1NTKD

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntkD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntkD01
4QAOA 1E29A 1CSWA 1OAEA 4O1WA 1DW2A 2RN0A 1E2RA 1WVEC 2B12B 5B66V 1SQPD 3DMIA 2ZOOA 4WQDA 3DP5A 4WQ9A 3PXSA 1KYOD 2PACA 4WQCA 1H31A 4JCGA 3CU4A 3O20A 4J20A 5C0ZA 1GDVA 3A0BV 5B5EV 1F1FA 4LJIA 2N9YB 3CXHW 2GIWA 2ZONG 1S6VB 1C2RA 2C1VA 3HQ8A 1CRJA 1KX7A 4P4QB 4NFGB 2BLFB 1MG3D 2C1DB 5DJQC 1FI3A 1HZUA 2Y0CA 3L4MA 5KAFV 3GG2A 1CIHA 2QJYB 2RMZA 3CX5W 3KZIV 1YICA 3ZCFA 1MG2D 4PJ0V 2QG4A 3ZOWA 1YIQA 2HV4A 2FWLA 4FA9A 1CRIA 4PW9B 4RSZA 3M97X 4YE1A 3SVWA 2D0SA 2BGVX 5TISV 2AI5A 1NTMD 2N9JA 4L3GA 3PTZA 1LFMA 1DIQC 2GB8B 4A7PA 2V07A 4WQ7A 1YEAA 1QL3A 2N9IA 3L75D 1IRWA 1KIBA 1B7VA 1CYJA 4FA1A 4FA5A 4FANA 4N0KA 4AAMA 1CHIA 1HJ3A 2C1DA 3L71D 4Y5RA 3H1KD 1M70A 1FOCA 3WFCC 4Q5PA 2LIRA 3L73D 2N18C 1HROA 1SQBD 3TDKA 2GC4D 4WQ8A 3PXTA 1H9XA 4GYDA 2Q3EA 2OZ1B 1MZ4A 2JWAA 1H31B 1BE3D 4FAVA 4PD4D 1W5CT 4U3FD 1NMLA 1YCCA 5E79V 1H9YA 1L9JC 1N90A 1A2SA 3ITKA 1PP9D 3X39A 2YK3A 1CTYA 2ZXYA 4UB8V 1BGYD 2MHMA 1AOFA 1CC5A 1ZZHA 1I8PA 1KV9A 3GW6A 3RN1A 1RAPA 1LC1A 2L91A 1BCCD 1L0LD 1L9BC 3HQ7A 3L70D 1IRVA 3SJLA 3ZOOA 2PCCB 2B11B 3H1LD 1QL4A 2OZ1A 2YCCA 5TJHA 2LITA 351CA 2V08A 2N3BA 1IZL0 1GJQA 1IO3A 5KLVD 1U74B 3KHUA 1DW3A 1YFCA 1N50A 5H2FV 1C75A 4WQAA 1AKKA 1N15A 1H33A 1CHJA 1CO6A 2B4ZA 3OCDA 4H0KA 1CXCA 1EZVD 1I5TA 4EIDA 2CE0A 1CRHA 3ORVA 1NTZD 1KB9D 1EB7A 1RZ6A 1M60A 2KS1A 4H0JA 3O0RC 3VMAA 3JBTB 1CTJA 2AIUA 1C6SA 1DW1A 2XTSB 1FI7A 5GTHV 3TGUD 1AYGA 1C7MA 5KAIV 5IY51 3RLMA 3L74D 1CSVA 3FWLA 2ZBOA 2C9XB 1FHBA 1KX2A 1GU2A 1CCHA 5CIDB 1YEBA 2CE1A 1SQVD 3PXWA 1N9CA 4DY9A 1CHHA 1QKSA 2C1UA 3PRJA 1J3SA 2ZZS1 3VNWA 2FRCA 1DW0A 3A9FA 1CORA 2B0ZB 1CSUA 2Y0DA 5KLIB 1K3GA 3ZOXA 4EIFA 1HJ5A 1F1CA 3C2CA 4AANA 5CIFB 3SXTA 2YQBA 1U75B 1W2LA 3VRDA 1SQQD 1FCDC 3HQ9A 5CIEB 5CYTR 3VYMA 2C2CA 3CP5A 155CA 2FYNB 3ZIYA 2QJKB 3WFBC 1HCMA 3CX5D 1NU1D 2L4DA 5KKZB 1CRYA 1CSXA 3SLEA 4WQEA 4IL6V 2BH5X 3O1YA 2B10B 1KYOW 3H1HD 3MK7C 1NNOA 1A8CA 3OA8A 1H33B 3OCDB 3TF5A 1H1OA 1C2NA 5CIGB 1CYCA 2KNCB 4EICA 3L72D 2YIUB 2JQRA 2VHDA 2EXVA 1LC2A 1HH7A 4V2KA 2QJPB 5DFSA 2A06D 1CNOA 3ZOYA 1DT1A 1I6EA 2FYUD 1OCDA 1CCRA 3CYTI 3MK7B 1HRCA 5EXQA 1DVHA 3WC8A 2MTAC 1GIWA 3DR0A 1H32A 2K9JB 3ZBMA 4PWAA 4KMGA 4L3HA 3PH2B 451CA 2DVHA 4UB6V 1CRCA 1LMSA 1ZRTD 1NTKD 2D0WA 1HZVA 1YTCA 3RN0A 1DIIC 1S5LV 5AURA 1R0QA 1IQCA 1A56A 4WQBA 1M6ZA 1HJ4A 1I8OA 1C6OA 1NMIA 3RMZA 5CIHB 1FJ0A 3HQ6A 3H1JD 4FA4A 1I54A 5CICB 4L1QA 1P84D 3PLNA 4O1QA 3NBTA 1RAQA 4MU8A 1VYDA 3WUIA 5CIBB 3H1ID 3OA8B 2JTIB 3A0HV 1CTZA 1QYZA 2BCCD 1NIRA 3NWVA 1C52A 1RZ5A 3CWBD 1FI9A 4XXLA 5GTIV 3CXHD 1PPJD 2N3YA 1AOQA 1C6RA 1DVVA 2BPBB 3L4OA 3TYIA 4AX3A 1CIGA 3WFEC 2CA3B 2O3JA 4EDFA 5DJQB 3BCCD 1YNRA 2PCBB 4D6TD 4GEDB 2CA4B 1SQXD 2I8FA 3WFDC 1COTA 1CYIA 2DGEA 3O5CA 1I6DA 2AXTV 1CIEA 1CRGA 5C9MA 1K3HA 1H32B 2BCNB 5DF5A 1CEDA 2C8SA 3NBSA 2ORLA 4EIEA 1ETPA 1CXAA 1CIFA 1GKSA 2CXBA 1GQ1A 2BH4X 1L0ND 1I55A 1QN2A 1LS9A 4XYDB 2IBZD 1KB0A 1BL9A 3WU2V 2Y0EA 1E8EA 3SWSA 5B6QA 1JDLA 4K3IA 4RJTA 4AAOA 1WEJF 4AALA 3PHLA 2N18B 4FB1A 2GC7D
chains in the Genus database with same CATH superfamily
1X0TA 4WWIA 1AV1A 4WB4A 3TNUB 3RGUA 3VN0A 1DW2A 1JY2O 1E2RA 1NU1J 5CJ4A 5CBNA 3CLQA 3PP5A 3PXSA 2PACA 4JYBA 1PL5A 2WSCJ 2G3AA 1SQXG 3H1HJ 3CU4A 1EZVE 5C0ZA 4BRYA 3A0BV 1URQC 1L4AC 1KB9E 3OA7A 3HTKB 4W7ZA 3H32A 1C2RA 1CRJA 1KX7A 4P4QB 2D2CB 4AQRD 1L0LK 2ZFCA 2Y0CA 3GG2A 1KQGB 1FDIA 1AJYA 1NTME 2ITAA 1NO4A 2H8PD 4N78E 3RBZA 4AUWA 2XNDH 3L75E 4PJ0H 2FYUJ 3SVWA 4H0LD 5CCGD 2XU6A 2E76C 2K37A 1LTTC 2KLUA 3CL3D 3P32A 1RF1C 1NTMD 3NFQA 4L3GA 4A7PA 1LFMA 4N78D 1A02J 2WSFJ 3L75D 2OYOA 3RK2C 1NTZK 1U7JA 3HTKA 4FA5A 5CMZA 4EIJA 4N0KA 4AAMA 1HJ3A 3H1KD 1M70A 3D6YA 3WFCC 2FFDB 3KXDA 3KZIE 1FS0E 2WITA 3TDKA 1EQ7A 4WQ8A 3AECC 4GYDA 2Q3EA 2OZ1B 1MZ4A 4OH8B 4FAVA 1X79B 1NHLA 1HVVA 5E79V 1H9YA 1OFCX 1MFTA 4OGQD 1N73C 3A3YB 2KUBA 3L70E 1UIIA 1CC5A 1ZZHA 3SWKA 4K3AA 3OW2O 2A06E 1VPCA 3RN1A 1RAPA 2AEMA 1JY2P 2BASA 5APWA 1H88A 4D6TJ 1FZCC 3L70D 3S1KA 3T97B 2FFDA 3HUSB 4KT0J 3SJLA 3RL0C 3H1LD 2OYIC 3EQ2A 1Y47A 2OZ1A 1OWAA 2YCCA 2LITA 1ZV8A 351CA 2QE7H 1Q81Q 2BEZF 5APTA 5KLVD 1U74B 3KHUA 3A0BH 5H2FV 1OVVA 3L4FA 3B5ND 1FZGA 1I5TA 4EIDA 2AEJA 3H1JE 5AVRB 1QEXA 1BE3G 4PD4H 4M3LA 5CCGA 3RK3C 2QSIA 3AEDC 1C6SA 1BDCA 2PP6A 1FI7A 1C7MA 3T97A 1BSNA 5IY51 2BCCE 1FHBA 1CCHA 1ZP0C 1BGYG 4JPZB 4RO0A 4DCKA 1S72P 1SQPJ 2CPSA 3A5TA 1KZUB 1NTKK 3M9BA 4ZKPA 1LTJB 2ZJSE 1J3SA 1J1EB 2YNYA 3VNWA 2QIWA 1CSUA 1SQXE 1PV3A 2M3BA 3S9OA 4JF7A 4AANA 1S5LE 5CIFB 3SXTA 2MKVA 2B9BA 2W6BA 4WY4D 2ZXXA 3HQ9A 1D7MA 2C2CA 3CP5A 155CA 2FYNB 1Q2NA 5AVTB 2QJKB 4XFJA 5AW2B 2WPSA 5KAIE 1NU1D 5KKZB 2KB7P 3SLEA 5KJ7C 4IL6V 2BH5X 2B10B 1PIXA 1CI6B 1RQVA 1ZXGA 1ZOYC 1RF0A 3H1HD 3TYYA 2YO3A 1A8CA 3OA8A 1H33B 3JCUH 1VQ8P 2FXMA 2OGUA 2NPSC 1LTJA 3OJAB 1H1OA 1YYCA 3G71P 1C2NA 1K73Q 5CIGB 2XKMA 3L74G 1LTIC 2OTLP 1K9MQ 1H8AA 1SQXK 4EICA 2FYUE 2KSJA 3EFFK 1KILE 2YMKA 1FOSF 2VHDA 1LC2A 2WPRA 4V2KA 3P8CE 1URQD 2NRGA 3L73J 1DT1A 1ZRTE 2FYUD 2PRRA 3CYTI 3MK7B 1KILD 1X22A 3M06A 1GIWA 2QVAA 3ZBMA 4PWAA 3AEBC 4UB6V 1CRCA 3CCVP 1ZRTD 4C46A 1PP9J 2N1TB 1HZVA 4PV1C 2M0BA 1A56A 1KQFB 1Q90D 2JKVA 1NMIA 1FJ0A 1NVOA 2E76D 4FA4A 1N7SD 2HFED 5CICB 4L1QA 2WSEH 1L0LJ 5CBOA 2A45I 1AFOA 3V2NA 3NBTA 5L8RJ 4RKUJ 1VYDA 2KP8A 1LJ2A 1PPJE 2JTIB 1KFNA 2E74D 1FZBA 3PJSK 3Q3DA 4AYCA 4ZMDA 3NWVA 4WY4A 3A0HH 3HE4A 1AA0A 1JY3O 4D6TE 1URQB 1ZW0A 4IL6X 4GOFA 1L4AB 2QA4P 1YJ9P 1PPJD 1AOQA 2N1TA 3MD0A 4RESB 4H0LC 1DVVA 2BPBB 3TYIA 2B88A 1NTZJ 4D6TD 4GEDB 2CA4B 3CXHI 2YIUC 1TU3F 2QJPC 1BE3E 2W90A 1CIEA 4BWNA 2Q7CA 1M57D 5DF5A 1VQ7P 4IL6H 4NPEA 3CX5I 2A45G 1NGMB 2E76B 1VL2A 2R5DA 1SQVJ 1GKSA 1FZFA 1JTHB 2CXBA 1X8YA 2OYHB 1GQ1A 1I55A 1YQ4C 1BGYE 4XYDB 3RK2B 3GF7A 1BL9A 1URQA 2POHA 2ZXEB 1L4AA 4ASVA 3RL0D 3FX0A 1SQVG 1KILA 2FY8A 3SWYA 2KK7A 3Q5SA 1JDLA 4OGQC 1KD1Q 4AAOA 1WEJF 4AALA 3PHLA 4TT3H 2AXTE 1OAEA 4O1WA 1WMKA 2RN0A 1K04A 1WVEC 3ABVC 1SQPD 3DMIA 3AEGC 1N8RQ 3GF3A 3DP5A 4WQ9A 1R8EA 4JCGA 1N7SA 1HGZA 2KI7B 1JTHA 1RF1A 4J20A 1YI2P 1N73B 1PZQA 1F1FA 3Q5PA 1VDFA 1VQKP 3WU2E 2ZONG 1JNMA 2K3RA 2C1VA 1JMMA 3V6IA 5EFWB 3MZWB 1MUUA 2BLFB 3CI9A 1MG3D 2XDJA 2C1DB 3LIDA 1FI3A 1KFMA 2KZIA 5BVZA 2KZJA 3B5NC 3L72J 1IK9A 3WUTA 1YICA 3ZCFA 3QH9A 3RL0B 1K8AQ 2OYIB 4PJ0V 2QG4A 3KZIH 1YIQA 2HV4A 1JY3P 2FWLA 1OW7A 4FA9A 1CRIA 2R3CA 4YE1A 5B66E 3AEAC 1HBWA 1OVUA 2HG5D 1BDDA 1W2EA 1S1CX 2G8YA 3KQGA 3LW5J 1N86A 1DIQC 2Q3IA 3HRNA 4WQ7A 5DJUB 1GZLA 4GIFA 5TISH 1IRWA 1NTKJ 4Y99B 1B7VA 1QL1A 2HLOA 1SFCB 5KJ7D 1CYJA 1LNQA 1USDA 3IAOA 2E5YA 2VRSA 3RK3B 2C1DA 4Y5RA 2O1JA 2W6AA 3IFMA 4I6MC 5CCHC 4Q5PA 3L73D 3H1JJ 2NPSD 1OMIA 1FZCA 2GC4D 4L74A 1PP9E 5AVWB 3PXTA 1H9XA 4KJMA 2QEXP 2OYIA 4WY4C 3CCSP 4EI2A 3H1IJ 4JYCA 1EDKA 4YPCA 3H6PA 3B8EB 1L9JC 1N90A 2BCCJ 1PP9D 1GU4A 4NPDA 2R44A 2WVRA 2YK3A 3MP7B 1L0LE 1SVFA 1CTYA 3H1IG 2H89C 1AOFA 2KS1B 3NXSA 3E1IA 3A7OA 3BCCJ 2L91A 1L0LD 2I8DA 1L9BC 1SQXJ 1YBKA 2B11B 1LTAC 3HE5B 3D6ZA 4PV1D 1YJWP 2ZT9D 2WWWA 1QL4A 3BCCG 3MUDA 1DD4A 1NTZE 4W80A 1KQLA 1JY2N 1YIJP 2N3BA 3L71G 3I55P 1KILC 3GHGC 1E79H 1KYOI 4WBAA 4WQAA 1BSHA 1CO6A 3OCDA 1CXCA 1EZVD 4UB8E 1CRHA 1NTZD 2C9LY 3V5BA 1KB9D 1EB7A 2FBWC 2KS1A 1VQOP 1SQVE 5AW0B 3VMZA 2AIUA 2KNCA 1DW1A 2XTSB 3D70A 1AYGA 2WSCH 1CSVA 3HE5A 3FWLA 5KJ7A 1N7SC 2WPVB 1SQVD 3PXWA 3AE8C 3CXHE 1CSBA 2YKQA 3E7KA 3M0DA 1CHHA 1QKSA 3IR9A 2ZZS1 1BCCG 1LWUC 2NPSA 5APVA 4I7ZC 2FRCA 2E74C 3A9FA 2R32A 5AVSB 2Y0DA 4UB6E 1FBMA 3ZOXA 3CX5E 1G2CB 1U75B 2JWDA 1OX3A 1FCDC 3FGAD 5CYTR 1AVYA 1T3UA 3CCJP 1SQVK 5GTHE 1FDOA 3CX5D 3UIAA 1NYHA 3VMYA 2KSEA 1A02F 1LT1A 1IFJA 5APSA 1NNOA 4PD4I 2KXPB 1LT9C 3L72E 3TF5A 1YITP 1JOCA 3W67A 4CPGA 4H0LB 3U1AA 1KORA 3CCRP 3M9QA 1AQ5A 2C9NY 1AVOA 1CYCA 2Y9ZA 3L72D 2YIUB 1G2CA 4HKZH 2JQRA 2QJPB 2YKOA 2A06D 2H88C 3ZOYA 1NTKE 4K35A 1JM0A 1DVHA 3WC8A 1BE3J 1H32A 3C1LA 3PH2B 451CA 4B86A 1NOHA 1ZLLA 1LMSA 1SQQG 1NTKD 1IO4A 1RE3A 1DIIC 5AURA 1S3JA 5KLIC 4DOJA 3HD7C 3B4SA 4Y28J 2O1KA 1M6ZA 2FXOA 1BGYJ 1CZQA 4OGQB 2AXCA 4H44D 1C6OA 3H1IE 1LTBC 1ZMEC 3H1JD 1I54A 2LR2A 2ZYGA 3MUDC 4GKGA 4O1QA 1WRGA 1RAQA 4MU8A 5CIBB 3H1ID 3OA8B 3A0HV 1CTZA 3Q5RA 2BCCD 2Q5UA 4MN4C 1RZ5A 3BCCE 5CCHD 1DIPA 2YKPA 3P8MC 2K1AA 1C6RA 2O01H 4EYYQ 3L4OA 4AX3A 4EDFA 2LKMA 3BCCD 1IFMA 4O9BA 1GK4A 1T2KD 1IFNA 2IZ0A 1SQXD 1MKMA 3B5NB 2HPCB 2I8FA 4QMAA 1CYIA 2DGEA 2P10A 1CRGA 3MIWA 1KQSO 3TGUJ 2BCNB 1DEEG 2AXTH 5AW7B 3L74J 4BXLA 3M0DC 4EIEA 2Z4EA 1CXAA 1JEKA 4I2LC 3G4SP 1K05A 2BH4X 3TGUG 1GW3A 1OIPA 1YHQP 1KB0A 5GTIE 1FAVA 2JO1A 2HR3A 2Y0EA 2E42A 5B6QA 2W8ZA 2Y9YA 1BCCE 2WPQA 1DH3A 3AE7C 1NJIQ 2OQQA 1LTSC 1M7LA 1PGPA 1S9KE 2YMYA 3B5NA 2HPCA 2J5UA 1KYOE 3N4XA 3CWBG 4QAOA 2B89A 4WY4B 4GT1A 2JEEA 3HE4B 1X9VA 1VF5D 2IDBA 3P8CD 3VYIA 3Q2YA 2B12B 1S9KD 2ZOOA 2J58A 1EXJA 1KYOD 1H31A 2OTKE 5B66H 2ZT9C 2ZVOB 2WSEJ 1R5LA 2C0XA 2N9YB 5AW9B 1KMIZ 2GIWA 5B5EH 2QRXA 1S6VB 3SSUA 4YXWH 4NFGB 4IOIH 1JCCA 5DJQC 3AEEC 3L4MA 2M5AB 1W5CE 2RMZA 3IF4A 5CCHA 3KZIV 2M8RA 1FZEA 3O6QA 5KAFH 4GDOA 4H13C 3ZOWA 3VMXA 3K5BA 1P84I 3NTNA 3V2QA 3OAKA 2K88A 2SPZA 4PW9B 1HH0A 1U57A 1GL2D 2IYPA 2D0SA 2IZ1A 5TISV 1RE3C 2N9JA 3PTZA 2H43A 1KILB 2V07A 3A0BE 1YEAA 2WT7B 2WSSH 2N9IA 4YTPC 3D0WA 1JY3N 1PGJA 4Z1MH 1CHIA 4PD4E 1IZNB 1QL2A 2N9BA 3CCEP 4XE5B 4C7NA 2N18C 1HROA 2P2UA 2M5AA 5AVXB 3F5HA 2QM8A 2JWAA 1N7SB 1BE3D 1RF1B 4PD4D 1W5CT 1RY3A 1NH4A 3TSIA 1NMLA 1Y9BA 5APUA 1YCCA 1VQ6P 1YJNP 1GU5A 5K5GB 3VTPC 1Q7YQ 1ZR2A 2BEQD 1LWUB 2DW3A 4I7ZB 2E74B 2JDIH 5APQA 1KB9H 3GHGA 2HYNA 2WT7A 1N7LA 3VP8A 3W68A 2E75C 3N7NA 2ZXYA 1BGYD 2MHMA 2XNXA 2ZVNB 1W2BO 1SQQK 1KV9A 4UB8H 2ZYAA 2LXCB 1MFZA 3BRTB 1LC1A 3HQ7A 1NTMG 2QJYC 1FDMA 1IRVA 4DZOA 2PCCB 3L75G 1KV4A 1QLED 4HB1A 1SP4A 2IFMA 3WMM0 3HD7D 3SFDC 3D71A 1R5SA 5TJHA 2WZ7A 3M0AA 5E79E 3CMAP 1SLQA 1LT9B 2V08A 1IZL0 1IO3A 3H1KG 1UIXA 1DW3A 1YFCA 1N50A 1T6AA 3KPEA 3CCUP 1L0NJ 1LWUA 1FZAA 1N15A 2Z5IA 4H0KA 1RHZB 3TGUE 2CE0A 3ORVA 3L74E 3GLMA 1FZCB 1GL2A 4H0JA 1L0NG 5AW1B 3JBTB 3TGUD 1LP1A 4ASWA 5KAIV 2RH0A 1JO5A 3L74D 4H44C 4OWFA 2C9XB 4GOEA 1KX2A 1JMBA 1NKNA 2P58A 1YEBA 2CE1A 3L37A 2R5BA 1PGOA 2ZAEB 1MV8A 1LTGC 1M1JC 1LT9A 5H2FE 1DW0A 2K9JA 1CORA 2B0ZB 1T3JA 5KLIB 3CCMP 3H1LG 5AVUB 4EIFA 3C2CA 3TK1A 3VRDA 1VQPP 5DJTB 3WFBC 5KLVG 1IC2A 3SWFA 2P1JA 3LW5H 2L4DA 1T2KC 3CCLP 3O8ZA 3II6A 1FE6A 5APYA 3O1YA 3I56P 1U7MA 3MK7C 4HJGH 3OCDB 2M3EA 2D2CD 2V7QH 3BASA 1FJPA 3BATA 2JP3A 1OW6A 2QM7A 2ZYDA 3CD6P 1YTZI 5AW4B 3G9RA 3G3ZA 3HD7A 2KNCB 3CC7P 2B87B 1J1DC 1HH7A 2Z5HA 3L71J 3AE1C 4LLHA 2XZRA 1SQBJ 2XV5A 1IFPA 1I6EA 1IK7A 1OCDA 2NZ2A 2C0WA 1HRCA 4IL6E 3AE3C 2MTAC 2NPSB 2GUVA 2YXRB 3QWOC 5BU8B 4U3FJ 5APXA 3E1RA 4L3HA 1S2EA 1SQBG 2DVHA 1XTGB 1VF5C 2I1JA 3C9IA 3U1CA 1YTCA 1YQ3C 4H13D 1P84E 1VQMP 3KDPB 1R0QA 4U3FG 3AE5C 1NU1G 1S5LH 4DJGA 1I8OA 4EOTA 2E5TA 2OARA 4R4MA 3H1HG 2B87A 1EC5A 1P84D 1BCCJ 3PLNA 5KAIH 4L73A 4I1LA 3WUIA 3BVHA 1QX8A 5AVQB 1XTCC 3TNUA 3AE2C 4PV1B 2ZT9B 1FI9A 3Q1MA 3CXHD 1DEBA 1WT6A 2OYHC 2N3YA 1GL2C 4NPFX 5GTIH 1JB0J 3H1KE 1NWQA 2FYUG 2KYVA 1CIGA 3WFEC 5DJQB 1YNRA 2PCBB 1GTWA 2GA1A 1T8ZA 1COTA 2AXTV 2LXBA 2WSFH 4H13B 1L0NE 1H32B 1KYOH 1FU1A 2E75D 4IFMA 1Q86Q 1CEDA 2C8SA 2MJZA 1HF9A 3SFEC 1ETPA 1NTMK 4YXDC 5C39A 3AE9C 2IPPA 1HUCA 2CK3H 3H25A 1NAFA 1L0ND 1QN2A 1HGVA 1GMJA 2JJLA 5TISE 3WU2V 1ZR4A 5AW3B 1Q82Q 2WMMA 2IFNA 1M90Q 5CHXA 4K3IA 3H1LE 5BU5A 2N18B 3JC22 1SQQJ 1SS1A 2E43A 1N2DC 5AW8B 3U59A 1E29A 1CSWA 1Z56A 1PPJG 1L0NK 1RH5B 3G6EP 5KLVE 2L5GB 5B66V 4WQDA 1EDJA 4WQCA 1IFIA 4D6TG 3O20A 1GDVA 5B5EV 3FXEA 1CW5A 4LJIA 3CMEP 3CXHW 2E75B 4ZKUA 3HQ8A 3B71A 1MZ9A 4Y99C 1HZUA 2YXQB 1SFCC 5KAFV 1ZN5A 1CIHA 2QJYB 3CX5W 3EFGA 1MG2D 2O01J 2W6JH 3R4YA 2IX7C 3HUSA 4RSZA 3M97X 3NMDA 3M91A 2BGVX 5KLVK 2AI5A 4LC1A 2GB8B 1USEA 3L71E 1QL3A 1G1IA 1KIBA 3CC4P 1SQBE 3AEFC 4FA1A 1OZHA 2OTJP 3CC2P 3AE4C 4FANA 1OXZA 3ZDMA 1SQPG 1H0TB 3L71D 4U3FE 1NU1E 5AVYB 1DX7A 1FOCA 1VQLP 3IN6A 2LIRA 1JUNA 2R3SA 1SQBD 1GD2E 4H44B 4PJ0E 3H1HE 1IJDB 1H31B 2N1TD 4U3FD 3EWKA 1DD3A 4KHXA 4R4LA 3CCQP 1A2SA 1L2PA 1M1JB 3ITKA 3X39A 5E79H 2P67A 2PFXA 3CWBJ 4N6JA 3WU2H 4UB8V 2IBZI 3S4RA 2UWJE 4W7YA 1SQBK 2D2CC 3O6QB 1I8PA 3GW6A 2K9YA 1H0TA 1BCCD 4HYTB 1NU1K 4HH2A 4IFDK 2PGDA 3ZOOA 1M8OB 1KTMA 3MTUE 1L4AD 2W27A 1RQUA 2Q1KA 1HJ0A 1EDIA 1E5WA 1GJQA 4JBZA 1YTZT 1M1JA 1CI6A 3L73G 4JQ0D 1C75A 1AKKA 2Q9IA 5H2FH 1IFDA 1H33A 1CHJA 2B4ZA 3R2PA 2O01N 4C7NB 1RZ6A 1M60A 4L75A 1J1DB 3O0RC 3VMAA 2IBZG 3L36A 1CTJA 2FFDC 1EZVI 5AVVB 3M9HA 1PP9G 5GTHV 3I5CA 2FYUK 3RLMA 1KB9I 1EDLA 2ZBOA 1GU2A 3RK2D 5CIDB 3JSVC 1M56D 1RE4A 3GHGB 1N9CA 3VP9A 4DY9A 1FJKA 2FYZA 2C1UA 3PRJA 1KC8Q 1VF5B 2I1KA 1L0LG 2V4HA 1SQQE 2W83C 5AW6B 1K3GA 1M1KQ 1JCDA 4LGDE 1HJ5A 1OVRA 1F1CA 5CCGC 2YQBA 3A2AA 1LGHB 3V2PA 1W2LA 3L35A 2HODB 1SQQD 4U7JA 5CIEB 1PGQA 3VYMA 1NAYA 3ZIYA 1HCMA 3HUSC 3USSA 4IFFA 1CRYA 4DT0A 1CSXA 4WQEA 1EZVG 1KYOW 4XA4A 1NTZG 5AVZB 2H7HA 2P7JA 2GUSA 3PH0A 2YO2A 2A45H 1NTMJ 1VQ5P 2KOGA 1G1JA 5AW5B 1GL2B 3L75J 1P84H 1GK6A 1GDTA 1LP1B 2EXVA 2HODA 3RBXA 5DFSA 3H1KJ 1SQPE 5M1BA 1VQ4P 1CNOA 3BRVB 1CCRA 3RK3E 1QVFO 1VQNP 5EXQA 2JR8A 4ZNCA 1VQ9P 3CXHH 3MGNA 1RF0C 3DR0A 3JCUE 2K9JB 2WQYC 3MHVA 4KMGA 1SFCD 1S4XA 3C8VA 2AEFA 2KLVA 1LTJC 1QGKB 1J1EC 2D0WA 3RK3D 3RN0A 4UB6H 3VOPA 2OYHA 3F89A 1S5LV 1FOSE 1KN7A 3GMAA 1IQCA 3CX5H 4WQBA 1J2JB 1HJ4A 3V4WA 3RMZA 5CIHB 3HQ6A 1H89A 5GTHH 1HJBA 2FYNC 1NKZB 2QJKC 1QVGO 3CWBE 3L70J 2Q6QA 2KIKA 5KKZC 1SQPK 2IYOA 3H1LJ 4OVNF 1QYZA 3V4QA 5KTBA 3WUVA 1NIRA 1C52A 3L72G 4L76A 3L70G 3CWBD 4XXLA 5GTIV 2FKWB 3HD7B 5KLVJ 2A06G 3FXDA 5B5EE 1N73A 3L73E 2O3JA 2CA3B 1PFIA 2GM4A 1AQTA 1FC2C 3LIEA 3WFDC 2V7QJ 3O5CA 3RL0g 1I6DA 3AE6C 4TLFA 5C9MA 1K3HA 1NTKG 1OW8A 5KAFE 3CPWO 3V2RA 3FWNA 1RE4C 2IBZE 5CJ0A 4C7RA 1HWTC 3NBSA 2ORLA 3A0HE 1GW4A 4GODA 1CIFA 4BRYB 3H1JG 1LS9A 3KYQA 2IBZD 2N1TC 2RKLA 3P7KA 3H32B 1E8EA 3SWSA 2CPBA 2PAJA 4WVZA 3WUUA 2WTYA 2J59M 1Y8AA 1HTLC 1S5LX 2BCCG 4RJTA 1SFCA 4N3YB 2FXPA 1EXIA 4FB1A 2GC7D
chains in the Genus database with same CATH topology
4QAOA 1E29A 1CSWA 1OAEA 4O1WA 1DW2A 2RN0A 1E2RA 1WVEC 2B12B 5B66V 1SQPD 3DMIA 2ZOOA 4WQDA 3DP5A 4WQ9A 3PXSA 1KYOD 2PACA 4WQCA 1H31A 4JCGA 3CU4A 3O20A 4J20A 5C0ZA 1GDVA 3A0BV 5B5EV 1F1FA 4LJIA 2N9YB 3CXHW 2GIWA 2ZONG 1S6VB 1C2RA 2C1VA 3HQ8A 1CRJA 1KX7A 4P4QB 4NFGB 2BLFB 1MG3D 2C1DB 5DJQC 1FI3A 1HZUA 2Y0CA 3L4MA 5KAFV 3GG2A 1CIHA 2QJYB 2RMZA 3CX5W 3KZIV 1YICA 3ZCFA 1MG2D 4PJ0V 2QG4A 3ZOWA 1YIQA 2HV4A 2FWLA 4FA9A 1CRIA 4PW9B 4RSZA 3M97X 4YE1A 3SVWA 2D0SA 2BGVX 5TISV 2AI5A 1NTMD 2N9JA 4L3GA 3PTZA 1LFMA 1DIQC 2GB8B 4A7PA 2V07A 4WQ7A 1YEAA 1QL3A 2N9IA 3L75D 1IRWA 1KIBA 1B7VA 1CYJA 4FA1A 4FA5A 4FANA 4N0KA 4AAMA 1CHIA 1HJ3A 2C1DA 3L71D 4Y5RA 3H1KD 1M70A 1FOCA 3WFCC 4Q5PA 2LIRA 3L73D 2N18C 1HROA 1SQBD 3TDKA 2GC4D 4WQ8A 3PXTA 1H9XA 4GYDA 2Q3EA 2OZ1B 1MZ4A 2JWAA 1H31B 1BE3D 4FAVA 4PD4D 1W5CT 4U3FD 1NMLA 1YCCA 5E79V 1H9YA 1L9JC 1N90A 1A2SA 3ITKA 1PP9D 3X39A 2YK3A 1CTYA 2ZXYA 4UB8V 1BGYD 2MHMA 1AOFA 1CC5A 1ZZHA 1I8PA 1KV9A 3GW6A 3RN1A 1RAPA 1LC1A 2L91A 1BCCD 1L0LD 1L9BC 3HQ7A 3L70D 1IRVA 3SJLA 3ZOOA 2PCCB 2B11B 3H1LD 1QL4A 2OZ1A 2YCCA 5TJHA 2LITA 351CA 2V08A 2N3BA 1IZL0 1GJQA 1IO3A 5KLVD 1U74B 3KHUA 1DW3A 1YFCA 1N50A 5H2FV 1C75A 4WQAA 1AKKA 1N15A 1H33A 1CHJA 1CO6A 2B4ZA 3OCDA 4H0KA 1CXCA 1EZVD 1I5TA 4EIDA 2CE0A 1CRHA 3ORVA 1NTZD 1KB9D 1EB7A 1RZ6A 1M60A 2KS1A 4H0JA 3O0RC 3VMAA 3JBTB 1CTJA 2AIUA 1C6SA 1DW1A 2XTSB 1FI7A 5GTHV 3TGUD 1AYGA 1C7MA 5KAIV 5IY51 3RLMA 3L74D 1CSVA 3FWLA 2ZBOA 2C9XB 1FHBA 1KX2A 1GU2A 1CCHA 5CIDB 1YEBA 2CE1A 1SQVD 3PXWA 1N9CA 4DY9A 1CHHA 1QKSA 2C1UA 3PRJA 1J3SA 2ZZS1 3VNWA 2FRCA 1DW0A 3A9FA 1CORA 2B0ZB 1CSUA 2Y0DA 5KLIB 1K3GA 3ZOXA 4EIFA 1HJ5A 1F1CA 3C2CA 4AANA 5CIFB 3SXTA 2YQBA 1U75B 1W2LA 3VRDA 1SQQD 1FCDC 3HQ9A 5CIEB 5CYTR 3VYMA 2C2CA 3CP5A 155CA 2FYNB 3ZIYA 2QJKB 3WFBC 1HCMA 3CX5D 1NU1D 2L4DA 5KKZB 1CRYA 1CSXA 3SLEA 4WQEA 4IL6V 2BH5X 3O1YA 2B10B 1KYOW 3H1HD 3MK7C 1NNOA 1A8CA 3OA8A 1H33B 3OCDB 3TF5A 1H1OA 1C2NA 5CIGB 1CYCA 2KNCB 4EICA 3L72D 2YIUB 2JQRA 2VHDA 2EXVA 1LC2A 1HH7A 4V2KA 2QJPB 5DFSA 2A06D 1CNOA 3ZOYA 1DT1A 1I6EA 2FYUD 1OCDA 1CCRA 3CYTI 3MK7B 1HRCA 5EXQA 1DVHA 3WC8A 2MTAC 1GIWA 3DR0A 1H32A 2K9JB 3ZBMA 4PWAA 4KMGA 4L3HA 3PH2B 451CA 2DVHA 4UB6V 1CRCA 1LMSA 1ZRTD 1NTKD 2D0WA 1HZVA 1YTCA 3RN0A 1DIIC 1S5LV 5AURA 1R0QA 1IQCA 1A56A 4WQBA 1M6ZA 1HJ4A 1I8OA 1C6OA 1NMIA 3RMZA 5CIHB 1FJ0A 3HQ6A 3H1JD 4FA4A 1I54A 5CICB 4L1QA 1P84D 3PLNA 4O1QA 3NBTA 1RAQA 4MU8A 1VYDA 3WUIA 5CIBB 3H1ID 3OA8B 2JTIB 3A0HV 1CTZA 1QYZA 2BCCD 1NIRA 3NWVA 1C52A 1RZ5A 3CWBD 1FI9A 4XXLA 5GTIV 3CXHD 1PPJD 2N3YA 1AOQA 1C6RA 1DVVA 2BPBB 3L4OA 3TYIA 4AX3A 1CIGA 3WFEC 2CA3B 2O3JA 4EDFA 5DJQB 3BCCD 1YNRA 2PCBB 4D6TD 4GEDB 2CA4B 1SQXD 2I8FA 3WFDC 1COTA 1CYIA 2DGEA 3O5CA 1I6DA 2AXTV 1CIEA 1CRGA 5C9MA 1K3HA 1H32B 2BCNB 5DF5A 1CEDA 2C8SA 3NBSA 2ORLA 4EIEA 1ETPA 1CXAA 1CIFA 1GKSA 2CXBA 1GQ1A 2BH4X 1L0ND 1I55A 1QN2A 1LS9A 4XYDB 2IBZD 1KB0A 1BL9A 3WU2V 2Y0EA 1E8EA 3SWSA 5B6QA 1JDLA 4K3IA 4RJTA 4AAOA 1WEJF 4AALA 3PHLA 2N18B 4FB1A 2GC7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QAO A;  1E29 A;  1CSW A;  1OAE A;  4O1W A;  1DW2 A;  2RN0 A;  1E2R A;  1WVE C;  2B12 B;  5B66 V;  1SQP D;  3DMI A;  2ZOO A;  4WQD A;  3DP5 A;  4WQ9 A;  3PXS A;  1KYO D;  2PAC A;  4WQC A;  1H31 A;  4JCG A;  3CU4 A;  3O20 A;  4J20 A;  5C0Z A;  1GDV A;  3A0B V;  5B5E V;  1F1F A;  4LJI A;  2N9Y B;  3CXH W;  2GIW A;  2ZON G;  1S6V B;  1C2R A;  2C1V A;  3HQ8 A;  1CRJ A;  1KX7 A;  4P4Q B;  4NFG B;  2BLF B;  1MG3 D;  2C1D B;  5DJQ C;  1FI3 A;  1HZU A;  2Y0C A;  3L4M A;  5KAF V;  3GG2 A;  1CIH A;  2QJY B;  2RMZ A;  3CX5 W;  3KZI V;  1YIC A;  3ZCF A;  1MG2 D;  4PJ0 V;  2QG4 A;  3ZOW A;  1YIQ A;  2HV4 A;  2FWL A;  4FA9 A;  1CRI A;  4PW9 B;  4RSZ A;  3M97 X;  4YE1 A;  3SVW A;  2D0S A;  2BGV X;  5TIS V;  2AI5 A;  1NTM D;  2N9J A;  4L3G A;  3PTZ A;  1LFM A;  1DIQ C;  2GB8 B;  4A7P A;  2V07 A;  4WQ7 A;  1YEA A;  1QL3 A;  2N9I A;  3L75 D;  1IRW A;  1KIB A;  1B7V A;  1CYJ A;  4FA1 A;  4FA5 A;  4FAN A;  4N0K A;  4AAM A;  1CHI A;  1HJ3 A;  2C1D A;  3L71 D;  4Y5R A;  3H1K D;  1M70 A;  1FOC A;  3WFC C;  4Q5P A;  2LIR A;  3L73 D;  2N18 C;  1HRO A;  1SQB D;  3TDK A;  2GC4 D;  4WQ8 A;  3PXT A;  1H9X A;  4GYD A;  2Q3E A;  2OZ1 B;  1MZ4 A;  2JWA A;  1H31 B;  1BE3 D;  4FAV A;  4PD4 D;  1W5C T;  4U3F D;  1NML A;  1YCC A;  5E79 V;  1H9Y A;  1L9J C;  1N90 A;  1A2S A;  3ITK A;  1PP9 D;  3X39 A;  2YK3 A;  1CTY A;  2ZXY A;  4UB8 V;  1BGY D;  2MHM A;  1AOF A;  1CC5 A;  1ZZH A;  1I8P A;  1KV9 A;  3GW6 A;  3RN1 A;  1RAP A;  1LC1 A;  2L91 A;  1BCC D;  1L0L D;  1L9B C;  3HQ7 A;  3L70 D;  1IRV A;  3SJL A;  3ZOO A;  2PCC B;  2B11 B;  3H1L D;  1QL4 A;  2OZ1 A;  2YCC A;  5TJH A;  2LIT A;  351C A;  2V08 A;  2N3B A;  1IZL 0;  1GJQ A;  1IO3 A;  5KLV D;  1U74 B;  3KHU A;  1DW3 A;  1YFC A;  1N50 A;  5H2F V;  1C75 A;  4WQA A;  1AKK A;  1N15 A;  1H33 A;  1CHJ A;  1CO6 A;  2B4Z A;  3OCD A;  4H0K A;  1CXC A;  1EZV D;  1I5T A;  4EID A;  2CE0 A;  1CRH A;  3ORV A;  1NTZ D;  1KB9 D;  1EB7 A;  1RZ6 A;  1M60 A;  2KS1 A;  4H0J A;  3O0R C;  3VMA A;  3JBT B;  1CTJ A;  2AIU A;  1C6S A;  1DW1 A;  2XTS B;  1FI7 A;  5GTH V;  3TGU D;  1AYG A;  1C7M A;  5KAI V;  5IY5 1;  3RLM A;  3L74 D;  1CSV A;  3FWL A;  2ZBO A;  2C9X B;  1FHB A;  1KX2 A;  1GU2 A;  1CCH A;  5CID B;  1YEB A;  2CE1 A;  1SQV D;  3PXW A;  1N9C A;  4DY9 A;  1CHH A;  1QKS A;  2C1U A;  3PRJ A;  1J3S A;  2ZZS 1;  3VNW A;  2FRC A;  1DW0 A;  3A9F A;  1COR A;  2B0Z B;  1CSU A;  2Y0D A;  5KLI B;  1K3G A;  3ZOX A;  4EIF A;  1HJ5 A;  1F1C A;  3C2C A;  4AAN A;  5CIF B;  3SXT A;  2YQB A;  1U75 B;  1W2L A;  3VRD A;  1SQQ D;  1FCD C;  3HQ9 A;  5CIE B;  5CYT R;  3VYM A;  2C2C A;  3CP5 A;  155C A;  2FYN B;  3ZIY A;  2QJK B;  3WFB C;  1HCM A;  3CX5 D;  1NU1 D;  2L4D A;  5KKZ B;  1CRY A;  1CSX A;  3SLE A;  4WQE A;  4IL6 V;  2BH5 X;  3O1Y A;  2B10 B;  1KYO W;  3H1H D;  3MK7 C;  1NNO A;  1A8C A;  3OA8 A;  1H33 B;  3OCD B;  3TF5 A;  1H1O A;  1C2N A;  5CIG B;  1CYC A;  2KNC B;  4EIC A;  3L72 D;  2YIU B;  2JQR A;  2VHD A;  2EXV A;  1LC2 A;  1HH7 A;  4V2K A;  2QJP B;  5DFS A;  2A06 D;  1CNO A;  3ZOY A;  1DT1 A;  1I6E A;  2FYU D;  1OCD A;  1CCR A;  3CYT I;  3MK7 B;  1HRC A;  5EXQ A;  1DVH A;  3WC8 A;  2MTA C;  1GIW A;  3DR0 A;  1H32 A;  2K9J B;  3ZBM A;  4PWA A;  4KMG A;  4L3H A;  3PH2 B;  451C A;  2DVH A;  4UB6 V;  1CRC A;  1LMS A;  1ZRT D;  1NTK D;  2D0W A;  1HZV A;  1YTC A;  3RN0 A;  1DII C;  1S5L V;  5AUR A;  1R0Q A;  1IQC A;  1A56 A;  4WQB A;  1M6Z A;  1HJ4 A;  1I8O A;  1C6O A;  1NMI A;  3RMZ A;  5CIH B;  1FJ0 A;  3HQ6 A;  3H1J D;  4FA4 A;  1I54 A;  5CIC B;  4L1Q A;  1P84 D;  3PLN A;  4O1Q A;  3NBT A;  1RAQ A;  4MU8 A;  1VYD A;  3WUI A;  5CIB B;  3H1I D;  3OA8 B;  2JTI B;  3A0H V;  1CTZ A;  1QYZ A;  2BCC D;  1NIR A;  3NWV A;  1C52 A;  1RZ5 A;  3CWB D;  1FI9 A;  4XXL A;  5GTI V;  3CXH D;  1PPJ D;  2N3Y A;  1AOQ A;  1C6R A;  1DVV A;  2BPB B;  3L4O A;  3TYI A;  4AX3 A;  1CIG A;  3WFE C;  2CA3 B;  2O3J A;  4EDF A;  5DJQ B;  3BCC D;  1YNR A;  2PCB B;  4D6T D;  4GED B;  2CA4 B;  1SQX D;  2I8F A;  3WFD C;  1COT A;  1CYI A;  2DGE A;  3O5C A;  1I6D A;  2AXT V;  1CIE A;  1CRG A;  5C9M A;  1K3H A;  1H32 B;  2BCN B;  5DF5 A;  1CED A;  2C8S A;  3NBS A;  2ORL A;  4EIE A;  1ETP A;  1CXA A;  1CIF A;  1GKS A;  2CXB A;  1GQ1 A;  2BH4 X;  1L0N D;  1I55 A;  1QN2 A;  1LS9 A;  4XYD B;  2IBZ D;  1KB0 A;  1BL9 A;  3WU2 V;  2Y0E A;  1E8E A;  3SWS A;  5B6Q A;  1JDL A;  4K3I A;  4RJT A;  4AAO A;  1WEJ F;  4AAL A;  3PHL A;  2N18 B;  4FB1 A;  2GC7 D; 
#chains in the Genus database with same CATH topology
 1X0T A;  4WWI A;  1AV1 A;  4WB4 A;  3TNU B;  3RGU A;  3VN0 A;  1DW2 A;  1JY2 O;  1E2R A;  1NU1 J;  5CJ4 A;  5CBN A;  3CLQ A;  3PP5 A;  3PXS A;  2PAC A;  4JYB A;  1PL5 A;  2WSC J;  2G3A A;  1SQX G;  3H1H J;  3CU4 A;  1EZV E;  5C0Z A;  4BRY A;  3A0B V;  1URQ C;  1L4A C;  1KB9 E;  3OA7 A;  3HTK B;  4W7Z A;  3H32 A;  1C2R A;  1CRJ A;  1KX7 A;  4P4Q B;  2D2C B;  4AQR D;  1L0L K;  2ZFC A;  2Y0C A;  3GG2 A;  1KQG B;  1FDI A;  1AJY A;  1NTM E;  2ITA A;  1NO4 A;  2H8P D;  4N78 E;  3RBZ A;  4AUW A;  2XND H;  3L75 E;  4PJ0 H;  2FYU J;  3SVW A;  4H0L D;  5CCG D;  2XU6 A;  2E76 C;  2K37 A;  1LTT C;  2KLU A;  3CL3 D;  3P32 A;  1RF1 C;  1NTM D;  3NFQ A;  4L3G A;  4A7P A;  1LFM A;  4N78 D;  1A02 J;  2WSF J;  3L75 D;  2OYO A;  3RK2 C;  1NTZ K;  1U7J A;  3HTK A;  4FA5 A;  5CMZ A;  4EIJ A;  4N0K A;  4AAM A;  1HJ3 A;  3H1K D;  1M70 A;  3D6Y A;  3WFC C;  2FFD B;  3KXD A;  3KZI E;  1FS0 E;  2WIT A;  3TDK A;  1EQ7 A;  4WQ8 A;  3AEC C;  4GYD A;  2Q3E A;  2OZ1 B;  1MZ4 A;  4OH8 B;  4FAV A;  1X79 B;  1NHL A;  1HVV A;  5E79 V;  1H9Y A;  1OFC X;  1MFT A;  4OGQ D;  1N73 C;  3A3Y B;  2KUB A;  3L70 E;  1UII A;  1CC5 A;  1ZZH A;  3SWK A;  4K3A A;  3OW2 O;  2A06 E;  1VPC A;  3RN1 A;  1RAP A;  2AEM A;  1JY2 P;  2BAS A;  5APW A;  1H88 A;  4D6T J;  1FZC C;  3L70 D;  3S1K A;  3T97 B;  2FFD A;  3HUS B;  4KT0 J;  3SJL A;  3RL0 C;  3H1L D;  2OYI C;  3EQ2 A;  1Y47 A;  2OZ1 A;  1OWA A;  2YCC A;  2LIT A;  1ZV8 A;  351C A;  2QE7 H;  1Q81 Q;  2BEZ F;  5APT A;  5KLV D;  1U74 B;  3KHU A;  3A0B H;  5H2F V;  1OVV A;  3L4F A;  3B5N D;  1FZG A;  1I5T A;  4EID A;  2AEJ A;  3H1J E;  5AVR B;  1QEX A;  1BE3 G;  4PD4 H;  4M3L A;  5CCG A;  3RK3 C;  2QSI A;  3AED C;  1C6S A;  1BDC A;  2PP6 A;  1FI7 A;  1C7M A;  3T97 A;  1BSN A;  5IY5 1;  2BCC E;  1FHB A;  1CCH A;  1ZP0 C;  1BGY G;  4JPZ B;  4RO0 A;  4DCK A;  1S72 P;  1SQP J;  2CPS A;  3A5T A;  1KZU B;  1NTK K;  3M9B A;  4ZKP A;  1LTJ B;  2ZJS E;  1J3S A;  1J1E B;  2YNY A;  3VNW A;  2QIW A;  1CSU A;  1SQX E;  1PV3 A;  2M3B A;  3S9O A;  4JF7 A;  4AAN A;  1S5L E;  5CIF B;  3SXT A;  2MKV A;  2B9B A;  2W6B A;  4WY4 D;  2ZXX A;  3HQ9 A;  1D7M A;  2C2C A;  3CP5 A;  155C A;  2FYN B;  1Q2N A;  5AVT B;  2QJK B;  4XFJ A;  5AW2 B;  2WPS A;  5KAI E;  1NU1 D;  5KKZ B;  2KB7 P;  3SLE A;  5KJ7 C;  4IL6 V;  2BH5 X;  2B10 B;  1PIX A;  1CI6 B;  1RQV A;  1ZXG A;  1ZOY C;  1RF0 A;  3H1H D;  3TYY A;  2YO3 A;  1A8C A;  3OA8 A;  1H33 B;  3JCU H;  1VQ8 P;  2FXM A;  2OGU A;  2NPS C;  1LTJ A;  3OJA B;  1H1O A;  1YYC A;  3G71 P;  1C2N A;  1K73 Q;  5CIG B;  2XKM A;  3L74 G;  1LTI C;  2OTL P;  1K9M Q;  1H8A A;  1SQX K;  4EIC A;  2FYU E;  2KSJ A;  3EFF K;  1KIL E;  2YMK A;  1FOS F;  2VHD A;  1LC2 A;  2WPR A;  4V2K A;  3P8C E;  1URQ D;  2NRG A;  3L73 J;  1DT1 A;  1ZRT E;  2FYU D;  2PRR A;  3CYT I;  3MK7 B;  1KIL D;  1X22 A;  3M06 A;  1GIW A;  2QVA A;  3ZBM A;  4PWA A;  3AEB C;  4UB6 V;  1CRC A;  3CCV P;  1ZRT D;  4C46 A;  1PP9 J;  2N1T B;  1HZV A;  4PV1 C;  2M0B A;  1A56 A;  1KQF B;  1Q90 D;  2JKV A;  1NMI A;  1FJ0 A;  1NVO A;  2E76 D;  4FA4 A;  1N7S D;  2HFE D;  5CIC B;  4L1Q A;  2WSE H;  1L0L J;  5CBO A;  2A45 I;  1AFO A;  3V2N A;  3NBT A;  5L8R J;  4RKU J;  1VYD A;  2KP8 A;  1LJ2 A;  1PPJ E;  2JTI B;  1KFN A;  2E74 D;  1FZB A;  3PJS K;  3Q3D A;  4AYC A;  4ZMD A;  3NWV A;  4WY4 A;  3A0H H;  3HE4 A;  1AA0 A;  1JY3 O;  4D6T E;  1URQ B;  1ZW0 A;  4IL6 X;  4GOF A;  1L4A B;  2QA4 P;  1YJ9 P;  1PPJ D;  1AOQ A;  2N1T A;  3MD0 A;  4RES B;  4H0L C;  1DVV A;  2BPB B;  3TYI A;  2B88 A;  1NTZ J;  4D6T D;  4GED B;  2CA4 B;  3CXH I;  2YIU C;  1TU3 F;  2QJP C;  1BE3 E;  2W90 A;  1CIE A;  4BWN A;  2Q7C A;  1M57 D;  5DF5 A;  1VQ7 P;  4IL6 H;  4NPE A;  3CX5 I;  2A45 G;  1NGM B;  2E76 B;  1VL2 A;  2R5D A;  1SQV J;  1GKS A;  1FZF A;  1JTH B;  2CXB A;  1X8Y A;  2OYH B;  1GQ1 A;  1I55 A;  1YQ4 C;  1BGY E;  4XYD B;  3RK2 B;  3GF7 A;  1BL9 A;  1URQ A;  2POH A;  2ZXE B;  1L4A A;  4ASV A;  3RL0 D;  3FX0 A;  1SQV G;  1KIL A;  2FY8 A;  3SWY A;  2KK7 A;  3Q5S A;  1JDL A;  4OGQ C;  1KD1 Q;  4AAO A;  1WEJ F;  4AAL A;  3PHL A;  4TT3 H;  2AXT E;  1OAE A;  4O1W A;  1WMK A;  2RN0 A;  1K04 A;  1WVE C;  3ABV C;  1SQP D;  3DMI A;  3AEG C;  1N8R Q;  3GF3 A;  3DP5 A;  4WQ9 A;  1R8E A;  4JCG A;  1N7S A;  1HGZ A;  2KI7 B;  1JTH A;  1RF1 A;  4J20 A;  1YI2 P;  1N73 B;  1PZQ A;  1F1F A;  3Q5P A;  1VDF A;  1VQK P;  3WU2 E;  2ZON G;  1JNM A;  2K3R A;  2C1V A;  1JMM A;  3V6I A;  5EFW B;  3MZW B;  1MUU A;  2BLF B;  3CI9 A;  1MG3 D;  2XDJ A;  2C1D B;  3LID A;  1FI3 A;  1KFM A;  2KZI A;  5BVZ A;  2KZJ A;  3B5N C;  3L72 J;  1IK9 A;  3WUT A;  1YIC A;  3ZCF A;  3QH9 A;  3RL0 B;  1K8A Q;  2OYI B;  4PJ0 V;  2QG4 A;  3KZI H;  1YIQ A;  2HV4 A;  1JY3 P;  2FWL A;  1OW7 A;  4FA9 A;  1CRI A;  2R3C A;  4YE1 A;  5B66 E;  3AEA C;  1HBW A;  1OVU A;  2HG5 D;  1BDD A;  1W2E A;  1S1C X;  2G8Y A;  3KQG A;  3LW5 J;  1N86 A;  1DIQ C;  2Q3I A;  3HRN A;  4WQ7 A;  5DJU B;  1GZL A;  4GIF A;  5TIS H;  1IRW A;  1NTK J;  4Y99 B;  1B7V A;  1QL1 A;  2HLO A;  1SFC B;  5KJ7 D;  1CYJ A;  1LNQ A;  1USD A;  3IAO A;  2E5Y A;  2VRS A;  3RK3 B;  2C1D A;  4Y5R A;  2O1J A;  2W6A A;  3IFM A;  4I6M C;  5CCH C;  4Q5P A;  3L73 D;  3H1J J;  2NPS D;  1OMI A;  1FZC A;  2GC4 D;  4L74 A;  1PP9 E;  5AVW B;  3PXT A;  1H9X A;  4KJM A;  2QEX P;  2OYI A;  4WY4 C;  3CCS P;  4EI2 A;  3H1I J;  4JYC A;  1EDK A;  4YPC A;  3H6P A;  3B8E B;  1L9J C;  1N90 A;  2BCC J;  1PP9 D;  1GU4 A;  4NPD A;  2R44 A;  2WVR A;  2YK3 A;  3MP7 B;  1L0L E;  1SVF A;  1CTY A;  3H1I G;  2H89 C;  1AOF A;  2KS1 B;  3NXS A;  3E1I A;  3A7O A;  3BCC J;  2L91 A;  1L0L D;  2I8D A;  1L9B C;  1SQX J;  1YBK A;  2B11 B;  1LTA C;  3HE5 B;  3D6Z A;  4PV1 D;  1YJW P;  2ZT9 D;  2WWW A;  1QL4 A;  3BCC G;  3MUD A;  1DD4 A;  1NTZ E;  4W80 A;  1KQL A;  1JY2 N;  1YIJ P;  2N3B A;  3L71 G;  3I55 P;  1KIL C;  3GHG C;  1E79 H;  1KYO I;  4WBA A;  4WQA A;  1BSH A;  1CO6 A;  3OCD A;  1CXC A;  1EZV D;  4UB8 E;  1CRH A;  1NTZ D;  2C9L Y;  3V5B A;  1KB9 D;  1EB7 A;  2FBW C;  2KS1 A;  1VQO P;  1SQV E;  5AW0 B;  3VMZ A;  2AIU A;  2KNC A;  1DW1 A;  2XTS B;  3D70 A;  1AYG A;  2WSC H;  1CSV A;  3HE5 A;  3FWL A;  5KJ7 A;  1N7S C;  2WPV B;  1SQV D;  3PXW A;  3AE8 C;  3CXH E;  1CSB A;  2YKQ A;  3E7K A;  3M0D A;  1CHH A;  1QKS A;  3IR9 A;  2ZZS 1;  1BCC G;  1LWU C;  2NPS A;  5APV A;  4I7Z C;  2FRC A;  2E74 C;  3A9F A;  2R32 A;  5AVS B;  2Y0D A;  4UB6 E;  1FBM A;  3ZOX A;  3CX5 E;  1G2C B;  1U75 B;  2JWD A;  1OX3 A;  1FCD C;  3FGA D;  5CYT R;  1AVY A;  1T3U A;  3CCJ P;  1SQV K;  5GTH E;  1FDO A;  3CX5 D;  3UIA A;  1NYH A;  3VMY A;  2KSE A;  1A02 F;  1LT1 A;  1IFJ A;  5APS A;  1NNO A;  4PD4 I;  2KXP B;  1LT9 C;  3L72 E;  3TF5 A;  1YIT P;  1JOC A;  3W67 A;  4CPG A;  4H0L B;  3U1A A;  1KOR A;  3CCR P;  3M9Q A;  1AQ5 A;  2C9N Y;  1AVO A;  1CYC A;  2Y9Z A;  3L72 D;  2YIU B;  1G2C A;  4HKZ H;  2JQR A;  2QJP B;  2YKO A;  2A06 D;  2H88 C;  3ZOY A;  1NTK E;  4K35 A;  1JM0 A;  1DVH A;  3WC8 A;  1BE3 J;  1H32 A;  3C1L A;  3PH2 B;  451C A;  4B86 A;  1NOH A;  1ZLL A;  1LMS A;  1SQQ G;  1NTK D;  1IO4 A;  1RE3 A;  1DII C;  5AUR A;  1S3J A;  5KLI C;  4DOJ A;  3HD7 C;  3B4S A;  4Y28 J;  2O1K A;  1M6Z A;  2FXO A;  1BGY J;  1CZQ A;  4OGQ B;  2AXC A;  4H44 D;  1C6O A;  3H1I E;  1LTB C;  1ZME C;  3H1J D;  1I54 A;  2LR2 A;  2ZYG A;  3MUD C;  4GKG A;  4O1Q A;  1WRG A;  1RAQ A;  4MU8 A;  5CIB B;  3H1I D;  3OA8 B;  3A0H V;  1CTZ A;  3Q5R A;  2BCC D;  2Q5U A;  4MN4 C;  1RZ5 A;  3BCC E;  5CCH D;  1DIP A;  2YKP A;  3P8M C;  2K1A A;  1C6R A;  2O01 H;  4EYY Q;  3L4O A;  4AX3 A;  4EDF A;  2LKM A;  3BCC D;  1IFM A;  4O9B A;  1GK4 A;  1T2K D;  1IFN A;  2IZ0 A;  1SQX D;  1MKM A;  3B5N B;  2HPC B;  2I8F A;  4QMA A;  1CYI A;  2DGE A;  2P10 A;  1CRG A;  3MIW A;  1KQS O;  3TGU J;  2BCN B;  1DEE G;  2AXT H;  5AW7 B;  3L74 J;  4BXL A;  3M0D C;  4EIE A;  2Z4E A;  1CXA A;  1JEK A;  4I2L C;  3G4S P;  1K05 A;  2BH4 X;  3TGU G;  1GW3 A;  1OIP A;  1YHQ P;  1KB0 A;  5GTI E;  1FAV A;  2JO1 A;  2HR3 A;  2Y0E A;  2E42 A;  5B6Q A;  2W8Z A;  2Y9Y A;  1BCC E;  2WPQ A;  1DH3 A;  3AE7 C;  1NJI Q;  2OQQ A;  1LTS C;  1M7L A;  1PGP A;  1S9K E;  2YMY A;  3B5N A;  2HPC A;  2J5U A;  1KYO E;  3N4X A;  3CWB G;  4QAO A;  2B89 A;  4WY4 B;  4GT1 A;  2JEE A;  3HE4 B;  1X9V A;  1VF5 D;  2IDB A;  3P8C D;  3VYI A;  3Q2Y A;  2B12 B;  1S9K D;  2ZOO A;  2J58 A;  1EXJ A;  1KYO D;  1H31 A;  2OTK E;  5B66 H;  2ZT9 C;  2ZVO B;  2WSE J;  1R5L A;  2C0X A;  2N9Y B;  5AW9 B;  1KMI Z;  2GIW A;  5B5E H;  2QRX A;  1S6V B;  3SSU A;  4YXW H;  4NFG B;  4IOI H;  1JCC A;  5DJQ C;  3AEE C;  3L4M A;  2M5A B;  1W5C E;  2RMZ A;  3IF4 A;  5CCH A;  3KZI V;  2M8R A;  1FZE A;  3O6Q A;  5KAF H;  4GDO A;  4H13 C;  3ZOW A;  3VMX A;  3K5B A;  1P84 I;  3NTN A;  3V2Q A;  3OAK A;  2K88 A;  2SPZ A;  4PW9 B;  1HH0 A;  1U57 A;  1GL2 D;  2IYP A;  2D0S A;  2IZ1 A;  5TIS V;  1RE3 C;  2N9J A;  3PTZ A;  2H43 A;  1KIL B;  2V07 A;  3A0B E;  1YEA A;  2WT7 B;  2WSS H;  2N9I A;  4YTP C;  3D0W A;  1JY3 N;  1PGJ A;  4Z1M H;  1CHI A;  4PD4 E;  1IZN B;  1QL2 A;  2N9B A;  3CCE P;  4XE5 B;  4C7N A;  2N18 C;  1HRO A;  2P2U A;  2M5A A;  5AVX B;  3F5H A;  2QM8 A;  2JWA A;  1N7S B;  1BE3 D;  1RF1 B;  4PD4 D;  1W5C T;  1RY3 A;  1NH4 A;  3TSI A;  1NML A;  1Y9B A;  5APU A;  1YCC A;  1VQ6 P;  1YJN P;  1GU5 A;  5K5G B;  3VTP C;  1Q7Y Q;  1ZR2 A;  2BEQ D;  1LWU B;  2DW3 A;  4I7Z B;  2E74 B;  2JDI H;  5APQ A;  1KB9 H;  3GHG A;  2HYN A;  2WT7 A;  1N7L A;  3VP8 A;  3W68 A;  2E75 C;  3N7N A;  2ZXY A;  1BGY D;  2MHM A;  2XNX A;  2ZVN B;  1W2B O;  1SQQ K;  1KV9 A;  4UB8 H;  2ZYA A;  2LXC B;  1MFZ A;  3BRT B;  1LC1 A;  3HQ7 A;  1NTM G;  2QJY C;  1FDM A;  1IRV A;  4DZO A;  2PCC B;  3L75 G;  1KV4 A;  1QLE D;  4HB1 A;  1SP4 A;  2IFM A;  3WMM 0;  3HD7 D;  3SFD C;  3D71 A;  1R5S A;  5TJH A;  2WZ7 A;  3M0A A;  5E79 E;  3CMA P;  1SLQ A;  1LT9 B;  2V08 A;  1IZL 0;  1IO3 A;  3H1K G;  1UIX A;  1DW3 A;  1YFC A;  1N50 A;  1T6A A;  3KPE A;  3CCU P;  1L0N J;  1LWU A;  1FZA A;  1N15 A;  2Z5I A;  4H0K A;  1RHZ B;  3TGU E;  2CE0 A;  3ORV A;  3L74 E;  3GLM A;  1FZC B;  1GL2 A;  4H0J A;  1L0N G;  5AW1 B;  3JBT B;  3TGU D;  1LP1 A;  4ASW A;  5KAI V;  2RH0 A;  1JO5 A;  3L74 D;  4H44 C;  4OWF A;  2C9X B;  4GOE A;  1KX2 A;  1JMB A;  1NKN A;  2P58 A;  1YEB A;  2CE1 A;  3L37 A;  2R5B A;  1PGO A;  2ZAE B;  1MV8 A;  1LTG C;  1M1J C;  1LT9 A;  5H2F E;  1DW0 A;  2K9J A;  1COR A;  2B0Z B;  1T3J A;  5KLI B;  3CCM P;  3H1L G;  5AVU B;  4EIF A;  3C2C A;  3TK1 A;  3VRD A;  1VQP P;  5DJT B;  3WFB C;  5KLV G;  1IC2 A;  3SWF A;  2P1J A;  3LW5 H;  2L4D A;  1T2K C;  3CCL P;  3O8Z A;  3II6 A;  1FE6 A;  5APY A;  3O1Y A;  3I56 P;  1U7M A;  3MK7 C;  4HJG H;  3OCD B;  2M3E A;  2D2C D;  2V7Q H;  3BAS A;  1FJP A;  3BAT A;  2JP3 A;  1OW6 A;  2QM7 A;  2ZYD A;  3CD6 P;  1YTZ I;  5AW4 B;  3G9R A;  3G3Z A;  3HD7 A;  2KNC B;  3CC7 P;  2B87 B;  1J1D C;  1HH7 A;  2Z5H A;  3L71 J;  3AE1 C;  4LLH A;  2XZR A;  1SQB J;  2XV5 A;  1IFP A;  1I6E A;  1IK7 A;  1OCD A;  2NZ2 A;  2C0W A;  1HRC A;  4IL6 E;  3AE3 C;  2MTA C;  2NPS B;  2GUV A;  2YXR B;  3QWO C;  5BU8 B;  4U3F J;  5APX A;  3E1R A;  4L3H A;  1S2E A;  1SQB G;  2DVH A;  1XTG B;  1VF5 C;  2I1J A;  3C9I A;  3U1C A;  1YTC A;  1YQ3 C;  4H13 D;  1P84 E;  1VQM P;  3KDP B;  1R0Q A;  4U3F G;  3AE5 C;  1NU1 G;  1S5L H;  4DJG A;  1I8O A;  4EOT A;  2E5T A;  2OAR A;  4R4M A;  3H1H G;  2B87 A;  1EC5 A;  1P84 D;  1BCC J;  3PLN A;  5KAI H;  4L73 A;  4I1L A;  3WUI A;  3BVH A;  1QX8 A;  5AVQ B;  1XTC C;  3TNU A;  3AE2 C;  4PV1 B;  2ZT9 B;  1FI9 A;  3Q1M A;  3CXH D;  1DEB A;  1WT6 A;  2OYH C;  2N3Y A;  1GL2 C;  4NPF X;  5GTI H;  1JB0 J;  3H1K E;  1NWQ A;  2FYU G;  2KYV A;  1CIG A;  3WFE C;  5DJQ B;  1YNR A;  2PCB B;  1GTW A;  2GA1 A;  1T8Z A;  1COT A;  2AXT V;  2LXB A;  2WSF H;  4H13 B;  1L0N E;  1H32 B;  1KYO H;  1FU1 A;  2E75 D;  4IFM A;  1Q86 Q;  1CED A;  2C8S A;  2MJZ A;  1HF9 A;  3SFE C;  1ETP A;  1NTM K;  4YXD C;  5C39 A;  3AE9 C;  2IPP A;  1HUC A;  2CK3 H;  3H25 A;  1NAF A;  1L0N D;  1QN2 A;  1HGV A;  1GMJ A;  2JJL A;  5TIS E;  3WU2 V;  1ZR4 A;  5AW3 B;  1Q82 Q;  2WMM A;  2IFN A;  1M90 Q;  5CHX A;  4K3I A;  3H1L E;  5BU5 A;  2N18 B;  3JC2 2;  1SQQ J;  1SS1 A;  2E43 A;  1N2D C;  5AW8 B;  3U59 A;  1E29 A;  1CSW A;  1Z56 A;  1PPJ G;  1L0N K;  1RH5 B;  3G6E P;  5KLV E;  2L5G B;  5B66 V;  4WQD A;  1EDJ A;  4WQC A;  1IFI A;  4D6T G;  3O20 A;  1GDV A;  5B5E V;  3FXE A;  1CW5 A;  4LJI A;  3CME P;  3CXH W;  2E75 B;  4ZKU A;  3HQ8 A;  3B71 A;  1MZ9 A;  4Y99 C;  1HZU A;  2YXQ B;  1SFC C;  5KAF V;  1ZN5 A;  1CIH A;  2QJY B;  3CX5 W;  3EFG A;  1MG2 D;  2O01 J;  2W6J H;  3R4Y A;  2IX7 C;  3HUS A;  4RSZ A;  3M97 X;  3NMD A;  3M91 A;  2BGV X;  5KLV K;  2AI5 A;  4LC1 A;  2GB8 B;  1USE A;  3L71 E;  1QL3 A;  1G1I A;  1KIB A;  3CC4 P;  1SQB E;  3AEF C;  4FA1 A;  1OZH A;  2OTJ P;  3CC2 P;  3AE4 C;  4FAN A;  1OXZ A;  3ZDM A;  1SQP G;  1H0T B;  3L71 D;  4U3F E;  1NU1 E;  5AVY B;  1DX7 A;  1FOC A;  1VQL P;  3IN6 A;  2LIR A;  1JUN A;  2R3S A;  1SQB D;  1GD2 E;  4H44 B;  4PJ0 E;  3H1H E;  1IJD B;  1H31 B;  2N1T D;  4U3F D;  3EWK A;  1DD3 A;  4KHX A;  4R4L A;  3CCQ P;  1A2S A;  1L2P A;  1M1J B;  3ITK A;  3X39 A;  5E79 H;  2P67 A;  2PFX A;  3CWB J;  4N6J A;  3WU2 H;  4UB8 V;  2IBZ I;  3S4R A;  2UWJ E;  4W7Y A;  1SQB K;  2D2C C;  3O6Q B;  1I8P A;  3GW6 A;  2K9Y A;  1H0T A;  1BCC D;  4HYT B;  1NU1 K;  4HH2 A;  4IFD K;  2PGD A;  3ZOO A;  1M8O B;  1KTM A;  3MTU E;  1L4A D;  2W27 A;  1RQU A;  2Q1K A;  1HJ0 A;  1EDI A;  1E5W A;  1GJQ A;  4JBZ A;  1YTZ T;  1M1J A;  1CI6 A;  3L73 G;  4JQ0 D;  1C75 A;  1AKK A;  2Q9I A;  5H2F H;  1IFD A;  1H33 A;  1CHJ A;  2B4Z A;  3R2P A;  2O01 N;  4C7N B;  1RZ6 A;  1M60 A;  4L75 A;  1J1D B;  3O0R C;  3VMA A;  2IBZ G;  3L36 A;  1CTJ A;  2FFD C;  1EZV I;  5AVV B;  3M9H A;  1PP9 G;  5GTH V;  3I5C A;  2FYU K;  3RLM A;  1KB9 I;  1EDL A;  2ZBO A;  1GU2 A;  3RK2 D;  5CID B;  3JSV C;  1M56 D;  1RE4 A;  3GHG B;  1N9C A;  3VP9 A;  4DY9 A;  1FJK A;  2FYZ A;  2C1U A;  3PRJ A;  1KC8 Q;  1VF5 B;  2I1K A;  1L0L G;  2V4H A;  1SQQ E;  2W83 C;  5AW6 B;  1K3G A;  1M1K Q;  1JCD A;  4LGD E;  1HJ5 A;  1OVR A;  1F1C A;  5CCG C;  2YQB A;  3A2A A;  1LGH B;  3V2P A;  1W2L A;  3L35 A;  2HOD B;  1SQQ D;  4U7J A;  5CIE B;  1PGQ A;  3VYM A;  1NAY A;  3ZIY A;  1HCM A;  3HUS C;  3USS A;  4IFF A;  1CRY A;  4DT0 A;  1CSX A;  4WQE A;  1EZV G;  1KYO W;  4XA4 A;  1NTZ G;  5AVZ B;  2H7H A;  2P7J A;  2GUS A;  3PH0 A;  2YO2 A;  2A45 H;  1NTM J;  1VQ5 P;  2KOG A;  1G1J A;  5AW5 B;  1GL2 B;  3L75 J;  1P84 H;  1GK6 A;  1GDT A;  1LP1 B;  2EXV A;  2HOD A;  3RBX A;  5DFS A;  3H1K J;  1SQP E;  5M1B A;  1VQ4 P;  1CNO A;  3BRV B;  1CCR A;  3RK3 E;  1QVF O;  1VQN P;  5EXQ A;  2JR8 A;  4ZNC A;  1VQ9 P;  3CXH H;  3MGN A;  1RF0 C;  3DR0 A;  3JCU E;  2K9J B;  2WQY C;  3MHV A;  4KMG A;  1SFC D;  1S4X A;  3C8V A;  2AEF A;  2KLV A;  1LTJ C;  1QGK B;  1J1E C;  2D0W A;  3RK3 D;  3RN0 A;  4UB6 H;  3VOP A;  2OYH A;  3F89 A;  1S5L V;  1FOS E;  1KN7 A;  3GMA A;  1IQC A;  3CX5 H;  4WQB A;  1J2J B;  1HJ4 A;  3V4W A;  3RMZ A;  5CIH B;  3HQ6 A;  1H89 A;  5GTH H;  1HJB A;  2FYN C;  1NKZ B;  2QJK C;  1QVG O;  3CWB E;  3L70 J;  2Q6Q A;  2KIK A;  5KKZ C;  1SQP K;  2IYO A;  3H1L J;  4OVN F;  1QYZ A;  3V4Q A;  5KTB A;  3WUV A;  1NIR A;  1C52 A;  3L72 G;  4L76 A;  3L70 G;  3CWB D;  4XXL A;  5GTI V;  2FKW B;  3HD7 B;  5KLV J;  2A06 G;  3FXD A;  5B5E E;  1N73 A;  3L73 E;  2O3J A;  2CA3 B;  1PFI A;  2GM4 A;  1AQT A;  1FC2 C;  3LIE A;  3WFD C;  2V7Q J;  3O5C A;  3RL0 g;  1I6D A;  3AE6 C;  4TLF A;  5C9M A;  1K3H A;  1NTK G;  1OW8 A;  5KAF E;  3CPW O;  3V2R A;  3FWN A;  1RE4 C;  2IBZ E;  5CJ0 A;  4C7R A;  1HWT C;  3NBS A;  2ORL A;  3A0H E;  1GW4 A;  4GOD A;  1CIF A;  4BRY B;  3H1J G;  1LS9 A;  3KYQ A;  2IBZ D;  2N1T C;  2RKL A;  3P7K A;  3H32 B;  1E8E A;  3SWS A;  2CPB A;  2PAJ A;  4WVZ A;  3WUU A;  2WTY A;  2J59 M;  1Y8A A;  1HTL C;  1S5L X;  2BCC G;  4RJT A;  1SFC A;  4N3Y B;  2FXP A;  1EXI A;  4FB1 A;  2GC7 D; 
#chains in the Genus database with same CATH homology
 4QAO A;  1E29 A;  1CSW A;  1OAE A;  4O1W A;  1DW2 A;  2RN0 A;  1E2R A;  1WVE C;  2B12 B;  5B66 V;  1SQP D;  3DMI A;  2ZOO A;  4WQD A;  3DP5 A;  4WQ9 A;  3PXS A;  1KYO D;  2PAC A;  4WQC A;  1H31 A;  4JCG A;  3CU4 A;  3O20 A;  4J20 A;  5C0Z A;  1GDV A;  3A0B V;  5B5E V;  1F1F A;  4LJI A;  2N9Y B;  3CXH W;  2GIW A;  2ZON G;  1S6V B;  1C2R A;  2C1V A;  3HQ8 A;  1CRJ A;  1KX7 A;  4P4Q B;  4NFG B;  2BLF B;  1MG3 D;  2C1D B;  5DJQ C;  1FI3 A;  1HZU A;  2Y0C A;  3L4M A;  5KAF V;  3GG2 A;  1CIH A;  2QJY B;  2RMZ A;  3CX5 W;  3KZI V;  1YIC A;  3ZCF A;  1MG2 D;  4PJ0 V;  2QG4 A;  3ZOW A;  1YIQ A;  2HV4 A;  2FWL A;  4FA9 A;  1CRI A;  4PW9 B;  4RSZ A;  3M97 X;  4YE1 A;  3SVW A;  2D0S A;  2BGV X;  5TIS V;  2AI5 A;  1NTM D;  2N9J A;  4L3G A;  3PTZ A;  1LFM A;  1DIQ C;  2GB8 B;  4A7P A;  2V07 A;  4WQ7 A;  1YEA A;  1QL3 A;  2N9I A;  3L75 D;  1IRW A;  1KIB A;  1B7V A;  1CYJ A;  4FA1 A;  4FA5 A;  4FAN A;  4N0K A;  4AAM A;  1CHI A;  1HJ3 A;  2C1D A;  3L71 D;  4Y5R A;  3H1K D;  1M70 A;  1FOC A;  3WFC C;  4Q5P A;  2LIR A;  3L73 D;  2N18 C;  1HRO A;  1SQB D;  3TDK A;  2GC4 D;  4WQ8 A;  3PXT A;  1H9X A;  4GYD A;  2Q3E A;  2OZ1 B;  1MZ4 A;  2JWA A;  1H31 B;  1BE3 D;  4FAV A;  4PD4 D;  1W5C T;  4U3F D;  1NML A;  1YCC A;  5E79 V;  1H9Y A;  1L9J C;  1N90 A;  1A2S A;  3ITK A;  1PP9 D;  3X39 A;  2YK3 A;  1CTY A;  2ZXY A;  4UB8 V;  1BGY D;  2MHM A;  1AOF A;  1CC5 A;  1ZZH A;  1I8P A;  1KV9 A;  3GW6 A;  3RN1 A;  1RAP A;  1LC1 A;  2L91 A;  1BCC D;  1L0L D;  1L9B C;  3HQ7 A;  3L70 D;  1IRV A;  3SJL A;  3ZOO A;  2PCC B;  2B11 B;  3H1L D;  1QL4 A;  2OZ1 A;  2YCC A;  5TJH A;  2LIT A;  351C A;  2V08 A;  2N3B A;  1IZL 0;  1GJQ A;  1IO3 A;  5KLV D;  1U74 B;  3KHU A;  1DW3 A;  1YFC A;  1N50 A;  5H2F V;  1C75 A;  4WQA A;  1AKK A;  1N15 A;  1H33 A;  1CHJ A;  1CO6 A;  2B4Z A;  3OCD A;  4H0K A;  1CXC A;  1EZV D;  1I5T A;  4EID A;  2CE0 A;  1CRH A;  3ORV A;  1NTZ D;  1KB9 D;  1EB7 A;  1RZ6 A;  1M60 A;  2KS1 A;  4H0J A;  3O0R C;  3VMA A;  3JBT B;  1CTJ A;  2AIU A;  1C6S A;  1DW1 A;  2XTS B;  1FI7 A;  5GTH V;  3TGU D;  1AYG A;  1C7M A;  5KAI V;  5IY5 1;  3RLM A;  3L74 D;  1CSV A;  3FWL A;  2ZBO A;  2C9X B;  1FHB A;  1KX2 A;  1GU2 A;  1CCH A;  5CID B;  1YEB A;  2CE1 A;  1SQV D;  3PXW A;  1N9C A;  4DY9 A;  1CHH A;  1QKS A;  2C1U A;  3PRJ A;  1J3S A;  2ZZS 1;  3VNW A;  2FRC A;  1DW0 A;  3A9F A;  1COR A;  2B0Z B;  1CSU A;  2Y0D A;  5KLI B;  1K3G A;  3ZOX A;  4EIF A;  1HJ5 A;  1F1C A;  3C2C A;  4AAN A;  5CIF B;  3SXT A;  2YQB A;  1U75 B;  1W2L A;  3VRD A;  1SQQ D;  1FCD C;  3HQ9 A;  5CIE B;  5CYT R;  3VYM A;  2C2C A;  3CP5 A;  155C A;  2FYN B;  3ZIY A;  2QJK B;  3WFB C;  1HCM A;  3CX5 D;  1NU1 D;  2L4D A;  5KKZ B;  1CRY A;  1CSX A;  3SLE A;  4WQE A;  4IL6 V;  2BH5 X;  3O1Y A;  2B10 B;  1KYO W;  3H1H D;  3MK7 C;  1NNO A;  1A8C A;  3OA8 A;  1H33 B;  3OCD B;  3TF5 A;  1H1O A;  1C2N A;  5CIG B;  1CYC A;  2KNC B;  4EIC A;  3L72 D;  2YIU B;  2JQR A;  2VHD A;  2EXV A;  1LC2 A;  1HH7 A;  4V2K A;  2QJP B;  5DFS A;  2A06 D;  1CNO A;  3ZOY A;  1DT1 A;  1I6E A;  2FYU D;  1OCD A;  1CCR A;  3CYT I;  3MK7 B;  1HRC A;  5EXQ A;  1DVH A;  3WC8 A;  2MTA C;  1GIW A;  3DR0 A;  1H32 A;  2K9J B;  3ZBM A;  4PWA A;  4KMG A;  4L3H A;  3PH2 B;  451C A;  2DVH A;  4UB6 V;  1CRC A;  1LMS A;  1ZRT D;  1NTK D;  2D0W A;  1HZV A;  1YTC A;  3RN0 A;  1DII C;  1S5L V;  5AUR A;  1R0Q A;  1IQC A;  1A56 A;  4WQB A;  1M6Z A;  1HJ4 A;  1I8O A;  1C6O A;  1NMI A;  3RMZ A;  5CIH B;  1FJ0 A;  3HQ6 A;  3H1J D;  4FA4 A;  1I54 A;  5CIC B;  4L1Q A;  1P84 D;  3PLN A;  4O1Q A;  3NBT A;  1RAQ A;  4MU8 A;  1VYD A;  3WUI A;  5CIB B;  3H1I D;  3OA8 B;  2JTI B;  3A0H V;  1CTZ A;  1QYZ A;  2BCC D;  1NIR A;  3NWV A;  1C52 A;  1RZ5 A;  3CWB D;  1FI9 A;  4XXL A;  5GTI V;  3CXH D;  1PPJ D;  2N3Y A;  1AOQ A;  1C6R A;  1DVV A;  2BPB B;  3L4O A;  3TYI A;  4AX3 A;  1CIG A;  3WFE C;  2CA3 B;  2O3J A;  4EDF A;  5DJQ B;  3BCC D;  1YNR A;  2PCB B;  4D6T D;  4GED B;  2CA4 B;  1SQX D;  2I8F A;  3WFD C;  1COT A;  1CYI A;  2DGE A;  3O5C A;  1I6D A;  2AXT V;  1CIE A;  1CRG A;  5C9M A;  1K3H A;  1H32 B;  2BCN B;  5DF5 A;  1CED A;  2C8S A;  3NBS A;  2ORL A;  4EIE A;  1ETP A;  1CXA A;  1CIF A;  1GKS A;  2CXB A;  1GQ1 A;  2BH4 X;  1L0N D;  1I55 A;  1QN2 A;  1LS9 A;  4XYD B;  2IBZ D;  1KB0 A;  1BL9 A;  3WU2 V;  2Y0E A;  1E8E A;  3SWS A;  5B6Q A;  1JDL A;  4K3I A;  4RJT A;  4AAO A;  1WEJ F;  4AAL A;  3PHL A;  2N18 B;  4FB1 A;  2GC7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...