1NTKD

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 51
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntkD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntkD01
1HZVA 1CO6A 3WFEC 1NU1D 1DIQC 1LMSA 1CNOA 2FYNB 1H32B 4WQ7A 2GB8B 3CU4A 3WFBC 2QG4A 1CHHA 2OZ1A 1H31A 3KZIV 1CORA 4P4QB 3SVWA 3H1LD 5TISV 2BCNB 1CEDA 3HQ9A 2VHDA 2IBZD 3X39A 3DR0A 2BPBB 1NNOA 3SLEA 1LC1A 1CSWA 2CE1A 1DW2A 1HRCA 2AI5A 1N15A 1IRVA 1U74B 1YEBA 1A8CA 2BH5X 2Q3EA 2HV4A 1SQVD 1KYOW 2A06D 4PW9B 1CIFA 1HJ4A 1MG2D 5DJQC 1HJ3A 3KHUA 1E8EA 3RN0A 1CRIA 3L4OA 2QJYB 2V07A 2ZONG 3PXSA 1GIWA 1CC5A 1F1CA 3ORVA 3PXTA 2RMZA 1U75B 1DT1A 2PCBB 3OA8A 1CSVA 1A2SA 2RN0A 3PXWA 1I8OA 3VYMA 1GQ1A 1C6OA 5CIHB 1H33A 1CIHA 1NMIA 1CHIA 1CRYA 3DP5A 1LFMA 2YCCA 3ZIYA 3WC8A 2YQBA 3PHLA 1C7MA 2ZOOA 4V2KA 2ZBOA 3TYIA 2C2CA 5KLVD 3BCCD 1L9JC 2O3JA 1N9CA 4AX3A 1CRGA 1SQPD 2Y0DA 4XXLA 1ETPA 2C1DB 1CIGA 1CTZA 3M97X 4XYDB 3OCDB 1CYCA 2CA3B 1M70A 4WQ9A 1CRHA 1QL3A 1CTJA 3L71D 1IO3A 1LC2A 2V08A 3ZBMA 1K3HA 1FCDC 2FRCA 1AYGA 1NTMD 3WFDC 4EIDA 3VMAA 1DW0A 2GC7D 3H1ID 3L75D 4D6TD 2L4DA 2QJKB 1ZZHA 3SWSA 4WQDA 1AOQA 2CA4B 1CSXA 1P84D 2N9YB 4A7PA 2YK3A 5C9MA 1I6DA 2KS1A 1RZ6A 2DVHA 1B7VA 1GU2A 1BL9A 1A56A 3L70D 1DVHA 1FOCA 2CE0A 1OCDA 4J20A 5CIFB 2AXTV 2BLFB 3CX5W 1PPJD 3HQ6A 3VRDA 4AAMA 1YCCA 1CRJA 4FA5A 3WU2V 3HQ7A 3A0HV 5H2FV 3TDKA 3CYTI 5GTHV 1HH7A 1WEJF 1H1OA 2LITA 3NWVA 4FANA 1L9BC 2C8SA 3NBTA 1NTZD 1YTCA 4H0JA 1I5TA 4QAOA 1NIRA 3L4MA 3CX5D 1RAQA 3O20A 155CA 1YICA 4NFGB 5TJHA 2MTAC 3L74D 1L0LD 3SJLA 2FYUD 2ZXYA 1FI9A 1M6ZA 3FWLA 1CYIA 5KAFV 2LIRA 1MG3D 2I8FA 2GC4D 2OZ1B 4AAOA 1H31B 4DY9A 4RSZA 1CCRA 4L3HA 4IL6V 1KYOD 4WQEA 4MU8A 5CIEB 3GW6A 1E2RA 1W5CT 1YNRA 2JWAA 3ZOXA 2FWLA 2N3BA 4WQBA 1HJ5A 2Y0EA 5AURA 1H9YA 4WQ8A 5B66V 3TGUD 1C6RA 4FA1A 4GYDA 1N50A 2GIWA 2D0WA 3CP5A 3MK7C 1OAEA 2ORLA 1KX7A 2PCCB 1N90A 2C1VA 2BCCD 2MHMA 4JCGA 4YE1A 1BGYD 1SQBD 3O1YA 3OA8B 4O1QA 3RN1A 1GDVA 3O5CA 1GJQA 1QL4A 3ZOOA 2B4ZA 5DJQB 2B12B 3ZOYA 1YEAA 1HCMA 1FI3A 1PP9D 4PWAA 4EIFA 1F1FA 1FI7A 1CXCA 5CIBB 1H33B 5B6QA 5DFSA 3A0BV 3L72D 1AKKA 5GTIV 5E79V 2DGEA 1LS9A 1RAPA 1DW1A 5CYTR 1IRWA 1BCCD 2Y0CA 2EXVA 4AALA 1CHJA 1C75A 1QKSA 4L3GA 1I54A 4WQCA 5KLIB 1FHBA 1C52A 1ZRTD 1E29A 2BH4X 1EB7A 2QJPB 1KB0A 4WQAA 4L1QA 1KB9D 3H1HD 1SQXD 4U3FD 1H9XA 4UB8V 3RMZA 3WUIA 3DMIA 5KAIV 1RZ5A 1S5LV 2N18C 3MK7B 3TF5A 2D0SA 1VYDA 2YIUB 1CXAA 2JTIB 5CIGB 1DVVA 3CWBD 4RJTA 1I8PA 1DIIC 4FA4A 4EIEA 4Q5PA 1IZL0 5B5EV 1BE3D 3O0RC 4FAVA 4KMGA 1QYZA 1I55A 1R0QA 1HZUA 3VNWA 1HROA 3PRJA 4GEDB 4H0KA 1KIBA 4O1WA 3RLMA 1FJ0A 4K3IA 1S6VB 2ZZS1 1GKSA 1M60A 5DF5A 1YFCA 5CICB 1CIEA 4UB6V 3A9FA 1CTYA 3H1JD 2JQRA 1I6EA 2C1DA 4PJ0V 3ZCFA 5C0ZA 3OCDA 3C2CA 3GG2A 4PD4D 3JBTB 2N18B 2B0ZB 3H1KD 2B11B 3L73D 3HQ8A 1SQQD 3CXHW 1YIQA 2BGVX 4LJIA 1C2NA 4EDFA 1DW3A 1CSUA 2C9XB 2CXBA 2PACA 4N0KA 1NMLA 5KKZB 2B10B 5EXQA 3PH2B 3PTZA 1EZVD 1QN2A 3SXTA 2KNCB 1J3SA 451CA 2C1UA 4FB1A 2N9IA 1H32A 1AOFA 2N3YA 3CXHD 1KV9A 2N9JA 3WFCC 2AIUA 1COTA 1K3GA 3PLNA 1MZ4A 4EICA 2XTSB 1W2LA 351CA 3ZOWA 1L0ND 2K9JB 4AANA 1JDLA 1WVEC 1CCHA 5IY51 1C6SA 3ITKA 4Y5RA 3NBSA 1NTKD 1CYJA 1C2RA 1CRCA 1IQCA 5CIDB 2L91A 4FA9A 1KX2A
chains in the Genus database with same CATH superfamily
3AE9C 1DIQC 2HR3A 2YXRB 1LMSA 3D0WA 2HODB 2QM7A 4GDOA 1FAVA 1VF5C 4WQ7A 3CU4A 3H1LD 5TISV 1USEA 2E76B 5KLVG 1CEDA 5BU5A 3HQ9A 4L75A 3CCEP 3CX5I 3X39A 1NAFA 3DR0A 2BPBB 4IOIH 3N7NA 1CSWA 1OW7A 3KXDA 2AI5A 3SWKA 3AEFC 1IRVA 1M7LA 4C7RA 3T97B 2A06D 1MG2D 2W6BA 3HTKB 4BXLA 3RN0A 1CRIA 4IL6X 2QJYB 3G4SP 3PXSA 1GIWA 3H1IG 4D6TG 3RL0g 3CL3D 1F1CA 1EDLA 4HJGH 2N9BA 2A45H 1A2SA 3N4XA 3FGAD 1RE3A 1I8OA 3TNUB 3A2AA 4H44B 5AVUB 1CIHA 2Y9YA 2WPRA 1PPJG 2YCCA 1PGOA 3HUSA 1YQ4C 3VN0A 3P8CE 2YQBA 2ZOOA 2Q6QA 5CCGA 2ZBOA 1L0NK 4L76A 2O3JA 3RK2C 1N9CA 1FOSE 4ZMDA 5KLVE 3L70J 3KZIE 1M8OB 1J1DB 3HD7B 1ETPA 1T2KC 4XFJA 3OCDB 3CX5H 2LR2A 1CRHA 1M1JA 2YO3A 1IO3A 3S4RA 5B5EE 1NU1K 5APYA 2V08A 1L4AC 3ZBMA 1Y47A 1K3HA 2YMKA 1AYGA 3USSA 5CJ0A 2QA4P 1YTZT 1NYHA 2LKMA 1KB9I 2L4DA 2QJKB 1NTME 2CA4B 1CSXA 1P84D 3H1IE 2M8RA 4D6TE 3V5BA 1I6DA 2KS1A 1N2DC 1Q81Q 1RZ6A 1B7VA 1PL5A 1DVHA 1EXJA 1OCDA 1GK6A 1HUCA 4J20A 4W7ZA 3CX5W 1YCCA 1CRJA 2H88C 1SQVK 1PPJE 4KT0J 1VQ8P 2FYZA 4O9BA 1HH7A 2LITA 1BGYG 3CC7P 5AW1B 1NTZD 1YTCA 5DJUB 1I5TA 1H0TB 5GTHH 5KKZC 3MTUE 1J2JB 2ZAEB 3O20A 4NFGB 3L74D 1L0LD 2FYUD 3RBXA 1IFMA 2BCCJ 2VRSA 4JPZB 1JB0J 3U1AA 1KYOD 5APTA 5KAFH 4H13D 1PP9J 5CIEB 4WQBA 3L72J 2Y0EA 3V2NA 1SQXG 1TU3F 2P10A 1YQ3C 1LTBC 3TGUD 3AE7C 4FA1A 1MFZA 2E75B 4GYDA 1HGZA 2N1TD 3QWOC 1URQC 3CP5A 2XZRA 1KX7A 2ZXXA 2K9JA 2KP8A 3RGUA 3CC4P 3H1HJ 2QEXP 1KZUB 2C1VA 1N7SB 4HH2A 1GDVA 2OTJP 1WMKA 1BGYE 1SQBE 1T3UA 1LTJC 2RH0A 1CZQA 3CCSP 1K73Q 2XNXA 5DFSA 1NTZJ 1AKKA 5GTIV 1VQKP 2D2CC 3HUSB 3MD0A 1RAPA 4OGQD 2EXVA 4AALA 5AVTB 1CHJA 1C75A 3A0BH 4L3GA 1I54A 4WQCA 5KLIB 1OVVA 4B86A 2QJYC 2Z4EA 2XNDH 1OZHA 2PRRA 1ZLLA 3V4QA 2J58A 3MP7B 1IO4A 2ZT9B 4U3FD 4MN4C 3RK3B 2C9LY 5KAIV 1S5LV 1SQXE 4H0LD 5EFWB 2NPSC 1S1CX 2IBZI 5CCHC 1JOCA 5CIGB 4RKUJ 3CWBD 2PAJA 1M1KQ 1DIIC 1EZVG 2KS1B 1HTLC 1YHQP 1IFIA 3KZIH 3G6EP 4AQRD 2OQQA 5DJTB 1N73B 2BEQD 3M0DA 5B5EH 4H0KA 4ASVA 4KJMA 2GUSA 2O1KA 1G2CB 2N1TA 2V7QJ 1YFCA 4WWIA 3HE4A 1LT9B 3H1JD 3RL0B 2Z5IA 2JQRA 1YIJP 3ZCFA 2MJZA 4PD4D 4UB6H 2FFDB 1VL2A 1JO5A 2FYNC 1KC8Q 3V2QA 1C2NA 1DW3A 2WZ7A 1CSUA 3H1LG 1KFMA 3R4YA 2HFED 4DOJA 3PH2B 3U1CA 1QN2A 1J3SA 1VQPP 2P2UA 2C1UA 1FZGA 1RE4A 1EZVE 2XDJA 2H89C 2WSEH 1ZN5A 3QH9A 2AIUA 2A06G 3CXHE 2KZIA 1H8AA 1ZMEC 5CHXA 2XTSB 351CA 1L0ND 3BRTB 2E74C 3WUUA 1X0TA 1KFNA 2K9JB 4AANA 1JDLA 5BVZA 1WVEC 3E7KA 1CCHA 5IY51 2WSEJ 3BVHA 1CSBA 3ITKA 4Y5RA 1RF1C 1PGJA 3Q3DA 3NBSA 1LNQA 1CRCA 2IPPA 2YXQB 3RK3E 2QSIA 5CIDB 2KXPB 3CCQP 4LC1A 2AEJA 1J1EB 1FDIA 1KX2A 2ZXEB 1CO6A 1NU1D 5CBOA 1FZCA 1AQTA 2QIWA 1IFDA 2QG4A 1H31A 3KZIV 5CBNA 4K35A 1NVOA 3IN6A 1M57D 3H1LE 3L37A 3AECC 1FZAA 5TISH 3G3ZA 1HRCA 2WTYA 1SLQA 1U74B 1R8EA 4IFDK 1A8CA 4I6MC 2Q3EA 1FOSF 1SQVD 2Y9ZA 3M9HA 3AE4C 1BDDA 2O01J 3BCCJ 2R3CA 1JMMA 2A06E 1U57A 4IFMA 1YBKA 2V07A 2ZONG 1SQPJ 2Q7CA 3L72G 5GTIE 1QVFO 3NXSA 3CCLP 2E75D 2PCBB 3OA8A 3L71J 5KLIC 1N7SD 1ZP0C 2NRGA 3VYMA 3M0AA 2M5AA 4H13B 5CIHB 1R5LA 1H33A 3L75J 4NPEA 3DP5A 1LFMA 5KAIE 5KTBA 1M1JC 3WC8A 1YJWP 1C7MA 4V2KA 3TYIA 4AYCA 1L9JC 2N1TB 1ZR4A 1U7JA 1NTZG 1LWUB 2Y0DA 4LLHA 3Q5SA 1IK7A 4XYDB 1SFCD 1CYCA 3LW5J 2CA3B 1M56D 1YI2P 4YXDC 1QL3A 3L74G 3HE5B 2WT7B 1L0LG 4KHXA 4YXWH 1KORA 2A45I 2FYUG 1FCDC 1VQ4P 1VQ5P 1Y8AA 3WFDC 4EIDA 3VYIA 3VMAA 1MV8A 3VMXA 3UIAA 2IYPA 1H0TA 1AOQA 2CPSA 4OGQB 1P84E 5KJ7D 4C7NA 1GU2A 1BL9A 3L70D 2WITA 3TGUG 2MKVA 5CIFB 2FXMA 2HYNA 4AAMA 1LJ2A 1Q82Q 1JY3N 3A0HV 5H2FV 3TDKA 3WMM0 2OYIA 1HGVA 3KYQA 3MUDC 3AE6C 4H0LB 3B5NC 2C8SA 3L4MA 3OA7A 3CX5D 1EXIA 1NTZE 1YICA 3CLQA 4M3LA 3HRNA 1FZCB 3SJLA 3RL0D 3H32B 3CMEP 1M6ZA 3O6QA 3L74E 3K5BA 1CYIA 1L0LE 1H31B 2FYUE 1N7SA 4Y99C 2ZVNB 4IL6V 1GW4A 1VF5D 4WQEA 2KNCA 4XE5B 1FC2C 1W5CT 1HJBA 1KYOE 2IZ0A 1FU1A 2N3BA 1X22A 1SQPK 1UIXA 4U3FG 3P7KA 1Q90D 4JYBA 1BCCJ 2R5DA 2WPSA 1J1EC 1N50A 1SFCA 3TGUE 3D71A 2D0WA 3MK7C 2YNYA 1OAEA 2ORLA 5AVWB 1LTGC 4RESB 2GUVA 2BCCD 3KPEA 2KLVA 3CWBG 2PFXA 1QGKB 2LXBA 3O1YA 3OA8B 4GT1A 2R44A 1JY2N 2K1AA 2OTLP 3ZOOA 2B4ZA 1DIPA 3ZOYA 1HCMA 3LIDA 4PWAA 1PP9D 5AW9B 2M5AB 2IFNA 5CIBB 1H33B 5B6QA 1NOHA 3GHGA 3L72D 1NAYA 5BU8B 1NJIQ 5KJ7A 3GF7A 1RF0C 1IRWA 3B4SA 2WVRA 2KI7B 2Y0CA 1QKSA 5GTIH 1ZRTD 1BE3J 2BH4X 2WSCH 1EB7A 4JBZA 1KILB 2QJPB 2W8ZA 4L1QA 1KB9D 1N73A 3H1JG 2Q5UA 3H1HD 1E79H 5CMZA 3Q5PA 5APXA 2XV5A 2P1JA 2M0BA 1H9XA 3WUIA 1LTSC 2N18C 4U3FE 2KUBA 1OW6A 2V4HA 2WSCJ 1NKNA 1BSNA 1T2KD 3IF4A 2D0SA 1EC5A 2YIUB 1MZ9A 1LT1A 2JTIB 4H13C 5KAIH 1G2CA 1S5LH 1K04A 1LT9A 1W5CE 1VQ7P 1Q2NA 3ABVC 1I8PA 4HB1A 4FA4A 3GMAA 1JMBA 1AVOA 3CWBE 4EIEA 2FFDA 1IZL0 3H1KJ 4C7NB 3L73J 2P67A 2W6JH 1SQQJ 3GF3A 1H89A 1IZNB 2OYOA 3FWNA 2BASA 1S2EA 2ZYGA 3G71P 3PRJA 3D70A 4GEDB 1QLED 4WY4C 1L0NG 1DX7A 4O1WA 3Q1MA 2OYIB 4Z1MH 3L35A 2NZ2A 5DF5A 5CICB 2G3AA 3A9FA 1CTYA 1PGQA 2HPCA 3PH0A 2FXPA 1NU1G 1P84H 3H1JE 1HJ0A 4OVNF 1VQLP 3V2RA 4OGQC 4PD4E 1RQVA 3O6QB 4LJIA 4EDFA 3AE3C 1NTKJ 3E1IA 3F5HA 2C9XB 5APSA 2DW3A 1VQ6P 4K3AA 2W90A 2E76C 3A0HE 5H2FE 3L4FA 3PTZA 3AEDC 2KNCB 451CA 2IYOA 2N3YA 3C9IA 2M3BA 1EDJA 3CCRP 4N78D 1SQVG 1K3GA 3PLNA 1SFCB 4EICA 3ZOWA 1HH0A 1NO4A 3B71A 2H8PD 1L0NE 4IL6E 1URQD 2L91A 1KYOH 4FA9A 3PP5A 3WFEC 3I55P 3TSIA 1GMJA 1QL2A 2C9NY 1CNOA 1NU1E 2Q3IA 4H44C 3GHGB 2GB8B 4PJ0E 3WFBC 1PZQA 1CHHA 2OZ1A 1QX8A 1AFOA 1FZEA 1CORA 4P4QB 3SVWA 2I1KA 4PV1D 2FKWB 2VHDA 2IBZD 2K9YA 4OWFA 3OW2O 3P8MC 1NNOA 1LC1A 2SPZA 2D2CD 3AEGC 3TK1A 2CE1A 1MFTA 3JSVC 1FS0E 4I7ZB 1J1DC 2UWJE 3HD7C 1N15A 1YEBA 2B87A 3V2PA 1KYOW 4PW9B 1HJ4A 3KHUA 1HJ3A 5KLVJ 1E8EA 1NKZB 1SQVE 2I1JA 5K5GB 1SQQK 1LWUA 1CC5A 3ORVA 3PXTA 1FZBA 1U75B 3W68A 2QJKC 2R5BA 2NPSD 3VMZA 1YTZI 1QVGO 5CCHD 1OFCX 3HE5A 3JCUE 2WT7A 3KQGA 3M91A 1GQ1A 1NTMJ 1VF5B 3L70G 1LTAC 2OGUA 3H1IJ 4D6TJ 1CHIA 1VQNP 2JJLA 1NH4A 2K37A 3ZIYA 2WPVB 2C2CA 2AEMA 3BCCD 1ZXGA 3VOPA 3MHVA 2YIUC 1GTWA 4AX3A 1SQPD 4XXLA 2RKLA 1GL2D 2HPCB 3M97X 3W67A 1ZOYC 1NTKK 1M70A 3VP9A 1KILD 1CTJA 3L71D 2WWWA 1OIPA 2QRXA 2XU6A 2KSJA 1AA0A 2FRCA 2YKQA 3CMAP 3CCVP 2GC7D 4OH8B 4DJGA 3L75D 1ZZHA 4WQDA 2O01N 1DH3A 2N9YB 2QM8A 4A7PA 1ZV8A 1X8YA 4BRYA 1H88A 1IC2A 2DVHA 3NMDA 3H32A 1PGPA 2R3SA 1A56A 1FBMA 1FOCA 2CE0A 3AE5C 3L70E 4PD4H 2KB7P 2E75C 1SVFA 3WU2V 3AE8C 2XKMA 3CYTI 3I56P 1SQQG 3KDPB 1FDMA 2JO1A 2BCCG 4FANA 1L9BC 3NBTA 3A0HH 2J59M 1N7SC 5H2FH 1QL1A 4GIFA 4H0JA 3EWKA 1NIRA 2E5YA 2E74D 2GM4A 155CA 2YKOA 1PP9G 1RE3C 1L4AB 3CX5E 3BRVB 1FI9A 2AXCA 5CCHA 3FWLA 3EFGA 1BGYJ 1SQBJ 4WBAA 1MG3D 2OZ1B 4AAOA 2W27A 3VMYA 2K3RA 4L73A 3HUSC 4RSZA 1VQOP 1CCRA 1DEEG 4L3HA 5CCGC 1SFCC 4MU8A 3LIEA 1WRGA 5KLVK 2L5GB 1YNRA 3AE1C 4IL6H 2JWAA 2Q9IA 3ZOXA 3H1HG 5AURA 1NTKG 2ZYDA 1PIXA 3Q2YA 4EIJA 4WQ8A 5B66V 2ZT9C 2B87B 1DD4A 1KD1Q 2ZJSE 3RK3C 1VQ9P 1GL2A 3OAKA 3M06A 3L36A 1EDIA 2GA1A 5AVQB 2B89A 5AW4B 1EZVI 3S1KA 2WMMA 1KILA 2PCCB 1VQMP 1NTMK 2AXTE 1SQXJ 2G8YA 3OJAB 4O1QA 3RN1A 1CW5A 3CXHI 3GLMA 4C46A 2BCCE 5DJQB 3NFQA 4LGDE 3CCJP 4EIFA 1FI7A 1CXCA 1N73C 1USDA 1PP9E 2C0WA 1FDOA 5E79V 2DGEA 2QVAA 1LS9A 1DW1A 1BCCD 3L72E 2WSFH 1S72P 3TYYA 3H6PA 2JR8A 2B9BA 4WQAA 1IFJA 1ZRTE 1Q7YQ 1LT9C 3RL0C 1Z56A 1KB9E 2ITAA 3JCUH 4UB8V 3RMZA 1S4XA 3DMIA 3H1HE 3RBZA 1RZ5A 1NTKE 2FFDC 1URQB 1G1JA 1W2BO 1VYDA 1CXAA 1RF1A 1KTMA 3BASA 2R32A 2W6AA 1LTJB 4BRYB 4R4LA 2E43A 1NWQA 3D6ZA 1BE3D 4PV1B 4FAVA 3CXHH 4KMGA 1QYZA 1OWAA 3VNWA 1GZLA 2D2CB 1MUUA 2ZVOB 1HROA 2YMYA 1KV4A 4TLFA 1KIBA 2P58A 1VDFA 1S6VB 1LP1B 5M1BA 2CPBA 1GKSA 1NTMG 1JTHA 3A0BE 1M60A 4NPFX 1JCDA 1PFIA 1I6EA 2C1DA 1SQBK 4PJ0V 5C0ZA 3C2CA 3GG2A 3JBTB 1L2PA 2OYHA 4CPGA 2KYVA 3B5ND 1NGMB 3WUVA 2B0ZB 2NPSB 3H1KD 2B11B 3L73D 1OVRA 1SQQD 3CXHW 1YIQA 4ZNCA 4HKZH 2W83C 5AVZB 3A7OA 2PACA 4N0KA 4JYCA 2B10B 3WU2E 2IBZG 5EXQA 1OXZA 1EDKA 2KZJA 3SXTA 2JKVA 2CK3H 1KN7A 3G9RA 3WUTA 1K05A 1AOFA 3D6YA 1KV9A 1ZR2A 3AEBC 3WFCC 3FXDA 3H1LJ 1SQXK 2Z5HA 1COTA 2KIKA 1GL2B 2JWDA 4N78E 1LGHB 5AVVB 1P84I 1WT6A 1N86A 2IZ1A 4JF7A 5CJ4A 3SWFA 1C6SA 4W80A 2E42A 4L74A 1FJKA 3BATA 2BEZF 1NTKD 5AVXB 1EQ7A 2OARA 1IQCA 3RK2D 3PJSK 1HZVA 4N6JA 3M9BA 3CC2P 2FYNB 4UB6E 1H32B 4YPCA 4NPDA 3M0DC 5B66E 1IFNA 4EYYQ 3IR9A 2O1JA 1L4AD 1T3JA 2BCNB 3BCCG 1CI6B 2J5UA 1X79B 2YKPA 3SLEA 2AXTH 1QEXA 1SQPG 5AW6B 2N1TC 4WVZA 2IBZE 5APVA 1DW2A 4BWNA 1SQBG 5AW2B 1LWUC 1K9MQ 4I1LA 2OTKE 3L71G 2BH5X 2HV4A 1CIFA 5DJQC 1LTIC 2E74B 1KYOI 1UIIA 3L4OA 3MUDA 3F89A 1RY3A 3B5NA 3L75G 5E79E 1OVUA 1RF1B 3JC22 2RMZA 1DT1A 4QMAA 1CSVA 2JEEA 2RN0A 2LXCB 2FBWC 3PXWA 1X9VA 1RE4C 1XTCC 2C0XA 3S9OA 1KB9H 1C6OA 1G1IA 3P8CD 1XTGB 1NMIA 1CRYA 4UB8E 3FXEA 3O8ZA 2ZFCA 2WSSH 1KQLA 3PHLA 1MKMA 3II6A 3A3YB 5KLVD 5AVYB 1JTHB 3ZDMA 4H0LC 4ZKPA 1NHLA 1CRGA 1HF9A 1T6AA 3BCCE 1AJYA 2C1DB 1CIGA 1CTZA 4WY4D 2H7HA 5TISE 4GODA 1SQPE 2FXOA 3IFMA 5AW8B 1GK4A 4WQ9A 2OYHB 2JDIH 3CPWO 3V6IA 1LC2A 1FZCC 1JY3P 1KILE 2P7JA 4PV1C 3L71E 1A02J 1NTMD 4TT3H 1DW0A 3H1ID 4D6TD 1KQGB 1FJPA 3SWSA 3R2PA 3VP8A 3L75E 2YK3A 5C9MA 3NTNA 5AVRB 3L74J 1L0LJ 3B8EB 1L4AA 2FYUJ 2PGDA 1S5LX 3SWYA 3P32A 1S9KE 1GU5A 5AW7B 1GDTA 4WB4A 1RQUA 2E76D 2YO2A 3EQ2A 3SFEC 1N7LA 1N8RQ 2AXTV 2BLFB 4EI2A 1M1JB 1RF0A 1PPJD 3HQ6A 3VRDA 2IX7C 4FA5A 4U7JA 3HQ7A 2KLUA 3CD6P 1M90Q 5GTHV 1WEJF 1H1OA 3NWVA 1W2EA 2IFMA 1K8AQ 5AW0B 3WU2H 1RHZB 4ASWA 3TGUJ 4QAOA 1DD3A 3A5TA 1RAQA 1YITP 2M3EA 3H25A 3CCMP 1IFPA 2MTAC 5TJHA 1D7MA 1HBWA 2ZXYA 3MIWA 1JEKA 2KOGA 2V7QH 5KAFV 2LIRA 3EFFK 2I8FA 2GC4D 4DY9A 1IJDB 2ZYAA 1BCCG 2A45G 2I8DA 1BSHA 1GL2C 1JY2P 1AVYA 2FY8A 3SFDC 4H44D 3GW6A 1HWTC 4PD4I 1E2RA 4GKGA 1GD2E 1KILC 2QJPC 2FWLA 5AW3B 1HJ5A 3C1LA 1H9YA 1JY3O 1IK9A 1KMIZ 2E5TA 1C6RA 1S3JA 2HLOA 4AUWA 4EOTA 4WY4A 1JCCA 2GIWA 5B66H 1DEBA 2PP6A 3HD7D 1AQ5A 1JNMA 3B5NB 3M9QA 1N90A 2MHMA 4JCGA 4YE1A 2POHA 1BGYD 1SQBD 2QE7H 4U3FJ 1E5WA 3O5CA 3VTPC 1GJQA 1QL4A 2B12B 1YYCA 1YEAA 3V4WA 2HG5D 1BE3G 3CI9A 1URQA 1FI3A 2HODA 1F1FA 1FE6A 4W7YA 1A02F 1ZW0A 4YTPC 3A0BV 1YJ9P 3CWBJ 4Y99B 3FX0A 1KQFB 5CYTR 5AVSB 5C39A 1LTJA 3IAOA 1FHBA 4RO0A 5E79H 2OYIC 1BCCE 1C52A 1S9KD 1E29A 1KB0A 4DT0A 1GU4A 1NTZK 1SQXD 1Y9BA 1OX3A 1RH5B 1T8ZA 1PV3A 3T97A 3H1KG 3L73G 3HTKA 3MK7B 3TF5A 2WPQA 1LP1A 3MZWB 3RK2B 1L0LK 2Q1KA 4UB8H 4HYTB 2FYUK 5APUA 2IDBA 3H1JJ 1DVVA 1JY2O 3SSUA 4GOEA 3MGNA 4RJTA 1GW3A 5AW5B 3AEAC 4Q5PA 2O01H 1JUNA 5B5EV 2NPSA 3O0RC 3U59A 5L8RJ 2WQYC 3TNUA 1I55A 1R0QA 3I5CA 1HZUA 3AE2C 2JP3A 1BE3E 4R4MA 1VPCA 1JM0A 2OYHC 4Y28J 1OMIA 3RLMA 1FJ0A 4K3IA 2ZZS1 1R5SA 4DCKA 1SS1A 2H43A 2B88A 1CIEA 4UB6V 3AEEC 3HD7A 3OCDA 2N18B 1L0NJ 3CCUP 4PJ0H 5APWA 1LTTC 3HQ8A 1BDCA 2BGVX 3GHGC 1U7MA 3H1KE 3L73E 5KJ7C 5APQA 1KQSO 2CXBA 1SQQE 1NMLA 1S5LE 5KKZB 3LW5H 1NU1J 4GOFA 1EZVD 1YJNP 3C8VA 2KSEA 1HVVA 5GTHE 1AV1A 4FB1A 2AEFA 2N9IA 4I2LC 1FZFA 1H32A 3HE4B 3CXHD 2K88A 2KK7A 2N9JA 4I7ZC 4N3YB 1OW8A 4JQ0D 5CCGD 1SP4A 3Q5RA 4WY4B 1MZ4A 4DZOA 1W2LA 1CI6A 4ZKUA 5KAFE 4XA4A 2ZT9D 1Q86Q 3RK3D 1CYJA 1C2RA 1SQVJ 2WSFJ 3E1RA 4IFFA
chains in the Genus database with same CATH topology
1HZVA 1CO6A 3WFEC 1NU1D 1DIQC 1LMSA 1CNOA 2FYNB 1H32B 4WQ7A 2GB8B 3CU4A 3WFBC 2QG4A 1CHHA 2OZ1A 1H31A 3KZIV 1CORA 4P4QB 3SVWA 3H1LD 5TISV 2BCNB 1CEDA 3HQ9A 2VHDA 2IBZD 3X39A 3DR0A 2BPBB 1NNOA 3SLEA 1LC1A 1CSWA 2CE1A 1DW2A 1HRCA 2AI5A 1N15A 1IRVA 1U74B 1YEBA 1A8CA 2BH5X 2Q3EA 2HV4A 1SQVD 1KYOW 2A06D 4PW9B 1CIFA 1HJ4A 1MG2D 5DJQC 1HJ3A 3KHUA 1E8EA 3RN0A 1CRIA 3L4OA 2QJYB 2V07A 2ZONG 3PXSA 1GIWA 1CC5A 1F1CA 3ORVA 3PXTA 2RMZA 1U75B 1DT1A 2PCBB 3OA8A 1CSVA 1A2SA 2RN0A 3PXWA 1I8OA 3VYMA 1GQ1A 1C6OA 5CIHB 1H33A 1CIHA 1NMIA 1CHIA 1CRYA 3DP5A 1LFMA 2YCCA 3ZIYA 3WC8A 2YQBA 3PHLA 1C7MA 2ZOOA 4V2KA 2ZBOA 3TYIA 2C2CA 5KLVD 3BCCD 1L9JC 2O3JA 1N9CA 4AX3A 1CRGA 1SQPD 2Y0DA 4XXLA 1ETPA 2C1DB 1CIGA 1CTZA 3M97X 4XYDB 3OCDB 1CYCA 2CA3B 1M70A 4WQ9A 1CRHA 1QL3A 1CTJA 3L71D 1IO3A 1LC2A 2V08A 3ZBMA 1K3HA 1FCDC 2FRCA 1AYGA 1NTMD 3WFDC 4EIDA 3VMAA 1DW0A 2GC7D 3H1ID 3L75D 4D6TD 2L4DA 2QJKB 1ZZHA 3SWSA 4WQDA 1AOQA 2CA4B 1CSXA 1P84D 2N9YB 4A7PA 2YK3A 5C9MA 1I6DA 2KS1A 1RZ6A 2DVHA 1B7VA 1GU2A 1BL9A 1A56A 3L70D 1DVHA 1FOCA 2CE0A 1OCDA 4J20A 5CIFB 2AXTV 2BLFB 3CX5W 1PPJD 3HQ6A 3VRDA 4AAMA 1YCCA 1CRJA 4FA5A 3WU2V 3HQ7A 3A0HV 5H2FV 3TDKA 3CYTI 5GTHV 1HH7A 1WEJF 1H1OA 2LITA 3NWVA 4FANA 1L9BC 2C8SA 3NBTA 1NTZD 1YTCA 4H0JA 1I5TA 4QAOA 1NIRA 3L4MA 3CX5D 1RAQA 3O20A 155CA 1YICA 4NFGB 5TJHA 2MTAC 3L74D 1L0LD 3SJLA 2FYUD 2ZXYA 1FI9A 1M6ZA 3FWLA 1CYIA 5KAFV 2LIRA 1MG3D 2I8FA 2GC4D 2OZ1B 4AAOA 1H31B 4DY9A 4RSZA 1CCRA 4L3HA 4IL6V 1KYOD 4WQEA 4MU8A 5CIEB 3GW6A 1E2RA 1W5CT 1YNRA 2JWAA 3ZOXA 2FWLA 2N3BA 4WQBA 1HJ5A 2Y0EA 5AURA 1H9YA 4WQ8A 5B66V 3TGUD 1C6RA 4FA1A 4GYDA 1N50A 2GIWA 2D0WA 3CP5A 3MK7C 1OAEA 2ORLA 1KX7A 2PCCB 1N90A 2C1VA 2BCCD 2MHMA 4JCGA 4YE1A 1BGYD 1SQBD 3O1YA 3OA8B 4O1QA 3RN1A 1GDVA 3O5CA 1GJQA 1QL4A 3ZOOA 2B4ZA 5DJQB 2B12B 3ZOYA 1YEAA 1HCMA 1FI3A 1PP9D 4PWAA 4EIFA 1F1FA 1FI7A 1CXCA 5CIBB 1H33B 5B6QA 5DFSA 3A0BV 3L72D 1AKKA 5GTIV 5E79V 2DGEA 1LS9A 1RAPA 1DW1A 5CYTR 1IRWA 1BCCD 2Y0CA 2EXVA 4AALA 1CHJA 1C75A 1QKSA 4L3GA 1I54A 4WQCA 5KLIB 1FHBA 1C52A 1ZRTD 1E29A 2BH4X 1EB7A 2QJPB 1KB0A 4WQAA 4L1QA 1KB9D 3H1HD 1SQXD 4U3FD 1H9XA 4UB8V 3RMZA 3WUIA 3DMIA 5KAIV 1RZ5A 1S5LV 2N18C 3MK7B 3TF5A 2D0SA 1VYDA 2YIUB 1CXAA 2JTIB 5CIGB 1DVVA 3CWBD 4RJTA 1I8PA 1DIIC 4FA4A 4EIEA 4Q5PA 1IZL0 5B5EV 1BE3D 3O0RC 4FAVA 4KMGA 1QYZA 1I55A 1R0QA 1HZUA 3VNWA 1HROA 3PRJA 4GEDB 4H0KA 1KIBA 4O1WA 3RLMA 1FJ0A 4K3IA 1S6VB 2ZZS1 1GKSA 1M60A 5DF5A 1YFCA 5CICB 1CIEA 4UB6V 3A9FA 1CTYA 3H1JD 2JQRA 1I6EA 2C1DA 4PJ0V 3ZCFA 5C0ZA 3OCDA 3C2CA 3GG2A 4PD4D 3JBTB 2N18B 2B0ZB 3H1KD 2B11B 3L73D 3HQ8A 1SQQD 3CXHW 1YIQA 2BGVX 4LJIA 1C2NA 4EDFA 1DW3A 1CSUA 2C9XB 2CXBA 2PACA 4N0KA 1NMLA 5KKZB 2B10B 5EXQA 3PH2B 3PTZA 1EZVD 1QN2A 3SXTA 2KNCB 1J3SA 451CA 2C1UA 4FB1A 2N9IA 1H32A 1AOFA 2N3YA 3CXHD 1KV9A 2N9JA 3WFCC 2AIUA 1COTA 1K3GA 3PLNA 1MZ4A 4EICA 2XTSB 1W2LA 351CA 3ZOWA 1L0ND 2K9JB 4AANA 1JDLA 1WVEC 1CCHA 5IY51 1C6SA 3ITKA 4Y5RA 3NBSA 1NTKD 1CYJA 1C2RA 1CRCA 1IQCA 5CIDB 2L91A 4FA9A 1KX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZV A;  1CO6 A;  3WFE C;  1NU1 D;  1DIQ C;  1LMS A;  1CNO A;  2FYN B;  1H32 B;  4WQ7 A;  2GB8 B;  3CU4 A;  3WFB C;  2QG4 A;  1CHH A;  2OZ1 A;  1H31 A;  3KZI V;  1COR A;  4P4Q B;  3SVW A;  3H1L D;  5TIS V;  2BCN B;  1CED A;  3HQ9 A;  2VHD A;  2IBZ D;  3X39 A;  3DR0 A;  2BPB B;  1NNO A;  3SLE A;  1LC1 A;  1CSW A;  2CE1 A;  1DW2 A;  1HRC A;  2AI5 A;  1N15 A;  1IRV A;  1U74 B;  1YEB A;  1A8C A;  2BH5 X;  2Q3E A;  2HV4 A;  1SQV D;  1KYO W;  2A06 D;  4PW9 B;  1CIF A;  1HJ4 A;  1MG2 D;  5DJQ C;  1HJ3 A;  3KHU A;  1E8E A;  3RN0 A;  1CRI A;  3L4O A;  2QJY B;  2V07 A;  2ZON G;  3PXS A;  1GIW A;  1CC5 A;  1F1C A;  3ORV A;  3PXT A;  2RMZ A;  1U75 B;  1DT1 A;  2PCB B;  3OA8 A;  1CSV A;  1A2S A;  2RN0 A;  3PXW A;  1I8O A;  3VYM A;  1GQ1 A;  1C6O A;  5CIH B;  1H33 A;  1CIH A;  1NMI A;  1CHI A;  1CRY A;  3DP5 A;  1LFM A;  2YCC A;  3ZIY A;  3WC8 A;  2YQB A;  3PHL A;  1C7M A;  2ZOO A;  4V2K A;  2ZBO A;  3TYI A;  2C2C A;  5KLV D;  3BCC D;  1L9J C;  2O3J A;  1N9C A;  4AX3 A;  1CRG A;  1SQP D;  2Y0D A;  4XXL A;  1ETP A;  2C1D B;  1CIG A;  1CTZ A;  3M97 X;  4XYD B;  3OCD B;  1CYC A;  2CA3 B;  1M70 A;  4WQ9 A;  1CRH A;  1QL3 A;  1CTJ A;  3L71 D;  1IO3 A;  1LC2 A;  2V08 A;  3ZBM A;  1K3H A;  1FCD C;  2FRC A;  1AYG A;  1NTM D;  3WFD C;  4EID A;  3VMA A;  1DW0 A;  2GC7 D;  3H1I D;  3L75 D;  4D6T D;  2L4D A;  2QJK B;  1ZZH A;  3SWS A;  4WQD A;  1AOQ A;  2CA4 B;  1CSX A;  1P84 D;  2N9Y B;  4A7P A;  2YK3 A;  5C9M A;  1I6D A;  2KS1 A;  1RZ6 A;  2DVH A;  1B7V A;  1GU2 A;  1BL9 A;  1A56 A;  3L70 D;  1DVH A;  1FOC A;  2CE0 A;  1OCD A;  4J20 A;  5CIF B;  2AXT V;  2BLF B;  3CX5 W;  1PPJ D;  3HQ6 A;  3VRD A;  4AAM A;  1YCC A;  1CRJ A;  4FA5 A;  3WU2 V;  3HQ7 A;  3A0H V;  5H2F V;  3TDK A;  3CYT I;  5GTH V;  1HH7 A;  1WEJ F;  1H1O A;  2LIT A;  3NWV A;  4FAN A;  1L9B C;  2C8S A;  3NBT A;  1NTZ D;  1YTC A;  4H0J A;  1I5T A;  4QAO A;  1NIR A;  3L4M A;  3CX5 D;  1RAQ A;  3O20 A;  155C A;  1YIC A;  4NFG B;  5TJH A;  2MTA C;  3L74 D;  1L0L D;  3SJL A;  2FYU D;  2ZXY A;  1FI9 A;  1M6Z A;  3FWL A;  1CYI A;  5KAF V;  2LIR A;  1MG3 D;  2I8F A;  2GC4 D;  2OZ1 B;  4AAO A;  1H31 B;  4DY9 A;  4RSZ A;  1CCR A;  4L3H A;  4IL6 V;  1KYO D;  4WQE A;  4MU8 A;  5CIE B;  3GW6 A;  1E2R A;  1W5C T;  1YNR A;  2JWA A;  3ZOX A;  2FWL A;  2N3B A;  4WQB A;  1HJ5 A;  2Y0E A;  5AUR A;  1H9Y A;  4WQ8 A;  5B66 V;  3TGU D;  1C6R A;  4FA1 A;  4GYD A;  1N50 A;  2GIW A;  2D0W A;  3CP5 A;  3MK7 C;  1OAE A;  2ORL A;  1KX7 A;  2PCC B;  1N90 A;  2C1V A;  2BCC D;  2MHM A;  4JCG A;  4YE1 A;  1BGY D;  1SQB D;  3O1Y A;  3OA8 B;  4O1Q A;  3RN1 A;  1GDV A;  3O5C A;  1GJQ A;  1QL4 A;  3ZOO A;  2B4Z A;  5DJQ B;  2B12 B;  3ZOY A;  1YEA A;  1HCM A;  1FI3 A;  1PP9 D;  4PWA A;  4EIF A;  1F1F A;  1FI7 A;  1CXC A;  5CIB B;  1H33 B;  5B6Q A;  5DFS A;  3A0B V;  3L72 D;  1AKK A;  5GTI V;  5E79 V;  2DGE A;  1LS9 A;  1RAP A;  1DW1 A;  5CYT R;  1IRW A;  1BCC D;  2Y0C A;  2EXV A;  4AAL A;  1CHJ A;  1C75 A;  1QKS A;  4L3G A;  1I54 A;  4WQC A;  5KLI B;  1FHB A;  1C52 A;  1ZRT D;  1E29 A;  2BH4 X;  1EB7 A;  2QJP B;  1KB0 A;  4WQA A;  4L1Q A;  1KB9 D;  3H1H D;  1SQX D;  4U3F D;  1H9X A;  4UB8 V;  3RMZ A;  3WUI A;  3DMI A;  5KAI V;  1RZ5 A;  1S5L V;  2N18 C;  3MK7 B;  3TF5 A;  2D0S A;  1VYD A;  2YIU B;  1CXA A;  2JTI B;  5CIG B;  1DVV A;  3CWB D;  4RJT A;  1I8P A;  1DII C;  4FA4 A;  4EIE A;  4Q5P A;  1IZL 0;  5B5E V;  1BE3 D;  3O0R C;  4FAV A;  4KMG A;  1QYZ A;  1I55 A;  1R0Q A;  1HZU A;  3VNW A;  1HRO A;  3PRJ A;  4GED B;  4H0K A;  1KIB A;  4O1W A;  3RLM A;  1FJ0 A;  4K3I A;  1S6V B;  2ZZS 1;  1GKS A;  1M60 A;  5DF5 A;  1YFC A;  5CIC B;  1CIE A;  4UB6 V;  3A9F A;  1CTY A;  3H1J D;  2JQR A;  1I6E A;  2C1D A;  4PJ0 V;  3ZCF A;  5C0Z A;  3OCD A;  3C2C A;  3GG2 A;  4PD4 D;  3JBT B;  2N18 B;  2B0Z B;  3H1K D;  2B11 B;  3L73 D;  3HQ8 A;  1SQQ D;  3CXH W;  1YIQ A;  2BGV X;  4LJI A;  1C2N A;  4EDF A;  1DW3 A;  1CSU A;  2C9X B;  2CXB A;  2PAC A;  4N0K A;  1NML A;  5KKZ B;  2B10 B;  5EXQ A;  3PH2 B;  3PTZ A;  1EZV D;  1QN2 A;  3SXT A;  2KNC B;  1J3S A;  451C A;  2C1U A;  4FB1 A;  2N9I A;  1H32 A;  1AOF A;  2N3Y A;  3CXH D;  1KV9 A;  2N9J A;  3WFC C;  2AIU A;  1COT A;  1K3G A;  3PLN A;  1MZ4 A;  4EIC A;  2XTS B;  1W2L A;  351C A;  3ZOW A;  1L0N D;  2K9J B;  4AAN A;  1JDL A;  1WVE C;  1CCH A;  5IY5 1;  1C6S A;  3ITK A;  4Y5R A;  3NBS A;  1NTK D;  1CYJ A;  1C2R A;  1CRC A;  1IQC A;  5CID B;  2L91 A;  4FA9 A;  1KX2 A; 
#chains in the Genus database with same CATH topology
 3AE9 C;  1DIQ C;  2HR3 A;  2YXR B;  1LMS A;  3D0W A;  2HOD B;  2QM7 A;  4GDO A;  1FAV A;  1VF5 C;  4WQ7 A;  3CU4 A;  3H1L D;  5TIS V;  1USE A;  2E76 B;  5KLV G;  1CED A;  5BU5 A;  3HQ9 A;  4L75 A;  3CCE P;  3CX5 I;  3X39 A;  1NAF A;  3DR0 A;  2BPB B;  4IOI H;  3N7N A;  1CSW A;  1OW7 A;  3KXD A;  2AI5 A;  3SWK A;  3AEF C;  1IRV A;  1M7L A;  4C7R A;  3T97 B;  2A06 D;  1MG2 D;  2W6B A;  3HTK B;  4BXL A;  3RN0 A;  1CRI A;  4IL6 X;  2QJY B;  3G4S P;  3PXS A;  1GIW A;  3H1I G;  4D6T G;  3RL0 g;  3CL3 D;  1F1C A;  1EDL A;  4HJG H;  2N9B A;  2A45 H;  1A2S A;  3N4X A;  3FGA D;  1RE3 A;  1I8O A;  3TNU B;  3A2A A;  4H44 B;  5AVU B;  1CIH A;  2Y9Y A;  2WPR A;  1PPJ G;  2YCC A;  1PGO A;  3HUS A;  1YQ4 C;  3VN0 A;  3P8C E;  2YQB A;  2ZOO A;  2Q6Q A;  5CCG A;  2ZBO A;  1L0N K;  4L76 A;  2O3J A;  3RK2 C;  1N9C A;  1FOS E;  4ZMD A;  5KLV E;  3L70 J;  3KZI E;  1M8O B;  1J1D B;  3HD7 B;  1ETP A;  1T2K C;  4XFJ A;  3OCD B;  3CX5 H;  2LR2 A;  1CRH A;  1M1J A;  2YO3 A;  1IO3 A;  3S4R A;  5B5E E;  1NU1 K;  5APY A;  2V08 A;  1L4A C;  3ZBM A;  1Y47 A;  1K3H A;  2YMK A;  1AYG A;  3USS A;  5CJ0 A;  2QA4 P;  1YTZ T;  1NYH A;  2LKM A;  1KB9 I;  2L4D A;  2QJK B;  1NTM E;  2CA4 B;  1CSX A;  1P84 D;  3H1I E;  2M8R A;  4D6T E;  3V5B A;  1I6D A;  2KS1 A;  1N2D C;  1Q81 Q;  1RZ6 A;  1B7V A;  1PL5 A;  1DVH A;  1EXJ A;  1OCD A;  1GK6 A;  1HUC A;  4J20 A;  4W7Z A;  3CX5 W;  1YCC A;  1CRJ A;  2H88 C;  1SQV K;  1PPJ E;  4KT0 J;  1VQ8 P;  2FYZ A;  4O9B A;  1HH7 A;  2LIT A;  1BGY G;  3CC7 P;  5AW1 B;  1NTZ D;  1YTC A;  5DJU B;  1I5T A;  1H0T B;  5GTH H;  5KKZ C;  3MTU E;  1J2J B;  2ZAE B;  3O20 A;  4NFG B;  3L74 D;  1L0L D;  2FYU D;  3RBX A;  1IFM A;  2BCC J;  2VRS A;  4JPZ B;  1JB0 J;  3U1A A;  1KYO D;  5APT A;  5KAF H;  4H13 D;  1PP9 J;  5CIE B;  4WQB A;  3L72 J;  2Y0E A;  3V2N A;  1SQX G;  1TU3 F;  2P10 A;  1YQ3 C;  1LTB C;  3TGU D;  3AE7 C;  4FA1 A;  1MFZ A;  2E75 B;  4GYD A;  1HGZ A;  2N1T D;  3QWO C;  1URQ C;  3CP5 A;  2XZR A;  1KX7 A;  2ZXX A;  2K9J A;  2KP8 A;  3RGU A;  3CC4 P;  3H1H J;  2QEX P;  1KZU B;  2C1V A;  1N7S B;  4HH2 A;  1GDV A;  2OTJ P;  1WMK A;  1BGY E;  1SQB E;  1T3U A;  1LTJ C;  2RH0 A;  1CZQ A;  3CCS P;  1K73 Q;  2XNX A;  5DFS A;  1NTZ J;  1AKK A;  5GTI V;  1VQK P;  2D2C C;  3HUS B;  3MD0 A;  1RAP A;  4OGQ D;  2EXV A;  4AAL A;  5AVT B;  1CHJ A;  1C75 A;  3A0B H;  4L3G A;  1I54 A;  4WQC A;  5KLI B;  1OVV A;  4B86 A;  2QJY C;  2Z4E A;  2XND H;  1OZH A;  2PRR A;  1ZLL A;  3V4Q A;  2J58 A;  3MP7 B;  1IO4 A;  2ZT9 B;  4U3F D;  4MN4 C;  3RK3 B;  2C9L Y;  5KAI V;  1S5L V;  1SQX E;  4H0L D;  5EFW B;  2NPS C;  1S1C X;  2IBZ I;  5CCH C;  1JOC A;  5CIG B;  4RKU J;  3CWB D;  2PAJ A;  1M1K Q;  1DII C;  1EZV G;  2KS1 B;  1HTL C;  1YHQ P;  1IFI A;  3KZI H;  3G6E P;  4AQR D;  2OQQ A;  5DJT B;  1N73 B;  2BEQ D;  3M0D A;  5B5E H;  4H0K A;  4ASV A;  4KJM A;  2GUS A;  2O1K A;  1G2C B;  2N1T A;  2V7Q J;  1YFC A;  4WWI A;  3HE4 A;  1LT9 B;  3H1J D;  3RL0 B;  2Z5I A;  2JQR A;  1YIJ P;  3ZCF A;  2MJZ A;  4PD4 D;  4UB6 H;  2FFD B;  1VL2 A;  1JO5 A;  2FYN C;  1KC8 Q;  3V2Q A;  1C2N A;  1DW3 A;  2WZ7 A;  1CSU A;  3H1L G;  1KFM A;  3R4Y A;  2HFE D;  4DOJ A;  3PH2 B;  3U1C A;  1QN2 A;  1J3S A;  1VQP P;  2P2U A;  2C1U A;  1FZG A;  1RE4 A;  1EZV E;  2XDJ A;  2H89 C;  2WSE H;  1ZN5 A;  3QH9 A;  2AIU A;  2A06 G;  3CXH E;  2KZI A;  1H8A A;  1ZME C;  5CHX A;  2XTS B;  351C A;  1L0N D;  3BRT B;  2E74 C;  3WUU A;  1X0T A;  1KFN A;  2K9J B;  4AAN A;  1JDL A;  5BVZ A;  1WVE C;  3E7K A;  1CCH A;  5IY5 1;  2WSE J;  3BVH A;  1CSB A;  3ITK A;  4Y5R A;  1RF1 C;  1PGJ A;  3Q3D A;  3NBS A;  1LNQ A;  1CRC A;  2IPP A;  2YXQ B;  3RK3 E;  2QSI A;  5CID B;  2KXP B;  3CCQ P;  4LC1 A;  2AEJ A;  1J1E B;  1FDI A;  1KX2 A;  2ZXE B;  1CO6 A;  1NU1 D;  5CBO A;  1FZC A;  1AQT A;  2QIW A;  1IFD A;  2QG4 A;  1H31 A;  3KZI V;  5CBN A;  4K35 A;  1NVO A;  3IN6 A;  1M57 D;  3H1L E;  3L37 A;  3AEC C;  1FZA A;  5TIS H;  3G3Z A;  1HRC A;  2WTY A;  1SLQ A;  1U74 B;  1R8E A;  4IFD K;  1A8C A;  4I6M C;  2Q3E A;  1FOS F;  1SQV D;  2Y9Z A;  3M9H A;  3AE4 C;  1BDD A;  2O01 J;  3BCC J;  2R3C A;  1JMM A;  2A06 E;  1U57 A;  4IFM A;  1YBK A;  2V07 A;  2ZON G;  1SQP J;  2Q7C A;  3L72 G;  5GTI E;  1QVF O;  3NXS A;  3CCL P;  2E75 D;  2PCB B;  3OA8 A;  3L71 J;  5KLI C;  1N7S D;  1ZP0 C;  2NRG A;  3VYM A;  3M0A A;  2M5A A;  4H13 B;  5CIH B;  1R5L A;  1H33 A;  3L75 J;  4NPE A;  3DP5 A;  1LFM A;  5KAI E;  5KTB A;  1M1J C;  3WC8 A;  1YJW P;  1C7M A;  4V2K A;  3TYI A;  4AYC A;  1L9J C;  2N1T B;  1ZR4 A;  1U7J A;  1NTZ G;  1LWU B;  2Y0D A;  4LLH A;  3Q5S A;  1IK7 A;  4XYD B;  1SFC D;  1CYC A;  3LW5 J;  2CA3 B;  1M56 D;  1YI2 P;  4YXD C;  1QL3 A;  3L74 G;  3HE5 B;  2WT7 B;  1L0L G;  4KHX A;  4YXW H;  1KOR A;  2A45 I;  2FYU G;  1FCD C;  1VQ4 P;  1VQ5 P;  1Y8A A;  3WFD C;  4EID A;  3VYI A;  3VMA A;  1MV8 A;  3VMX A;  3UIA A;  2IYP A;  1H0T A;  1AOQ A;  2CPS A;  4OGQ B;  1P84 E;  5KJ7 D;  4C7N A;  1GU2 A;  1BL9 A;  3L70 D;  2WIT A;  3TGU G;  2MKV A;  5CIF B;  2FXM A;  2HYN A;  4AAM A;  1LJ2 A;  1Q82 Q;  1JY3 N;  3A0H V;  5H2F V;  3TDK A;  3WMM 0;  2OYI A;  1HGV A;  3KYQ A;  3MUD C;  3AE6 C;  4H0L B;  3B5N C;  2C8S A;  3L4M A;  3OA7 A;  3CX5 D;  1EXI A;  1NTZ E;  1YIC A;  3CLQ A;  4M3L A;  3HRN A;  1FZC B;  3SJL A;  3RL0 D;  3H32 B;  3CME P;  1M6Z A;  3O6Q A;  3L74 E;  3K5B A;  1CYI A;  1L0L E;  1H31 B;  2FYU E;  1N7S A;  4Y99 C;  2ZVN B;  4IL6 V;  1GW4 A;  1VF5 D;  4WQE A;  2KNC A;  4XE5 B;  1FC2 C;  1W5C T;  1HJB A;  1KYO E;  2IZ0 A;  1FU1 A;  2N3B A;  1X22 A;  1SQP K;  1UIX A;  4U3F G;  3P7K A;  1Q90 D;  4JYB A;  1BCC J;  2R5D A;  2WPS A;  1J1E C;  1N50 A;  1SFC A;  3TGU E;  3D71 A;  2D0W A;  3MK7 C;  2YNY A;  1OAE A;  2ORL A;  5AVW B;  1LTG C;  4RES B;  2GUV A;  2BCC D;  3KPE A;  2KLV A;  3CWB G;  2PFX A;  1QGK B;  2LXB A;  3O1Y A;  3OA8 B;  4GT1 A;  2R44 A;  1JY2 N;  2K1A A;  2OTL P;  3ZOO A;  2B4Z A;  1DIP A;  3ZOY A;  1HCM A;  3LID A;  4PWA A;  1PP9 D;  5AW9 B;  2M5A B;  2IFN A;  5CIB B;  1H33 B;  5B6Q A;  1NOH A;  3GHG A;  3L72 D;  1NAY A;  5BU8 B;  1NJI Q;  5KJ7 A;  3GF7 A;  1RF0 C;  1IRW A;  3B4S A;  2WVR A;  2KI7 B;  2Y0C A;  1QKS A;  5GTI H;  1ZRT D;  1BE3 J;  2BH4 X;  2WSC H;  1EB7 A;  4JBZ A;  1KIL B;  2QJP B;  2W8Z A;  4L1Q A;  1KB9 D;  1N73 A;  3H1J G;  2Q5U A;  3H1H D;  1E79 H;  5CMZ A;  3Q5P A;  5APX A;  2XV5 A;  2P1J A;  2M0B A;  1H9X A;  3WUI A;  1LTS C;  2N18 C;  4U3F E;  2KUB A;  1OW6 A;  2V4H A;  2WSC J;  1NKN A;  1BSN A;  1T2K D;  3IF4 A;  2D0S A;  1EC5 A;  2YIU B;  1MZ9 A;  1LT1 A;  2JTI B;  4H13 C;  5KAI H;  1G2C A;  1S5L H;  1K04 A;  1LT9 A;  1W5C E;  1VQ7 P;  1Q2N A;  3ABV C;  1I8P A;  4HB1 A;  4FA4 A;  3GMA A;  1JMB A;  1AVO A;  3CWB E;  4EIE A;  2FFD A;  1IZL 0;  3H1K J;  4C7N B;  3L73 J;  2P67 A;  2W6J H;  1SQQ J;  3GF3 A;  1H89 A;  1IZN B;  2OYO A;  3FWN A;  2BAS A;  1S2E A;  2ZYG A;  3G71 P;  3PRJ A;  3D70 A;  4GED B;  1QLE D;  4WY4 C;  1L0N G;  1DX7 A;  4O1W A;  3Q1M A;  2OYI B;  4Z1M H;  3L35 A;  2NZ2 A;  5DF5 A;  5CIC B;  2G3A A;  3A9F A;  1CTY A;  1PGQ A;  2HPC A;  3PH0 A;  2FXP A;  1NU1 G;  1P84 H;  3H1J E;  1HJ0 A;  4OVN F;  1VQL P;  3V2R A;  4OGQ C;  4PD4 E;  1RQV A;  3O6Q B;  4LJI A;  4EDF A;  3AE3 C;  1NTK J;  3E1I A;  3F5H A;  2C9X B;  5APS A;  2DW3 A;  1VQ6 P;  4K3A A;  2W90 A;  2E76 C;  3A0H E;  5H2F E;  3L4F A;  3PTZ A;  3AED C;  2KNC B;  451C A;  2IYO A;  2N3Y A;  3C9I A;  2M3B A;  1EDJ A;  3CCR P;  4N78 D;  1SQV G;  1K3G A;  3PLN A;  1SFC B;  4EIC A;  3ZOW A;  1HH0 A;  1NO4 A;  3B71 A;  2H8P D;  1L0N E;  4IL6 E;  1URQ D;  2L91 A;  1KYO H;  4FA9 A;  3PP5 A;  3WFE C;  3I55 P;  3TSI A;  1GMJ A;  1QL2 A;  2C9N Y;  1CNO A;  1NU1 E;  2Q3I A;  4H44 C;  3GHG B;  2GB8 B;  4PJ0 E;  3WFB C;  1PZQ A;  1CHH A;  2OZ1 A;  1QX8 A;  1AFO A;  1FZE A;  1COR A;  4P4Q B;  3SVW A;  2I1K A;  4PV1 D;  2FKW B;  2VHD A;  2IBZ D;  2K9Y A;  4OWF A;  3OW2 O;  3P8M C;  1NNO A;  1LC1 A;  2SPZ A;  2D2C D;  3AEG C;  3TK1 A;  2CE1 A;  1MFT A;  3JSV C;  1FS0 E;  4I7Z B;  1J1D C;  2UWJ E;  3HD7 C;  1N15 A;  1YEB A;  2B87 A;  3V2P A;  1KYO W;  4PW9 B;  1HJ4 A;  3KHU A;  1HJ3 A;  5KLV J;  1E8E A;  1NKZ B;  1SQV E;  2I1J A;  5K5G B;  1SQQ K;  1LWU A;  1CC5 A;  3ORV A;  3PXT A;  1FZB A;  1U75 B;  3W68 A;  2QJK C;  2R5B A;  2NPS D;  3VMZ A;  1YTZ I;  1QVG O;  5CCH D;  1OFC X;  3HE5 A;  3JCU E;  2WT7 A;  3KQG A;  3M91 A;  1GQ1 A;  1NTM J;  1VF5 B;  3L70 G;  1LTA C;  2OGU A;  3H1I J;  4D6T J;  1CHI A;  1VQN P;  2JJL A;  1NH4 A;  2K37 A;  3ZIY A;  2WPV B;  2C2C A;  2AEM A;  3BCC D;  1ZXG A;  3VOP A;  3MHV A;  2YIU C;  1GTW A;  4AX3 A;  1SQP D;  4XXL A;  2RKL A;  1GL2 D;  2HPC B;  3M97 X;  3W67 A;  1ZOY C;  1NTK K;  1M70 A;  3VP9 A;  1KIL D;  1CTJ A;  3L71 D;  2WWW A;  1OIP A;  2QRX A;  2XU6 A;  2KSJ A;  1AA0 A;  2FRC A;  2YKQ A;  3CMA P;  3CCV P;  2GC7 D;  4OH8 B;  4DJG A;  3L75 D;  1ZZH A;  4WQD A;  2O01 N;  1DH3 A;  2N9Y B;  2QM8 A;  4A7P A;  1ZV8 A;  1X8Y A;  4BRY A;  1H88 A;  1IC2 A;  2DVH A;  3NMD A;  3H32 A;  1PGP A;  2R3S A;  1A56 A;  1FBM A;  1FOC A;  2CE0 A;  3AE5 C;  3L70 E;  4PD4 H;  2KB7 P;  2E75 C;  1SVF A;  3WU2 V;  3AE8 C;  2XKM A;  3CYT I;  3I56 P;  1SQQ G;  3KDP B;  1FDM A;  2JO1 A;  2BCC G;  4FAN A;  1L9B C;  3NBT A;  3A0H H;  2J59 M;  1N7S C;  5H2F H;  1QL1 A;  4GIF A;  4H0J A;  3EWK A;  1NIR A;  2E5Y A;  2E74 D;  2GM4 A;  155C A;  2YKO A;  1PP9 G;  1RE3 C;  1L4A B;  3CX5 E;  3BRV B;  1FI9 A;  2AXC A;  5CCH A;  3FWL A;  3EFG A;  1BGY J;  1SQB J;  4WBA A;  1MG3 D;  2OZ1 B;  4AAO A;  2W27 A;  3VMY A;  2K3R A;  4L73 A;  3HUS C;  4RSZ A;  1VQO P;  1CCR A;  1DEE G;  4L3H A;  5CCG C;  1SFC C;  4MU8 A;  3LIE A;  1WRG A;  5KLV K;  2L5G B;  1YNR A;  3AE1 C;  4IL6 H;  2JWA A;  2Q9I A;  3ZOX A;  3H1H G;  5AUR A;  1NTK G;  2ZYD A;  1PIX A;  3Q2Y A;  4EIJ A;  4WQ8 A;  5B66 V;  2ZT9 C;  2B87 B;  1DD4 A;  1KD1 Q;  2ZJS E;  3RK3 C;  1VQ9 P;  1GL2 A;  3OAK A;  3M06 A;  3L36 A;  1EDI A;  2GA1 A;  5AVQ B;  2B89 A;  5AW4 B;  1EZV I;  3S1K A;  2WMM A;  1KIL A;  2PCC B;  1VQM P;  1NTM K;  2AXT E;  1SQX J;  2G8Y A;  3OJA B;  4O1Q A;  3RN1 A;  1CW5 A;  3CXH I;  3GLM A;  4C46 A;  2BCC E;  5DJQ B;  3NFQ A;  4LGD E;  3CCJ P;  4EIF A;  1FI7 A;  1CXC A;  1N73 C;  1USD A;  1PP9 E;  2C0W A;  1FDO A;  5E79 V;  2DGE A;  2QVA A;  1LS9 A;  1DW1 A;  1BCC D;  3L72 E;  2WSF H;  1S72 P;  3TYY A;  3H6P A;  2JR8 A;  2B9B A;  4WQA A;  1IFJ A;  1ZRT E;  1Q7Y Q;  1LT9 C;  3RL0 C;  1Z56 A;  1KB9 E;  2ITA A;  3JCU H;  4UB8 V;  3RMZ A;  1S4X A;  3DMI A;  3H1H E;  3RBZ A;  1RZ5 A;  1NTK E;  2FFD C;  1URQ B;  1G1J A;  1W2B O;  1VYD A;  1CXA A;  1RF1 A;  1KTM A;  3BAS A;  2R32 A;  2W6A A;  1LTJ B;  4BRY B;  4R4L A;  2E43 A;  1NWQ A;  3D6Z A;  1BE3 D;  4PV1 B;  4FAV A;  3CXH H;  4KMG A;  1QYZ A;  1OWA A;  3VNW A;  1GZL A;  2D2C B;  1MUU A;  2ZVO B;  1HRO A;  2YMY A;  1KV4 A;  4TLF A;  1KIB A;  2P58 A;  1VDF A;  1S6V B;  1LP1 B;  5M1B A;  2CPB A;  1GKS A;  1NTM G;  1JTH A;  3A0B E;  1M60 A;  4NPF X;  1JCD A;  1PFI A;  1I6E A;  2C1D A;  1SQB K;  4PJ0 V;  5C0Z A;  3C2C A;  3GG2 A;  3JBT B;  1L2P A;  2OYH A;  4CPG A;  2KYV A;  3B5N D;  1NGM B;  3WUV A;  2B0Z B;  2NPS B;  3H1K D;  2B11 B;  3L73 D;  1OVR A;  1SQQ D;  3CXH W;  1YIQ A;  4ZNC A;  4HKZ H;  2W83 C;  5AVZ B;  3A7O A;  2PAC A;  4N0K A;  4JYC A;  2B10 B;  3WU2 E;  2IBZ G;  5EXQ A;  1OXZ A;  1EDK A;  2KZJ A;  3SXT A;  2JKV A;  2CK3 H;  1KN7 A;  3G9R A;  3WUT A;  1K05 A;  1AOF A;  3D6Y A;  1KV9 A;  1ZR2 A;  3AEB C;  3WFC C;  3FXD A;  3H1L J;  1SQX K;  2Z5H A;  1COT A;  2KIK A;  1GL2 B;  2JWD A;  4N78 E;  1LGH B;  5AVV B;  1P84 I;  1WT6 A;  1N86 A;  2IZ1 A;  4JF7 A;  5CJ4 A;  3SWF A;  1C6S A;  4W80 A;  2E42 A;  4L74 A;  1FJK A;  3BAT A;  2BEZ F;  1NTK D;  5AVX B;  1EQ7 A;  2OAR A;  1IQC A;  3RK2 D;  3PJS K;  1HZV A;  4N6J A;  3M9B A;  3CC2 P;  2FYN B;  4UB6 E;  1H32 B;  4YPC A;  4NPD A;  3M0D C;  5B66 E;  1IFN A;  4EYY Q;  3IR9 A;  2O1J A;  1L4A D;  1T3J A;  2BCN B;  3BCC G;  1CI6 B;  2J5U A;  1X79 B;  2YKP A;  3SLE A;  2AXT H;  1QEX A;  1SQP G;  5AW6 B;  2N1T C;  4WVZ A;  2IBZ E;  5APV A;  1DW2 A;  4BWN A;  1SQB G;  5AW2 B;  1LWU C;  1K9M Q;  4I1L A;  2OTK E;  3L71 G;  2BH5 X;  2HV4 A;  1CIF A;  5DJQ C;  1LTI C;  2E74 B;  1KYO I;  1UII A;  3L4O A;  3MUD A;  3F89 A;  1RY3 A;  3B5N A;  3L75 G;  5E79 E;  1OVU A;  1RF1 B;  3JC2 2;  2RMZ A;  1DT1 A;  4QMA A;  1CSV A;  2JEE A;  2RN0 A;  2LXC B;  2FBW C;  3PXW A;  1X9V A;  1RE4 C;  1XTC C;  2C0X A;  3S9O A;  1KB9 H;  1C6O A;  1G1I A;  3P8C D;  1XTG B;  1NMI A;  1CRY A;  4UB8 E;  3FXE A;  3O8Z A;  2ZFC A;  2WSS H;  1KQL A;  3PHL A;  1MKM A;  3II6 A;  3A3Y B;  5KLV D;  5AVY B;  1JTH B;  3ZDM A;  4H0L C;  4ZKP A;  1NHL A;  1CRG A;  1HF9 A;  1T6A A;  3BCC E;  1AJY A;  2C1D B;  1CIG A;  1CTZ A;  4WY4 D;  2H7H A;  5TIS E;  4GOD A;  1SQP E;  2FXO A;  3IFM A;  5AW8 B;  1GK4 A;  4WQ9 A;  2OYH B;  2JDI H;  3CPW O;  3V6I A;  1LC2 A;  1FZC C;  1JY3 P;  1KIL E;  2P7J A;  4PV1 C;  3L71 E;  1A02 J;  1NTM D;  4TT3 H;  1DW0 A;  3H1I D;  4D6T D;  1KQG B;  1FJP A;  3SWS A;  3R2P A;  3VP8 A;  3L75 E;  2YK3 A;  5C9M A;  3NTN A;  5AVR B;  3L74 J;  1L0L J;  3B8E B;  1L4A A;  2FYU J;  2PGD A;  1S5L X;  3SWY A;  3P32 A;  1S9K E;  1GU5 A;  5AW7 B;  1GDT A;  4WB4 A;  1RQU A;  2E76 D;  2YO2 A;  3EQ2 A;  3SFE C;  1N7L A;  1N8R Q;  2AXT V;  2BLF B;  4EI2 A;  1M1J B;  1RF0 A;  1PPJ D;  3HQ6 A;  3VRD A;  2IX7 C;  4FA5 A;  4U7J A;  3HQ7 A;  2KLU A;  3CD6 P;  1M90 Q;  5GTH V;  1WEJ F;  1H1O A;  3NWV A;  1W2E A;  2IFM A;  1K8A Q;  5AW0 B;  3WU2 H;  1RHZ B;  4ASW A;  3TGU J;  4QAO A;  1DD3 A;  3A5T A;  1RAQ A;  1YIT P;  2M3E A;  3H25 A;  3CCM P;  1IFP A;  2MTA C;  5TJH A;  1D7M A;  1HBW A;  2ZXY A;  3MIW A;  1JEK A;  2KOG A;  2V7Q H;  5KAF V;  2LIR A;  3EFF K;  2I8F A;  2GC4 D;  4DY9 A;  1IJD B;  2ZYA A;  1BCC G;  2A45 G;  2I8D A;  1BSH A;  1GL2 C;  1JY2 P;  1AVY A;  2FY8 A;  3SFD C;  4H44 D;  3GW6 A;  1HWT C;  4PD4 I;  1E2R A;  4GKG A;  1GD2 E;  1KIL C;  2QJP C;  2FWL A;  5AW3 B;  1HJ5 A;  3C1L A;  1H9Y A;  1JY3 O;  1IK9 A;  1KMI Z;  2E5T A;  1C6R A;  1S3J A;  2HLO A;  4AUW A;  4EOT A;  4WY4 A;  1JCC A;  2GIW A;  5B66 H;  1DEB A;  2PP6 A;  3HD7 D;  1AQ5 A;  1JNM A;  3B5N B;  3M9Q A;  1N90 A;  2MHM A;  4JCG A;  4YE1 A;  2POH A;  1BGY D;  1SQB D;  2QE7 H;  4U3F J;  1E5W A;  3O5C A;  3VTP C;  1GJQ A;  1QL4 A;  2B12 B;  1YYC A;  1YEA A;  3V4W A;  2HG5 D;  1BE3 G;  3CI9 A;  1URQ A;  1FI3 A;  2HOD A;  1F1F A;  1FE6 A;  4W7Y A;  1A02 F;  1ZW0 A;  4YTP C;  3A0B V;  1YJ9 P;  3CWB J;  4Y99 B;  3FX0 A;  1KQF B;  5CYT R;  5AVS B;  5C39 A;  1LTJ A;  3IAO A;  1FHB A;  4RO0 A;  5E79 H;  2OYI C;  1BCC E;  1C52 A;  1S9K D;  1E29 A;  1KB0 A;  4DT0 A;  1GU4 A;  1NTZ K;  1SQX D;  1Y9B A;  1OX3 A;  1RH5 B;  1T8Z A;  1PV3 A;  3T97 A;  3H1K G;  3L73 G;  3HTK A;  3MK7 B;  3TF5 A;  2WPQ A;  1LP1 A;  3MZW B;  3RK2 B;  1L0L K;  2Q1K A;  4UB8 H;  4HYT B;  2FYU K;  5APU A;  2IDB A;  3H1J J;  1DVV A;  1JY2 O;  3SSU A;  4GOE A;  3MGN A;  4RJT A;  1GW3 A;  5AW5 B;  3AEA C;  4Q5P A;  2O01 H;  1JUN A;  5B5E V;  2NPS A;  3O0R C;  3U59 A;  5L8R J;  2WQY C;  3TNU A;  1I55 A;  1R0Q A;  3I5C A;  1HZU A;  3AE2 C;  2JP3 A;  1BE3 E;  4R4M A;  1VPC A;  1JM0 A;  2OYH C;  4Y28 J;  1OMI A;  3RLM A;  1FJ0 A;  4K3I A;  2ZZS 1;  1R5S A;  4DCK A;  1SS1 A;  2H43 A;  2B88 A;  1CIE A;  4UB6 V;  3AEE C;  3HD7 A;  3OCD A;  2N18 B;  1L0N J;  3CCU P;  4PJ0 H;  5APW A;  1LTT C;  3HQ8 A;  1BDC A;  2BGV X;  3GHG C;  1U7M A;  3H1K E;  3L73 E;  5KJ7 C;  5APQ A;  1KQS O;  2CXB A;  1SQQ E;  1NML A;  1S5L E;  5KKZ B;  3LW5 H;  1NU1 J;  4GOF A;  1EZV D;  1YJN P;  3C8V A;  2KSE A;  1HVV A;  5GTH E;  1AV1 A;  4FB1 A;  2AEF A;  2N9I A;  4I2L C;  1FZF A;  1H32 A;  3HE4 B;  3CXH D;  2K88 A;  2KK7 A;  2N9J A;  4I7Z C;  4N3Y B;  1OW8 A;  4JQ0 D;  5CCG D;  1SP4 A;  3Q5R A;  4WY4 B;  1MZ4 A;  4DZO A;  1W2L A;  1CI6 A;  4ZKU A;  5KAF E;  4XA4 A;  2ZT9 D;  1Q86 Q;  3RK3 D;  1CYJ A;  1C2R A;  1SQV J;  2WSF J;  3E1R A;  4IFF A; 
#chains in the Genus database with same CATH homology
 1HZV A;  1CO6 A;  3WFE C;  1NU1 D;  1DIQ C;  1LMS A;  1CNO A;  2FYN B;  1H32 B;  4WQ7 A;  2GB8 B;  3CU4 A;  3WFB C;  2QG4 A;  1CHH A;  2OZ1 A;  1H31 A;  3KZI V;  1COR A;  4P4Q B;  3SVW A;  3H1L D;  5TIS V;  2BCN B;  1CED A;  3HQ9 A;  2VHD A;  2IBZ D;  3X39 A;  3DR0 A;  2BPB B;  1NNO A;  3SLE A;  1LC1 A;  1CSW A;  2CE1 A;  1DW2 A;  1HRC A;  2AI5 A;  1N15 A;  1IRV A;  1U74 B;  1YEB A;  1A8C A;  2BH5 X;  2Q3E A;  2HV4 A;  1SQV D;  1KYO W;  2A06 D;  4PW9 B;  1CIF A;  1HJ4 A;  1MG2 D;  5DJQ C;  1HJ3 A;  3KHU A;  1E8E A;  3RN0 A;  1CRI A;  3L4O A;  2QJY B;  2V07 A;  2ZON G;  3PXS A;  1GIW A;  1CC5 A;  1F1C A;  3ORV A;  3PXT A;  2RMZ A;  1U75 B;  1DT1 A;  2PCB B;  3OA8 A;  1CSV A;  1A2S A;  2RN0 A;  3PXW A;  1I8O A;  3VYM A;  1GQ1 A;  1C6O A;  5CIH B;  1H33 A;  1CIH A;  1NMI A;  1CHI A;  1CRY A;  3DP5 A;  1LFM A;  2YCC A;  3ZIY A;  3WC8 A;  2YQB A;  3PHL A;  1C7M A;  2ZOO A;  4V2K A;  2ZBO A;  3TYI A;  2C2C A;  5KLV D;  3BCC D;  1L9J C;  2O3J A;  1N9C A;  4AX3 A;  1CRG A;  1SQP D;  2Y0D A;  4XXL A;  1ETP A;  2C1D B;  1CIG A;  1CTZ A;  3M97 X;  4XYD B;  3OCD B;  1CYC A;  2CA3 B;  1M70 A;  4WQ9 A;  1CRH A;  1QL3 A;  1CTJ A;  3L71 D;  1IO3 A;  1LC2 A;  2V08 A;  3ZBM A;  1K3H A;  1FCD C;  2FRC A;  1AYG A;  1NTM D;  3WFD C;  4EID A;  3VMA A;  1DW0 A;  2GC7 D;  3H1I D;  3L75 D;  4D6T D;  2L4D A;  2QJK B;  1ZZH A;  3SWS A;  4WQD A;  1AOQ A;  2CA4 B;  1CSX A;  1P84 D;  2N9Y B;  4A7P A;  2YK3 A;  5C9M A;  1I6D A;  2KS1 A;  1RZ6 A;  2DVH A;  1B7V A;  1GU2 A;  1BL9 A;  1A56 A;  3L70 D;  1DVH A;  1FOC A;  2CE0 A;  1OCD A;  4J20 A;  5CIF B;  2AXT V;  2BLF B;  3CX5 W;  1PPJ D;  3HQ6 A;  3VRD A;  4AAM A;  1YCC A;  1CRJ A;  4FA5 A;  3WU2 V;  3HQ7 A;  3A0H V;  5H2F V;  3TDK A;  3CYT I;  5GTH V;  1HH7 A;  1WEJ F;  1H1O A;  2LIT A;  3NWV A;  4FAN A;  1L9B C;  2C8S A;  3NBT A;  1NTZ D;  1YTC A;  4H0J A;  1I5T A;  4QAO A;  1NIR A;  3L4M A;  3CX5 D;  1RAQ A;  3O20 A;  155C A;  1YIC A;  4NFG B;  5TJH A;  2MTA C;  3L74 D;  1L0L D;  3SJL A;  2FYU D;  2ZXY A;  1FI9 A;  1M6Z A;  3FWL A;  1CYI A;  5KAF V;  2LIR A;  1MG3 D;  2I8F A;  2GC4 D;  2OZ1 B;  4AAO A;  1H31 B;  4DY9 A;  4RSZ A;  1CCR A;  4L3H A;  4IL6 V;  1KYO D;  4WQE A;  4MU8 A;  5CIE B;  3GW6 A;  1E2R A;  1W5C T;  1YNR A;  2JWA A;  3ZOX A;  2FWL A;  2N3B A;  4WQB A;  1HJ5 A;  2Y0E A;  5AUR A;  1H9Y A;  4WQ8 A;  5B66 V;  3TGU D;  1C6R A;  4FA1 A;  4GYD A;  1N50 A;  2GIW A;  2D0W A;  3CP5 A;  3MK7 C;  1OAE A;  2ORL A;  1KX7 A;  2PCC B;  1N90 A;  2C1V A;  2BCC D;  2MHM A;  4JCG A;  4YE1 A;  1BGY D;  1SQB D;  3O1Y A;  3OA8 B;  4O1Q A;  3RN1 A;  1GDV A;  3O5C A;  1GJQ A;  1QL4 A;  3ZOO A;  2B4Z A;  5DJQ B;  2B12 B;  3ZOY A;  1YEA A;  1HCM A;  1FI3 A;  1PP9 D;  4PWA A;  4EIF A;  1F1F A;  1FI7 A;  1CXC A;  5CIB B;  1H33 B;  5B6Q A;  5DFS A;  3A0B V;  3L72 D;  1AKK A;  5GTI V;  5E79 V;  2DGE A;  1LS9 A;  1RAP A;  1DW1 A;  5CYT R;  1IRW A;  1BCC D;  2Y0C A;  2EXV A;  4AAL A;  1CHJ A;  1C75 A;  1QKS A;  4L3G A;  1I54 A;  4WQC A;  5KLI B;  1FHB A;  1C52 A;  1ZRT D;  1E29 A;  2BH4 X;  1EB7 A;  2QJP B;  1KB0 A;  4WQA A;  4L1Q A;  1KB9 D;  3H1H D;  1SQX D;  4U3F D;  1H9X A;  4UB8 V;  3RMZ A;  3WUI A;  3DMI A;  5KAI V;  1RZ5 A;  1S5L V;  2N18 C;  3MK7 B;  3TF5 A;  2D0S A;  1VYD A;  2YIU B;  1CXA A;  2JTI B;  5CIG B;  1DVV A;  3CWB D;  4RJT A;  1I8P A;  1DII C;  4FA4 A;  4EIE A;  4Q5P A;  1IZL 0;  5B5E V;  1BE3 D;  3O0R C;  4FAV A;  4KMG A;  1QYZ A;  1I55 A;  1R0Q A;  1HZU A;  3VNW A;  1HRO A;  3PRJ A;  4GED B;  4H0K A;  1KIB A;  4O1W A;  3RLM A;  1FJ0 A;  4K3I A;  1S6V B;  2ZZS 1;  1GKS A;  1M60 A;  5DF5 A;  1YFC A;  5CIC B;  1CIE A;  4UB6 V;  3A9F A;  1CTY A;  3H1J D;  2JQR A;  1I6E A;  2C1D A;  4PJ0 V;  3ZCF A;  5C0Z A;  3OCD A;  3C2C A;  3GG2 A;  4PD4 D;  3JBT B;  2N18 B;  2B0Z B;  3H1K D;  2B11 B;  3L73 D;  3HQ8 A;  1SQQ D;  3CXH W;  1YIQ A;  2BGV X;  4LJI A;  1C2N A;  4EDF A;  1DW3 A;  1CSU A;  2C9X B;  2CXB A;  2PAC A;  4N0K A;  1NML A;  5KKZ B;  2B10 B;  5EXQ A;  3PH2 B;  3PTZ A;  1EZV D;  1QN2 A;  3SXT A;  2KNC B;  1J3S A;  451C A;  2C1U A;  4FB1 A;  2N9I A;  1H32 A;  1AOF A;  2N3Y A;  3CXH D;  1KV9 A;  2N9J A;  3WFC C;  2AIU A;  1COT A;  1K3G A;  3PLN A;  1MZ4 A;  4EIC A;  2XTS B;  1W2L A;  351C A;  3ZOW A;  1L0N D;  2K9J B;  4AAN A;  1JDL A;  1WVE C;  1CCH A;  5IY5 1;  1C6S A;  3ITK A;  4Y5R A;  3NBS A;  1NTK D;  1CYJ A;  1C2R A;  1CRC A;  1IQC A;  5CID B;  2L91 A;  4FA9 A;  1KX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...