3L71D

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 74
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l71D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l71D02
2DGEA 2PCBB 1CHJA 2YK3A 2OZ1B 4FA5A 3RMZA 1EZVD 4D6TD 1CYCA 1I6EA 451CA 3SVWA 1KV9A 1CYIA 1SQBD 1QN2A 1NIRA 1A8CA 1AOFA 3CU4A 3O20A 4Q5PA 1JDLA 3O5CA 1M60A 1CIFA 3TDKA 2C8SA 5CIHB 1DT1A 1H31B 1KB9D 2N9JA 4WQ7A 4FB1A 2CA3B 2GIWA 1DW3A 3TF5A 2N9YB 3TYIA 4EICA 1YCCA 1DVHA 1YICA 3CYTI 4O1WA 1I5TA 1DW0A 3L71D 3OCDB 1CRJA 1SQPD 4AX3A 1CSUA 1YTCA 4RSZA 2N9IA 5B66V 2B0ZB 1DVVA 4H0JA 1U74B 3PXSA 2FYNB 3H1ID 1CSVA 3L72D 1H32A 1SQXD 2CE1A 5CIDB 4V2KA 4LJIA 2RN0A 2EXVA 3HQ8A 2GC7D 1KYOD 1C52A 5C0ZA 1L0LD 1N50A 3RN1A 1GU2A 4A7PA 3NWVA 2B4ZA 2C1UA 2BPBB 1F1CA 1YEBA 4PW9B 1R0QA 4O1QA 3DMIA 4NFGB 5DJQB 1S5LV 2HV4A 4EIEA 1FHBA 1GIWA 2O3JA 4PJ0V 4XXLA 3L73D 1EB7A 4FA9A 351CA 3HQ9A 2GC4D 3JBTB 1YFCA 3SWSA 1I8OA 2AIUA 2I8FA 4AANA 4WQBA 1CRHA 3ZOOA 3NBSA 3ZIYA 1CTYA 1DIQC 1HJ5A 4WQAA 1LC1A 1VYDA 1NTMD 5KAIV 1CRCA 1AKKA 2V08A 2ZXYA 1FCDC 2Q3EA 1CYJA 1SQVD 2JTIB 1WEJF 1CO6A 1KYOW 1LS9A 5DJQC 1M6ZA 3DP5A 4WQEA 1PP9D 3TGUD 3VYMA 1C2RA 3KHUA 1PPJD 5KKZB 2N18C 2CXBA 1L9JC 2BLFB 1CC5A 3ORVA 4PWAA 3PTZA 1QKSA 4P4QB 1IRVA 2V07A 1HJ3A 1K3GA 1CHIA 2A06D 5EXQA 1F1FA 1RAPA 5GTIV 3PXWA 1NU1D 1NNOA 5H2FV 1H32B 2K9JB 2N3BA 2QJPB 1IZL0 1I55A 1CSXA 1FJ0A 3WFDC 4EIFA 1E8EA 1HJ4A 1LC2A 2YIUB 3SXTA 1GKSA 1KIBA 1LMSA 1NMIA 4J20A 3L4MA 1QL4A 2VHDA 3X39A 2FWLA 3L70D 2C1VA 1I54A 3CX5D 4GYDA 4U3FD 4FANA 2KS1A 2PCCB 1P84D 2LITA 5GTHV 1L0ND 4JCGA 1S6VB 2B11B 3BCCD 3WFCC 2C2CA 3H1KD 2D0WA 3A9FA 1GDVA 1HZUA 4DY9A 3WC8A 1CXCA 5B6QA 2ZZS1 1C6RA 5CIGB 5CIEB 2ORLA 2CE0A 4L3GA 1CRYA 1E29A 1BGYD 3ZOYA 3PHLA 3RN0A 2FYUD 5TISV 3WFEC 3O0RC 2RMZA 5DFSA 3HQ6A 4L1QA 5CIFB 4AALA 3WU2V 4FA1A 3L4OA 1AYGA 3ZCFA 1H9YA 1FI7A 2ZOOA 3CX5W 2GB8B 1YNRA 1DW2A 1CIHA 2LIRA 1ZRTD 4KMGA 3H1HD 5DF5A 1RZ6A 3ZOXA 3FWLA 2N18B 3A0BV 4PD4D 3SLEA 5AURA 1I8PA 2KNCB 5B5EV 2Y0EA 3NBTA 3C2CA 1C7MA 2IBZD 4MU8A 2B10B 3DR0A 1C75A 1GJQA 3L74D 1C6SA 3GG2A 1CIGA 3O1YA 2BH5X 2QJYB 1OAEA 5KAFV 1DIIC 3M97X 2MTAC 4K3IA 2C1DA 1NTZD 4Y5RA 2QG4A 3RLMA 4WQDA 1KX7A 1CXAA 3ZOWA 1CEDA 1NTKD 1B7VA 4WQ8A 3VMAA 4EDFA 1I6DA 5KLIB 1GQ1A 5CIBB 1KX2A 3PRJA 1LFMA 1CHHA 1A2SA 1BE3D 3ITKA 3A0HV 1RAQA 1CTJA 4YE1A 4H0KA 1H33A 1FI3A 1FOCA 1HROA 1L9BC 2BCCD 2FRCA 3WFBC 2L91A 1N90A 1E2RA 1QL3A 3H1LD 4FA4A 2BGVX 3CP5A 1CCHA 1CRGA 3PLNA 3OA8A 4AAOA 5C9MA 2CA4B 3CWBD 1CRIA 1CCRA 1W5CT 4EIDA 1RZ5A 5CYTR 4UB8V 3HQ7A 2L4DA 2AI5A 1MG2D 2QJKB 2XTSB 155CA 1HH7A 5CICB 5E79V 2B12B 4FAVA 2ZBOA 1K3HA 1W2LA 3PXTA 2OZ1A 1DW1A 4AAMA 1CTZA 3SJLA 1YEAA 4L3HA 3CXHD 4UB6V 4WQCA 4IL6V 1NMLA 2C1DB 1IQCA 2Y0DA 1H9XA 2PACA 2AXTV 2JQRA 4N0KA 1HCMA 3MK7B 4GEDB 1CORA 1H31A 2MHMA 1C6OA 4QAOA 3H1JD 3VNWA 1IO3A 4RJTA 1OCDA 1J3SA 1C2NA 1FI9A 1CNOA 3WUIA 3VRDA 1A56A 1SQQD 2JWAA 2DVHA 1YIQA 2BH4X 5IY51 1H33B 1IRWA 3OCDA 1MZ4A 3L75D 1ZZHA 1CIEA 1HRCA 1H1OA 1COTA 1WVEC 3ZBMA 2N3YA 4WQ9A 2YQBA 3CXHW 1KB0A 5KLVD 1BCCD 1U75B 3MK7C 1HZVA 1CSWA 1ETPA 1AOQA 3OA8B 1N15A 2C9XB 2ZONG 1M70A 2D0SA 5TJHA 2YCCA 2BCNB 3GW6A 2Y0CA 1QYZA 1BL9A 1N9CA 4XYDB 3PH2B 1MG3D 3KZIV
chains in the Genus database with same CATH superfamily
2PCBB 2V7QH 1S3JA 1E79H 1CHJA 1M1KQ 2RH0A 1URQD 1NTKK 1GK4A 1NGMB 1GW3A 2YK3A 3EWKA 1X79B 2OZ1B 2BEQD 4D6TD 1CYCA 2WPRA 1KV9A 2XV5A 2OYHC 1EDJA 1QN2A 3GHGA 1NIRA 1A8CA 3CU4A 2WTYA 3VP9A 4BWNA 4Q5PA 2O01J 1KQLA 2ZJSE 1CIFA 3TDKA 2NPSB 1U57A 1YYCA 1H31B 1KB9D 4FB1A 4WQ7A 2CA3B 3H32A 3H1HG 3TYIA 1SQXJ 3Q1MA 1YICA 4O1WA 2P10A 1RH5B 3O6QA 2G8YA 3CMAP 2Q6QA 2N9IA 4LC1A 3HE5A 1ZW0A 1EXJA 2B0ZB 1DVVA 3VN0A 2WSEJ 3V6IA 1PGJA 1ZRTE 1U74B 5APXA 5CCHA 4C7NB 3H1HE 3AE8C 1H32A 2K9JA 1ZMEC 1BCCG 2K3RA 1SQXD 2JKVA 2RN0A 2A45G 2N1TA 1Q7YQ 2GC7D 1KYOD 1C52A 1NTKG 2LR2A 2P2UA 2AXCA 1FJPA 1N50A 3L74E 2W8ZA 4BRYB 2C1UA 3GMAA 3C1LA 1YEBA 4PW9B 2XNDH 3AEFC 1SP4A 1KFNA 3HD7D 3DMIA 3I55P 4NFGB 4Y99B 1S5LV 1FHBA 2Y9ZA 1PP9J 1YIJP 2GC4D 1NTKE 2PGDA 3Q5PA 2OTLP 3SWSA 4GOFA 3RL0D 4AANA 1JNMA 2OTKE 4YTPC 1GL2D 1HJ5A 1LC1A 1BE3E 4XA4A 3BASA 1S1CX 2WMMA 2JTIB 1CO6A 3CWBG 1E5WA 3ABVC 1PP9D 3QH9A 1BDCA 3VYMA 2R32A 1SVFA 3KHUA 2N18C 3PH0A 2UWJE 1Q90D 1YTZI 2P7JA 1T2KC 1CC5A 3ORVA 4PWAA 2Q3IA 2AEFA 2AEMA 2L5GB 1HJ3A 1L0NE 4IOIH 5EFWB 1G2CB 2QE7H 1LTJC 3BRVB 4IL6E 3HE4B 3G6EP 3WU2E 1FJ0A 4EIFA 1E8EA 5AVVB 3E1IA 1GKSA 3M91A 3VMYA 1LMSA 3H1JG 2FWLA 2B87B 2B88A 3A0BE 1Y9BA 5B5EE 4FANA 1JCDA 3P8CD 5GTHV 1LT9B 1S5LH 2B11B 3V2PA 2C2CA 1J1DC 1GDVA 2GA1A 3TSIA 1URQB 2POHA 3B5NC 3R4YA 1JMBA 3V2NA 2FXMA 2XDJA 3H1JE 2ORLA 1GDTA 1FZEA 3H1HJ 2CE0A 4DT0A 2B9BA 4L3GA 1PV3A 5KJ7A 4W7YA 1YJNP 2Z5HA 3Q3DA 5AW4B 3OW2O 5APQA 1NVOA 3L74J 4FA1A 3L4OA 1MKMA 2ZOOA 2J59M 3CX5W 2GB8B 1N73A 1A02J 3TNUA 1URQC 1DW2A 3KZIE 1LTSC 5DJUB 1ZRTD 2QJKC 3H1HD 5DF5A 2KNCB 1I8PA 1N7SA 3OAKA 3NBTA 4OGQD 3C2CA 1C7MA 1NTKJ 3HUSC 2B10B 1C75A 3SSUA 3L74D 1KILA 2LXCB 1CIGA 2QJYB 1BE3J 1YQ3C 1RE4A 1U7MA 2WT7A 2MTAC 5BVZA 1LWUC 3CLQA 3CCUP 3CCRP 1CXAA 3ZOWA 4U7JA 1GD2E 1NTKD 2HODB 2KB7P 3Q2YA 2ITAA 3S9OA 2QA4P 1JY2N 5AW8B 1KZUB 1NTMK 5GTHH 4ASWA 5KLIB 1WT6A 5E79E 3HD7B 4YXWH 1SQVK 3K5BA 1BE3D 4H0KA 1L0NJ 1LTGC 1H33A 5AW1B 1P84H 3RL0B 3L72G 3HRNA 1L9BC 2FRCA 3WFBC 1FZGA 3E1RA 2MKVA 1QL3A 2AXTE 4OVNF 3L71E 1GL2B 1BGYG 4ZMDA 3CPWO 3HD7C 1NU1K 5C9MA 2OYHA 3CWBD 2H88C 3H1IE 1W5CT 4EIDA 5AW0B 1D7MA 3CXHH 4PJ0E 3RL0C 1FE6A 1EXIA 4IL6X 2AI5A 1RQVA 1VQNP 5CICB 1YJWP 4FAVA 3H1JJ 2W27A 5AVQB 1N2DC 2OZ1A 2Z4EA 4L3HA 4UB6V 5KAIE 1UIXA 1VPCA 2ZXXA 2C1DB 2Y0DA 1NKNA 1JUNA 4L76A 3I56P 1L4AD 1HCMA 2QEXP 2NPSA 1H31A 3VNWA 1C6OA 3H1JD 4RJTA 1C2NA 1NTME 2JWAA 2ZT9D 1IK7A 2IFNA 3CCJP 1M1JC 1SQVE 4IFFA 1HTLC 2WWWA 1MZ4A 3WUVA 4EYYQ 1NU1G 1CIEA 2O1KA 1YHQP 5GTIE 1OMIA 2IFMA 3BATA 3M0AA 4C7NA 1KQGB 1IFIA 2YO3A 3H1LG 3OA8B 2C9XB 3M0DA 3L70G 3G71P 3AECC 4U3FG 1EC5A 1NU1E 1VQKP 3RGUA 4BRYA 1NTZK 2JJLA 5DJTB 3RK3C 5AVZB 1KB9E 3U1CA 2K88A 1M90Q 1PZQA 3AEGC 4OGQB 1VQLP 3TYYA 1DEEG 3CX5E 1FDOA 4FA5A 3G3ZA 4UB6H 1I6EA 3L71J 3SVWA 1AOFA 2IZ1A 1VQ9P 3O20A 2Z5IA 3O5CA 3B4SA 1M60A 1KQFB 2C9LY 3SFDC 1MZ9A 1U7JA 2C8SA 1YQ4C 2D2CD 2KOGA 1PFIA 3H1IJ 4K35A 1PL5A 1Y47A 3C9IA 3TF5A 4L74A 4PV1B 5APSA 1VF5D 1YCCA 1LTTC 1KC8Q 2M0BA 3L71D 1GU4A 3USSA 1T2KD 3OCDB 1FS0E 4MN4C 4AX3A 1YTCA 3A7OA 4RSZA 1IK9A 2QJPC 1G2CA 3PXSA 1T3UA 5KAFE 2KXPB 3H1ID 3HTKB 2JWDA 1NTZG 3L72D 3HE4A 5KLVG 4HYTB 4WY4D 2WSSH 3RN1A 4A7PA 5AW7B 2YKPA 2B4ZA 2B87A 1NTMJ 4H0LB 1HH0A 1M57D 1R0QA 2E74D 1WMKA 1LT9A 1SQVJ 3A0HE 1GIWA 1PP9E 2O3JA 1RF1C 5CMZA 2HFED 4YXDC 1URQA 1H88A 1UIIA 2O01N 3JSVC 3WMM0 1SQQK 1NYHA 1NTMD 3A2AA 1CRCA 1ZN5A 1FCDC 3Q5SA 1QVFO 1CYJA 1SQVD 2FFDB 1NU1J 2H7HA 3DP5A 3FXDA 2ZYAA 1FBMA 1C2RA 3MGNA 2WPVB 1L9JC 1CI6B 2BLFB 3IF4A 3PTZA 3KDPB 4P4QB 2KNCA 1IRVA 2KZJA 3E7KA 3TK1A 3L70J 4NPFX 3P8CE 4U3FJ 1CHIA 1HGZA 5EXQA 3AEBC 3PXWA 1RE3C 1NU1D 1NNOA 2ZYGA 5APYA 4XE5B 2FFDC 5H2FV 2G3AA 1M7LA 2PP6A 4WB4A 1L4AC 1OX3A 1I55A 2WZ7A 1HJ4A 3RK3E 2YIUB 3S4RA 1QL1A 3CCQP 1NMIA 4PD4I 3L4MA 2OARA 1ZP0C 3H25A 2ZT9C 3L70D 2C1VA 3CX5D 1LTBC 4GYDA 3VMXA 2HODA 4U3FD 1FOSE 4GIFA 4GKGA 1SQQG 2H8PD 1LGHB 5BU8B 3HD7A 1BSHA 3AE1C 2QRXA 2ZZS1 4ZNCA 2YIUC 4DCKA 1OFCX 1K05A 2CPSA 3W67A 1SQPK 3VMZA 3WFEC 4O9BA 1GL2A 3OA7A 2QIWA 4L1QA 4RESB 4AALA 3JCUH 3WU2V 1VQ7P 2IPPA 1H9YA 1FI7A 1K04A 1YNRA 2FYZA 1BCCE 3MTUE 1DH3A 1JTHB 2N18B 3A0BV 1SLQA 5B5EV 2Y0EA 1JY2P 1FOSF 2SPZA 1JY3N 1EZVG 2E43A 3LW5J 5H2FH 3GG2A 1GZLA 2BH5X 1FZFA 1FC2C 2OYIC 1P84I 5CCHD 2KLVA 2D2CC 1LTJB 4ASVA 4WY4B 1AFOA 4K3IA 2C1DA 1NTZD 1GTWA 2KUBA 1FAVA 1VF5C 3KQGA 3II6A 3RLMA 1CZQA 1VDFA 2AEJA 3H6PA 1EZVE 4H44D 1B7VA 4WVZA 1AVYA 4UB8E 1KILE 3P8MC 2ZXEB 4EDFA 1RF0C 4JQ0D 2V7QJ 4B86A 4JPZB 1CHHA 1SQPG 3AEAC 1A02F 3ITKA 3V2RA 2I8DA 1RAQA 3CXHI 2WPSA 3CWBE 1KTMA 5AVSB 1OW7A 2KK7A 1J1DB 4WY4C 1AQ5A 3B5NB 2WITA 4ZKUA 3CP5A 2FYUG 1J1EC 4AUWA 3WU2H 1LNQA 2IBZI 2MJZA 2E74C 3PLNA 3OA8A 4AAOA 1PGOA 3IN6A 2CA4B 3PJSK 3ZDMA 1CRIA 1S72P 1WRGA 3A0BH 1RZ5A 1LJ2A 5B5EH 1VQ6P 3L73G 3HQ7A 2PRRA 2QJKB 1MG2D 2XTSB 3RK3D 5E79V 2B12B 1H89A 1K3HA 3AE9C 3HUSB 3PXTA 1DW1A 1USDA 1QX8A 1SQQJ 4OWFA 1YJ9P 4PD4H 4NPDA 1DEBA 1IQCA 1J2JB 1ZV8A 2AXTV 2CPBA 1IFJA 2GM4A 1PPJG 4N0KA 2W6BA 4LLHA 1LWUB 1QL2A 5CJ0A 3MK7B 1BCCJ 2MHMA 1OVRA 1MFTA 1IO3A 3NTNA 3AE5C 2YNYA 2KZIA 4JF7A 1R8EA 1FI9A 1CNOA 1A56A 1SQQD 2FXOA 4I7ZC 2DVHA 1NH4A 5IY51 2A06G 1ZLLA 3OCDA 4L75A 2E76D 3GF3A 1HRCA 5AVTB 2QM7A 4HH2A 1PPJE 1H1OA 3ZBMA 2C0WA 2IYOA 1KB0A 3CI9A 1BCCD 2QM8A 1U75B 3MK7C 3HTKA 5CCGA 3UIAA 1ZR4A 2OTJP 2B89A 3FXEA 2LXBA 3MUDA 2I1JA 2YCCA 1OXZA 1BL9A 2E5YA 2P1JA 2XZRA 2P58A 1YITP 3M06A 1X0TA 1EDKA 2FXPA 4RKUJ 3CWBJ 5B66E 4GODA 1JO5A 2IZ0A 5E79H 1N7SD 1X8YA 2OGUA 3RMZA 1EZVD 1KYOI 2XNXA 2WSFH 1KILD 1Z56A 1PGPA 4NPEA 1DIPA 1SQPJ 1QVGO 1JDLA 1M8OB 2AXTH 2KYVA 1RE3A 5KKZC 2FFDA 3L72E 1RQUA 2GIWA 4H44B 2KI7B 2N9YB 1BGYE 1DVHA 2DW3A 1DW0A 1CI6A 2IBZG 5C39A 2R3CA 1SQPD 5CCHC 1R5LA 4Z1MH 3U59A 3L75G 1M1JB 3KYQA 3AEDC 4H0JA 2FYNB 1K8AQ 1CSVA 3L73J 4W80A 4H44C 1JB0J 1SFCD 2CE1A 5CIDB 4V2KA 1CSBA 2EXVA 1FZBA 3HQ8A 1S5LX 3NMDA 4EIJA 5C0ZA 3FX0A 1GU2A 2O1JA 3NWVA 1AVOA 4QMAA 1F1CA 3AE2C 4O1QA 4AYCA 4R4LA 5DJQB 2HV4A 4EIEA 3V2QA 1SQXK 3PP5A 2FYNC 3L73D 351CA 3RK3B 3HQ9A 3QWOC 1YFCA 2BCCG 1GW4A 1AQTA 2JDIH 1YTZT 4D6TG 3ZOOA 3NBSA 1VYDA 2GUVA 1BSNA 1AKKA 2V08A 1LT1A 2CK3H 4LGDE 2ZXYA 2VRSA 5AVXB 1WEJF 5CBOA 1LS9A 5DJQC 2XKMA 2E5TA 1IZNB 3SWFA 5KLVK 1PPJD 1JOCA 3VP8A 2CXBA 3H1LE 4DOJA 2BEZF 3B8EB 1JTHA 3L70E 1MUUA 1JEKA 2HPCB 2V07A 4U3FE 1QGKB 3IR9A 1KB9H 2E76B 1VL2A 1K3GA 2A06D 5TISE 3CX5H 1EQ7A 2YKQA 2QJPB 1HJ0A 1IZL0 4W7ZA 3T97B 1N7LA 1LTJA 2Q1KA 3WFDC 1SS1A 1SQXG 2BASA 2O01H 4WY4A 3SXTA 3L72J 1YBKA 1QL4A 2VHDA 3AE4C 1BGYJ 1SQBK 2E76C 1P84D 2LITA 4JCGA 3S1KA 3WFCC 1KYOH 2D0WA 1YI2P 1HZUA 4DY9A 1MFZA 1RF1B 4N78D 5CIGB 2W6AA 3G4SP 2WSEH 2A45I 2R3SA 1CRYA 1FJKA 3B5NA 1BGYD 2KSEA 3ZOYA 1LTAC 1JY3P 3RBZA 3RN0A 1K73Q 3VYIA 3O0RC 2RMZA 3HQ6A 1N73C 5CIFB 1ZOYC 1AYGA 2KLUA 3ZCFA 1N7SC 1NTZE 5KLVE 2LIRA 2ZVOB 4KMGA 2HLOA 3FWLA 2Q9IA 1L0LK 3V5BA 1R5SA 3D6YA 1KILC 5BU5A 4C46A 2IBZD 3CCVP 2NZ2A 2R5BA 1IFPA 4OH8B 1SQBG 1C6SA 1DX7A 3HUSA 1OVVA 3LW5H 3CMEP 1DIIC 3M97X 1X9VA 5AVYB 1SFCB 1BDDA 4Y5RA 1L4AB 2WSCJ 3L37A 2BCCJ 1CEDA 4WQ8A 2KS1B 3H1LJ 1LWUA 4N3YB 1Q2NA 1SQBE 2ZT9B 3IFMA 5CIBB 3PRJA 1IFMA 4YE1A 3BRTB 2HG5D 3FGAD 4AQRD 1SFCC 1FI3A 1FOCA 1RY3A 1S4XA 1HROA 1OIPA 2BCCD 3CL3D 1N90A 1E2RA 3H1LD 4FA4A 4HJGH 1L0LG 1CRGA 3L35A 4EI2A 3W68A 2I1KA 4GT1A 4UB8V 2GUSA 2L4DA 5AW2B 1QLED 2KSJA 1HH7A 1L0LE 1LTIC 2WVRA 2ZBOA 1W2LA 1L0NK 1SQQE 4XFJA 4AAMA 2J58A 1CTZA 3L74G 2OQQA 4IL6V 1OZHA 3NXSA 3CD6P 2OYOA 1NMLA 1H0TB 2OYIB 2NPSC 5AVWB 2D2CB 1H9XA 4BXLA 1K9MQ 3TGUG 1KORA 1PGQA 3JCUE 1VF5B 3NFQA 1NTZJ 4N6JA 3G9RA 5AW3B 1CORA 5KLVJ 4QAOA 4RO0A 2P67A 1J3SA 2FYUK 1NOHA 3U1AA 1YIQA 3GLMA 1BE3G 2BH4X 1NO4A 2A45H 3TGUE 2JEEA 1VQ8P 1LP1B 1COTA 3KXDA 1N86A 1M1JA 1WVEC 5H2FE 2N3YA 4WQ9A 1NAYA 5CBNA 3M0DC 3CXHW 3L36A 5KLVD 2M3EA 4I1LA 4IFDK 3RK2D 2N1TD 1CSWA 3CCEP 1G1JA 1N15A 1M70A 5TJHA 3CC2P 1J1EB 2Y0CA 1QYZA 4WBAA 3MP7B 1JMMA 1SQBJ 2E74B 1Q81Q 1FZCB 4XYDB 1L0NG 4Y99C 4HKZH 3BCCG 3KZIV 4UB8H 1IFNA 3H1KG 2DGEA 2E75D 4C7RA 1HBWA 1HGVA 1VQ4P 4K3AA 3D70A 3L4FA 4L73A 2M5AB 2IDBA 4IL6H 451CA 1GK6A 3MIWA 1CYIA 1SQPE 1SQBD 3BCCE 1FZCC 2PFXA 3H1KE 4H13D 4TLFA 2LKMA 1ZXGA 2J5UA 2YXQB 5CIHB 1DT1A 2N9JA 2HR3A 1NHLA 1DW3A 1S5LE 3N4XA 3MD0A 2YKOA 4EICA 1OW6A 2FY8A 2FYUE 3CYTI 2YO2A 1I5TA 1HUCA 4GOEA 2K9YA 5L8RJ 1L0LJ 2FKWB 1CRJA 1CSUA 4I7ZB 2KP8A 2HPCA 1IC2A 5B66V 3V4QA 1JY3O 1CW5A 3L73E 3CC7P 1M56D 4PD4E 1FDMA 2IX7C 3T97A 4LJIA 2W90A 1HF9A 1L0LD 1DD3A 1S9KE 1LT9C 2BPBB 3KZIH 4DJGA 1AV1A 1VQ5P 2ZVNB 4JYCA 1FZAA 1NJIQ 5APWA 4PJ0V 1HVVA 4XXLA 1EB7A 4FA9A 3TGUJ 3D0WA 3JBTB 1KB9I 1RF1A 2W83C 3EFFK 5KJ7D 1I8OA 2AIUA 2I8FA 4WQBA 1W5CE 1PIXA 3MHVA 1CRHA 3GHGB 3ZIYA 1CTYA 1DIQC 4WQAA 5KAIV 1GMJA 3CX5I 3IAOA 5K5GB 2ZFCA 2Q7CA 2A06E 5AW9B 3A5TA 2W6JH 2Q3EA 3CCSP 1KYOW 2KIKA 4EOTA 1M6ZA 5GTHE 3H32B 4WQEA 3SFEC 5CJ4A 3TGUD 2WPQA 3RL0g 2YMYA 5KKZB 1XTGB 2H89C 2JR8A 2RKLA 2ZYDA 2R44A 4PV1D 3O6QB 1FU1A 2PAJA 4DZOA 1QKSA 3B71A 3L71G 3GHGC 1QEXA 3HE5B 5B66H 1P84E 2QJYC 3CC4P 3FWNA 5APUA 1F1FA 1RAPA 5GTIV 3BCCJ 2K37A 1VQOP 1H32B 2K9JB 3H1KJ 2N3BA 1G1IA 1OVUA 3H1IG 2Q5UA 3O8ZA 3RK2B 1CSXA 4N78E 4TT3H 2N1TB 1W2BO 1LC2A 5CCGD 2FBWC 1SFCA 1KIBA 1Q86Q 1L4AA 4J20A 3X39A 1ZR2A 3JC22 3A3YB 3AE6C 5KLIC 1I54A 3CXHE 2FYUJ 2KS1A 2PCCB 1VQPP 1L0ND 1Y8AA 2NRGA 1S6VB 4H0LD 4PJ0H 3BCCD 1KMIZ 4I2LC 2E75B 3H1KD 3A9FA 4JYBA 3WC8A 1CXCA 3RBXA 3RK2C 5B6QA 2N1TC 1GU5A 1C6RA 5CIEB 5APVA 3F89A 3CCLP 1IO4A 1GL2C 2Y9YA 2H43A 5KAIH 1E29A 2IBZE 2HYNA 2QSIA 3PHLA 2FYUD 5TISV 1NTMG 2R5DA 5DFSA 3L75E 4H13B 1TU3F 1DD4A 1JCCA 1SQVG 2ZAEB 1AA0A 2E75C 1JY2O 1CIHA 2YXRB 1XTCC 1RZ6A 3ZOXA 5AURA 4PD4D 3SLEA 3I5CA 1KFMA 3EFGA 3WUTA 1W2EA 4MU8A 3AE7C 3DR0A 2WQYC 3M9QA 5GTIH 1KN7A 1GJQA 4H13C 4M3LA 1S9KD 3O1YA 4HB1A 1OAEA 2K1AA 4GDOA 3EQ2A 5KAFV 2QVAA 3LIEA 4Y28J 4CPGA 1H0TA 2OYIA 2QG4A 4WQDA 3F5HA 1KX7A 2NPSD 2BCCE 5AW5B 3WUUA 3BVHA 4D6TE 1T3JA 1T8ZA 3VMAA 4JBZA 2WSCH 1I6DA 1GQ1A 1NAFA 1KX2A 3VOPA 1LFMA 1T6AA 1A2SA 3R2PA 3M9BA 3A0HV 1CTJA 1EDLA 1RF0A 3LIDA 4UB6E 2JO1A 2WSFJ 1LP1A 5APTA 2XU6A 3SWKA 4R4MA 2L91A 5TISH 2M3BA 2E42A 3V4WA 3SWYA 2BGVX 1MV8A 1HJBA 1CCHA 5KTBA 3Q5RA 3OJAB 1JM0A 2JP3A 4KT0J 1HWTC 1N73B 3TNUB 3D71A 5AW6B 4ZKPA 1FZCA 1CCRA 2C0XA 3VTPC 1H8AA 1SQXE 4OGQC 3AEEC 1N7SB 5CYTR 1FDIA 5KJ7C 1KYOE 155CA 2N9BA 5CHXA 1KD1Q 2YMKA 1KILB 1NWQA 5KAFH 3SJLA 2M5AA 3AE3C 1YEAA 3CXHD 4WQCA 1OWAA 1USEA 2WT7B 5AVRB 1KV4A 1IFDA 3L75J 3P32A 2V4HA 1N8RQ 1AJYA 4YPCA 1RHZB 2PACA 3CCMP 1PP9G 3N7NA 2JQRA 4PV1C 3GF7A 4GEDB 1OCDA 1S2EA 4KHXA 3WUIA 3C8VA 1EZVI 3VRDA 3A0HH 1Q82Q 4WWIA 1H33B 1RE4C 1X22A 1IRWA 3P7KA 3L75D 1NKZB 3MZWB 1ZZHA 1KQSO 1IJDB 5CCGC 1OW8A 2YQBA 4IFMA 3M9HA 3KPEA 3MUDC 3B5ND 3D6ZA 1HZVA 1ETPA 2IYPA 5AVUB 1AOQA 2ZONG 2M8RA 1EDIA 2D0SA 4D6TJ 4I6MC 1L2PA 4H0LC 2BCNB 3GW6A 2OYHB 1N9CA 3PH2B 1MG3D 4KJMA 1VQMP 2C9NY 5M1BA
chains in the Genus database with same CATH topology
2DGEA 2PCBB 1CHJA 2YK3A 2OZ1B 4FA5A 3RMZA 1EZVD 4D6TD 1CYCA 1I6EA 451CA 3SVWA 1KV9A 1CYIA 1SQBD 1QN2A 1NIRA 1A8CA 1AOFA 3CU4A 3O20A 4Q5PA 1JDLA 3O5CA 1M60A 1CIFA 3TDKA 2C8SA 5CIHB 1DT1A 1H31B 1KB9D 2N9JA 4WQ7A 4FB1A 2CA3B 2GIWA 1DW3A 3TF5A 2N9YB 3TYIA 4EICA 1YCCA 1DVHA 1YICA 3CYTI 4O1WA 1I5TA 1DW0A 3L71D 3OCDB 1CRJA 1SQPD 4AX3A 1CSUA 1YTCA 4RSZA 2N9IA 5B66V 2B0ZB 1DVVA 4H0JA 1U74B 3PXSA 2FYNB 3H1ID 1CSVA 3L72D 1H32A 1SQXD 2CE1A 5CIDB 4V2KA 4LJIA 2RN0A 2EXVA 3HQ8A 2GC7D 1KYOD 1C52A 5C0ZA 1L0LD 1N50A 3RN1A 1GU2A 4A7PA 3NWVA 2B4ZA 2C1UA 2BPBB 1F1CA 1YEBA 4PW9B 1R0QA 4O1QA 3DMIA 4NFGB 5DJQB 1S5LV 2HV4A 4EIEA 1FHBA 1GIWA 2O3JA 4PJ0V 4XXLA 3L73D 1EB7A 4FA9A 351CA 3HQ9A 2GC4D 3JBTB 1YFCA 3SWSA 1I8OA 2AIUA 2I8FA 4AANA 4WQBA 1CRHA 3ZOOA 3NBSA 3ZIYA 1CTYA 1DIQC 1HJ5A 4WQAA 1LC1A 1VYDA 1NTMD 5KAIV 1CRCA 1AKKA 2V08A 2ZXYA 1FCDC 2Q3EA 1CYJA 1SQVD 2JTIB 1WEJF 1CO6A 1KYOW 1LS9A 5DJQC 1M6ZA 3DP5A 4WQEA 1PP9D 3TGUD 3VYMA 1C2RA 3KHUA 1PPJD 5KKZB 2N18C 2CXBA 1L9JC 2BLFB 1CC5A 3ORVA 4PWAA 3PTZA 1QKSA 4P4QB 1IRVA 2V07A 1HJ3A 1K3GA 1CHIA 2A06D 5EXQA 1F1FA 1RAPA 5GTIV 3PXWA 1NU1D 1NNOA 5H2FV 1H32B 2K9JB 2N3BA 2QJPB 1IZL0 1I55A 1CSXA 1FJ0A 3WFDC 4EIFA 1E8EA 1HJ4A 1LC2A 2YIUB 3SXTA 1GKSA 1KIBA 1LMSA 1NMIA 4J20A 3L4MA 1QL4A 2VHDA 3X39A 2FWLA 3L70D 2C1VA 1I54A 3CX5D 4GYDA 4U3FD 4FANA 2KS1A 2PCCB 1P84D 2LITA 5GTHV 1L0ND 4JCGA 1S6VB 2B11B 3BCCD 3WFCC 2C2CA 3H1KD 2D0WA 3A9FA 1GDVA 1HZUA 4DY9A 3WC8A 1CXCA 5B6QA 2ZZS1 1C6RA 5CIGB 5CIEB 2ORLA 2CE0A 4L3GA 1CRYA 1E29A 1BGYD 3ZOYA 3PHLA 3RN0A 2FYUD 5TISV 3WFEC 3O0RC 2RMZA 5DFSA 3HQ6A 4L1QA 5CIFB 4AALA 3WU2V 4FA1A 3L4OA 1AYGA 3ZCFA 1H9YA 1FI7A 2ZOOA 3CX5W 2GB8B 1YNRA 1DW2A 1CIHA 2LIRA 1ZRTD 4KMGA 3H1HD 5DF5A 1RZ6A 3ZOXA 3FWLA 2N18B 3A0BV 4PD4D 3SLEA 5AURA 1I8PA 2KNCB 5B5EV 2Y0EA 3NBTA 3C2CA 1C7MA 2IBZD 4MU8A 2B10B 3DR0A 1C75A 1GJQA 3L74D 1C6SA 3GG2A 1CIGA 3O1YA 2BH5X 2QJYB 1OAEA 5KAFV 1DIIC 3M97X 2MTAC 4K3IA 2C1DA 1NTZD 4Y5RA 2QG4A 3RLMA 4WQDA 1KX7A 1CXAA 3ZOWA 1CEDA 1NTKD 1B7VA 4WQ8A 3VMAA 4EDFA 1I6DA 5KLIB 1GQ1A 5CIBB 1KX2A 3PRJA 1LFMA 1CHHA 1A2SA 1BE3D 3ITKA 3A0HV 1RAQA 1CTJA 4YE1A 4H0KA 1H33A 1FI3A 1FOCA 1HROA 1L9BC 2BCCD 2FRCA 3WFBC 2L91A 1N90A 1E2RA 1QL3A 3H1LD 4FA4A 2BGVX 3CP5A 1CCHA 1CRGA 3PLNA 3OA8A 4AAOA 5C9MA 2CA4B 3CWBD 1CRIA 1CCRA 1W5CT 4EIDA 1RZ5A 5CYTR 4UB8V 3HQ7A 2L4DA 2AI5A 1MG2D 2QJKB 2XTSB 155CA 1HH7A 5CICB 5E79V 2B12B 4FAVA 2ZBOA 1K3HA 1W2LA 3PXTA 2OZ1A 1DW1A 4AAMA 1CTZA 3SJLA 1YEAA 4L3HA 3CXHD 4UB6V 4WQCA 4IL6V 1NMLA 2C1DB 1IQCA 2Y0DA 1H9XA 2PACA 2AXTV 2JQRA 4N0KA 1HCMA 3MK7B 4GEDB 1CORA 1H31A 2MHMA 1C6OA 4QAOA 3H1JD 3VNWA 1IO3A 4RJTA 1OCDA 1J3SA 1C2NA 1FI9A 1CNOA 3WUIA 3VRDA 1A56A 1SQQD 2JWAA 2DVHA 1YIQA 2BH4X 5IY51 1H33B 1IRWA 3OCDA 1MZ4A 3L75D 1ZZHA 1CIEA 1HRCA 1H1OA 1COTA 1WVEC 3ZBMA 2N3YA 4WQ9A 2YQBA 3CXHW 1KB0A 5KLVD 1BCCD 1U75B 3MK7C 1HZVA 1CSWA 1ETPA 1AOQA 3OA8B 1N15A 2C9XB 2ZONG 1M70A 2D0SA 5TJHA 2YCCA 2BCNB 3GW6A 2Y0CA 1QYZA 1BL9A 1N9CA 4XYDB 3PH2B 1MG3D 3KZIV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGE A;  2PCB B;  1CHJ A;  2YK3 A;  2OZ1 B;  4FA5 A;  3RMZ A;  1EZV D;  4D6T D;  1CYC A;  1I6E A;  451C A;  3SVW A;  1KV9 A;  1CYI A;  1SQB D;  1QN2 A;  1NIR A;  1A8C A;  1AOF A;  3CU4 A;  3O20 A;  4Q5P A;  1JDL A;  3O5C A;  1M60 A;  1CIF A;  3TDK A;  2C8S A;  5CIH B;  1DT1 A;  1H31 B;  1KB9 D;  2N9J A;  4WQ7 A;  4FB1 A;  2CA3 B;  2GIW A;  1DW3 A;  3TF5 A;  2N9Y B;  3TYI A;  4EIC A;  1YCC A;  1DVH A;  1YIC A;  3CYT I;  4O1W A;  1I5T A;  1DW0 A;  3L71 D;  3OCD B;  1CRJ A;  1SQP D;  4AX3 A;  1CSU A;  1YTC A;  4RSZ A;  2N9I A;  5B66 V;  2B0Z B;  1DVV A;  4H0J A;  1U74 B;  3PXS A;  2FYN B;  3H1I D;  1CSV A;  3L72 D;  1H32 A;  1SQX D;  2CE1 A;  5CID B;  4V2K A;  4LJI A;  2RN0 A;  2EXV A;  3HQ8 A;  2GC7 D;  1KYO D;  1C52 A;  5C0Z A;  1L0L D;  1N50 A;  3RN1 A;  1GU2 A;  4A7P A;  3NWV A;  2B4Z A;  2C1U A;  2BPB B;  1F1C A;  1YEB A;  4PW9 B;  1R0Q A;  4O1Q A;  3DMI A;  4NFG B;  5DJQ B;  1S5L V;  2HV4 A;  4EIE A;  1FHB A;  1GIW A;  2O3J A;  4PJ0 V;  4XXL A;  3L73 D;  1EB7 A;  4FA9 A;  351C A;  3HQ9 A;  2GC4 D;  3JBT B;  1YFC A;  3SWS A;  1I8O A;  2AIU A;  2I8F A;  4AAN A;  4WQB A;  1CRH A;  3ZOO A;  3NBS A;  3ZIY A;  1CTY A;  1DIQ C;  1HJ5 A;  4WQA A;  1LC1 A;  1VYD A;  1NTM D;  5KAI V;  1CRC A;  1AKK A;  2V08 A;  2ZXY A;  1FCD C;  2Q3E A;  1CYJ A;  1SQV D;  2JTI B;  1WEJ F;  1CO6 A;  1KYO W;  1LS9 A;  5DJQ C;  1M6Z A;  3DP5 A;  4WQE A;  1PP9 D;  3TGU D;  3VYM A;  1C2R A;  3KHU A;  1PPJ D;  5KKZ B;  2N18 C;  2CXB A;  1L9J C;  2BLF B;  1CC5 A;  3ORV A;  4PWA A;  3PTZ A;  1QKS A;  4P4Q B;  1IRV A;  2V07 A;  1HJ3 A;  1K3G A;  1CHI A;  2A06 D;  5EXQ A;  1F1F A;  1RAP A;  5GTI V;  3PXW A;  1NU1 D;  1NNO A;  5H2F V;  1H32 B;  2K9J B;  2N3B A;  2QJP B;  1IZL 0;  1I55 A;  1CSX A;  1FJ0 A;  3WFD C;  4EIF A;  1E8E A;  1HJ4 A;  1LC2 A;  2YIU B;  3SXT A;  1GKS A;  1KIB A;  1LMS A;  1NMI A;  4J20 A;  3L4M A;  1QL4 A;  2VHD A;  3X39 A;  2FWL A;  3L70 D;  2C1V A;  1I54 A;  3CX5 D;  4GYD A;  4U3F D;  4FAN A;  2KS1 A;  2PCC B;  1P84 D;  2LIT A;  5GTH V;  1L0N D;  4JCG A;  1S6V B;  2B11 B;  3BCC D;  3WFC C;  2C2C A;  3H1K D;  2D0W A;  3A9F A;  1GDV A;  1HZU A;  4DY9 A;  3WC8 A;  1CXC A;  5B6Q A;  2ZZS 1;  1C6R A;  5CIG B;  5CIE B;  2ORL A;  2CE0 A;  4L3G A;  1CRY A;  1E29 A;  1BGY D;  3ZOY A;  3PHL A;  3RN0 A;  2FYU D;  5TIS V;  3WFE C;  3O0R C;  2RMZ A;  5DFS A;  3HQ6 A;  4L1Q A;  5CIF B;  4AAL A;  3WU2 V;  4FA1 A;  3L4O A;  1AYG A;  3ZCF A;  1H9Y A;  1FI7 A;  2ZOO A;  3CX5 W;  2GB8 B;  1YNR A;  1DW2 A;  1CIH A;  2LIR A;  1ZRT D;  4KMG A;  3H1H D;  5DF5 A;  1RZ6 A;  3ZOX A;  3FWL A;  2N18 B;  3A0B V;  4PD4 D;  3SLE A;  5AUR A;  1I8P A;  2KNC B;  5B5E V;  2Y0E A;  3NBT A;  3C2C A;  1C7M A;  2IBZ D;  4MU8 A;  2B10 B;  3DR0 A;  1C75 A;  1GJQ A;  3L74 D;  1C6S A;  3GG2 A;  1CIG A;  3O1Y A;  2BH5 X;  2QJY B;  1OAE A;  5KAF V;  1DII C;  3M97 X;  2MTA C;  4K3I A;  2C1D A;  1NTZ D;  4Y5R A;  2QG4 A;  3RLM A;  4WQD A;  1KX7 A;  1CXA A;  3ZOW A;  1CED A;  1NTK D;  1B7V A;  4WQ8 A;  3VMA A;  4EDF A;  1I6D A;  5KLI B;  1GQ1 A;  5CIB B;  1KX2 A;  3PRJ A;  1LFM A;  1CHH A;  1A2S A;  1BE3 D;  3ITK A;  3A0H V;  1RAQ A;  1CTJ A;  4YE1 A;  4H0K A;  1H33 A;  1FI3 A;  1FOC A;  1HRO A;  1L9B C;  2BCC D;  2FRC A;  3WFB C;  2L91 A;  1N90 A;  1E2R A;  1QL3 A;  3H1L D;  4FA4 A;  2BGV X;  3CP5 A;  1CCH A;  1CRG A;  3PLN A;  3OA8 A;  4AAO A;  5C9M A;  2CA4 B;  3CWB D;  1CRI A;  1CCR A;  1W5C T;  4EID A;  1RZ5 A;  5CYT R;  4UB8 V;  3HQ7 A;  2L4D A;  2AI5 A;  1MG2 D;  2QJK B;  2XTS B;  155C A;  1HH7 A;  5CIC B;  5E79 V;  2B12 B;  4FAV A;  2ZBO A;  1K3H A;  1W2L A;  3PXT A;  2OZ1 A;  1DW1 A;  4AAM A;  1CTZ A;  3SJL A;  1YEA A;  4L3H A;  3CXH D;  4UB6 V;  4WQC A;  4IL6 V;  1NML A;  2C1D B;  1IQC A;  2Y0D A;  1H9X A;  2PAC A;  2AXT V;  2JQR A;  4N0K A;  1HCM A;  3MK7 B;  4GED B;  1COR A;  1H31 A;  2MHM A;  1C6O A;  4QAO A;  3H1J D;  3VNW A;  1IO3 A;  4RJT A;  1OCD A;  1J3S A;  1C2N A;  1FI9 A;  1CNO A;  3WUI A;  3VRD A;  1A56 A;  1SQQ D;  2JWA A;  2DVH A;  1YIQ A;  2BH4 X;  5IY5 1;  1H33 B;  1IRW A;  3OCD A;  1MZ4 A;  3L75 D;  1ZZH A;  1CIE A;  1HRC A;  1H1O A;  1COT A;  1WVE C;  3ZBM A;  2N3Y A;  4WQ9 A;  2YQB A;  3CXH W;  1KB0 A;  5KLV D;  1BCC D;  1U75 B;  3MK7 C;  1HZV A;  1CSW A;  1ETP A;  1AOQ A;  3OA8 B;  1N15 A;  2C9X B;  2ZON G;  1M70 A;  2D0S A;  5TJH A;  2YCC A;  2BCN B;  3GW6 A;  2Y0C A;  1QYZ A;  1BL9 A;  1N9C A;  4XYD B;  3PH2 B;  1MG3 D;  3KZI V; 
#chains in the Genus database with same CATH topology
 2PCB B;  2V7Q H;  1S3J A;  1E79 H;  1CHJ A;  1M1K Q;  2RH0 A;  1URQ D;  1NTK K;  1GK4 A;  1NGM B;  1GW3 A;  2YK3 A;  3EWK A;  1X79 B;  2OZ1 B;  2BEQ D;  4D6T D;  1CYC A;  2WPR A;  1KV9 A;  2XV5 A;  2OYH C;  1EDJ A;  1QN2 A;  3GHG A;  1NIR A;  1A8C A;  3CU4 A;  2WTY A;  3VP9 A;  4BWN A;  4Q5P A;  2O01 J;  1KQL A;  2ZJS E;  1CIF A;  3TDK A;  2NPS B;  1U57 A;  1YYC A;  1H31 B;  1KB9 D;  4FB1 A;  4WQ7 A;  2CA3 B;  3H32 A;  3H1H G;  3TYI A;  1SQX J;  3Q1M A;  1YIC A;  4O1W A;  2P10 A;  1RH5 B;  3O6Q A;  2G8Y A;  3CMA P;  2Q6Q A;  2N9I A;  4LC1 A;  3HE5 A;  1ZW0 A;  1EXJ A;  2B0Z B;  1DVV A;  3VN0 A;  2WSE J;  3V6I A;  1PGJ A;  1ZRT E;  1U74 B;  5APX A;  5CCH A;  4C7N B;  3H1H E;  3AE8 C;  1H32 A;  2K9J A;  1ZME C;  1BCC G;  2K3R A;  1SQX D;  2JKV A;  2RN0 A;  2A45 G;  2N1T A;  1Q7Y Q;  2GC7 D;  1KYO D;  1C52 A;  1NTK G;  2LR2 A;  2P2U A;  2AXC A;  1FJP A;  1N50 A;  3L74 E;  2W8Z A;  4BRY B;  2C1U A;  3GMA A;  3C1L A;  1YEB A;  4PW9 B;  2XND H;  3AEF C;  1SP4 A;  1KFN A;  3HD7 D;  3DMI A;  3I55 P;  4NFG B;  4Y99 B;  1S5L V;  1FHB A;  2Y9Z A;  1PP9 J;  1YIJ P;  2GC4 D;  1NTK E;  2PGD A;  3Q5P A;  2OTL P;  3SWS A;  4GOF A;  3RL0 D;  4AAN A;  1JNM A;  2OTK E;  4YTP C;  1GL2 D;  1HJ5 A;  1LC1 A;  1BE3 E;  4XA4 A;  3BAS A;  1S1C X;  2WMM A;  2JTI B;  1CO6 A;  3CWB G;  1E5W A;  3ABV C;  1PP9 D;  3QH9 A;  1BDC A;  3VYM A;  2R32 A;  1SVF A;  3KHU A;  2N18 C;  3PH0 A;  2UWJ E;  1Q90 D;  1YTZ I;  2P7J A;  1T2K C;  1CC5 A;  3ORV A;  4PWA A;  2Q3I A;  2AEF A;  2AEM A;  2L5G B;  1HJ3 A;  1L0N E;  4IOI H;  5EFW B;  1G2C B;  2QE7 H;  1LTJ C;  3BRV B;  4IL6 E;  3HE4 B;  3G6E P;  3WU2 E;  1FJ0 A;  4EIF A;  1E8E A;  5AVV B;  3E1I A;  1GKS A;  3M91 A;  3VMY A;  1LMS A;  3H1J G;  2FWL A;  2B87 B;  2B88 A;  3A0B E;  1Y9B A;  5B5E E;  4FAN A;  1JCD A;  3P8C D;  5GTH V;  1LT9 B;  1S5L H;  2B11 B;  3V2P A;  2C2C A;  1J1D C;  1GDV A;  2GA1 A;  3TSI A;  1URQ B;  2POH A;  3B5N C;  3R4Y A;  1JMB A;  3V2N A;  2FXM A;  2XDJ A;  3H1J E;  2ORL A;  1GDT A;  1FZE A;  3H1H J;  2CE0 A;  4DT0 A;  2B9B A;  4L3G A;  1PV3 A;  5KJ7 A;  4W7Y A;  1YJN P;  2Z5H A;  3Q3D A;  5AW4 B;  3OW2 O;  5APQ A;  1NVO A;  3L74 J;  4FA1 A;  3L4O A;  1MKM A;  2ZOO A;  2J59 M;  3CX5 W;  2GB8 B;  1N73 A;  1A02 J;  3TNU A;  1URQ C;  1DW2 A;  3KZI E;  1LTS C;  5DJU B;  1ZRT D;  2QJK C;  3H1H D;  5DF5 A;  2KNC B;  1I8P A;  1N7S A;  3OAK A;  3NBT A;  4OGQ D;  3C2C A;  1C7M A;  1NTK J;  3HUS C;  2B10 B;  1C75 A;  3SSU A;  3L74 D;  1KIL A;  2LXC B;  1CIG A;  2QJY B;  1BE3 J;  1YQ3 C;  1RE4 A;  1U7M A;  2WT7 A;  2MTA C;  5BVZ A;  1LWU C;  3CLQ A;  3CCU P;  3CCR P;  1CXA A;  3ZOW A;  4U7J A;  1GD2 E;  1NTK D;  2HOD B;  2KB7 P;  3Q2Y A;  2ITA A;  3S9O A;  2QA4 P;  1JY2 N;  5AW8 B;  1KZU B;  1NTM K;  5GTH H;  4ASW A;  5KLI B;  1WT6 A;  5E79 E;  3HD7 B;  4YXW H;  1SQV K;  3K5B A;  1BE3 D;  4H0K A;  1L0N J;  1LTG C;  1H33 A;  5AW1 B;  1P84 H;  3RL0 B;  3L72 G;  3HRN A;  1L9B C;  2FRC A;  3WFB C;  1FZG A;  3E1R A;  2MKV A;  1QL3 A;  2AXT E;  4OVN F;  3L71 E;  1GL2 B;  1BGY G;  4ZMD A;  3CPW O;  3HD7 C;  1NU1 K;  5C9M A;  2OYH A;  3CWB D;  2H88 C;  3H1I E;  1W5C T;  4EID A;  5AW0 B;  1D7M A;  3CXH H;  4PJ0 E;  3RL0 C;  1FE6 A;  1EXI A;  4IL6 X;  2AI5 A;  1RQV A;  1VQN P;  5CIC B;  1YJW P;  4FAV A;  3H1J J;  2W27 A;  5AVQ B;  1N2D C;  2OZ1 A;  2Z4E A;  4L3H A;  4UB6 V;  5KAI E;  1UIX A;  1VPC A;  2ZXX A;  2C1D B;  2Y0D A;  1NKN A;  1JUN A;  4L76 A;  3I56 P;  1L4A D;  1HCM A;  2QEX P;  2NPS A;  1H31 A;  3VNW A;  1C6O A;  3H1J D;  4RJT A;  1C2N A;  1NTM E;  2JWA A;  2ZT9 D;  1IK7 A;  2IFN A;  3CCJ P;  1M1J C;  1SQV E;  4IFF A;  1HTL C;  2WWW A;  1MZ4 A;  3WUV A;  4EYY Q;  1NU1 G;  1CIE A;  2O1K A;  1YHQ P;  5GTI E;  1OMI A;  2IFM A;  3BAT A;  3M0A A;  4C7N A;  1KQG B;  1IFI A;  2YO3 A;  3H1L G;  3OA8 B;  2C9X B;  3M0D A;  3L70 G;  3G71 P;  3AEC C;  4U3F G;  1EC5 A;  1NU1 E;  1VQK P;  3RGU A;  4BRY A;  1NTZ K;  2JJL A;  5DJT B;  3RK3 C;  5AVZ B;  1KB9 E;  3U1C A;  2K88 A;  1M90 Q;  1PZQ A;  3AEG C;  4OGQ B;  1VQL P;  3TYY A;  1DEE G;  3CX5 E;  1FDO A;  4FA5 A;  3G3Z A;  4UB6 H;  1I6E A;  3L71 J;  3SVW A;  1AOF A;  2IZ1 A;  1VQ9 P;  3O20 A;  2Z5I A;  3O5C A;  3B4S A;  1M60 A;  1KQF B;  2C9L Y;  3SFD C;  1MZ9 A;  1U7J A;  2C8S A;  1YQ4 C;  2D2C D;  2KOG A;  1PFI A;  3H1I J;  4K35 A;  1PL5 A;  1Y47 A;  3C9I A;  3TF5 A;  4L74 A;  4PV1 B;  5APS A;  1VF5 D;  1YCC A;  1LTT C;  1KC8 Q;  2M0B A;  3L71 D;  1GU4 A;  3USS A;  1T2K D;  3OCD B;  1FS0 E;  4MN4 C;  4AX3 A;  1YTC A;  3A7O A;  4RSZ A;  1IK9 A;  2QJP C;  1G2C A;  3PXS A;  1T3U A;  5KAF E;  2KXP B;  3H1I D;  3HTK B;  2JWD A;  1NTZ G;  3L72 D;  3HE4 A;  5KLV G;  4HYT B;  4WY4 D;  2WSS H;  3RN1 A;  4A7P A;  5AW7 B;  2YKP A;  2B4Z A;  2B87 A;  1NTM J;  4H0L B;  1HH0 A;  1M57 D;  1R0Q A;  2E74 D;  1WMK A;  1LT9 A;  1SQV J;  3A0H E;  1GIW A;  1PP9 E;  2O3J A;  1RF1 C;  5CMZ A;  2HFE D;  4YXD C;  1URQ A;  1H88 A;  1UII A;  2O01 N;  3JSV C;  3WMM 0;  1SQQ K;  1NYH A;  1NTM D;  3A2A A;  1CRC A;  1ZN5 A;  1FCD C;  3Q5S A;  1QVF O;  1CYJ A;  1SQV D;  2FFD B;  1NU1 J;  2H7H A;  3DP5 A;  3FXD A;  2ZYA A;  1FBM A;  1C2R A;  3MGN A;  2WPV B;  1L9J C;  1CI6 B;  2BLF B;  3IF4 A;  3PTZ A;  3KDP B;  4P4Q B;  2KNC A;  1IRV A;  2KZJ A;  3E7K A;  3TK1 A;  3L70 J;  4NPF X;  3P8C E;  4U3F J;  1CHI A;  1HGZ A;  5EXQ A;  3AEB C;  3PXW A;  1RE3 C;  1NU1 D;  1NNO A;  2ZYG A;  5APY A;  4XE5 B;  2FFD C;  5H2F V;  2G3A A;  1M7L A;  2PP6 A;  4WB4 A;  1L4A C;  1OX3 A;  1I55 A;  2WZ7 A;  1HJ4 A;  3RK3 E;  2YIU B;  3S4R A;  1QL1 A;  3CCQ P;  1NMI A;  4PD4 I;  3L4M A;  2OAR A;  1ZP0 C;  3H25 A;  2ZT9 C;  3L70 D;  2C1V A;  3CX5 D;  1LTB C;  4GYD A;  3VMX A;  2HOD A;  4U3F D;  1FOS E;  4GIF A;  4GKG A;  1SQQ G;  2H8P D;  1LGH B;  5BU8 B;  3HD7 A;  1BSH A;  3AE1 C;  2QRX A;  2ZZS 1;  4ZNC A;  2YIU C;  4DCK A;  1OFC X;  1K05 A;  2CPS A;  3W67 A;  1SQP K;  3VMZ A;  3WFE C;  4O9B A;  1GL2 A;  3OA7 A;  2QIW A;  4L1Q A;  4RES B;  4AAL A;  3JCU H;  3WU2 V;  1VQ7 P;  2IPP A;  1H9Y A;  1FI7 A;  1K04 A;  1YNR A;  2FYZ A;  1BCC E;  3MTU E;  1DH3 A;  1JTH B;  2N18 B;  3A0B V;  1SLQ A;  5B5E V;  2Y0E A;  1JY2 P;  1FOS F;  2SPZ A;  1JY3 N;  1EZV G;  2E43 A;  3LW5 J;  5H2F H;  3GG2 A;  1GZL A;  2BH5 X;  1FZF A;  1FC2 C;  2OYI C;  1P84 I;  5CCH D;  2KLV A;  2D2C C;  1LTJ B;  4ASV A;  4WY4 B;  1AFO A;  4K3I A;  2C1D A;  1NTZ D;  1GTW A;  2KUB A;  1FAV A;  1VF5 C;  3KQG A;  3II6 A;  3RLM A;  1CZQ A;  1VDF A;  2AEJ A;  3H6P A;  1EZV E;  4H44 D;  1B7V A;  4WVZ A;  1AVY A;  4UB8 E;  1KIL E;  3P8M C;  2ZXE B;  4EDF A;  1RF0 C;  4JQ0 D;  2V7Q J;  4B86 A;  4JPZ B;  1CHH A;  1SQP G;  3AEA C;  1A02 F;  3ITK A;  3V2R A;  2I8D A;  1RAQ A;  3CXH I;  2WPS A;  3CWB E;  1KTM A;  5AVS B;  1OW7 A;  2KK7 A;  1J1D B;  4WY4 C;  1AQ5 A;  3B5N B;  2WIT A;  4ZKU A;  3CP5 A;  2FYU G;  1J1E C;  4AUW A;  3WU2 H;  1LNQ A;  2IBZ I;  2MJZ A;  2E74 C;  3PLN A;  3OA8 A;  4AAO A;  1PGO A;  3IN6 A;  2CA4 B;  3PJS K;  3ZDM A;  1CRI A;  1S72 P;  1WRG A;  3A0B H;  1RZ5 A;  1LJ2 A;  5B5E H;  1VQ6 P;  3L73 G;  3HQ7 A;  2PRR A;  2QJK B;  1MG2 D;  2XTS B;  3RK3 D;  5E79 V;  2B12 B;  1H89 A;  1K3H A;  3AE9 C;  3HUS B;  3PXT A;  1DW1 A;  1USD A;  1QX8 A;  1SQQ J;  4OWF A;  1YJ9 P;  4PD4 H;  4NPD A;  1DEB A;  1IQC A;  1J2J B;  1ZV8 A;  2AXT V;  2CPB A;  1IFJ A;  2GM4 A;  1PPJ G;  4N0K A;  2W6B A;  4LLH A;  1LWU B;  1QL2 A;  5CJ0 A;  3MK7 B;  1BCC J;  2MHM A;  1OVR A;  1MFT A;  1IO3 A;  3NTN A;  3AE5 C;  2YNY A;  2KZI A;  4JF7 A;  1R8E A;  1FI9 A;  1CNO A;  1A56 A;  1SQQ D;  2FXO A;  4I7Z C;  2DVH A;  1NH4 A;  5IY5 1;  2A06 G;  1ZLL A;  3OCD A;  4L75 A;  2E76 D;  3GF3 A;  1HRC A;  5AVT B;  2QM7 A;  4HH2 A;  1PPJ E;  1H1O A;  3ZBM A;  2C0W A;  2IYO A;  1KB0 A;  3CI9 A;  1BCC D;  2QM8 A;  1U75 B;  3MK7 C;  3HTK A;  5CCG A;  3UIA A;  1ZR4 A;  2OTJ P;  2B89 A;  3FXE A;  2LXB A;  3MUD A;  2I1J A;  2YCC A;  1OXZ A;  1BL9 A;  2E5Y A;  2P1J A;  2XZR A;  2P58 A;  1YIT P;  3M06 A;  1X0T A;  1EDK A;  2FXP A;  4RKU J;  3CWB J;  5B66 E;  4GOD A;  1JO5 A;  2IZ0 A;  5E79 H;  1N7S D;  1X8Y A;  2OGU A;  3RMZ A;  1EZV D;  1KYO I;  2XNX A;  2WSF H;  1KIL D;  1Z56 A;  1PGP A;  4NPE A;  1DIP A;  1SQP J;  1QVG O;  1JDL A;  1M8O B;  2AXT H;  2KYV A;  1RE3 A;  5KKZ C;  2FFD A;  3L72 E;  1RQU A;  2GIW A;  4H44 B;  2KI7 B;  2N9Y B;  1BGY E;  1DVH A;  2DW3 A;  1DW0 A;  1CI6 A;  2IBZ G;  5C39 A;  2R3C A;  1SQP D;  5CCH C;  1R5L A;  4Z1M H;  3U59 A;  3L75 G;  1M1J B;  3KYQ A;  3AED C;  4H0J A;  2FYN B;  1K8A Q;  1CSV A;  3L73 J;  4W80 A;  4H44 C;  1JB0 J;  1SFC D;  2CE1 A;  5CID B;  4V2K A;  1CSB A;  2EXV A;  1FZB A;  3HQ8 A;  1S5L X;  3NMD A;  4EIJ A;  5C0Z A;  3FX0 A;  1GU2 A;  2O1J A;  3NWV A;  1AVO A;  4QMA A;  1F1C A;  3AE2 C;  4O1Q A;  4AYC A;  4R4L A;  5DJQ B;  2HV4 A;  4EIE A;  3V2Q A;  1SQX K;  3PP5 A;  2FYN C;  3L73 D;  351C A;  3RK3 B;  3HQ9 A;  3QWO C;  1YFC A;  2BCC G;  1GW4 A;  1AQT A;  2JDI H;  1YTZ T;  4D6T G;  3ZOO A;  3NBS A;  1VYD A;  2GUV A;  1BSN A;  1AKK A;  2V08 A;  1LT1 A;  2CK3 H;  4LGD E;  2ZXY A;  2VRS A;  5AVX B;  1WEJ F;  5CBO A;  1LS9 A;  5DJQ C;  2XKM A;  2E5T A;  1IZN B;  3SWF A;  5KLV K;  1PPJ D;  1JOC A;  3VP8 A;  2CXB A;  3H1L E;  4DOJ A;  2BEZ F;  3B8E B;  1JTH A;  3L70 E;  1MUU A;  1JEK A;  2HPC B;  2V07 A;  4U3F E;  1QGK B;  3IR9 A;  1KB9 H;  2E76 B;  1VL2 A;  1K3G A;  2A06 D;  5TIS E;  3CX5 H;  1EQ7 A;  2YKQ A;  2QJP B;  1HJ0 A;  1IZL 0;  4W7Z A;  3T97 B;  1N7L A;  1LTJ A;  2Q1K A;  3WFD C;  1SS1 A;  1SQX G;  2BAS A;  2O01 H;  4WY4 A;  3SXT A;  3L72 J;  1YBK A;  1QL4 A;  2VHD A;  3AE4 C;  1BGY J;  1SQB K;  2E76 C;  1P84 D;  2LIT A;  4JCG A;  3S1K A;  3WFC C;  1KYO H;  2D0W A;  1YI2 P;  1HZU A;  4DY9 A;  1MFZ A;  1RF1 B;  4N78 D;  5CIG B;  2W6A A;  3G4S P;  2WSE H;  2A45 I;  2R3S A;  1CRY A;  1FJK A;  3B5N A;  1BGY D;  2KSE A;  3ZOY A;  1LTA C;  1JY3 P;  3RBZ A;  3RN0 A;  1K73 Q;  3VYI A;  3O0R C;  2RMZ A;  3HQ6 A;  1N73 C;  5CIF B;  1ZOY C;  1AYG A;  2KLU A;  3ZCF A;  1N7S C;  1NTZ E;  5KLV E;  2LIR A;  2ZVO B;  4KMG A;  2HLO A;  3FWL A;  2Q9I A;  1L0L K;  3V5B A;  1R5S A;  3D6Y A;  1KIL C;  5BU5 A;  4C46 A;  2IBZ D;  3CCV P;  2NZ2 A;  2R5B A;  1IFP A;  4OH8 B;  1SQB G;  1C6S A;  1DX7 A;  3HUS A;  1OVV A;  3LW5 H;  3CME P;  1DII C;  3M97 X;  1X9V A;  5AVY B;  1SFC B;  1BDD A;  4Y5R A;  1L4A B;  2WSC J;  3L37 A;  2BCC J;  1CED A;  4WQ8 A;  2KS1 B;  3H1L J;  1LWU A;  4N3Y B;  1Q2N A;  1SQB E;  2ZT9 B;  3IFM A;  5CIB B;  3PRJ A;  1IFM A;  4YE1 A;  3BRT B;  2HG5 D;  3FGA D;  4AQR D;  1SFC C;  1FI3 A;  1FOC A;  1RY3 A;  1S4X A;  1HRO A;  1OIP A;  2BCC D;  3CL3 D;  1N90 A;  1E2R A;  3H1L D;  4FA4 A;  4HJG H;  1L0L G;  1CRG A;  3L35 A;  4EI2 A;  3W68 A;  2I1K A;  4GT1 A;  4UB8 V;  2GUS A;  2L4D A;  5AW2 B;  1QLE D;  2KSJ A;  1HH7 A;  1L0L E;  1LTI C;  2WVR A;  2ZBO A;  1W2L A;  1L0N K;  1SQQ E;  4XFJ A;  4AAM A;  2J58 A;  1CTZ A;  3L74 G;  2OQQ A;  4IL6 V;  1OZH A;  3NXS A;  3CD6 P;  2OYO A;  1NML A;  1H0T B;  2OYI B;  2NPS C;  5AVW B;  2D2C B;  1H9X A;  4BXL A;  1K9M Q;  3TGU G;  1KOR A;  1PGQ A;  3JCU E;  1VF5 B;  3NFQ A;  1NTZ J;  4N6J A;  3G9R A;  5AW3 B;  1COR A;  5KLV J;  4QAO A;  4RO0 A;  2P67 A;  1J3S A;  2FYU K;  1NOH A;  3U1A A;  1YIQ A;  3GLM A;  1BE3 G;  2BH4 X;  1NO4 A;  2A45 H;  3TGU E;  2JEE A;  1VQ8 P;  1LP1 B;  1COT A;  3KXD A;  1N86 A;  1M1J A;  1WVE C;  5H2F E;  2N3Y A;  4WQ9 A;  1NAY A;  5CBN A;  3M0D C;  3CXH W;  3L36 A;  5KLV D;  2M3E A;  4I1L A;  4IFD K;  3RK2 D;  2N1T D;  1CSW A;  3CCE P;  1G1J A;  1N15 A;  1M70 A;  5TJH A;  3CC2 P;  1J1E B;  2Y0C A;  1QYZ A;  4WBA A;  3MP7 B;  1JMM A;  1SQB J;  2E74 B;  1Q81 Q;  1FZC B;  4XYD B;  1L0N G;  4Y99 C;  4HKZ H;  3BCC G;  3KZI V;  4UB8 H;  1IFN A;  3H1K G;  2DGE A;  2E75 D;  4C7R A;  1HBW A;  1HGV A;  1VQ4 P;  4K3A A;  3D70 A;  3L4F A;  4L73 A;  2M5A B;  2IDB A;  4IL6 H;  451C A;  1GK6 A;  3MIW A;  1CYI A;  1SQP E;  1SQB D;  3BCC E;  1FZC C;  2PFX A;  3H1K E;  4H13 D;  4TLF A;  2LKM A;  1ZXG A;  2J5U A;  2YXQ B;  5CIH B;  1DT1 A;  2N9J A;  2HR3 A;  1NHL A;  1DW3 A;  1S5L E;  3N4X A;  3MD0 A;  2YKO A;  4EIC A;  1OW6 A;  2FY8 A;  2FYU E;  3CYT I;  2YO2 A;  1I5T A;  1HUC A;  4GOE A;  2K9Y A;  5L8R J;  1L0L J;  2FKW B;  1CRJ A;  1CSU A;  4I7Z B;  2KP8 A;  2HPC A;  1IC2 A;  5B66 V;  3V4Q A;  1JY3 O;  1CW5 A;  3L73 E;  3CC7 P;  1M56 D;  4PD4 E;  1FDM A;  2IX7 C;  3T97 A;  4LJI A;  2W90 A;  1HF9 A;  1L0L D;  1DD3 A;  1S9K E;  1LT9 C;  2BPB B;  3KZI H;  4DJG A;  1AV1 A;  1VQ5 P;  2ZVN B;  4JYC A;  1FZA A;  1NJI Q;  5APW A;  4PJ0 V;  1HVV A;  4XXL A;  1EB7 A;  4FA9 A;  3TGU J;  3D0W A;  3JBT B;  1KB9 I;  1RF1 A;  2W83 C;  3EFF K;  5KJ7 D;  1I8O A;  2AIU A;  2I8F A;  4WQB A;  1W5C E;  1PIX A;  3MHV A;  1CRH A;  3GHG B;  3ZIY A;  1CTY A;  1DIQ C;  4WQA A;  5KAI V;  1GMJ A;  3CX5 I;  3IAO A;  5K5G B;  2ZFC A;  2Q7C A;  2A06 E;  5AW9 B;  3A5T A;  2W6J H;  2Q3E A;  3CCS P;  1KYO W;  2KIK A;  4EOT A;  1M6Z A;  5GTH E;  3H32 B;  4WQE A;  3SFE C;  5CJ4 A;  3TGU D;  2WPQ A;  3RL0 g;  2YMY A;  5KKZ B;  1XTG B;  2H89 C;  2JR8 A;  2RKL A;  2ZYD A;  2R44 A;  4PV1 D;  3O6Q B;  1FU1 A;  2PAJ A;  4DZO A;  1QKS A;  3B71 A;  3L71 G;  3GHG C;  1QEX A;  3HE5 B;  5B66 H;  1P84 E;  2QJY C;  3CC4 P;  3FWN A;  5APU A;  1F1F A;  1RAP A;  5GTI V;  3BCC J;  2K37 A;  1VQO P;  1H32 B;  2K9J B;  3H1K J;  2N3B A;  1G1I A;  1OVU A;  3H1I G;  2Q5U A;  3O8Z A;  3RK2 B;  1CSX A;  4N78 E;  4TT3 H;  2N1T B;  1W2B O;  1LC2 A;  5CCG D;  2FBW C;  1SFC A;  1KIB A;  1Q86 Q;  1L4A A;  4J20 A;  3X39 A;  1ZR2 A;  3JC2 2;  3A3Y B;  3AE6 C;  5KLI C;  1I54 A;  3CXH E;  2FYU J;  2KS1 A;  2PCC B;  1VQP P;  1L0N D;  1Y8A A;  2NRG A;  1S6V B;  4H0L D;  4PJ0 H;  3BCC D;  1KMI Z;  4I2L C;  2E75 B;  3H1K D;  3A9F A;  4JYB A;  3WC8 A;  1CXC A;  3RBX A;  3RK2 C;  5B6Q A;  2N1T C;  1GU5 A;  1C6R A;  5CIE B;  5APV A;  3F89 A;  3CCL P;  1IO4 A;  1GL2 C;  2Y9Y A;  2H43 A;  5KAI H;  1E29 A;  2IBZ E;  2HYN A;  2QSI A;  3PHL A;  2FYU D;  5TIS V;  1NTM G;  2R5D A;  5DFS A;  3L75 E;  4H13 B;  1TU3 F;  1DD4 A;  1JCC A;  1SQV G;  2ZAE B;  1AA0 A;  2E75 C;  1JY2 O;  1CIH A;  2YXR B;  1XTC C;  1RZ6 A;  3ZOX A;  5AUR A;  4PD4 D;  3SLE A;  3I5C A;  1KFM A;  3EFG A;  3WUT A;  1W2E A;  4MU8 A;  3AE7 C;  3DR0 A;  2WQY C;  3M9Q A;  5GTI H;  1KN7 A;  1GJQ A;  4H13 C;  4M3L A;  1S9K D;  3O1Y A;  4HB1 A;  1OAE A;  2K1A A;  4GDO A;  3EQ2 A;  5KAF V;  2QVA A;  3LIE A;  4Y28 J;  4CPG A;  1H0T A;  2OYI A;  2QG4 A;  4WQD A;  3F5H A;  1KX7 A;  2NPS D;  2BCC E;  5AW5 B;  3WUU A;  3BVH A;  4D6T E;  1T3J A;  1T8Z A;  3VMA A;  4JBZ A;  2WSC H;  1I6D A;  1GQ1 A;  1NAF A;  1KX2 A;  3VOP A;  1LFM A;  1T6A A;  1A2S A;  3R2P A;  3M9B A;  3A0H V;  1CTJ A;  1EDL A;  1RF0 A;  3LID A;  4UB6 E;  2JO1 A;  2WSF J;  1LP1 A;  5APT A;  2XU6 A;  3SWK A;  4R4M A;  2L91 A;  5TIS H;  2M3B A;  2E42 A;  3V4W A;  3SWY A;  2BGV X;  1MV8 A;  1HJB A;  1CCH A;  5KTB A;  3Q5R A;  3OJA B;  1JM0 A;  2JP3 A;  4KT0 J;  1HWT C;  1N73 B;  3TNU B;  3D71 A;  5AW6 B;  4ZKP A;  1FZC A;  1CCR A;  2C0X A;  3VTP C;  1H8A A;  1SQX E;  4OGQ C;  3AEE C;  1N7S B;  5CYT R;  1FDI A;  5KJ7 C;  1KYO E;  155C A;  2N9B A;  5CHX A;  1KD1 Q;  2YMK A;  1KIL B;  1NWQ A;  5KAF H;  3SJL A;  2M5A A;  3AE3 C;  1YEA A;  3CXH D;  4WQC A;  1OWA A;  1USE A;  2WT7 B;  5AVR B;  1KV4 A;  1IFD A;  3L75 J;  3P32 A;  2V4H A;  1N8R Q;  1AJY A;  4YPC A;  1RHZ B;  2PAC A;  3CCM P;  1PP9 G;  3N7N A;  2JQR A;  4PV1 C;  3GF7 A;  4GED B;  1OCD A;  1S2E A;  4KHX A;  3WUI A;  3C8V A;  1EZV I;  3VRD A;  3A0H H;  1Q82 Q;  4WWI A;  1H33 B;  1RE4 C;  1X22 A;  1IRW A;  3P7K A;  3L75 D;  1NKZ B;  3MZW B;  1ZZH A;  1KQS O;  1IJD B;  5CCG C;  1OW8 A;  2YQB A;  4IFM A;  3M9H A;  3KPE A;  3MUD C;  3B5N D;  3D6Z A;  1HZV A;  1ETP A;  2IYP A;  5AVU B;  1AOQ A;  2ZON G;  2M8R A;  1EDI A;  2D0S A;  4D6T J;  4I6M C;  1L2P A;  4H0L C;  2BCN B;  3GW6 A;  2OYH B;  1N9C A;  3PH2 B;  1MG3 D;  4KJM A;  1VQM P;  2C9N Y;  5M1B A; 
#chains in the Genus database with same CATH homology
 2DGE A;  2PCB B;  1CHJ A;  2YK3 A;  2OZ1 B;  4FA5 A;  3RMZ A;  1EZV D;  4D6T D;  1CYC A;  1I6E A;  451C A;  3SVW A;  1KV9 A;  1CYI A;  1SQB D;  1QN2 A;  1NIR A;  1A8C A;  1AOF A;  3CU4 A;  3O20 A;  4Q5P A;  1JDL A;  3O5C A;  1M60 A;  1CIF A;  3TDK A;  2C8S A;  5CIH B;  1DT1 A;  1H31 B;  1KB9 D;  2N9J A;  4WQ7 A;  4FB1 A;  2CA3 B;  2GIW A;  1DW3 A;  3TF5 A;  2N9Y B;  3TYI A;  4EIC A;  1YCC A;  1DVH A;  1YIC A;  3CYT I;  4O1W A;  1I5T A;  1DW0 A;  3L71 D;  3OCD B;  1CRJ A;  1SQP D;  4AX3 A;  1CSU A;  1YTC A;  4RSZ A;  2N9I A;  5B66 V;  2B0Z B;  1DVV A;  4H0J A;  1U74 B;  3PXS A;  2FYN B;  3H1I D;  1CSV A;  3L72 D;  1H32 A;  1SQX D;  2CE1 A;  5CID B;  4V2K A;  4LJI A;  2RN0 A;  2EXV A;  3HQ8 A;  2GC7 D;  1KYO D;  1C52 A;  5C0Z A;  1L0L D;  1N50 A;  3RN1 A;  1GU2 A;  4A7P A;  3NWV A;  2B4Z A;  2C1U A;  2BPB B;  1F1C A;  1YEB A;  4PW9 B;  1R0Q A;  4O1Q A;  3DMI A;  4NFG B;  5DJQ B;  1S5L V;  2HV4 A;  4EIE A;  1FHB A;  1GIW A;  2O3J A;  4PJ0 V;  4XXL A;  3L73 D;  1EB7 A;  4FA9 A;  351C A;  3HQ9 A;  2GC4 D;  3JBT B;  1YFC A;  3SWS A;  1I8O A;  2AIU A;  2I8F A;  4AAN A;  4WQB A;  1CRH A;  3ZOO A;  3NBS A;  3ZIY A;  1CTY A;  1DIQ C;  1HJ5 A;  4WQA A;  1LC1 A;  1VYD A;  1NTM D;  5KAI V;  1CRC A;  1AKK A;  2V08 A;  2ZXY A;  1FCD C;  2Q3E A;  1CYJ A;  1SQV D;  2JTI B;  1WEJ F;  1CO6 A;  1KYO W;  1LS9 A;  5DJQ C;  1M6Z A;  3DP5 A;  4WQE A;  1PP9 D;  3TGU D;  3VYM A;  1C2R A;  3KHU A;  1PPJ D;  5KKZ B;  2N18 C;  2CXB A;  1L9J C;  2BLF B;  1CC5 A;  3ORV A;  4PWA A;  3PTZ A;  1QKS A;  4P4Q B;  1IRV A;  2V07 A;  1HJ3 A;  1K3G A;  1CHI A;  2A06 D;  5EXQ A;  1F1F A;  1RAP A;  5GTI V;  3PXW A;  1NU1 D;  1NNO A;  5H2F V;  1H32 B;  2K9J B;  2N3B A;  2QJP B;  1IZL 0;  1I55 A;  1CSX A;  1FJ0 A;  3WFD C;  4EIF A;  1E8E A;  1HJ4 A;  1LC2 A;  2YIU B;  3SXT A;  1GKS A;  1KIB A;  1LMS A;  1NMI A;  4J20 A;  3L4M A;  1QL4 A;  2VHD A;  3X39 A;  2FWL A;  3L70 D;  2C1V A;  1I54 A;  3CX5 D;  4GYD A;  4U3F D;  4FAN A;  2KS1 A;  2PCC B;  1P84 D;  2LIT A;  5GTH V;  1L0N D;  4JCG A;  1S6V B;  2B11 B;  3BCC D;  3WFC C;  2C2C A;  3H1K D;  2D0W A;  3A9F A;  1GDV A;  1HZU A;  4DY9 A;  3WC8 A;  1CXC A;  5B6Q A;  2ZZS 1;  1C6R A;  5CIG B;  5CIE B;  2ORL A;  2CE0 A;  4L3G A;  1CRY A;  1E29 A;  1BGY D;  3ZOY A;  3PHL A;  3RN0 A;  2FYU D;  5TIS V;  3WFE C;  3O0R C;  2RMZ A;  5DFS A;  3HQ6 A;  4L1Q A;  5CIF B;  4AAL A;  3WU2 V;  4FA1 A;  3L4O A;  1AYG A;  3ZCF A;  1H9Y A;  1FI7 A;  2ZOO A;  3CX5 W;  2GB8 B;  1YNR A;  1DW2 A;  1CIH A;  2LIR A;  1ZRT D;  4KMG A;  3H1H D;  5DF5 A;  1RZ6 A;  3ZOX A;  3FWL A;  2N18 B;  3A0B V;  4PD4 D;  3SLE A;  5AUR A;  1I8P A;  2KNC B;  5B5E V;  2Y0E A;  3NBT A;  3C2C A;  1C7M A;  2IBZ D;  4MU8 A;  2B10 B;  3DR0 A;  1C75 A;  1GJQ A;  3L74 D;  1C6S A;  3GG2 A;  1CIG A;  3O1Y A;  2BH5 X;  2QJY B;  1OAE A;  5KAF V;  1DII C;  3M97 X;  2MTA C;  4K3I A;  2C1D A;  1NTZ D;  4Y5R A;  2QG4 A;  3RLM A;  4WQD A;  1KX7 A;  1CXA A;  3ZOW A;  1CED A;  1NTK D;  1B7V A;  4WQ8 A;  3VMA A;  4EDF A;  1I6D A;  5KLI B;  1GQ1 A;  5CIB B;  1KX2 A;  3PRJ A;  1LFM A;  1CHH A;  1A2S A;  1BE3 D;  3ITK A;  3A0H V;  1RAQ A;  1CTJ A;  4YE1 A;  4H0K A;  1H33 A;  1FI3 A;  1FOC A;  1HRO A;  1L9B C;  2BCC D;  2FRC A;  3WFB C;  2L91 A;  1N90 A;  1E2R A;  1QL3 A;  3H1L D;  4FA4 A;  2BGV X;  3CP5 A;  1CCH A;  1CRG A;  3PLN A;  3OA8 A;  4AAO A;  5C9M A;  2CA4 B;  3CWB D;  1CRI A;  1CCR A;  1W5C T;  4EID A;  1RZ5 A;  5CYT R;  4UB8 V;  3HQ7 A;  2L4D A;  2AI5 A;  1MG2 D;  2QJK B;  2XTS B;  155C A;  1HH7 A;  5CIC B;  5E79 V;  2B12 B;  4FAV A;  2ZBO A;  1K3H A;  1W2L A;  3PXT A;  2OZ1 A;  1DW1 A;  4AAM A;  1CTZ A;  3SJL A;  1YEA A;  4L3H A;  3CXH D;  4UB6 V;  4WQC A;  4IL6 V;  1NML A;  2C1D B;  1IQC A;  2Y0D A;  1H9X A;  2PAC A;  2AXT V;  2JQR A;  4N0K A;  1HCM A;  3MK7 B;  4GED B;  1COR A;  1H31 A;  2MHM A;  1C6O A;  4QAO A;  3H1J D;  3VNW A;  1IO3 A;  4RJT A;  1OCD A;  1J3S A;  1C2N A;  1FI9 A;  1CNO A;  3WUI A;  3VRD A;  1A56 A;  1SQQ D;  2JWA A;  2DVH A;  1YIQ A;  2BH4 X;  5IY5 1;  1H33 B;  1IRW A;  3OCD A;  1MZ4 A;  3L75 D;  1ZZH A;  1CIE A;  1HRC A;  1H1O A;  1COT A;  1WVE C;  3ZBM A;  2N3Y A;  4WQ9 A;  2YQB A;  3CXH W;  1KB0 A;  5KLV D;  1BCC D;  1U75 B;  3MK7 C;  1HZV A;  1CSW A;  1ETP A;  1AOQ A;  3OA8 B;  1N15 A;  2C9X B;  2ZON G;  1M70 A;  2D0S A;  5TJH A;  2YCC A;  2BCN B;  3GW6 A;  2Y0C A;  1QYZ A;  1BL9 A;  1N9C A;  4XYD B;  3PH2 B;  1MG3 D;  3KZI V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...