3L71D

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 74
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l71D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l71D02
1QKSA 3PXTA 5IY51 1GQ1A 2PACA 1YNRA 1H1OA 3SJLA 1BE3D 1CHIA 5CIHB 3ZOYA 1DW0A 5TJHA 3SVWA 3HQ8A 3OCDB 1EB7A 3TF5A 4V2KA 1I8OA 4FANA 1W5CT 5TISV 2JWAA 3CXHW 1E29A 1CSWA 1K3GA 2K9JB 1NMIA 2N18C 1AOQA 1I6DA 1NTMD 5E79V 2N9JA 1KX7A 1DVHA 1HCMA 2BH4X 2Q3EA 1H33B 4WQCA 1IO3A 1NTKD 3OA8A 2LIRA 2B0ZB 4AALA 5C9MA 1DVVA 1R0QA 2PCCB 2QJPB 1CC5A 2B11B 4L3GA 1NNOA 2BGVX 1CO6A 4GEDB 3SXTA 4N0KA 3CYTI 3CXHD 1CCRA 4H0KA 1PPJD 2BPBB 1CRCA 5DJQB 2BH5X 2N3YA 3H1HD 2L91A 1M70A 4MU8A 1IQCA 1EZVD 3SLEA 2QJKB 4PD4D 2C9XB 3WU2V 2KNCB 4FB1A 1GU2A 4JCGA 2EXVA 2CA4B 1GIWA 3WFEC 1CXCA 2BLFB 1F1FA 1CRGA 1ETPA 4GYDA 3NBTA 3ITKA 1OAEA 2YK3A 1CRIA 4U3FD 2ORLA 3A0HV 1A56A 3CWBD 5DF5A 3PRJA 1NMLA 3WFCC 2QG4A 3L4MA 1SQPD 3PXSA 4UB6V 2I8FA 1KIBA 1BL9A 5CIGB 1L0LD 3NWVA 1SQVD 3ZIYA 2BCNB 1AYGA 3WFDC 4O1QA 1QL3A 2N18B 1A8CA 4WQAA 1DIQC 2DGEA 4FA1A 5B5EV 3MK7B 1WVEC 1CYJA 1ZRTD 1I8PA 3WFBC 5KAFV 3NBSA 1I54A 1A2SA 2AXTV 1GDVA 2FYNB 1QL4A 1CSVA 1NIRA 4AAMA 1CTZA 4WQ9A 3PTZA 3L70D 1PP9D 3L75D 1RAPA 4FA4A 2XTSB 1CIFA 1DT1A 2MTAC 2V07A 2VHDA 1CIEA 1HRCA 1YIQA 1JDLA 1I55A 2V08A 3ZBMA 1H9YA 2RMZA 3L73D 4EIEA 1VYDA 1C6OA 3PLNA 1H33A 4QAOA 1YICA 3H1LD 5CYTR 1E8EA 2B10B 1CRJA 2YIUB 4FA9A 4J20A 4L1QA 4NFGB 2D0WA 2RN0A 1DIIC 3VYMA 2N9IA 2JQRA 1CYIA 2GB8B 3TGUD 1IZL0 2C1VA 1CXAA 4RJTA 2CA3B 4WQBA 3DR0A 5KAIV 1MG3D 5CIBB 1H31B 1U75B 2PCBB 1N90A 1KB0A 2OZ1B 3OA8B 3RMZA 3CU4A 2B4ZA 2Y0EA 3H1KD 1S5LV 1S6VB 4XYDB 2ZONG 2IBZD 1H9XA 1ZZHA 2C8SA 2N9YB 3ORVA 2Y0DA 1WEJF 155CA 1U74B 3WC8A 1CIHA 4WQDA 3GW6A 1CCHA 1CRHA 3RN1A 1HJ5A 4EICA 4Q5PA 1C2NA 4L3HA 1I5TA 1LMSA 2C1DB 2D0SA 1E2RA 3DP5A 3M97X 5CICB 1YCCA 2CE0A 1COTA 1AKKA 5KLVD 5EXQA 1FOCA 2YCCA 1HROA 3KZIV 2QJYB 4PWAA 4WQ7A 5B6QA 1J3SA 1HH7A 4EDFA 3SWSA 2ZZS1 4PJ0V 3A9FA 2BCCD 4YE1A 2FWLA 5AURA 4PW9B 4IL6V 1H32B 1DW3A 4EIDA 1C7MA 3H1JD 3X39A 1RZ6A 1LS9A 4A7PA 4FAVA 1CRYA 2ZBOA 1H31A 1FCDC 2LITA 2AI5A 1RAQA 3FWLA 2ZOOA 1CIGA 1N15A 2FRCA 1C2RA 2AIUA 2OZ1A 451CA 1NTZD 1W2LA 2GC4D 2KS1A 1SQBD 1FJ0A 4Y5RA 1BGYD 2CE1A 3A0BV 2YQBA 3PXWA 3L4OA 1DW1A 2GC7D 1CTYA 2A06D 3RLMA 3CX5D 1L0ND 3CP5A 5DFSA 2B12B 3GG2A 4DY9A 1BCCD 3HQ7A 5C0ZA 4XXLA 5CIFB 3HQ9A 3WUIA 1LFMA 2N3BA 1FI9A 2C1DA 1H32A 1I6EA 2JTIB 4RSZA 1N50A 4H0JA 3MK7C 1MZ4A 5GTIV 1C6SA 4AX3A 1CHJA 1GJQA 5KLIB 4WQEA 1KYOD 1C75A 1YEBA 1CORA 2HV4A 1LC1A 2C1UA 1CEDA 5GTHV 1OCDA 1CSXA 1FHBA 1KX2A 1QN2A 5DJQC 4O1WA 1SQQD 3O20A 1CYCA 3ZOOA 2O3JA 2GIWA 2ZXYA 3VRDA 1LC2A 1KV9A 1FI7A 5B66V 1YEAA 3L74D 3H1ID 1FI3A 3OCDA 3PHLA 3L71D 2DVHA 3ZOXA 1SQXD 2FYUD 3TDKA 5CIEB 3L72D 2CXBA 3ZCFA 5CIDB 4EIFA 1CNOA 3DMIA 3HQ6A 2L4DA 3KHUA 3TYIA 1K3HA 3O5CA 1KYOW 2C2CA 4WQ8A 4UB8V 1L9BC 4D6TD 1C6RA 3O0RC 3O1YA 4LJIA 4AANA 1GKSA 1NU1D 3RN0A 4AAOA 5KKZB 1CSUA 1DW2A 1HJ4A 1B7VA 3C2CA 1HZVA 1IRVA 1M60A 1CHHA 1IRWA 3JBTB 4K3IA 1YTCA 1QYZA 3VMAA 4FA5A 2MHMA 1YFCA 3VNWA 1M6ZA 1P84D 5H2FV 2Y0CA 3ZOWA 1CTJA 1HZUA 1HJ3A 4KMGA 1AOFA 1C52A 1KB9D 1N9CA 3CX5W 1F1CA 1L9JC 351CA 1RZ5A 3BCCD 1MG2D 3PH2B 4P4QB
chains in the Genus database with same CATH superfamily
2A45I 3VOPA 5AW0B 3Q2YA 3SFEC 3PXTA 1JEKA 1GQ1A 1PPJG 1NJIQ 3GHGB 1CHIA 4I2LC 1RE3A 4WY4A 1GZLA 5TJHA 3HQ8A 4XFJA 1EDLA 3TSIA 3TF5A 4FANA 1GK4A 3CXHW 2KYVA 3VP9A 1BSHA 2ZJSE 1FZCB 2WPRA 1AOQA 3H1IJ 3HE5B 3VP8A 1I6DA 1NTMD 1KX7A 2N9JA 1HCMA 1FC2C 2WSCJ 1X79B 5KLVJ 5CJ4A 1NWQA 2I1KA 1W2EA 3WU2H 2FYNC 1LWUB 1NTKE 2LIRA 2W8ZA 3A0BH 1VQ7P 1KB9I 4IFMA 4WBAA 4U3FE 5H2FH 4GEDB 5APYA 1L0LJ 3SWKA 1CCRA 1FZBA 2OARA 2WSCH 2IDBA 1FJPA 1RF0C 3L73E 2ZT9D 1OW8A 3RK2D 1LTJA 2KXPB 1WRGA 2E74C 3SLEA 2QJKB 4IFFA 4GDOA 4JCGA 3HD7B 1Q90D 4RESB 1QLED 1MUUA 1AA0A 1LT9A 1HTLC 1KFMA 1F1FA 4XA4A 1URQC 1R5LA 1GDTA 2YK3A 1CRIA 1RH5B 4ASVA 4U3FD 1L4AD 1DD4A 1JY3N 1SFCA 3A0HV 4L74A 3CWBD 1LWUC 1SQQK 3CCVP 1AQTA 3LW5J 3PRJA 2FFDB 1ZXGA 2BEZF 5APTA 1BL9A 1G2CA 1NVOA 2AXTH 1SQVD 3ZIYA 1RQVA 3WFDC 4O1QA 2J59M 2PAJA 1NGMB 4DCKA 3A0HE 2E76D 3L70G 1I8PA 3RL0B 1I54A 1KILB 2AXTV 5AW8B 1NTKG 1NIRA 3WU2E 5AVRB 3D0WA 1RAPA 2OYHB 2QM7A 1DT1A 3R2PA 2VHDA 3AE5C 1CIEA 2JDIH 1AV1A 1YIQA 5CMZA 2PRRA 3H1JE 3KYQA 1M7LA 1JDLA 4PJ0E 4H13B 2RMZA 1NTKK 3CCQP 1HF9A 3C9IA 5AW5B 2ZVNB 2FFDC 1RF0A 1NTMJ 4MN4C 4JQ0D 1GL2B 1VYDA 2YKQA 1L4AA 1H33A 1RE3C 1PV3A 5APWA 1NU1E 1E8EA 2M3EA 1CRJA 1WMKA 2M8RA 2OYIC 2CPBA 2GB8B 4H0LC 4H13D 3VN0A 1IZL0 1YI2P 4WY4B 4WQBA 3DR0A 1ZN5A 2AXCA 2FXPA 1H31B 5APVA 3CC2P 2W6AA 3V2NA 2OZ1B 3RMZA 1P84E 4UB8E 1LWUA 1LGHB 1FBMA 1S4XA 1S6VB 1USDA 3L71E 4EIJA 1SFCB 2IBZD 1H9XA 1DEBA 4WY4D 1N8RQ 2N9YB 3L72E 1OVUA 1IFDA 2Y0DA 1AFOA 2HYNA 1DIPA 1N7LA 2OYOA 4Z1MH 3CCUP 3AE8C 1CRHA 1Y47A 1KILD 1R5SA 1NU1J 3H6PA 3L72J 2KLVA 1PPJE 2RKLA 4JBZA 2WTYA 1LMSA 2C1DB 3M0DA 1E2RA 1NTME 3GF7A 3DP5A 4W7ZA 4K3AA 1FU1A 2WPSA 2KP8A 1SP4A 1YHQP 2ZYAA 3H1JJ 1BDCA 1KORA 2ZVOB 3KZIV 3AEAC 3LIDA 1S5LH 1PGQA 2R3CA 1PP9G 2V7QH 3H25A 1JUNA 5AW2B 3H1JD 3V6IA 4PV1C 3KQGA 5KAIH 1MKMA 1K05A 1DD3A 1LS9A 1KMIZ 1H31A 1FCDC 1HUCA 3FWLA 2ZOOA 2OZ1A 1C2RA 451CA 2YMKA 3ZDMA 1URQB 4PJ0H 1LTSC 3A0BV 1J2JB 4EI2A 2Q3IA 1QEXA 2E74B 5CBOA 3L4OA 1LTTC 2G8YA 1A02J 1DEEG 2P2UA 1JO5A 2B12B 3TGUJ 5KLVE 1NTMG 1KQSO 4ZNCA 3HQ7A 4XXLA 5CIFB 1Y9BA 1LFMA 2E76B 3JC22 2Q5UA 1N50A 3QH9A 4H0JA 5BVZA 2E74D 1DH3A 1D7MA 1KQFB 1VQMP 2H8PD 3D6YA 4AX3A 1EDIA 3FGAD 5M1BA 1OCDA 1CSXA 1FHBA 4HJGH 1NAFA 4ZMDA 1BGYE 2FYZA 3H1LJ 5DJQC 2K9JA 3AECC 2NPSD 3KZIE 1SQQD 5GTHH 3RL0C 1FDMA 1PGPA 3ZOOA 2O3JA 4D6TE 1S3JA 3VRDA 4YXDC 3AE9C 1KV9A 1ZMEC 3D71A 1FZCC 3CPWO 1NU1G 3HRNA 3ZOXA 5K5GB 1KQGB 3F5HA 2D2CC 3AEDC 1VF5C 3L72D 3HE4A 4EIFA 4GT1A 3DMIA 2OYIB 3P8CE 3KHUA 1K3HA 1GK6A 4IL6E 1KYOW 4I1LA 3USSA 2QJYC 3O6QA 1H89A 1L9BC 2V7QJ 1VQKP 1NYHA 4AAOA 4PD4I 1GU5A 3TGUE 1SQVJ 1SFCD 3C2CA 1HZVA 1CHHA 1IRWA 3V4WA 1QYZA 1MFZA 3B4SA 2Q6QA 4FA5A 3H1JG 2OYIA 3O8ZA 2AEFA 2UWJE 2Y0CA 1CTJA 1HZUA 3A7OA 2AEJA 1AOFA 4NPFX 1E79H 1F1CA 2Y9ZA 1KILA 3PH2B 4BRYB 2E5TA 1QKSA 3RL0D 2PACA 1YNRA 3ZOYA 4N3YB 3E1RA 4H44D 3AE4C 4V2KA 1I8OA 1MV8A 2POHA 1W5CT 5TISV 3CXHI 3GLMA 2GM4A 2BEQD 1LT9C 2WPQA 2K1AA 3E7KA 3HD7A 1Q81Q 5E79V 2JJLA 1JY2O 2Q3EA 3LW5H 5KAFE 3OA8A 2N9BA 2QM8A 2B0ZB 4AALA 1G1IA 3L70E 1SQBK 2PCCB 3CX5I 1RF1B 1VQ9P 1NNOA 2QSIA 3NXSA 1H0TA 1CO6A 2FYUE 2M3BA 1BE3J 3CYTI 3CXHD 3EFFK 3AEGC 1S5LX 2N1TD 1QGKB 2L5GB 5APXA 4WWIA 1YBKA 4KHXA 5AVSB 3CCRP 1S9KD 1OVRA 1EZVD 5AW9B 3B71A 4O9BA 2ZYDA 1H8AA 2CA4B 1IFMA 2LXBA 2KSEA 1QL1A 3H1IG 1RE4C 2HFED 3AE3C 2E5YA 1CRGA 3HTKA 3NBTA 3ITKA 2QJKC 3RBZA 2IYOA 1BGYJ 5TISH 1A56A 3L73G 1H88A 2P58A 3WFCC 2QG4A 1JCCA 1EC5A 1L0NK 1OX3A 3RK2B 5APQA 3G9RA 3TNUA 1QL3A 2N18B 4WQAA 1DIQC 2DGEA 3O6QB 1JB0J 2ZAEB 1ZRTD 5KAFV 3Q1MA 3P8MC 2E42A 1S2EA 1NTKJ 1A2SA 3VMYA 1FJKA 1QL4A 2D2CB 4UB6H 1CTZA 1AQ5A 1PP9D 2FY8A 1VQPP 2K9YA 1GW3A 4FA4A 1M1KQ 1CIFA 1AJYA 4I6MC 5CCHC 2PGDA 1URQA 1I55A 2D2CD 3L73D 4EIEA 2WZ7A 3M0AA 2FKWB 2KOGA 2YXQB 3PLNA 3P32A 2A45G 1FS0E 4QAOA 3WUTA 3RK3B 3CWBJ 1KFNA 1U57A 5AVZB 2YIUB 4J20A 3AE1C 4L1QA 4NFGB 2KZIA 2RN0A 1DIIC 2JQRA 1PP9E 2G3AA 2NPSC 2C1VA 1CXAA 3RGUA 2CA3B 5BU8B 3V2QA 5KJ7C 5AW4B 4YPCA 1N90A 5TISE 3CU4A 3AEEC 3D70A 3A0BE 4RKUJ 5B5EH 3H1KD 2SPZA 1AVYA 4XYDB 4WY4C 2ZONG 1ZV8A 3BCCE 1ZZHA 3QWOC 1L0NJ 1KILE 5B66E 2QVAA 1HJ5A 1ZR2A 2GA1A 1UIIA 4Q5PA 3L72G 1I5TA 2XV5A 3FWNA 3M97X 1L0NG 2ITAA 3L74G 1L2PA 1COTA 5KLVD 1T3UA 2R5BA 3B5NA 3S1KA 2KS1B 3HUSB 3D6ZA 1JNMA 3HD7C 2PFXA 1SQVG 4PJ0V 5AVTB 4XE5B 4B86A 3A9FA 5GTHE 1DW3A 3H32A 3L70J 4H44B 4AUWA 1EZVG 4LC1A 4A7PA 3HE5A 1OFCX 4OH8B 2ZBOA 1PGJA 3S4RA 4U3FG 1RAQA 5CBNA 1N7SC 4D6TG 1AVOA 2FRCA 1NTZD 1IZNB 1W2LA 1SQBD 3BATA 2KI7B 1SQBE 4JYCA 3MUDA 5CCGA 3L36A 5APUA 4PD4H 5AW3B 1BE3G 2GC7D 2IZ1A 3L75G 1FAVA 3I55P 3U1AA 1L4AB 1M8OB 3V2PA 1JY3P 3GG2A 1M56D 1VQOP 3I5CA 5C0ZA 3AE7C 3HUSC 4H13C 4HH2A 2H43A 3CMAP 1Q82Q 3PP5A 3OAKA 1X8YA 1MZ4A 5GTIV 3HE4B 1Q86Q 1CHJA 1GJQA 2M0BA 5KLIB 1T3JA 4WQEA 5AVXB 1CORA 3Q5PA 2HV4A 1G1JA 1CEDA 2C1UA 5AVYB 3CWBG 3P8CD 3JCUE 5KAFH 3MP7B 5KJ7D 2YO3A 1YTZI 1LTJB 3CXHH 4PD4E 1FZGA 1CYCA 3KXDA 2ZXYA 1LT9B 2XNXA 1L0NE 2ZYGA 3V4QA 3IN6A 3H1KE 3RK3D 2XZRA 5CIEB 1NHLA 1ZR4A 3PJSK 3MZWB 1UIXA 2AXTE 3UIAA 3HQ6A 4U7JA 1FOSE 3TYIA 2HPCA 3O5CA 2NPSB 1E5WA 2W27A 2C2CA 1VF5D 2CPSA 1SQXK 3O1YA 1EXIA 3H1LE 1OIPA 1GTWA 5KKZB 3ABVC 1B7VA 3K5BA 1IRVA 2HLOA 1Y8AA 1JM0A 4K3IA 2MHMA 1KQLA 3VNWA 1P84D 2BCCG 1W5CE 2LXCB 3BVHA 3M06A 4CPGA 1C52A 4OGQD 3CX5W 2FXMA 1CW5A 5KJ7A 3AE6C 3NMDA 2JKVA 4Y99B 4P4QB 2FFDA 5E79H 5IY51 2QRXA 1H1OA 2QA4P 4UB6E 1S9KE 3OCDB 1EB7A 3B5ND 1J1EB 2P1JA 1SQBJ 3A0HH 1LT1A 2JWAA 1E29A 1CSWA 1VQ8P 4OGQB 3EFGA 4JYBA 4KJMA 3I56P 1K3GA 1YJWP 2N18C 3IAOA 2WSEH 3CCEP 1JY3O 1DVHA 1BCCG 1IFIA 4H44C 2K37A 4WQCA 1IO3A 1NTKD 2N1TC 3FXEA 5C9MA 1DVVA 1R0QA 2BASA 2QJPB 2B11B 3M9QA 2R5DA 3VMXA 3RK3E 1BGYG 2BCCE 1CI6B 3N4XA 3SXTA 1YJNP 3U1CA 4EOTA 3GF3A 4HKZH 2E76C 4H0KA 3SFDC 3W68A 2K88A 4TLFA 5BU5A 1L4AC 5DJQB 2N3YA 3T97B 1JMBA 1SQVE 1NTZE 1LTAC 2Q1KA 1M70A 3P7KA 4ASWA 4MU8A 3JSVC 1IQCA 4GOEA 2WT7B 1YITP 2C9XB 3WU2V 2KNCB 1N7SA 4N78D 3EQ2A 2OTLP 2EXVA 4OGQC 1KYOI 3H1IE 3WFEC 2OTKE 1OMIA 1CXCA 3L74E 2BLFB 4DJGA 5KLVG 1ETPA 2IBZI 1QX8A 1OAEA 3LIEA 3GMAA 3H1HG 5DF5A 1SQPE 4AYCA 1NMLA 3BRVB 2A45H 2I8FA 1NKNA 2GUSA 5CIGB 1IFNA 1WT6A 1KC8Q 1K73Q 1AYGA 4LLHA 1A8CA 3WUVA 2BCCJ 1WVEC 4BWNA 2OYHC 1FZCA 1M90Q 3WFBC 3CL3D 1NTZG 4N6JA 1PIXA 3NBSA 1IC2A 1GW4A 2YMYA 2QIWA 1L0LG 4YTPC 3CC4P 1N7SD 1HWTC 1RHZB 5AVUB 4WQ9A 2B87B 3PTZA 3L70D 1PL5A 1QVGO 4BXLA 3A3YB 3L75D 2W90A 2KZJA 1RE4A 1YTZT 2MTAC 2V07A 2O01N 2CK3H 4PV1D 1IFPA 1EXJA 2YKPA 2LKMA 3ZBMA 3AEBC 1N7SB 4DOJA 1M1JB 3GHGA 3OJAB 1N2DC 1C6OA 3TK1A 5KKZC 2VRSA 3T97A 1P84H 1YICA 3H1LD 1URQD 1RQUA 1K8AQ 4FA9A 2D0WA 2KIKA 3CX5E 2QEXP 1OW7A 1LTIC 2MKVA 4HB1A 2WSSH 2KNCA 3EWKA 4ZKPA 3AE2C 5KAIV 5CIBB 3BCCJ 2YIUC 1KB0A 1BCCE 4NPDA 1RY3A 3H1KJ 2OQQA 2KSJA 2MJZA 4OVNF 2B4ZA 3H1HJ 1S5LV 3KPEA 2I1JA 1VQ6P 1L0LE 2R44A 3ORVA 5KLVK 1U74B 1NO4A 1CCHA 1SLQA 1VQ4P 2OYHA 5CCGC 3Q5RA 1SQXJ 1C2NA 4GIFA 3CLQA 4TT3H 5CJ0A 3BCCG 2D0SA 3A5TA 3M91A 5CICB 1IK7A 3L75J 4R4MA 1AKKA 1ZOYC 2KLUA 2GUVA 3L73J 1HROA 2XDJA 2QJYB 2FYUJ 1KB9E 4WQ7A 5B6QA 4GKGA 1J3SA 3KDPB 1SQQJ 1KTMA 3SWSA 2ZZS1 3R4YA 3L71J 2BCCD 2FWLA 5AURA 1YJ9P 5C39A 4IL6V 1OVVA 1NU1K 2J5UA 4EIDA 2W6BA 1T2KC 2ZFCA 1C7MA 1EZVI 3X39A 3V2RA 4EYYQ 1RZ6A 1MFTA 4FAVA 3AEFC 1CRYA 3OW2O 2LITA 1Q2NA 3C8VA 2AIUA 1LP1B 4Y5RA 1OWAA 2IFNA 2YQBA 1SQPG 3VYIA 3PXWA 2H88C 1DW1A 1M57D 1IO4A 1K04A 1KZUB 2A06D 3RLMA 2O1KA 3CX5D 1SQPJ 1L0LK 3CP5A 2XKMA 1J1DB 1SQXG 2ZXEB 3MIWA 3HQ9A 3G6EP 3WUIA 1FI9A 2N3BA 2C1DA 3G4SP 1H32A 4RSZA 1FZAA 3VMZA 2XU6A 1VDFA 1KV4A 1EDJA 2OTJP 5DJUB 3SSUA 1KYOD 1EDKA 1GL2A 5KTBA 4I7ZC 3L71G 1LC1A 1XTCC 5AVWB 1KX2A 1FDIA 3HTKB 1QN2A 2P67A 1XTGB 2B89A 4O1WA 3O20A 1CSBA 2GIWA 2JR8A 1U7JA 1VQ5P 1LC2A 1FI7A 3OA7A 3MUDC 5B66V 1T6AA 1YEAA 1HJ0A 2W6JH 3W67A 1HBWA 3H1ID 1FI3A 2IYPA 2FBWC 1S1CX 2E75B 3PHLA 1SVFA 2B9BA 1BSNA 1H0TB 1JY2N 1FDOA 1SQXD 1HGZA 5B5EE 3F89A 3TDKA 2CXBA 1CNOA 2L4DA 2W83C 5DJTB 2Z5IA 1A02F 1YIJP 1LP1A 2WSFH 2V4HA 4D6TD 1C6RA 1NH4A 2IZ0A 2Q7CA 4LJIA 4AANA 3Q3DA 3RN0A 1W2BO 3TYYA 3FXDA 2O01J 1HJ4A 3CD6P 4PV1B 1M60A 1KYOH 1IJDB 1YTCA 3CCSP 3BRTB 4WVZA 1YFCA 4QMAA 1QL2A 3L4FA 1M6ZA 4GODA 5H2FV 3HD7D 2WSFJ 2RH0A 1QVFO 1S5LE 1HJ3A 1JOCA 3Q5SA 4U3FJ 5CCHA 1RZ5A 1HGVA 2K3RA 5KAIE 3SJLA 1BE3D 5CIHB 3CI9A 1YYCA 1FE6A 5GTIH 1DW0A 3SVWA 4H0LB 5APSA 5H2FE 1HJBA 2JO1A 2FXOA 2K9JB 1TU3F 1NMIA 2E75D 3RL0g 1JTHA 3U59A 1KD1Q 1GMJA 2JWDA 2BH4X 2C0WA 1H33B 2JEEA 2WPVB 2HR3A 1X0TA 1CC5A 3TGUG 4L3GA 1M1JC 1SQVK 2BGVX 2H7HA 3IF4A 1PP9J 3II6A 1J1EC 4N0KA 4JPZB 2ZXXA 1FOSF 1NAYA 1P84I 1PPJD 4GOFA 2BPBB 3H1HE 1CRCA 2BH5X 3H1HD 1LTGC 2L91A 5L8RJ 1GU4A 1J1DC 4UB8H 3BASA 1BCCJ 4PD4D 4FB1A 1GU2A 3CCLP 4BRYA 2IX7C 4LGDE 1GIWA 5AVQB 1T2KD 1YQ4C 3CC7P 4GYDA 3RK2C 3IR9A 4W7YA 2WVRA 2ORLA 4KT0J 1PGOA 3RBXA 1NTZJ 2YXRB 3GHGC 2O01H 1KYOE 1PZQA 1LJ2A 3L4MA 1SQPD 3PXSA 4UB6V 4R4LA 1KIBA 2Q9IA 1L0LD 3NWVA 2JP3A 4M3LA 5EFWB 2BCNB 2IFMA 4FA1A 1SQPK 5B5EV 2R3SA 3MK7B 1ZRTE 1CYJA 3A2AA 4JF7A 3MTUE 1GDVA 2M5AA 2FYNB 2PP6A 3L37A 1CSVA 2P10A 4AAMA 3MGNA 2J58A 4OWFA 2XTSB 1NTZK 1N73A 1KB9H 2NZ2A 3HUSA 1VQNP 1HRCA 2WWWA 1R8EA 3CX5H 4HYTB 2DW3A 2V08A 1DX7A 1H9YA 2WITA 2H89C 2C9LY 2M5AB 2HODA 2C0XA 4L75A 5E79E 3JCUH 2YKOA 3M0DC 1JCDA 5CYTR 2E43A 2B10B 1SQQE 1PFIA 3C1LA 2I8DA 4DT0A 3H32B 3M9BA 3VYMA 2N9IA 1CYIA 3TGUD 1GD2E 4RJTA 5B66H 1KN7A 1MG3D 2B87A 2FYUK 2P7JA 1U75B 3H1LG 2PCBB 3SWYA 4ZKUA 3OA8B 1N86A 2C9NY 2ZT9C 2Y0EA 1FZEA 5KLIC 2OGUA 2QE7H 2C8SA 1WEJF 155CA 3B5NB 1LTBC 3WC8A 1CIHA 3TNUB 4WQDA 3GW6A 3RN1A 3WUUA 4C7NA 1OXZA 4EICA 5CHXA 2IBZG 4L3HA 4WB4A 4C46A 4YXWH 3G3ZA 1YCCA 1YQ3C 2CE0A 3MD0A 2E75C 3CMEP 5EXQA 1FOCA 2YCCA 3VTPC 5CCGD 1Q7YQ 3MHVA 3M9HA 2WQYC 1N73C 1SQBG 4PWAA 5GTIE 1HH7A 2WMMA 3CCJP 4EDFA 4YE1A 1JMMA 4PW9B 1H32B 4RO0A 1GL2C 5CCHD 2KB7P 2LR2A 2O1JA 1X22A 4C7RA 1IK9A 5AW6B 2AI5A 2YNYA 1VPCA 1CIGA 1HVVA 2WSEJ 1N15A 4IL6H 1NTMK 2B88A 3FX0A 1S72P 2GC4D 2KS1A 1FJ0A 1BGYD 2CE1A 1T8ZA 3RK3C 1EZVE 3E1IA 1CZQA 1CTYA 2FYUG 3G71P 3IFMA 3L75E 1L0ND 4N78E 1IFJA 5DFSA 1SS1A 4DY9A 3PH0A 1SQXE 1BCCD 2HG5D 1ZW0A 2IBZE 1N73B 5AW7B 1I6EA 4H0LD 2JTIB 3S9OA 1K9MQ 2Z4EA 3MK7C 1RF1C 1CI6A 1C6SA 1OW6A 2KUBA 4IFDK 4NPEA 3CCMP 2HODB 4K35A 1C75A 5AVVB 1YEBA 5GTHV 2N1TB 1VF5B 4DZOA 1LTJC 1X9VA 3NTNA 2NRGA 1ZP0C 1USEA 1JY2P 2XNDH 3L74J 4Y28J 3SWFA 2HPCB 3N7NA 3L74D 2A06E 2QJPC 1FZFA 1G2CB 1HH0A 3NFQA 3OCDA 1SQQG 3L71D 2DVHA 1KILC 2N1TA 1VQLP 2FYUD 4I7ZB 4IOIH 1LNQA 4L76A 1MZ9A 3ZCFA 5CIDB 5AW1B 1BE3E 1U7MA 3H1KG 4WQ8A 2KK7A 4UB8V 2IPPA 3O0RC 1GKSA 1NU1D 2A06G 2ZT9B 1CSUA 1DW2A 1JTHB 3WMM0 2R32A 1Z56A 1GL2D 1NOHA 3JBTB 4Y99C 4C7NB 3VMAA 1VL2A 1ZLLA 4IL6X 3B5NC 4L73A 3L35A 1M1JA 1NKZB 1OZHA 3B8EB 3ZOWA 4W80A 1BDDA 2NPSA 4KMGA 4D6TJ 3V5BA 1EQ7A 1KB9D 1N9CA 1RF1A 3CWBE 1SFCC 1L9JC 2WT7A 2Z5HA 3CXHE 351CA 3KZIH 4AQRD 2AEMA 3BCCD 2Y9YA 1MG2D 2YO2A
chains in the Genus database with same CATH topology
1QKSA 3PXTA 5IY51 1GQ1A 2PACA 1YNRA 1H1OA 3SJLA 1BE3D 1CHIA 5CIHB 3ZOYA 1DW0A 5TJHA 3SVWA 3HQ8A 3OCDB 1EB7A 3TF5A 4V2KA 1I8OA 4FANA 1W5CT 5TISV 2JWAA 3CXHW 1E29A 1CSWA 1K3GA 2K9JB 1NMIA 2N18C 1AOQA 1I6DA 1NTMD 5E79V 2N9JA 1KX7A 1DVHA 1HCMA 2BH4X 2Q3EA 1H33B 4WQCA 1IO3A 1NTKD 3OA8A 2LIRA 2B0ZB 4AALA 5C9MA 1DVVA 1R0QA 2PCCB 2QJPB 1CC5A 2B11B 4L3GA 1NNOA 2BGVX 1CO6A 4GEDB 3SXTA 4N0KA 3CYTI 3CXHD 1CCRA 4H0KA 1PPJD 2BPBB 1CRCA 5DJQB 2BH5X 2N3YA 3H1HD 2L91A 1M70A 4MU8A 1IQCA 1EZVD 3SLEA 2QJKB 4PD4D 2C9XB 3WU2V 2KNCB 4FB1A 1GU2A 4JCGA 2EXVA 2CA4B 1GIWA 3WFEC 1CXCA 2BLFB 1F1FA 1CRGA 1ETPA 4GYDA 3NBTA 3ITKA 1OAEA 2YK3A 1CRIA 4U3FD 2ORLA 3A0HV 1A56A 3CWBD 5DF5A 3PRJA 1NMLA 3WFCC 2QG4A 3L4MA 1SQPD 3PXSA 4UB6V 2I8FA 1KIBA 1BL9A 5CIGB 1L0LD 3NWVA 1SQVD 3ZIYA 2BCNB 1AYGA 3WFDC 4O1QA 1QL3A 2N18B 1A8CA 4WQAA 1DIQC 2DGEA 4FA1A 5B5EV 3MK7B 1WVEC 1CYJA 1ZRTD 1I8PA 3WFBC 5KAFV 3NBSA 1I54A 1A2SA 2AXTV 1GDVA 2FYNB 1QL4A 1CSVA 1NIRA 4AAMA 1CTZA 4WQ9A 3PTZA 3L70D 1PP9D 3L75D 1RAPA 4FA4A 2XTSB 1CIFA 1DT1A 2MTAC 2V07A 2VHDA 1CIEA 1HRCA 1YIQA 1JDLA 1I55A 2V08A 3ZBMA 1H9YA 2RMZA 3L73D 4EIEA 1VYDA 1C6OA 3PLNA 1H33A 4QAOA 1YICA 3H1LD 5CYTR 1E8EA 2B10B 1CRJA 2YIUB 4FA9A 4J20A 4L1QA 4NFGB 2D0WA 2RN0A 1DIIC 3VYMA 2N9IA 2JQRA 1CYIA 2GB8B 3TGUD 1IZL0 2C1VA 1CXAA 4RJTA 2CA3B 4WQBA 3DR0A 5KAIV 1MG3D 5CIBB 1H31B 1U75B 2PCBB 1N90A 1KB0A 2OZ1B 3OA8B 3RMZA 3CU4A 2B4ZA 2Y0EA 3H1KD 1S5LV 1S6VB 4XYDB 2ZONG 2IBZD 1H9XA 1ZZHA 2C8SA 2N9YB 3ORVA 2Y0DA 1WEJF 155CA 1U74B 3WC8A 1CIHA 4WQDA 3GW6A 1CCHA 1CRHA 3RN1A 1HJ5A 4EICA 4Q5PA 1C2NA 4L3HA 1I5TA 1LMSA 2C1DB 2D0SA 1E2RA 3DP5A 3M97X 5CICB 1YCCA 2CE0A 1COTA 1AKKA 5KLVD 5EXQA 1FOCA 2YCCA 1HROA 3KZIV 2QJYB 4PWAA 4WQ7A 5B6QA 1J3SA 1HH7A 4EDFA 3SWSA 2ZZS1 4PJ0V 3A9FA 2BCCD 4YE1A 2FWLA 5AURA 4PW9B 4IL6V 1H32B 1DW3A 4EIDA 1C7MA 3H1JD 3X39A 1RZ6A 1LS9A 4A7PA 4FAVA 1CRYA 2ZBOA 1H31A 1FCDC 2LITA 2AI5A 1RAQA 3FWLA 2ZOOA 1CIGA 1N15A 2FRCA 1C2RA 2AIUA 2OZ1A 451CA 1NTZD 1W2LA 2GC4D 2KS1A 1SQBD 1FJ0A 4Y5RA 1BGYD 2CE1A 3A0BV 2YQBA 3PXWA 3L4OA 1DW1A 2GC7D 1CTYA 2A06D 3RLMA 3CX5D 1L0ND 3CP5A 5DFSA 2B12B 3GG2A 4DY9A 1BCCD 3HQ7A 5C0ZA 4XXLA 5CIFB 3HQ9A 3WUIA 1LFMA 2N3BA 1FI9A 2C1DA 1H32A 1I6EA 2JTIB 4RSZA 1N50A 4H0JA 3MK7C 1MZ4A 5GTIV 1C6SA 4AX3A 1CHJA 1GJQA 5KLIB 4WQEA 1KYOD 1C75A 1YEBA 1CORA 2HV4A 1LC1A 2C1UA 1CEDA 5GTHV 1OCDA 1CSXA 1FHBA 1KX2A 1QN2A 5DJQC 4O1WA 1SQQD 3O20A 1CYCA 3ZOOA 2O3JA 2GIWA 2ZXYA 3VRDA 1LC2A 1KV9A 1FI7A 5B66V 1YEAA 3L74D 3H1ID 1FI3A 3OCDA 3PHLA 3L71D 2DVHA 3ZOXA 1SQXD 2FYUD 3TDKA 5CIEB 3L72D 2CXBA 3ZCFA 5CIDB 4EIFA 1CNOA 3DMIA 3HQ6A 2L4DA 3KHUA 3TYIA 1K3HA 3O5CA 1KYOW 2C2CA 4WQ8A 4UB8V 1L9BC 4D6TD 1C6RA 3O0RC 3O1YA 4LJIA 4AANA 1GKSA 1NU1D 3RN0A 4AAOA 5KKZB 1CSUA 1DW2A 1HJ4A 1B7VA 3C2CA 1HZVA 1IRVA 1M60A 1CHHA 1IRWA 3JBTB 4K3IA 1YTCA 1QYZA 3VMAA 4FA5A 2MHMA 1YFCA 3VNWA 1M6ZA 1P84D 5H2FV 2Y0CA 3ZOWA 1CTJA 1HZUA 1HJ3A 4KMGA 1AOFA 1C52A 1KB9D 1N9CA 3CX5W 1F1CA 1L9JC 351CA 1RZ5A 3BCCD 1MG2D 3PH2B 4P4QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKS A;  3PXT A;  5IY5 1;  1GQ1 A;  2PAC A;  1YNR A;  1H1O A;  3SJL A;  1BE3 D;  1CHI A;  5CIH B;  3ZOY A;  1DW0 A;  5TJH A;  3SVW A;  3HQ8 A;  3OCD B;  1EB7 A;  3TF5 A;  4V2K A;  1I8O A;  4FAN A;  1W5C T;  5TIS V;  2JWA A;  3CXH W;  1E29 A;  1CSW A;  1K3G A;  2K9J B;  1NMI A;  2N18 C;  1AOQ A;  1I6D A;  1NTM D;  5E79 V;  2N9J A;  1KX7 A;  1DVH A;  1HCM A;  2BH4 X;  2Q3E A;  1H33 B;  4WQC A;  1IO3 A;  1NTK D;  3OA8 A;  2LIR A;  2B0Z B;  4AAL A;  5C9M A;  1DVV A;  1R0Q A;  2PCC B;  2QJP B;  1CC5 A;  2B11 B;  4L3G A;  1NNO A;  2BGV X;  1CO6 A;  4GED B;  3SXT A;  4N0K A;  3CYT I;  3CXH D;  1CCR A;  4H0K A;  1PPJ D;  2BPB B;  1CRC A;  5DJQ B;  2BH5 X;  2N3Y A;  3H1H D;  2L91 A;  1M70 A;  4MU8 A;  1IQC A;  1EZV D;  3SLE A;  2QJK B;  4PD4 D;  2C9X B;  3WU2 V;  2KNC B;  4FB1 A;  1GU2 A;  4JCG A;  2EXV A;  2CA4 B;  1GIW A;  3WFE C;  1CXC A;  2BLF B;  1F1F A;  1CRG A;  1ETP A;  4GYD A;  3NBT A;  3ITK A;  1OAE A;  2YK3 A;  1CRI A;  4U3F D;  2ORL A;  3A0H V;  1A56 A;  3CWB D;  5DF5 A;  3PRJ A;  1NML A;  3WFC C;  2QG4 A;  3L4M A;  1SQP D;  3PXS A;  4UB6 V;  2I8F A;  1KIB A;  1BL9 A;  5CIG B;  1L0L D;  3NWV A;  1SQV D;  3ZIY A;  2BCN B;  1AYG A;  3WFD C;  4O1Q A;  1QL3 A;  2N18 B;  1A8C A;  4WQA A;  1DIQ C;  2DGE A;  4FA1 A;  5B5E V;  3MK7 B;  1WVE C;  1CYJ A;  1ZRT D;  1I8P A;  3WFB C;  5KAF V;  3NBS A;  1I54 A;  1A2S A;  2AXT V;  1GDV A;  2FYN B;  1QL4 A;  1CSV A;  1NIR A;  4AAM A;  1CTZ A;  4WQ9 A;  3PTZ A;  3L70 D;  1PP9 D;  3L75 D;  1RAP A;  4FA4 A;  2XTS B;  1CIF A;  1DT1 A;  2MTA C;  2V07 A;  2VHD A;  1CIE A;  1HRC A;  1YIQ A;  1JDL A;  1I55 A;  2V08 A;  3ZBM A;  1H9Y A;  2RMZ A;  3L73 D;  4EIE A;  1VYD A;  1C6O A;  3PLN A;  1H33 A;  4QAO A;  1YIC A;  3H1L D;  5CYT R;  1E8E A;  2B10 B;  1CRJ A;  2YIU B;  4FA9 A;  4J20 A;  4L1Q A;  4NFG B;  2D0W A;  2RN0 A;  1DII C;  3VYM A;  2N9I A;  2JQR A;  1CYI A;  2GB8 B;  3TGU D;  1IZL 0;  2C1V A;  1CXA A;  4RJT A;  2CA3 B;  4WQB A;  3DR0 A;  5KAI V;  1MG3 D;  5CIB B;  1H31 B;  1U75 B;  2PCB B;  1N90 A;  1KB0 A;  2OZ1 B;  3OA8 B;  3RMZ A;  3CU4 A;  2B4Z A;  2Y0E A;  3H1K D;  1S5L V;  1S6V B;  4XYD B;  2ZON G;  2IBZ D;  1H9X A;  1ZZH A;  2C8S A;  2N9Y B;  3ORV A;  2Y0D A;  1WEJ F;  155C A;  1U74 B;  3WC8 A;  1CIH A;  4WQD A;  3GW6 A;  1CCH A;  1CRH A;  3RN1 A;  1HJ5 A;  4EIC A;  4Q5P A;  1C2N A;  4L3H A;  1I5T A;  1LMS A;  2C1D B;  2D0S A;  1E2R A;  3DP5 A;  3M97 X;  5CIC B;  1YCC A;  2CE0 A;  1COT A;  1AKK A;  5KLV D;  5EXQ A;  1FOC A;  2YCC A;  1HRO A;  3KZI V;  2QJY B;  4PWA A;  4WQ7 A;  5B6Q A;  1J3S A;  1HH7 A;  4EDF A;  3SWS A;  2ZZS 1;  4PJ0 V;  3A9F A;  2BCC D;  4YE1 A;  2FWL A;  5AUR A;  4PW9 B;  4IL6 V;  1H32 B;  1DW3 A;  4EID A;  1C7M A;  3H1J D;  3X39 A;  1RZ6 A;  1LS9 A;  4A7P A;  4FAV A;  1CRY A;  2ZBO A;  1H31 A;  1FCD C;  2LIT A;  2AI5 A;  1RAQ A;  3FWL A;  2ZOO A;  1CIG A;  1N15 A;  2FRC A;  1C2R A;  2AIU A;  2OZ1 A;  451C A;  1NTZ D;  1W2L A;  2GC4 D;  2KS1 A;  1SQB D;  1FJ0 A;  4Y5R A;  1BGY D;  2CE1 A;  3A0B V;  2YQB A;  3PXW A;  3L4O A;  1DW1 A;  2GC7 D;  1CTY A;  2A06 D;  3RLM A;  3CX5 D;  1L0N D;  3CP5 A;  5DFS A;  2B12 B;  3GG2 A;  4DY9 A;  1BCC D;  3HQ7 A;  5C0Z A;  4XXL A;  5CIF B;  3HQ9 A;  3WUI A;  1LFM A;  2N3B A;  1FI9 A;  2C1D A;  1H32 A;  1I6E A;  2JTI B;  4RSZ A;  1N50 A;  4H0J A;  3MK7 C;  1MZ4 A;  5GTI V;  1C6S A;  4AX3 A;  1CHJ A;  1GJQ A;  5KLI B;  4WQE A;  1KYO D;  1C75 A;  1YEB A;  1COR A;  2HV4 A;  1LC1 A;  2C1U A;  1CED A;  5GTH V;  1OCD A;  1CSX A;  1FHB A;  1KX2 A;  1QN2 A;  5DJQ C;  4O1W A;  1SQQ D;  3O20 A;  1CYC A;  3ZOO A;  2O3J A;  2GIW A;  2ZXY A;  3VRD A;  1LC2 A;  1KV9 A;  1FI7 A;  5B66 V;  1YEA A;  3L74 D;  3H1I D;  1FI3 A;  3OCD A;  3PHL A;  3L71 D;  2DVH A;  3ZOX A;  1SQX D;  2FYU D;  3TDK A;  5CIE B;  3L72 D;  2CXB A;  3ZCF A;  5CID B;  4EIF A;  1CNO A;  3DMI A;  3HQ6 A;  2L4D A;  3KHU A;  3TYI A;  1K3H A;  3O5C A;  1KYO W;  2C2C A;  4WQ8 A;  4UB8 V;  1L9B C;  4D6T D;  1C6R A;  3O0R C;  3O1Y A;  4LJI A;  4AAN A;  1GKS A;  1NU1 D;  3RN0 A;  4AAO A;  5KKZ B;  1CSU A;  1DW2 A;  1HJ4 A;  1B7V A;  3C2C A;  1HZV A;  1IRV A;  1M60 A;  1CHH A;  1IRW A;  3JBT B;  4K3I A;  1YTC A;  1QYZ A;  3VMA A;  4FA5 A;  2MHM A;  1YFC A;  3VNW A;  1M6Z A;  1P84 D;  5H2F V;  2Y0C A;  3ZOW A;  1CTJ A;  1HZU A;  1HJ3 A;  4KMG A;  1AOF A;  1C52 A;  1KB9 D;  1N9C A;  3CX5 W;  1F1C A;  1L9J C;  351C A;  1RZ5 A;  3BCC D;  1MG2 D;  3PH2 B;  4P4Q B; 
#chains in the Genus database with same CATH topology
 2A45 I;  3VOP A;  5AW0 B;  3Q2Y A;  3SFE C;  3PXT A;  1JEK A;  1GQ1 A;  1PPJ G;  1NJI Q;  3GHG B;  1CHI A;  4I2L C;  1RE3 A;  4WY4 A;  1GZL A;  5TJH A;  3HQ8 A;  4XFJ A;  1EDL A;  3TSI A;  3TF5 A;  4FAN A;  1GK4 A;  3CXH W;  2KYV A;  3VP9 A;  1BSH A;  2ZJS E;  1FZC B;  2WPR A;  1AOQ A;  3H1I J;  3HE5 B;  3VP8 A;  1I6D A;  1NTM D;  1KX7 A;  2N9J A;  1HCM A;  1FC2 C;  2WSC J;  1X79 B;  5KLV J;  5CJ4 A;  1NWQ A;  2I1K A;  1W2E A;  3WU2 H;  2FYN C;  1LWU B;  1NTK E;  2LIR A;  2W8Z A;  3A0B H;  1VQ7 P;  1KB9 I;  4IFM A;  4WBA A;  4U3F E;  5H2F H;  4GED B;  5APY A;  1L0L J;  3SWK A;  1CCR A;  1FZB A;  2OAR A;  2WSC H;  2IDB A;  1FJP A;  1RF0 C;  3L73 E;  2ZT9 D;  1OW8 A;  3RK2 D;  1LTJ A;  2KXP B;  1WRG A;  2E74 C;  3SLE A;  2QJK B;  4IFF A;  4GDO A;  4JCG A;  3HD7 B;  1Q90 D;  4RES B;  1QLE D;  1MUU A;  1AA0 A;  1LT9 A;  1HTL C;  1KFM A;  1F1F A;  4XA4 A;  1URQ C;  1R5L A;  1GDT A;  2YK3 A;  1CRI A;  1RH5 B;  4ASV A;  4U3F D;  1L4A D;  1DD4 A;  1JY3 N;  1SFC A;  3A0H V;  4L74 A;  3CWB D;  1LWU C;  1SQQ K;  3CCV P;  1AQT A;  3LW5 J;  3PRJ A;  2FFD B;  1ZXG A;  2BEZ F;  5APT A;  1BL9 A;  1G2C A;  1NVO A;  2AXT H;  1SQV D;  3ZIY A;  1RQV A;  3WFD C;  4O1Q A;  2J59 M;  2PAJ A;  1NGM B;  4DCK A;  3A0H E;  2E76 D;  3L70 G;  1I8P A;  3RL0 B;  1I54 A;  1KIL B;  2AXT V;  5AW8 B;  1NTK G;  1NIR A;  3WU2 E;  5AVR B;  3D0W A;  1RAP A;  2OYH B;  2QM7 A;  1DT1 A;  3R2P A;  2VHD A;  3AE5 C;  1CIE A;  2JDI H;  1AV1 A;  1YIQ A;  5CMZ A;  2PRR A;  3H1J E;  3KYQ A;  1M7L A;  1JDL A;  4PJ0 E;  4H13 B;  2RMZ A;  1NTK K;  3CCQ P;  1HF9 A;  3C9I A;  5AW5 B;  2ZVN B;  2FFD C;  1RF0 A;  1NTM J;  4MN4 C;  4JQ0 D;  1GL2 B;  1VYD A;  2YKQ A;  1L4A A;  1H33 A;  1RE3 C;  1PV3 A;  5APW A;  1NU1 E;  1E8E A;  2M3E A;  1CRJ A;  1WMK A;  2M8R A;  2OYI C;  2CPB A;  2GB8 B;  4H0L C;  4H13 D;  3VN0 A;  1IZL 0;  1YI2 P;  4WY4 B;  4WQB A;  3DR0 A;  1ZN5 A;  2AXC A;  2FXP A;  1H31 B;  5APV A;  3CC2 P;  2W6A A;  3V2N A;  2OZ1 B;  3RMZ A;  1P84 E;  4UB8 E;  1LWU A;  1LGH B;  1FBM A;  1S4X A;  1S6V B;  1USD A;  3L71 E;  4EIJ A;  1SFC B;  2IBZ D;  1H9X A;  1DEB A;  4WY4 D;  1N8R Q;  2N9Y B;  3L72 E;  1OVU A;  1IFD A;  2Y0D A;  1AFO A;  2HYN A;  1DIP A;  1N7L A;  2OYO A;  4Z1M H;  3CCU P;  3AE8 C;  1CRH A;  1Y47 A;  1KIL D;  1R5S A;  1NU1 J;  3H6P A;  3L72 J;  2KLV A;  1PPJ E;  2RKL A;  4JBZ A;  2WTY A;  1LMS A;  2C1D B;  3M0D A;  1E2R A;  1NTM E;  3GF7 A;  3DP5 A;  4W7Z A;  4K3A A;  1FU1 A;  2WPS A;  2KP8 A;  1SP4 A;  1YHQ P;  2ZYA A;  3H1J J;  1BDC A;  1KOR A;  2ZVO B;  3KZI V;  3AEA C;  3LID A;  1S5L H;  1PGQ A;  2R3C A;  1PP9 G;  2V7Q H;  3H25 A;  1JUN A;  5AW2 B;  3H1J D;  3V6I A;  4PV1 C;  3KQG A;  5KAI H;  1MKM A;  1K05 A;  1DD3 A;  1LS9 A;  1KMI Z;  1H31 A;  1FCD C;  1HUC A;  3FWL A;  2ZOO A;  2OZ1 A;  1C2R A;  451C A;  2YMK A;  3ZDM A;  1URQ B;  4PJ0 H;  1LTS C;  3A0B V;  1J2J B;  4EI2 A;  2Q3I A;  1QEX A;  2E74 B;  5CBO A;  3L4O A;  1LTT C;  2G8Y A;  1A02 J;  1DEE G;  2P2U A;  1JO5 A;  2B12 B;  3TGU J;  5KLV E;  1NTM G;  1KQS O;  4ZNC A;  3HQ7 A;  4XXL A;  5CIF B;  1Y9B A;  1LFM A;  2E76 B;  3JC2 2;  2Q5U A;  1N50 A;  3QH9 A;  4H0J A;  5BVZ A;  2E74 D;  1DH3 A;  1D7M A;  1KQF B;  1VQM P;  2H8P D;  3D6Y A;  4AX3 A;  1EDI A;  3FGA D;  5M1B A;  1OCD A;  1CSX A;  1FHB A;  4HJG H;  1NAF A;  4ZMD A;  1BGY E;  2FYZ A;  3H1L J;  5DJQ C;  2K9J A;  3AEC C;  2NPS D;  3KZI E;  1SQQ D;  5GTH H;  3RL0 C;  1FDM A;  1PGP A;  3ZOO A;  2O3J A;  4D6T E;  1S3J A;  3VRD A;  4YXD C;  3AE9 C;  1KV9 A;  1ZME C;  3D71 A;  1FZC C;  3CPW O;  1NU1 G;  3HRN A;  3ZOX A;  5K5G B;  1KQG B;  3F5H A;  2D2C C;  3AED C;  1VF5 C;  3L72 D;  3HE4 A;  4EIF A;  4GT1 A;  3DMI A;  2OYI B;  3P8C E;  3KHU A;  1K3H A;  1GK6 A;  4IL6 E;  1KYO W;  4I1L A;  3USS A;  2QJY C;  3O6Q A;  1H89 A;  1L9B C;  2V7Q J;  1VQK P;  1NYH A;  4AAO A;  4PD4 I;  1GU5 A;  3TGU E;  1SQV J;  1SFC D;  3C2C A;  1HZV A;  1CHH A;  1IRW A;  3V4W A;  1QYZ A;  1MFZ A;  3B4S A;  2Q6Q A;  4FA5 A;  3H1J G;  2OYI A;  3O8Z A;  2AEF A;  2UWJ E;  2Y0C A;  1CTJ A;  1HZU A;  3A7O A;  2AEJ A;  1AOF A;  4NPF X;  1E79 H;  1F1C A;  2Y9Z A;  1KIL A;  3PH2 B;  4BRY B;  2E5T A;  1QKS A;  3RL0 D;  2PAC A;  1YNR A;  3ZOY A;  4N3Y B;  3E1R A;  4H44 D;  3AE4 C;  4V2K A;  1I8O A;  1MV8 A;  2POH A;  1W5C T;  5TIS V;  3CXH I;  3GLM A;  2GM4 A;  2BEQ D;  1LT9 C;  2WPQ A;  2K1A A;  3E7K A;  3HD7 A;  1Q81 Q;  5E79 V;  2JJL A;  1JY2 O;  2Q3E A;  3LW5 H;  5KAF E;  3OA8 A;  2N9B A;  2QM8 A;  2B0Z B;  4AAL A;  1G1I A;  3L70 E;  1SQB K;  2PCC B;  3CX5 I;  1RF1 B;  1VQ9 P;  1NNO A;  2QSI A;  3NXS A;  1H0T A;  1CO6 A;  2FYU E;  2M3B A;  1BE3 J;  3CYT I;  3CXH D;  3EFF K;  3AEG C;  1S5L X;  2N1T D;  1QGK B;  2L5G B;  5APX A;  4WWI A;  1YBK A;  4KHX A;  5AVS B;  3CCR P;  1S9K D;  1OVR A;  1EZV D;  5AW9 B;  3B71 A;  4O9B A;  2ZYD A;  1H8A A;  2CA4 B;  1IFM A;  2LXB A;  2KSE A;  1QL1 A;  3H1I G;  1RE4 C;  2HFE D;  3AE3 C;  2E5Y A;  1CRG A;  3HTK A;  3NBT A;  3ITK A;  2QJK C;  3RBZ A;  2IYO A;  1BGY J;  5TIS H;  1A56 A;  3L73 G;  1H88 A;  2P58 A;  3WFC C;  2QG4 A;  1JCC A;  1EC5 A;  1L0N K;  1OX3 A;  3RK2 B;  5APQ A;  3G9R A;  3TNU A;  1QL3 A;  2N18 B;  4WQA A;  1DIQ C;  2DGE A;  3O6Q B;  1JB0 J;  2ZAE B;  1ZRT D;  5KAF V;  3Q1M A;  3P8M C;  2E42 A;  1S2E A;  1NTK J;  1A2S A;  3VMY A;  1FJK A;  1QL4 A;  2D2C B;  4UB6 H;  1CTZ A;  1AQ5 A;  1PP9 D;  2FY8 A;  1VQP P;  2K9Y A;  1GW3 A;  4FA4 A;  1M1K Q;  1CIF A;  1AJY A;  4I6M C;  5CCH C;  2PGD A;  1URQ A;  1I55 A;  2D2C D;  3L73 D;  4EIE A;  2WZ7 A;  3M0A A;  2FKW B;  2KOG A;  2YXQ B;  3PLN A;  3P32 A;  2A45 G;  1FS0 E;  4QAO A;  3WUT A;  3RK3 B;  3CWB J;  1KFN A;  1U57 A;  5AVZ B;  2YIU B;  4J20 A;  3AE1 C;  4L1Q A;  4NFG B;  2KZI A;  2RN0 A;  1DII C;  2JQR A;  1PP9 E;  2G3A A;  2NPS C;  2C1V A;  1CXA A;  3RGU A;  2CA3 B;  5BU8 B;  3V2Q A;  5KJ7 C;  5AW4 B;  4YPC A;  1N90 A;  5TIS E;  3CU4 A;  3AEE C;  3D70 A;  3A0B E;  4RKU J;  5B5E H;  3H1K D;  2SPZ A;  1AVY A;  4XYD B;  4WY4 C;  2ZON G;  1ZV8 A;  3BCC E;  1ZZH A;  3QWO C;  1L0N J;  1KIL E;  5B66 E;  2QVA A;  1HJ5 A;  1ZR2 A;  2GA1 A;  1UII A;  4Q5P A;  3L72 G;  1I5T A;  2XV5 A;  3FWN A;  3M97 X;  1L0N G;  2ITA A;  3L74 G;  1L2P A;  1COT A;  5KLV D;  1T3U A;  2R5B A;  3B5N A;  3S1K A;  2KS1 B;  3HUS B;  3D6Z A;  1JNM A;  3HD7 C;  2PFX A;  1SQV G;  4PJ0 V;  5AVT B;  4XE5 B;  4B86 A;  3A9F A;  5GTH E;  1DW3 A;  3H32 A;  3L70 J;  4H44 B;  4AUW A;  1EZV G;  4LC1 A;  4A7P A;  3HE5 A;  1OFC X;  4OH8 B;  2ZBO A;  1PGJ A;  3S4R A;  4U3F G;  1RAQ A;  5CBN A;  1N7S C;  4D6T G;  1AVO A;  2FRC A;  1NTZ D;  1IZN B;  1W2L A;  1SQB D;  3BAT A;  2KI7 B;  1SQB E;  4JYC A;  3MUD A;  5CCG A;  3L36 A;  5APU A;  4PD4 H;  5AW3 B;  1BE3 G;  2GC7 D;  2IZ1 A;  3L75 G;  1FAV A;  3I55 P;  3U1A A;  1L4A B;  1M8O B;  3V2P A;  1JY3 P;  3GG2 A;  1M56 D;  1VQO P;  3I5C A;  5C0Z A;  3AE7 C;  3HUS C;  4H13 C;  4HH2 A;  2H43 A;  3CMA P;  1Q82 Q;  3PP5 A;  3OAK A;  1X8Y A;  1MZ4 A;  5GTI V;  3HE4 B;  1Q86 Q;  1CHJ A;  1GJQ A;  2M0B A;  5KLI B;  1T3J A;  4WQE A;  5AVX B;  1COR A;  3Q5P A;  2HV4 A;  1G1J A;  1CED A;  2C1U A;  5AVY B;  3CWB G;  3P8C D;  3JCU E;  5KAF H;  3MP7 B;  5KJ7 D;  2YO3 A;  1YTZ I;  1LTJ B;  3CXH H;  4PD4 E;  1FZG A;  1CYC A;  3KXD A;  2ZXY A;  1LT9 B;  2XNX A;  1L0N E;  2ZYG A;  3V4Q A;  3IN6 A;  3H1K E;  3RK3 D;  2XZR A;  5CIE B;  1NHL A;  1ZR4 A;  3PJS K;  3MZW B;  1UIX A;  2AXT E;  3UIA A;  3HQ6 A;  4U7J A;  1FOS E;  3TYI A;  2HPC A;  3O5C A;  2NPS B;  1E5W A;  2W27 A;  2C2C A;  1VF5 D;  2CPS A;  1SQX K;  3O1Y A;  1EXI A;  3H1L E;  1OIP A;  1GTW A;  5KKZ B;  3ABV C;  1B7V A;  3K5B A;  1IRV A;  2HLO A;  1Y8A A;  1JM0 A;  4K3I A;  2MHM A;  1KQL A;  3VNW A;  1P84 D;  2BCC G;  1W5C E;  2LXC B;  3BVH A;  3M06 A;  4CPG A;  1C52 A;  4OGQ D;  3CX5 W;  2FXM A;  1CW5 A;  5KJ7 A;  3AE6 C;  3NMD A;  2JKV A;  4Y99 B;  4P4Q B;  2FFD A;  5E79 H;  5IY5 1;  2QRX A;  1H1O A;  2QA4 P;  4UB6 E;  1S9K E;  3OCD B;  1EB7 A;  3B5N D;  1J1E B;  2P1J A;  1SQB J;  3A0H H;  1LT1 A;  2JWA A;  1E29 A;  1CSW A;  1VQ8 P;  4OGQ B;  3EFG A;  4JYB A;  4KJM A;  3I56 P;  1K3G A;  1YJW P;  2N18 C;  3IAO A;  2WSE H;  3CCE P;  1JY3 O;  1DVH A;  1BCC G;  1IFI A;  4H44 C;  2K37 A;  4WQC A;  1IO3 A;  1NTK D;  2N1T C;  3FXE A;  5C9M A;  1DVV A;  1R0Q A;  2BAS A;  2QJP B;  2B11 B;  3M9Q A;  2R5D A;  3VMX A;  3RK3 E;  1BGY G;  2BCC E;  1CI6 B;  3N4X A;  3SXT A;  1YJN P;  3U1C A;  4EOT A;  3GF3 A;  4HKZ H;  2E76 C;  4H0K A;  3SFD C;  3W68 A;  2K88 A;  4TLF A;  5BU5 A;  1L4A C;  5DJQ B;  2N3Y A;  3T97 B;  1JMB A;  1SQV E;  1NTZ E;  1LTA C;  2Q1K A;  1M70 A;  3P7K A;  4ASW A;  4MU8 A;  3JSV C;  1IQC A;  4GOE A;  2WT7 B;  1YIT P;  2C9X B;  3WU2 V;  2KNC B;  1N7S A;  4N78 D;  3EQ2 A;  2OTL P;  2EXV A;  4OGQ C;  1KYO I;  3H1I E;  3WFE C;  2OTK E;  1OMI A;  1CXC A;  3L74 E;  2BLF B;  4DJG A;  5KLV G;  1ETP A;  2IBZ I;  1QX8 A;  1OAE A;  3LIE A;  3GMA A;  3H1H G;  5DF5 A;  1SQP E;  4AYC A;  1NML A;  3BRV B;  2A45 H;  2I8F A;  1NKN A;  2GUS A;  5CIG B;  1IFN A;  1WT6 A;  1KC8 Q;  1K73 Q;  1AYG A;  4LLH A;  1A8C A;  3WUV A;  2BCC J;  1WVE C;  4BWN A;  2OYH C;  1FZC A;  1M90 Q;  3WFB C;  3CL3 D;  1NTZ G;  4N6J A;  1PIX A;  3NBS A;  1IC2 A;  1GW4 A;  2YMY A;  2QIW A;  1L0L G;  4YTP C;  3CC4 P;  1N7S D;  1HWT C;  1RHZ B;  5AVU B;  4WQ9 A;  2B87 B;  3PTZ A;  3L70 D;  1PL5 A;  1QVG O;  4BXL A;  3A3Y B;  3L75 D;  2W90 A;  2KZJ A;  1RE4 A;  1YTZ T;  2MTA C;  2V07 A;  2O01 N;  2CK3 H;  4PV1 D;  1IFP A;  1EXJ A;  2YKP A;  2LKM A;  3ZBM A;  3AEB C;  1N7S B;  4DOJ A;  1M1J B;  3GHG A;  3OJA B;  1N2D C;  1C6O A;  3TK1 A;  5KKZ C;  2VRS A;  3T97 A;  1P84 H;  1YIC A;  3H1L D;  1URQ D;  1RQU A;  1K8A Q;  4FA9 A;  2D0W A;  2KIK A;  3CX5 E;  2QEX P;  1OW7 A;  1LTI C;  2MKV A;  4HB1 A;  2WSS H;  2KNC A;  3EWK A;  4ZKP A;  3AE2 C;  5KAI V;  5CIB B;  3BCC J;  2YIU C;  1KB0 A;  1BCC E;  4NPD A;  1RY3 A;  3H1K J;  2OQQ A;  2KSJ A;  2MJZ A;  4OVN F;  2B4Z A;  3H1H J;  1S5L V;  3KPE A;  2I1J A;  1VQ6 P;  1L0L E;  2R44 A;  3ORV A;  5KLV K;  1U74 B;  1NO4 A;  1CCH A;  1SLQ A;  1VQ4 P;  2OYH A;  5CCG C;  3Q5R A;  1SQX J;  1C2N A;  4GIF A;  3CLQ A;  4TT3 H;  5CJ0 A;  3BCC G;  2D0S A;  3A5T A;  3M91 A;  5CIC B;  1IK7 A;  3L75 J;  4R4M A;  1AKK A;  1ZOY C;  2KLU A;  2GUV A;  3L73 J;  1HRO A;  2XDJ A;  2QJY B;  2FYU J;  1KB9 E;  4WQ7 A;  5B6Q A;  4GKG A;  1J3S A;  3KDP B;  1SQQ J;  1KTM A;  3SWS A;  2ZZS 1;  3R4Y A;  3L71 J;  2BCC D;  2FWL A;  5AUR A;  1YJ9 P;  5C39 A;  4IL6 V;  1OVV A;  1NU1 K;  2J5U A;  4EID A;  2W6B A;  1T2K C;  2ZFC A;  1C7M A;  1EZV I;  3X39 A;  3V2R A;  4EYY Q;  1RZ6 A;  1MFT A;  4FAV A;  3AEF C;  1CRY A;  3OW2 O;  2LIT A;  1Q2N A;  3C8V A;  2AIU A;  1LP1 B;  4Y5R A;  1OWA A;  2IFN A;  2YQB A;  1SQP G;  3VYI A;  3PXW A;  2H88 C;  1DW1 A;  1M57 D;  1IO4 A;  1K04 A;  1KZU B;  2A06 D;  3RLM A;  2O1K A;  3CX5 D;  1SQP J;  1L0L K;  3CP5 A;  2XKM A;  1J1D B;  1SQX G;  2ZXE B;  3MIW A;  3HQ9 A;  3G6E P;  3WUI A;  1FI9 A;  2N3B A;  2C1D A;  3G4S P;  1H32 A;  4RSZ A;  1FZA A;  3VMZ A;  2XU6 A;  1VDF A;  1KV4 A;  1EDJ A;  2OTJ P;  5DJU B;  3SSU A;  1KYO D;  1EDK A;  1GL2 A;  5KTB A;  4I7Z C;  3L71 G;  1LC1 A;  1XTC C;  5AVW B;  1KX2 A;  1FDI A;  3HTK B;  1QN2 A;  2P67 A;  1XTG B;  2B89 A;  4O1W A;  3O20 A;  1CSB A;  2GIW A;  2JR8 A;  1U7J A;  1VQ5 P;  1LC2 A;  1FI7 A;  3OA7 A;  3MUD C;  5B66 V;  1T6A A;  1YEA A;  1HJ0 A;  2W6J H;  3W67 A;  1HBW A;  3H1I D;  1FI3 A;  2IYP A;  2FBW C;  1S1C X;  2E75 B;  3PHL A;  1SVF A;  2B9B A;  1BSN A;  1H0T B;  1JY2 N;  1FDO A;  1SQX D;  1HGZ A;  5B5E E;  3F89 A;  3TDK A;  2CXB A;  1CNO A;  2L4D A;  2W83 C;  5DJT B;  2Z5I A;  1A02 F;  1YIJ P;  1LP1 A;  2WSF H;  2V4H A;  4D6T D;  1C6R A;  1NH4 A;  2IZ0 A;  2Q7C A;  4LJI A;  4AAN A;  3Q3D A;  3RN0 A;  1W2B O;  3TYY A;  3FXD A;  2O01 J;  1HJ4 A;  3CD6 P;  4PV1 B;  1M60 A;  1KYO H;  1IJD B;  1YTC A;  3CCS P;  3BRT B;  4WVZ A;  1YFC A;  4QMA A;  1QL2 A;  3L4F A;  1M6Z A;  4GOD A;  5H2F V;  3HD7 D;  2WSF J;  2RH0 A;  1QVF O;  1S5L E;  1HJ3 A;  1JOC A;  3Q5S A;  4U3F J;  5CCH A;  1RZ5 A;  1HGV A;  2K3R A;  5KAI E;  3SJL A;  1BE3 D;  5CIH B;  3CI9 A;  1YYC A;  1FE6 A;  5GTI H;  1DW0 A;  3SVW A;  4H0L B;  5APS A;  5H2F E;  1HJB A;  2JO1 A;  2FXO A;  2K9J B;  1TU3 F;  1NMI A;  2E75 D;  3RL0 g;  1JTH A;  3U59 A;  1KD1 Q;  1GMJ A;  2JWD A;  2BH4 X;  2C0W A;  1H33 B;  2JEE A;  2WPV B;  2HR3 A;  1X0T A;  1CC5 A;  3TGU G;  4L3G A;  1M1J C;  1SQV K;  2BGV X;  2H7H A;  3IF4 A;  1PP9 J;  3II6 A;  1J1E C;  4N0K A;  4JPZ B;  2ZXX A;  1FOS F;  1NAY A;  1P84 I;  1PPJ D;  4GOF A;  2BPB B;  3H1H E;  1CRC A;  2BH5 X;  3H1H D;  1LTG C;  2L91 A;  5L8R J;  1GU4 A;  1J1D C;  4UB8 H;  3BAS A;  1BCC J;  4PD4 D;  4FB1 A;  1GU2 A;  3CCL P;  4BRY A;  2IX7 C;  4LGD E;  1GIW A;  5AVQ B;  1T2K D;  1YQ4 C;  3CC7 P;  4GYD A;  3RK2 C;  3IR9 A;  4W7Y A;  2WVR A;  2ORL A;  4KT0 J;  1PGO A;  3RBX A;  1NTZ J;  2YXR B;  3GHG C;  2O01 H;  1KYO E;  1PZQ A;  1LJ2 A;  3L4M A;  1SQP D;  3PXS A;  4UB6 V;  4R4L A;  1KIB A;  2Q9I A;  1L0L D;  3NWV A;  2JP3 A;  4M3L A;  5EFW B;  2BCN B;  2IFM A;  4FA1 A;  1SQP K;  5B5E V;  2R3S A;  3MK7 B;  1ZRT E;  1CYJ A;  3A2A A;  4JF7 A;  3MTU E;  1GDV A;  2M5A A;  2FYN B;  2PP6 A;  3L37 A;  1CSV A;  2P10 A;  4AAM A;  3MGN A;  2J58 A;  4OWF A;  2XTS B;  1NTZ K;  1N73 A;  1KB9 H;  2NZ2 A;  3HUS A;  1VQN P;  1HRC A;  2WWW A;  1R8E A;  3CX5 H;  4HYT B;  2DW3 A;  2V08 A;  1DX7 A;  1H9Y A;  2WIT A;  2H89 C;  2C9L Y;  2M5A B;  2HOD A;  2C0X A;  4L75 A;  5E79 E;  3JCU H;  2YKO A;  3M0D C;  1JCD A;  5CYT R;  2E43 A;  2B10 B;  1SQQ E;  1PFI A;  3C1L A;  2I8D A;  4DT0 A;  3H32 B;  3M9B A;  3VYM A;  2N9I A;  1CYI A;  3TGU D;  1GD2 E;  4RJT A;  5B66 H;  1KN7 A;  1MG3 D;  2B87 A;  2FYU K;  2P7J A;  1U75 B;  3H1L G;  2PCB B;  3SWY A;  4ZKU A;  3OA8 B;  1N86 A;  2C9N Y;  2ZT9 C;  2Y0E A;  1FZE A;  5KLI C;  2OGU A;  2QE7 H;  2C8S A;  1WEJ F;  155C A;  3B5N B;  1LTB C;  3WC8 A;  1CIH A;  3TNU B;  4WQD A;  3GW6 A;  3RN1 A;  3WUU A;  4C7N A;  1OXZ A;  4EIC A;  5CHX A;  2IBZ G;  4L3H A;  4WB4 A;  4C46 A;  4YXW H;  3G3Z A;  1YCC A;  1YQ3 C;  2CE0 A;  3MD0 A;  2E75 C;  3CME P;  5EXQ A;  1FOC A;  2YCC A;  3VTP C;  5CCG D;  1Q7Y Q;  3MHV A;  3M9H A;  2WQY C;  1N73 C;  1SQB G;  4PWA A;  5GTI E;  1HH7 A;  2WMM A;  3CCJ P;  4EDF A;  4YE1 A;  1JMM A;  4PW9 B;  1H32 B;  4RO0 A;  1GL2 C;  5CCH D;  2KB7 P;  2LR2 A;  2O1J A;  1X22 A;  4C7R A;  1IK9 A;  5AW6 B;  2AI5 A;  2YNY A;  1VPC A;  1CIG A;  1HVV A;  2WSE J;  1N15 A;  4IL6 H;  1NTM K;  2B88 A;  3FX0 A;  1S72 P;  2GC4 D;  2KS1 A;  1FJ0 A;  1BGY D;  2CE1 A;  1T8Z A;  3RK3 C;  1EZV E;  3E1I A;  1CZQ A;  1CTY A;  2FYU G;  3G71 P;  3IFM A;  3L75 E;  1L0N D;  4N78 E;  1IFJ A;  5DFS A;  1SS1 A;  4DY9 A;  3PH0 A;  1SQX E;  1BCC D;  2HG5 D;  1ZW0 A;  2IBZ E;  1N73 B;  5AW7 B;  1I6E A;  4H0L D;  2JTI B;  3S9O A;  1K9M Q;  2Z4E A;  3MK7 C;  1RF1 C;  1CI6 A;  1C6S A;  1OW6 A;  2KUB A;  4IFD K;  4NPE A;  3CCM P;  2HOD B;  4K35 A;  1C75 A;  5AVV B;  1YEB A;  5GTH V;  2N1T B;  1VF5 B;  4DZO A;  1LTJ C;  1X9V A;  3NTN A;  2NRG A;  1ZP0 C;  1USE A;  1JY2 P;  2XND H;  3L74 J;  4Y28 J;  3SWF A;  2HPC B;  3N7N A;  3L74 D;  2A06 E;  2QJP C;  1FZF A;  1G2C B;  1HH0 A;  3NFQ A;  3OCD A;  1SQQ G;  3L71 D;  2DVH A;  1KIL C;  2N1T A;  1VQL P;  2FYU D;  4I7Z B;  4IOI H;  1LNQ A;  4L76 A;  1MZ9 A;  3ZCF A;  5CID B;  5AW1 B;  1BE3 E;  1U7M A;  3H1K G;  4WQ8 A;  2KK7 A;  4UB8 V;  2IPP A;  3O0R C;  1GKS A;  1NU1 D;  2A06 G;  2ZT9 B;  1CSU A;  1DW2 A;  1JTH B;  3WMM 0;  2R32 A;  1Z56 A;  1GL2 D;  1NOH A;  3JBT B;  4Y99 C;  4C7N B;  3VMA A;  1VL2 A;  1ZLL A;  4IL6 X;  3B5N C;  4L73 A;  3L35 A;  1M1J A;  1NKZ B;  1OZH A;  3B8E B;  3ZOW A;  4W80 A;  1BDD A;  2NPS A;  4KMG A;  4D6T J;  3V5B A;  1EQ7 A;  1KB9 D;  1N9C A;  1RF1 A;  3CWB E;  1SFC C;  1L9J C;  2WT7 A;  2Z5H A;  3CXH E;  351C A;  3KZI H;  4AQR D;  2AEM A;  3BCC D;  2Y9Y A;  1MG2 D;  2YO2 A; 
#chains in the Genus database with same CATH homology
 1QKS A;  3PXT A;  5IY5 1;  1GQ1 A;  2PAC A;  1YNR A;  1H1O A;  3SJL A;  1BE3 D;  1CHI A;  5CIH B;  3ZOY A;  1DW0 A;  5TJH A;  3SVW A;  3HQ8 A;  3OCD B;  1EB7 A;  3TF5 A;  4V2K A;  1I8O A;  4FAN A;  1W5C T;  5TIS V;  2JWA A;  3CXH W;  1E29 A;  1CSW A;  1K3G A;  2K9J B;  1NMI A;  2N18 C;  1AOQ A;  1I6D A;  1NTM D;  5E79 V;  2N9J A;  1KX7 A;  1DVH A;  1HCM A;  2BH4 X;  2Q3E A;  1H33 B;  4WQC A;  1IO3 A;  1NTK D;  3OA8 A;  2LIR A;  2B0Z B;  4AAL A;  5C9M A;  1DVV A;  1R0Q A;  2PCC B;  2QJP B;  1CC5 A;  2B11 B;  4L3G A;  1NNO A;  2BGV X;  1CO6 A;  4GED B;  3SXT A;  4N0K A;  3CYT I;  3CXH D;  1CCR A;  4H0K A;  1PPJ D;  2BPB B;  1CRC A;  5DJQ B;  2BH5 X;  2N3Y A;  3H1H D;  2L91 A;  1M70 A;  4MU8 A;  1IQC A;  1EZV D;  3SLE A;  2QJK B;  4PD4 D;  2C9X B;  3WU2 V;  2KNC B;  4FB1 A;  1GU2 A;  4JCG A;  2EXV A;  2CA4 B;  1GIW A;  3WFE C;  1CXC A;  2BLF B;  1F1F A;  1CRG A;  1ETP A;  4GYD A;  3NBT A;  3ITK A;  1OAE A;  2YK3 A;  1CRI A;  4U3F D;  2ORL A;  3A0H V;  1A56 A;  3CWB D;  5DF5 A;  3PRJ A;  1NML A;  3WFC C;  2QG4 A;  3L4M A;  1SQP D;  3PXS A;  4UB6 V;  2I8F A;  1KIB A;  1BL9 A;  5CIG B;  1L0L D;  3NWV A;  1SQV D;  3ZIY A;  2BCN B;  1AYG A;  3WFD C;  4O1Q A;  1QL3 A;  2N18 B;  1A8C A;  4WQA A;  1DIQ C;  2DGE A;  4FA1 A;  5B5E V;  3MK7 B;  1WVE C;  1CYJ A;  1ZRT D;  1I8P A;  3WFB C;  5KAF V;  3NBS A;  1I54 A;  1A2S A;  2AXT V;  1GDV A;  2FYN B;  1QL4 A;  1CSV A;  1NIR A;  4AAM A;  1CTZ A;  4WQ9 A;  3PTZ A;  3L70 D;  1PP9 D;  3L75 D;  1RAP A;  4FA4 A;  2XTS B;  1CIF A;  1DT1 A;  2MTA C;  2V07 A;  2VHD A;  1CIE A;  1HRC A;  1YIQ A;  1JDL A;  1I55 A;  2V08 A;  3ZBM A;  1H9Y A;  2RMZ A;  3L73 D;  4EIE A;  1VYD A;  1C6O A;  3PLN A;  1H33 A;  4QAO A;  1YIC A;  3H1L D;  5CYT R;  1E8E A;  2B10 B;  1CRJ A;  2YIU B;  4FA9 A;  4J20 A;  4L1Q A;  4NFG B;  2D0W A;  2RN0 A;  1DII C;  3VYM A;  2N9I A;  2JQR A;  1CYI A;  2GB8 B;  3TGU D;  1IZL 0;  2C1V A;  1CXA A;  4RJT A;  2CA3 B;  4WQB A;  3DR0 A;  5KAI V;  1MG3 D;  5CIB B;  1H31 B;  1U75 B;  2PCB B;  1N90 A;  1KB0 A;  2OZ1 B;  3OA8 B;  3RMZ A;  3CU4 A;  2B4Z A;  2Y0E A;  3H1K D;  1S5L V;  1S6V B;  4XYD B;  2ZON G;  2IBZ D;  1H9X A;  1ZZH A;  2C8S A;  2N9Y B;  3ORV A;  2Y0D A;  1WEJ F;  155C A;  1U74 B;  3WC8 A;  1CIH A;  4WQD A;  3GW6 A;  1CCH A;  1CRH A;  3RN1 A;  1HJ5 A;  4EIC A;  4Q5P A;  1C2N A;  4L3H A;  1I5T A;  1LMS A;  2C1D B;  2D0S A;  1E2R A;  3DP5 A;  3M97 X;  5CIC B;  1YCC A;  2CE0 A;  1COT A;  1AKK A;  5KLV D;  5EXQ A;  1FOC A;  2YCC A;  1HRO A;  3KZI V;  2QJY B;  4PWA A;  4WQ7 A;  5B6Q A;  1J3S A;  1HH7 A;  4EDF A;  3SWS A;  2ZZS 1;  4PJ0 V;  3A9F A;  2BCC D;  4YE1 A;  2FWL A;  5AUR A;  4PW9 B;  4IL6 V;  1H32 B;  1DW3 A;  4EID A;  1C7M A;  3H1J D;  3X39 A;  1RZ6 A;  1LS9 A;  4A7P A;  4FAV A;  1CRY A;  2ZBO A;  1H31 A;  1FCD C;  2LIT A;  2AI5 A;  1RAQ A;  3FWL A;  2ZOO A;  1CIG A;  1N15 A;  2FRC A;  1C2R A;  2AIU A;  2OZ1 A;  451C A;  1NTZ D;  1W2L A;  2GC4 D;  2KS1 A;  1SQB D;  1FJ0 A;  4Y5R A;  1BGY D;  2CE1 A;  3A0B V;  2YQB A;  3PXW A;  3L4O A;  1DW1 A;  2GC7 D;  1CTY A;  2A06 D;  3RLM A;  3CX5 D;  1L0N D;  3CP5 A;  5DFS A;  2B12 B;  3GG2 A;  4DY9 A;  1BCC D;  3HQ7 A;  5C0Z A;  4XXL A;  5CIF B;  3HQ9 A;  3WUI A;  1LFM A;  2N3B A;  1FI9 A;  2C1D A;  1H32 A;  1I6E A;  2JTI B;  4RSZ A;  1N50 A;  4H0J A;  3MK7 C;  1MZ4 A;  5GTI V;  1C6S A;  4AX3 A;  1CHJ A;  1GJQ A;  5KLI B;  4WQE A;  1KYO D;  1C75 A;  1YEB A;  1COR A;  2HV4 A;  1LC1 A;  2C1U A;  1CED A;  5GTH V;  1OCD A;  1CSX A;  1FHB A;  1KX2 A;  1QN2 A;  5DJQ C;  4O1W A;  1SQQ D;  3O20 A;  1CYC A;  3ZOO A;  2O3J A;  2GIW A;  2ZXY A;  3VRD A;  1LC2 A;  1KV9 A;  1FI7 A;  5B66 V;  1YEA A;  3L74 D;  3H1I D;  1FI3 A;  3OCD A;  3PHL A;  3L71 D;  2DVH A;  3ZOX A;  1SQX D;  2FYU D;  3TDK A;  5CIE B;  3L72 D;  2CXB A;  3ZCF A;  5CID B;  4EIF A;  1CNO A;  3DMI A;  3HQ6 A;  2L4D A;  3KHU A;  3TYI A;  1K3H A;  3O5C A;  1KYO W;  2C2C A;  4WQ8 A;  4UB8 V;  1L9B C;  4D6T D;  1C6R A;  3O0R C;  3O1Y A;  4LJI A;  4AAN A;  1GKS A;  1NU1 D;  3RN0 A;  4AAO A;  5KKZ B;  1CSU A;  1DW2 A;  1HJ4 A;  1B7V A;  3C2C A;  1HZV A;  1IRV A;  1M60 A;  1CHH A;  1IRW A;  3JBT B;  4K3I A;  1YTC A;  1QYZ A;  3VMA A;  4FA5 A;  2MHM A;  1YFC A;  3VNW A;  1M6Z A;  1P84 D;  5H2F V;  2Y0C A;  3ZOW A;  1CTJ A;  1HZU A;  1HJ3 A;  4KMG A;  1AOF A;  1C52 A;  1KB9 D;  1N9C A;  3CX5 W;  1F1C A;  1L9J C;  351C A;  1RZ5 A;  3BCC D;  1MG2 D;  3PH2 B;  4P4Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...