AB 2A45G 3CX5I 2AIUA 5KAIE 3TYYA 3RK2C 4PV1B 3WFBC 1VQ6P 1NYHA 1VL2A 5IY51 3WFEC 1VQ8P 3GHGA 1X8YA 3P8CD 4JPZB 1KYOI 1LWUA 1CTYA 2WSFH 1E2RA 3HE5B 1SFCD 4MU8A 1C6RA 2XU6A 2G3AA 1GU5A 3RMZA 1SQPD 4O1QA 3O8ZA 4TT3H 3IAOA 1NMIA 2ZONG 5AVVB 1JTHB 4H0LD 1N7SD 1L0LE 1H33A 2QJKB 2XDJA 1N7SA 3D70A 5AW8B 1VQPP 1R0QA 2YMYA 1KB9D 3CCLP 2N3YA 1C75A 1YQ4C 4L3HA 1F1CA 1ETPA 3L74D 4L74A 1BCCD 3MK7C 3KZIH 1KYOH 1RZ5A 1ZMEC 3GW6A 1PPJE 1YI2P 2J5UA 3X39A 4R4MA 1RF1C 2OYHA 5APWA 4MN4C 2L4DA 3AEGC 1DIQC 4EDFA 1YTZT 4U3FG 1HJ4A 2BH4X 1LWUB 3CXHW 3AE4C 3M0DC 4WY4C 1FJ0A 1YICA 4BRYB 1MUUA 1Y9BA 2Q5UA 4AAOA 2FYZA 1AVYA 5DJTB 4H13B 5AW2B 1JY2N 3H1LE 1LNQA 4P4QB 3SFEC 3ZDMA 1M1JB 2BCNB 3AEAC 2H43A 1VQ7P 3L4OA 2WITA 2N18C 1H9YA 3H1LJ 3P8MC 3VNWA 4GKGA 4Z1MH 2HLOA 3BASA 1DX7A 1ZRTD 4NPDA 3LIDA 1QGKB 2P1JA 5APQA 3MP7B 2AEJA 1NTME 3A2AA 3VRDA 4ZKUA 1LTAC 4JF7A 1YTZI 2N1TA 2ZT9D 3HUSB 1N8RQ 3Q5PA 2C1DB 1S6VB 1LTGC 1MFZA 1KB0A 3IFMA 1HGZA 5CIEB 3PLNA 2WQYC 1G2CA 1L4AC 1GW3A 5E79H 3FWNA 1Z56A 1HJ5A 3L71D 1GK6A 3RK2B 2E5YA 1FZBA 1QL2A 4V2KA 4RJTA 1JMMA 1FZEA 2QIWA 1L9BC 3L35A 3KZIE 3AEDC 1K3HA 4Q5PA 3KPEA 3D6ZA 2ZYDA 1T2KC 3BATA 1VQKP 4ASWA 1Y47A 2Q6QA 2W8ZA 3AE1C 1KILB 2D0SA 4UB8E 3V4WA 3BCCD 2OZ1A 1W2BO 2FYUJ 2QM8A 3L72G 5BVZA 1FDOA 1FI9A 1M57D 2FY8A 3A0BV 5C0ZA 1DVHA 1ZP0C 2ZXXA 4HJGH 1FJKA 5C39A 1CSWA 1NTZJ 4HKZH 1N7SB 5AVUB 1PIXA 3OA7A 2KUBA 2UWJE 1EXIA 2E74B 2DVHA 3B71A 1NNOA 5KKZB 1JUNA 1KQLA 3FGAD 3WUVA 1AFOA 3SVWA 2ZYGA 4XA4A 2M5AB 2SPZA 1K9MQ 2Y0EA 2M3BA 1HZUA 2JDIH 2V7QH 1RAQA 3I5CA 4O9BA 1KQFB 1URQB 1IFNA 1YIJP 1SFCB 2P58A 4H0KA 1EZVG 3M0DA 3MHVA 3DR0A 1YEAA 2HR3A 1FCDC 4OWFA 1Q7YQ 2B89A 3H1HE 5B66V 4K35A 3HQ8A 4H13C 3OAKA 1VQ9P 3VMAA 1I5TA 1M1JC 3QWOC 4O1WA 1CRHA 1M1JA 3II6A 4FA1A 1YQ3C 2KNCA 1NTKJ 1MFTA 3L71E 3NXSA 1NVOA 1S72P 1BCCJ 4PWAA 1RF1A 3DMIA 1RH5B 2ZJSE 1I8PA 3H1KJ 3WUUA 4YXWH 1LT9C 1EQ7A 3M0AA 1AOQA 2HPCA 2WT7B 4IL6V 1BSNA 4L76A 1EDJA 2FYNC 3V6IA 5H2FE 3CD6P 2E42A 4ZMDA 2MTAC 3U59A 1H89A 2Z4EA 2B0ZB 2B12B 2VRSA 1JDLA 1VPCA 2C1VA 1SQQK 2V07A 2C8SA 1SQVK 1SQBG 2H8PD 1KIBA 1IFIA 2JWAA 3RK3B 1S5LH 1HUCA 1WMKA 3MTUE 2XKMA 2OTLP 3FXEA 3TDKA 2KB7P 3ZOYA 4PJ0V 5AVXB 1RE4A 2B88A 1J1DC 5APYA 1CI6A 1RQUA 4I7ZC 2JWDA 2AEFA 2WPQA 1A2SA 2FYUK 1CRIA 2ZT9B 4W7ZA 1NU1E 2QA4P 3MIWA 1SQXD 4DY9A 5DFSA 2B4ZA 3HE5A 2GC4D 3VP8A 4BRYA 3E1IA 2ITAA 2B11B 5DJQC 1OW8A 2N1TC 1I54A 3CCQP 3PXWA 1D7MA 3TGUJ 5AW7B 3VMXA 2JKVA 4R4LA 2OYIB 2A06E 3H1KE 4KT0J 1L0NE 3PH2B 1SQXJ 1IJDB 3BCCG 3G9RA 3WU2E 4DZOA 1CXCA 3ZCFA 1X9VA 2WSSH 1IFJA 1S9KE 2N1TD 2RKLA 4IFFA 5DJUB 2BCCD 5CIGB 1DVVA 1WRGA 3H1IG 1FDIA 2K9JA 3OCDB 4IOIH 2QE7H 2Q3EA 2CA3B 3V5BA 3O6QA 1PV3A 1NOHA 2I1JA 1CSBA 1Q81Q 1GIWA 1GKSA 3H1HJ 3B5NB 2CE1A 2WSEH 1CI6B 3CU4A 1M8OB 1YNRA 3GHGB 1J2JB 1WT6A 3HD7B 1CEDA 1VF5D 3OJAB 2W83C 4BXLA 1USDA 1L0NJ 3H1KG 1SQBE 3L74J 2I1KA 1NTKD 1DEEG 3MGNA 3E7KA 2C2CA 2FYNB 1RF0A 3AE5C 2Z5HA 4RO0A 1FZFA 1JY3O 3IN6A 3IF4A 4WY4B 5AVSB 1VDFA 3W68A 3NMDA 2KZJA 3HUSA 1EC5A 4KHXA 5AW5B 3O1YA 2FWLA 3CCSP 1ZOYC 2FXMA 4UB8H 4Y99B 1NMLA 4U3FD 1A8CA 5CBOA 5GTIE 1LC2A 3RK3D 3RL0C 4LJIA 3K5BA 1H0TB 2R3CA 2IBZG 4A7PA 2WPRA 1L0LD 1IK7A 4N78D 1K73Q 4PW9B 1C2NA 1W5CE 1CIHA 2D0WA 1GL2C 1PZQA 4LC1A 4AALA 3S9OA 2M0BA 1FAVA 1QL4A 1OFCX 2YXRB 4FA9A 2Y0DA 5DJQB 2YKOA 1KILA 2WSCH 1EB7A 3HTKB 2ZVNB 2ZZS1 1VYDA 1L9JC 3CCEP 1YJNP 2XNXA 3AECC 3ORVA 3R2PA 4GODA 1U74B 3WMM0 2RMZA 2ZFCA 4PD4I 5AW9B 1GU2A 1KZUB 3HD7A 3KHUA 3W67A 4UB8V 1S3JA 3C2CA 1KB9E 1Y8AA 4PD4H 3M9HA 2CA4B 1AVOA 4W80A 1H9XA 1LP1B 1KYOD 3H1IJ 3L73E 1E29A 2HODA 2O1KA 1PP9E 1OCDA 5APSA 1MZ9A 2AXTV 3L72D 5CIFB 1URQD 2OYHB 3D6YA 2D2CD 2BCCG 2OTJP 3TK1A 1ZRTE 1KQGB 2OQQA 4WB4A 3H6PA 3HTKA 1CSVA 1P84H 3L70J 1A02J 4I2LC 2PACA 3ZBMA 1KYOE 1OZHA 1DIIC 1U75B 2BASA 1GU4A 2HYNA 3PRJA 4YXDC 1FZCA 5KAIV 4EYYQ 4C7RA 1OWAA 4IL6X 4PV1C 1DW3A 2C0XA 1MV8A 5CCGD 1U7MA 1NAFA 3L73G 2WPVB 2IBZD 2K37A 1AV1A 4OH8B 2NPSA 1LT9A 2E75B 5CICB 2R5DA 1PL5A 5K5GB 2BLFB 3CC2P 4B86A 1N90A 1LTJC 1RE3C 1LTTC 4H13D 1KC8Q 4QAOA 4FB1A 1VQ5P 2C9XB 3H1JG 1U57A 3HE4B 1N7LA 1LTBC 4HH2A 1C6SA 1HGVA 1Q86Q 1EDKA 1NWQA 1QN2A 1CRCA 1EDIA 1SP4A 1PP9J 3RBXA 3PP5A 1AQ5A 4AANA 4KMGA 5KLIB 3A5TA 451CA 1COTA 3ZOXA 1T3JA 1JCCA 1SQQJ 1GTWA 2P10A 2M8RA 5B66H 4GOEA 4EICA 1L0LG 3CCUP 3G4SP 1KILE 1NKNA 1J1DB 2BEQD 4NPFX 3LIEA 4GEDB 4EIDA 2GIWA 1G1JA 351CA 1IC2A 1LS9A 3SWYA 1I55A 1YEBA 3OA8B 3WFDC 1NU1D 3VYMA 4RESB 5TJHA 3A0HH 1JEKA 4D6TE 3CPWO 1OXZA 1JNMA 4XFJA 3SXTA 2CPSA 3FWLA 2N1TB 1FZGA 2FFDA 5B5EH 1DIPA 1MKMA 2YO3A 4OGQB 3A9FA 5KAIH 2N18B 2KP8A 1S5LX 4OGQD 1PGPA 2YKQA 3F5HA 4H44B 2N9YB 2IZ0A 3IR9A 1HH7A 4LLHA 2AI5A 3AEEC 4PD4D 1T6AA 1FOSF 4AQRD 3MZWB 3JCUE 2KZIA 3P7KA 3HUSC 2V7QJ 3CL3D 5EXQA 3UIAA 2XTSB 1IRVA 3L4MA 3CLQA 3RK2D 2I8FA 1SQVG 2P7JA 1HJBA 3I56P 3LW5J 3S1KA 3PTZA 1KV4A 1RE3A 1N2DC 4LGDE 1HJ0A 2E74D 1GW4A 1BGYG 1DT1A 1PGOA 1C52A 1NIRA 2CXBA 3KDPB 1W5CT 1PGJA 2OTKE 2C0WA 4WQ7A 1TU3F 4GOFA 3BCCE 2HG5D 1QVGO 3CWBE 3B5NC 3SSUA 2R44A 5TISH 1SQBJ 1IZL0 3L74E 1K3GA 1QL1A 1S2EA 3GF7A 1L2PA 1FJPA 1CSXA 4H0LB 1PGQA 1K05A 1MG2D 2W90A 4WVZA 3VMZA 155CA 1LTJB 1OVUA 4XYDB 3NTNA 4C7NA 4L73A 1AA0A 1URQC 4NPEA 3SWSA 4EIJA 2E75D 1U7JA 1T8ZA 3MUDA 5APXA 3E1RA 3AE7C 1M6ZA 2MHMA 1AYGA 1IO4A 4DCKA 2QG4A 2E5TA 3L73D 1NTZD 1N7SC 2GA1A 1S5LV 1I6EA 3Q5SA 1DH3A 4L75A 3O20A 5KLIC 1GQ1A 3U1AA 3M06A 3A0HE 3KYQA 1SQVE 5AVZB 1SQQE 3AEFC 5KLVJ 3R4YA 3JBTB 5KAFH 3RLMA 5CCHC 3H1KD 2NRGA 3AE2C 2K9YA 1NGMB 2V08A 1SLQA 5AVYB 1HROA 1J1EB 2MJZA 1WVEC 4EOTA 3TGUG 1WEJF 3CX5E 3H1LD 5B66E 1KB9H 3G3ZA 4ZNCA 1GDTA 3TF5A 3OA8A 4C46A 2HPCB 1ZZHA 1LTIC 2I8DA 1LTSC 1OX3A 1W2EA 1ZXGA 2OARA 3RK3E 2PCCB 1JY3N 4EIEA 1M70A 4YPCA 2IX7C 2WSFJ 2E43A 5CBNA 1OVRA 2E76B 4D6TG 2B87B 1R5LA 1LT9B 2BEZF 1W2LA 1ZN5A 1H32A 1QYZA 1Q90D 5CIBB 2LITA 3V2PA 4FA4A 1G1IA 3L70E 1H0TA 3NBTA 2XNDH 2JQRA 3SFDC 1XTGB 3SJLA 2NPSC 3H1HG 4EIFA 3G6EP 1OVVA 5KJ7C 1YTCA 1L4AD 5E79V 2D2CC 3CMAP 2JJLA 3L4FA 1IFDA 3QH9A 2KOGA 3FX0A 2OYHC 3BRTB 1YFCA 2YO2A 1X79B 3AEBC 1NO4A 3H1JE 4JYBA 1RF0C 4WY4A 3B5NA 3MUDC 1H8AA 5AVRB 2FKWB 2Q3IA 1CC5A 4H0LC 3VYIA 1FC2C 1BDCA 1KILD 1CYCA 5APTA 4XE5B 3RGUA 2HV4A 1PPJD 1N86A 4JCGA 1EZVD 1SQBK 1L0LK 2N9BA 3B4SA 1ZW0A 1JOCA 3V2NA 1J3SA 4DJGA 4EI2A 3AE8C 4K3IA 3HE4A 3VOPA 5CMZA 4U7JA 2C1DA 3VTPC 3G71P 3VMYA 1P84E 2EXVA 2ZXYA 5B5EV 3CXHH 1CCHA 1VQOP 1CCRA 2DGEA 3CWBG 3CYTI 2IFNA 4WY4D 2JEEA 1FI3A 4W7YA 2WMMA 1CHIA 1FU1A 3WFCC 4BWNA 1B7VA 2JP3A 3BVHA 1AKKA 1HWTC 2CE0A 5GTIH 2ORLA 3EWKA 3GMAA 1SQBD 1C7MA 3CCJP 1IK9A 3TGUD 2E76C 2BH5X 1L0NK 4OVNF 2K1AA 3GHGC 5CCHA 5APUA 1NTMG 2FFDB 1KB9I 1KV9A 4WQ8A 1JY2O 4AX3A 1RY3A 1E8EA 1LFMA 3L75G 1N73B 2YMKA 4UB6H 2GUVA 4H44D 3WU2V 2FYUD 4M3LA 1NU1K 1OIPA 4U3FE 1P84I 2W6JH 3CX5H 3V2QA 4QMAA 5KLVE 1NAYA 5CCHD 5CJ4A 1KYOW 1P84D 2K9JB 2D2CB 4J20A 2Q9IA 2W6AA 1URQA 5KTBA 5GTIV 5BU8B 1GK4A 3L71G 1HCMA 3TNUB 3TNUA 1SQPJ 3EFGA 1RHZB 3SWFA 3RN1A 3L73J 1HF9A 2YIUB 5AURA 5H2FH 4YE1A 2IDBA 2QRXA 2KSEA 4N3YB 3CX5D 4WQEA 4WWIA 2O01N 4KJMA 1H31B 2QJPC 3H1ID 2YQBA 2V4HA 2GM4A 4UB6V 1NKZB 4RSZA 1EDLA 3H25A 1QKSA 5L8RJ 2BCCJ 3O0RC 4TLFA 5DF5A 3H1JJ 4WQDA 2H89C 2BGVX 3CP5A 4WQBA
chains in the Genus database with same CATH topology
1CXAA 1CORA 2RN0A 4L1QA 1NTMD 2MTAC 1C6OA 1MG3D 3ZOWA 2B0ZB 3ITKA 2B12B 1CIGA 3A9FA 2N18B 1JDLA 3HQ7A 3SLEA 2C1VA 2V07A 2C8SA 3ZOOA 1KIBA 2JWAA 2N9YB 1CNOA 1HH7A 1N9CA 2AI5A 4PD4D 3NWVA 3TDKA 3HQ6A 3GG2A 3ZOYA 2A06D 4GYDA 1SQVD 4PJ0V 5EXQA 2XTSB 1IRVA 3L4MA 3H1JD 4WQ9A 3OCDA 2PCBB 1OAEA 2I8FA 1FI7A 3MK7B 1A2SA 3WUIA 1IQCA 1BGYD 3CWBD 2KNCB 1CRIA 3PTZA 3RN0A 3PHLA 1SQXD 2YK3A 2KS1A 4DY9A 3L75D 5KAFV 5DFSA 1IO3A 1CTJA 1CTZA 2B4ZA 2GC7D 2GC4D 2OZ1B 1HRCA 1DT1A 1C52A 2B11B 5DJQC 1NIRA 1I54A 2CXBA 3PXWA 1W5CT 4WQ7A 1KX2A 1C2RA 4WQAA 1IZL0 1K3GA 3PH2B 1CSXA 5TISV 3NBSA 1MG2D 1CXCA 1BL9A 3ZCFA 155CA 4XYDB 3SWSA 1LC1A 3HQ9A 2ZOOA 3O5CA 5H2FV 1CRJA 1DW2A 1M6ZA 1CRGA 2MHMA 2BCCD 1AYGA 5CIGB 1DVVA 2QG4A 1IRWA 1SQQD 3M97X 1RAPA 3L73D 3L70D 3OCDB 1NTZD 2Q3EA 1YCCA 1PP9D 1S5LV 1I6EA 3TYIA 1I8OA 1H33B 2QJPB 3KZIV 2CA3B 3O20A 1GQ1A 1I6DA 3JBTB 2AIUA 3RLMA 3H1KD 1GIWA 1GKSA 2CE1A 3WFBC 2V08A 3CU4A 1YNRA 5GTHV 5IY51 3WFEC 1HROA 1WVEC 2BPBB 1WEJF 1CEDA 3H1LD 1GJQA 1NTKD 4FANA 1FOCA 1CTYA 3TF5A 3OA8A 1E2RA 2C2CA 2FYNB 4MU8A 1ZZHA 1C6RA 3RMZA 1SQPD 4XXLA 3CXHD 4O1QA 1N50A 2PCCB 4EIEA 1M70A 1NMIA 2ZONG 2QJYB 4H0JA 5KLVD 3O1YA 2FWLA 3ZIYA 1H33A 2QJKB 3WC8A 1W2LA 4FAVA 2N9JA 1NMLA 4U3FD 1H32A 1A8CA 1LMSA 1R0QA 1QYZA 5CIBB 1LC2A 1KB9D 2LITA 2N3YA 4FA4A 1C75A 4L3HA 4LJIA 1F1CA 1ETPA 3L74D 3NBTA 1BCCD 3MK7C 1N15A 4A7PA 1L0LD 2JQRA 4PW9B 3SJLA 1RZ5A 1C2NA 4EIFA 1CIHA 3GW6A 2D0WA 3X39A 1YTCA 4AALA 3PXTA 2L4DA 5E79V 1DIQC 4EDFA 1QL4A 2LIRA 1HJ4A 1CHJA 2BH4X 4FA9A 4FA5A 3CXHW 2Y0DA 1YFCA 5DJQB 1EB7A 1CIFA 1FJ0A 1YICA 2ZZS1 1VYDA 1L9JC 4AAOA 3ORVA 1RZ6A 2GB8B 1CC5A 1U74B 4P4QB 2RMZA 1GU2A 2BCNB 3KHUA 4UB8V 1CYCA 3C2CA 1CHHA 1CYJA 1CSUA 2HV4A 1PPJD 3L4OA 2N18C 1H9YA 2CA4B 4JCGA 3VNWA 1H9XA 1EZVD 1ZRTD 1KYOD 3VRDA 2C1UA 1J3SA 1YIQA 1E29A 4AAMA 2ZBOA 5B6QA 5CIHB 1OCDA 4K3IA 1DW0A 1CRYA 2C1DB 4NFGB 1S6VB 2C1DA 2AXTV 3L72D 1KB0A 5CIFB 2EXVA 5CIEB 3A0HV 2ZXYA 3PLNA 5B5EV 1CCHA 1BE3D 4N0KA 1CCRA 1HJ5A 4Y5RA 3L71D 2DGEA 3CYTI 1QL3A 3PXSA 1CSVA 4V2KA 4RJTA 2PACA 1FI3A 1L9BC 2FRCA 3ZBMA 2VHDA 1CHIA 1AOFA 1K3HA 4Q5PA 3WFCC 1DIIC 1U75B 2N3BA 4L3GA 1B7VA 3PRJA 1AKKA 2CE0A 1L0ND 5KAIV 2N9IA 2ORLA 2D0SA 1SQBD 1FHBA 3BCCD 2OZ1A 1C7MA 1F1FA 1DW3A 1H1OA 3TGUD 1FI9A 2O3JA 2BH5X 3A0BV 2B10B 4D6TD 5C0ZA 1DVHA 1H31A 1KV9A 2IBZD 4WQ8A 2JTIB 4AX3A 1E8EA 1CSWA 1LFMA 2YCCA 1M60A 5CICB 2BLFB 1H32B 3WU2V 2Y0CA 2FYUD 1GDVA 1N90A 1CYIA 2DVHA 1NNOA 3CX5W 5KKZB 1A56A 3SVWA 4QAOA 3H1HD 4FB1A 1HZVA 2Y0EA 1KYOW 2C9XB 1HZUA 1P84D 2K9JB 1RAQA 3DP5A 4J20A 1C6SA 5GTIV 1MZ4A 4H0KA 1HCMA 3DR0A 1QN2A 1CRCA 4WQCA 1YEAA 1FCDC 4AANA 4KMGA 5KLIB 3RN1A 451CA 1COTA 3ZOXA 5B66V 3HQ8A 2YIUB 5AURA 4YE1A 3VMAA 4EICA 5C9MA 1I5TA 1CIEA 3CX5D 2L91A 4WQEA 5CIDB 1H31B 4O1WA 1CRHA 3H1ID 2YQBA 4FA1A 4UB6V 1CO6A 4GEDB 5CYTR 1DW1A 4EIDA 2GIWA 4RSZA 4PWAA 1KX7A 351CA 3DMIA 1QKSA 1I8PA 1LS9A 1HJ3A 1I55A 1YEBA 3OA8B 3WFDC 3O0RC 1NU1D 3VYMA 5TJHA 1AOQA 5DF5A 4WQDA 4IL6V 3SXTA 2BGVX 3CP5A 3FWLA 4WQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXA A;  1COR A;  2RN0 A;  4L1Q A;  1NTM D;  2MTA C;  1C6O A;  1MG3 D;  3ZOW A;  2B0Z B;  3ITK A;  2B12 B;  1CIG A;  3A9F A;  2N18 B;  1JDL A;  3HQ7 A;  3SLE A;  2C1V A;  2V07 A;  2C8S A;  3ZOO A;  1KIB A;  2JWA A;  2N9Y B;  1CNO A;  1HH7 A;  1N9C A;  2AI5 A;  4PD4 D;  3NWV A;  3TDK A;  3HQ6 A;  3GG2 A;  3ZOY A;  2A06 D;  4GYD A;  1SQV D;  4PJ0 V;  5EXQ A;  2XTS B;  1IRV A;  3L4M A;  3H1J D;  4WQ9 A;  3OCD A;  2PCB B;  1OAE A;  2I8F A;  1FI7 A;  3MK7 B;  1A2S A;  3WUI A;  1IQC A;  1BGY D;  3CWB D;  2KNC B;  1CRI A;  3PTZ A;  3RN0 A;  3PHL A;  1SQX D;  2YK3 A;  2KS1 A;  4DY9 A;  3L75 D;  5KAF V;  5DFS A;  1IO3 A;  1CTJ A;  1CTZ A;  2B4Z A;  2GC7 D;  2GC4 D;  2OZ1 B;  1HRC A;  1DT1 A;  1C52 A;  2B11 B;  5DJQ C;  1NIR A;  1I54 A;  2CXB A;  3PXW A;  1W5C T;  4WQ7 A;  1KX2 A;  1C2R A;  4WQA A;  1IZL 0;  1K3G A;  3PH2 B;  1CSX A;  5TIS V;  3NBS A;  1MG2 D;  1CXC A;  1BL9 A;  3ZCF A;  155C A;  4XYD B;  3SWS A;  1LC1 A;  3HQ9 A;  2ZOO A;  3O5C A;  5H2F V;  1CRJ A;  1DW2 A;  1M6Z A;  1CRG A;  2MHM A;  2BCC D;  1AYG A;  5CIG B;  1DVV A;  2QG4 A;  1IRW A;  1SQQ D;  3M97 X;  1RAP A;  3L73 D;  3L70 D;  3OCD B;  1NTZ D;  2Q3E A;  1YCC A;  1PP9 D;  1S5L V;  1I6E A;  3TYI A;  1I8O A;  1H33 B;  2QJP B;  3KZI V;  2CA3 B;  3O20 A;  1GQ1 A;  1I6D A;  3JBT B;  2AIU A;  3RLM A;  3H1K D;  1GIW A;  1GKS A;  2CE1 A;  3WFB C;  2V08 A;  3CU4 A;  1YNR A;  5GTH V;  5IY5 1;  3WFE C;  1HRO A;  1WVE C;  2BPB B;  1WEJ F;  1CED A;  3H1L D;  1GJQ A;  1NTK D;  4FAN A;  1FOC A;  1CTY A;  3TF5 A;  3OA8 A;  1E2R A;  2C2C A;  2FYN B;  4MU8 A;  1ZZH A;  1C6R A;  3RMZ A;  1SQP D;  4XXL A;  3CXH D;  4O1Q A;  1N50 A;  2PCC B;  4EIE A;  1M70 A;  1NMI A;  2ZON G;  2QJY B;  4H0J A;  5KLV D;  3O1Y A;  2FWL A;  3ZIY A;  1H33 A;  2QJK B;  3WC8 A;  1W2L A;  4FAV A;  2N9J A;  1NML A;  4U3F D;  1H32 A;  1A8C A;  1LMS A;  1R0Q A;  1QYZ A;  5CIB B;  1LC2 A;  1KB9 D;  2LIT A;  2N3Y A;  4FA4 A;  1C75 A;  4L3H A;  4LJI A;  1F1C A;  1ETP A;  3L74 D;  3NBT A;  1BCC D;  3MK7 C;  1N15 A;  4A7P A;  1L0L D;  2JQR A;  4PW9 B;  3SJL A;  1RZ5 A;  1C2N A;  4EIF A;  1CIH A;  3GW6 A;  2D0W A;  3X39 A;  1YTC A;  4AAL A;  3PXT A;  2L4D A;  5E79 V;  1DIQ C;  4EDF A;  1QL4 A;  2LIR A;  1HJ4 A;  1CHJ A;  2BH4 X;  4FA9 A;  4FA5 A;  3CXH W;  2Y0D A;  1YFC A;  5DJQ B;  1EB7 A;  1CIF A;  1FJ0 A;  1YIC A;  2ZZS 1;  1VYD A;  1L9J C;  4AAO A;  3ORV A;  1RZ6 A;  2GB8 B;  1CC5 A;  1U74 B;  4P4Q B;  2RMZ A;  1GU2 A;  2BCN B;  3KHU A;  4UB8 V;  1CYC A;  3C2C A;  1CHH A;  1CYJ A;  1CSU A;  2HV4 A;  1PPJ D;  3L4O A;  2N18 C;  1H9Y A;  2CA4 B;  4JCG A;  3VNW A;  1H9X A;  1EZV D;  1ZRT D;  1KYO D;  3VRD A;  2C1U A;  1J3S A;  1YIQ A;  1E29 A;  4AAM A;  2ZBO A;  5B6Q A;  5CIH B;  1OCD A;  4K3I A;  1DW0 A;  1CRY A;  2C1D B;  4NFG B;  1S6V B;  2C1D A;  2AXT V;  3L72 D;  1KB0 A;  5CIF B;  2EXV A;  5CIE B;  3A0H V;  2ZXY A;  3PLN A;  5B5E V;  1CCH A;  1BE3 D;  4N0K A;  1CCR A;  1HJ5 A;  4Y5R A;  3L71 D;  2DGE A;  3CYT I;  1QL3 A;  3PXS A;  1CSV A;  4V2K A;  4RJT A;  2PAC A;  1FI3 A;  1L9B C;  2FRC A;  3ZBM A;  2VHD A;  1CHI A;  1AOF A;  1K3H A;  4Q5P A;  3WFC C;  1DII C;  1U75 B;  2N3B A;  4L3G A;  1B7V A;  3PRJ A;  1AKK A;  2CE0 A;  1L0N D;  5KAI V;  2N9I A;  2ORL A;  2D0S A;  1SQB D;  1FHB A;  3BCC D;  2OZ1 A;  1C7M A;  1F1F A;  1DW3 A;  1H1O A;  3TGU D;  1FI9 A;  2O3J A;  2BH5 X;  3A0B V;  2B10 B;  4D6T D;  5C0Z A;  1DVH A;  1H31 A;  1KV9 A;  2IBZ D;  4WQ8 A;  2JTI B;  4AX3 A;  1E8E A;  1CSW A;  1LFM A;  2YCC A;  1M60 A;  5CIC B;  2BLF B;  1H32 B;  3WU2 V;  2Y0C A;  2FYU D;  1GDV A;  1N90 A;  1CYI A;  2DVH A;  1NNO A;  3CX5 W;  5KKZ B;  1A56 A;  3SVW A;  4QAO A;  3H1H D;  4FB1 A;  1HZV A;  2Y0E A;  1KYO W;  2C9X B;  1HZU A;  1P84 D;  2K9J B;  1RAQ A;  3DP5 A;  4J20 A;  1C6S A;  5GTI V;  1MZ4 A;  4H0K A;  1HCM A;  3DR0 A;  1QN2 A;  1CRC A;  4WQC A;  1YEA A;  1FCD C;  4AAN A;  4KMG A;  5KLI B;  3RN1 A;  451C A;  1COT A;  3ZOX A;  5B66 V;  3HQ8 A;  2YIU B;  5AUR A;  4YE1 A;  3VMA A;  4EIC A;  5C9M A;  1I5T A;  1CIE A;  3CX5 D;  2L91 A;  4WQE A;  5CID B;  1H31 B;  4O1W A;  1CRH A;  3H1I D;  2YQB A;  4FA1 A;  4UB6 V;  1CO6 A;  4GED B;  5CYT R;  1DW1 A;  4EID A;  2GIW A;  4RSZ A;  4PWA A;  1KX7 A;  351C A;  3DMI A;  1QKS A;  1I8P A;  1LS9 A;  1HJ3 A;  1I55 A;  1YEB A;  3OA8 B;  3WFD C;  3O0R C;  1NU1 D;  3VYM A;  5TJH A;  1AOQ A;  5DF5 A;  4WQD A;  4IL6 V;  3SXT A;  2BGV X;  3CP5 A;  3FWL A;  4WQB A; 
#chains in the Genus database with same CATH topology
 1CXA A;  1COR A;  4L1Q A;  3L70 G;  1YYC A;  1C6O A;  3ZOW A;  3ITK A;  3KXD A;  1KMI Z;  1CIG A;  4AYC A;  2G8Y A;  2NPS D;  1KOR A;  3L75 E;  3SLE A;  1G2C B;  3CWB J;  3D71 A;  2AXT E;  2OYO A;  3TGU E;  4GT1 A;  1QEX A;  3Q2Y A;  2AXC A;  2A06 D;  4GYD A;  3L72 E;  2LXB A;  5AVQ B;  4WQ9 A;  3H1J D;  3CME P;  3OCD A;  2P67 A;  1SQP K;  1NU1 J;  1SQQ G;  4JQ0 D;  3WUI A;  2YNY A;  1BGY D;  2AEM A;  3CWB D;  1L0L J;  3JCU H;  3RL0 g;  2KNC B;  2ZVO B;  2J58 A;  3RN0 A;  3AE3 C;  3PHL A;  2YK3 A;  2KS1 A;  4IFM A;  3VP9 A;  2KS1 B;  3L75 D;  5KAF V;  2M3E A;  3CC7 P;  1IO3 A;  1CTJ A;  1CTZ A;  2GC7 D;  2A45 H;  2E75 C;  2OZ1 B;  1L4A A;  1HRC A;  1FDM A;  1IFP A;  2WPS A;  5GTH E;  2IZ1 A;  1K8A Q;  1NTK K;  2QSI A;  2OYI A;  1KX2 A;  1C2R A;  4WQA A;  2ZXE B;  3L75 J;  3Q1M A;  2RH0 A;  1LWU C;  1T2K D;  4K3A A;  5GTH H;  2PGD A;  1E79 H;  1BL9 A;  1J1E C;  3L36 A;  1BGY E;  1LTJ A;  1LC1 A;  3O5C A;  3CCV P;  1KFN A;  1PP9 G;  3USS A;  3V4Q A;  1LP1 A;  1DW2 A;  1CRG A;  1SQV J;  3H1I E;  1SQQ D;  4DT0 A;  3JC2 2;  1KTM A;  2KIK A;  1SQP E;  3L71 J;  5CCG A;  1YCC A;  4N78 E;  3TYI A;  1H33 B;  1SQP G;  3KZI V;  1JY3 P;  1GZL A;  1S5L E;  1OMI A;  4HYT B;  1QVF O;  4I1L A;  1UIX A;  1JO5 A;  2FXO A;  2KYV A;  2QVA A;  3MD0 A;  1S9K D;  2B9B A;  1GL2 A;  1BGY J;  3S4R A;  5GTH V;  2BPB B;  1SQX E;  3Q5R A;  3FXD A;  3JSV C;  1GJQ A;  2A06 G;  1JCD A;  4FAN A;  1QX8 A;  1FOC A;  1PPJ G;  4OGQ C;  1FZC B;  4UB6 E;  1EZV I;  2H7H A;  5AVW B;  3V2R A;  3D0W A;  4H44 C;  2Q7C A;  3AE6 C;  4U3F J;  2YKP A;  4XXL A;  3CXH D;  1N50 A;  1VQ4 P;  3EFF K;  1JM0 A;  1QLE D;  2J59 M;  2QJY B;  1JMB A;  2B87 A;  4ASV A;  5B5E E;  4H0J A;  5KLV D;  3CI9 A;  1VQL P;  2NZ2 A;  3ZIY A;  2KLU A;  3A3Y B;  4C7N B;  1IZN B;  5BU5 A;  3WC8 A;  1SFC C;  4FAV A;  2N9J A;  3O6Q B;  4WBA A;  2FYU G;  3L72 J;  1LMS A;  1USE A;  1M56 D;  2K3R A;  2QEX P;  2FYU E;  2C9N Y;  3U1C A;  3H1L G;  2KK7 A;  1N15 A;  1HH0 A;  3P8C E;  2JR8 A;  2IPP A;  1NTZ G;  3B5N D;  3M9B A;  4Y28 J;  2XV5 A;  2PFX A;  4CPG A;  3PXT A;  3L37 A;  2LIR A;  1ZR2 A;  1CHJ A;  4FA5 A;  5E79 E;  2Y9Z A;  2HFE D;  2O1J A;  1FZA A;  3CCM P;  1RE4 C;  1CIF A;  5AW4 B;  2KI7 B;  2WZ7 A;  1NTZ K;  4D6T J;  3Q3D A;  2R3S A;  1RZ6 A;  1DD4 A;  2GB8 B;  2IYO A;  1VF5 C;  1HTL C;  2L5G B;  1NTK E;  2QJK C;  2P2U A;  2FXP A;  1CHH A;  1FOS E;  5AW6 B;  1CYJ A;  1CSU A;  4DOJ A;  3OW2 O;  3PJS K;  1ZR4 A;  1RQV A;  1BDD A;  1M7L A;  2WSE J;  2PRR A;  1DD3 A;  3RK3 C;  3RL0 D;  1Q82 Q;  2C1U A;  2JO1 A;  2WT7 A;  2LR2 A;  1YIQ A;  4AAM A;  2ZBO A;  5KLV G;  3CCR P;  5B6Q A;  4I6M C;  5CIH B;  1GD2 E;  1DW0 A;  1CRY A;  1DEB A;  3RBZ A;  4NFG B;  1JB0 J;  1BCC G;  2FFD C;  4I7Z B;  2KLV A;  3A0H V;  3H32 B;  5CHX A;  1GL2 D;  2LXC B;  1YJ9 P;  5KJ7 D;  1AJY A;  3SWK A;  1SVF A;  5APV A;  1K04 A;  1VQM P;  1BE3 D;  4N0K A;  1JY2 P;  3CXH E;  4Y5R A;  2KSJ A;  1QL3 A;  3PXS A;  1LT1 A;  4IFD K;  5CCG C;  2FRC A;  1IFM A;  1R8E A;  2VHD A;  1AOF A;  2CK3 H;  2LKM A;  1YBK A;  4PJ0 E;  1ZLL A;  2N3B A;  1X0T A;  1FZC C;  2H88 C;  4L3G A;  2IFM A;  2R32 A;  4JBZ A;  1L0N D;  2N9I A;  3I55 P;  1FE6 A;  1FHB A;  3N7N A;  1BE3 J;  1F1F A;  2CPB A;  1H1O A;  1BE3 E;  3BRV B;  2O3J A;  4D6T D;  2B10 B;  3EQ2 A;  2YIU C;  1H31 A;  1LJ2 A;  1JTH A;  3PH0 A;  2ZT9 C;  5KLV K;  4YTP C;  2JTI B;  1T3U A;  2YCC A;  1M60 A;  2NPS B;  1A02 F;  2MKV A;  1H32 B;  4ZKP A;  2Y0C A;  1GDV A;  1NTK G;  2Z5I A;  5M1B A;  1CYI A;  3WU2 H;  1S4X A;  3CX5 W;  2OYI C;  1A56 A;  5AVT B;  3H1H D;  2HOD B;  4PD4 E;  1KN7 A;  1AQT A;  1HZV A;  2M5A A;  1KD1 Q;  2WSC J;  2BCC E;  5KJ7 A;  1EXJ A;  3CXH I;  3DP5 A;  1BCC E;  2OGU A;  1NJI Q;  1MZ4 A;  5KAF E;  3C1L A;  1KIL C;  1BSH A;  3HD7 C;  2QM7 A;  4WQC A;  1XTC C;  3A0B H;  1YIT P;  1NTM J;  1OW6 A;  2WTY A;  2DW3 A;  1VF5 B;  5C9M A;  4AUW A;  1CIE A;  1X22 A;  2L91 A;  2KXP B;  5CID B;  3C8V A;  2IBZ I;  3F89 A;  5AW3 B;  1NTM K;  1CO6 A;  1EZV E;  5CYT R;  1DW1 A;  1KX7 A;  2WWW A;  1N73 A;  2E74 C;  3ABV C;  2AXT H;  2POH A;  1HJ3 A;  2O01 H;  5KKZ C;  2E76 D;  1HVV A;  1H88 A;  1SQX K;  4N6J A;  2IBZ E;  2A45 I;  5TIS E;  2C9L Y;  2RN0 A;  3HRN A;  1NTM D;  1KQS O;  1MG3 D;  4HB1 A;  3A0B E;  3M91 A;  1NTZ E;  3H32 A;  3HQ7 A;  3ZOO A;  2R5B A;  1SQX G;  2WVR A;  3BCC J;  3P32 A;  3T97 A;  1CNO A;  4GDO A;  1N9C A;  2Y9Y A;  3NWV A;  3HQ6 A;  3GG2 A;  1YJW P;  2ZAE B;  1SQV D;  1FS0 E;  1LGH B;  1SS1 A;  1ZV8 A;  1M1K Q;  1YHQ P;  2GUS A;  4GIF A;  2PCB B;  1OAE A;  1FI7 A;  3GLM A;  3MK7 B;  1HBW A;  4Y99 C;  1IQC A;  1SFC A;  2PAJ A;  3AE9 C;  3VN0 A;  3C9I A;  5CJ0 A;  1OW7 A;  3RL0 B;  1RF1 B;  1BE3 G;  1KFM A;  3NFQ A;  3TSI A;  1NH4 A;  5EFW B;  3CC4 P;  3LW5 H;  5AW1 B;  1M90 Q;  2K88 A;  1PFI A;  1GL2 B;  4IL6 H;  2O01 J;  1Q2N A;  2XZR A;  3L74 G;  1NHL A;  4IL6 E;  1VQN P;  1S1C X;  2ZYA A;  5TIS V;  4RKU J;  3NBS A;  1CW5 A;  3M9Q A;  1CZQ A;  5AW0 B;  2YXQ B;  3HD7 D;  4PV1 D;  4JYC A;  3HQ9 A;  3A7O A;  2ZOO A;  1R5S A;  1E5W A;  5H2F V;  1L0N G;  1CRJ A;  4PJ0 H;  3GF3 A;  1FBM A;  1IRW A;  3M97 X;  1RAP A;  3L70 D;  3B8E B;  2IYP A;  1GMJ A;  1PP9 D;  1N73 C;  1UII A;  2QJY C;  1I8O A;  2QJP B;  3KQG A;  2PP6 A;  1NU1 G;  3N4X A;  2FBW C;  1I6D A;  2W27 A;  3T97 B;  2W6B A;  3WUT A;  2Q1K A;  1L4A B;  2A45 G;  3CX5 I;  2AIU A;  5KAI E;  3TYY A;  3RK2 C;  4PV1 B;  3WFB C;  1VQ6 P;  1NYH A;  1VL2 A;  5IY5 1;  3WFE C;  1VQ8 P;  3GHG A;  1X8Y A;  3P8C D;  4JPZ B;  1KYO I;  1LWU A;  1CTY A;  2WSF H;  1E2R A;  3HE5 B;  1SFC D;  4MU8 A;  1C6R A;  2XU6 A;  2G3A A;  1GU5 A;  3RMZ A;  1SQP D;  4O1Q A;  3O8Z A;  4TT3 H;  3IAO A;  1NMI A;  2ZON G;  5AVV B;  1JTH B;  4H0L D;  1N7S D;  1L0L E;  1H33 A;  2QJK B;  2XDJ A;  1N7S A;  3D70 A;  5AW8 B;  1VQP P;  1R0Q A;  2YMY A;  1KB9 D;  3CCL P;  2N3Y A;  1C75 A;  1YQ4 C;  4L3H A;  1F1C A;  1ETP A;  3L74 D;  4L74 A;  1BCC D;  3MK7 C;  3KZI H;  1KYO H;  1RZ5 A;  1ZME C;  3GW6 A;  1PPJ E;  1YI2 P;  2J5U A;  3X39 A;  4R4M A;  1RF1 C;  2OYH A;  5APW A;  4MN4 C;  2L4D A;  3AEG C;  1DIQ C;  4EDF A;  1YTZ T;  4U3F G;  1HJ4 A;  2BH4 X;  1LWU B;  3CXH W;  3AE4 C;  3M0D C;  4WY4 C;  1FJ0 A;  1YIC A;  4BRY B;  1MUU A;  1Y9B A;  2Q5U A;  4AAO A;  2FYZ A;  1AVY A;  5DJT B;  4H13 B;  5AW2 B;  1JY2 N;  3H1L E;  1LNQ A;  4P4Q B;  3SFE C;  3ZDM A;  1M1J B;  2BCN B;  3AEA C;  2H43 A;  1VQ7 P;  3L4O A;  2WIT A;  2N18 C;  1H9Y A;  3H1L J;  3P8M C;  3VNW A;  4GKG A;  4Z1M H;  2HLO A;  3BAS A;  1DX7 A;  1ZRT D;  4NPD A;  3LID A;  1QGK B;  2P1J A;  5APQ A;  3MP7 B;  2AEJ A;  1NTM E;  3A2A A;  3VRD A;  4ZKU A;  1LTA C;  4JF7 A;  1YTZ I;  2N1T A;  2ZT9 D;  3HUS B;  1N8R Q;  3Q5P A;  2C1D B;  1S6V B;  1LTG C;  1MFZ A;  1KB0 A;  3IFM A;  1HGZ A;  5CIE B;  3PLN A;  2WQY C;  1G2C A;  1L4A C;  1GW3 A;  5E79 H;  3FWN A;  1Z56 A;  1HJ5 A;  3L71 D;  1GK6 A;  3RK2 B;  2E5Y A;  1FZB A;  1QL2 A;  4V2K A;  4RJT A;  1JMM A;  1FZE A;  2QIW A;  1L9B C;  3L35 A;  3KZI E;  3AED C;  1K3H A;  4Q5P A;  3KPE A;  3D6Z A;  2ZYD A;  1T2K C;  3BAT A;  1VQK P;  4ASW A;  1Y47 A;  2Q6Q A;  2W8Z A;  3AE1 C;  1KIL B;  2D0S A;  4UB8 E;  3V4W A;  3BCC D;  2OZ1 A;  1W2B O;  2FYU J;  2QM8 A;  3L72 G;  5BVZ A;  1FDO A;  1FI9 A;  1M57 D;  2FY8 A;  3A0B V;  5C0Z A;  1DVH A;  1ZP0 C;  2ZXX A;  4HJG H;  1FJK A;  5C39 A;  1CSW A;  1NTZ J;  4HKZ H;  1N7S B;  5AVU B;  1PIX A;  3OA7 A;  2KUB A;  2UWJ E;  1EXI A;  2E74 B;  2DVH A;  3B71 A;  1NNO A;  5KKZ B;  1JUN A;  1KQL A;  3FGA D;  3WUV A;  1AFO A;  3SVW A;  2ZYG A;  4XA4 A;  2M5A B;  2SPZ A;  1K9M Q;  2Y0E A;  2M3B A;  1HZU A;  2JDI H;  2V7Q H;  1RAQ A;  3I5C A;  4O9B A;  1KQF B;  1URQ B;  1IFN A;  1YIJ P;  1SFC B;  2P58 A;  4H0K A;  1EZV G;  3M0D A;  3MHV A;  3DR0 A;  1YEA A;  2HR3 A;  1FCD C;  4OWF A;  1Q7Y Q;  2B89 A;  3H1H E;  5B66 V;  4K35 A;  3HQ8 A;  4H13 C;  3OAK A;  1VQ9 P;  3VMA A;  1I5T A;  1M1J C;  3QWO C;  4O1W A;  1CRH A;  1M1J A;  3II6 A;  4FA1 A;  1YQ3 C;  2KNC A;  1NTK J;  1MFT A;  3L71 E;  3NXS A;  1NVO A;  1S72 P;  1BCC J;  4PWA A;  1RF1 A;  3DMI A;  1RH5 B;  2ZJS E;  1I8P A;  3H1K J;  3WUU A;  4YXW H;  1LT9 C;  1EQ7 A;  3M0A A;  1AOQ A;  2HPC A;  2WT7 B;  4IL6 V;  1BSN A;  4L76 A;  1EDJ A;  2FYN C;  3V6I A;  5H2F E;  3CD6 P;  2E42 A;  4ZMD A;  2MTA C;  3U59 A;  1H89 A;  2Z4E A;  2B0Z B;  2B12 B;  2VRS A;  1JDL A;  1VPC A;  2C1V A;  1SQQ K;  2V07 A;  2C8S A;  1SQV K;  1SQB G;  2H8P D;  1KIB A;  1IFI A;  2JWA A;  3RK3 B;  1S5L H;  1HUC A;  1WMK A;  3MTU E;  2XKM A;  2OTL P;  3FXE A;  3TDK A;  2KB7 P;  3ZOY A;  4PJ0 V;  5AVX B;  1RE4 A;  2B88 A;  1J1D C;  5APY A;  1CI6 A;  1RQU A;  4I7Z C;  2JWD A;  2AEF A;  2WPQ A;  1A2S A;  2FYU K;  1CRI A;  2ZT9 B;  4W7Z A;  1NU1 E;  2QA4 P;  3MIW A;  1SQX D;  4DY9 A;  5DFS A;  2B4Z A;  3HE5 A;  2GC4 D;  3VP8 A;  4BRY A;  3E1I A;  2ITA A;  2B11 B;  5DJQ C;  1OW8 A;  2N1T C;  1I54 A;  3CCQ P;  3PXW A;  1D7M A;  3TGU J;  5AW7 B;  3VMX A;  2JKV A;  4R4L A;  2OYI B;  2A06 E;  3H1K E;  4KT0 J;  1L0N E;  3PH2 B;  1SQX J;  1IJD B;  3BCC G;  3G9R A;  3WU2 E;  4DZO A;  1CXC A;  3ZCF A;  1X9V A;  2WSS H;  1IFJ A;  1S9K E;  2N1T D;  2RKL A;  4IFF A;  5DJU B;  2BCC D;  5CIG B;  1DVV A;  1WRG A;  3H1I G;  1FDI A;  2K9J A;  3OCD B;  4IOI H;  2QE7 H;  2Q3E A;  2CA3 B;  3V5B A;  3O6Q A;  1PV3 A;  1NOH A;  2I1J A;  1CSB A;  1Q81 Q;  1GIW A;  1GKS A;  3H1H J;  3B5N B;  2CE1 A;  2WSE H;  1CI6 B;  3CU4 A;  1M8O B;  1YNR A;  3GHG B;  1J2J B;  1WT6 A;  3HD7 B;  1CED A;  1VF5 D;  3OJA B;  2W83 C;  4BXL A;  1USD A;  1L0N J;  3H1K G;  1SQB E;  3L74 J;  2I1K A;  1NTK D;  1DEE G;  3MGN A;  3E7K A;  2C2C A;  2FYN B;  1RF0 A;  3AE5 C;  2Z5H A;  4RO0 A;  1FZF A;  1JY3 O;  3IN6 A;  3IF4 A;  4WY4 B;  5AVS B;  1VDF A;  3W68 A;  3NMD A;  2KZJ A;  3HUS A;  1EC5 A;  4KHX A;  5AW5 B;  3O1Y A;  2FWL A;  3CCS P;  1ZOY C;  2FXM A;  4UB8 H;  4Y99 B;  1NML A;  4U3F D;  1A8C A;  5CBO A;  5GTI E;  1LC2 A;  3RK3 D;  3RL0 C;  4LJI A;  3K5B A;  1H0T B;  2R3C A;  2IBZ G;  4A7P A;  2WPR A;  1L0L D;  1IK7 A;  4N78 D;  1K73 Q;  4PW9 B;  1C2N A;  1W5C E;  1CIH A;  2D0W A;  1GL2 C;  1PZQ A;  4LC1 A;  4AAL A;  3S9O A;  2M0B A;  1FAV A;  1QL4 A;  1OFC X;  2YXR B;  4FA9 A;  2Y0D A;  5DJQ B;  2YKO A;  1KIL A;  2WSC H;  1EB7 A;  3HTK B;  2ZVN B;  2ZZS 1;  1VYD A;  1L9J C;  3CCE P;  1YJN P;  2XNX A;  3AEC C;  3ORV A;  3R2P A;  4GOD A;  1U74 B;  3WMM 0;  2RMZ A;  2ZFC A;  4PD4 I;  5AW9 B;  1GU2 A;  1KZU B;  3HD7 A;  3KHU A;  3W67 A;  4UB8 V;  1S3J A;  3C2C A;  1KB9 E;  1Y8A A;  4PD4 H;  3M9H A;  2CA4 B;  1AVO A;  4W80 A;  1H9X A;  1LP1 B;  1KYO D;  3H1I J;  3L73 E;  1E29 A;  2HOD A;  2O1K A;  1PP9 E;  1OCD A;  5APS A;  1MZ9 A;  2AXT V;  3L72 D;  5CIF B;  1URQ D;  2OYH B;  3D6Y A;  2D2C D;  2BCC G;  2OTJ P;  3TK1 A;  1ZRT E;  1KQG B;  2OQQ A;  4WB4 A;  3H6P A;  3HTK A;  1CSV A;  1P84 H;  3L70 J;  1A02 J;  4I2L C;  2PAC A;  3ZBM A;  1KYO E;  1OZH A;  1DII C;  1U75 B;  2BAS A;  1GU4 A;  2HYN A;  3PRJ A;  4YXD C;  1FZC A;  5KAI V;  4EYY Q;  4C7R A;  1OWA A;  4IL6 X;  4PV1 C;  1DW3 A;  2C0X A;  1MV8 A;  5CCG D;  1U7M A;  1NAF A;  3L73 G;  2WPV B;  2IBZ D;  2K37 A;  1AV1 A;  4OH8 B;  2NPS A;  1LT9 A;  2E75 B;  5CIC B;  2R5D A;  1PL5 A;  5K5G B;  2BLF B;  3CC2 P;  4B86 A;  1N90 A;  1LTJ C;  1RE3 C;  1LTT C;  4H13 D;  1KC8 Q;  4QAO A;  4FB1 A;  1VQ5 P;  2C9X B;  3H1J G;  1U57 A;  3HE4 B;  1N7L A;  1LTB C;  4HH2 A;  1C6S A;  1HGV A;  1Q86 Q;  1EDK A;  1NWQ A;  1QN2 A;  1CRC A;  1EDI A;  1SP4 A;  1PP9 J;  3RBX A;  3PP5 A;  1AQ5 A;  4AAN A;  4KMG A;  5KLI B;  3A5T A;  451C A;  1COT A;  3ZOX A;  1T3J A;  1JCC A;  1SQQ J;  1GTW A;  2P10 A;  2M8R A;  5B66 H;  4GOE A;  4EIC A;  1L0L G;  3CCU P;  3G4S P;  1KIL E;  1NKN A;  1J1D B;  2BEQ D;  4NPF X;  3LIE A;  4GED B;  4EID A;  2GIW A;  1G1J A;  351C A;  1IC2 A;  1LS9 A;  3SWY A;  1I55 A;  1YEB A;  3OA8 B;  3WFD C;  1NU1 D;  3VYM A;  4RES B;  5TJH A;  3A0H H;  1JEK A;  4D6T E;  3CPW O;  1OXZ A;  1JNM A;  4XFJ A;  3SXT A;  2CPS A;  3FWL A;  2N1T B;  1FZG A;  2FFD A;  5B5E H;  1DIP A;  1MKM A;  2YO3 A;  4OGQ B;  3A9F A;  5KAI H;  2N18 B;  2KP8 A;  1S5L X;  4OGQ D;  1PGP A;  2YKQ A;  3F5H A;  4H44 B;  2N9Y B;  2IZ0 A;  3IR9 A;  1HH7 A;  4LLH A;  2AI5 A;  3AEE C;  4PD4 D;  1T6A A;  1FOS F;  4AQR D;  3MZW B;  3JCU E;  2KZI A;  3P7K A;  3HUS C;  2V7Q J;  3CL3 D;  5EXQ A;  3UIA A;  2XTS B;  1IRV A;  3L4M A;  3CLQ A;  3RK2 D;  2I8F A;  1SQV G;  2P7J A;  1HJB A;  3I56 P;  3LW5 J;  3S1K A;  3PTZ A;  1KV4 A;  1RE3 A;  1N2D C;  4LGD E;  1HJ0 A;  2E74 D;  1GW4 A;  1BGY G;  1DT1 A;  1PGO A;  1C52 A;  1NIR A;  2CXB A;  3KDP B;  1W5C T;  1PGJ A;  2OTK E;  2C0W A;  4WQ7 A;  1TU3 F;  4GOF A;  3BCC E;  2HG5 D;  1QVG O;  3CWB E;  3B5N C;  3SSU A;  2R44 A;  5TIS H;  1SQB J;  1IZL 0;  3L74 E;  1K3G A;  1QL1 A;  1S2E A;  3GF7 A;  1L2P A;  1FJP A;  1CSX A;  4H0L B;  1PGQ A;  1K05 A;  1MG2 D;  2W90 A;  4WVZ A;  3VMZ A;  155C A;  1LTJ B;  1OVU A;  4XYD B;  3NTN A;  4C7N A;  4L73 A;  1AA0 A;  1URQ C;  4NPE A;  3SWS A;  4EIJ A;  2E75 D;  1U7J A;  1T8Z A;  3MUD A;  5APX A;  3E1R A;  3AE7 C;  1M6Z A;  2MHM A;  1AYG A;  1IO4 A;  4DCK A;  2QG4 A;  2E5T A;  3L73 D;  1NTZ D;  1N7S C;  2GA1 A;  1S5L V;  1I6E A;  3Q5S A;  1DH3 A;  4L75 A;  3O20 A;  5KLI C;  1GQ1 A;  3U1A A;  3M06 A;  3A0H E;  3KYQ A;  1SQV E;  5AVZ B;  1SQQ E;  3AEF C;  5KLV J;  3R4Y A;  3JBT B;  5KAF H;  3RLM A;  5CCH C;  3H1K D;  2NRG A;  3AE2 C;  2K9Y A;  1NGM B;  2V08 A;  1SLQ A;  5AVY B;  1HRO A;  1J1E B;  2MJZ A;  1WVE C;  4EOT A;  3TGU G;  1WEJ F;  3CX5 E;  3H1L D;  5B66 E;  1KB9 H;  3G3Z A;  4ZNC A;  1GDT A;  3TF5 A;  3OA8 A;  4C46 A;  2HPC B;  1ZZH A;  1LTI C;  2I8D A;  1LTS C;  1OX3 A;  1W2E A;  1ZXG A;  2OAR A;  3RK3 E;  2PCC B;  1JY3 N;  4EIE A;  1M70 A;  4YPC A;  2IX7 C;  2WSF J;  2E43 A;  5CBN A;  1OVR A;  2E76 B;  4D6T G;  2B87 B;  1R5L A;  1LT9 B;  2BEZ F;  1W2L A;  1ZN5 A;  1H32 A;  1QYZ A;  1Q90 D;  5CIB B;  2LIT A;  3V2P A;  4FA4 A;  1G1I A;  3L70 E;  1H0T A;  3NBT A;  2XND H;  2JQR A;  3SFD C;  1XTG B;  3SJL A;  2NPS C;  3H1H G;  4EIF A;  3G6E P;  1OVV A;  5KJ7 C;  1YTC A;  1L4A D;  5E79 V;  2D2C C;  3CMA P;  2JJL A;  3L4F A;  1IFD A;  3QH9 A;  2KOG A;  3FX0 A;  2OYH C;  3BRT B;  1YFC A;  2YO2 A;  1X79 B;  3AEB C;  1NO4 A;  3H1J E;  4JYB A;  1RF0 C;  4WY4 A;  3B5N A;  3MUD C;  1H8A A;  5AVR B;  2FKW B;  2Q3I A;  1CC5 A;  4H0L C;  3VYI A;  1FC2 C;  1BDC A;  1KIL D;  1CYC A;  5APT A;  4XE5 B;  3RGU A;  2HV4 A;  1PPJ D;  1N86 A;  4JCG A;  1EZV D;  1SQB K;  1L0L K;  2N9B A;  3B4S A;  1ZW0 A;  1JOC A;  3V2N A;  1J3S A;  4DJG A;  4EI2 A;  3AE8 C;  4K3I A;  3HE4 A;  3VOP A;  5CMZ A;  4U7J A;  2C1D A;  3VTP C;  3G71 P;  3VMY A;  1P84 E;  2EXV A;  2ZXY A;  5B5E V;  3CXH H;  1CCH A;  1VQO P;  1CCR A;  2DGE A;  3CWB G;  3CYT I;  2IFN A;  4WY4 D;  2JEE A;  1FI3 A;  4W7Y A;  2WMM A;  1CHI A;  1FU1 A;  3WFC C;  4BWN A;  1B7V A;  2JP3 A;  3BVH A;  1AKK A;  1HWT C;  2CE0 A;  5GTI H;  2ORL A;  3EWK A;  3GMA A;  1SQB D;  1C7M A;  3CCJ P;  1IK9 A;  3TGU D;  2E76 C;  2BH5 X;  1L0N K;  4OVN F;  2K1A A;  3GHG C;  5CCH A;  5APU A;  1NTM G;  2FFD B;  1KB9 I;  1KV9 A;  4WQ8 A;  1JY2 O;  4AX3 A;  1RY3 A;  1E8E A;  1LFM A;  3L75 G;  1N73 B;  2YMK A;  4UB6 H;  2GUV A;  4H44 D;  3WU2 V;  2FYU D;  4M3L A;  1NU1 K;  1OIP A;  4U3F E;  1P84 I;  2W6J H;  3CX5 H;  3V2Q A;  4QMA A;  5KLV E;  1NAY A;  5CCH D;  5CJ4 A;  1KYO W;  1P84 D;  2K9J B;  2D2C B;  4J20 A;  2Q9I A;  2W6A A;  1URQ A;  5KTB A;  5GTI V;  5BU8 B;  1GK4 A;  3L71 G;  1HCM A;  3TNU B;  3TNU A;  1SQP J;  3EFG A;  1RHZ B;  3SWF A;  3RN1 A;  3L73 J;  1HF9 A;  2YIU B;  5AUR A;  5H2F H;  4YE1 A;  2IDB A;  2QRX A;  2KSE A;  4N3Y B;  3CX5 D;  4WQE A;  4WWI A;  2O01 N;  4KJM A;  1H31 B;  2QJP C;  3H1I D;  2YQB A;  2V4H A;  2GM4 A;  4UB6 V;  1NKZ B;  4RSZ A;  1EDL A;  3H25 A;  1QKS A;  5L8R J;  2BCC J;  3O0R C;  4TLF A;  5DF5 A;  3H1J J;  4WQD A;  2H89 C;  2BGV X;  3CP5 A;  4WQB A; 
#chains in the Genus database with same CATH homology
 1CXA A;  1COR A;  2RN0 A;  4L1Q A;  1NTM D;  2MTA C;  1C6O A;  1MG3 D;  3ZOW A;  2B0Z B;  3ITK A;  2B12 B;  1CIG A;  3A9F A;  2N18 B;  1JDL A;  3HQ7 A;  3SLE A;  2C1V A;  2V07 A;  2C8S A;  3ZOO A;  1KIB A;  2JWA A;  2N9Y B;  1CNO A;  1HH7 A;  1N9C A;  2AI5 A;  4PD4 D;  3NWV A;  3TDK A;  3HQ6 A;  3GG2 A;  3ZOY A;  2A06 D;  4GYD A;  1SQV D;  4PJ0 V;  5EXQ A;  2XTS B;  1IRV A;  3L4M A;  3H1J D;  4WQ9 A;  3OCD A;  2PCB B;  1OAE A;  2I8F A;  1FI7 A;  3MK7 B;  1A2S A;  3WUI A;  1IQC A;  1BGY D;  3CWB D;  2KNC B;  1CRI A;  3PTZ A;  3RN0 A;  3PHL A;  1SQX D;  2YK3 A;  2KS1 A;  4DY9 A;  3L75 D;  5KAF V;  5DFS A;  1IO3 A;  1CTJ A;  1CTZ A;  2B4Z A;  2GC7 D;  2GC4 D;  2OZ1 B;  1HRC A;  1DT1 A;  1C52 A;  2B11 B;  5DJQ C;  1NIR A;  1I54 A;  2CXB A;  3PXW A;  1W5C T;  4WQ7 A;  1KX2 A;  1C2R A;  4WQA A;  1IZL 0;  1K3G A;  3PH2 B;  1CSX A;  5TIS V;  3NBS A;  1MG2 D;  1CXC A;  1BL9 A;  3ZCF A;  155C A;  4XYD B;  3SWS A;  1LC1 A;  3HQ9 A;  2ZOO A;  3O5C A;  5H2F V;  1CRJ A;  1DW2 A;  1M6Z A;  1CRG A;  2MHM A;  2BCC D;  1AYG A;  5CIG B;  1DVV A;  2QG4 A;  1IRW A;  1SQQ D;  3M97 X;  1RAP A;  3L73 D;  3L70 D;  3OCD B;  1NTZ D;  2Q3E A;  1YCC A;  1PP9 D;  1S5L V;  1I6E A;  3TYI A;  1I8O A;  1H33 B;  2QJP B;  3KZI V;  2CA3 B;  3O20 A;  1GQ1 A;  1I6D A;  3JBT B;  2AIU A;  3RLM A;  3H1K D;  1GIW A;  1GKS A;  2CE1 A;  3WFB C;  2V08 A;  3CU4 A;  1YNR A;  5GTH V;  5IY5 1;  3WFE C;  1HRO A;  1WVE C;  2BPB B;  1WEJ F;  1CED A;  3H1L D;  1GJQ A;  1NTK D;  4FAN A;  1FOC A;  1CTY A;  3TF5 A;  3OA8 A;  1E2R A;  2C2C A;  2FYN B;  4MU8 A;  1ZZH A;  1C6R A;  3RMZ A;  1SQP D;  4XXL A;  3CXH D;  4O1Q A;  1N50 A;  2PCC B;  4EIE A;  1M70 A;  1NMI A;  2ZON G;  2QJY B;  4H0J A;  5KLV D;  3O1Y A;  2FWL A;  3ZIY A;  1H33 A;  2QJK B;  3WC8 A;  1W2L A;  4FAV A;  2N9J A;  1NML A;  4U3F D;  1H32 A;  1A8C A;  1LMS A;  1R0Q A;  1QYZ A;  5CIB B;  1LC2 A;  1KB9 D;  2LIT A;  2N3Y A;  4FA4 A;  1C75 A;  4L3H A;  4LJI A;  1F1C A;  1ETP A;  3L74 D;  3NBT A;  1BCC D;  3MK7 C;  1N15 A;  4A7P A;  1L0L D;  2JQR A;  4PW9 B;  3SJL A;  1RZ5 A;  1C2N A;  4EIF A;  1CIH A;  3GW6 A;  2D0W A;  3X39 A;  1YTC A;  4AAL A;  3PXT A;  2L4D A;  5E79 V;  1DIQ C;  4EDF A;  1QL4 A;  2LIR A;  1HJ4 A;  1CHJ A;  2BH4 X;  4FA9 A;  4FA5 A;  3CXH W;  2Y0D A;  1YFC A;  5DJQ B;  1EB7 A;  1CIF A;  1FJ0 A;  1YIC A;  2ZZS 1;  1VYD A;  1L9J C;  4AAO A;  3ORV A;  1RZ6 A;  2GB8 B;  1CC5 A;  1U74 B;  4P4Q B;  2RMZ A;  1GU2 A;  2BCN B;  3KHU A;  4UB8 V;  1CYC A;  3C2C A;  1CHH A;  1CYJ A;  1CSU A;  2HV4 A;  1PPJ D;  3L4O A;  2N18 C;  1H9Y A;  2CA4 B;  4JCG A;  3VNW A;  1H9X A;  1EZV D;  1ZRT D;  1KYO D;  3VRD A;  2C1U A;  1J3S A;  1YIQ A;  1E29 A;  4AAM A;  2ZBO A;  5B6Q A;  5CIH B;  1OCD A;  4K3I A;  1DW0 A;  1CRY A;  2C1D B;  4NFG B;  1S6V B;  2C1D A;  2AXT V;  3L72 D;  1KB0 A;  5CIF B;  2EXV A;  5CIE B;  3A0H V;  2ZXY A;  3PLN A;  5B5E V;  1CCH A;  1BE3 D;  4N0K A;  1CCR A;  1HJ5 A;  4Y5R A;  3L71 D;  2DGE A;  3CYT I;  1QL3 A;  3PXS A;  1CSV A;  4V2K A;  4RJT A;  2PAC A;  1FI3 A;  1L9B C;  2FRC A;  3ZBM A;  2VHD A;  1CHI A;  1AOF A;  1K3H A;  4Q5P A;  3WFC C;  1DII C;  1U75 B;  2N3B A;  4L3G A;  1B7V A;  3PRJ A;  1AKK A;  2CE0 A;  1L0N D;  5KAI V;  2N9I A;  2ORL A;  2D0S A;  1SQB D;  1FHB A;  3BCC D;  2OZ1 A;  1C7M A;  1F1F A;  1DW3 A;  1H1O A;  3TGU D;  1FI9 A;  2O3J A;  2BH5 X;  3A0B V;  2B10 B;  4D6T D;  5C0Z A;  1DVH A;  1H31 A;  1KV9 A;  2IBZ D;  4WQ8 A;  2JTI B;  4AX3 A;  1E8E A;  1CSW A;  1LFM A;  2YCC A;  1M60 A;  5CIC B;  2BLF B;  1H32 B;  3WU2 V;  2Y0C A;  2FYU D;  1GDV A;  1N90 A;  1CYI A;  2DVH A;  1NNO A;  3CX5 W;  5KKZ B;  1A56 A;  3SVW A;  4QAO A;  3H1H D;  4FB1 A;  1HZV A;  2Y0E A;  1KYO W;  2C9X B;  1HZU A;  1P84 D;  2K9J B;  1RAQ A;  3DP5 A;  4J20 A;  1C6S A;  5GTI V;  1MZ4 A;  4H0K A;  1HCM A;  3DR0 A;  1QN2 A;  1CRC A;  4WQC A;  1YEA A;  1FCD C;  4AAN A;  4KMG A;  5KLI B;  3RN1 A;  451C A;  1COT A;  3ZOX A;  5B66 V;  3HQ8 A;  2YIU B;  5AUR A;  4YE1 A;  3VMA A;  4EIC A;  5C9M A;  1I5T A;  1CIE A;  3CX5 D;  2L91 A;  4WQE A;  5CID B;  1H31 B;  4O1W A;  1CRH A;  3H1I D;  2YQB A;  4FA1 A;  4UB6 V;  1CO6 A;  4GED B;  5CYT R;  1DW1 A;  4EID A;  2GIW A;  4RSZ A;  4PWA A;  1KX7 A;  351C A;  3DMI A;  1QKS A;  1I8P A;  1LS9 A;  1HJ3 A;  1I55 A;  1YEB A;  3OA8 B;  3WFD C;  3O0R C;  1NU1 D;  3VYM A;  5TJH A;  1AOQ A;  5DF5 A;  4WQD A;  4IL6 V;  3SXT A;  2BGV X;  3CP5 A;  3FWL A;  4WQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...