1NTKD

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntkD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntkD01
1H9XA 1A2SA 3WFDC 1N15A 1N9CA 1AYGA 4K3IA 1NTMD 2C8SA 2PCBB 4H0JA 3ZIYA 4RJTA 2C1DA 2YQBA 2KS1A 1DW2A 3L74D 1IRVA 5CIEB 3A9FA 1QN2A 3H1HD 3CX5W 1U74B 3L71D 1NU1D 1C6OA 4WQCA 2Q3EA 1NIRA 4LJIA 1YNRA 1RAQA 4PJ0V 2AXTV 5B6QA 2PCCB 3PHLA 1DW1A 2GC4D 3TF5A 1YCCA 1NNOA 2QG4A 5KKZB 1ZRTD 4L1QA 1C6RA 3PXWA 2CE0A 2C9XB 3C2CA 3VYMA 1CYIA 351CA 3FWLA 1YTCA 1I54A 1QKSA 2GC7D 1H31A 4O1QA 3VRDA 1HROA 2QJPB 1J3SA 1DT1A 1NMIA 1CO6A 2CE1A 1S5LV 2CA4B 3GG2A 1C6SA 4FA9A 1SQBD 1H33A 1H1OA 1CRIA 3OA8A 1L9BC 1LFMA 4N0KA 5TISV 1YEBA 2FYNB 1W2LA 2BCCD 3CWBD 3PH2B 1CSUA 1YFCA 3RN1A 1E8EA 3HQ9A 3KZIV 2KNCB 1IQCA 4EICA 1ETPA 2PACA 1COTA 3WU2V 4DY9A 4WQ9A 3O20A 4Y5RA 2VHDA 3ZOOA 4FA4A 5CIBB 1DW0A 1U75B 1I6EA 1SQPD 3CP5A 5DF5A 1GQ1A 3VMAA 1H32A 4FB1A 2AIUA 3RLMA 4IL6V 5AURA 1RAPA 1A56A 2DVHA 5EXQA 1CRHA 451CA 1RZ6A 1YEAA 3WC8A 3WFCC 1CEDA 3ZCFA 1ZZHA 1H32B 2N18C 1KYOW 1PP9D 5IY51 2QJYB 1FI3A 2QJKB 1HJ3A 1QL3A 3TDKA 1GU2A 3TYIA 2BCNB 1GIWA 1C75A 1MG3D 3H1KD 3SLEA 1K3GA 1N50A 2CA3B 2EXVA 4RSZA 5TJHA 5B5EV 4AAMA 3SXTA 1LS9A 2YCCA 1A8CA 3ZBMA 2BGVX 1CIFA 3X39A 5GTHV 3L72D 2N9JA 2GB8B 3DP5A 1QYZA 4FAVA 5KAIV 3CXHW 2LITA 3PXSA 1E2RA 1I6DA 2N9YB 2I8FA 3NBTA 1F1FA 3ITKA 4KMGA 5E79V 5CICB 2B0ZB 3BCCD 2L91A 3PTZA 1AKKA 1BGYD 1C2RA 2FYUD 1KX7A 2ZBOA 3TGUD 1QL4A 3SJLA 4WQEA 2BPBB 5CIGB 3DMIA 4PWAA 3PRJA 4FANA 1HZUA 4L3GA 1KB9D 3NWVA 1CXAA 155CA 3ZOWA 5DFSA 5CYTR 2B11B 3L4MA 4JCGA 2FRCA 1RZ5A 4EIFA 1CHIA 1N90A 2B4ZA 1CNOA 1PPJD 5KLIB 4AX3A 4NFGB 1L0LD 4O1WA 4UB8V 1C7MA 4MU8A 3HQ8A 2D0WA 2ZOOA 2JTIB 1CIGA 1IRWA 5C9MA 2B10B 1LC2A 1CTYA 3WFEC 1W5CT 4P4QB 3PLNA 1F1CA 2HV4A 2N9IA 5CIFB 1WVEC 3H1LD 4WQ7A 3RMZA 1CSXA 4AALA 1GKSA 2RN0A 5GTIV 2N18B 1CIHA 3O0RC 1BE3D 1FI9A 3L75D 3MK7C 3ORVA 3PXTA 1CCRA 1VYDA 3L4OA 4FA1A 3CX5D 2AI5A 1FOCA 2MTAC 4J20A 3HQ6A 5CIHB 1L9JC 1BCCD 1I8PA 3WFBC 1HZVA 3VNWA 1OCDA 1M70A 1DIQC 1I8OA 1CTJA 1DVHA 1NMLA 3GW6A 2Y0CA 1SQXD 1SQVD 5CIDB 1YICA 4GYDA 4YE1A 2XTSB 1GJQA 1WEJF 3OCDB 3JBTB 1KIBA 5DJQC 4XXLA 2CXBA 3NBSA 1CORA 4H0KA 4WQ8A 2ZXYA 1GDVA 1R0QA 4V2KA 5H2FV 1KV9A 3CYTI 2IBZD 2ZZS1 3ZOYA 2Y0EA 3SVWA 2K9JB 1AOQA 2OZ1B 2N3BA 3DR0A 1JDLA 2YIUB 1SQQD 3H1ID 1CRGA 3O5CA 4Q5PA 5C0ZA 1H9YA 1FHBA 1KB0A 2BH4X 1CSVA 1C2NA 4WQAA 1I5TA 1DIIC 4GEDB 4PW9B 2V07A 2C1VA 1MZ4A 3WUIA 1HH7A 1NTKD 1OAEA 2C1DB 3L73D 1AOFA 5KLVD 3O1YA 4WQDA 3ZOXA 1FJ0A 2B12B 4FA5A 4EIEA 1C52A 2BLFB 1HCMA 1KX2A 1LC1A 2RMZA 2JQRA 1KYOD 1DVVA 1S6VB 1YIQA 1CYJA 2A06D 2L4DA 3MK7B 2ORLA 2FWLA 1BL9A 1FI7A 2ZONG 1H31B 1CHHA 1EB7A 1M60A 1K3HA 3M97X 2N3YA 3A0HV 4PD4D 5KAFV 1I55A 1M6ZA 1EZVD 2C1UA 2V08A 1E29A 2Y0DA 5B66V 1CRCA 1CCHA 3KHUA 1IO3A 3A0BV 1H33B 3OA8B 3CXHD 3L70D 1CYCA 4EIDA 3OCDA 4XYDB 1CC5A 4QAOA 1CRYA 1CRJA 2DGEA 5DJQB 3SWSA 1IZL0 1CHJA 2GIWA 1NTZD 4EDFA 4WQBA 1HRCA 4AANA 1HJ4A 1B7VA 3CU4A 1DW3A 4UB6V 1P84D 4D6TD 1LMSA 3H1JD 2OZ1A 4U3FD 1CTZA 1FCDC 2D0SA 3HQ7A 1CSWA 1L0ND 2JWAA 2BH5X 1HJ5A 4AAOA 2LIRA 4A7PA 2C2CA 2MHMA 2YK3A 1CXCA 1MG2D 1CIEA 2O3JA 3RN0A 4L3HA
chains in the Genus database with same CATH superfamily
1H9XA 4UB6E 3G9RA 2IBZE 4WBAA 3B8EB 3WFDC 1PIXA 3C9IA 2KS1A 1OZHA 1IO4A 1NU1D 4ASVA 1C6OA 4WQCA 3L74E 2Q3EA 4WY4A 1URQA 3O6QA 3H1HE 4D6TJ 3RL0C 2AXTV 1LTTC 4K35A 3PHLA 2GC4D 1Q81Q 4OGQB 2VRSA 5EFWB 1J1DC 3T97B 3C2CA 3FWLA 1YTCA 2K1AA 1I54A 2AEFA 5APVA 4O1QA 1NTMK 2YNYA 2H7HA 1K9MQ 1JY2N 3SWYA 1TU3F 1DT1A 3AE2C 3VYIA 1GK6A 2CE1A 3L74J 4NPDA 1S5LV 3H1HJ 2KNCA 3L71J 2Z4EA 1SQBD 1H33A 3HE5A 2A45H 3OA8A 1KILC 3SWFA 4N0KA 2WZ7A 5TISV 2LXCB 1YEBA 3CX5I 2OYHB 1H0TB 2D2CC 1YJWP 3NFQA 1GL2C 1L4AC 2BCCE 3CWBE 1VQ6P 3JC22 1COTA 4Y5RA 1R5LA 3ZOOA 4FA4A 1DW0A 4OWFA 3CP5A 2LXBA 4C7NA 3VMAA 5AW0B 1L0LG 2DVHA 5EXQA 3S9OA 1LTJB 2NPSD 2BCCJ 3CWBJ 1KV4A 3B5NC 1W5CE 2QJYB 1FI3A 3A0BH 2ZVOB 2C0WA 4ZKUA 3JCUH 3MP7B 1GU2A 1BE3G 2W90A 2XZRA 2FXMA 3KXDA 4EOTA 3SLEA 1N50A 1SQPJ 1AV1A 1M7LA 3H1KE 1IC2A 4WB4A 1LS9A 3MZWB 1BCCG 3X39A 2N9JA 3A3YB 1IJDB 2B88A 2O01J 2Q9IA 4UB6H 1I6DA 3CCLP 1KILA 4NPEA 1SQXG 2NRGA 4KMGA 2CPSA 2B0ZB 1RY3A 1L4AA 1U7JA 1C2RA 1ZRTE 2I8DA 5APSA 3H1KJ 1JY3P 2QA4P 1QL4A 3SJLA 2E75C 2BPBB 5AVTB 4PWAA 1QL1A 1RE3A 1HZUA 3HD7D 1OIPA 2OYHA 3ZOWA 4I7ZB 5CYTR 2G3AA 2QM7A 2B11B 2YIUC 3N4XA 1KB9E 2QM8A 5CHXA 1ZN5A 1EZVI 3KQGA 3AEEC 5KLIB 2Y9YA 2NPSB 1RHZB 2FYUG 1QVGO 4NFGB 2Z5HA 1L0LD 4O1WA 3RL0g 1YI2P 3RK3E 1C7MA 2E76C 3B5NA 2JTIB 3CC7P 1FOSE 1G2CB 2ZAEB 1VQ4P 1JMMA 3PLNA 2P10A 1F1CA 2KB7P 1NOHA 3HUSB 1LTJA 3RMZA 2JKVA 4K3AA 3H1LE 1HH0A 3G4SP 2WPQA 3F89A 2N18B 2E43A 2K88A 1BE3D 1XTGB 1EDIA 1FI9A 2PGDA 5APXA 5AW9B 3PXTA 3CX5D 3L75E 2AI5A 3WU2E 2WWWA 4ASWA 1OW8A 2Z5IA 1BCCD 3WFBC 1LT9C 1AFOA 1G1JA 1S5LX 2R3SA 1PP9E 4IL6E 3NMDA 3USSA 1EZVG 2KK7A 3H1LJ 5CBNA 1SQXD 1SS1A 5CIDB 3HD7B 4GYDA 2O01H 1VDFA 3K5BA 1ZXGA 3P8CE 2V7QJ 1WEJF 3AE8C 3JBTB 1SQVE 4GDOA 1FZGA 2HPCA 3L75J 4R4MA 4QMAA 3CPWO 3OAKA 2R5BA 2IBZD 2W6JH 3SVWA 1OXZA 1PP9J 5B5EE 2OZ1B 1BSNA 1K73Q 1NO4A 1SVFA 4YTPC 1RF1C 1CRGA 3SWKA 3O5CA 1RE4C 4U3FG 1M56D 3V2RA 1KB0A 1SQVJ 3P32A 1ZLLA 3Q5SA 2Q5UA 4H44D 1RF0C 4PW9B 1N7SC 2PAJA 1KORA 3FGAD 5CCHD 2WSEJ 1KN7A 3C1LA 3U1AA 1OFCX 1G2CA 1AOFA 3CCSP 1NTMG 2HYNA 4FA5A 3CCRP 3AEAC 1HCMA 1Q90D 1LC1A 1SQQK 2P58A 1KB9H 2LR2A 3AE1C 5E79H 2PP6A 1LT9A 2XNDH 3ZDMA 2RKLA 2WT7B 1CYJA 4HKZH 1KC8Q 2IYOA 3MK7B 1RH5B 2MJZA 2FWLA 1BL9A 2ZVNB 1S3JA 2QJPC 4N6JA 1CHHA 3AEBC 5KLVK 1JTHB 1K8AQ 3VOPA 3F5HA 3M97X 4PD4D 1KYOH 1M6ZA 1EZVD 3PH0A 3B4SA 1P84I 3S1KA 3CCJP 5KJ7C 1FJKA 3O8ZA 1CZQA 3AE5C 5AW5B 1URQD 3CXHD 4B86A 4UB8H 4EIDA 1EC5A 4XYDB 3TSIA 2V7QH 3V2PA 5GTIE 2DGEA 5DJQB 2HODB 3M91A 3SWSA 1RF1A 1JCCA 1RE4A 4H44B 1HRCA 4EI2A 3U1CA 1NTZE 4XE5B 4DJGA 1D7MA 1IZNB 2FKWB 3Q5PA 2OZ1A 1N73B 1N7SA 4U3FD 3HQ7A 4H0LC 2XDJA 2JWAA 2BH5X 1L0NE 2LIRA 4A7PA 2MHMA 4N78D 1S2EA 1KQSO 2O3JA 1VF5C 4H13D 3RN0A 4L3HA 4BRYA 4W80A 5CCGC 2Q3IA 5AW6B 1AYGA 1N15A 1N9CA 3WUVA 1NTMD 1UIXA 4H0JA 3ZIYA 1CI6B 2YQBA 1NTZJ 1IRVA 2ITAA 1JY3O 3A9FA 3WUUA 3CCEP 1VQ7P 4PJ0V 3EFGA 2E74C 3TF5A 1YCCA 1L0NJ 1ZRTD 2WT7A 2KS1B 2KI7B 3PXWA 2CE0A 5AW3B 1NTKE 3KYQA 1VQLP 5KJ7A 3VP8A 1URQB 2GC7D 3O6QB 1YHQP 4L73A 3SFEC 2ZYAA 3M9BA 4LGDE 2ZYDA 3RL0D 1H8AA 1NMIA 1MFTA 2KOGA 2M3EA 4O9BA 1DD4A 2H43A 3VMXA 1H1OA 1T6AA 3TNUA 3RK2C 1BGYG 4EYYQ 1GW3A 1SLQA 2FYNB 1E8EA 1YFCA 3RN1A 1NTKJ 4DOJA 1FU1A 4CPGA 2W6AA 2KNCB 1IQCA 1ETPA 1IFJA 4DY9A 3WU2V 2VHDA 3HE5B 1M57D 4H13B 4HB1A 1Q86Q 1KILD 1GQ1A 1PPJG 3IF4A 1N73A 5CCGA 5KAFE 2D2CD 4IL6V 1FZCB 1GL2D 1M90Q 2B89A 1CRHA 3WMM0 1L4AD 1YJNP 3QWOC 451CA 3A0BE 3WC8A 1PGJA 3JCUE 1T3UA 5GTIH 1FJPA 4AQRD 3ZCFA 4C7NB 3L4FA 1KYOW 1PP9D 2R5DA 4MN4C 3I56P 1QL3A 1SQPK 3TYIA 2BCNB 1FZEA 1GIWA 1IFMA 2P1JA 5BU5A 2CA3B 4RSZA 5B5EV 1KMIZ 4AAMA 3RL0B 2GM4A 2P7JA 3ZBMA 1U7MA 1JB0J 1CIFA 3B5ND 3RBZA 1J1DB 2GB8B 1NWQA 1QYZA 1T8ZA 3L72E 2KSEA 3LIEA 2LITA 1MFZA 3L71E 3TK1A 1J1EC 2FFDC 5CICB 1KZUB 2L91A 3PTZA 1AKKA 1BGYD 3RK3C 1M1JC 3BCCE 4WQEA 5KAIE 3DMIA 1OMIA 1KILB 3NWVA 3TGUE 3P8MC 5DFSA 1ZR4A 3H32A 2O01N 4LLHA 2D2CB 3L4MA 3L72J 1GL2B 3LW5J 1L4AB 4JCGA 2FXOA 1PPJD 1JY2P 2E75D 2XV5A 2XU6A 4MU8A 5AVQB 2D0WA 2ZOOA 1LWUC 3BCCJ 2KZIA 2ZT9C 1CIGA 1FZCA 1IFNA 2FYUJ 1CTYA 1NKNA 1LJ2A 4P4QB 1FAVA 2HV4A 3HE4B 3TGUJ 2N9IA 3L73G 1WVEC 5KLVG 3H6PA 2FY8A 1CSXA 2RN0A 5GTIV 3RBXA 2WMMA 1SQPE 3B5NB 3O0RC 1QGKB 5DJTB 3BRTB 2E76D 1VQNP 3KZIE 2W27A 1CCRA 1VYDA 4IOIH 3L4OA 4J20A 3HQ6A 4JYBA 1DEEG 1L9JC 1I8PA 1S9KE 3D6YA 1R5SA 3CCVP 5KAFH 1EXJA 2IBZI 1I8OA 1CTJA 5AVWB 1KQLA 1Q7YQ 1E79H 2WPRA 3GW6A 3OA7A 1T2KC 2KP8A 4JYCA 1YICA 4YE1A 3OCDB 4I1LA 4AUWA 2Q6QA 2NZ2A 4M3LA 2J59M 1M1KQ 5CMZA 1YTZT 4XXLA 2CXBA 1NAYA 3NBSA 4WQ8A 4HYTB 1R0QA 1VPCA 1GDTA 1VQPP 2E75B 1PGOA 3SFDC 1HF9A 1G1IA 3E7KA 2HPCB 3II6A 1JDLA 2YIUB 1SQQD 3I55P 4D6TG 1GL2A 1SQVK 1JUNA 1LWUA 3LW5H 5C0ZA 3H1IE 1FHBA 5H2FE 3CCUP 1C2NA 5AVXB 2C1VA 1MZ4A 2YXQB 2IBZG 3WUIA 5GTHH 4KT0J 5E79E 1NTKD 3L73D 2E76B 3C8VA 5KLVD 4PD4I 5KAIH 3HE4A 2B12B 4EIEA 3L74G 1AVOA 2J58A 1JO5A 3H1HG 3A7OA 1SFCC 2JQRA 3GHGC 2KLVA 5KKZC 2K3RA 3H1IJ 3CXHI 5CBOA 1N7SD 1DVVA 1HJBA 1S6VB 1S1CX 1KYOE 1GMJA 1Y8AA 3RGUA 1NVOA 5AW8B 2A06E 1NAFA 2KSJA 3V4WA 1M60A 1LT9B 2M0BA 2N1TC 4UB8E 5KAFV 3AE6C 2V08A 1YQ3C 2I1JA 1E29A 3G6EP 3V2QA 2BASA 2FXPA 1CCHA 3KHUA 3A0BV 2KYVA 1BSHA 2N9BA 3FWNA 3OCDA 2BEZF 3L70E 3L35A 4JF7A 1J2JB 3KZIH 3VTPC 1IZL0 2BCCG 3CWBG 4EDFA 1OWAA 4WQBA 1KQFB 1PZQA 3CU4A 5KJ7D 4UB6V 4D6TD 2YO2A 1P84E 1CSWA 3H1JE 2HR3A 4BXLA 1RF1B 1BDDA 1LTIC 3AE9C 1AA0A 1L2PA 2J5UA 2Y9ZA 2C2CA 2Q7CA 1IFIA 2O1JA 3L70J 3MHVA 1JOCA 1A2SA 1NTZK 3GF3A 1SFCA 1N7SB 3GHGA 2C8SA 2PCBB 2QJKC 1KB9I 2V4HA 1DW2A 3L74D 5CIEB 4H0LD 3H1HD 3CX5W 3L71D 1YYCA 1YNRA 3D0WA 1NU1E 1RAQA 1IK7A 1KD1Q 1LP1B 1L0NK 4BRYB 3H1JJ 2PCCB 1VF5D 1DW1A 5APYA 3H1KG 1NNOA 1HBWA 5CCGD 4L1QA 5BVZA 1C6RA 2WSCJ 5H2FH 2C9XB 1JY2O 1HWTC 3VYMA 1CYIA 2P2UA 3VRDA 1HROA 3M0AA 2QJPB 1EDLA 2ZXEB 4HH2A 3GMAA 2L5GB 1JM0A 2E74D 1Y47A 1OVRA 1NU1J 3CD6P 1JNMA 3CL3D 1L9BC 1LFMA 4GT1A 1NTKK 1SQBE 2H8PD 2BCCD 3CWBD 3VMZA 4EIJA 3BVHA 3KZIV 1HGVA 1Z56A 1VQ5P 4WQ9A 3D71A 3TNUB 2OYIC 5CIBB 2K9YA 5APTA 1ZP0C 3Q5RA 2KXPB 1SQPD 5TISE 3RK2D 1H32A 4I2LC 4FB1A 2AIUA 4H0LB 3RLMA 1RAPA 4C46A 4DT0A 2OTJP 5B66E 1SQBJ 1A02F 1RZ6A 2R44A 4TT3H 1QX8A 1VF5B 1RF0A 1CEDA 4PV1C 3H1LG 5IY51 4W7ZA 5BU8B 1WMKA 3AEDC 1ZV8A 1HJ3A 3R4YA 3TDKA 3L75G 1C75A 3WUTA 3H1KD 3IFMA 1K3GA 2JO1A 4N3YB 1LP1A 3HTKA 2IPPA 1P84H 5TJHA 3CC2P 2DW3A 1YTZI 3IR9A 3SXTA 2E74B 1HGZA 2YCCA 1X79B 5KTBA 1PP9G 3DP5A 2WSCH 3NXSA 1HVVA 4FAVA 4GOEA 1YIJP 3CXHW 4Y99C 1E2RA 2N9YB 2I8FA 1SQVG 1USDA 1F1FA 3ITKA 5E79V 4IFMA 2E5YA 1KX7A 2ZBOA 3E1IA 5CIGB 1OX3A 3PRJA 3L36A 2OYIA 4FANA 3RK2B 4L3GA 1KB9D 4NPFX 2YKQA 1SP4A 2PFXA 4EIFA 2QEXP 1CHIA 2KZJA 1N90A 1PGPA 1CNOA 5L8RJ 4AX3A 3RK3D 2XKMA 4UB8V 2PRRA 1GK4A 3H32B 1L0LE 1KFNA 2JDIH 3U59A 3FXDA 5C9MA 2B10B 3WFEC 1W5CT 4WY4C 1MZ9A 1MKMA 3H1LD 1N8RQ 4AYCA 4AALA 4W7YA 3KDPB 1S5LH 3W68A 3L75D 3AE7C 1LTGC 1N2DC 1BE3E 2ZT9D 2M3BA 4FA1A 5TISH 1L0LJ 3CX5E 1HZVA 3VNWA 1OCDA 2HLOA 1HTLC 2QSIA 3IAOA 1M70A 1DIQC 3QH9A 1EDJA 2CPBA 1BCCE 1DD3A 5B66H 3FX0A 1DVHA 1FZBA 4GOFA 2M5AA 3P8CD 1SQVD 1QEXA 2C9NY 1SQXE 3V4QA 1KIBA 2K9JA 1KTMA 3V2NA 1J1EB 1BE3J 2C0XA 5AW4B 2FFDB 5CJ0A 5AVSB 3GF7A 2ZXYA 2CK3H 3PJSK 2IZ1A 3RK3B 1M1JB 1NTZG 3ZOYA 2OTLP 1BCCJ 1T2KD 3CLQA 2Y0EA 3FXEA 3BRVB 2A45I 3DR0A 1VL2A 1S72P 1OW6A 5AVUB 5GTHE 1XTCC 2OYOA 1LT1A 1SQXJ 1L0NG 2BH4X 4KHXA 1JMBA 3W67A 4LC1A 2FYUE 1I5TA 1JCDA 1X8YA 3VP9A 3E1RA 1JEKA 4U7JA 3PP5A 1HH7A 4DZOA 1OAEA 2C1DB 1GU5A 1LWUB 2ZXXA 1Q2NA 2W6BA 4WQDA 4GIFA 2ZT9B 3G3ZA 1YJ9P 1SQQG 2O1KA 1C52A 4C7RA 4JBZA 3AE3C 5AW7B 4OGQC 3LIDA 3B71A 3NTNA 1AQ5A 1WRGA 1N7LA 2ORLA 1NTKG 1VQKP 1H31B 1HUCA 1KFMA 2A45G 5AW2B 2N3YA 2IX7C 1SFCD 1I55A 4Z1MH 1AQTA 1LGHB 5B66V 2WTYA 1UIIA 4PD4E 2JEEA 4XFJA 1EZVE 1IO3A 1RE3C 3BASA 1GTWA 3CCQP 2OYHC 1CC5A 1RQVA 3CXHE 2OGUA 1AVYA 1CRYA 2H89C 2FFDA 2M8RA 1M8OB 1FE6A 2N1TD 1CHJA 1NTZD 2I1KA 2HFED 1CW5A 1GD2E 3CX5H 4AANA 3JSVC 1M1JA 1ZMEC 2AEMA 1DW3A 1NJIQ 1CSBA 1NGMB 1K04A 1LMSA 3AECC 1CTZA 1FCDC 1E5WA 1HJ0A 3P7KA 3GLMA 1L0ND 4U3FE 4AAOA 2YK3A 1LTJC 1MG2D 1FZAA 2RH0A 4N78E 3Q3DA 1FDIA 2QJYC 4K3IA 2G8YA 4RJTA 2W83C 2C1DA 3L37A 4IL6X 2IYPA 1NTME 3EFFK 1QN2A 3T97A 3CC4P 1U74B 1NIRA 4LJIA 3AEGC 1QVFO 1R8EA 5B6QA 1JY3N 4U3FJ 1SFCB 3GHGB 2QG4A 5KKZB 2IDBA 4L74A 2Q1KA 2H88C 1ZOYC 4YXWH 351CA 1H88A 5AVZB 1QKSA 5APQA 2HG5D 1H31A 3L72G 2SPZA 2UWJE 1DH3A 5AVVB 3L71G 1J3SA 4PJ0E 3VN0A 2JP3A 1NTMJ 1H0TA 2YXRB 1CO6A 1NU1K 2N1TB 2KLUA 3ABVC 4BWNA 1DIPA 2CA4B 3GG2A 1C6SA 2OTKE 4R4LA 3D70A 4FA9A 3BCCG 1CRIA 1OW7A 1KQGB 2IFNA 4I7ZC 3TGUG 1W2LA 2QVAA 3Q2YA 3PH2B 1CSUA 1QLED 2POHA 3HQ9A 4EICA 2PACA 2FYZA 2JR8A 3O20A 5KLIC 2WITA 2NPSC 3TYYA 1W2BO 1EXIA 1U75B 1I6EA 1PGQA 1EQ7A 5DF5A 2R32A 2ZYGA 1VQMP 4PD4H 3A0HE 1KILE 1SQBK 5AURA 2ZJSE 1A56A 2AXCA 3VMYA 3S4RA 1PL5A 1AJYA 1YEAA 3HUSC 3MD0A 3IN6A 3CCMP 1A02J 3WFCC 4OVNF 3CXHH 1FS0E 1DEBA 3I5CA 1ZZHA 1H32B 2N18C 1N86A 1FC2C 4L76A 3OJAB 3R2PA 1SQPG 2QJKB 4ZMDA 1LTAC 3D6ZA 2OQQA 1MG3D 1IFPA 2EXVA 1X0TA 1YITP 2FBWC 1GU4A 4PV1D 1A8CA 2BGVX 5GTHV 3L72D 1FDOA 4RESB 2ZFCA 3HD7C 5KAIV 3PXSA 3HTKB 2E5TA 3NBTA 2GA1A 4XA4A 3Q1MA 2N1TA 3BCCD 2FYUD 1KYOI 1U57A 4HJGH 1WT6A 4Y28J 2MKVA 2W8ZA 3A5TA 3TGUD 1BGYE 3G71P 2NPSA 2IZ0A 1FDMA 1CXAA 2AXTE 4GKGA 4RO0A 155CA 1VQOP 5DJUB 2WPVB 2WSSH 2JWDA 4IFDK 2FRCA 1RZ5A 3V5BA 3H1IG 2QE7H 2B4ZA 4PJ0H 5AW1B 3HUSA 1X22A 4JPZB 2OYIB 1PPJE 2JJLA 2WPSA 3BATA 3CMEP 1W2EA 1S4XA 3HQ8A 1Q82Q 4RKUJ 1BGYJ 1IRWA 1NYHA 1QL2A 1S5LE 1LC2A 4WWIA 4YXDC 3EQ2A 1DX7A 5CIFB 2P67A 4ZNCA 4WQ7A 4L75A 1MV8A 2B87B 3M06A 1YBKA 1EDKA 1GKSA 4PV1B 1USEA 2XNXA 4JQ0D 5CJ4A 1CIHA 5M1BA 1VQ9P 3MK7C 3ORVA 2GUVA 1L0LK 1S9KD 1FOCA 2MTAC 1FOSF 2A06G 3HD7A 4WY4D 5CIHB 3A0HH 1Y9BA 3HRNA 3M0DC 1NMLA 3WU2H 2IFMA 2KIKA 3M9QA 2Y0CA 4DCKA 3V6IA 3N7NA 3OW2O 4Y99B 2XTSB 1RQUA 1GJQA 4I6MC 1IFDA 4IL6H 5DJQC 2WSFJ 3L70G 1MUUA 5APUA 4KJMA 2R3CA 1CORA 4H0KA 4ZKPA 4H44C 1GDVA 4V2KA 1LTBC 5H2FV 2M5AB 1KV9A 2WVRA 1OVUA 3CYTI 2ZZS1 2QRXA 3MUDC 5CCHC 1N73C 2K9JB 1AOQA 2N3BA 1NHLA 5APWA 4YPCA 1IK9A 2YKPA 3H1ID 1LNQA 2WSEH 1SQXK 3H1JG 4Q5PA 1NKZB 4GODA 1FZFA 1SQQE 1H9YA 1PV3A 2AEJA 2KUBA 1CSVA 4WQAA 1FBMA 5B5EH 1DIIC 4GEDB 2V07A 2GUSA 2QIWA 1K05A 2YKOA 3KPEA 2K37A 1X9VA 3SSUA 3H25A 2C9LY 3O1YA 1GW4A 1NH4A 3ZOXA 1FJ0A 3L73E 5KLVE 3MTUE 1ZR2A 4WY4B 5AVRB 2AXTH 2BLFB 2E42A 1KX2A 3UIAA 1NU1G 2B87A 2RMZA 1JTHA 1OVVA 3MGNA 2FYUK 1SQQJ 3M9HA 1KYOD 1YIQA 4IFFA 2A06D 3M0DA 2L4DA 2YMKA 3MIWA 1URQC 3AEFC 2YO3A 1FI7A 2ZONG 1EB7A 1GZLA 1K3HA 5AVYB 2B9BA 3A2AA 3A0HV 3L73J 5KLVJ 2LKMA 2C1UA 4OGQD 4OH8B 2HODA 2BEQD 3CI9A 2Y0DA 1PFIA 1CRCA 5C39A 1H33B 3OA8B 1LTSC 3L70D 1CYCA 2FYNC 1SQBG 3MUDA 2OARA 5CCHA 4QAOA 1T3JA 2YMYA 1CRJA 2WSFH 3CMAP 1ZW0A 2GIWA 1BDCA 4TLFA 4H13C 1HJ4A 1B7VA 3EWKA 1P84D 1H89A 3H1JD 2D0SA 4D6TE 1CI6A 1FZCC 5K5GB 3AE4C 1HJ5A 1VQ8P 2WQYC 1CXCA 1YQ4C 4WVZA 1CIEA
chains in the Genus database with same CATH topology
1H9XA 1A2SA 3WFDC 1N15A 1N9CA 1AYGA 4K3IA 1NTMD 2C8SA 2PCBB 4H0JA 3ZIYA 4RJTA 2C1DA 2YQBA 2KS1A 1DW2A 3L74D 1IRVA 5CIEB 3A9FA 1QN2A 3H1HD 3CX5W 1U74B 3L71D 1NU1D 1C6OA 4WQCA 2Q3EA 1NIRA 4LJIA 1YNRA 1RAQA 4PJ0V 2AXTV 5B6QA 2PCCB 3PHLA 1DW1A 2GC4D 3TF5A 1YCCA 1NNOA 2QG4A 5KKZB 1ZRTD 4L1QA 1C6RA 3PXWA 2CE0A 2C9XB 3C2CA 3VYMA 1CYIA 351CA 3FWLA 1YTCA 1I54A 1QKSA 2GC7D 1H31A 4O1QA 3VRDA 1HROA 2QJPB 1J3SA 1DT1A 1NMIA 1CO6A 2CE1A 1S5LV 2CA4B 3GG2A 1C6SA 4FA9A 1SQBD 1H33A 1H1OA 1CRIA 3OA8A 1L9BC 1LFMA 4N0KA 5TISV 1YEBA 2FYNB 1W2LA 2BCCD 3CWBD 3PH2B 1CSUA 1YFCA 3RN1A 1E8EA 3HQ9A 3KZIV 2KNCB 1IQCA 4EICA 1ETPA 2PACA 1COTA 3WU2V 4DY9A 4WQ9A 3O20A 4Y5RA 2VHDA 3ZOOA 4FA4A 5CIBB 1DW0A 1U75B 1I6EA 1SQPD 3CP5A 5DF5A 1GQ1A 3VMAA 1H32A 4FB1A 2AIUA 3RLMA 4IL6V 5AURA 1RAPA 1A56A 2DVHA 5EXQA 1CRHA 451CA 1RZ6A 1YEAA 3WC8A 3WFCC 1CEDA 3ZCFA 1ZZHA 1H32B 2N18C 1KYOW 1PP9D 5IY51 2QJYB 1FI3A 2QJKB 1HJ3A 1QL3A 3TDKA 1GU2A 3TYIA 2BCNB 1GIWA 1C75A 1MG3D 3H1KD 3SLEA 1K3GA 1N50A 2CA3B 2EXVA 4RSZA 5TJHA 5B5EV 4AAMA 3SXTA 1LS9A 2YCCA 1A8CA 3ZBMA 2BGVX 1CIFA 3X39A 5GTHV 3L72D 2N9JA 2GB8B 3DP5A 1QYZA 4FAVA 5KAIV 3CXHW 2LITA 3PXSA 1E2RA 1I6DA 2N9YB 2I8FA 3NBTA 1F1FA 3ITKA 4KMGA 5E79V 5CICB 2B0ZB 3BCCD 2L91A 3PTZA 1AKKA 1BGYD 1C2RA 2FYUD 1KX7A 2ZBOA 3TGUD 1QL4A 3SJLA 4WQEA 2BPBB 5CIGB 3DMIA 4PWAA 3PRJA 4FANA 1HZUA 4L3GA 1KB9D 3NWVA 1CXAA 155CA 3ZOWA 5DFSA 5CYTR 2B11B 3L4MA 4JCGA 2FRCA 1RZ5A 4EIFA 1CHIA 1N90A 2B4ZA 1CNOA 1PPJD 5KLIB 4AX3A 4NFGB 1L0LD 4O1WA 4UB8V 1C7MA 4MU8A 3HQ8A 2D0WA 2ZOOA 2JTIB 1CIGA 1IRWA 5C9MA 2B10B 1LC2A 1CTYA 3WFEC 1W5CT 4P4QB 3PLNA 1F1CA 2HV4A 2N9IA 5CIFB 1WVEC 3H1LD 4WQ7A 3RMZA 1CSXA 4AALA 1GKSA 2RN0A 5GTIV 2N18B 1CIHA 3O0RC 1BE3D 1FI9A 3L75D 3MK7C 3ORVA 3PXTA 1CCRA 1VYDA 3L4OA 4FA1A 3CX5D 2AI5A 1FOCA 2MTAC 4J20A 3HQ6A 5CIHB 1L9JC 1BCCD 1I8PA 3WFBC 1HZVA 3VNWA 1OCDA 1M70A 1DIQC 1I8OA 1CTJA 1DVHA 1NMLA 3GW6A 2Y0CA 1SQXD 1SQVD 5CIDB 1YICA 4GYDA 4YE1A 2XTSB 1GJQA 1WEJF 3OCDB 3JBTB 1KIBA 5DJQC 4XXLA 2CXBA 3NBSA 1CORA 4H0KA 4WQ8A 2ZXYA 1GDVA 1R0QA 4V2KA 5H2FV 1KV9A 3CYTI 2IBZD 2ZZS1 3ZOYA 2Y0EA 3SVWA 2K9JB 1AOQA 2OZ1B 2N3BA 3DR0A 1JDLA 2YIUB 1SQQD 3H1ID 1CRGA 3O5CA 4Q5PA 5C0ZA 1H9YA 1FHBA 1KB0A 2BH4X 1CSVA 1C2NA 4WQAA 1I5TA 1DIIC 4GEDB 4PW9B 2V07A 2C1VA 1MZ4A 3WUIA 1HH7A 1NTKD 1OAEA 2C1DB 3L73D 1AOFA 5KLVD 3O1YA 4WQDA 3ZOXA 1FJ0A 2B12B 4FA5A 4EIEA 1C52A 2BLFB 1HCMA 1KX2A 1LC1A 2RMZA 2JQRA 1KYOD 1DVVA 1S6VB 1YIQA 1CYJA 2A06D 2L4DA 3MK7B 2ORLA 2FWLA 1BL9A 1FI7A 2ZONG 1H31B 1CHHA 1EB7A 1M60A 1K3HA 3M97X 2N3YA 3A0HV 4PD4D 5KAFV 1I55A 1M6ZA 1EZVD 2C1UA 2V08A 1E29A 2Y0DA 5B66V 1CRCA 1CCHA 3KHUA 1IO3A 3A0BV 1H33B 3OA8B 3CXHD 3L70D 1CYCA 4EIDA 3OCDA 4XYDB 1CC5A 4QAOA 1CRYA 1CRJA 2DGEA 5DJQB 3SWSA 1IZL0 1CHJA 2GIWA 1NTZD 4EDFA 4WQBA 1HRCA 4AANA 1HJ4A 1B7VA 3CU4A 1DW3A 4UB6V 1P84D 4D6TD 1LMSA 3H1JD 2OZ1A 4U3FD 1CTZA 1FCDC 2D0SA 3HQ7A 1CSWA 1L0ND 2JWAA 2BH5X 1HJ5A 4AAOA 2LIRA 4A7PA 2C2CA 2MHMA 2YK3A 1CXCA 1MG2D 1CIEA 2O3JA 3RN0A 4L3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9X A;  1A2S A;  3WFD C;  1N15 A;  1N9C A;  1AYG A;  4K3I A;  1NTM D;  2C8S A;  2PCB B;  4H0J A;  3ZIY A;  4RJT A;  2C1D A;  2YQB A;  2KS1 A;  1DW2 A;  3L74 D;  1IRV A;  5CIE B;  3A9F A;  1QN2 A;  3H1H D;  3CX5 W;  1U74 B;  3L71 D;  1NU1 D;  1C6O A;  4WQC A;  2Q3E A;  1NIR A;  4LJI A;  1YNR A;  1RAQ A;  4PJ0 V;  2AXT V;  5B6Q A;  2PCC B;  3PHL A;  1DW1 A;  2GC4 D;  3TF5 A;  1YCC A;  1NNO A;  2QG4 A;  5KKZ B;  1ZRT D;  4L1Q A;  1C6R A;  3PXW A;  2CE0 A;  2C9X B;  3C2C A;  3VYM A;  1CYI A;  351C A;  3FWL A;  1YTC A;  1I54 A;  1QKS A;  2GC7 D;  1H31 A;  4O1Q A;  3VRD A;  1HRO A;  2QJP B;  1J3S A;  1DT1 A;  1NMI A;  1CO6 A;  2CE1 A;  1S5L V;  2CA4 B;  3GG2 A;  1C6S A;  4FA9 A;  1SQB D;  1H33 A;  1H1O A;  1CRI A;  3OA8 A;  1L9B C;  1LFM A;  4N0K A;  5TIS V;  1YEB A;  2FYN B;  1W2L A;  2BCC D;  3CWB D;  3PH2 B;  1CSU A;  1YFC A;  3RN1 A;  1E8E A;  3HQ9 A;  3KZI V;  2KNC B;  1IQC A;  4EIC A;  1ETP A;  2PAC A;  1COT A;  3WU2 V;  4DY9 A;  4WQ9 A;  3O20 A;  4Y5R A;  2VHD A;  3ZOO A;  4FA4 A;  5CIB B;  1DW0 A;  1U75 B;  1I6E A;  1SQP D;  3CP5 A;  5DF5 A;  1GQ1 A;  3VMA A;  1H32 A;  4FB1 A;  2AIU A;  3RLM A;  4IL6 V;  5AUR A;  1RAP A;  1A56 A;  2DVH A;  5EXQ A;  1CRH A;  451C A;  1RZ6 A;  1YEA A;  3WC8 A;  3WFC C;  1CED A;  3ZCF A;  1ZZH A;  1H32 B;  2N18 C;  1KYO W;  1PP9 D;  5IY5 1;  2QJY B;  1FI3 A;  2QJK B;  1HJ3 A;  1QL3 A;  3TDK A;  1GU2 A;  3TYI A;  2BCN B;  1GIW A;  1C75 A;  1MG3 D;  3H1K D;  3SLE A;  1K3G A;  1N50 A;  2CA3 B;  2EXV A;  4RSZ A;  5TJH A;  5B5E V;  4AAM A;  3SXT A;  1LS9 A;  2YCC A;  1A8C A;  3ZBM A;  2BGV X;  1CIF A;  3X39 A;  5GTH V;  3L72 D;  2N9J A;  2GB8 B;  3DP5 A;  1QYZ A;  4FAV A;  5KAI V;  3CXH W;  2LIT A;  3PXS A;  1E2R A;  1I6D A;  2N9Y B;  2I8F A;  3NBT A;  1F1F A;  3ITK A;  4KMG A;  5E79 V;  5CIC B;  2B0Z B;  3BCC D;  2L91 A;  3PTZ A;  1AKK A;  1BGY D;  1C2R A;  2FYU D;  1KX7 A;  2ZBO A;  3TGU D;  1QL4 A;  3SJL A;  4WQE A;  2BPB B;  5CIG B;  3DMI A;  4PWA A;  3PRJ A;  4FAN A;  1HZU A;  4L3G A;  1KB9 D;  3NWV A;  1CXA A;  155C A;  3ZOW A;  5DFS A;  5CYT R;  2B11 B;  3L4M A;  4JCG A;  2FRC A;  1RZ5 A;  4EIF A;  1CHI A;  1N90 A;  2B4Z A;  1CNO A;  1PPJ D;  5KLI B;  4AX3 A;  4NFG B;  1L0L D;  4O1W A;  4UB8 V;  1C7M A;  4MU8 A;  3HQ8 A;  2D0W A;  2ZOO A;  2JTI B;  1CIG A;  1IRW A;  5C9M A;  2B10 B;  1LC2 A;  1CTY A;  3WFE C;  1W5C T;  4P4Q B;  3PLN A;  1F1C A;  2HV4 A;  2N9I A;  5CIF B;  1WVE C;  3H1L D;  4WQ7 A;  3RMZ A;  1CSX A;  4AAL A;  1GKS A;  2RN0 A;  5GTI V;  2N18 B;  1CIH A;  3O0R C;  1BE3 D;  1FI9 A;  3L75 D;  3MK7 C;  3ORV A;  3PXT A;  1CCR A;  1VYD A;  3L4O A;  4FA1 A;  3CX5 D;  2AI5 A;  1FOC A;  2MTA C;  4J20 A;  3HQ6 A;  5CIH B;  1L9J C;  1BCC D;  1I8P A;  3WFB C;  1HZV A;  3VNW A;  1OCD A;  1M70 A;  1DIQ C;  1I8O A;  1CTJ A;  1DVH A;  1NML A;  3GW6 A;  2Y0C A;  1SQX D;  1SQV D;  5CID B;  1YIC A;  4GYD A;  4YE1 A;  2XTS B;  1GJQ A;  1WEJ F;  3OCD B;  3JBT B;  1KIB A;  5DJQ C;  4XXL A;  2CXB A;  3NBS A;  1COR A;  4H0K A;  4WQ8 A;  2ZXY A;  1GDV A;  1R0Q A;  4V2K A;  5H2F V;  1KV9 A;  3CYT I;  2IBZ D;  2ZZS 1;  3ZOY A;  2Y0E A;  3SVW A;  2K9J B;  1AOQ A;  2OZ1 B;  2N3B A;  3DR0 A;  1JDL A;  2YIU B;  1SQQ D;  3H1I D;  1CRG A;  3O5C A;  4Q5P A;  5C0Z A;  1H9Y A;  1FHB A;  1KB0 A;  2BH4 X;  1CSV A;  1C2N A;  4WQA A;  1I5T A;  1DII C;  4GED B;  4PW9 B;  2V07 A;  2C1V A;  1MZ4 A;  3WUI A;  1HH7 A;  1NTK D;  1OAE A;  2C1D B;  3L73 D;  1AOF A;  5KLV D;  3O1Y A;  4WQD A;  3ZOX A;  1FJ0 A;  2B12 B;  4FA5 A;  4EIE A;  1C52 A;  2BLF B;  1HCM A;  1KX2 A;  1LC1 A;  2RMZ A;  2JQR A;  1KYO D;  1DVV A;  1S6V B;  1YIQ A;  1CYJ A;  2A06 D;  2L4D A;  3MK7 B;  2ORL A;  2FWL A;  1BL9 A;  1FI7 A;  2ZON G;  1H31 B;  1CHH A;  1EB7 A;  1M60 A;  1K3H A;  3M97 X;  2N3Y A;  3A0H V;  4PD4 D;  5KAF V;  1I55 A;  1M6Z A;  1EZV D;  2C1U A;  2V08 A;  1E29 A;  2Y0D A;  5B66 V;  1CRC A;  1CCH A;  3KHU A;  1IO3 A;  3A0B V;  1H33 B;  3OA8 B;  3CXH D;  3L70 D;  1CYC A;  4EID A;  3OCD A;  4XYD B;  1CC5 A;  4QAO A;  1CRY A;  1CRJ A;  2DGE A;  5DJQ B;  3SWS A;  1IZL 0;  1CHJ A;  2GIW A;  1NTZ D;  4EDF A;  4WQB A;  1HRC A;  4AAN A;  1HJ4 A;  1B7V A;  3CU4 A;  1DW3 A;  4UB6 V;  1P84 D;  4D6T D;  1LMS A;  3H1J D;  2OZ1 A;  4U3F D;  1CTZ A;  1FCD C;  2D0S A;  3HQ7 A;  1CSW A;  1L0N D;  2JWA A;  2BH5 X;  1HJ5 A;  4AAO A;  2LIR A;  4A7P A;  2C2C A;  2MHM A;  2YK3 A;  1CXC A;  1MG2 D;  1CIE A;  2O3J A;  3RN0 A;  4L3H A; 
#chains in the Genus database with same CATH topology
 1H9X A;  4UB6 E;  3G9R A;  2IBZ E;  4WBA A;  3B8E B;  3WFD C;  1PIX A;  3C9I A;  2KS1 A;  1OZH A;  1IO4 A;  1NU1 D;  4ASV A;  1C6O A;  4WQC A;  3L74 E;  2Q3E A;  4WY4 A;  1URQ A;  3O6Q A;  3H1H E;  4D6T J;  3RL0 C;  2AXT V;  1LTT C;  4K35 A;  3PHL A;  2GC4 D;  1Q81 Q;  4OGQ B;  2VRS A;  5EFW B;  1J1D C;  3T97 B;  3C2C A;  3FWL A;  1YTC A;  2K1A A;  1I54 A;  2AEF A;  5APV A;  4O1Q A;  1NTM K;  2YNY A;  2H7H A;  1K9M Q;  1JY2 N;  3SWY A;  1TU3 F;  1DT1 A;  3AE2 C;  3VYI A;  1GK6 A;  2CE1 A;  3L74 J;  4NPD A;  1S5L V;  3H1H J;  2KNC A;  3L71 J;  2Z4E A;  1SQB D;  1H33 A;  3HE5 A;  2A45 H;  3OA8 A;  1KIL C;  3SWF A;  4N0K A;  2WZ7 A;  5TIS V;  2LXC B;  1YEB A;  3CX5 I;  2OYH B;  1H0T B;  2D2C C;  1YJW P;  3NFQ A;  1GL2 C;  1L4A C;  2BCC E;  3CWB E;  1VQ6 P;  3JC2 2;  1COT A;  4Y5R A;  1R5L A;  3ZOO A;  4FA4 A;  1DW0 A;  4OWF A;  3CP5 A;  2LXB A;  4C7N A;  3VMA A;  5AW0 B;  1L0L G;  2DVH A;  5EXQ A;  3S9O A;  1LTJ B;  2NPS D;  2BCC J;  3CWB J;  1KV4 A;  3B5N C;  1W5C E;  2QJY B;  1FI3 A;  3A0B H;  2ZVO B;  2C0W A;  4ZKU A;  3JCU H;  3MP7 B;  1GU2 A;  1BE3 G;  2W90 A;  2XZR A;  2FXM A;  3KXD A;  4EOT A;  3SLE A;  1N50 A;  1SQP J;  1AV1 A;  1M7L A;  3H1K E;  1IC2 A;  4WB4 A;  1LS9 A;  3MZW B;  1BCC G;  3X39 A;  2N9J A;  3A3Y B;  1IJD B;  2B88 A;  2O01 J;  2Q9I A;  4UB6 H;  1I6D A;  3CCL P;  1KIL A;  4NPE A;  1SQX G;  2NRG A;  4KMG A;  2CPS A;  2B0Z B;  1RY3 A;  1L4A A;  1U7J A;  1C2R A;  1ZRT E;  2I8D A;  5APS A;  3H1K J;  1JY3 P;  2QA4 P;  1QL4 A;  3SJL A;  2E75 C;  2BPB B;  5AVT B;  4PWA A;  1QL1 A;  1RE3 A;  1HZU A;  3HD7 D;  1OIP A;  2OYH A;  3ZOW A;  4I7Z B;  5CYT R;  2G3A A;  2QM7 A;  2B11 B;  2YIU C;  3N4X A;  1KB9 E;  2QM8 A;  5CHX A;  1ZN5 A;  1EZV I;  3KQG A;  3AEE C;  5KLI B;  2Y9Y A;  2NPS B;  1RHZ B;  2FYU G;  1QVG O;  4NFG B;  2Z5H A;  1L0L D;  4O1W A;  3RL0 g;  1YI2 P;  3RK3 E;  1C7M A;  2E76 C;  3B5N A;  2JTI B;  3CC7 P;  1FOS E;  1G2C B;  2ZAE B;  1VQ4 P;  1JMM A;  3PLN A;  2P10 A;  1F1C A;  2KB7 P;  1NOH A;  3HUS B;  1LTJ A;  3RMZ A;  2JKV A;  4K3A A;  3H1L E;  1HH0 A;  3G4S P;  2WPQ A;  3F89 A;  2N18 B;  2E43 A;  2K88 A;  1BE3 D;  1XTG B;  1EDI A;  1FI9 A;  2PGD A;  5APX A;  5AW9 B;  3PXT A;  3CX5 D;  3L75 E;  2AI5 A;  3WU2 E;  2WWW A;  4ASW A;  1OW8 A;  2Z5I A;  1BCC D;  3WFB C;  1LT9 C;  1AFO A;  1G1J A;  1S5L X;  2R3S A;  1PP9 E;  4IL6 E;  3NMD A;  3USS A;  1EZV G;  2KK7 A;  3H1L J;  5CBN A;  1SQX D;  1SS1 A;  5CID B;  3HD7 B;  4GYD A;  2O01 H;  1VDF A;  3K5B A;  1ZXG A;  3P8C E;  2V7Q J;  1WEJ F;  3AE8 C;  3JBT B;  1SQV E;  4GDO A;  1FZG A;  2HPC A;  3L75 J;  4R4M A;  4QMA A;  3CPW O;  3OAK A;  2R5B A;  2IBZ D;  2W6J H;  3SVW A;  1OXZ A;  1PP9 J;  5B5E E;  2OZ1 B;  1BSN A;  1K73 Q;  1NO4 A;  1SVF A;  4YTP C;  1RF1 C;  1CRG A;  3SWK A;  3O5C A;  1RE4 C;  4U3F G;  1M56 D;  3V2R A;  1KB0 A;  1SQV J;  3P32 A;  1ZLL A;  3Q5S A;  2Q5U A;  4H44 D;  1RF0 C;  4PW9 B;  1N7S C;  2PAJ A;  1KOR A;  3FGA D;  5CCH D;  2WSE J;  1KN7 A;  3C1L A;  3U1A A;  1OFC X;  1G2C A;  1AOF A;  3CCS P;  1NTM G;  2HYN A;  4FA5 A;  3CCR P;  3AEA C;  1HCM A;  1Q90 D;  1LC1 A;  1SQQ K;  2P58 A;  1KB9 H;  2LR2 A;  3AE1 C;  5E79 H;  2PP6 A;  1LT9 A;  2XND H;  3ZDM A;  2RKL A;  2WT7 B;  1CYJ A;  4HKZ H;  1KC8 Q;  2IYO A;  3MK7 B;  1RH5 B;  2MJZ A;  2FWL A;  1BL9 A;  2ZVN B;  1S3J A;  2QJP C;  4N6J A;  1CHH A;  3AEB C;  5KLV K;  1JTH B;  1K8A Q;  3VOP A;  3F5H A;  3M97 X;  4PD4 D;  1KYO H;  1M6Z A;  1EZV D;  3PH0 A;  3B4S A;  1P84 I;  3S1K A;  3CCJ P;  5KJ7 C;  1FJK A;  3O8Z A;  1CZQ A;  3AE5 C;  5AW5 B;  1URQ D;  3CXH D;  4B86 A;  4UB8 H;  4EID A;  1EC5 A;  4XYD B;  3TSI A;  2V7Q H;  3V2P A;  5GTI E;  2DGE A;  5DJQ B;  2HOD B;  3M91 A;  3SWS A;  1RF1 A;  1JCC A;  1RE4 A;  4H44 B;  1HRC A;  4EI2 A;  3U1C A;  1NTZ E;  4XE5 B;  4DJG A;  1D7M A;  1IZN B;  2FKW B;  3Q5P A;  2OZ1 A;  1N73 B;  1N7S A;  4U3F D;  3HQ7 A;  4H0L C;  2XDJ A;  2JWA A;  2BH5 X;  1L0N E;  2LIR A;  4A7P A;  2MHM A;  4N78 D;  1S2E A;  1KQS O;  2O3J A;  1VF5 C;  4H13 D;  3RN0 A;  4L3H A;  4BRY A;  4W80 A;  5CCG C;  2Q3I A;  5AW6 B;  1AYG A;  1N15 A;  1N9C A;  3WUV A;  1NTM D;  1UIX A;  4H0J A;  3ZIY A;  1CI6 B;  2YQB A;  1NTZ J;  1IRV A;  2ITA A;  1JY3 O;  3A9F A;  3WUU A;  3CCE P;  1VQ7 P;  4PJ0 V;  3EFG A;  2E74 C;  3TF5 A;  1YCC A;  1L0N J;  1ZRT D;  2WT7 A;  2KS1 B;  2KI7 B;  3PXW A;  2CE0 A;  5AW3 B;  1NTK E;  3KYQ A;  1VQL P;  5KJ7 A;  3VP8 A;  1URQ B;  2GC7 D;  3O6Q B;  1YHQ P;  4L73 A;  3SFE C;  2ZYA A;  3M9B A;  4LGD E;  2ZYD A;  3RL0 D;  1H8A A;  1NMI A;  1MFT A;  2KOG A;  2M3E A;  4O9B A;  1DD4 A;  2H43 A;  3VMX A;  1H1O A;  1T6A A;  3TNU A;  3RK2 C;  1BGY G;  4EYY Q;  1GW3 A;  1SLQ A;  2FYN B;  1E8E A;  1YFC A;  3RN1 A;  1NTK J;  4DOJ A;  1FU1 A;  4CPG A;  2W6A A;  2KNC B;  1IQC A;  1ETP A;  1IFJ A;  4DY9 A;  3WU2 V;  2VHD A;  3HE5 B;  1M57 D;  4H13 B;  4HB1 A;  1Q86 Q;  1KIL D;  1GQ1 A;  1PPJ G;  3IF4 A;  1N73 A;  5CCG A;  5KAF E;  2D2C D;  4IL6 V;  1FZC B;  1GL2 D;  1M90 Q;  2B89 A;  1CRH A;  3WMM 0;  1L4A D;  1YJN P;  3QWO C;  451C A;  3A0B E;  3WC8 A;  1PGJ A;  3JCU E;  1T3U A;  5GTI H;  1FJP A;  4AQR D;  3ZCF A;  4C7N B;  3L4F A;  1KYO W;  1PP9 D;  2R5D A;  4MN4 C;  3I56 P;  1QL3 A;  1SQP K;  3TYI A;  2BCN B;  1FZE A;  1GIW A;  1IFM A;  2P1J A;  5BU5 A;  2CA3 B;  4RSZ A;  5B5E V;  1KMI Z;  4AAM A;  3RL0 B;  2GM4 A;  2P7J A;  3ZBM A;  1U7M A;  1JB0 J;  1CIF A;  3B5N D;  3RBZ A;  1J1D B;  2GB8 B;  1NWQ A;  1QYZ A;  1T8Z A;  3L72 E;  2KSE A;  3LIE A;  2LIT A;  1MFZ A;  3L71 E;  3TK1 A;  1J1E C;  2FFD C;  5CIC B;  1KZU B;  2L91 A;  3PTZ A;  1AKK A;  1BGY D;  3RK3 C;  1M1J C;  3BCC E;  4WQE A;  5KAI E;  3DMI A;  1OMI A;  1KIL B;  3NWV A;  3TGU E;  3P8M C;  5DFS A;  1ZR4 A;  3H32 A;  2O01 N;  4LLH A;  2D2C B;  3L4M A;  3L72 J;  1GL2 B;  3LW5 J;  1L4A B;  4JCG A;  2FXO A;  1PPJ D;  1JY2 P;  2E75 D;  2XV5 A;  2XU6 A;  4MU8 A;  5AVQ B;  2D0W A;  2ZOO A;  1LWU C;  3BCC J;  2KZI A;  2ZT9 C;  1CIG A;  1FZC A;  1IFN A;  2FYU J;  1CTY A;  1NKN A;  1LJ2 A;  4P4Q B;  1FAV A;  2HV4 A;  3HE4 B;  3TGU J;  2N9I A;  3L73 G;  1WVE C;  5KLV G;  3H6P A;  2FY8 A;  1CSX A;  2RN0 A;  5GTI V;  3RBX A;  2WMM A;  1SQP E;  3B5N B;  3O0R C;  1QGK B;  5DJT B;  3BRT B;  2E76 D;  1VQN P;  3KZI E;  2W27 A;  1CCR A;  1VYD A;  4IOI H;  3L4O A;  4J20 A;  3HQ6 A;  4JYB A;  1DEE G;  1L9J C;  1I8P A;  1S9K E;  3D6Y A;  1R5S A;  3CCV P;  5KAF H;  1EXJ A;  2IBZ I;  1I8O A;  1CTJ A;  5AVW B;  1KQL A;  1Q7Y Q;  1E79 H;  2WPR A;  3GW6 A;  3OA7 A;  1T2K C;  2KP8 A;  4JYC A;  1YIC A;  4YE1 A;  3OCD B;  4I1L A;  4AUW A;  2Q6Q A;  2NZ2 A;  4M3L A;  2J59 M;  1M1K Q;  5CMZ A;  1YTZ T;  4XXL A;  2CXB A;  1NAY A;  3NBS A;  4WQ8 A;  4HYT B;  1R0Q A;  1VPC A;  1GDT A;  1VQP P;  2E75 B;  1PGO A;  3SFD C;  1HF9 A;  1G1I A;  3E7K A;  2HPC B;  3II6 A;  1JDL A;  2YIU B;  1SQQ D;  3I55 P;  4D6T G;  1GL2 A;  1SQV K;  1JUN A;  1LWU A;  3LW5 H;  5C0Z A;  3H1I E;  1FHB A;  5H2F E;  3CCU P;  1C2N A;  5AVX B;  2C1V A;  1MZ4 A;  2YXQ B;  2IBZ G;  3WUI A;  5GTH H;  4KT0 J;  5E79 E;  1NTK D;  3L73 D;  2E76 B;  3C8V A;  5KLV D;  4PD4 I;  5KAI H;  3HE4 A;  2B12 B;  4EIE A;  3L74 G;  1AVO A;  2J58 A;  1JO5 A;  3H1H G;  3A7O A;  1SFC C;  2JQR A;  3GHG C;  2KLV A;  5KKZ C;  2K3R A;  3H1I J;  3CXH I;  5CBO A;  1N7S D;  1DVV A;  1HJB A;  1S6V B;  1S1C X;  1KYO E;  1GMJ A;  1Y8A A;  3RGU A;  1NVO A;  5AW8 B;  2A06 E;  1NAF A;  2KSJ A;  3V4W A;  1M60 A;  1LT9 B;  2M0B A;  2N1T C;  4UB8 E;  5KAF V;  3AE6 C;  2V08 A;  1YQ3 C;  2I1J A;  1E29 A;  3G6E P;  3V2Q A;  2BAS A;  2FXP A;  1CCH A;  3KHU A;  3A0B V;  2KYV A;  1BSH A;  2N9B A;  3FWN A;  3OCD A;  2BEZ F;  3L70 E;  3L35 A;  4JF7 A;  1J2J B;  3KZI H;  3VTP C;  1IZL 0;  2BCC G;  3CWB G;  4EDF A;  1OWA A;  4WQB A;  1KQF B;  1PZQ A;  3CU4 A;  5KJ7 D;  4UB6 V;  4D6T D;  2YO2 A;  1P84 E;  1CSW A;  3H1J E;  2HR3 A;  4BXL A;  1RF1 B;  1BDD A;  1LTI C;  3AE9 C;  1AA0 A;  1L2P A;  2J5U A;  2Y9Z A;  2C2C A;  2Q7C A;  1IFI A;  2O1J A;  3L70 J;  3MHV A;  1JOC A;  1A2S A;  1NTZ K;  3GF3 A;  1SFC A;  1N7S B;  3GHG A;  2C8S A;  2PCB B;  2QJK C;  1KB9 I;  2V4H A;  1DW2 A;  3L74 D;  5CIE B;  4H0L D;  3H1H D;  3CX5 W;  3L71 D;  1YYC A;  1YNR A;  3D0W A;  1NU1 E;  1RAQ A;  1IK7 A;  1KD1 Q;  1LP1 B;  1L0N K;  4BRY B;  3H1J J;  2PCC B;  1VF5 D;  1DW1 A;  5APY A;  3H1K G;  1NNO A;  1HBW A;  5CCG D;  4L1Q A;  5BVZ A;  1C6R A;  2WSC J;  5H2F H;  2C9X B;  1JY2 O;  1HWT C;  3VYM A;  1CYI A;  2P2U A;  3VRD A;  1HRO A;  3M0A A;  2QJP B;  1EDL A;  2ZXE B;  4HH2 A;  3GMA A;  2L5G B;  1JM0 A;  2E74 D;  1Y47 A;  1OVR A;  1NU1 J;  3CD6 P;  1JNM A;  3CL3 D;  1L9B C;  1LFM A;  4GT1 A;  1NTK K;  1SQB E;  2H8P D;  2BCC D;  3CWB D;  3VMZ A;  4EIJ A;  3BVH A;  3KZI V;  1HGV A;  1Z56 A;  1VQ5 P;  4WQ9 A;  3D71 A;  3TNU B;  2OYI C;  5CIB B;  2K9Y A;  5APT A;  1ZP0 C;  3Q5R A;  2KXP B;  1SQP D;  5TIS E;  3RK2 D;  1H32 A;  4I2L C;  4FB1 A;  2AIU A;  4H0L B;  3RLM A;  1RAP A;  4C46 A;  4DT0 A;  2OTJ P;  5B66 E;  1SQB J;  1A02 F;  1RZ6 A;  2R44 A;  4TT3 H;  1QX8 A;  1VF5 B;  1RF0 A;  1CED A;  4PV1 C;  3H1L G;  5IY5 1;  4W7Z A;  5BU8 B;  1WMK A;  3AED C;  1ZV8 A;  1HJ3 A;  3R4Y A;  3TDK A;  3L75 G;  1C75 A;  3WUT A;  3H1K D;  3IFM A;  1K3G A;  2JO1 A;  4N3Y B;  1LP1 A;  3HTK A;  2IPP A;  1P84 H;  5TJH A;  3CC2 P;  2DW3 A;  1YTZ I;  3IR9 A;  3SXT A;  2E74 B;  1HGZ A;  2YCC A;  1X79 B;  5KTB A;  1PP9 G;  3DP5 A;  2WSC H;  3NXS A;  1HVV A;  4FAV A;  4GOE A;  1YIJ P;  3CXH W;  4Y99 C;  1E2R A;  2N9Y B;  2I8F A;  1SQV G;  1USD A;  1F1F A;  3ITK A;  5E79 V;  4IFM A;  2E5Y A;  1KX7 A;  2ZBO A;  3E1I A;  5CIG B;  1OX3 A;  3PRJ A;  3L36 A;  2OYI A;  4FAN A;  3RK2 B;  4L3G A;  1KB9 D;  4NPF X;  2YKQ A;  1SP4 A;  2PFX A;  4EIF A;  2QEX P;  1CHI A;  2KZJ A;  1N90 A;  1PGP A;  1CNO A;  5L8R J;  4AX3 A;  3RK3 D;  2XKM A;  4UB8 V;  2PRR A;  1GK4 A;  3H32 B;  1L0L E;  1KFN A;  2JDI H;  3U59 A;  3FXD A;  5C9M A;  2B10 B;  3WFE C;  1W5C T;  4WY4 C;  1MZ9 A;  1MKM A;  3H1L D;  1N8R Q;  4AYC A;  4AAL A;  4W7Y A;  3KDP B;  1S5L H;  3W68 A;  3L75 D;  3AE7 C;  1LTG C;  1N2D C;  1BE3 E;  2ZT9 D;  2M3B A;  4FA1 A;  5TIS H;  1L0L J;  3CX5 E;  1HZV A;  3VNW A;  1OCD A;  2HLO A;  1HTL C;  2QSI A;  3IAO A;  1M70 A;  1DIQ C;  3QH9 A;  1EDJ A;  2CPB A;  1BCC E;  1DD3 A;  5B66 H;  3FX0 A;  1DVH A;  1FZB A;  4GOF A;  2M5A A;  3P8C D;  1SQV D;  1QEX A;  2C9N Y;  1SQX E;  3V4Q A;  1KIB A;  2K9J A;  1KTM A;  3V2N A;  1J1E B;  1BE3 J;  2C0X A;  5AW4 B;  2FFD B;  5CJ0 A;  5AVS B;  3GF7 A;  2ZXY A;  2CK3 H;  3PJS K;  2IZ1 A;  3RK3 B;  1M1J B;  1NTZ G;  3ZOY A;  2OTL P;  1BCC J;  1T2K D;  3CLQ A;  2Y0E A;  3FXE A;  3BRV B;  2A45 I;  3DR0 A;  1VL2 A;  1S72 P;  1OW6 A;  5AVU B;  5GTH E;  1XTC C;  2OYO A;  1LT1 A;  1SQX J;  1L0N G;  2BH4 X;  4KHX A;  1JMB A;  3W67 A;  4LC1 A;  2FYU E;  1I5T A;  1JCD A;  1X8Y A;  3VP9 A;  3E1R A;  1JEK A;  4U7J A;  3PP5 A;  1HH7 A;  4DZO A;  1OAE A;  2C1D B;  1GU5 A;  1LWU B;  2ZXX A;  1Q2N A;  2W6B A;  4WQD A;  4GIF A;  2ZT9 B;  3G3Z A;  1YJ9 P;  1SQQ G;  2O1K A;  1C52 A;  4C7R A;  4JBZ A;  3AE3 C;  5AW7 B;  4OGQ C;  3LID A;  3B71 A;  3NTN A;  1AQ5 A;  1WRG A;  1N7L A;  2ORL A;  1NTK G;  1VQK P;  1H31 B;  1HUC A;  1KFM A;  2A45 G;  5AW2 B;  2N3Y A;  2IX7 C;  1SFC D;  1I55 A;  4Z1M H;  1AQT A;  1LGH B;  5B66 V;  2WTY A;  1UII A;  4PD4 E;  2JEE A;  4XFJ A;  1EZV E;  1IO3 A;  1RE3 C;  3BAS A;  1GTW A;  3CCQ P;  2OYH C;  1CC5 A;  1RQV A;  3CXH E;  2OGU A;  1AVY A;  1CRY A;  2H89 C;  2FFD A;  2M8R A;  1M8O B;  1FE6 A;  2N1T D;  1CHJ A;  1NTZ D;  2I1K A;  2HFE D;  1CW5 A;  1GD2 E;  3CX5 H;  4AAN A;  3JSV C;  1M1J A;  1ZME C;  2AEM A;  1DW3 A;  1NJI Q;  1CSB A;  1NGM B;  1K04 A;  1LMS A;  3AEC C;  1CTZ A;  1FCD C;  1E5W A;  1HJ0 A;  3P7K A;  3GLM A;  1L0N D;  4U3F E;  4AAO A;  2YK3 A;  1LTJ C;  1MG2 D;  1FZA A;  2RH0 A;  4N78 E;  3Q3D A;  1FDI A;  2QJY C;  4K3I A;  2G8Y A;  4RJT A;  2W83 C;  2C1D A;  3L37 A;  4IL6 X;  2IYP A;  1NTM E;  3EFF K;  1QN2 A;  3T97 A;  3CC4 P;  1U74 B;  1NIR A;  4LJI A;  3AEG C;  1QVF O;  1R8E A;  5B6Q A;  1JY3 N;  4U3F J;  1SFC B;  3GHG B;  2QG4 A;  5KKZ B;  2IDB A;  4L74 A;  2Q1K A;  2H88 C;  1ZOY C;  4YXW H;  351C A;  1H88 A;  5AVZ B;  1QKS A;  5APQ A;  2HG5 D;  1H31 A;  3L72 G;  2SPZ A;  2UWJ E;  1DH3 A;  5AVV B;  3L71 G;  1J3S A;  4PJ0 E;  3VN0 A;  2JP3 A;  1NTM J;  1H0T A;  2YXR B;  1CO6 A;  1NU1 K;  2N1T B;  2KLU A;  3ABV C;  4BWN A;  1DIP A;  2CA4 B;  3GG2 A;  1C6S A;  2OTK E;  4R4L A;  3D70 A;  4FA9 A;  3BCC G;  1CRI A;  1OW7 A;  1KQG B;  2IFN A;  4I7Z C;  3TGU G;  1W2L A;  2QVA A;  3Q2Y A;  3PH2 B;  1CSU A;  1QLE D;  2POH A;  3HQ9 A;  4EIC A;  2PAC A;  2FYZ A;  2JR8 A;  3O20 A;  5KLI C;  2WIT A;  2NPS C;  3TYY A;  1W2B O;  1EXI A;  1U75 B;  1I6E A;  1PGQ A;  1EQ7 A;  5DF5 A;  2R32 A;  2ZYG A;  1VQM P;  4PD4 H;  3A0H E;  1KIL E;  1SQB K;  5AUR A;  2ZJS E;  1A56 A;  2AXC A;  3VMY A;  3S4R A;  1PL5 A;  1AJY A;  1YEA A;  3HUS C;  3MD0 A;  3IN6 A;  3CCM P;  1A02 J;  3WFC C;  4OVN F;  3CXH H;  1FS0 E;  1DEB A;  3I5C A;  1ZZH A;  1H32 B;  2N18 C;  1N86 A;  1FC2 C;  4L76 A;  3OJA B;  3R2P A;  1SQP G;  2QJK B;  4ZMD A;  1LTA C;  3D6Z A;  2OQQ A;  1MG3 D;  1IFP A;  2EXV A;  1X0T A;  1YIT P;  2FBW C;  1GU4 A;  4PV1 D;  1A8C A;  2BGV X;  5GTH V;  3L72 D;  1FDO A;  4RES B;  2ZFC A;  3HD7 C;  5KAI V;  3PXS A;  3HTK B;  2E5T A;  3NBT A;  2GA1 A;  4XA4 A;  3Q1M A;  2N1T A;  3BCC D;  2FYU D;  1KYO I;  1U57 A;  4HJG H;  1WT6 A;  4Y28 J;  2MKV A;  2W8Z A;  3A5T A;  3TGU D;  1BGY E;  3G71 P;  2NPS A;  2IZ0 A;  1FDM A;  1CXA A;  2AXT E;  4GKG A;  4RO0 A;  155C A;  1VQO P;  5DJU B;  2WPV B;  2WSS H;  2JWD A;  4IFD K;  2FRC A;  1RZ5 A;  3V5B A;  3H1I G;  2QE7 H;  2B4Z A;  4PJ0 H;  5AW1 B;  3HUS A;  1X22 A;  4JPZ B;  2OYI B;  1PPJ E;  2JJL A;  2WPS A;  3BAT A;  3CME P;  1W2E A;  1S4X A;  3HQ8 A;  1Q82 Q;  4RKU J;  1BGY J;  1IRW A;  1NYH A;  1QL2 A;  1S5L E;  1LC2 A;  4WWI A;  4YXD C;  3EQ2 A;  1DX7 A;  5CIF B;  2P67 A;  4ZNC A;  4WQ7 A;  4L75 A;  1MV8 A;  2B87 B;  3M06 A;  1YBK A;  1EDK A;  1GKS A;  4PV1 B;  1USE A;  2XNX A;  4JQ0 D;  5CJ4 A;  1CIH A;  5M1B A;  1VQ9 P;  3MK7 C;  3ORV A;  2GUV A;  1L0L K;  1S9K D;  1FOC A;  2MTA C;  1FOS F;  2A06 G;  3HD7 A;  4WY4 D;  5CIH B;  3A0H H;  1Y9B A;  3HRN A;  3M0D C;  1NML A;  3WU2 H;  2IFM A;  2KIK A;  3M9Q A;  2Y0C A;  4DCK A;  3V6I A;  3N7N A;  3OW2 O;  4Y99 B;  2XTS B;  1RQU A;  1GJQ A;  4I6M C;  1IFD A;  4IL6 H;  5DJQ C;  2WSF J;  3L70 G;  1MUU A;  5APU A;  4KJM A;  2R3C A;  1COR A;  4H0K A;  4ZKP A;  4H44 C;  1GDV A;  4V2K A;  1LTB C;  5H2F V;  2M5A B;  1KV9 A;  2WVR A;  1OVU A;  3CYT I;  2ZZS 1;  2QRX A;  3MUD C;  5CCH C;  1N73 C;  2K9J B;  1AOQ A;  2N3B A;  1NHL A;  5APW A;  4YPC A;  1IK9 A;  2YKP A;  3H1I D;  1LNQ A;  2WSE H;  1SQX K;  3H1J G;  4Q5P A;  1NKZ B;  4GOD A;  1FZF A;  1SQQ E;  1H9Y A;  1PV3 A;  2AEJ A;  2KUB A;  1CSV A;  4WQA A;  1FBM A;  5B5E H;  1DII C;  4GED B;  2V07 A;  2GUS A;  2QIW A;  1K05 A;  2YKO A;  3KPE A;  2K37 A;  1X9V A;  3SSU A;  3H25 A;  2C9L Y;  3O1Y A;  1GW4 A;  1NH4 A;  3ZOX A;  1FJ0 A;  3L73 E;  5KLV E;  3MTU E;  1ZR2 A;  4WY4 B;  5AVR B;  2AXT H;  2BLF B;  2E42 A;  1KX2 A;  3UIA A;  1NU1 G;  2B87 A;  2RMZ A;  1JTH A;  1OVV A;  3MGN A;  2FYU K;  1SQQ J;  3M9H A;  1KYO D;  1YIQ A;  4IFF A;  2A06 D;  3M0D A;  2L4D A;  2YMK A;  3MIW A;  1URQ C;  3AEF C;  2YO3 A;  1FI7 A;  2ZON G;  1EB7 A;  1GZL A;  1K3H A;  5AVY B;  2B9B A;  3A2A A;  3A0H V;  3L73 J;  5KLV J;  2LKM A;  2C1U A;  4OGQ D;  4OH8 B;  2HOD A;  2BEQ D;  3CI9 A;  2Y0D A;  1PFI A;  1CRC A;  5C39 A;  1H33 B;  3OA8 B;  1LTS C;  3L70 D;  1CYC A;  2FYN C;  1SQB G;  3MUD A;  2OAR A;  5CCH A;  4QAO A;  1T3J A;  2YMY A;  1CRJ A;  2WSF H;  3CMA P;  1ZW0 A;  2GIW A;  1BDC A;  4TLF A;  4H13 C;  1HJ4 A;  1B7V A;  3EWK A;  1P84 D;  1H89 A;  3H1J D;  2D0S A;  4D6T E;  1CI6 A;  1FZC C;  5K5G B;  3AE4 C;  1HJ5 A;  1VQ8 P;  2WQY C;  1CXC A;  1YQ4 C;  4WVZ A;  1CIE A; 
#chains in the Genus database with same CATH homology
 1H9X A;  1A2S A;  3WFD C;  1N15 A;  1N9C A;  1AYG A;  4K3I A;  1NTM D;  2C8S A;  2PCB B;  4H0J A;  3ZIY A;  4RJT A;  2C1D A;  2YQB A;  2KS1 A;  1DW2 A;  3L74 D;  1IRV A;  5CIE B;  3A9F A;  1QN2 A;  3H1H D;  3CX5 W;  1U74 B;  3L71 D;  1NU1 D;  1C6O A;  4WQC A;  2Q3E A;  1NIR A;  4LJI A;  1YNR A;  1RAQ A;  4PJ0 V;  2AXT V;  5B6Q A;  2PCC B;  3PHL A;  1DW1 A;  2GC4 D;  3TF5 A;  1YCC A;  1NNO A;  2QG4 A;  5KKZ B;  1ZRT D;  4L1Q A;  1C6R A;  3PXW A;  2CE0 A;  2C9X B;  3C2C A;  3VYM A;  1CYI A;  351C A;  3FWL A;  1YTC A;  1I54 A;  1QKS A;  2GC7 D;  1H31 A;  4O1Q A;  3VRD A;  1HRO A;  2QJP B;  1J3S A;  1DT1 A;  1NMI A;  1CO6 A;  2CE1 A;  1S5L V;  2CA4 B;  3GG2 A;  1C6S A;  4FA9 A;  1SQB D;  1H33 A;  1H1O A;  1CRI A;  3OA8 A;  1L9B C;  1LFM A;  4N0K A;  5TIS V;  1YEB A;  2FYN B;  1W2L A;  2BCC D;  3CWB D;  3PH2 B;  1CSU A;  1YFC A;  3RN1 A;  1E8E A;  3HQ9 A;  3KZI V;  2KNC B;  1IQC A;  4EIC A;  1ETP A;  2PAC A;  1COT A;  3WU2 V;  4DY9 A;  4WQ9 A;  3O20 A;  4Y5R A;  2VHD A;  3ZOO A;  4FA4 A;  5CIB B;  1DW0 A;  1U75 B;  1I6E A;  1SQP D;  3CP5 A;  5DF5 A;  1GQ1 A;  3VMA A;  1H32 A;  4FB1 A;  2AIU A;  3RLM A;  4IL6 V;  5AUR A;  1RAP A;  1A56 A;  2DVH A;  5EXQ A;  1CRH A;  451C A;  1RZ6 A;  1YEA A;  3WC8 A;  3WFC C;  1CED A;  3ZCF A;  1ZZH A;  1H32 B;  2N18 C;  1KYO W;  1PP9 D;  5IY5 1;  2QJY B;  1FI3 A;  2QJK B;  1HJ3 A;  1QL3 A;  3TDK A;  1GU2 A;  3TYI A;  2BCN B;  1GIW A;  1C75 A;  1MG3 D;  3H1K D;  3SLE A;  1K3G A;  1N50 A;  2CA3 B;  2EXV A;  4RSZ A;  5TJH A;  5B5E V;  4AAM A;  3SXT A;  1LS9 A;  2YCC A;  1A8C A;  3ZBM A;  2BGV X;  1CIF A;  3X39 A;  5GTH V;  3L72 D;  2N9J A;  2GB8 B;  3DP5 A;  1QYZ A;  4FAV A;  5KAI V;  3CXH W;  2LIT A;  3PXS A;  1E2R A;  1I6D A;  2N9Y B;  2I8F A;  3NBT A;  1F1F A;  3ITK A;  4KMG A;  5E79 V;  5CIC B;  2B0Z B;  3BCC D;  2L91 A;  3PTZ A;  1AKK A;  1BGY D;  1C2R A;  2FYU D;  1KX7 A;  2ZBO A;  3TGU D;  1QL4 A;  3SJL A;  4WQE A;  2BPB B;  5CIG B;  3DMI A;  4PWA A;  3PRJ A;  4FAN A;  1HZU A;  4L3G A;  1KB9 D;  3NWV A;  1CXA A;  155C A;  3ZOW A;  5DFS A;  5CYT R;  2B11 B;  3L4M A;  4JCG A;  2FRC A;  1RZ5 A;  4EIF A;  1CHI A;  1N90 A;  2B4Z A;  1CNO A;  1PPJ D;  5KLI B;  4AX3 A;  4NFG B;  1L0L D;  4O1W A;  4UB8 V;  1C7M A;  4MU8 A;  3HQ8 A;  2D0W A;  2ZOO A;  2JTI B;  1CIG A;  1IRW A;  5C9M A;  2B10 B;  1LC2 A;  1CTY A;  3WFE C;  1W5C T;  4P4Q B;  3PLN A;  1F1C A;  2HV4 A;  2N9I A;  5CIF B;  1WVE C;  3H1L D;  4WQ7 A;  3RMZ A;  1CSX A;  4AAL A;  1GKS A;  2RN0 A;  5GTI V;  2N18 B;  1CIH A;  3O0R C;  1BE3 D;  1FI9 A;  3L75 D;  3MK7 C;  3ORV A;  3PXT A;  1CCR A;  1VYD A;  3L4O A;  4FA1 A;  3CX5 D;  2AI5 A;  1FOC A;  2MTA C;  4J20 A;  3HQ6 A;  5CIH B;  1L9J C;  1BCC D;  1I8P A;  3WFB C;  1HZV A;  3VNW A;  1OCD A;  1M70 A;  1DIQ C;  1I8O A;  1CTJ A;  1DVH A;  1NML A;  3GW6 A;  2Y0C A;  1SQX D;  1SQV D;  5CID B;  1YIC A;  4GYD A;  4YE1 A;  2XTS B;  1GJQ A;  1WEJ F;  3OCD B;  3JBT B;  1KIB A;  5DJQ C;  4XXL A;  2CXB A;  3NBS A;  1COR A;  4H0K A;  4WQ8 A;  2ZXY A;  1GDV A;  1R0Q A;  4V2K A;  5H2F V;  1KV9 A;  3CYT I;  2IBZ D;  2ZZS 1;  3ZOY A;  2Y0E A;  3SVW A;  2K9J B;  1AOQ A;  2OZ1 B;  2N3B A;  3DR0 A;  1JDL A;  2YIU B;  1SQQ D;  3H1I D;  1CRG A;  3O5C A;  4Q5P A;  5C0Z A;  1H9Y A;  1FHB A;  1KB0 A;  2BH4 X;  1CSV A;  1C2N A;  4WQA A;  1I5T A;  1DII C;  4GED B;  4PW9 B;  2V07 A;  2C1V A;  1MZ4 A;  3WUI A;  1HH7 A;  1NTK D;  1OAE A;  2C1D B;  3L73 D;  1AOF A;  5KLV D;  3O1Y A;  4WQD A;  3ZOX A;  1FJ0 A;  2B12 B;  4FA5 A;  4EIE A;  1C52 A;  2BLF B;  1HCM A;  1KX2 A;  1LC1 A;  2RMZ A;  2JQR A;  1KYO D;  1DVV A;  1S6V B;  1YIQ A;  1CYJ A;  2A06 D;  2L4D A;  3MK7 B;  2ORL A;  2FWL A;  1BL9 A;  1FI7 A;  2ZON G;  1H31 B;  1CHH A;  1EB7 A;  1M60 A;  1K3H A;  3M97 X;  2N3Y A;  3A0H V;  4PD4 D;  5KAF V;  1I55 A;  1M6Z A;  1EZV D;  2C1U A;  2V08 A;  1E29 A;  2Y0D A;  5B66 V;  1CRC A;  1CCH A;  3KHU A;  1IO3 A;  3A0B V;  1H33 B;  3OA8 B;  3CXH D;  3L70 D;  1CYC A;  4EID A;  3OCD A;  4XYD B;  1CC5 A;  4QAO A;  1CRY A;  1CRJ A;  2DGE A;  5DJQ B;  3SWS A;  1IZL 0;  1CHJ A;  2GIW A;  1NTZ D;  4EDF A;  4WQB A;  1HRC A;  4AAN A;  1HJ4 A;  1B7V A;  3CU4 A;  1DW3 A;  4UB6 V;  1P84 D;  4D6T D;  1LMS A;  3H1J D;  2OZ1 A;  4U3F D;  1CTZ A;  1FCD C;  2D0S A;  3HQ7 A;  1CSW A;  1L0N D;  2JWA A;  2BH5 X;  1HJ5 A;  4AAO A;  2LIR A;  4A7P A;  2C2C A;  2MHM A;  2YK3 A;  1CXC A;  1MG2 D;  1CIE A;  2O3J A;  3RN0 A;  4L3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...