3L71D

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 74
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l71D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l71D02
3SVWA 1A8CA 3SLEA 3M97X 4FA5A 5CIFB 2QJYB 1FOCA 1YNRA 2CE1A 3OCDB 1NTMD 2N3BA 2FRCA 3L72D 1K3GA 5CIBB 1LMSA 5KLIB 1GU2A 1C2NA 1FI9A 2RN0A 1RAQA 2ZXYA 5B5EV 1IZL0 2EXVA 1B7VA 1I54A 2I8FA 3H1KD 3L75D 4EIFA 3ZOWA 4PJ0V 4A7PA 1C6SA 1QN2A 5CIDB 1WEJF 3L73D 3NBTA 2B4ZA 3H1JD 1C6RA 4AX3A 3WUIA 3HQ7A 3TDKA 2JWAA 2N9JA 4JCGA 5H2FV 1CIFA 1CRIA 1I8OA 5C0ZA 2N18B 2VHDA 1ETPA 1C7MA 1QKSA 2KS1A 2QJPB 3PLNA 2ZOOA 1N9CA 2C1DA 4NFGB 4O1QA 2GC7D 2B11B 4H0JA 2BPBB 4MU8A 5KKZB 1R0QA 2FWLA 1KX7A 3DMIA 4PW9B 1CRHA 3VRDA 1F1FA 5TJHA 5B66V 2C9XB 2GIWA 3CWBD 3CP5A 1DW3A 1DVHA 1CYIA 3ZOOA 4K3IA 1HJ5A 2AXTV 3PTZA 2PACA 1NIRA 1CNOA 1H33B 2LIRA 5EXQA 3SXTA 4FA1A 2N9YB 2MTAC 3OA8B 3RN0A 1LS9A 3O20A 1DVVA 1HH7A 2B10B 4WQ9A 1HRCA 4J20A 3ZIYA 1MG2D 4FA4A 3L74D 1GDVA 5KAFV 1L0LD 3WU2V 1YEBA 4GEDB 1CEDA 1H31A 5DJQC 1BL9A 1I55A 3SJLA 3WFCC 2L91A 1C75A 2LITA 1FI7A 1YTCA 1FHBA 2BH5X 4XXLA 1CXAA 3PHLA 3VMAA 1A2SA 2OZ1B 451CA 3CXHD 4P4QB 2CA3B 1E29A 1CIHA 3WC8A 3TGUD 4Q5PA 2YQBA 1CC5A 4L1QA 4AAOA 1GJQA 351CA 1K3HA 1YICA 1L9JC 1IRVA 1H32B 4DY9A 1HJ4A 2A06D 2C2CA 4PWAA 1BCCD 1LC1A 5TISV 4RSZA 4GYDA 4LJIA 2BCNB 1I5TA 2QJKB 1CHHA 1IQCA 4EIEA 1CHJA 2N18C 4FAVA 3WFEC 1U74B 4D6TD 5CIHB 2B0ZB 3HQ8A 3ORVA 1LC2A 1IRWA 2O3JA 4RJTA 1CYJA 1I6DA 2DGEA 1M70A 1N15A 3L71D 2V07A 1DW2A 4AANA 1N90A 3RN1A 5B6QA 1CRYA 1EZVD 2ZBOA 1YIQA 3MK7B 5CIGB 1GQ1A 1NMLA 2FYNB 3O1YA 4XYDB 1H9YA 1A56A 1KV9A 1OAEA 5IY51 5AURA 1CCHA 1CYCA 3A0HV 2V08A 1U75B 1DT1A 2KNCB 1YCCA 1CTZA 3PXSA 1CRJA 2ZZS1 3VYMA 3JBTB 155CA 3FWLA 2CE0A 1DW1A 2YCCA 1NNOA 4WQ7A 3HQ6A 1HCMA 1SQVD 1W5CT 1CSWA 1RAPA 3PH2B 5GTHV 3PXTA 3KHUA 1SQXD 3TYIA 2PCCB 3CX5D 4WQ8A 1AOQA 1FJ0A 1CSVA 4IL6V 2BH4X 1AYGA 1DIQC 3C2CA 2C1DB 1RZ5A 3ZOYA 3TF5A 5DFSA 1HZVA 3OCDA 2HV4A 1VYDA 2JTIB 3GW6A 4FANA 2RMZA 3L70D 1BGYD 1C52A 5DF5A 1ZRTD 4EIDA 4FA9A 1CTJA 1H9XA 4EICA 4WQDA 2CA4B 3GG2A 2B12B 5C9MA 4UB6V 5CYTR 1FI3A 1SQQD 1H1OA 4N0KA 5E79V 2K9JB 1CXCA 4FB1A 1QL3A 1OCDA 3VNWA 3CX5W 1YFCA 1QL4A 1DIIC 2Y0CA 4WQAA 3H1LD 1E8EA 1GIWA 1KX2A 2GB8B 3CYTI 1NTZD 1WVEC 1CRCA 1MG3D 1H31B 2BGVX 1EB7A 3A9FA 4WQEA 1J3SA 4YE1A 1CTYA 2AI5A 3H1HD 1HZUA 1LFMA 3L4MA 1CRGA 1CIGA 3CXHW 1HJ3A 2YIUB 3SWSA 1CO6A 1KB9D 1NTKD 2PCBB 4L3GA 2QG4A 3WFBC 2FYUD 4QAOA 2N3YA 3O0RC 2C1VA 1H33A 4AAMA 1FCDC 2MHMA 2JQRA 1CORA 1JDLA 3MK7C 1P84D 2D0SA 2AIUA 3H1ID 3DP5A 1MZ4A 1CSXA 1PP9D 3OA8A 1QYZA 4V2KA 4Y5RA 4PD4D 1C6OA 1M6ZA 1KB0A 4EDFA 1CCRA 1HROA 3HQ9A 5KAIV 1IO3A 1CHIA 1NU1D 2Y0DA 1AKKA 1KYOD 2N9IA 1C2RA 3WFDC 1YEAA 2L4DA 2YK3A 4H0KA 2DVHA 3PXWA 1L9BC 1W2LA 1BE3D 5GTIV 1DW0A 1AOFA 1F1CA 2Y0EA 5CIEB 1RZ6A 2D0WA 1S5LV 2OZ1A 4KMGA 4L3HA 3CU4A 3BCCD 4AALA 3PRJA 2C8SA 1KIBA 1SQBD 2ORLA 3NWVA 2BLFB 3DR0A 2Q3EA 2IBZD 3X39A 1GKSA 3A0BV 3RMZA 3ZCFA 1M60A 4WQBA 3L4OA 3RLMA 3KZIV 1E2RA 1PPJD 1L0ND 1ZZHA 3ITKA 1I6EA 5KLVD 2BCCD 1CIEA 1KYOW 1H32A 4UB8V 3ZBMA 1S6VB 1NMIA 1I8PA 3O5CA 3ZOXA 2GC4D 2C1UA 5DJQB 4O1WA 3NBSA 1COTA 4U3FD 5CICB 2ZONG 4WQCA 1SQPD 1CSUA 2CXBA 1N50A 2XTSB
chains in the Genus database with same CATH superfamily
3CX5E 2WSFJ 3SVWA 3S4RA 1JOCA 5C39A 2QJYB 3IR9A 1YNRA 1AQ5A 1K3GA 1Q7YQ 5KLIB 1GU2A 4KHXA 1YQ4C 5AVTB 2YIUC 3TNUB 2ZXYA 5B5EV 2B9BA 2EXVA 2BCCE 4LGDE 5B5EE 4WVZA 4BWNA 3L75D 4EIFA 1GU5A 3N7NA 2IBZI 1LTBC 5TISE 4A7PA 3G71P 2FFDB 5CIDB 3L36A 3D0WA 3FGAD 3L73D 1NYHA 2B4ZA 3H1JD 1C6RA 3B5ND 2M5AB 2E75C 1SQPJ 2KP8A 2D2CD 4JCGA 1H0TB 1C7MA 2E76D 1KILD 1FZCA 3P8CE 2QJPB 2QIWA 3H1KG 1SFCB 1N9CA 1NTMJ 1SS1A 1VQ7P 2GC7D 1GZLA 4H0JA 3L72J 3H1HE 1X0TA 5H2FH 2BPBB 4MU8A 4TLFA 2KXPB 2M3EA 1PV3A 1LTAC 2FYZA 1F1FA 1T8ZA 2WSEJ 3G6EP 2GIWA 2GA1A 2FYUE 1NU1G 1DD3A 4K3IA 1NIRA 1OX3A 2PP6A 5APQA 3B8EB 3SWKA 5EXQA 2PFXA 3HTKA 3SXTA 1NU1K 5BU5A 2YXQB 3OA8B 1KB9H 3A7OA 3H1IE 3O20A 5KJ7D 1DVVA 1ZMEC 3CPWO 4WQ9A 1HRCA 2ZYAA 4J20A 3ZIYA 4JYBA 1RE4A 1MG2D 1ZOYC 4FA4A 1M1JB 3L74D 1OVRA 1GL2B 3BRVB 1CEDA 2QA4P 2WT7B 1I55A 3W68A 2L91A 1CZQA 2GUSA 1DH3A 3JSVC 2LITA 1FI7A 2C9NY 1YTCA 1ZN5A 3WU2H 1A2SA 3C8VA 5KLVG 3Q2YA 2QJYC 2CA3B 1HBWA 4Q5PA 5KLVK 2YQBA 2R3SA 5KLIC 1JM0A 2Z4EA 3FXEA 1IJDB 4UB6E 3TK1A 3A5TA 3CX5H 5BU8B 1PPJE 3F5HA 3I56P 2OGUA 1HJ4A 1XTGB 4PWAA 1BCCD 2FFDC 2WSCJ 4GOFA 3TSIA 2R44A 1CHHA 3FXDA 3M06A 5B5EH 4U3FE 4EIEA 3BATA 4FAVA 1FBMA 3CX5I 1FZFA 5TISH 4D6TD 1T3UA 1JMBA 1T6AA 2QJPC 3B5NA 3V2NA 1SFCC 1ZW0A 1S72P 2UWJE 2O3JA 1N2DC 4PV1D 2B87B 2OYIA 3AECC 1DW2A 4AANA 1HJ0A 1N90A 1KILA 2WZ7A 2ZBOA 1IK9A 1GQ1A 1G2CA 2B88A 2IYOA 1H9YA 5CCGD 1MFZA 1LTJA 3CXHI 1YITP 2LKMA 1DT1A 2KLUA 4GT1A 1VQ6P 1CTZA 3L75E 2JDIH 1N73A 1FC2C 3D71A 2R5BA 155CA 5M1BA 2CE0A 3CL3D 3L73E 3H1JE 2YCCA 1NNOA 2ZVNB 1HCMA 1W5CT 2K9YA 1NAFA 1M1JC 3PH2B 4HH2A 1GL2C 3TYIA 2YKQA 1S5LE 5KJ7A 1KILE 4I7ZB 1DIQC 1YBKA 3C2CA 1RZ5A 3RL0D 3H32B 1HZVA 3OCDA 2FXPA 4RO0A 1VYDA 2WQYC 1K73Q 3GW6A 1YQ3C 5AVRB 1JY2O 3L70D 3MP7B 1C52A 1IFPA 1ZRTD 1AJYA 2H43A 3E1IA 2XU6A 1FZBA 1MV8A 1EDJA 1L0LG 5C9MA 1EC5A 1OVVA 1EZVI 1L0LK 1H1OA 1MFTA 5E79V 2K9JB 1CXCA 5AW5B 1LT1A 1KFMA 1M57D 5E79E 1DIIC 3H1LD 2ZVOB 1GIWA 5AVZB 1RE3A 2Q3IA 3B4SA 3CYTI 4UB6H 3L74E 3AE5C 1JY2N 1CRCA 1MG3D 1FDOA 1ZR2A 4YE1A 2XZRA 3RGUA 3MGNA 3CCQP 2GM4A 2KI7B 5AVSB 3TYYA 3A3YB 3ZDMA 4N78D 1HJ3A 3SWSA 3Q5SA 1KB9D 3IN6A 4DCKA 1IC2A 1LTIC 4QAOA 3TGUJ 2C1VA 1H33A 4JYCA 2ZAEB 1P84D 2D0SA 2AIUA 2E5YA 2I1JA 2YMYA 4RKUJ 1QYZA 4V2KA 4YTPC 3E7KA 1C6OA 2C0WA 1S9KD 1CHIA 4AUWA 4H13B 1NU1D 3PP5A 1BCCE 2Y0DA 2N9IA 1C2RA 1UIIA 1W2BO 2P58A 3HE5B 1AVYA 3H1HJ 5CCGA 3CCJP 1R5LA 1D7MA 4WBAA 3PXWA 4EI2A 3L71G 1W2LA 2G8YA 4WWIA 3KDPB 3KXDA 2D0WA 3KQGA 4I1LA 2OZ1A 4D6TE 4I7ZC 2FYUJ 4L3HA 5AW9B 1K8AQ 1T3JA 2KS1B 4AALA 2ORLA 2BLFB 3U1AA 2WTYA 3M9BA 3MUDA 1GW3A 5GTIH 3ZCFA 3H1IJ 1M60A 3GHGA 3AE6C 3RLMA 1S5LH 1HF9A 2ZFCA 1PGPA 1ZZHA 3FX0A 5KLVD 1SQVG 2BCCD 2Q1KA 1KYOW 3SWFA 4UB8V 3ZBMA 1S6VB 1SQXG 2WMMA 1SQVK 3BCCG 2QEXP 1SQXK 1PGOA 4Y28J 2DW3A 1AVOA 3IFMA 1N7LA 2FBWC 2WITA 2YXRB 1BGYG 1N50A 2XTSB 3AE7C 3L35A 3M9QA 5AVWB 3G3ZA 3SLEA 4H0LB 3CCMP 5E79H 1JO5A 3II6A 2E75D 2FRCA 1Y47A 1JNMA 1C2NA 2YO3A 2O01H 1FI9A 1YJNP 3L70E 1RAQA 4CPGA 1ZRTE 1B7VA 2KNCA 3VTPC 1YI2P 1RF0A 3MIWA 1QN2A 3OW2O 1DX7A 4U3FJ 2HFED 3L72G 3FWNA 4AX3A 3QWOC 3TDKA 3QH9A 1G1JA 5H2FV 4H13C 3HE4A 3H1LE 3U59A 5AVQB 2KS1A 1NTKG 1USEA 1PIXA 2ZOOA 2C1DA 4NFGB 4L73A 5L8RJ 3BRTB 1NTKK 5CCHC 5KKZB 1E79H 1PZQA 2JWDA 1HGZA 1PP9G 1KX7A 3AE3C 2OYHA 3VRDA 3R2PA 3A2AA 4N78E 3VMYA 2C9XB 4WY4B 3CP5A 1KB9E 3L75J 1CYIA 5AW6B 1MZ9A 4MN4C 3L73J 3H1JJ 2HYNA 1P84E 1SP4A 1KC8Q 1BE3G 1VQPP 1WRGA 2XNXA 3EFFK 4I2LC 5APXA 1S9KE 1GDVA 1L0LD 3B71A 3WU2V 1YTZT 1NU1E 4GEDB 2E74B 2MJZA 1EXJA 3O6QA 1BL9A 1VDFA 1ZLLA 2KUBA 4XA4A 5AVXB 2IBZG 1LTSC 3VMAA 2K37A 1YTZI 2J59M 2HPCB 1RF1B 3USSA 3D6ZA 3S1KA 2FKWB 1VQNP 4H0LC 2R5DA 2JR8A 1CIHA 1JTHB 5CJ0A 3EFGA 1GJQA 4NPEA 1L0NJ 2M0BA 1SFCD 1L9JC 4W7YA 2O01J 3L74J 1FZGA 5KLVE 3AE4C 1A02F 2E43A 2C2CA 1LC1A 5TISV 4RSZA 4Y99B 2A45H 1SVFA 3BVHA 3CCEP 1CI6B 3BASA 3SSUA 4ZKPA 3KYQA 5APYA 1IQCA 4IFDK 2KLVA 1U74B 2B0ZB 1LGHB 3HQ8A 3ORVA 1IRWA 3T97B 2CPSA 1I6DA 1N15A 3L71D 1IFDA 4KT0J 5KKZC 4IOIH 3RN1A 2J5UA 4HKZH 1GL2D 5CIGB 2JJLA 1KV9A 5AURA 3V4QA 4WY4C 1CYCA 1KV4A 2V08A 1OXZA 4YXDC 1BCCJ 5KAIE 1YYCA 1X22A 2QRXA 3HD7B 1OW7A 1S2EA 1L4AB 4JF7A 1VL2A 1FJPA 1CW5A 1CRJA 2Q9IA 3JBTB 2B89A 2IX7C 4NPDA 4GODA 3HUSB 1KMIZ 1SQVD 4D6TJ 1CSWA 1IFNA 4XFJA 3PXTA 2M8RA 1SQXD 3MTUE 4IL6V 2WSSH 1N8RQ 2NPSB 1P84H 3CWBG 4IL6E 3ZOYA 2WWWA 1IK7A 2JTIB 2R32A 4FANA 1M8OB 1BGYD 2IPPA 1RF1C 1KB9I 1Q81Q 3TNUA 3PJSK 4EICA 1LWUB 2B12B 1EDLA 2L5GB 5K5GB 1P84I 4UB6V 5CYTR 1FI3A 1UIXA 2FFDA 1OMIA 2OTKE 4N0KA 4FB1A 3M0DC 1QL3A 3U1CA 1X8YA 2M5AA 3VNWA 1E8EA 2W27A 2QM7A 1KFNA 1H0TA 1KX2A 4Y99C 2LXBA 1NTZD 4JBZA 1L0LE 1H31B 1R5SA 1EB7A 3AE2C 3IAOA 1CTYA 1SFCA 3CCLP 2AI5A 3TGUG 1JCCA 1HZUA 3L70J 2N9BA 2I8DA 1LTGC 3V2PA 3OAKA 1JY3N 2E42A 3AEEC 3GF3A 4OGQB 1NTKD 4L3GA 2QG4A 4GDOA 3WFBC 1VQ8P 4QMAA 2FXOA 2KK7A 5KTBA 2KOGA 3O0RC 3H1HG 2JQRA 1JDLA 3I55P 1CSXA 1PP9D 3OA8A 1RQVA 3MZWB 4IFMA 3H1LJ 1M6ZA 1CCRA 1HROA 3HQ9A 3AEGC 3G9RA 3HD7C 1M1JA 1L4AC 1GL2A 2FYUG 1KYOD 1LP1B 3LIDA 2YK3A 2WT7A 3HUSC 3V5BA 2FYUK 1KZUB 1M56D 1BE3D 5GTIV 5KAIH 2Y0EA 1EZVG 2ZYDA 5CIEB 1QVGO 5GTIE 3AEAC 4ASWA 1S5LV 3H25A 2NPSC 2KIKA 3MD0A 2HG5D 1FS0E 1KIBA 1SQBD 3CMEP 1USDA 1N7SB 2IBZD 3X39A 2AXTE 3L71E 3A0BV 3RMZA 3A0BE 4DT0A 1JB0J 3CC2P 4IL6H 3ITKA 4GOEA 1LWUC 1S4XA 2Y9YA 4HB1A 4IFFA 4ZKUA 3VN0A 3O5CA 5KAFE 5DJQB 4O1WA 1VQKP 3WUUA 3D70A 3UIAA 1KQLA 1SQVE 1CSUA 2CXBA 2P10A 3RBXA 1SQXE 4W80A 3BCCE 3M97X 1S3JA 2N3BA 2B87A 5CIBB 1IZNB 1LMSA 1X79B 1BSHA 1SQQG 4H13D 2WPVB 1BGYE 1VQOP 5KLVJ 4OGQC 2BCCJ 1SQQK 1IZL0 1E5WA 2I8FA 1XTCC 2V7QH 3H1KD 2P7JA 1VQMP 1C6SA 5CCHD 1GU4A 1WEJF 2N1TB 2M3BA 3P32A 1DD4A 2JWAA 4BRYB 2N9JA 2IDBA 1CIFA 3WUVA 1ETPA 3IF4A 3W67A 2QVAA 1NTZE 1VQ9P 2HR3A 3PLNA 2W6JH 4O1QA 1YIJP 2BEQD 3CCSP 3H32A 2B11B 1IO4A 3L4FA 3L72E 2AEMA 3RK2B 5APVA 2IZ0A 2C0XA 2FWLA 4GIFA 1GD2E 1DEBA 3DMIA 4PW9B 2IZ1A 1CRHA 1OFCX 5TJHA 5B66V 4HYTB 3Q1MA 4TT3H 3CWBD 1NTKE 5B66E 3ZOOA 1N7SC 3M0AA 1G1IA 5APSA 1HJBA 2N9YB 3RN0A 1LS9A 2K9JA 1H8AA 1FJKA 1PP9E 1HH7A 2B10B 2P67A 3ABVC 3AEFC 4H0LD 5AW8B 3RK3B 2AXTH 5APWA 1HGVA 5GTHE 5CHXA 1YEBA 1URQB 1FDMA 4B86A 3A0BH 1KYOE 2XNDH 5DJQC 2IFNA 1KQSO 2XV5A 1C75A 2SPZA 1DEEG 1BE3E 1FHBA 3SWYA 4XXLA 5KAFH 3M91A 2HODB 1U7JA 1L0NG 1OWAA 4O9BA 3CXHD 3L74G 1NHLA 4L74A 1L0NK 1T2KC 2O01N 3TGUD 1SQBE 2E5TA 4L1QA 2KYVA 2IBZE 1NKZB 4AAOA 351CA 1K3HA 1SQPG 1IRVA 1H32B 1QEXA 2JP3A 4DY9A 3SFDC 4N6JA 1L0LJ 1BSNA 1SQPK 4W7ZA 4GYDA 1RH5B 4H44B 2VRSA 3HE5A 4OVNF 2V7QJ 2N1TC 2JEEA 1NTMG 1WMKA 1LT9B 5CMZA 4WY4D 2OQQA 1CHJA 1NTMK 5CCHA 3WFEC 3AE1C 3CCVP 5AW0B 1VF5B 4RJTA 4R4MA 1CYJA 1M7LA 2V07A 3RK2C 3D6YA 1PGJA 4JPZB 3WMM0 1EZVD 3EQ2A 1YIQA 1NMLA 2JO1A 3CD6P 5IY51 3P7KA 3A0HV 2K1AA 4D6TG 1U75B 3A0HE 1VQ4P 3H1KE 1NJIQ 3VYMA 3FWLA 1LNQA 2LR2A 5AW3B 3OJAB 4HJGH 5B66H 3RK3C 4L76A 1J1EB 1JCDA 1RAPA 2PAJA 3KHUA 1URQC 1AOQA 1FZCB 1CSVA 3GF7A 2BH4X 1R8EA 5DFSA 3L71J 1H89A 2HV4A 4EOTA 1AV1A 2Z5IA 5GTHH 3G4SP 1KQFB 2PGDA 1KYOH 4EIJA 2WPSA 4FA9A 3V2RA 2CA4B 1NOHA 3CWBE 3GG2A 2W83C 2G3AA 3HTKB 1K9MQ 1SQQD 5AVUB 1GTWA 3WUTA 1GW4A 1HVVA 3C9IA 1SQVJ 3CX5W 1QL4A 1SQXJ 2H89C 3MHVA 2GB8B 1KYOI 2YKOA 4H44C 3NFQA 2BGVX 2BASA 4WQEA 3V6IA 3JCUE 1S1CX 1LT9C 2ZT9B 2QSIA 4ZNCA 1LFMA 3L4MA 1BGYJ 1YJWP 3CXHW 3HD7D 1L4AD 3H1LG 3VYIA 2WSCH 4DJGA 1VF5C 3CXHE 2Y9ZA 2A06G 4WY4A 3TGUE 1EQ7A 1FCDC 2MHMA 1ZP0C 1CORA 2A45I 1PGQA 4DOJA 1OW8A 2CPBA 1MZ4A 1IFIA 1RY3A 2NPSD 4Y5RA 4PD4D 1KB0A 5KAIV 1IO3A 1NTZJ 2OTJP 2GUVA 3P8MC 3Q5PA 3CC4P 1VQ5P 4IL6X 4C7NB 3WFDC 1L2PA 2H88C 1ZXGA 1DW0A 1PL5A 1J1EC 3A0HH 4C46A 2JKVA 1W5CE 1ZV8A 1RZ6A 2RKLA 3CC7P 1FZCC 3B5NB 5AW2B 1NTKJ 4KMGA 2I1KA 4RESB 1RF1A 3CU4A 2AXCA 2E74C 2NRGA 2HPCA 1JY2P 3BCCD 2D2CB 2C8SA 2W90A 3LIEA 1GDTA 2XDJA 2OYIB 3DR0A 1JUNA 1GKSA 1J1DB 1JTHA 2E76B 1NWQA 1KILB 1QL1A 1PP9J 2WPRA 3H6PA 3KZIV 1EZVE 1G2CB 1L0ND 1JEKA 1LTJB 3M0DA 3KZIE 1I6EA 1KORA 1I8PA 4L75A 1K04A 1N73B 1K05A 1QX8A 3VMXA 2C1UA 2ZXXA 1CI6A 1JY3O 1BE3J 1LJ2A 1MUUA 2YO2A 4OGQD 1SLQA 5CICB 1RE4C 2ZONG 4WQCA 1SQPD 2OARA 5EFWB 3L37A 5APTA 1QL2A 4GKGA 2BCCG 4C7RA 1A8CA 1SQBJ 4FA5A 5CIFB 1BDCA 1FOCA 3OCDB 2CE1A 2ZT9C 3T97A 1NTMD 2FXMA 3L72D 3SFEC 4KJMA 1HH0A 3EWKA 2POHA 2RN0A 1GK6A 2CK3H 3JCUH 1CSBA 1I54A 1AA0A 2YMKA 4C7NA 3ZOWA 4PJ0V 3HD7A 1L4AA 1RQUA 3V4WA 2WPQA 3NBTA 1AQTA 4PJ0E 3CLQA 1SQQE 2PRRA 3WUIA 3CXHH 3HQ7A 3HUSA 3NTNA 1DIPA 1I8OA 1CRIA 1HUCA 5C0ZA 2N18B 2IYPA 2VHDA 1N7SD 1Y8AA 1QKSA 2KSJA 2W6AA 2YKPA 5CJ4A 1S5LX 2NPSA 1OVUA 3O8ZA 2O1KA 3RBZA 2V4HA 1R0QA 3F89A 4Z1MH 3H1IG 2XKMA 2ZJSE 3B5NC 5AW1B 2K88A 2Q5UA 2R3CA 2D2CC 1GK4A 5DJUB 3H1KJ 3CCRP 1DW3A 1DVHA 2OYIC 1LWUA 3N4XA 1J1DC 1HJ5A 2AXTV 3PTZA 2E76C 2PACA 1Q90D 1CNOA 1H33B 1KILC 2OYOA 2LIRA 2Z5HA 4DZOA 4FA1A 1IFJA 3M9HA 3VOPA 2MTAC 1LTJC 4PV1B 3Q3DA 4K3AA 4OH8B 4PD4E 2QE7H 1T2KD 3Q5RA 1NU1J 5KAFV 1N73C 1H31A 1QLED 3SJLA 3WFCC 4U7JA 3OA7A 3KZIH 3C1LA 2W8ZA 1KN7A 2BH5X 1NVOA 1CXAA 5DJTB 4AYCA 3PHLA 1MKMA 2OZ1B 1PPJG 5KJ7C 4I6MC 451CA 3CWBJ 4P4QB 1VQLP 2N1TD 1E29A 3WC8A 2C9LY 5AVVB 1CC5A 4WB4A 3GHGB 1LTTC 1FZEA 2RH0A 1Q2NA 3RL0B 1Z56A 4U3FG 4XE5B 1YICA 1L0NE 1VPCA 2A06D 4AQRD 3RK2D 1LP1A 4LJIA 2BCNB 1I5TA 2QJKB 4K35A 2P1JA 1FAVA 1RE3C 2N18C 1SQPE 5AW4B 5CIHB 4PJ0H 1LC2A 3L75G 2DGEA 1M70A 3R4YA 4OWFA 1QGKB 1NTME 5BVZA 1N7SA 3RK3D 5B6QA 1CRYA 3RL0g 3VP9A 3L73G 3H1JG 3MK7B 1URQD 2FYNB 3O1YA 4XYDB 5CBOA 4BXLA 1A56A 1OAEA 5CBNA 1CCHA 1FOSF 3LW5H 3JC22 4ASVA 3K5BA 2KNCB 1M90Q 2WVRA 3GMAA 1YCCA 2QM8A 1KD1Q 3PXSA 3NXSA 2Q6QA 2ZZS1 2ZXEB 1DW1A 4PV1C 1FU1A 4WQ7A 3KPEA 3HQ6A 4R4LA 3HE4B 1H88A 5GTHV 3PH0A 2PCCB 3CX5D 4WQ8A 4M3LA 1FJ0A 5CCGC 1AYGA 2C1DB 2Q7CA 4N3YB 3TF5A 2P2UA 1J2JB 2ZYGA 4PD4H 1X9VA 2RMZA 2W6BA 1AFOA 3CCUP 2OYHB 5DF5A 3S9OA 4H44D 4EIDA 2BEZF 1CTJA 1H9XA 5APUA 3MUDC 4WQDA 4UB8E 3AE8C 4NPFX 3GHGC 2J58A 2AEFA 3RL0C 4PD4I 2N1TA 2O1JA 1OCDA 1WT6A 3HRNA 1YFCA 2WSFH 2Y0CA 4WQAA 4BRYA 1VF5D 1ZR4A 1Y9BA 1NH4A 1Q86Q 1OW6A 3CMAP 3P8CD 1U7MA 1WVEC 3GLMA 3O6QB 3A9FA 2QJKC 1J3SA 4LC1A 5AVYB 3H1HD 2IFMA 1NGMB 1EDKA 1CRGA 1W2EA 1CIGA 4YXWH 2YIUB 2OTLP 3VP8A 1CO6A 2PCBB 1IFMA 2FYUD 1NTZG 1BCCG 1NKNA 3CI9A 2N3YA 1EXIA 3E1RA 1HWTC 4AAMA 1SQQJ 1NTZK 2NZ2A 1NAYA 1A02J 3MK7C 3H1ID 1BDDA 2LXCB 3AEDC 3DP5A 2FYNC 2AEJA 5AW7B 1YJ9P 2E75B 1GMJA 1OZHA 2E74D 4EYYQ 4EDFA 4LLHA 2H7HA 5H2FE 3VMZA 1RF0C 2A06E 1AKKA 1URQA 1YEAA 3LW5J 2L4DA 4H0KA 2DVHA 1L9BC 2KZIA 1AOFA 2WSEH 3AE9C 1F1CA 2KSEA 2H8PD 1FE6A 1FZAA 1OIPA 2HODA 2KZJA 3PRJA 4ZMDA 3NWVA 1M1KQ 2MKVA 3V2QA 3AEBC 2Q3EA 2YNYA 1KTMA 4YPCA 2FY8A 1FOSE 1Q82Q 4WQBA 3RK3E 1NO4A 3L4OA 1HTLC 2OYHC 1E2RA 1PFIA 1RHZB 1PPJD 1U57A 1JY3P 1JMMA 1CIEA 1FDIA 1H32A 1TU3F 1KQGB 1NMIA 2ZT9D 3ZOXA 2GC4D 1SQBG 3WU2E 1N86A 2ITAA 3NBSA 1COTA 1SQBK 4U3FD 4JQ0D 2HLOA 1QVFO 3I5CA 1LT9A 2K3RA 4UB8H 1EDIA 2A45G 3L70G 1YHQP 2KB7P 3NMDA 3BCCJ
chains in the Genus database with same CATH topology
3SVWA 1A8CA 3SLEA 3M97X 4FA5A 5CIFB 2QJYB 1FOCA 1YNRA 2CE1A 3OCDB 1NTMD 2N3BA 2FRCA 3L72D 1K3GA 5CIBB 1LMSA 5KLIB 1GU2A 1C2NA 1FI9A 2RN0A 1RAQA 2ZXYA 5B5EV 1IZL0 2EXVA 1B7VA 1I54A 2I8FA 3H1KD 3L75D 4EIFA 3ZOWA 4PJ0V 4A7PA 1C6SA 1QN2A 5CIDB 1WEJF 3L73D 3NBTA 2B4ZA 3H1JD 1C6RA 4AX3A 3WUIA 3HQ7A 3TDKA 2JWAA 2N9JA 4JCGA 5H2FV 1CIFA 1CRIA 1I8OA 5C0ZA 2N18B 2VHDA 1ETPA 1C7MA 1QKSA 2KS1A 2QJPB 3PLNA 2ZOOA 1N9CA 2C1DA 4NFGB 4O1QA 2GC7D 2B11B 4H0JA 2BPBB 4MU8A 5KKZB 1R0QA 2FWLA 1KX7A 3DMIA 4PW9B 1CRHA 3VRDA 1F1FA 5TJHA 5B66V 2C9XB 2GIWA 3CWBD 3CP5A 1DW3A 1DVHA 1CYIA 3ZOOA 4K3IA 1HJ5A 2AXTV 3PTZA 2PACA 1NIRA 1CNOA 1H33B 2LIRA 5EXQA 3SXTA 4FA1A 2N9YB 2MTAC 3OA8B 3RN0A 1LS9A 3O20A 1DVVA 1HH7A 2B10B 4WQ9A 1HRCA 4J20A 3ZIYA 1MG2D 4FA4A 3L74D 1GDVA 5KAFV 1L0LD 3WU2V 1YEBA 4GEDB 1CEDA 1H31A 5DJQC 1BL9A 1I55A 3SJLA 3WFCC 2L91A 1C75A 2LITA 1FI7A 1YTCA 1FHBA 2BH5X 4XXLA 1CXAA 3PHLA 3VMAA 1A2SA 2OZ1B 451CA 3CXHD 4P4QB 2CA3B 1E29A 1CIHA 3WC8A 3TGUD 4Q5PA 2YQBA 1CC5A 4L1QA 4AAOA 1GJQA 351CA 1K3HA 1YICA 1L9JC 1IRVA 1H32B 4DY9A 1HJ4A 2A06D 2C2CA 4PWAA 1BCCD 1LC1A 5TISV 4RSZA 4GYDA 4LJIA 2BCNB 1I5TA 2QJKB 1CHHA 1IQCA 4EIEA 1CHJA 2N18C 4FAVA 3WFEC 1U74B 4D6TD 5CIHB 2B0ZB 3HQ8A 3ORVA 1LC2A 1IRWA 2O3JA 4RJTA 1CYJA 1I6DA 2DGEA 1M70A 1N15A 3L71D 2V07A 1DW2A 4AANA 1N90A 3RN1A 5B6QA 1CRYA 1EZVD 2ZBOA 1YIQA 3MK7B 5CIGB 1GQ1A 1NMLA 2FYNB 3O1YA 4XYDB 1H9YA 1A56A 1KV9A 1OAEA 5IY51 5AURA 1CCHA 1CYCA 3A0HV 2V08A 1U75B 1DT1A 2KNCB 1YCCA 1CTZA 3PXSA 1CRJA 2ZZS1 3VYMA 3JBTB 155CA 3FWLA 2CE0A 1DW1A 2YCCA 1NNOA 4WQ7A 3HQ6A 1HCMA 1SQVD 1W5CT 1CSWA 1RAPA 3PH2B 5GTHV 3PXTA 3KHUA 1SQXD 3TYIA 2PCCB 3CX5D 4WQ8A 1AOQA 1FJ0A 1CSVA 4IL6V 2BH4X 1AYGA 1DIQC 3C2CA 2C1DB 1RZ5A 3ZOYA 3TF5A 5DFSA 1HZVA 3OCDA 2HV4A 1VYDA 2JTIB 3GW6A 4FANA 2RMZA 3L70D 1BGYD 1C52A 5DF5A 1ZRTD 4EIDA 4FA9A 1CTJA 1H9XA 4EICA 4WQDA 2CA4B 3GG2A 2B12B 5C9MA 4UB6V 5CYTR 1FI3A 1SQQD 1H1OA 4N0KA 5E79V 2K9JB 1CXCA 4FB1A 1QL3A 1OCDA 3VNWA 3CX5W 1YFCA 1QL4A 1DIIC 2Y0CA 4WQAA 3H1LD 1E8EA 1GIWA 1KX2A 2GB8B 3CYTI 1NTZD 1WVEC 1CRCA 1MG3D 1H31B 2BGVX 1EB7A 3A9FA 4WQEA 1J3SA 4YE1A 1CTYA 2AI5A 3H1HD 1HZUA 1LFMA 3L4MA 1CRGA 1CIGA 3CXHW 1HJ3A 2YIUB 3SWSA 1CO6A 1KB9D 1NTKD 2PCBB 4L3GA 2QG4A 3WFBC 2FYUD 4QAOA 2N3YA 3O0RC 2C1VA 1H33A 4AAMA 1FCDC 2MHMA 2JQRA 1CORA 1JDLA 3MK7C 1P84D 2D0SA 2AIUA 3H1ID 3DP5A 1MZ4A 1CSXA 1PP9D 3OA8A 1QYZA 4V2KA 4Y5RA 4PD4D 1C6OA 1M6ZA 1KB0A 4EDFA 1CCRA 1HROA 3HQ9A 5KAIV 1IO3A 1CHIA 1NU1D 2Y0DA 1AKKA 1KYOD 2N9IA 1C2RA 3WFDC 1YEAA 2L4DA 2YK3A 4H0KA 2DVHA 3PXWA 1L9BC 1W2LA 1BE3D 5GTIV 1DW0A 1AOFA 1F1CA 2Y0EA 5CIEB 1RZ6A 2D0WA 1S5LV 2OZ1A 4KMGA 4L3HA 3CU4A 3BCCD 4AALA 3PRJA 2C8SA 1KIBA 1SQBD 2ORLA 3NWVA 2BLFB 3DR0A 2Q3EA 2IBZD 3X39A 1GKSA 3A0BV 3RMZA 3ZCFA 1M60A 4WQBA 3L4OA 3RLMA 3KZIV 1E2RA 1PPJD 1L0ND 1ZZHA 3ITKA 1I6EA 5KLVD 2BCCD 1CIEA 1KYOW 1H32A 4UB8V 3ZBMA 1S6VB 1NMIA 1I8PA 3O5CA 3ZOXA 2GC4D 2C1UA 5DJQB 4O1WA 3NBSA 1COTA 4U3FD 5CICB 2ZONG 4WQCA 1SQPD 1CSUA 2CXBA 1N50A 2XTSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVW A;  1A8C A;  3SLE A;  3M97 X;  4FA5 A;  5CIF B;  2QJY B;  1FOC A;  1YNR A;  2CE1 A;  3OCD B;  1NTM D;  2N3B A;  2FRC A;  3L72 D;  1K3G A;  5CIB B;  1LMS A;  5KLI B;  1GU2 A;  1C2N A;  1FI9 A;  2RN0 A;  1RAQ A;  2ZXY A;  5B5E V;  1IZL 0;  2EXV A;  1B7V A;  1I54 A;  2I8F A;  3H1K D;  3L75 D;  4EIF A;  3ZOW A;  4PJ0 V;  4A7P A;  1C6S A;  1QN2 A;  5CID B;  1WEJ F;  3L73 D;  3NBT A;  2B4Z A;  3H1J D;  1C6R A;  4AX3 A;  3WUI A;  3HQ7 A;  3TDK A;  2JWA A;  2N9J A;  4JCG A;  5H2F V;  1CIF A;  1CRI A;  1I8O A;  5C0Z A;  2N18 B;  2VHD A;  1ETP A;  1C7M A;  1QKS A;  2KS1 A;  2QJP B;  3PLN A;  2ZOO A;  1N9C A;  2C1D A;  4NFG B;  4O1Q A;  2GC7 D;  2B11 B;  4H0J A;  2BPB B;  4MU8 A;  5KKZ B;  1R0Q A;  2FWL A;  1KX7 A;  3DMI A;  4PW9 B;  1CRH A;  3VRD A;  1F1F A;  5TJH A;  5B66 V;  2C9X B;  2GIW A;  3CWB D;  3CP5 A;  1DW3 A;  1DVH A;  1CYI A;  3ZOO A;  4K3I A;  1HJ5 A;  2AXT V;  3PTZ A;  2PAC A;  1NIR A;  1CNO A;  1H33 B;  2LIR A;  5EXQ A;  3SXT A;  4FA1 A;  2N9Y B;  2MTA C;  3OA8 B;  3RN0 A;  1LS9 A;  3O20 A;  1DVV A;  1HH7 A;  2B10 B;  4WQ9 A;  1HRC A;  4J20 A;  3ZIY A;  1MG2 D;  4FA4 A;  3L74 D;  1GDV A;  5KAF V;  1L0L D;  3WU2 V;  1YEB A;  4GED B;  1CED A;  1H31 A;  5DJQ C;  1BL9 A;  1I55 A;  3SJL A;  3WFC C;  2L91 A;  1C75 A;  2LIT A;  1FI7 A;  1YTC A;  1FHB A;  2BH5 X;  4XXL A;  1CXA A;  3PHL A;  3VMA A;  1A2S A;  2OZ1 B;  451C A;  3CXH D;  4P4Q B;  2CA3 B;  1E29 A;  1CIH A;  3WC8 A;  3TGU D;  4Q5P A;  2YQB A;  1CC5 A;  4L1Q A;  4AAO A;  1GJQ A;  351C A;  1K3H A;  1YIC A;  1L9J C;  1IRV A;  1H32 B;  4DY9 A;  1HJ4 A;  2A06 D;  2C2C A;  4PWA A;  1BCC D;  1LC1 A;  5TIS V;  4RSZ A;  4GYD A;  4LJI A;  2BCN B;  1I5T A;  2QJK B;  1CHH A;  1IQC A;  4EIE A;  1CHJ A;  2N18 C;  4FAV A;  3WFE C;  1U74 B;  4D6T D;  5CIH B;  2B0Z B;  3HQ8 A;  3ORV A;  1LC2 A;  1IRW A;  2O3J A;  4RJT A;  1CYJ A;  1I6D A;  2DGE A;  1M70 A;  1N15 A;  3L71 D;  2V07 A;  1DW2 A;  4AAN A;  1N90 A;  3RN1 A;  5B6Q A;  1CRY A;  1EZV D;  2ZBO A;  1YIQ A;  3MK7 B;  5CIG B;  1GQ1 A;  1NML A;  2FYN B;  3O1Y A;  4XYD B;  1H9Y A;  1A56 A;  1KV9 A;  1OAE A;  5IY5 1;  5AUR A;  1CCH A;  1CYC A;  3A0H V;  2V08 A;  1U75 B;  1DT1 A;  2KNC B;  1YCC A;  1CTZ A;  3PXS A;  1CRJ A;  2ZZS 1;  3VYM A;  3JBT B;  155C A;  3FWL A;  2CE0 A;  1DW1 A;  2YCC A;  1NNO A;  4WQ7 A;  3HQ6 A;  1HCM A;  1SQV D;  1W5C T;  1CSW A;  1RAP A;  3PH2 B;  5GTH V;  3PXT A;  3KHU A;  1SQX D;  3TYI A;  2PCC B;  3CX5 D;  4WQ8 A;  1AOQ A;  1FJ0 A;  1CSV A;  4IL6 V;  2BH4 X;  1AYG A;  1DIQ C;  3C2C A;  2C1D B;  1RZ5 A;  3ZOY A;  3TF5 A;  5DFS A;  1HZV A;  3OCD A;  2HV4 A;  1VYD A;  2JTI B;  3GW6 A;  4FAN A;  2RMZ A;  3L70 D;  1BGY D;  1C52 A;  5DF5 A;  1ZRT D;  4EID A;  4FA9 A;  1CTJ A;  1H9X A;  4EIC A;  4WQD A;  2CA4 B;  3GG2 A;  2B12 B;  5C9M A;  4UB6 V;  5CYT R;  1FI3 A;  1SQQ D;  1H1O A;  4N0K A;  5E79 V;  2K9J B;  1CXC A;  4FB1 A;  1QL3 A;  1OCD A;  3VNW A;  3CX5 W;  1YFC A;  1QL4 A;  1DII C;  2Y0C A;  4WQA A;  3H1L D;  1E8E A;  1GIW A;  1KX2 A;  2GB8 B;  3CYT I;  1NTZ D;  1WVE C;  1CRC A;  1MG3 D;  1H31 B;  2BGV X;  1EB7 A;  3A9F A;  4WQE A;  1J3S A;  4YE1 A;  1CTY A;  2AI5 A;  3H1H D;  1HZU A;  1LFM A;  3L4M A;  1CRG A;  1CIG A;  3CXH W;  1HJ3 A;  2YIU B;  3SWS A;  1CO6 A;  1KB9 D;  1NTK D;  2PCB B;  4L3G A;  2QG4 A;  3WFB C;  2FYU D;  4QAO A;  2N3Y A;  3O0R C;  2C1V A;  1H33 A;  4AAM A;  1FCD C;  2MHM A;  2JQR A;  1COR A;  1JDL A;  3MK7 C;  1P84 D;  2D0S A;  2AIU A;  3H1I D;  3DP5 A;  1MZ4 A;  1CSX A;  1PP9 D;  3OA8 A;  1QYZ A;  4V2K A;  4Y5R A;  4PD4 D;  1C6O A;  1M6Z A;  1KB0 A;  4EDF A;  1CCR A;  1HRO A;  3HQ9 A;  5KAI V;  1IO3 A;  1CHI A;  1NU1 D;  2Y0D A;  1AKK A;  1KYO D;  2N9I A;  1C2R A;  3WFD C;  1YEA A;  2L4D A;  2YK3 A;  4H0K A;  2DVH A;  3PXW A;  1L9B C;  1W2L A;  1BE3 D;  5GTI V;  1DW0 A;  1AOF A;  1F1C A;  2Y0E A;  5CIE B;  1RZ6 A;  2D0W A;  1S5L V;  2OZ1 A;  4KMG A;  4L3H A;  3CU4 A;  3BCC D;  4AAL A;  3PRJ A;  2C8S A;  1KIB A;  1SQB D;  2ORL A;  3NWV A;  2BLF B;  3DR0 A;  2Q3E A;  2IBZ D;  3X39 A;  1GKS A;  3A0B V;  3RMZ A;  3ZCF A;  1M60 A;  4WQB A;  3L4O A;  3RLM A;  3KZI V;  1E2R A;  1PPJ D;  1L0N D;  1ZZH A;  3ITK A;  1I6E A;  5KLV D;  2BCC D;  1CIE A;  1KYO W;  1H32 A;  4UB8 V;  3ZBM A;  1S6V B;  1NMI A;  1I8P A;  3O5C A;  3ZOX A;  2GC4 D;  2C1U A;  5DJQ B;  4O1W A;  3NBS A;  1COT A;  4U3F D;  5CIC B;  2ZON G;  4WQC A;  1SQP D;  1CSU A;  2CXB A;  1N50 A;  2XTS B; 
#chains in the Genus database with same CATH topology
 3CX5 E;  2WSF J;  3SVW A;  3S4R A;  1JOC A;  5C39 A;  2QJY B;  3IR9 A;  1YNR A;  1AQ5 A;  1K3G A;  1Q7Y Q;  5KLI B;  1GU2 A;  4KHX A;  1YQ4 C;  5AVT B;  2YIU C;  3TNU B;  2ZXY A;  5B5E V;  2B9B A;  2EXV A;  2BCC E;  4LGD E;  5B5E E;  4WVZ A;  4BWN A;  3L75 D;  4EIF A;  1GU5 A;  3N7N A;  2IBZ I;  1LTB C;  5TIS E;  4A7P A;  3G71 P;  2FFD B;  5CID B;  3L36 A;  3D0W A;  3FGA D;  3L73 D;  1NYH A;  2B4Z A;  3H1J D;  1C6R A;  3B5N D;  2M5A B;  2E75 C;  1SQP J;  2KP8 A;  2D2C D;  4JCG A;  1H0T B;  1C7M A;  2E76 D;  1KIL D;  1FZC A;  3P8C E;  2QJP B;  2QIW A;  3H1K G;  1SFC B;  1N9C A;  1NTM J;  1SS1 A;  1VQ7 P;  2GC7 D;  1GZL A;  4H0J A;  3L72 J;  3H1H E;  1X0T A;  5H2F H;  2BPB B;  4MU8 A;  4TLF A;  2KXP B;  2M3E A;  1PV3 A;  1LTA C;  2FYZ A;  1F1F A;  1T8Z A;  2WSE J;  3G6E P;  2GIW A;  2GA1 A;  2FYU E;  1NU1 G;  1DD3 A;  4K3I A;  1NIR A;  1OX3 A;  2PP6 A;  5APQ A;  3B8E B;  3SWK A;  5EXQ A;  2PFX A;  3HTK A;  3SXT A;  1NU1 K;  5BU5 A;  2YXQ B;  3OA8 B;  1KB9 H;  3A7O A;  3H1I E;  3O20 A;  5KJ7 D;  1DVV A;  1ZME C;  3CPW O;  4WQ9 A;  1HRC A;  2ZYA A;  4J20 A;  3ZIY A;  4JYB A;  1RE4 A;  1MG2 D;  1ZOY C;  4FA4 A;  1M1J B;  3L74 D;  1OVR A;  1GL2 B;  3BRV B;  1CED A;  2QA4 P;  2WT7 B;  1I55 A;  3W68 A;  2L91 A;  1CZQ A;  2GUS A;  1DH3 A;  3JSV C;  2LIT A;  1FI7 A;  2C9N Y;  1YTC A;  1ZN5 A;  3WU2 H;  1A2S A;  3C8V A;  5KLV G;  3Q2Y A;  2QJY C;  2CA3 B;  1HBW A;  4Q5P A;  5KLV K;  2YQB A;  2R3S A;  5KLI C;  1JM0 A;  2Z4E A;  3FXE A;  1IJD B;  4UB6 E;  3TK1 A;  3A5T A;  3CX5 H;  5BU8 B;  1PPJ E;  3F5H A;  3I56 P;  2OGU A;  1HJ4 A;  1XTG B;  4PWA A;  1BCC D;  2FFD C;  2WSC J;  4GOF A;  3TSI A;  2R44 A;  1CHH A;  3FXD A;  3M06 A;  5B5E H;  4U3F E;  4EIE A;  3BAT A;  4FAV A;  1FBM A;  3CX5 I;  1FZF A;  5TIS H;  4D6T D;  1T3U A;  1JMB A;  1T6A A;  2QJP C;  3B5N A;  3V2N A;  1SFC C;  1ZW0 A;  1S72 P;  2UWJ E;  2O3J A;  1N2D C;  4PV1 D;  2B87 B;  2OYI A;  3AEC C;  1DW2 A;  4AAN A;  1HJ0 A;  1N90 A;  1KIL A;  2WZ7 A;  2ZBO A;  1IK9 A;  1GQ1 A;  1G2C A;  2B88 A;  2IYO A;  1H9Y A;  5CCG D;  1MFZ A;  1LTJ A;  3CXH I;  1YIT P;  2LKM A;  1DT1 A;  2KLU A;  4GT1 A;  1VQ6 P;  1CTZ A;  3L75 E;  2JDI H;  1N73 A;  1FC2 C;  3D71 A;  2R5B A;  155C A;  5M1B A;  2CE0 A;  3CL3 D;  3L73 E;  3H1J E;  2YCC A;  1NNO A;  2ZVN B;  1HCM A;  1W5C T;  2K9Y A;  1NAF A;  1M1J C;  3PH2 B;  4HH2 A;  1GL2 C;  3TYI A;  2YKQ A;  1S5L E;  5KJ7 A;  1KIL E;  4I7Z B;  1DIQ C;  1YBK A;  3C2C A;  1RZ5 A;  3RL0 D;  3H32 B;  1HZV A;  3OCD A;  2FXP A;  4RO0 A;  1VYD A;  2WQY C;  1K73 Q;  3GW6 A;  1YQ3 C;  5AVR B;  1JY2 O;  3L70 D;  3MP7 B;  1C52 A;  1IFP A;  1ZRT D;  1AJY A;  2H43 A;  3E1I A;  2XU6 A;  1FZB A;  1MV8 A;  1EDJ A;  1L0L G;  5C9M A;  1EC5 A;  1OVV A;  1EZV I;  1L0L K;  1H1O A;  1MFT A;  5E79 V;  2K9J B;  1CXC A;  5AW5 B;  1LT1 A;  1KFM A;  1M57 D;  5E79 E;  1DII C;  3H1L D;  2ZVO B;  1GIW A;  5AVZ B;  1RE3 A;  2Q3I A;  3B4S A;  3CYT I;  4UB6 H;  3L74 E;  3AE5 C;  1JY2 N;  1CRC A;  1MG3 D;  1FDO A;  1ZR2 A;  4YE1 A;  2XZR A;  3RGU A;  3MGN A;  3CCQ P;  2GM4 A;  2KI7 B;  5AVS B;  3TYY A;  3A3Y B;  3ZDM A;  4N78 D;  1HJ3 A;  3SWS A;  3Q5S A;  1KB9 D;  3IN6 A;  4DCK A;  1IC2 A;  1LTI C;  4QAO A;  3TGU J;  2C1V A;  1H33 A;  4JYC A;  2ZAE B;  1P84 D;  2D0S A;  2AIU A;  2E5Y A;  2I1J A;  2YMY A;  4RKU J;  1QYZ A;  4V2K A;  4YTP C;  3E7K A;  1C6O A;  2C0W A;  1S9K D;  1CHI A;  4AUW A;  4H13 B;  1NU1 D;  3PP5 A;  1BCC E;  2Y0D A;  2N9I A;  1C2R A;  1UII A;  1W2B O;  2P58 A;  3HE5 B;  1AVY A;  3H1H J;  5CCG A;  3CCJ P;  1R5L A;  1D7M A;  4WBA A;  3PXW A;  4EI2 A;  3L71 G;  1W2L A;  2G8Y A;  4WWI A;  3KDP B;  3KXD A;  2D0W A;  3KQG A;  4I1L A;  2OZ1 A;  4D6T E;  4I7Z C;  2FYU J;  4L3H A;  5AW9 B;  1K8A Q;  1T3J A;  2KS1 B;  4AAL A;  2ORL A;  2BLF B;  3U1A A;  2WTY A;  3M9B A;  3MUD A;  1GW3 A;  5GTI H;  3ZCF A;  3H1I J;  1M60 A;  3GHG A;  3AE6 C;  3RLM A;  1S5L H;  1HF9 A;  2ZFC A;  1PGP A;  1ZZH A;  3FX0 A;  5KLV D;  1SQV G;  2BCC D;  2Q1K A;  1KYO W;  3SWF A;  4UB8 V;  3ZBM A;  1S6V B;  1SQX G;  2WMM A;  1SQV K;  3BCC G;  2QEX P;  1SQX K;  1PGO A;  4Y28 J;  2DW3 A;  1AVO A;  3IFM A;  1N7L A;  2FBW C;  2WIT A;  2YXR B;  1BGY G;  1N50 A;  2XTS B;  3AE7 C;  3L35 A;  3M9Q A;  5AVW B;  3G3Z A;  3SLE A;  4H0L B;  3CCM P;  5E79 H;  1JO5 A;  3II6 A;  2E75 D;  2FRC A;  1Y47 A;  1JNM A;  1C2N A;  2YO3 A;  2O01 H;  1FI9 A;  1YJN P;  3L70 E;  1RAQ A;  4CPG A;  1ZRT E;  1B7V A;  2KNC A;  3VTP C;  1YI2 P;  1RF0 A;  3MIW A;  1QN2 A;  3OW2 O;  1DX7 A;  4U3F J;  2HFE D;  3L72 G;  3FWN A;  4AX3 A;  3QWO C;  3TDK A;  3QH9 A;  1G1J A;  5H2F V;  4H13 C;  3HE4 A;  3H1L E;  3U59 A;  5AVQ B;  2KS1 A;  1NTK G;  1USE A;  1PIX A;  2ZOO A;  2C1D A;  4NFG B;  4L73 A;  5L8R J;  3BRT B;  1NTK K;  5CCH C;  5KKZ B;  1E79 H;  1PZQ A;  2JWD A;  1HGZ A;  1PP9 G;  1KX7 A;  3AE3 C;  2OYH A;  3VRD A;  3R2P A;  3A2A A;  4N78 E;  3VMY A;  2C9X B;  4WY4 B;  3CP5 A;  1KB9 E;  3L75 J;  1CYI A;  5AW6 B;  1MZ9 A;  4MN4 C;  3L73 J;  3H1J J;  2HYN A;  1P84 E;  1SP4 A;  1KC8 Q;  1BE3 G;  1VQP P;  1WRG A;  2XNX A;  3EFF K;  4I2L C;  5APX A;  1S9K E;  1GDV A;  1L0L D;  3B71 A;  3WU2 V;  1YTZ T;  1NU1 E;  4GED B;  2E74 B;  2MJZ A;  1EXJ A;  3O6Q A;  1BL9 A;  1VDF A;  1ZLL A;  2KUB A;  4XA4 A;  5AVX B;  2IBZ G;  1LTS C;  3VMA A;  2K37 A;  1YTZ I;  2J59 M;  2HPC B;  1RF1 B;  3USS A;  3D6Z A;  3S1K A;  2FKW B;  1VQN P;  4H0L C;  2R5D A;  2JR8 A;  1CIH A;  1JTH B;  5CJ0 A;  3EFG A;  1GJQ A;  4NPE A;  1L0N J;  2M0B A;  1SFC D;  1L9J C;  4W7Y A;  2O01 J;  3L74 J;  1FZG A;  5KLV E;  3AE4 C;  1A02 F;  2E43 A;  2C2C A;  1LC1 A;  5TIS V;  4RSZ A;  4Y99 B;  2A45 H;  1SVF A;  3BVH A;  3CCE P;  1CI6 B;  3BAS A;  3SSU A;  4ZKP A;  3KYQ A;  5APY A;  1IQC A;  4IFD K;  2KLV A;  1U74 B;  2B0Z B;  1LGH B;  3HQ8 A;  3ORV A;  1IRW A;  3T97 B;  2CPS A;  1I6D A;  1N15 A;  3L71 D;  1IFD A;  4KT0 J;  5KKZ C;  4IOI H;  3RN1 A;  2J5U A;  4HKZ H;  1GL2 D;  5CIG B;  2JJL A;  1KV9 A;  5AUR A;  3V4Q A;  4WY4 C;  1CYC A;  1KV4 A;  2V08 A;  1OXZ A;  4YXD C;  1BCC J;  5KAI E;  1YYC A;  1X22 A;  2QRX A;  3HD7 B;  1OW7 A;  1S2E A;  1L4A B;  4JF7 A;  1VL2 A;  1FJP A;  1CW5 A;  1CRJ A;  2Q9I A;  3JBT B;  2B89 A;  2IX7 C;  4NPD A;  4GOD A;  3HUS B;  1KMI Z;  1SQV D;  4D6T J;  1CSW A;  1IFN A;  4XFJ A;  3PXT A;  2M8R A;  1SQX D;  3MTU E;  4IL6 V;  2WSS H;  1N8R Q;  2NPS B;  1P84 H;  3CWB G;  4IL6 E;  3ZOY A;  2WWW A;  1IK7 A;  2JTI B;  2R32 A;  4FAN A;  1M8O B;  1BGY D;  2IPP A;  1RF1 C;  1KB9 I;  1Q81 Q;  3TNU A;  3PJS K;  4EIC A;  1LWU B;  2B12 B;  1EDL A;  2L5G B;  5K5G B;  1P84 I;  4UB6 V;  5CYT R;  1FI3 A;  1UIX A;  2FFD A;  1OMI A;  2OTK E;  4N0K A;  4FB1 A;  3M0D C;  1QL3 A;  3U1C A;  1X8Y A;  2M5A A;  3VNW A;  1E8E A;  2W27 A;  2QM7 A;  1KFN A;  1H0T A;  1KX2 A;  4Y99 C;  2LXB A;  1NTZ D;  4JBZ A;  1L0L E;  1H31 B;  1R5S A;  1EB7 A;  3AE2 C;  3IAO A;  1CTY A;  1SFC A;  3CCL P;  2AI5 A;  3TGU G;  1JCC A;  1HZU A;  3L70 J;  2N9B A;  2I8D A;  1LTG C;  3V2P A;  3OAK A;  1JY3 N;  2E42 A;  3AEE C;  3GF3 A;  4OGQ B;  1NTK D;  4L3G A;  2QG4 A;  4GDO A;  3WFB C;  1VQ8 P;  4QMA A;  2FXO A;  2KK7 A;  5KTB A;  2KOG A;  3O0R C;  3H1H G;  2JQR A;  1JDL A;  3I55 P;  1CSX A;  1PP9 D;  3OA8 A;  1RQV A;  3MZW B;  4IFM A;  3H1L J;  1M6Z A;  1CCR A;  1HRO A;  3HQ9 A;  3AEG C;  3G9R A;  3HD7 C;  1M1J A;  1L4A C;  1GL2 A;  2FYU G;  1KYO D;  1LP1 B;  3LID A;  2YK3 A;  2WT7 A;  3HUS C;  3V5B A;  2FYU K;  1KZU B;  1M56 D;  1BE3 D;  5GTI V;  5KAI H;  2Y0E A;  1EZV G;  2ZYD A;  5CIE B;  1QVG O;  5GTI E;  3AEA C;  4ASW A;  1S5L V;  3H25 A;  2NPS C;  2KIK A;  3MD0 A;  2HG5 D;  1FS0 E;  1KIB A;  1SQB D;  3CME P;  1USD A;  1N7S B;  2IBZ D;  3X39 A;  2AXT E;  3L71 E;  3A0B V;  3RMZ A;  3A0B E;  4DT0 A;  1JB0 J;  3CC2 P;  4IL6 H;  3ITK A;  4GOE A;  1LWU C;  1S4X A;  2Y9Y A;  4HB1 A;  4IFF A;  4ZKU A;  3VN0 A;  3O5C A;  5KAF E;  5DJQ B;  4O1W A;  1VQK P;  3WUU A;  3D70 A;  3UIA A;  1KQL A;  1SQV E;  1CSU A;  2CXB A;  2P10 A;  3RBX A;  1SQX E;  4W80 A;  3BCC E;  3M97 X;  1S3J A;  2N3B A;  2B87 A;  5CIB B;  1IZN B;  1LMS A;  1X79 B;  1BSH A;  1SQQ G;  4H13 D;  2WPV B;  1BGY E;  1VQO P;  5KLV J;  4OGQ C;  2BCC J;  1SQQ K;  1IZL 0;  1E5W A;  2I8F A;  1XTC C;  2V7Q H;  3H1K D;  2P7J A;  1VQM P;  1C6S A;  5CCH D;  1GU4 A;  1WEJ F;  2N1T B;  2M3B A;  3P32 A;  1DD4 A;  2JWA A;  4BRY B;  2N9J A;  2IDB A;  1CIF A;  3WUV A;  1ETP A;  3IF4 A;  3W67 A;  2QVA A;  1NTZ E;  1VQ9 P;  2HR3 A;  3PLN A;  2W6J H;  4O1Q A;  1YIJ P;  2BEQ D;  3CCS P;  3H32 A;  2B11 B;  1IO4 A;  3L4F A;  3L72 E;  2AEM A;  3RK2 B;  5APV A;  2IZ0 A;  2C0X A;  2FWL A;  4GIF A;  1GD2 E;  1DEB A;  3DMI A;  4PW9 B;  2IZ1 A;  1CRH A;  1OFC X;  5TJH A;  5B66 V;  4HYT B;  3Q1M A;  4TT3 H;  3CWB D;  1NTK E;  5B66 E;  3ZOO A;  1N7S C;  3M0A A;  1G1I A;  5APS A;  1HJB A;  2N9Y B;  3RN0 A;  1LS9 A;  2K9J A;  1H8A A;  1FJK A;  1PP9 E;  1HH7 A;  2B10 B;  2P67 A;  3ABV C;  3AEF C;  4H0L D;  5AW8 B;  3RK3 B;  2AXT H;  5APW A;  1HGV A;  5GTH E;  5CHX A;  1YEB A;  1URQ B;  1FDM A;  4B86 A;  3A0B H;  1KYO E;  2XND H;  5DJQ C;  2IFN A;  1KQS O;  2XV5 A;  1C75 A;  2SPZ A;  1DEE G;  1BE3 E;  1FHB A;  3SWY A;  4XXL A;  5KAF H;  3M91 A;  2HOD B;  1U7J A;  1L0N G;  1OWA A;  4O9B A;  3CXH D;  3L74 G;  1NHL A;  4L74 A;  1L0N K;  1T2K C;  2O01 N;  3TGU D;  1SQB E;  2E5T A;  4L1Q A;  2KYV A;  2IBZ E;  1NKZ B;  4AAO A;  351C A;  1K3H A;  1SQP G;  1IRV A;  1H32 B;  1QEX A;  2JP3 A;  4DY9 A;  3SFD C;  4N6J A;  1L0L J;  1BSN A;  1SQP K;  4W7Z A;  4GYD A;  1RH5 B;  4H44 B;  2VRS A;  3HE5 A;  4OVN F;  2V7Q J;  2N1T C;  2JEE A;  1NTM G;  1WMK A;  1LT9 B;  5CMZ A;  4WY4 D;  2OQQ A;  1CHJ A;  1NTM K;  5CCH A;  3WFE C;  3AE1 C;  3CCV P;  5AW0 B;  1VF5 B;  4RJT A;  4R4M A;  1CYJ A;  1M7L A;  2V07 A;  3RK2 C;  3D6Y A;  1PGJ A;  4JPZ B;  3WMM 0;  1EZV D;  3EQ2 A;  1YIQ A;  1NML A;  2JO1 A;  3CD6 P;  5IY5 1;  3P7K A;  3A0H V;  2K1A A;  4D6T G;  1U75 B;  3A0H E;  1VQ4 P;  3H1K E;  1NJI Q;  3VYM A;  3FWL A;  1LNQ A;  2LR2 A;  5AW3 B;  3OJA B;  4HJG H;  5B66 H;  3RK3 C;  4L76 A;  1J1E B;  1JCD A;  1RAP A;  2PAJ A;  3KHU A;  1URQ C;  1AOQ A;  1FZC B;  1CSV A;  3GF7 A;  2BH4 X;  1R8E A;  5DFS A;  3L71 J;  1H89 A;  2HV4 A;  4EOT A;  1AV1 A;  2Z5I A;  5GTH H;  3G4S P;  1KQF B;  2PGD A;  1KYO H;  4EIJ A;  2WPS A;  4FA9 A;  3V2R A;  2CA4 B;  1NOH A;  3CWB E;  3GG2 A;  2W83 C;  2G3A A;  3HTK B;  1K9M Q;  1SQQ D;  5AVU B;  1GTW A;  3WUT A;  1GW4 A;  1HVV A;  3C9I A;  1SQV J;  3CX5 W;  1QL4 A;  1SQX J;  2H89 C;  3MHV A;  2GB8 B;  1KYO I;  2YKO A;  4H44 C;  3NFQ A;  2BGV X;  2BAS A;  4WQE A;  3V6I A;  3JCU E;  1S1C X;  1LT9 C;  2ZT9 B;  2QSI A;  4ZNC A;  1LFM A;  3L4M A;  1BGY J;  1YJW P;  3CXH W;  3HD7 D;  1L4A D;  3H1L G;  3VYI A;  2WSC H;  4DJG A;  1VF5 C;  3CXH E;  2Y9Z A;  2A06 G;  4WY4 A;  3TGU E;  1EQ7 A;  1FCD C;  2MHM A;  1ZP0 C;  1COR A;  2A45 I;  1PGQ A;  4DOJ A;  1OW8 A;  2CPB A;  1MZ4 A;  1IFI A;  1RY3 A;  2NPS D;  4Y5R A;  4PD4 D;  1KB0 A;  5KAI V;  1IO3 A;  1NTZ J;  2OTJ P;  2GUV A;  3P8M C;  3Q5P A;  3CC4 P;  1VQ5 P;  4IL6 X;  4C7N B;  3WFD C;  1L2P A;  2H88 C;  1ZXG A;  1DW0 A;  1PL5 A;  1J1E C;  3A0H H;  4C46 A;  2JKV A;  1W5C E;  1ZV8 A;  1RZ6 A;  2RKL A;  3CC7 P;  1FZC C;  3B5N B;  5AW2 B;  1NTK J;  4KMG A;  2I1K A;  4RES B;  1RF1 A;  3CU4 A;  2AXC A;  2E74 C;  2NRG A;  2HPC A;  1JY2 P;  3BCC D;  2D2C B;  2C8S A;  2W90 A;  3LIE A;  1GDT A;  2XDJ A;  2OYI B;  3DR0 A;  1JUN A;  1GKS A;  1J1D B;  1JTH A;  2E76 B;  1NWQ A;  1KIL B;  1QL1 A;  1PP9 J;  2WPR A;  3H6P A;  3KZI V;  1EZV E;  1G2C B;  1L0N D;  1JEK A;  1LTJ B;  3M0D A;  3KZI E;  1I6E A;  1KOR A;  1I8P A;  4L75 A;  1K04 A;  1N73 B;  1K05 A;  1QX8 A;  3VMX A;  2C1U A;  2ZXX A;  1CI6 A;  1JY3 O;  1BE3 J;  1LJ2 A;  1MUU A;  2YO2 A;  4OGQ D;  1SLQ A;  5CIC B;  1RE4 C;  2ZON G;  4WQC A;  1SQP D;  2OAR A;  5EFW B;  3L37 A;  5APT A;  1QL2 A;  4GKG A;  2BCC G;  4C7R A;  1A8C A;  1SQB J;  4FA5 A;  5CIF B;  1BDC A;  1FOC A;  3OCD B;  2CE1 A;  2ZT9 C;  3T97 A;  1NTM D;  2FXM A;  3L72 D;  3SFE C;  4KJM A;  1HH0 A;  3EWK A;  2POH A;  2RN0 A;  1GK6 A;  2CK3 H;  3JCU H;  1CSB A;  1I54 A;  1AA0 A;  2YMK A;  4C7N A;  3ZOW A;  4PJ0 V;  3HD7 A;  1L4A A;  1RQU A;  3V4W A;  2WPQ A;  3NBT A;  1AQT A;  4PJ0 E;  3CLQ A;  1SQQ E;  2PRR A;  3WUI A;  3CXH H;  3HQ7 A;  3HUS A;  3NTN A;  1DIP A;  1I8O A;  1CRI A;  1HUC A;  5C0Z A;  2N18 B;  2IYP A;  2VHD A;  1N7S D;  1Y8A A;  1QKS A;  2KSJ A;  2W6A A;  2YKP A;  5CJ4 A;  1S5L X;  2NPS A;  1OVU A;  3O8Z A;  2O1K A;  3RBZ A;  2V4H A;  1R0Q A;  3F89 A;  4Z1M H;  3H1I G;  2XKM A;  2ZJS E;  3B5N C;  5AW1 B;  2K88 A;  2Q5U A;  2R3C A;  2D2C C;  1GK4 A;  5DJU B;  3H1K J;  3CCR P;  1DW3 A;  1DVH A;  2OYI C;  1LWU A;  3N4X A;  1J1D C;  1HJ5 A;  2AXT V;  3PTZ A;  2E76 C;  2PAC A;  1Q90 D;  1CNO A;  1H33 B;  1KIL C;  2OYO A;  2LIR A;  2Z5H A;  4DZO A;  4FA1 A;  1IFJ A;  3M9H A;  3VOP A;  2MTA C;  1LTJ C;  4PV1 B;  3Q3D A;  4K3A A;  4OH8 B;  4PD4 E;  2QE7 H;  1T2K D;  3Q5R A;  1NU1 J;  5KAF V;  1N73 C;  1H31 A;  1QLE D;  3SJL A;  3WFC C;  4U7J A;  3OA7 A;  3KZI H;  3C1L A;  2W8Z A;  1KN7 A;  2BH5 X;  1NVO A;  1CXA A;  5DJT B;  4AYC A;  3PHL A;  1MKM A;  2OZ1 B;  1PPJ G;  5KJ7 C;  4I6M C;  451C A;  3CWB J;  4P4Q B;  1VQL P;  2N1T D;  1E29 A;  3WC8 A;  2C9L Y;  5AVV B;  1CC5 A;  4WB4 A;  3GHG B;  1LTT C;  1FZE A;  2RH0 A;  1Q2N A;  3RL0 B;  1Z56 A;  4U3F G;  4XE5 B;  1YIC A;  1L0N E;  1VPC A;  2A06 D;  4AQR D;  3RK2 D;  1LP1 A;  4LJI A;  2BCN B;  1I5T A;  2QJK B;  4K35 A;  2P1J A;  1FAV A;  1RE3 C;  2N18 C;  1SQP E;  5AW4 B;  5CIH B;  4PJ0 H;  1LC2 A;  3L75 G;  2DGE A;  1M70 A;  3R4Y A;  4OWF A;  1QGK B;  1NTM E;  5BVZ A;  1N7S A;  3RK3 D;  5B6Q A;  1CRY A;  3RL0 g;  3VP9 A;  3L73 G;  3H1J G;  3MK7 B;  1URQ D;  2FYN B;  3O1Y A;  4XYD B;  5CBO A;  4BXL A;  1A56 A;  1OAE A;  5CBN A;  1CCH A;  1FOS F;  3LW5 H;  3JC2 2;  4ASV A;  3K5B A;  2KNC B;  1M90 Q;  2WVR A;  3GMA A;  1YCC A;  2QM8 A;  1KD1 Q;  3PXS A;  3NXS A;  2Q6Q A;  2ZZS 1;  2ZXE B;  1DW1 A;  4PV1 C;  1FU1 A;  4WQ7 A;  3KPE A;  3HQ6 A;  4R4L A;  3HE4 B;  1H88 A;  5GTH V;  3PH0 A;  2PCC B;  3CX5 D;  4WQ8 A;  4M3L A;  1FJ0 A;  5CCG C;  1AYG A;  2C1D B;  2Q7C A;  4N3Y B;  3TF5 A;  2P2U A;  1J2J B;  2ZYG A;  4PD4 H;  1X9V A;  2RMZ A;  2W6B A;  1AFO A;  3CCU P;  2OYH B;  5DF5 A;  3S9O A;  4H44 D;  4EID A;  2BEZ F;  1CTJ A;  1H9X A;  5APU A;  3MUD C;  4WQD A;  4UB8 E;  3AE8 C;  4NPF X;  3GHG C;  2J58 A;  2AEF A;  3RL0 C;  4PD4 I;  2N1T A;  2O1J A;  1OCD A;  1WT6 A;  3HRN A;  1YFC A;  2WSF H;  2Y0C A;  4WQA A;  4BRY A;  1VF5 D;  1ZR4 A;  1Y9B A;  1NH4 A;  1Q86 Q;  1OW6 A;  3CMA P;  3P8C D;  1U7M A;  1WVE C;  3GLM A;  3O6Q B;  3A9F A;  2QJK C;  1J3S A;  4LC1 A;  5AVY B;  3H1H D;  2IFM A;  1NGM B;  1EDK A;  1CRG A;  1W2E A;  1CIG A;  4YXW H;  2YIU B;  2OTL P;  3VP8 A;  1CO6 A;  2PCB B;  1IFM A;  2FYU D;  1NTZ G;  1BCC G;  1NKN A;  3CI9 A;  2N3Y A;  1EXI A;  3E1R A;  1HWT C;  4AAM A;  1SQQ J;  1NTZ K;  2NZ2 A;  1NAY A;  1A02 J;  3MK7 C;  3H1I D;  1BDD A;  2LXC B;  3AED C;  3DP5 A;  2FYN C;  2AEJ A;  5AW7 B;  1YJ9 P;  2E75 B;  1GMJ A;  1OZH A;  2E74 D;  4EYY Q;  4EDF A;  4LLH A;  2H7H A;  5H2F E;  3VMZ A;  1RF0 C;  2A06 E;  1AKK A;  1URQ A;  1YEA A;  3LW5 J;  2L4D A;  4H0K A;  2DVH A;  1L9B C;  2KZI A;  1AOF A;  2WSE H;  3AE9 C;  1F1C A;  2KSE A;  2H8P D;  1FE6 A;  1FZA A;  1OIP A;  2HOD A;  2KZJ A;  3PRJ A;  4ZMD A;  3NWV A;  1M1K Q;  2MKV A;  3V2Q A;  3AEB C;  2Q3E A;  2YNY A;  1KTM A;  4YPC A;  2FY8 A;  1FOS E;  1Q82 Q;  4WQB A;  3RK3 E;  1NO4 A;  3L4O A;  1HTL C;  2OYH C;  1E2R A;  1PFI A;  1RHZ B;  1PPJ D;  1U57 A;  1JY3 P;  1JMM A;  1CIE A;  1FDI A;  1H32 A;  1TU3 F;  1KQG B;  1NMI A;  2ZT9 D;  3ZOX A;  2GC4 D;  1SQB G;  3WU2 E;  1N86 A;  2ITA A;  3NBS A;  1COT A;  1SQB K;  4U3F D;  4JQ0 D;  2HLO A;  1QVF O;  3I5C A;  1LT9 A;  2K3R A;  4UB8 H;  1EDI A;  2A45 G;  3L70 G;  1YHQ P;  2KB7 P;  3NMD A;  3BCC J; 
#chains in the Genus database with same CATH homology
 3SVW A;  1A8C A;  3SLE A;  3M97 X;  4FA5 A;  5CIF B;  2QJY B;  1FOC A;  1YNR A;  2CE1 A;  3OCD B;  1NTM D;  2N3B A;  2FRC A;  3L72 D;  1K3G A;  5CIB B;  1LMS A;  5KLI B;  1GU2 A;  1C2N A;  1FI9 A;  2RN0 A;  1RAQ A;  2ZXY A;  5B5E V;  1IZL 0;  2EXV A;  1B7V A;  1I54 A;  2I8F A;  3H1K D;  3L75 D;  4EIF A;  3ZOW A;  4PJ0 V;  4A7P A;  1C6S A;  1QN2 A;  5CID B;  1WEJ F;  3L73 D;  3NBT A;  2B4Z A;  3H1J D;  1C6R A;  4AX3 A;  3WUI A;  3HQ7 A;  3TDK A;  2JWA A;  2N9J A;  4JCG A;  5H2F V;  1CIF A;  1CRI A;  1I8O A;  5C0Z A;  2N18 B;  2VHD A;  1ETP A;  1C7M A;  1QKS A;  2KS1 A;  2QJP B;  3PLN A;  2ZOO A;  1N9C A;  2C1D A;  4NFG B;  4O1Q A;  2GC7 D;  2B11 B;  4H0J A;  2BPB B;  4MU8 A;  5KKZ B;  1R0Q A;  2FWL A;  1KX7 A;  3DMI A;  4PW9 B;  1CRH A;  3VRD A;  1F1F A;  5TJH A;  5B66 V;  2C9X B;  2GIW A;  3CWB D;  3CP5 A;  1DW3 A;  1DVH A;  1CYI A;  3ZOO A;  4K3I A;  1HJ5 A;  2AXT V;  3PTZ A;  2PAC A;  1NIR A;  1CNO A;  1H33 B;  2LIR A;  5EXQ A;  3SXT A;  4FA1 A;  2N9Y B;  2MTA C;  3OA8 B;  3RN0 A;  1LS9 A;  3O20 A;  1DVV A;  1HH7 A;  2B10 B;  4WQ9 A;  1HRC A;  4J20 A;  3ZIY A;  1MG2 D;  4FA4 A;  3L74 D;  1GDV A;  5KAF V;  1L0L D;  3WU2 V;  1YEB A;  4GED B;  1CED A;  1H31 A;  5DJQ C;  1BL9 A;  1I55 A;  3SJL A;  3WFC C;  2L91 A;  1C75 A;  2LIT A;  1FI7 A;  1YTC A;  1FHB A;  2BH5 X;  4XXL A;  1CXA A;  3PHL A;  3VMA A;  1A2S A;  2OZ1 B;  451C A;  3CXH D;  4P4Q B;  2CA3 B;  1E29 A;  1CIH A;  3WC8 A;  3TGU D;  4Q5P A;  2YQB A;  1CC5 A;  4L1Q A;  4AAO A;  1GJQ A;  351C A;  1K3H A;  1YIC A;  1L9J C;  1IRV A;  1H32 B;  4DY9 A;  1HJ4 A;  2A06 D;  2C2C A;  4PWA A;  1BCC D;  1LC1 A;  5TIS V;  4RSZ A;  4GYD A;  4LJI A;  2BCN B;  1I5T A;  2QJK B;  1CHH A;  1IQC A;  4EIE A;  1CHJ A;  2N18 C;  4FAV A;  3WFE C;  1U74 B;  4D6T D;  5CIH B;  2B0Z B;  3HQ8 A;  3ORV A;  1LC2 A;  1IRW A;  2O3J A;  4RJT A;  1CYJ A;  1I6D A;  2DGE A;  1M70 A;  1N15 A;  3L71 D;  2V07 A;  1DW2 A;  4AAN A;  1N90 A;  3RN1 A;  5B6Q A;  1CRY A;  1EZV D;  2ZBO A;  1YIQ A;  3MK7 B;  5CIG B;  1GQ1 A;  1NML A;  2FYN B;  3O1Y A;  4XYD B;  1H9Y A;  1A56 A;  1KV9 A;  1OAE A;  5IY5 1;  5AUR A;  1CCH A;  1CYC A;  3A0H V;  2V08 A;  1U75 B;  1DT1 A;  2KNC B;  1YCC A;  1CTZ A;  3PXS A;  1CRJ A;  2ZZS 1;  3VYM A;  3JBT B;  155C A;  3FWL A;  2CE0 A;  1DW1 A;  2YCC A;  1NNO A;  4WQ7 A;  3HQ6 A;  1HCM A;  1SQV D;  1W5C T;  1CSW A;  1RAP A;  3PH2 B;  5GTH V;  3PXT A;  3KHU A;  1SQX D;  3TYI A;  2PCC B;  3CX5 D;  4WQ8 A;  1AOQ A;  1FJ0 A;  1CSV A;  4IL6 V;  2BH4 X;  1AYG A;  1DIQ C;  3C2C A;  2C1D B;  1RZ5 A;  3ZOY A;  3TF5 A;  5DFS A;  1HZV A;  3OCD A;  2HV4 A;  1VYD A;  2JTI B;  3GW6 A;  4FAN A;  2RMZ A;  3L70 D;  1BGY D;  1C52 A;  5DF5 A;  1ZRT D;  4EID A;  4FA9 A;  1CTJ A;  1H9X A;  4EIC A;  4WQD A;  2CA4 B;  3GG2 A;  2B12 B;  5C9M A;  4UB6 V;  5CYT R;  1FI3 A;  1SQQ D;  1H1O A;  4N0K A;  5E79 V;  2K9J B;  1CXC A;  4FB1 A;  1QL3 A;  1OCD A;  3VNW A;  3CX5 W;  1YFC A;  1QL4 A;  1DII C;  2Y0C A;  4WQA A;  3H1L D;  1E8E A;  1GIW A;  1KX2 A;  2GB8 B;  3CYT I;  1NTZ D;  1WVE C;  1CRC A;  1MG3 D;  1H31 B;  2BGV X;  1EB7 A;  3A9F A;  4WQE A;  1J3S A;  4YE1 A;  1CTY A;  2AI5 A;  3H1H D;  1HZU A;  1LFM A;  3L4M A;  1CRG A;  1CIG A;  3CXH W;  1HJ3 A;  2YIU B;  3SWS A;  1CO6 A;  1KB9 D;  1NTK D;  2PCB B;  4L3G A;  2QG4 A;  3WFB C;  2FYU D;  4QAO A;  2N3Y A;  3O0R C;  2C1V A;  1H33 A;  4AAM A;  1FCD C;  2MHM A;  2JQR A;  1COR A;  1JDL A;  3MK7 C;  1P84 D;  2D0S A;  2AIU A;  3H1I D;  3DP5 A;  1MZ4 A;  1CSX A;  1PP9 D;  3OA8 A;  1QYZ A;  4V2K A;  4Y5R A;  4PD4 D;  1C6O A;  1M6Z A;  1KB0 A;  4EDF A;  1CCR A;  1HRO A;  3HQ9 A;  5KAI V;  1IO3 A;  1CHI A;  1NU1 D;  2Y0D A;  1AKK A;  1KYO D;  2N9I A;  1C2R A;  3WFD C;  1YEA A;  2L4D A;  2YK3 A;  4H0K A;  2DVH A;  3PXW A;  1L9B C;  1W2L A;  1BE3 D;  5GTI V;  1DW0 A;  1AOF A;  1F1C A;  2Y0E A;  5CIE B;  1RZ6 A;  2D0W A;  1S5L V;  2OZ1 A;  4KMG A;  4L3H A;  3CU4 A;  3BCC D;  4AAL A;  3PRJ A;  2C8S A;  1KIB A;  1SQB D;  2ORL A;  3NWV A;  2BLF B;  3DR0 A;  2Q3E A;  2IBZ D;  3X39 A;  1GKS A;  3A0B V;  3RMZ A;  3ZCF A;  1M60 A;  4WQB A;  3L4O A;  3RLM A;  3KZI V;  1E2R A;  1PPJ D;  1L0N D;  1ZZH A;  3ITK A;  1I6E A;  5KLV D;  2BCC D;  1CIE A;  1KYO W;  1H32 A;  4UB8 V;  3ZBM A;  1S6V B;  1NMI A;  1I8P A;  3O5C A;  3ZOX A;  2GC4 D;  2C1U A;  5DJQ B;  4O1W A;  3NBS A;  1COT A;  4U3F D;  5CIC B;  2ZON G;  4WQC A;  1SQP D;  1CSU A;  2CXB A;  1N50 A;  2XTS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...