1NTKD

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 51
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntkD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntkD01
1H31A 4MU8A 2CA4B 3ZOXA 3O5CA 1CIGA 1OCDA 2HV4A 4YE1A 2DGEA 2QJKB 3HQ6A 1E29A 3H1ID 2N9IA 1H32A 1W2LA 3CYTI 2Q3EA 4WQCA 5CIBB 1CEDA 4FA4A 2BPBB 1W5CT 2ZOOA 3VNWA 5KLIB 1NTZD 4EIDA 5B6QA 2BCCD 3L75D 2GC4D 1YTCA 3PLNA 1K3HA 1NIRA 3TF5A 3HQ9A 1MG3D 2QJPB 4FA9A 1C2RA 1U74B 2C1DA 3BCCD 4O1QA 4V2KA 3RLMA 1CSUA 4WQ7A 1YFCA 155CA 1CXCA 2CE1A 1CRHA 4AANA 1AOQA 1I8OA 3VMAA 2V07A 2ORLA 4QAOA 5KAFV 1VYDA 5TISV 2C1VA 1COTA 5C0ZA 1AYGA 3ZCFA 1DVHA 2JTIB 3SXTA 3WFDC 3CWBD 1F1FA 1CNOA 2BCNB 2L4DA 2RMZA 5DF5A 1CIEA 3SVWA 1L0LD 2JQRA 1HCMA 3L71D 5CIDB 2B4ZA 1H33A 1KYOD 3NBSA 1GIWA 3ZOYA 3L73D 1KB0A 1N50A 3M97X 2ZONG 1E8EA 3NBTA 3MK7C 1MZ4A 1MG2D 2C2CA 2DVHA 2A06D 1BCCD 1HZUA 5H2FV 1KYOW 1FHBA 2XTSB 1L9BC 2BH5X 1KX7A 1CYCA 1QKSA 4UB6V 1SQBD 1H31B 1FI3A 1DVVA 1H9YA 1C2NA 1CTZA 1FJ0A 1I55A 4AAOA 4U3FD 4PD4D 1BL9A 2QG4A 3OA8A 1PPJD 1NMIA 4AAMA 1NU1D 1N90A 1CHIA 1NTKD 2KS1A 3CU4A 4WQEA 1LFMA 4J20A 1FCDC 1P84D 1CRGA 2N18C 5GTIV 4A7PA 3PH2B 4H0JA 2C8SA 1DW2A 4Y5RA 3FWLA 5TJHA 1CHJA 1C52A 4RJTA 3HQ7A 3L72D 3WU2V 1CTYA 3WUIA 4WQ8A 1I6DA 1NTMD 2Y0DA 1GKSA 1C6RA 5CIFB 3CXHD 3PHLA 1YICA 2CA3B 2B0ZB 3X39A 3H1KD 3JBTB 1H9XA 2N3BA 1ZZHA 2GC7D 3PXSA 5B66V 2PCBB 4LJIA 1LMSA 5KAIV 3RN1A 4FA5A 3KZIV 4WQBA 1H32B 5CIEB 4FAVA 1IRWA 1NMLA 2KNCB 1FI7A 1GQ1A 1KV9A 2L91A 1QN2A 1CRYA 3L4MA 1N15A 3O20A 1C75A 2K9JB 1IQCA 4FB1A 3WFBC 1LC2A 2N9YB 1H1OA 1K3GA 351CA 3CXHW 3GG2A 1LC1A 1HJ3A 1CC5A 1HJ4A 1ETPA 1KIBA 1YIQA 4FA1A 1KX2A 2FYNB 1CCRA 1DW1A 1DT1A 1KB9D 1L0ND 1ZRTD 2AXTV 2YIUB 2JWAA 3SWSA 3PTZA 4D6TD 2ZZS1 2FYUD 3PRJA 3A0HV 451CA 2YQBA 2ZXYA 3PXWA 2BH4X 3CX5W 4EDFA 3VYMA 3L74D 4L3GA 4DY9A 1DIQC 1BE3D 3TGUD 4IL6V 4KMGA 1SQVD 2N9JA 2ZBOA 4P4QB 5IY51 1HROA 4PWAA 3CP5A 1YNRA 4WQDA 1HJ5A 1SQPD 4PW9B 3ZBMA 4EICA 1FI9A 1IO3A 2B12B 2AIUA 3MK7B 1N9CA 2Y0CA 2IBZD 4L1QA 1A2SA 1J3SA 2LITA 1C6SA 1GDVA 5DJQB 1HZVA 3WFEC 2N18B 1CSWA 3ZIYA 2OZ1A 2CXBA 1RAQA 2OZ1B 1CYJA 1CYIA 2BLFB 1QYZA 1NNOA 2I8FA 4WQ9A 1S6VB 3H1HD 3WFCC 2PCCB 2BGVX 5E79V 1CCHA 3A0BV 3L4OA 5CYTR 3OA8B 1SQQD 2YK3A 3A9FA 1IZL0 3VRDA 3NWVA 3OCDA 2O3JA 3L70D 2CE0A 1CXAA 4RSZA 3WC8A 5CIGB 5C9MA 3RN0A 5KLVD 1AKKA 1WVEC 1I8PA 4GEDB 5EXQA 4EIFA 2QJYB 1B7VA 1CSXA 1RZ6A 1U75B 2LIRA 1CIFA 1L9JC 3O1YA 4AALA 1FOCA 3DP5A 3TDKA 2B11B 3SLEA 2C9XB 4N0KA 1CRIA 1HRCA 1A8CA 4GYDA 4O1WA 3ITKA 1GJQA 1QL4A 1C7MA 4EIEA 5KKZB 1M70A 1YEAA 1GU2A 2FRCA 3CX5D 1RAPA 2GB8B 2MHMA 1CSVA 1PP9D 1I5TA 3HQ8A 2D0SA 1YCCA 1E2RA 1QL3A 5AURA 4AX3A 4XXLA 3H1JD 3DR0A 2V08A 3ORVA 1A56A 1CORA 4WQAA 1BGYD 3RMZA 1I6EA 1IRVA 2B10B 3ZOWA 5B5EV 4K3IA 3PXTA 4UB8V 4FANA 5GTHV 2C1DB 3O0RC 2MTAC 1CTJA 1LS9A 4PJ0V 3ZOOA 1CHHA 1M6ZA 2C1UA 1YEBA 5CICB 1EB7A 1RZ5A 2VHDA 2Y0EA 1I54A 2FWLA 4XYDB 4JCGA 1SQXD 4NFGB 3TYIA 1EZVD 2EXVA 1JDLA 1DW3A 3C2CA 1CIHA 3DMIA 3OCDB 5CIHB 1C6OA 1WEJF 1DIIC 5DJQC 2YCCA 1F1CA 2RN0A 4H0KA 2N3YA 3GW6A 2D0WA 1M60A 1H33B 4Q5PA 1HH7A 1OAEA 1CO6A 2PACA 3KHUA 1DW0A 5DFSA 2GIWA 1R0QA 1CRJA 3SJLA 1CRCA 1S5LV 4L3HA 1AOFA 3H1LD 2AI5A
chains in the Genus database with same CATH superfamily
1USDA 2XNDH 4M3LA 1OCDA 4YE1A 5KAFH 3HQ6A 3Q5PA 1PPJG 1W2BO 3CWBG 2D2CD 2Q3EA 3LW5J 5CIBB 1JCDA 1QGKB 1NTZD 3MD0A 3BRVB 2O01J 4YTPC 1YYCA 3V4QA 4IFDK 2QA4P 1K3HA 1L0NG 2ZYGA 1Y8AA 3IFMA 3HQ9A 1EDIA 1MG3D 3A3YB 3L75J 3L4FA 1KV4A 1NTMG 2B9BA 4DZOA 1U74B 1JY3O 4XFJA 3BCCD 3WMM0 5CMZA 1X8YA 1KQSO 1H89A 1WMKA 3V4WA 5KAFV 2O01H 4IFMA 1VYDA 1N73B 3U59A 4OGQD 5KLVG 2C1VA 3L72E 4AUWA 3Q1MA 5APUA 5KAFE 2BCNB 2Q5UA 5APVA 3KZIH 2L4DA 3VOPA 1DD4A 4WY4A 2V7QJ 4I7ZC 1S2EA 1GDTA 3L71D 2WSCJ 4PV1C 5CIDB 2A45G 1KYOD 1GIWA 1URQA 1R5LA 5GTHE 2QM8A 4B86A 4OGQB 2M3BA 3RL0B 3MK7C 2W90A 1MFTA 3L72G 2A06D 1M1JC 5H2FV 1SFCD 1AA0A 1SQQG 2XTSB 1L9BC 2BH5X 3CL3D 2N1TB 3H25A 1FI3A 3M0AA 1NTZJ 1DVVA 2GA1A 1VQOP 1FJ0A 4JF7A 4AAOA 4U3FD 1FAVA 2QEXP 4AAMA 1NU1D 1NTKD 1JUNA 4J20A 2AXTE 1FCDC 3BCCJ 1CRGA 2N18C 3PH2B 2WPSA 3FXDA 3G3ZA 1L4AD 2C8SA 1VQ9P 4Y5RA 3FWLA 4OWFA 5B66H 5AW1B 3HQ7A 3CLQA 1LP1A 1HH0A 2FYZA 4WB4A 1S5LX 1I6DA 3A0HH 1C6RA 2WPVB 1SQQJ 4H0LD 1VQ8P 1LTJB 1GD2E 1SQQK 3D6YA 1WT6A 1JM0A 2GC7D 4LLHA 3PH0A 5AVUB 2UWJE 1LMSA 2A45H 1H32B 4Y28J 2KB7P 4JYCA 1SS1A 1MZ9A 2M8RA 2OQQA 3OJAB 1RHZB 3R2PA 2QJPC 3E7KA 4R4LA 3O20A 4JPZB 1FZFA 1HF9A 3II6A 2GM4A 3CXHH 2N9YB 1H1OA 3L71J 4XA4A 1Y9BA 1HJ4A 1ZP0C 4FA1A 2HODA 2FYNB 2AXTV 1DT1A 1L0ND 1ZRTD 4TLFA 2JWAA 4Z1MH 4GDOA 2JJLA 4W7ZA 5KLIC 4D6TD 3CPWO 2FYUD 1YJ9P 2YQBA 1GL2B 3TNUB 1M8OB 1EXIA 2AEFA 1N8RQ 4EDFA 3L74D 3V5BA 4N78D 1DIQC 3MGNA 3VN0A 3NTNA 1HROA 4PWAA 3RK2D 5KJ7C 5APQA 1NOHA 2CK3H 1YNRA 4WQDA 2YKQA 1HJ5A 3Q5SA 1EDKA 4EOTA 5AW3B 5KLVK 3G71P 4H13D 3O8ZA 3G4SP 3H32A 1LTTC 3FXEA 2YO3A 4NPDA 2CXBA 2BCCE 1YQ4C 2BLFB 4ZNCA 1S6VB 5CCGC 3H1HD 1JY2P 1JEKA 1PGOA 1Q2NA 1VQPP 2QRXA 3A0BV 3L4OA 4OH8B 2ZXXA 2FXOA 5CYTR 3OA8B 3B4SA 3GHGC 1SQQD 3A9FA 4UB6H 1EDLA 4OVNF 3CCSP 1S72P 5CIGB 4I6MC 2BEQD 5TISH 1PV3A 1AKKA 1LWUC 5KAIH 2FFDA 2AXTH 5B5EH 3CCUP 3GMAA 2WVRA 1IC2A 2W6JH 2QJYB 1B7VA 1CSXA 4LC1A 1L9JC 4AALA 1SQVK 4C46A 1LJ2A 3SLEA 1KILD 1L0LG 3L71E 1N73C 1A8CA 1KB9H 4GYDA 1Q7YQ 1QL4A 5KKZB 2LXCB 1T2KC 1NTKK 1YBKA 1FZCC 1GU2A 4WY4B 1RAPA 1QVGO 1KORA 4GOEA 3JC22 1P84H 2OYHA 2WMMA 1IK7A 1MFZA 3VMYA 3BVHA 2WSFH 2E74D 4AX3A 3DR0A 1K05A 1BDCA 1N2DC 2V08A 2YKPA 1A56A 1CZQA 1URQC 2Q6QA 4TT3H 2ZT9D 4K3IA 1ZN5A 4C7NA 3KPEA 1VF5B 1S3JA 3T97A 3HD7A 1J1DC 4L74A 1M90Q 1RF0A 3ZOOA 1CHHA 1M6ZA 3IN6A 2K3RA 5APSA 3L70G 1YEBA 1L0LJ 2VHDA 1T3JA 3MTUE 1I54A 4XYDB 4JCGA 1AFOA 1SQXD 2EXVA 1OFCX 2QVAA 5AW2B 4I7ZB 1NWQA 3C2CA 1CIHA 3OCDB 2ZVNB 1C6OA 2XKMA 2G8YA 1DIIC 1P84E 1LWUB 2FFDB 1EZVI 2D0WA 1M60A 2HFED 5CCHC 3EFFK 3CCVP 2IFMA 1BE3J 1YHQP 3O6QB 4GT1A 1HH7A 3EFGA 1FOSE 5H2FH 1WRGA 3BATA 3H1LD 1GK6A 1HJBA 5AVZB 4MU8A 3L70J 1CIGA 2HV4A 3HD7D 2DGEA 1FU1A 3A2AA 4MN4C 5CBNA 1E29A 3H1ID 2R5BA 2WT7B 1KYOI 2W6BA 2Z4EA 1EC5A 4WQCA 2LR2A 4FA4A 3A7OA 1W5CT 4I1LA 1RQUA 3JSVC 3U1AA 2J5UA 5B6QA 2BCCD 5AW4B 4C7NB 3AEFC 1GL2D 2IX7C 1J1EC 3AE8C 2CPBA 5AVXB 1C2RA 1GU5A 4BXLA 3LIEA 3CC7P 3A0HE 1M57D 1CSUA 3KDPB 1YFCA 3P32A 1URQD 3CCLP 2J59M 2R5DA 3VMAA 2V07A 2ORLA 1KFNA 3CWBE 5TISV 4PV1D 1OZHA 4Y99B 1DVHA 3WU2E 3SXTA 3L74E 1JTHB 2GUVA 1L0LE 1LTBC 3KXDA 4U3FG 3MP7B 1KB9E 1N7SD 2NRGA 1VQLP 5DF5A 1CIEA 1M56D 5TISE 3AE3C 1VF5C 3I56P 1NTMJ 2IFNA 5B5EE 3NBSA 2E75C 1KB0A 1RE4A 2K1AA 3D0WA 1FZGA 2XZRA 3KQGA 3RBZA 2ZONG 1J2JB 1EDJA 1PL5A 3NBTA 5KJ7D 3M0DA 2C2CA 2DVHA 2LKMA 3OW2O 1GL2A 4L73A 4WY4D 1OVRA 2XV5A 1L4AA 3WUUA 1CYCA 1U57A 1JY3P 1LTJA 1FZBA 2ZJSE 2V7QH 1S9KD 1GK4A 2H43A 1C2NA 2E74B 3L75E 1I55A 3Q5RA 2WQYC 1BL9A 2B87A 1NMIA 3CD6P 4Y99C 4U3FJ 1IFNA 3CU4A 2KS1A 1P84D 3V2PA 4DCKA 2D2CC 4R4MA 1RF1A 2JKVA 3H1HJ 4JYBA 3RL0D 1H88A 1Q81Q 3HD7C 1N7SA 1CHJA 2DW3A 2IDBA 2HR3A 3L72D 5L8RJ 2V4HA 3WUIA 1BCCG 2N1TD 4WQ8A 1A02J 2FXPA 3AEGC 2N9BA 4HB1A 1JCCA 2H7HA 2FYNC 2JO1A 4LGDE 4RKUJ 4ASWA 4W7YA 2E76B 1JY2O 2KK7A 1MUUA 1OVVA 4LJIA 3CXHI 5KAIV 3NXSA 4FA5A 4WWIA 3KZIV 4WQBA 1LP1B 2WT7A 1IRWA 3F5HA 1NMLA 1BCCE 2QIWA 1NAFA 2QSIA 2YMYA 1LTSC 1QN2A 1CRYA 1IO4A 2W8ZA 2KOGA 3IF4A 1AQTA 1C75A 1N7SC 4FB1A 1FDMA 1LC2A 1LWUA 2POHA 1GTWA 5AVRB 1L0NJ 2A06G 1ETPA 4UB8E 3L73J 1YIQA 1KX2A 2PGDA 1H0TB 2PAJA 3H6PA 2QJKC 4H44D 2ZZS1 1PFIA 3PRJA 3A0HV 3P8CE 1JOCA 3PXWA 2BH4X 1VDFA 2IYOA 1GZLA 2YO2A 2OYIB 2P67A 2XNXA 2WSCH 3L36A 1Q86Q 1BE3D 3TGUD 4IL6V 1SQQE 3PJSK 2M5AB 2ZBOA 3RL0g 3CXHE 3RL0C 4D6TE 3CP5A 2JP3A 3H1HE 1IO3A 3RK3C 1YJWP 2YXQB 3MK7B 2IBZD 3T97B 4AQRD 1HVVA 2LITA 1T3UA 3W67A 5M1BA 1HZVA 3WFEC 2N18B 3BASA 1CSWA 3ZIYA 1AV1A 4WVZA 3CCJP 2MKVA 3L73G 1RAQA 2OZ1B 1CYJA 1EZVG 3M9BA 1X22A 1E5WA 1S4XA 1YI2P 3WFCC 2BGVX 2IPPA 5E79V 3FGAD 2H89C 3SWKA 2R3CA 2C0WA 1VQNP 3VRDA 3NWVA 3OCDA 3L37A 3L70D 1CXAA 3WC8A 1S1CX 4H0LB 3RN0A 2WITA 2NZ2A 4GKGA 4C7RA 1WVEC 1URQB 1NTMK 5EXQA 1IJDB 3G6EP 2M3EA 2LIRA 1LTGC 2P2UA 4HH2A 2I1JA 2WSSH 5APWA 1LT9A 2WSEJ 2C9XB 3B5NC 1VPCA 4KJMA 2GUSA 4H44B 3CCRP 1M70A 1FZCB 2FYUK 1SFCC 3TYYA 4AYCA 4KT0J 1L0NK 2HPCA 4GIFA 1YQ3C 3M9QA 1YCCA 4H44C 3FX0A 2R44A 1IFIA 4BRYB 3H1JD 4PJ0H 1SQBG 2JR8A 2W6AA 2KNCA 1BGYD 4KHXA 1FJKA 2W83C 2B10B 1KYOH 3CC2P 2J58A 4RO0A 5CCHD 1NAYA 2M5AA 1ZR4A 2A45I 4D6TJ 4EIJA 1KQGB 2NPSA 1A02F 2YKOA 3O0RC 2JDIH 4O9BA 3SFDC 1JY2N 1IZNB 2WSEH 2Y0EA 1UIXA 2E43A 3TYIA 1KQLA 3Q3DA 1QL1A 1OVUA 3HE4B 3H1KJ 1USEA 5CIHB 2ZT9B 2YCCA 3VYIA 4H0KA 2H88C 3K5BA 2K9JA 1M1JA 1PGQA 2BCCG 1NGMB 1SQXE 1SQBJ 1T2KD 5KKZC 4Q5PA 1TU3F 2K9YA 1KB9I 2YXRB 1OAEA 2KZIA 1DW0A 5DFSA 5E79H 2JWDA 4L3HA 4BWNA 1AOFA 2WPRA 2G3AA 1R8EA 2E5TA 5EFWB 2QJKB 1OWAA 1GMJA 1H32A 1W2LA 3M9HA 2P58A 1EZVE 1Y47A 2R3SA 1CEDA 2XU6A 2BPBB 2ZOOA 3GHGB 4GODA 3BRTB 5BU8B 2KSEA 2P1JA 3TNUA 3HE5A 3PLNA 1YTCA 3IR9A 2E76C 1PZQA 4FA9A 4L75A 5KTBA 1RF0C 2QJYC 3KYQA 1RF1C 4O1QA 4EI2A 3RLMA 3Q2YA 1CXCA 1K9MQ 3SWYA 3S9OA 1DEBA 2OGUA 1COTA 5C0ZA 2B89A 5APTA 1EQ7A 1NO4A 2OTLP 2JTIB 2FBWC 1AVOA 1VQ6P 3MHVA 2Q1KA 2NPSD 1SQXK 3SVWA 1HCMA 1IK9A 3S1KA 3R4YA 3M0DC 1RE3A 3RK2B 1H33A 1NU1J 3L70E 3FWNA 1Q90D 1M1JB 3S4RA 3AEBC 5DJTB 3M97X 2M0BA 4IFFA 1E8EA 1PP9G 1OW6A 2BEZF 1SQXJ 1MG2D 1OMIA 1K04A 1BCCD 1HZUA 1VQ5P 1KX7A 1AVYA 2FFDC 4DT0A 1SQBD 3C8VA 1H31B 3H1LG 1J1EB 3AE5C 1CTZA 5DJUB 2Y9YA 1N73A 2HLOA 4PD4D 1JY3N 2QG4A 2FXMA 3OA8A 1G2CB 2N1TC 3CX5H 3TGUG 1N90A 1CHIA 2HPCB 1PP9E 2O1JA 4H0JA 1KYOE 5AW5B 1DW2A 1KD1Q 5CHXA 3GLMA 1CTYA 2PP6A 1BDDA 3P8CD 1L2PA 1M1KQ 1GKSA 1JMMA 1NH4A 3VP9A 1LT9B 2JEEA 1VQMP 1BE3G 3A0BH 3PHLA 1NJIQ 2CA3B 3X39A 3H1KD 3JBTB 1H9XA 1IFMA 2C0XA 2N3BA 1ZZHA 5B66V 2WTYA 1ZLLA 2PCBB 2OYIA 3U1CA 5APXA 5AW8B 3RN1A 4FAVA 1U7MA 4ZKUA 3AE7C 4H13C 1HUCA 3RBXA 1YITP 1FI7A 1JTHA 1JO5A 1IFDA 5AVSB 5GTHH 1ZW0A 3E1IA 1BGYE 2BASA 3L4MA 5E79E 2K9JB 1IQCA 3WFBC 4ASVA 1K3GA 351CA 3CXHW 2KIKA 3GG2A 1HJ3A 1CC5A 3IAOA 4K35A 2KXPB 2E42A 1NKNA 1DW1A 1KB9D 3E1RA 3B5NA 3SWSA 3H1JE 1VQKP 1RY3A 451CA 2Q7CA 3B8EB 2O1KA 1EXJA 3CX5W 3JCUE 2OYIC 4L3GA 1NTKE 4DY9A 1JNMA 4KMGA 1KN7A 5GTIH 3G9RA 3HTKA 4P4QB 5IY51 4U3FE 2ZYDA 1XTGB 1SQPD 4PW9B 1FI9A 1RQVA 4UB8H 2H8PD 3RK3B 2B88A 3H1IG 2ZVOB 4L1QA 1A2SA 1J3SA 3VTPC 1GDVA 3GF7A 2FYUJ 1ZOYC 2OZ1A 1BGYG 1K73Q 1QYZA 1IFPA 1FZCA 4WQ9A 2FKWB 1FDIA 2W27A 1W2EA 2I1KA 4IL6X 3M91A 1SQVE 2YK3A 1FJPA 1IZL0 3P7KA 1P84I 2IBZE 2CE0A 3RK2C 5C9MA 3CX5E 1DIPA 4IOIH 2E76D 3UIAA 1NHLA 1BCCJ 1L4AB 1HGZA 4N78E 4EIFA 1BSNA 3CMEP 3I55P 1RZ6A 1U75B 3O1YA 1NTKG 3H1IJ 3TK1A 1FOCA 3TDKA 3AEDC 3C1LA 1CRIA 1SQPJ 4PD4E 3CI9A 1HRCA 1H8AA 1ZRTE 4O1WA 1L0NE 1Z56A 3ITKA 3VMXA 1GJQA 1C7MA 4EIEA 1AJYA 1Q82Q 1NU1K 1VQ7P 1BE3E 2FRCA 3WU2H 3CX5D 2GB8B 2MHMA 1CSVA 3HQ8A 1RF1B 3MUDC 1AQ5A 3H1JJ 4HKZH 5AVWB 1G2CA 4XXLA 1SQBK 5KLVE 2KI7B 1LT9C 3V6IA 3ORVA 3AECC 1DX7A 5BU5A 1CORA 3RMZA 1FOSF 1IRVA 4DOJA 3ZOWA 3HE5B 4UB8V 1MV8A 1JMBA 4ZMDA 3MUDA 2OTKE 5GTHV 1R5SA 1UIIA 5AVVB 1SFCA 4HYTB 2IBZG 3ABVC 3L72J 1CTJA 1DD3A 1LS9A 4PJ0V 2FWLA 3B71A 4NFGB 4DJGA 1EZVD 2A06E 3AE4C 1JDLA 1H0TA 5AW0B 4YPCA 4PJ0E 1DW3A 2WZ7A 3DMIA 2P7JA 2KS1B 1RE3C 3CCQP 3H1JG 5DJQC 1F1CA 2RN0A 1YTZT 3GW6A 3HUSB 1GL2C 3EQ2A 3CWBJ 1H33B 2WWWA 1YJNP 2C9LY 3AE1C 1CO6A 1QL2A 2PACA 1X79B 1T6AA 2PFXA 1R0QA 1KTMA 1CRJA 2Z5HA 1SVFA 1VF5D 3SJLA 1CRCA 1DH3A 1FZAA 2AI5A 4I2LC 1KFMA 2IZ0A 1H31A 2K37A 1X0TA 1D7MA 1NTZK 2CA4B 3ZOXA 3O5CA 3CMAP 3VP8A 2N9IA 4NPFX 3BCCE 2D2CB 5AW7B 3CYTI 3USSA 1IFJA 1KZUB 4UB6E 3VNWA 5KLIB 3CX5I 4EIDA 1G1IA 3L75D 1OXZA 2GC4D 3L71G 3KZIE 2E75B 5KAIE 1NIRA 1NTZE 5AVTB 3TF5A 1MKMA 3HTKB 2QJPB 5CCGA 4GOFA 3H1KE 3RGUA 2NPSB 2C1DA 1LGHB 1LT1A 4RESB 4V2KA 4WQ7A 155CA 2XDJA 2Z5IA 2CE1A 5CJ4A 1CRHA 4AANA 2KP8A 1AOQA 1I8OA 1SP4A 2SPZA 3AE2C 4QAOA 3OA7A 1AYGA 3ZCFA 4N6JA 3WFDC 3CWBD 1F1FA 2KYVA 2OYHC 1S9KE 1CNOA 2ZXEB 1NTZG 2RMZA 3D71A 1KQFB 1L0LD 2IBZI 2JQRA 1FS0E 2B4ZA 4H0LC 2ZFCA 3ZOYA 2P10A 3L73D 1N50A 3AE9C 2AEJA 3BCCG 4OGQC 3OAKA 1OX3A 1G1JA 1HTLC 2YNYA 2KLVA 1MZ4A 3C9IA 5C39A 1SQBE 4PD4H 1KYOW 1SLQA 4HJGH 5CCHA 1FHBA 3L35A 3N4XA 1FDOA 1QKSA 4PD4I 4UB6V 2RKLA 2KUBA 4D6TG 1H9YA 1E79H 3H1KG 4NPEA 2L5GB 2KLUA 1PPJD 3V2QA 3F89A 4WQEA 4ZKPA 1LFMA 3HE4A 1KMIZ 2RH0A 3EWKA 5GTIV 4A7PA 3M06A 3L73E 2VRSA 1DEEG 3MIWA 1U7JA 2C9NY 5TJHA 1YTZI 1C52A 4RJTA 3WU2V 5H2FE 1CW5A 1KILA 3I5CA 1GW3A 3CC4P 3WUVA 1NTMD 2MJZA 2QE7H 2Y0DA 2BCCJ 5CIFB 1FZEA 2QM7A 3CXHD 1OW8A 1NU1E 4U7JA 5K5GB 1YICA 2PRRA 1K8AQ 1FBMA 1N7LA 4PV1B 1VQ4P 1X9VA 1FE6A 2B0ZB 1NKZB 3TGUE 1HWTC 5CCGD 3PXSA 4WY4C 3WUTA 1NVOA 5CIEB 3RK3D 2ZAEB 2KNCB 1GQ1A 1KV9A 2L91A 3QWOC 2Q3IA 3SFEC 3A0BE 1N15A 1NYHA 2CPSA 3TSIA 3H32B 1J1DB 1N86A 3N7NA 2OTJP 1LC1A 2WPQA 2WSFJ 1KIBA 2IYPA 1HJ0A 1RH5B 1CCRA 4CPGA 2YIUB 3V2NA 3PTZA 4EYYQ 4QMAA 4IL6E 1RE4C 2ZXYA 1M7LA 3VYMA 3A5TA 3HD7B 1NU1G 1SQVD 2N9JA 3JCUH 1JB0J 3ZDMA 2HG5D 3MZWB 4L76A 3GF3A 1T8ZA 5CJ0A 1PP9J 5GTIE 4EICA 3ZBMA 1KILE 1CSBA 1W5CE 3AEEC 5AVQB 5B66E 1HBWA 2B12B 2AIUA 1N9CA 2Y0CA 2OARA 1KILB 5APYA 3QH9A 1XTCC 1C6SA 1BSHA 1ZR2A 5DJQB 1N7SB 3SWFA 2I8DA 3D70A 1QVFO 3VMZA 1SQXG 1CYIA 3AEAC 1NNOA 2I8FA 3W68A 2FY8A 4JBZA 2PCCB 1OW7A 1S5LE 3CCEP 1KC8Q 3TGUJ 1CCHA 2R32A 4IL6H 2OYHB 1GU4A 3H1LJ 5AVYB 1LNQA 2YMKA 1CI6B 1FC2C 2O3JA 4YXDC 2AXCA 4RSZA 2E75D 3CCMP 5KLVD 1LTJC 3HUSA 4XE5B 4YXWH 1I8PA 2IZ1A 1SQPK 4GEDB 2FYUG 1L4AC 1HGVA 2Y9ZA 2NPSC 1BGYJ 1CIFA 3HRNA 3L74G 3DP5A 2OYOA 2B11B 4H13B 4N0KA 2E5YA 2ITAA 2LXBA 1ZXGA 5CBOA 3SSUA 5BVZA 2KSJA 3P8MC 3AE6C 1CI6A 1YEAA 3V2RA 4N3YB 1PP9D 2K88A 1I5TA 1S5LH 2HYNA 2D0SA 1E2RA 1QLED 1QL3A 5AURA 2B87B 1NTKJ 2ZYAA 2YIUC 1KILC 4WQAA 1VL2A 1I6EA 1PIXA 1YIJP 5B5EV 3PXTA 5KJ7A 1PPJE 4FANA 1SQPG 3RK3E 1QEXA 1SQVJ 2C1DB 1SFCB 3NFQA 2MTAC 2AEMA 2Q9IA 3L74J 2O01N 2C1UA 3HUSC 5CICB 1QX8A 1LTAC 1LTIC 1EB7A 1RZ5A 3LW5H 2ZT9C 1L0LK 3B5NB 3B5ND 2FYUE 4JQ0D 3GHGA 3H1HG 1PGJA 1OIPA 1NTME 2E74C 1WEJF 4W80A 4WBAA 3PP5A 1SQPE 2N3YA 2KZJA 1PGPA 3H1LE 3L75G 3O6QA 3D6ZA 5AW6B 4BRYA 2HODB 1ZMEC 2N1TA 3NMDA 3KHUA 3LIDA 2GIWA 4K3AA 5AW9B 1SQVG 1S5LV 5KLVJ 1GW4A 1ZV8A 3H1IE
chains in the Genus database with same CATH topology
1H31A 4MU8A 2CA4B 3ZOXA 3O5CA 1CIGA 1OCDA 2HV4A 4YE1A 2DGEA 2QJKB 3HQ6A 1E29A 3H1ID 2N9IA 1H32A 1W2LA 3CYTI 2Q3EA 4WQCA 5CIBB 1CEDA 4FA4A 2BPBB 1W5CT 2ZOOA 3VNWA 5KLIB 1NTZD 4EIDA 5B6QA 2BCCD 3L75D 2GC4D 1YTCA 3PLNA 1K3HA 1NIRA 3TF5A 3HQ9A 1MG3D 2QJPB 4FA9A 1C2RA 1U74B 2C1DA 3BCCD 4O1QA 4V2KA 3RLMA 1CSUA 4WQ7A 1YFCA 155CA 1CXCA 2CE1A 1CRHA 4AANA 1AOQA 1I8OA 3VMAA 2V07A 2ORLA 4QAOA 5KAFV 1VYDA 5TISV 2C1VA 1COTA 5C0ZA 1AYGA 3ZCFA 1DVHA 2JTIB 3SXTA 3WFDC 3CWBD 1F1FA 1CNOA 2BCNB 2L4DA 2RMZA 5DF5A 1CIEA 3SVWA 1L0LD 2JQRA 1HCMA 3L71D 5CIDB 2B4ZA 1H33A 1KYOD 3NBSA 1GIWA 3ZOYA 3L73D 1KB0A 1N50A 3M97X 2ZONG 1E8EA 3NBTA 3MK7C 1MZ4A 1MG2D 2C2CA 2DVHA 2A06D 1BCCD 1HZUA 5H2FV 1KYOW 1FHBA 2XTSB 1L9BC 2BH5X 1KX7A 1CYCA 1QKSA 4UB6V 1SQBD 1H31B 1FI3A 1DVVA 1H9YA 1C2NA 1CTZA 1FJ0A 1I55A 4AAOA 4U3FD 4PD4D 1BL9A 2QG4A 3OA8A 1PPJD 1NMIA 4AAMA 1NU1D 1N90A 1CHIA 1NTKD 2KS1A 3CU4A 4WQEA 1LFMA 4J20A 1FCDC 1P84D 1CRGA 2N18C 5GTIV 4A7PA 3PH2B 4H0JA 2C8SA 1DW2A 4Y5RA 3FWLA 5TJHA 1CHJA 1C52A 4RJTA 3HQ7A 3L72D 3WU2V 1CTYA 3WUIA 4WQ8A 1I6DA 1NTMD 2Y0DA 1GKSA 1C6RA 5CIFB 3CXHD 3PHLA 1YICA 2CA3B 2B0ZB 3X39A 3H1KD 3JBTB 1H9XA 2N3BA 1ZZHA 2GC7D 3PXSA 5B66V 2PCBB 4LJIA 1LMSA 5KAIV 3RN1A 4FA5A 3KZIV 4WQBA 1H32B 5CIEB 4FAVA 1IRWA 1NMLA 2KNCB 1FI7A 1GQ1A 1KV9A 2L91A 1QN2A 1CRYA 3L4MA 1N15A 3O20A 1C75A 2K9JB 1IQCA 4FB1A 3WFBC 1LC2A 2N9YB 1H1OA 1K3GA 351CA 3CXHW 3GG2A 1LC1A 1HJ3A 1CC5A 1HJ4A 1ETPA 1KIBA 1YIQA 4FA1A 1KX2A 2FYNB 1CCRA 1DW1A 1DT1A 1KB9D 1L0ND 1ZRTD 2AXTV 2YIUB 2JWAA 3SWSA 3PTZA 4D6TD 2ZZS1 2FYUD 3PRJA 3A0HV 451CA 2YQBA 2ZXYA 3PXWA 2BH4X 3CX5W 4EDFA 3VYMA 3L74D 4L3GA 4DY9A 1DIQC 1BE3D 3TGUD 4IL6V 4KMGA 1SQVD 2N9JA 2ZBOA 4P4QB 5IY51 1HROA 4PWAA 3CP5A 1YNRA 4WQDA 1HJ5A 1SQPD 4PW9B 3ZBMA 4EICA 1FI9A 1IO3A 2B12B 2AIUA 3MK7B 1N9CA 2Y0CA 2IBZD 4L1QA 1A2SA 1J3SA 2LITA 1C6SA 1GDVA 5DJQB 1HZVA 3WFEC 2N18B 1CSWA 3ZIYA 2OZ1A 2CXBA 1RAQA 2OZ1B 1CYJA 1CYIA 2BLFB 1QYZA 1NNOA 2I8FA 4WQ9A 1S6VB 3H1HD 3WFCC 2PCCB 2BGVX 5E79V 1CCHA 3A0BV 3L4OA 5CYTR 3OA8B 1SQQD 2YK3A 3A9FA 1IZL0 3VRDA 3NWVA 3OCDA 2O3JA 3L70D 2CE0A 1CXAA 4RSZA 3WC8A 5CIGB 5C9MA 3RN0A 5KLVD 1AKKA 1WVEC 1I8PA 4GEDB 5EXQA 4EIFA 2QJYB 1B7VA 1CSXA 1RZ6A 1U75B 2LIRA 1CIFA 1L9JC 3O1YA 4AALA 1FOCA 3DP5A 3TDKA 2B11B 3SLEA 2C9XB 4N0KA 1CRIA 1HRCA 1A8CA 4GYDA 4O1WA 3ITKA 1GJQA 1QL4A 1C7MA 4EIEA 5KKZB 1M70A 1YEAA 1GU2A 2FRCA 3CX5D 1RAPA 2GB8B 2MHMA 1CSVA 1PP9D 1I5TA 3HQ8A 2D0SA 1YCCA 1E2RA 1QL3A 5AURA 4AX3A 4XXLA 3H1JD 3DR0A 2V08A 3ORVA 1A56A 1CORA 4WQAA 1BGYD 3RMZA 1I6EA 1IRVA 2B10B 3ZOWA 5B5EV 4K3IA 3PXTA 4UB8V 4FANA 5GTHV 2C1DB 3O0RC 2MTAC 1CTJA 1LS9A 4PJ0V 3ZOOA 1CHHA 1M6ZA 2C1UA 1YEBA 5CICB 1EB7A 1RZ5A 2VHDA 2Y0EA 1I54A 2FWLA 4XYDB 4JCGA 1SQXD 4NFGB 3TYIA 1EZVD 2EXVA 1JDLA 1DW3A 3C2CA 1CIHA 3DMIA 3OCDB 5CIHB 1C6OA 1WEJF 1DIIC 5DJQC 2YCCA 1F1CA 2RN0A 4H0KA 2N3YA 3GW6A 2D0WA 1M60A 1H33B 4Q5PA 1HH7A 1OAEA 1CO6A 2PACA 3KHUA 1DW0A 5DFSA 2GIWA 1R0QA 1CRJA 3SJLA 1CRCA 1S5LV 4L3HA 1AOFA 3H1LD 2AI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H31 A;  4MU8 A;  2CA4 B;  3ZOX A;  3O5C A;  1CIG A;  1OCD A;  2HV4 A;  4YE1 A;  2DGE A;  2QJK B;  3HQ6 A;  1E29 A;  3H1I D;  2N9I A;  1H32 A;  1W2L A;  3CYT I;  2Q3E A;  4WQC A;  5CIB B;  1CED A;  4FA4 A;  2BPB B;  1W5C T;  2ZOO A;  3VNW A;  5KLI B;  1NTZ D;  4EID A;  5B6Q A;  2BCC D;  3L75 D;  2GC4 D;  1YTC A;  3PLN A;  1K3H A;  1NIR A;  3TF5 A;  3HQ9 A;  1MG3 D;  2QJP B;  4FA9 A;  1C2R A;  1U74 B;  2C1D A;  3BCC D;  4O1Q A;  4V2K A;  3RLM A;  1CSU A;  4WQ7 A;  1YFC A;  155C A;  1CXC A;  2CE1 A;  1CRH A;  4AAN A;  1AOQ A;  1I8O A;  3VMA A;  2V07 A;  2ORL A;  4QAO A;  5KAF V;  1VYD A;  5TIS V;  2C1V A;  1COT A;  5C0Z A;  1AYG A;  3ZCF A;  1DVH A;  2JTI B;  3SXT A;  3WFD C;  3CWB D;  1F1F A;  1CNO A;  2BCN B;  2L4D A;  2RMZ A;  5DF5 A;  1CIE A;  3SVW A;  1L0L D;  2JQR A;  1HCM A;  3L71 D;  5CID B;  2B4Z A;  1H33 A;  1KYO D;  3NBS A;  1GIW A;  3ZOY A;  3L73 D;  1KB0 A;  1N50 A;  3M97 X;  2ZON G;  1E8E A;  3NBT A;  3MK7 C;  1MZ4 A;  1MG2 D;  2C2C A;  2DVH A;  2A06 D;  1BCC D;  1HZU A;  5H2F V;  1KYO W;  1FHB A;  2XTS B;  1L9B C;  2BH5 X;  1KX7 A;  1CYC A;  1QKS A;  4UB6 V;  1SQB D;  1H31 B;  1FI3 A;  1DVV A;  1H9Y A;  1C2N A;  1CTZ A;  1FJ0 A;  1I55 A;  4AAO A;  4U3F D;  4PD4 D;  1BL9 A;  2QG4 A;  3OA8 A;  1PPJ D;  1NMI A;  4AAM A;  1NU1 D;  1N90 A;  1CHI A;  1NTK D;  2KS1 A;  3CU4 A;  4WQE A;  1LFM A;  4J20 A;  1FCD C;  1P84 D;  1CRG A;  2N18 C;  5GTI V;  4A7P A;  3PH2 B;  4H0J A;  2C8S A;  1DW2 A;  4Y5R A;  3FWL A;  5TJH A;  1CHJ A;  1C52 A;  4RJT A;  3HQ7 A;  3L72 D;  3WU2 V;  1CTY A;  3WUI A;  4WQ8 A;  1I6D A;  1NTM D;  2Y0D A;  1GKS A;  1C6R A;  5CIF B;  3CXH D;  3PHL A;  1YIC A;  2CA3 B;  2B0Z B;  3X39 A;  3H1K D;  3JBT B;  1H9X A;  2N3B A;  1ZZH A;  2GC7 D;  3PXS A;  5B66 V;  2PCB B;  4LJI A;  1LMS A;  5KAI V;  3RN1 A;  4FA5 A;  3KZI V;  4WQB A;  1H32 B;  5CIE B;  4FAV A;  1IRW A;  1NML A;  2KNC B;  1FI7 A;  1GQ1 A;  1KV9 A;  2L91 A;  1QN2 A;  1CRY A;  3L4M A;  1N15 A;  3O20 A;  1C75 A;  2K9J B;  1IQC A;  4FB1 A;  3WFB C;  1LC2 A;  2N9Y B;  1H1O A;  1K3G A;  351C A;  3CXH W;  3GG2 A;  1LC1 A;  1HJ3 A;  1CC5 A;  1HJ4 A;  1ETP A;  1KIB A;  1YIQ A;  4FA1 A;  1KX2 A;  2FYN B;  1CCR A;  1DW1 A;  1DT1 A;  1KB9 D;  1L0N D;  1ZRT D;  2AXT V;  2YIU B;  2JWA A;  3SWS A;  3PTZ A;  4D6T D;  2ZZS 1;  2FYU D;  3PRJ A;  3A0H V;  451C A;  2YQB A;  2ZXY A;  3PXW A;  2BH4 X;  3CX5 W;  4EDF A;  3VYM A;  3L74 D;  4L3G A;  4DY9 A;  1DIQ C;  1BE3 D;  3TGU D;  4IL6 V;  4KMG A;  1SQV D;  2N9J A;  2ZBO A;  4P4Q B;  5IY5 1;  1HRO A;  4PWA A;  3CP5 A;  1YNR A;  4WQD A;  1HJ5 A;  1SQP D;  4PW9 B;  3ZBM A;  4EIC A;  1FI9 A;  1IO3 A;  2B12 B;  2AIU A;  3MK7 B;  1N9C A;  2Y0C A;  2IBZ D;  4L1Q A;  1A2S A;  1J3S A;  2LIT A;  1C6S A;  1GDV A;  5DJQ B;  1HZV A;  3WFE C;  2N18 B;  1CSW A;  3ZIY A;  2OZ1 A;  2CXB A;  1RAQ A;  2OZ1 B;  1CYJ A;  1CYI A;  2BLF B;  1QYZ A;  1NNO A;  2I8F A;  4WQ9 A;  1S6V B;  3H1H D;  3WFC C;  2PCC B;  2BGV X;  5E79 V;  1CCH A;  3A0B V;  3L4O A;  5CYT R;  3OA8 B;  1SQQ D;  2YK3 A;  3A9F A;  1IZL 0;  3VRD A;  3NWV A;  3OCD A;  2O3J A;  3L70 D;  2CE0 A;  1CXA A;  4RSZ A;  3WC8 A;  5CIG B;  5C9M A;  3RN0 A;  5KLV D;  1AKK A;  1WVE C;  1I8P A;  4GED B;  5EXQ A;  4EIF A;  2QJY B;  1B7V A;  1CSX A;  1RZ6 A;  1U75 B;  2LIR A;  1CIF A;  1L9J C;  3O1Y A;  4AAL A;  1FOC A;  3DP5 A;  3TDK A;  2B11 B;  3SLE A;  2C9X B;  4N0K A;  1CRI A;  1HRC A;  1A8C A;  4GYD A;  4O1W A;  3ITK A;  1GJQ A;  1QL4 A;  1C7M A;  4EIE A;  5KKZ B;  1M70 A;  1YEA A;  1GU2 A;  2FRC A;  3CX5 D;  1RAP A;  2GB8 B;  2MHM A;  1CSV A;  1PP9 D;  1I5T A;  3HQ8 A;  2D0S A;  1YCC A;  1E2R A;  1QL3 A;  5AUR A;  4AX3 A;  4XXL A;  3H1J D;  3DR0 A;  2V08 A;  3ORV A;  1A56 A;  1COR A;  4WQA A;  1BGY D;  3RMZ A;  1I6E A;  1IRV A;  2B10 B;  3ZOW A;  5B5E V;  4K3I A;  3PXT A;  4UB8 V;  4FAN A;  5GTH V;  2C1D B;  3O0R C;  2MTA C;  1CTJ A;  1LS9 A;  4PJ0 V;  3ZOO A;  1CHH A;  1M6Z A;  2C1U A;  1YEB A;  5CIC B;  1EB7 A;  1RZ5 A;  2VHD A;  2Y0E A;  1I54 A;  2FWL A;  4XYD B;  4JCG A;  1SQX D;  4NFG B;  3TYI A;  1EZV D;  2EXV A;  1JDL A;  1DW3 A;  3C2C A;  1CIH A;  3DMI A;  3OCD B;  5CIH B;  1C6O A;  1WEJ F;  1DII C;  5DJQ C;  2YCC A;  1F1C A;  2RN0 A;  4H0K A;  2N3Y A;  3GW6 A;  2D0W A;  1M60 A;  1H33 B;  4Q5P A;  1HH7 A;  1OAE A;  1CO6 A;  2PAC A;  3KHU A;  1DW0 A;  5DFS A;  2GIW A;  1R0Q A;  1CRJ A;  3SJL A;  1CRC A;  1S5L V;  4L3H A;  1AOF A;  3H1L D;  2AI5 A; 
#chains in the Genus database with same CATH topology
 1USD A;  2XND H;  4M3L A;  1OCD A;  4YE1 A;  5KAF H;  3HQ6 A;  3Q5P A;  1PPJ G;  1W2B O;  3CWB G;  2D2C D;  2Q3E A;  3LW5 J;  5CIB B;  1JCD A;  1QGK B;  1NTZ D;  3MD0 A;  3BRV B;  2O01 J;  4YTP C;  1YYC A;  3V4Q A;  4IFD K;  2QA4 P;  1K3H A;  1L0N G;  2ZYG A;  1Y8A A;  3IFM A;  3HQ9 A;  1EDI A;  1MG3 D;  3A3Y B;  3L75 J;  3L4F A;  1KV4 A;  1NTM G;  2B9B A;  4DZO A;  1U74 B;  1JY3 O;  4XFJ A;  3BCC D;  3WMM 0;  5CMZ A;  1X8Y A;  1KQS O;  1H89 A;  1WMK A;  3V4W A;  5KAF V;  2O01 H;  4IFM A;  1VYD A;  1N73 B;  3U59 A;  4OGQ D;  5KLV G;  2C1V A;  3L72 E;  4AUW A;  3Q1M A;  5APU A;  5KAF E;  2BCN B;  2Q5U A;  5APV A;  3KZI H;  2L4D A;  3VOP A;  1DD4 A;  4WY4 A;  2V7Q J;  4I7Z C;  1S2E A;  1GDT A;  3L71 D;  2WSC J;  4PV1 C;  5CID B;  2A45 G;  1KYO D;  1GIW A;  1URQ A;  1R5L A;  5GTH E;  2QM8 A;  4B86 A;  4OGQ B;  2M3B A;  3RL0 B;  3MK7 C;  2W90 A;  1MFT A;  3L72 G;  2A06 D;  1M1J C;  5H2F V;  1SFC D;  1AA0 A;  1SQQ G;  2XTS B;  1L9B C;  2BH5 X;  3CL3 D;  2N1T B;  3H25 A;  1FI3 A;  3M0A A;  1NTZ J;  1DVV A;  2GA1 A;  1VQO P;  1FJ0 A;  4JF7 A;  4AAO A;  4U3F D;  1FAV A;  2QEX P;  4AAM A;  1NU1 D;  1NTK D;  1JUN A;  4J20 A;  2AXT E;  1FCD C;  3BCC J;  1CRG A;  2N18 C;  3PH2 B;  2WPS A;  3FXD A;  3G3Z A;  1L4A D;  2C8S A;  1VQ9 P;  4Y5R A;  3FWL A;  4OWF A;  5B66 H;  5AW1 B;  3HQ7 A;  3CLQ A;  1LP1 A;  1HH0 A;  2FYZ A;  4WB4 A;  1S5L X;  1I6D A;  3A0H H;  1C6R A;  2WPV B;  1SQQ J;  4H0L D;  1VQ8 P;  1LTJ B;  1GD2 E;  1SQQ K;  3D6Y A;  1WT6 A;  1JM0 A;  2GC7 D;  4LLH A;  3PH0 A;  5AVU B;  2UWJ E;  1LMS A;  2A45 H;  1H32 B;  4Y28 J;  2KB7 P;  4JYC A;  1SS1 A;  1MZ9 A;  2M8R A;  2OQQ A;  3OJA B;  1RHZ B;  3R2P A;  2QJP C;  3E7K A;  4R4L A;  3O20 A;  4JPZ B;  1FZF A;  1HF9 A;  3II6 A;  2GM4 A;  3CXH H;  2N9Y B;  1H1O A;  3L71 J;  4XA4 A;  1Y9B A;  1HJ4 A;  1ZP0 C;  4FA1 A;  2HOD A;  2FYN B;  2AXT V;  1DT1 A;  1L0N D;  1ZRT D;  4TLF A;  2JWA A;  4Z1M H;  4GDO A;  2JJL A;  4W7Z A;  5KLI C;  4D6T D;  3CPW O;  2FYU D;  1YJ9 P;  2YQB A;  1GL2 B;  3TNU B;  1M8O B;  1EXI A;  2AEF A;  1N8R Q;  4EDF A;  3L74 D;  3V5B A;  4N78 D;  1DIQ C;  3MGN A;  3VN0 A;  3NTN A;  1HRO A;  4PWA A;  3RK2 D;  5KJ7 C;  5APQ A;  1NOH A;  2CK3 H;  1YNR A;  4WQD A;  2YKQ A;  1HJ5 A;  3Q5S A;  1EDK A;  4EOT A;  5AW3 B;  5KLV K;  3G71 P;  4H13 D;  3O8Z A;  3G4S P;  3H32 A;  1LTT C;  3FXE A;  2YO3 A;  4NPD A;  2CXB A;  2BCC E;  1YQ4 C;  2BLF B;  4ZNC A;  1S6V B;  5CCG C;  3H1H D;  1JY2 P;  1JEK A;  1PGO A;  1Q2N A;  1VQP P;  2QRX A;  3A0B V;  3L4O A;  4OH8 B;  2ZXX A;  2FXO A;  5CYT R;  3OA8 B;  3B4S A;  3GHG C;  1SQQ D;  3A9F A;  4UB6 H;  1EDL A;  4OVN F;  3CCS P;  1S72 P;  5CIG B;  4I6M C;  2BEQ D;  5TIS H;  1PV3 A;  1AKK A;  1LWU C;  5KAI H;  2FFD A;  2AXT H;  5B5E H;  3CCU P;  3GMA A;  2WVR A;  1IC2 A;  2W6J H;  2QJY B;  1B7V A;  1CSX A;  4LC1 A;  1L9J C;  4AAL A;  1SQV K;  4C46 A;  1LJ2 A;  3SLE A;  1KIL D;  1L0L G;  3L71 E;  1N73 C;  1A8C A;  1KB9 H;  4GYD A;  1Q7Y Q;  1QL4 A;  5KKZ B;  2LXC B;  1T2K C;  1NTK K;  1YBK A;  1FZC C;  1GU2 A;  4WY4 B;  1RAP A;  1QVG O;  1KOR A;  4GOE A;  3JC2 2;  1P84 H;  2OYH A;  2WMM A;  1IK7 A;  1MFZ A;  3VMY A;  3BVH A;  2WSF H;  2E74 D;  4AX3 A;  3DR0 A;  1K05 A;  1BDC A;  1N2D C;  2V08 A;  2YKP A;  1A56 A;  1CZQ A;  1URQ C;  2Q6Q A;  4TT3 H;  2ZT9 D;  4K3I A;  1ZN5 A;  4C7N A;  3KPE A;  1VF5 B;  1S3J A;  3T97 A;  3HD7 A;  1J1D C;  4L74 A;  1M90 Q;  1RF0 A;  3ZOO A;  1CHH A;  1M6Z A;  3IN6 A;  2K3R A;  5APS A;  3L70 G;  1YEB A;  1L0L J;  2VHD A;  1T3J A;  3MTU E;  1I54 A;  4XYD B;  4JCG A;  1AFO A;  1SQX D;  2EXV A;  1OFC X;  2QVA A;  5AW2 B;  4I7Z B;  1NWQ A;  3C2C A;  1CIH A;  3OCD B;  2ZVN B;  1C6O A;  2XKM A;  2G8Y A;  1DII C;  1P84 E;  1LWU B;  2FFD B;  1EZV I;  2D0W A;  1M60 A;  2HFE D;  5CCH C;  3EFF K;  3CCV P;  2IFM A;  1BE3 J;  1YHQ P;  3O6Q B;  4GT1 A;  1HH7 A;  3EFG A;  1FOS E;  5H2F H;  1WRG A;  3BAT A;  3H1L D;  1GK6 A;  1HJB A;  5AVZ B;  4MU8 A;  3L70 J;  1CIG A;  2HV4 A;  3HD7 D;  2DGE A;  1FU1 A;  3A2A A;  4MN4 C;  5CBN A;  1E29 A;  3H1I D;  2R5B A;  2WT7 B;  1KYO I;  2W6B A;  2Z4E A;  1EC5 A;  4WQC A;  2LR2 A;  4FA4 A;  3A7O A;  1W5C T;  4I1L A;  1RQU A;  3JSV C;  3U1A A;  2J5U A;  5B6Q A;  2BCC D;  5AW4 B;  4C7N B;  3AEF C;  1GL2 D;  2IX7 C;  1J1E C;  3AE8 C;  2CPB A;  5AVX B;  1C2R A;  1GU5 A;  4BXL A;  3LIE A;  3CC7 P;  3A0H E;  1M57 D;  1CSU A;  3KDP B;  1YFC A;  3P32 A;  1URQ D;  3CCL P;  2J59 M;  2R5D A;  3VMA A;  2V07 A;  2ORL A;  1KFN A;  3CWB E;  5TIS V;  4PV1 D;  1OZH A;  4Y99 B;  1DVH A;  3WU2 E;  3SXT A;  3L74 E;  1JTH B;  2GUV A;  1L0L E;  1LTB C;  3KXD A;  4U3F G;  3MP7 B;  1KB9 E;  1N7S D;  2NRG A;  1VQL P;  5DF5 A;  1CIE A;  1M56 D;  5TIS E;  3AE3 C;  1VF5 C;  3I56 P;  1NTM J;  2IFN A;  5B5E E;  3NBS A;  2E75 C;  1KB0 A;  1RE4 A;  2K1A A;  3D0W A;  1FZG A;  2XZR A;  3KQG A;  3RBZ A;  2ZON G;  1J2J B;  1EDJ A;  1PL5 A;  3NBT A;  5KJ7 D;  3M0D A;  2C2C A;  2DVH A;  2LKM A;  3OW2 O;  1GL2 A;  4L73 A;  4WY4 D;  1OVR A;  2XV5 A;  1L4A A;  3WUU A;  1CYC A;  1U57 A;  1JY3 P;  1LTJ A;  1FZB A;  2ZJS E;  2V7Q H;  1S9K D;  1GK4 A;  2H43 A;  1C2N A;  2E74 B;  3L75 E;  1I55 A;  3Q5R A;  2WQY C;  1BL9 A;  2B87 A;  1NMI A;  3CD6 P;  4Y99 C;  4U3F J;  1IFN A;  3CU4 A;  2KS1 A;  1P84 D;  3V2P A;  4DCK A;  2D2C C;  4R4M A;  1RF1 A;  2JKV A;  3H1H J;  4JYB A;  3RL0 D;  1H88 A;  1Q81 Q;  3HD7 C;  1N7S A;  1CHJ A;  2DW3 A;  2IDB A;  2HR3 A;  3L72 D;  5L8R J;  2V4H A;  3WUI A;  1BCC G;  2N1T D;  4WQ8 A;  1A02 J;  2FXP A;  3AEG C;  2N9B A;  4HB1 A;  1JCC A;  2H7H A;  2FYN C;  2JO1 A;  4LGD E;  4RKU J;  4ASW A;  4W7Y A;  2E76 B;  1JY2 O;  2KK7 A;  1MUU A;  1OVV A;  4LJI A;  3CXH I;  5KAI V;  3NXS A;  4FA5 A;  4WWI A;  3KZI V;  4WQB A;  1LP1 B;  2WT7 A;  1IRW A;  3F5H A;  1NML A;  1BCC E;  2QIW A;  1NAF A;  2QSI A;  2YMY A;  1LTS C;  1QN2 A;  1CRY A;  1IO4 A;  2W8Z A;  2KOG A;  3IF4 A;  1AQT A;  1C75 A;  1N7S C;  4FB1 A;  1FDM A;  1LC2 A;  1LWU A;  2POH A;  1GTW A;  5AVR B;  1L0N J;  2A06 G;  1ETP A;  4UB8 E;  3L73 J;  1YIQ A;  1KX2 A;  2PGD A;  1H0T B;  2PAJ A;  3H6P A;  2QJK C;  4H44 D;  2ZZS 1;  1PFI A;  3PRJ A;  3A0H V;  3P8C E;  1JOC A;  3PXW A;  2BH4 X;  1VDF A;  2IYO A;  1GZL A;  2YO2 A;  2OYI B;  2P67 A;  2XNX A;  2WSC H;  3L36 A;  1Q86 Q;  1BE3 D;  3TGU D;  4IL6 V;  1SQQ E;  3PJS K;  2M5A B;  2ZBO A;  3RL0 g;  3CXH E;  3RL0 C;  4D6T E;  3CP5 A;  2JP3 A;  3H1H E;  1IO3 A;  3RK3 C;  1YJW P;  2YXQ B;  3MK7 B;  2IBZ D;  3T97 B;  4AQR D;  1HVV A;  2LIT A;  1T3U A;  3W67 A;  5M1B A;  1HZV A;  3WFE C;  2N18 B;  3BAS A;  1CSW A;  3ZIY A;  1AV1 A;  4WVZ A;  3CCJ P;  2MKV A;  3L73 G;  1RAQ A;  2OZ1 B;  1CYJ A;  1EZV G;  3M9B A;  1X22 A;  1E5W A;  1S4X A;  1YI2 P;  3WFC C;  2BGV X;  2IPP A;  5E79 V;  3FGA D;  2H89 C;  3SWK A;  2R3C A;  2C0W A;  1VQN P;  3VRD A;  3NWV A;  3OCD A;  3L37 A;  3L70 D;  1CXA A;  3WC8 A;  1S1C X;  4H0L B;  3RN0 A;  2WIT A;  2NZ2 A;  4GKG A;  4C7R A;  1WVE C;  1URQ B;  1NTM K;  5EXQ A;  1IJD B;  3G6E P;  2M3E A;  2LIR A;  1LTG C;  2P2U A;  4HH2 A;  2I1J A;  2WSS H;  5APW A;  1LT9 A;  2WSE J;  2C9X B;  3B5N C;  1VPC A;  4KJM A;  2GUS A;  4H44 B;  3CCR P;  1M70 A;  1FZC B;  2FYU K;  1SFC C;  3TYY A;  4AYC A;  4KT0 J;  1L0N K;  2HPC A;  4GIF A;  1YQ3 C;  3M9Q A;  1YCC A;  4H44 C;  3FX0 A;  2R44 A;  1IFI A;  4BRY B;  3H1J D;  4PJ0 H;  1SQB G;  2JR8 A;  2W6A A;  2KNC A;  1BGY D;  4KHX A;  1FJK A;  2W83 C;  2B10 B;  1KYO H;  3CC2 P;  2J58 A;  4RO0 A;  5CCH D;  1NAY A;  2M5A A;  1ZR4 A;  2A45 I;  4D6T J;  4EIJ A;  1KQG B;  2NPS A;  1A02 F;  2YKO A;  3O0R C;  2JDI H;  4O9B A;  3SFD C;  1JY2 N;  1IZN B;  2WSE H;  2Y0E A;  1UIX A;  2E43 A;  3TYI A;  1KQL A;  3Q3D A;  1QL1 A;  1OVU A;  3HE4 B;  3H1K J;  1USE A;  5CIH B;  2ZT9 B;  2YCC A;  3VYI A;  4H0K A;  2H88 C;  3K5B A;  2K9J A;  1M1J A;  1PGQ A;  2BCC G;  1NGM B;  1SQX E;  1SQB J;  1T2K D;  5KKZ C;  4Q5P A;  1TU3 F;  2K9Y A;  1KB9 I;  2YXR B;  1OAE A;  2KZI A;  1DW0 A;  5DFS A;  5E79 H;  2JWD A;  4L3H A;  4BWN A;  1AOF A;  2WPR A;  2G3A A;  1R8E A;  2E5T A;  5EFW B;  2QJK B;  1OWA A;  1GMJ A;  1H32 A;  1W2L A;  3M9H A;  2P58 A;  1EZV E;  1Y47 A;  2R3S A;  1CED A;  2XU6 A;  2BPB B;  2ZOO A;  3GHG B;  4GOD A;  3BRT B;  5BU8 B;  2KSE A;  2P1J A;  3TNU A;  3HE5 A;  3PLN A;  1YTC A;  3IR9 A;  2E76 C;  1PZQ A;  4FA9 A;  4L75 A;  5KTB A;  1RF0 C;  2QJY C;  3KYQ A;  1RF1 C;  4O1Q A;  4EI2 A;  3RLM A;  3Q2Y A;  1CXC A;  1K9M Q;  3SWY A;  3S9O A;  1DEB A;  2OGU A;  1COT A;  5C0Z A;  2B89 A;  5APT A;  1EQ7 A;  1NO4 A;  2OTL P;  2JTI B;  2FBW C;  1AVO A;  1VQ6 P;  3MHV A;  2Q1K A;  2NPS D;  1SQX K;  3SVW A;  1HCM A;  1IK9 A;  3S1K A;  3R4Y A;  3M0D C;  1RE3 A;  3RK2 B;  1H33 A;  1NU1 J;  3L70 E;  3FWN A;  1Q90 D;  1M1J B;  3S4R A;  3AEB C;  5DJT B;  3M97 X;  2M0B A;  4IFF A;  1E8E A;  1PP9 G;  1OW6 A;  2BEZ F;  1SQX J;  1MG2 D;  1OMI A;  1K04 A;  1BCC D;  1HZU A;  1VQ5 P;  1KX7 A;  1AVY A;  2FFD C;  4DT0 A;  1SQB D;  3C8V A;  1H31 B;  3H1L G;  1J1E B;  3AE5 C;  1CTZ A;  5DJU B;  2Y9Y A;  1N73 A;  2HLO A;  4PD4 D;  1JY3 N;  2QG4 A;  2FXM A;  3OA8 A;  1G2C B;  2N1T C;  3CX5 H;  3TGU G;  1N90 A;  1CHI A;  2HPC B;  1PP9 E;  2O1J A;  4H0J A;  1KYO E;  5AW5 B;  1DW2 A;  1KD1 Q;  5CHX A;  3GLM A;  1CTY A;  2PP6 A;  1BDD A;  3P8C D;  1L2P A;  1M1K Q;  1GKS A;  1JMM A;  1NH4 A;  3VP9 A;  1LT9 B;  2JEE A;  1VQM P;  1BE3 G;  3A0B H;  3PHL A;  1NJI Q;  2CA3 B;  3X39 A;  3H1K D;  3JBT B;  1H9X A;  1IFM A;  2C0X A;  2N3B A;  1ZZH A;  5B66 V;  2WTY A;  1ZLL A;  2PCB B;  2OYI A;  3U1C A;  5APX A;  5AW8 B;  3RN1 A;  4FAV A;  1U7M A;  4ZKU A;  3AE7 C;  4H13 C;  1HUC A;  3RBX A;  1YIT P;  1FI7 A;  1JTH A;  1JO5 A;  1IFD A;  5AVS B;  5GTH H;  1ZW0 A;  3E1I A;  1BGY E;  2BAS A;  3L4M A;  5E79 E;  2K9J B;  1IQC A;  3WFB C;  4ASV A;  1K3G A;  351C A;  3CXH W;  2KIK A;  3GG2 A;  1HJ3 A;  1CC5 A;  3IAO A;  4K35 A;  2KXP B;  2E42 A;  1NKN A;  1DW1 A;  1KB9 D;  3E1R A;  3B5N A;  3SWS A;  3H1J E;  1VQK P;  1RY3 A;  451C A;  2Q7C A;  3B8E B;  2O1K A;  1EXJ A;  3CX5 W;  3JCU E;  2OYI C;  4L3G A;  1NTK E;  4DY9 A;  1JNM A;  4KMG A;  1KN7 A;  5GTI H;  3G9R A;  3HTK A;  4P4Q B;  5IY5 1;  4U3F E;  2ZYD A;  1XTG B;  1SQP D;  4PW9 B;  1FI9 A;  1RQV A;  4UB8 H;  2H8P D;  3RK3 B;  2B88 A;  3H1I G;  2ZVO B;  4L1Q A;  1A2S A;  1J3S A;  3VTP C;  1GDV A;  3GF7 A;  2FYU J;  1ZOY C;  2OZ1 A;  1BGY G;  1K73 Q;  1QYZ A;  1IFP A;  1FZC A;  4WQ9 A;  2FKW B;  1FDI A;  2W27 A;  1W2E A;  2I1K A;  4IL6 X;  3M91 A;  1SQV E;  2YK3 A;  1FJP A;  1IZL 0;  3P7K A;  1P84 I;  2IBZ E;  2CE0 A;  3RK2 C;  5C9M A;  3CX5 E;  1DIP A;  4IOI H;  2E76 D;  3UIA A;  1NHL A;  1BCC J;  1L4A B;  1HGZ A;  4N78 E;  4EIF A;  1BSN A;  3CME P;  3I55 P;  1RZ6 A;  1U75 B;  3O1Y A;  1NTK G;  3H1I J;  3TK1 A;  1FOC A;  3TDK A;  3AED C;  3C1L A;  1CRI A;  1SQP J;  4PD4 E;  3CI9 A;  1HRC A;  1H8A A;  1ZRT E;  4O1W A;  1L0N E;  1Z56 A;  3ITK A;  3VMX A;  1GJQ A;  1C7M A;  4EIE A;  1AJY A;  1Q82 Q;  1NU1 K;  1VQ7 P;  1BE3 E;  2FRC A;  3WU2 H;  3CX5 D;  2GB8 B;  2MHM A;  1CSV A;  3HQ8 A;  1RF1 B;  3MUD C;  1AQ5 A;  3H1J J;  4HKZ H;  5AVW B;  1G2C A;  4XXL A;  1SQB K;  5KLV E;  2KI7 B;  1LT9 C;  3V6I A;  3ORV A;  3AEC C;  1DX7 A;  5BU5 A;  1COR A;  3RMZ A;  1FOS F;  1IRV A;  4DOJ A;  3ZOW A;  3HE5 B;  4UB8 V;  1MV8 A;  1JMB A;  4ZMD A;  3MUD A;  2OTK E;  5GTH V;  1R5S A;  1UII A;  5AVV B;  1SFC A;  4HYT B;  2IBZ G;  3ABV C;  3L72 J;  1CTJ A;  1DD3 A;  1LS9 A;  4PJ0 V;  2FWL A;  3B71 A;  4NFG B;  4DJG A;  1EZV D;  2A06 E;  3AE4 C;  1JDL A;  1H0T A;  5AW0 B;  4YPC A;  4PJ0 E;  1DW3 A;  2WZ7 A;  3DMI A;  2P7J A;  2KS1 B;  1RE3 C;  3CCQ P;  3H1J G;  5DJQ C;  1F1C A;  2RN0 A;  1YTZ T;  3GW6 A;  3HUS B;  1GL2 C;  3EQ2 A;  3CWB J;  1H33 B;  2WWW A;  1YJN P;  2C9L Y;  3AE1 C;  1CO6 A;  1QL2 A;  2PAC A;  1X79 B;  1T6A A;  2PFX A;  1R0Q A;  1KTM A;  1CRJ A;  2Z5H A;  1SVF A;  1VF5 D;  3SJL A;  1CRC A;  1DH3 A;  1FZA A;  2AI5 A;  4I2L C;  1KFM A;  2IZ0 A;  1H31 A;  2K37 A;  1X0T A;  1D7M A;  1NTZ K;  2CA4 B;  3ZOX A;  3O5C A;  3CMA P;  3VP8 A;  2N9I A;  4NPF X;  3BCC E;  2D2C B;  5AW7 B;  3CYT I;  3USS A;  1IFJ A;  1KZU B;  4UB6 E;  3VNW A;  5KLI B;  3CX5 I;  4EID A;  1G1I A;  3L75 D;  1OXZ A;  2GC4 D;  3L71 G;  3KZI E;  2E75 B;  5KAI E;  1NIR A;  1NTZ E;  5AVT B;  3TF5 A;  1MKM A;  3HTK B;  2QJP B;  5CCG A;  4GOF A;  3H1K E;  3RGU A;  2NPS B;  2C1D A;  1LGH B;  1LT1 A;  4RES B;  4V2K A;  4WQ7 A;  155C A;  2XDJ A;  2Z5I A;  2CE1 A;  5CJ4 A;  1CRH A;  4AAN A;  2KP8 A;  1AOQ A;  1I8O A;  1SP4 A;  2SPZ A;  3AE2 C;  4QAO A;  3OA7 A;  1AYG A;  3ZCF A;  4N6J A;  3WFD C;  3CWB D;  1F1F A;  2KYV A;  2OYH C;  1S9K E;  1CNO A;  2ZXE B;  1NTZ G;  2RMZ A;  3D71 A;  1KQF B;  1L0L D;  2IBZ I;  2JQR A;  1FS0 E;  2B4Z A;  4H0L C;  2ZFC A;  3ZOY A;  2P10 A;  3L73 D;  1N50 A;  3AE9 C;  2AEJ A;  3BCC G;  4OGQ C;  3OAK A;  1OX3 A;  1G1J A;  1HTL C;  2YNY A;  2KLV A;  1MZ4 A;  3C9I A;  5C39 A;  1SQB E;  4PD4 H;  1KYO W;  1SLQ A;  4HJG H;  5CCH A;  1FHB A;  3L35 A;  3N4X A;  1FDO A;  1QKS A;  4PD4 I;  4UB6 V;  2RKL A;  2KUB A;  4D6T G;  1H9Y A;  1E79 H;  3H1K G;  4NPE A;  2L5G B;  2KLU A;  1PPJ D;  3V2Q A;  3F89 A;  4WQE A;  4ZKP A;  1LFM A;  3HE4 A;  1KMI Z;  2RH0 A;  3EWK A;  5GTI V;  4A7P A;  3M06 A;  3L73 E;  2VRS A;  1DEE G;  3MIW A;  1U7J A;  2C9N Y;  5TJH A;  1YTZ I;  1C52 A;  4RJT A;  3WU2 V;  5H2F E;  1CW5 A;  1KIL A;  3I5C A;  1GW3 A;  3CC4 P;  3WUV A;  1NTM D;  2MJZ A;  2QE7 H;  2Y0D A;  2BCC J;  5CIF B;  1FZE A;  2QM7 A;  3CXH D;  1OW8 A;  1NU1 E;  4U7J A;  5K5G B;  1YIC A;  2PRR A;  1K8A Q;  1FBM A;  1N7L A;  4PV1 B;  1VQ4 P;  1X9V A;  1FE6 A;  2B0Z B;  1NKZ B;  3TGU E;  1HWT C;  5CCG D;  3PXS A;  4WY4 C;  3WUT A;  1NVO A;  5CIE B;  3RK3 D;  2ZAE B;  2KNC B;  1GQ1 A;  1KV9 A;  2L91 A;  3QWO C;  2Q3I A;  3SFE C;  3A0B E;  1N15 A;  1NYH A;  2CPS A;  3TSI A;  3H32 B;  1J1D B;  1N86 A;  3N7N A;  2OTJ P;  1LC1 A;  2WPQ A;  2WSF J;  1KIB A;  2IYP A;  1HJ0 A;  1RH5 B;  1CCR A;  4CPG A;  2YIU B;  3V2N A;  3PTZ A;  4EYY Q;  4QMA A;  4IL6 E;  1RE4 C;  2ZXY A;  1M7L A;  3VYM A;  3A5T A;  3HD7 B;  1NU1 G;  1SQV D;  2N9J A;  3JCU H;  1JB0 J;  3ZDM A;  2HG5 D;  3MZW B;  4L76 A;  3GF3 A;  1T8Z A;  5CJ0 A;  1PP9 J;  5GTI E;  4EIC A;  3ZBM A;  1KIL E;  1CSB A;  1W5C E;  3AEE C;  5AVQ B;  5B66 E;  1HBW A;  2B12 B;  2AIU A;  1N9C A;  2Y0C A;  2OAR A;  1KIL B;  5APY A;  3QH9 A;  1XTC C;  1C6S A;  1BSH A;  1ZR2 A;  5DJQ B;  1N7S B;  3SWF A;  2I8D A;  3D70 A;  1QVF O;  3VMZ A;  1SQX G;  1CYI A;  3AEA C;  1NNO A;  2I8F A;  3W68 A;  2FY8 A;  4JBZ A;  2PCC B;  1OW7 A;  1S5L E;  3CCE P;  1KC8 Q;  3TGU J;  1CCH A;  2R32 A;  4IL6 H;  2OYH B;  1GU4 A;  3H1L J;  5AVY B;  1LNQ A;  2YMK A;  1CI6 B;  1FC2 C;  2O3J A;  4YXD C;  2AXC A;  4RSZ A;  2E75 D;  3CCM P;  5KLV D;  1LTJ C;  3HUS A;  4XE5 B;  4YXW H;  1I8P A;  2IZ1 A;  1SQP K;  4GED B;  2FYU G;  1L4A C;  1HGV A;  2Y9Z A;  2NPS C;  1BGY J;  1CIF A;  3HRN A;  3L74 G;  3DP5 A;  2OYO A;  2B11 B;  4H13 B;  4N0K A;  2E5Y A;  2ITA A;  2LXB A;  1ZXG A;  5CBO A;  3SSU A;  5BVZ A;  2KSJ A;  3P8M C;  3AE6 C;  1CI6 A;  1YEA A;  3V2R A;  4N3Y B;  1PP9 D;  2K88 A;  1I5T A;  1S5L H;  2HYN A;  2D0S A;  1E2R A;  1QLE D;  1QL3 A;  5AUR A;  2B87 B;  1NTK J;  2ZYA A;  2YIU C;  1KIL C;  4WQA A;  1VL2 A;  1I6E A;  1PIX A;  1YIJ P;  5B5E V;  3PXT A;  5KJ7 A;  1PPJ E;  4FAN A;  1SQP G;  3RK3 E;  1QEX A;  1SQV J;  2C1D B;  1SFC B;  3NFQ A;  2MTA C;  2AEM A;  2Q9I A;  3L74 J;  2O01 N;  2C1U A;  3HUS C;  5CIC B;  1QX8 A;  1LTA C;  1LTI C;  1EB7 A;  1RZ5 A;  3LW5 H;  2ZT9 C;  1L0L K;  3B5N B;  3B5N D;  2FYU E;  4JQ0 D;  3GHG A;  3H1H G;  1PGJ A;  1OIP A;  1NTM E;  2E74 C;  1WEJ F;  4W80 A;  4WBA A;  3PP5 A;  1SQP E;  2N3Y A;  2KZJ A;  1PGP A;  3H1L E;  3L75 G;  3O6Q A;  3D6Z A;  5AW6 B;  4BRY A;  2HOD B;  1ZME C;  2N1T A;  3NMD A;  3KHU A;  3LID A;  2GIW A;  4K3A A;  5AW9 B;  1SQV G;  1S5L V;  5KLV J;  1GW4 A;  1ZV8 A;  3H1I E; 
#chains in the Genus database with same CATH homology
 1H31 A;  4MU8 A;  2CA4 B;  3ZOX A;  3O5C A;  1CIG A;  1OCD A;  2HV4 A;  4YE1 A;  2DGE A;  2QJK B;  3HQ6 A;  1E29 A;  3H1I D;  2N9I A;  1H32 A;  1W2L A;  3CYT I;  2Q3E A;  4WQC A;  5CIB B;  1CED A;  4FA4 A;  2BPB B;  1W5C T;  2ZOO A;  3VNW A;  5KLI B;  1NTZ D;  4EID A;  5B6Q A;  2BCC D;  3L75 D;  2GC4 D;  1YTC A;  3PLN A;  1K3H A;  1NIR A;  3TF5 A;  3HQ9 A;  1MG3 D;  2QJP B;  4FA9 A;  1C2R A;  1U74 B;  2C1D A;  3BCC D;  4O1Q A;  4V2K A;  3RLM A;  1CSU A;  4WQ7 A;  1YFC A;  155C A;  1CXC A;  2CE1 A;  1CRH A;  4AAN A;  1AOQ A;  1I8O A;  3VMA A;  2V07 A;  2ORL A;  4QAO A;  5KAF V;  1VYD A;  5TIS V;  2C1V A;  1COT A;  5C0Z A;  1AYG A;  3ZCF A;  1DVH A;  2JTI B;  3SXT A;  3WFD C;  3CWB D;  1F1F A;  1CNO A;  2BCN B;  2L4D A;  2RMZ A;  5DF5 A;  1CIE A;  3SVW A;  1L0L D;  2JQR A;  1HCM A;  3L71 D;  5CID B;  2B4Z A;  1H33 A;  1KYO D;  3NBS A;  1GIW A;  3ZOY A;  3L73 D;  1KB0 A;  1N50 A;  3M97 X;  2ZON G;  1E8E A;  3NBT A;  3MK7 C;  1MZ4 A;  1MG2 D;  2C2C A;  2DVH A;  2A06 D;  1BCC D;  1HZU A;  5H2F V;  1KYO W;  1FHB A;  2XTS B;  1L9B C;  2BH5 X;  1KX7 A;  1CYC A;  1QKS A;  4UB6 V;  1SQB D;  1H31 B;  1FI3 A;  1DVV A;  1H9Y A;  1C2N A;  1CTZ A;  1FJ0 A;  1I55 A;  4AAO A;  4U3F D;  4PD4 D;  1BL9 A;  2QG4 A;  3OA8 A;  1PPJ D;  1NMI A;  4AAM A;  1NU1 D;  1N90 A;  1CHI A;  1NTK D;  2KS1 A;  3CU4 A;  4WQE A;  1LFM A;  4J20 A;  1FCD C;  1P84 D;  1CRG A;  2N18 C;  5GTI V;  4A7P A;  3PH2 B;  4H0J A;  2C8S A;  1DW2 A;  4Y5R A;  3FWL A;  5TJH A;  1CHJ A;  1C52 A;  4RJT A;  3HQ7 A;  3L72 D;  3WU2 V;  1CTY A;  3WUI A;  4WQ8 A;  1I6D A;  1NTM D;  2Y0D A;  1GKS A;  1C6R A;  5CIF B;  3CXH D;  3PHL A;  1YIC A;  2CA3 B;  2B0Z B;  3X39 A;  3H1K D;  3JBT B;  1H9X A;  2N3B A;  1ZZH A;  2GC7 D;  3PXS A;  5B66 V;  2PCB B;  4LJI A;  1LMS A;  5KAI V;  3RN1 A;  4FA5 A;  3KZI V;  4WQB A;  1H32 B;  5CIE B;  4FAV A;  1IRW A;  1NML A;  2KNC B;  1FI7 A;  1GQ1 A;  1KV9 A;  2L91 A;  1QN2 A;  1CRY A;  3L4M A;  1N15 A;  3O20 A;  1C75 A;  2K9J B;  1IQC A;  4FB1 A;  3WFB C;  1LC2 A;  2N9Y B;  1H1O A;  1K3G A;  351C A;  3CXH W;  3GG2 A;  1LC1 A;  1HJ3 A;  1CC5 A;  1HJ4 A;  1ETP A;  1KIB A;  1YIQ A;  4FA1 A;  1KX2 A;  2FYN B;  1CCR A;  1DW1 A;  1DT1 A;  1KB9 D;  1L0N D;  1ZRT D;  2AXT V;  2YIU B;  2JWA A;  3SWS A;  3PTZ A;  4D6T D;  2ZZS 1;  2FYU D;  3PRJ A;  3A0H V;  451C A;  2YQB A;  2ZXY A;  3PXW A;  2BH4 X;  3CX5 W;  4EDF A;  3VYM A;  3L74 D;  4L3G A;  4DY9 A;  1DIQ C;  1BE3 D;  3TGU D;  4IL6 V;  4KMG A;  1SQV D;  2N9J A;  2ZBO A;  4P4Q B;  5IY5 1;  1HRO A;  4PWA A;  3CP5 A;  1YNR A;  4WQD A;  1HJ5 A;  1SQP D;  4PW9 B;  3ZBM A;  4EIC A;  1FI9 A;  1IO3 A;  2B12 B;  2AIU A;  3MK7 B;  1N9C A;  2Y0C A;  2IBZ D;  4L1Q A;  1A2S A;  1J3S A;  2LIT A;  1C6S A;  1GDV A;  5DJQ B;  1HZV A;  3WFE C;  2N18 B;  1CSW A;  3ZIY A;  2OZ1 A;  2CXB A;  1RAQ A;  2OZ1 B;  1CYJ A;  1CYI A;  2BLF B;  1QYZ A;  1NNO A;  2I8F A;  4WQ9 A;  1S6V B;  3H1H D;  3WFC C;  2PCC B;  2BGV X;  5E79 V;  1CCH A;  3A0B V;  3L4O A;  5CYT R;  3OA8 B;  1SQQ D;  2YK3 A;  3A9F A;  1IZL 0;  3VRD A;  3NWV A;  3OCD A;  2O3J A;  3L70 D;  2CE0 A;  1CXA A;  4RSZ A;  3WC8 A;  5CIG B;  5C9M A;  3RN0 A;  5KLV D;  1AKK A;  1WVE C;  1I8P A;  4GED B;  5EXQ A;  4EIF A;  2QJY B;  1B7V A;  1CSX A;  1RZ6 A;  1U75 B;  2LIR A;  1CIF A;  1L9J C;  3O1Y A;  4AAL A;  1FOC A;  3DP5 A;  3TDK A;  2B11 B;  3SLE A;  2C9X B;  4N0K A;  1CRI A;  1HRC A;  1A8C A;  4GYD A;  4O1W A;  3ITK A;  1GJQ A;  1QL4 A;  1C7M A;  4EIE A;  5KKZ B;  1M70 A;  1YEA A;  1GU2 A;  2FRC A;  3CX5 D;  1RAP A;  2GB8 B;  2MHM A;  1CSV A;  1PP9 D;  1I5T A;  3HQ8 A;  2D0S A;  1YCC A;  1E2R A;  1QL3 A;  5AUR A;  4AX3 A;  4XXL A;  3H1J D;  3DR0 A;  2V08 A;  3ORV A;  1A56 A;  1COR A;  4WQA A;  1BGY D;  3RMZ A;  1I6E A;  1IRV A;  2B10 B;  3ZOW A;  5B5E V;  4K3I A;  3PXT A;  4UB8 V;  4FAN A;  5GTH V;  2C1D B;  3O0R C;  2MTA C;  1CTJ A;  1LS9 A;  4PJ0 V;  3ZOO A;  1CHH A;  1M6Z A;  2C1U A;  1YEB A;  5CIC B;  1EB7 A;  1RZ5 A;  2VHD A;  2Y0E A;  1I54 A;  2FWL A;  4XYD B;  4JCG A;  1SQX D;  4NFG B;  3TYI A;  1EZV D;  2EXV A;  1JDL A;  1DW3 A;  3C2C A;  1CIH A;  3DMI A;  3OCD B;  5CIH B;  1C6O A;  1WEJ F;  1DII C;  5DJQ C;  2YCC A;  1F1C A;  2RN0 A;  4H0K A;  2N3Y A;  3GW6 A;  2D0W A;  1M60 A;  1H33 B;  4Q5P A;  1HH7 A;  1OAE A;  1CO6 A;  2PAC A;  3KHU A;  1DW0 A;  5DFS A;  2GIW A;  1R0Q A;  1CRJ A;  3SJL A;  1CRC A;  1S5L V;  4L3H A;  1AOF A;  3H1L D;  2AI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...