3L71D

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 74
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l71D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l71D02
3WFDC 1C7MA 4PJ0V 1NNOA 2ZZS1 1CTYA 4JCGA 1I54A 1YTCA 5CIBB 2HV4A 2GC4D 4QAOA 1EZVD 2FWLA 2V07A 3OCDB 2QJPB 1CTZA 1CIFA 4EIFA 1LFMA 1DIQC 2C1DA 1SQVD 3RN0A 2C1UA 3FWLA 1S5LV 2Y0CA 1CIEA 1IRVA 2B0ZB 5B66V 3GW6A 4WQ9A 4IL6V 1A8CA 3MK7C 1CORA 2VHDA 4WQDA 3ORVA 1L9JC 5E79V 1KB0A 2BCNB 5CIFB 4AAMA 2C8SA 1CSXA 2JTIB 3A0BV 5DFSA 3PLNA 3ZBMA 1ZZHA 1OAEA 1DT1A 4H0KA 3PH2B 3RMZA 1AKKA 1CRCA 1I8PA 1MZ4A 1KX7A 2BGVX 5KAFV 1M60A 4WQCA 2CA4B 2L91A 2V08A 2N9YB 3M97X 4MU8A 1QKSA 2Y0EA 3ZOWA 2XTSB 1U75B 4WQ8A 2MHMA 5B6QA 1C2RA 3OCDA 4FA4A 5CICB 1HCMA 1C6OA 1FHBA 4L1QA 4FA1A 3O1YA 351CA 1CCHA 2AI5A 3CX5W 1BCCD 1CCRA 2BPBB 5H2FV 1MG3D 2N18B 1NTKD 3A0HV 3PXTA 4WQBA 5DJQC 3WFCC 1L0ND 1SQPD 5KAIV 1N9CA 2C1DB 2ZXYA 1W2LA 1HH7A 2QJKB 2GB8B 1QL3A 2RN0A 3H1LD 4PW9B 1LC2A 4AX3A 1A56A 4V2KA 4FA5A 1CRJA 3L4OA 1KYOD 1IQCA 4RJTA 3H1JD 1E2RA 4PD4D 2EXVA 3ITKA 3SXTA 3C2CA 4N0KA 4AANA 4YE1A 1H31B 4L3GA 4O1QA 4PWAA 1IO3A 4J20A 2D0SA 2RMZA 1H9YA 1RAPA 4H0JA 1YIQA 5CIGB 3OA8B 4EIEA 1YEBA 5CIDB 4EDFA 1KX2A 4EIDA 3PHLA 1GDVA 5TJHA 3CXHW 5CIHB 3VRDA 1C52A 1H9XA 1GU2A 2Q3EA 3L71D 3PTZA 5KLIB 3ZOXA 1RZ5A 2GC7D 3CWBD 5KKZB 2QJYB 2DGEA 3WU2V 3L70D 3L75D 1FI7A 1CIHA 1LC1A 3L73D 1P84D 2N9IA 3VYMA 1PP9D 3X39A 2YIUB 1CXAA 2YQBA 4LJIA 1H31A 1CIGA 1F1CA 3O5CA 1CC5A 1RZ6A 3WFEC 4AAOA 4NFGB 3NBSA 2GIWA 3WUIA 1FJ0A 2YCCA 1CTJA 3OA8A 1HZVA 4P4QB 2CA3B 2BH4X 4AALA 2K9JB 155CA 1QYZA 1KB9D 1IZL0 3ZOOA 1GIWA 1BL9A 3MK7B 3GG2A 3DMIA 2FRCA 4KMGA 3ZIYA 4A7PA 2OZ1B 1N50A 3H1KD 1SQQD 2C9XB 2BLFB 1NTZD 4O1WA 1CSWA 1DW2A 1WEJF 1OCDA 4Q5PA 451CA 5GTIV 3HQ6A 1M6ZA 1LS9A 2KNCB 3WC8A 1NU1D 2JQRA 1J3SA 1MG2D 1VYDA 1KIBA 2ZOOA 3SVWA 2IBZD 1CRIA 1I5TA 3O20A 1H33B 1I6EA 1HROA 3PXWA 1N15A 3H1HD 2N3YA 3A9FA 5CYTR 1AOQA 1CRGA 1C6RA 1NIRA 1I6DA 1CYCA 4U3FD 1C2NA 3CP5A 2MTAC 4RSZA 1CO6A 1R0QA 3CXHD 3TDKA 1FOCA 2B4ZA 2L4DA 4Y5RA 4K3IA 4WQAA 2OZ1A 1C75A 5AURA 3L4MA 1PPJD 1FI9A 1E29A 1BGYD 1NTMD 2LIRA 1CSUA 1AYGA 1CHIA 1AOFA 1H1OA 5KLVD 1L0LD 2FYUD 2B11B 1KYOW 3VMAA 1DW1A 3SLEA 1I55A 1N90A 1QN2A 1K3GA 4FANA 4XXLA 1C6SA 1B7VA 1QL4A 5TISV 3RN1A 1IRWA 1YNRA 2BH5X 3VNWA 1CHHA 1W5CT 3L74D 1U74B 4FB1A 3PRJA 1CXCA 1H33A 2C2CA 2CE1A 2I8FA 2CXBA 3HQ8A 2ORLA 1RAQA 1CEDA 2Y0DA 2AXTV 1LMSA 2KS1A 1ETPA 4GYDA 1CYIA 4EICA 4XYDB 3CU4A 3TYIA 1KV9A 3TGUD 1YFCA 1DVVA 3CX5D 1SQBD 3O0RC 1DW0A 1GQ1A 1H32B 2LITA 3DP5A 4WQEA 2N18C 3KZIV 1JDLA 2YK3A 2PACA 3CYTI 2JWAA 3SWSA 2A06D 3NWVA 1K3HA 3HQ9A 2ZBOA 2PCCB 3ZCFA 1HJ4A 1CNOA 5CIEB 1DIIC 4GEDB 1CRYA 1WVEC 1COTA 2O3JA 3ZOYA 1DW3A 4WQ7A 5C0ZA 3KHUA 1SQXD 3NBTA 4D6TD 1YICA 1A2SA 2AIUA 1S6VB 3JBTB 2DVHA 3DR0A 3WFBC 2FYNB 5EXQA 1EB7A 1CHJA 3SJLA 1BE3D 2N9JA 1DVHA 1CYJA 1L9BC 1YEAA 1YCCA 5B5EV 2N3BA 2B10B 1M70A 1E8EA 1I8OA 4FAVA 2CE0A 3TF5A 3HQ7A 1HJ5A 1H32A 4DY9A 4L3HA 2QG4A 1NMLA 5DJQB 1FI3A 3H1ID 1CSVA 1HRCA 2C1VA 1ZRTD 2D0WA 1HJ3A 5GTHV 1GJQA 1GKSA 1F1FA 4UB6V 2BCCD 1HZUA 2PCBB 5DF5A 2B12B 3BCCD 1FCDC 5C9MA 3RLMA 4UB8V 2ZONG 3L72D 1NMIA 1CRHA 4FA9A 5IY51 3PXSA
chains in the Genus database with same CATH superfamily
4W7ZA 1HJBA 3HE4A 5APUA 4JCGA 1I54A 1OIPA 1Q7YQ 2Y9YA 1GW4A 2QJPB 1MV8A 2A06G 1LFMA 2C1DA 4WY4D 3RN0A 3FWNA 1SVFA 2W6JH 4KHXA 3WU2H 2B0ZB 5B66V 1JY3N 1A8CA 2CPSA 4R4LA 4WQDA 1KQFB 3ORVA 1L9JC 1KYOH 3QWOC 3E7KA 5CIFB 4AAMA 3CC4P 4DZOA 1LT1A 1BCCE 2C8SA 3B5NB 3AEDC 2JTIB 3A0BV 5DFSA 3PLNA 2NPSB 2RKLA 1ZZHA 1OAEA 1DT1A 2KZJA 3A5TA 4H44C 1DD3A 4L76A 1M60A 1N7SA 2ZYGA 2FBWC 2CA4B 2L91A 1M57D 3II6A 3M97X 1YYCA 2Y9ZA 1OW7A 1NAFA 2BCCG 1IK7A 3SWKA 3TNUB 3CX5I 4L1QA 4FA1A 1JTHA 2YNYA 1JY3O 351CA 1W5CE 3IAOA 5H2FV 3L72G 1NTKD 4KT0J 4WQBA 2OYOA 1W2BO 3WFCC 3HE5A 1Y9BA 1L0ND 5AVTB 2ZXYA 4DCKA 4Y99C 1M90Q 1HH7A 2QJKB 2GB8B 4PW9B 3MHVA 4H13B 4AX3A 2PGDA 1A56A 1NTMK 3AE2C 3RK3E 1LTAC 2WPQA 1WT6A 1IQCA 2J58A 2HODB 5KLVK 1L0LK 4H44D 3EWKA 3L71E 4N0KA 3HD7A 4L3GA 3JC22 3CWBE 4O1QA 4J20A 3P32A 1OX3A 4R4MA 1S9KD 2A45H 1YEBA 5AVZB 3OJAB 1FS0E 5BU8B 2P67A 1VQ5P 2B87B 1KTMA 3M9QA 4I6MC 2HLOA 2M3EA 3P8MC 2O01J 4BRYB 3B5NC 1SQBK 1SLQA 2XV5A 5AVRB 3ZOXA 1LP1A 1RZ5A 2GC7D 4N3YB 1KV4A 3H1KE 1SQQE 2P58A 4EI2A 2DGEA 4IFMA 1NTZE 1IFNA 3AE6C 2N1TB 1FI7A 1CIHA 3L73D 1LT9A 2N9IA 3MD0A 1HH0A 3X39A 1CXAA 1H31A 1YQ3C 1CIGA 3L72J 1PIXA 2QE7H 1CC5A 4AAOA 1X79B 1E79H 3H1LG 1G1IA 3WUIA 1SQXK 1NKNA 5BVZA 2LR2A 3I56P 1KB9D 1D7MA 1BL9A 1ZOYC 3GG2A 3D6YA 1AV1A 1FZFA 1GL2C 5E79E 2QJKC 1HGZA 2K88A 2IYPA 3G3ZA 4EOTA 4O1WA 1IFDA 3CXHE 1DW2A 4H13C 3B5ND 3Q1MA 2ZFCA 2OYHB 2KSJA 2Z4EA 2P7JA 1Y8AA 2PFXA 1CI6A 3M0DA 1K05A 2GM4A 3RBXA 2FXOA 1FZBA 1MG2D 1VYDA 2WPSA 1X22A 3LW5J 2KZIA 1I5TA 4GODA 4L74A 4DOJA 1VL2A 3O6QB 2P10A 3O20A 2FYUE 1VPCA 3AE1C 1U7MA 1N15A 2N3YA 3T97B 1CRGA 1PGQA 5GTHH 2ZVOB 1LJ2A 2H89C 2MTAC 1R5SA 1CO6A 1R0QA 2K9JA 1N2DC 3TDKA 1FOCA 2KS1B 2IFMA 3L70G 3BATA 5KAIE 2KB7P 3RGUA 1VQ7P 3I5CA 1L4AA 1SQVK 1PP9G 1GL2D 3P8CD 4GDOA 1FI9A 2W6AA 3LIDA 2B9BA 1TU3F 1M56D 5AVSB 1AYGA 4H13D 1CHIA 1AOFA 5APTA 1KYOI 3WMM0 2K9YA 4XA4A 4OWFA 3SLEA 1OMIA 2N1TC 2D2CD 1I55A 5CCHC 4LLHA 4FANA 1AA0A 1B7VA 2NZ2A 3WUUA 3Q3DA 1JEKA 2IFNA 3SSUA 2QRXA 1YNRA 2BH5X 1CHHA 2VRSA 2A06E 4UB8E 4FB1A 3RL0D 4JYBA 1YJNP 2M5AB 4JYCA 1GK4A 3AEGC 2ORLA 1KMIZ 1RAQA 1EDIA 1CEDA 2Y0DA 1QVFO 1BDCA 1CYIA 4XYDB 3CU4A 3D0WA 2IBZG 1DVVA 2C9NY 3RK2C 1DW0A 3EFFK 3DP5A 1E5WA 1RF1B 1NH4A 1N7LA 1PGOA 3M06A 5B66E 5AW5B 1YITP 3K5BA 2OYHC 3H1HG 1FOSE 1NKZB 3CCRP 1SQPK 2JWAA 3L4FA 1Q86Q 1FBMA 3HQ9A 4AYCA 1P84I 2PCCB 3WU2E 1S1CX 4QMAA 4TT3H 2K1AA 2N1TD 2N9BA 1IJDB 3NXSA 2ZYDA 3BVHA 4U7JA 2BCCE 1HBWA 1UIXA 3L70J 2YXRB 1RF0C 1S6VB 1NTMG 5KJ7C 5BU5A 2KLUA 2JWDA 3IR9A 3WUTA 3DR0A 3L72E 3WFBC 5EXQA 1GU4A 1L9BC 2A45I 1E8EA 4ZKUA 2CE0A 3RK2D 1EZVE 4DY9A 3CWBG 1NMLA 3L74G 5H2FE 1HRCA 3F5HA 1EXIA 1GJQA 1GKSA 4GIFA 2PCBB 3V2NA 4HB1A 5DF5A 2JEEA 2E74B 2Q5UA 2ZONG 3TGUG 3PXSA 3WFDC 1DD4A 3L75E 1C7MA 4PJ0V 3RL0g 1AFOA 2WSEJ 3B8EB 2HV4A 5KJ7D 2SPZA 1SQQG 1CIFA 1DIQC 1NTZG 2GUVA 2WTYA 4L73A 1WRGA 1FZCB 3FWLA 5L8RJ 1GL2A 5CMZA 2Y0CA 1IRVA 4WQ9A 3CI9A 2R5DA 1SQXG 3MK7C 4N78E 1DIPA 1PFIA 4D6TG 1NOHA 5E79V 2QM8A 3B71A 2BCNB 2W8ZA 1LGHB 1SFCC 3V5BA 3PH2B 1LTJA 1AKKA 1CRCA 1MZ4A 5KAFV 2AEMA 3D71A 3H1LE 1QVGO 2AEFA 3CCJP 1RQVA 2H43A 2V08A 1PL5A 1M1JA 3L71J 1NU1K 2LKMA 3I55P 3VMYA 2Y0EA 2W27A 3CWBJ 3H1JE 3A7OA 2MHMA 5B6QA 3OCDA 4PD4E 3H25A 1FHBA 5GTIH 2W83C 4YPCA 3GMAA 1BCCD 2BPBB 1MG3D 4BRYA 3V2PA 3A0HV 2FYUG 1X0TA 3RK3C 5KAIV 1KFMA 2GUSA 3AE7C 3Q5SA 1W2LA 3JCUE 5CBOA 3MP7B 1LC2A 2E74C 3SWFA 2Q6QA 1SFCD 4V2KA 1SQVG 2GA1A 3L4OA 2WT7A 1SQQJ 1E2RA 3MIWA 1URQD 5AW3B 2O1JA 4RESB 1NTZJ 3ITKA 2B88A 2E75C 2XU6A 1KB9H 1ZXGA 1MUUA 5CCGC 4PWAA 3OA7A 1FE6A 1MFZA 2FXPA 1SQXJ 3L70E 4H0JA 4D6TJ 1ZR2A 3CLQA 1FZCC 3E1RA 2WSFJ 2KLVA 1PP9E 1VF5B 3GHGA 4ZKPA 3FXEA 5TJHA 4HKZH 3RK3D 3VRDA 1FJPA 1C52A 2E76B 5TISH 5GTHE 3W68A 2IZ1A 2BASA 1GU2A 1H88A 3L71D 3PTZA 2WSCH 2E74D 4OGQB 3GF3A 3CWBD 1H8AA 3CPWO 1X8YA 1KILB 2R32A 1IO4A 2ZXEB 3WU2V 1AQ5A 2AXTH 1CSBA 3T97A 1DEBA 1RF0A 5KJ7A 2POHA 1SQPG 2E75D 2OGUA 5AVUB 2Q9IA 2YQBA 3CCEP 3AECC 3O5CA 5CCGD 2FYUJ 3KZIH 1HTLC 3A2AA 3H32B 1FJ0A 1ZP0C 1G1JA 2IBZE 1CTJA 3OA8A 1M1KQ 1A02J 155CA 1QYZA 3MUDC 1IZL0 1GIWA 1UIIA 3NFQA 3H1HE 4JBZA 5EFWB 1N50A 3H1KD 1SQQD 1FOSF 4U3FE 3L35A 2QM7A 4GT1A 1NTZD 1CSWA 1Q81Q 1RE3C 1H0TA 4BXLA 4Q5PA 3SFDC 2KNCB 3G71P 4JPZB 1EZVG 1P84H 1BGYE 5B5EH 1KIBA 1NTME 2ZOOA 2RH0A 3SVWA 4C7NA 3HTKB 3QH9A 5KLVE 1IFPA 1L0LE 3V4QA 1GDTA 1H33B 3RBZA 5K5GB 2KI7B 1GMJA 2WVRA 1T2KC 2FXMA 3Q5RA 1MFTA 1LTTC 1VF5C 1FU1A 2P2UA 3CXHD 3L74E 3N4XA 3V6IA 1RHZB 2QJPC 2B4ZA 4GOEA 4Y5RA 3L75G 1FDIA 4WQAA 2OZ1A 3L4MA 2YO2A 1M8OB 1G2CA 1SFCA 2LIRA 1CSUA 1FZGA 1H1OA 4OGQC 3V2RA 3TGUE 2FFDB 2LXBA 1SS1A 1KILC 1URQA 2FYUD 3CX5E 1SQBE 1DW1A 5DJUB 1QX8A 2KYVA 2NPSC 1S5LH 4NPDA 1C6SA 1EDLA 2E43A 1IRWA 1W5CT 4K3AA 2A45G 4IL6H 1U74B 1EC5A 5CHXA 2BCCJ 1S4XA 2C2CA 2CE1A 3U1CA 4AUWA 2FKWB 2XDJA 5AW9B 1RE4A 2OTJP 4PJ0E 2P1JA 1VF5D 3C1LA 1SQXE 4GYDA 4EICA 4D6TE 4WY4A 1NU1G 2PP6A 1KV9A 1VQ6P 2LXCB 3O0RC 4JQ0D 1GQ1A 1NWQA 3H1JG 1NTKK 3HUSB 1JDLA 2OARA 2ZT9B 2PACA 1L0NK 3FGAD 4OGQD 2A06D 1K3HA 2ZBOA 1HJ4A 3IN6A 1COTA 2O3JA 2NPSD 1JCCA 1PV3A 2KUBA 3NBTA 1PPJG 3HE4B 5KAFE 1YICA 3L75J 1VQKP 1KB9I 1BDDA 2W6BA 2M3BA 1CZQA 5AVQB 3SJLA 1YEAA 1M70A 1IFIA 1XTCC 4FAVA 3NTNA 1VQOP 1H32A 5AVVB 1Z56A 2QIWA 1FI3A 4NPEA 3SFEC 1OVRA 1CSVA 3A0HE 2C1VA 1SQVE 5GTHV 2E5YA 2FFDC 2BCCD 5GTIE 3F89A 3VYIA 1HZUA 4YXDC 1FCDC 5CBNA 3L72D 1CRHA 3CCLP 1N7SB 4FA9A 2YK3A 2YKOA 2ZZS1 1NU1J 3H1LJ 1GZLA 3S1KA 3WUVA 1YTCA 5CIBB 3BASA 2MKVA 4QAOA 3MUDA 1EZVD 1YJWP 2FWLA 2V07A 2JKVA 3H1JJ 1KILE 4Y28J 1JTHB 2C1UA 3EQ2A 2K3RA 1N73B 1RE3A 3HE5B 3BRTB 2YXQB 3HUSC 4N6JA 2ZT9C 3O8ZA 1FDMA 1USEA 3AE8C 2ITAA 3CCVP 2HPCA 1EDKA 1BE3G 1SQPE 1T6AA 2O01N 2KIKA 3TK1A 2BEQD 1I8PA 2Z5HA 1CW5A 4U3FG 4ZNCA 3PH0A 4WQCA 5M1BA 2N9YB 3H1IG 3HD7B 5CCHD 1QKSA 2KP8A 2KXPB 3ZOWA 2HR3A 1IFJA 1U75B 1KYOE 3CL3D 1GTWA 4RO0A 3PP5A 3TYYA 1C2RA 1JOCA 4N78D 2IPPA 2AXTE 3C8VA 1EDJA 2V4HA 1OVVA 1HCMA 3BCCG 1BGYG 5CJ4A 3O1YA 2JO1A 3CX5W 1PP9J 2N18B 4MN4C 3Q2YA 5KLVG 1VQPP 3PXTA 1L0LG 1OW6A 2R44A 2WZ7A 5APYA 3KXDA 2ZT9D 2HFED 2RN0A 3H1LD 1LNQA 1IFMA 3B5NA 3AEEC 2NPSA 1LP1B 3VP8A 4FA5A 1CRJA 2KSEA 3H1JD 1N7SC 1VQMP 1VQ8P 3R2PA 2WSSH 4PD4D 4TLFA 1NHLA 3CC7P 1H89A 1LT9B 3SXTA 3KYQA 1YBKA 2V7QJ 4YE1A 3SWYA 1H31B 1FZAA 2J59M 1IO3A 1H9YA 5AVWB 3VN0A 1SQBG 2J5UA 1T3JA 1Y47A 3TNUA 1P84E 3VOPA 1EXJA 3D70A 1N73C 1KX2A 4EIDA 3BRVB 3PHLA 1JCDA 1JMMA 1ZN5A 1HVVA 1GDVA 3VMXA 4HJGH 3CXHW 1BSHA 4IFDK 3H1HJ 2I8DA 2PRRA 1H9XA 1RH5B 5AW6B 4U3FJ 4OVNF 2WSFH 1RF1C 2Q3EA 5KLIB 2AXCA 1CI6B 2QJYB 1FAVA 3L37A 3L70D 2HODA 3L36A 1NTKG 2I1KA 1YTZI 3HD7C 1BGYJ 1L0NG 1NTMJ 1PP9D 2R3SA 4EIJA 4LJIA 2QVAA 1F1CA 5APWA 5KLVJ 1L0LJ 3WFEC 4NFGB 3NBSA 2GIWA 1NU1E 4I1LA 1KQSO 3AE9C 4P4QB 1KC8Q 2K9JB 1JB0J 2B87A 3DMIA 3L74J 2JP3A 1OZHA 2ZYAA 4IL6E 1K8AQ 3KPEA 4KMGA 4A7PA 3MGNA 1YQ4C 1L4AB 3M9BA 1LTIC 5DJTB 1ZR4A 4JF7A 451CA 5APSA 1S72P 5GTIV 3HQ6A 1M6ZA 5APQA 4H44B 3TGUJ 1PPJE 1SQBJ 3B4SA 3WC8A 1J3SA 1LT9C 2N1TA 2KK7A 5CCHA 2IBZD 1CRIA 2L5GB 1R5LA 4O9BA 1I6EA 1AOQA 3H1HD 5CYTR 4DJGA 1C6RA 1I6DA 4U3FD 3G6EP 2OQQA 4UB6H 1A02F 1OW8A 3M0AA 3V2QA 2H88C 1MZ9A 1AQTA 1S2EA 3VP9A 3L73G 2WITA 4UB8H 1OVUA 5AURA 1GU5A 1GK6A 1ZV8A 4NPFX 1KQGB 1BGYD 3NMDA 1NTMD 5KLIC 1DEEG 2XNDH 2OYHA 1USDA 4LC1A 5KLVD 1L0LD 3M0DC 1RQUA 3GLMA 2QJYC 1KYOW 3VMAA 4GOFA 3AEAC 1N90A 1FJKA 1MKMA 1K3GA 1YHQP 5AW7B 4XXLA 1J1EB 5TISV 3RN1A 3VNWA 5B66H 3O6QA 3L74D 1ZW0A 3PRJA 1PZQA 1KQLA 2O01H 3V4WA 2JR8A 2AXTV 3A0BH 3JSVC 5APVA 2KS1A 1YTZT 2YMYA 3AE5C 2WPVB 3TGUD 1L4AC 2WPRA 3CX5D 1SQBD 2LITA 1LTGC 2FY8A 3KZIV 2IYOA 1KFNA 1BE3E 1S5LX 1SQVJ 3CCUP 3S4RA 4IL6X 3SWSA 3NWVA 1T3UA 3TSIA 1LWUB 3ZCFA 3KQGA 3U59A 1CNOA 1VQLP 1DIIC 1CRYA 3H1IE 4BWNA 1ZRTE 4XFJA 4LGDE 1DW3A 4WQ7A 5C0ZA 5H2FH 1GW3A 2MJZA 3KHUA 4HH2A 1SQXD 3AE3C 4D6TD 2JJLA 1A2SA 1EQ7A 2AIUA 3BCCE 3L73J 3JBTB 2CPBA 2M5AA 3N7NA 2YMKA 1N73A 3MZWB 2OTKE 2DVHA 2FYNB 1N8RQ 1HWTC 2Q7CA 2N9JA 1DVHA 4EYYQ 1YCCA 5B5EV 2N3BA 1U7JA 1VQ9P 1GL2B 2Z5IA 2C0XA 1L4AD 3TF5A 3HQ7A 1HJ5A 3LW5H 1RF1A 5DJQB 3CMAP 2D0WA 3G9RA 3CD6P 1W2EA 1F1FA 2E76C 2D2CB 1N86A 1DH3A 1ZMEC 4WVZA 1HGVA 5C9MA 1LTJB 4RKUJ 2UWJE 1SQPJ 1VQNP 1J1EC 3FX0A 1NMIA 4C7RA 3C9IA 3RL0B 5AW1B 1JNMA 1NNOA 1CTYA 2Q3IA 1M1JB 2O1KA 3OW2O 1FC2C 3CXHI 1J2JB 2GC4D 2WSCJ 3OCDB 1CTZA 4EIFA 4XE5B 1QL1A 1SQVD 1QLED 1PGJA 1S5LV 5AVYB 1CIEA 1T2KD 3GW6A 4IL6V 1CORA 2VHDA 1KB0A 4PD4H 1AVYA 1JY2P 1SQQK 2E76D 1NTKE 1LWUC 1HUCA 4H0LB 1CSXA 3ZBMA 4B86A 1NTZK 1SP4A 1L0NE 4H0KA 3RMZA 1AVOA 2XZRA 2WT7B 4GKGA 3VTPC 2H8PD 1KX7A 2BGVX 2OYIB 1FDOA 1KILD 2QSIA 4WBAA 3D6ZA 2WQYC 5C39A 3JCUH 4MU8A 1RY3A 2XTSB 5CCGA 4WWIA 4Z1MH 2FYNC 4WQ8A 4FA4A 1KZUB 5CICB 2ZJSE 3Q5PA 4WB4A 1C6OA 1FZCA 3RK2B 3GHGB 1CCHA 3GF7A 2AI5A 2B89A 1CCRA 5DJQC 1JM0A 1K04A 3AE4C 1SQPD 2IX7C 1S9KE 1N9CA 2C1DB 4ASWA 1U57A 1DX7A 1NVOA 2D2CC 2E42A 3FXDA 3R4YA 2KOGA 1QL3A 1JY2N 1LTJC 1OXZA 1KYOD 2ZAEB 4RJTA 2Q1KA 3RL0C 3USSA 2EXVA 2FYUK 1M1JC 3C2CA 4AANA 2PAJA 1NYHA 1S3JA 4K35A 1IK9A 3KDPB 1K73Q 2D0SA 2RMZA 1M7LA 1RAPA 1JUNA 1YIQA 5CIGB 3L73E 3OA8B 4EIEA 1JMBA 2K37A 5CIDB 4EDFA 2V7QH 2C9LY 5CIHB 4I2LC 3A3YB 1QEXA 4IFFA 1NO4A 1WMKA 3VMZA 4UB6E 1KB9E 1JY2O 3CCQP 2WSEH 4H0LC 1H0TB 2IDBA 2YKPA 2FYZA 2E5TA 4C46A 5KKZB 3EFGA 3LIEA 2OYIC 1BCCG 3L75D 1LC1A 1P84D 3PJSK 2YO3A 3VYMA 1EZVI 4C7NB 2YIUB 3AEFC 2OTLP 4PV1B 3OAKA 1RZ6A 5TISE 1KD1Q 4W7YA 2YCCA 2HG5D 1HZVA 2CA3B 2BH4X 3GHGC 1OWAA 4AALA 2I1JA 3ZOOA 3MK7B 2WWWA 4M3LA 1YJ9P 1OFCX 2FRCA 2CK3H 3ZIYA 2OZ1B 3G4SP 1R8EA 2C9XB 2BLFB 1LTSC 1KN7A 1J1DB 1G2CB 1SFCB 1QL2A 2AEJA 1GD2E 1KORA 4H0LD 2DW3A 3HRNA 3A0BE 1WEJF 4KJMA 3KZIE 1OCDA 4AQRD 1URQB 1LS9A 1K9MQ 5APXA 1KILA 3P8CE 2JDIH 1NU1D 2JQRA 2G3AA 5CJ0A 4OH8B 2NRGA 3CCSP 4YXWH 1HROA 3PXWA 3A9FA 1VDFA 1NIRA 3H32A 3CX5H 3E1IA 3L71G 1CYCA 1C2NA 3CP5A 1YIJP 4RSZA 4I7ZB 1IC2A 3RK3B 2ZVNB 4WY4B 5AW8B 4YTPC 2L4DA 4K3IA 4ZMDA 1LTBC 1C75A 5B5EE 1PPJD 1E29A 1BCCJ 1ZLLA 4CPGA 1LWUA 4PJ0H 2YKQA 1BE3J 1NGMB 5AW0B 4PD4I 5KKZC 2B11B 1VQ4P 2KNCA 4W80A 2E75B 5KTBA 3ZDMA 1QN2A 2G8YA 1AJYA 1PGPA 3AEBC 3H1IJ 1L2PA 1QL4A 2YIUC 3HTKA 3H1KG 4PV1C 2ZXXA 3H6PA 1CXCA 1H33A 1N7SD 2I8FA 4ASVA 1HJ0A 2R5BA 5E79H 2CXBA 3HQ8A 3BCCJ 3CXHH 1IZNB 3IF4A 2IZ0A 1LMSA 1ETPA 3TYIA 5AW4B 2R3CA 1YFCA 2XNXA 5AVXB 2C0WA 1H32B 2M8RA 5KAFH 4WQEA 1S5LE 1J1DC 2N18C 1Q82Q 1X9VA 1NAYA 1HF9A 1URQC 3CYTI 2FFDA 3S9OA 1XTGB 3ABVC 3M91A 5CIEB 4GEDB 1WVEC 3ZOYA 4L75A 2XKMA 3IFMA 3A0HH 4PV1D 2QEXP 5AW2B 5KAIH 1T8ZA 1RE4C 3UIAA 2M0BA 3M9HA 2HYNA 1JO5A 3HD7D 4I7ZC 1EB7A 1CHJA 3U1AA 1BE3D 4WY4C 2BEZF 2W90A 4IOIH 1CYJA 2QA4P 1YI2P 2B10B 1JY3P 1I8OA 1QGKB 3P7KA 1NJIQ 1Q90D 1Q2NA 4L3HA 4HYTB 3CC2P 2QG4A 1FZEA 3H1ID 1ZRTD 3MTUE 1HJ3A 3HUSA 4Y99B 3W67A 3H1KJ 4UB6V 4DT0A 2OYIA 2HPCB 2IBZI 3CMEP 2B12B 1NTKJ 3BCCD 3CCMP 1BSNA 3RLMA 1L0NJ 4UB8V 2WMMA 2H7HA 5IY51
chains in the Genus database with same CATH topology
3WFDC 1C7MA 4PJ0V 1NNOA 2ZZS1 1CTYA 4JCGA 1I54A 1YTCA 5CIBB 2HV4A 2GC4D 4QAOA 1EZVD 2FWLA 2V07A 3OCDB 2QJPB 1CTZA 1CIFA 4EIFA 1LFMA 1DIQC 2C1DA 1SQVD 3RN0A 2C1UA 3FWLA 1S5LV 2Y0CA 1CIEA 1IRVA 2B0ZB 5B66V 3GW6A 4WQ9A 4IL6V 1A8CA 3MK7C 1CORA 2VHDA 4WQDA 3ORVA 1L9JC 5E79V 1KB0A 2BCNB 5CIFB 4AAMA 2C8SA 1CSXA 2JTIB 3A0BV 5DFSA 3PLNA 3ZBMA 1ZZHA 1OAEA 1DT1A 4H0KA 3PH2B 3RMZA 1AKKA 1CRCA 1I8PA 1MZ4A 1KX7A 2BGVX 5KAFV 1M60A 4WQCA 2CA4B 2L91A 2V08A 2N9YB 3M97X 4MU8A 1QKSA 2Y0EA 3ZOWA 2XTSB 1U75B 4WQ8A 2MHMA 5B6QA 1C2RA 3OCDA 4FA4A 5CICB 1HCMA 1C6OA 1FHBA 4L1QA 4FA1A 3O1YA 351CA 1CCHA 2AI5A 3CX5W 1BCCD 1CCRA 2BPBB 5H2FV 1MG3D 2N18B 1NTKD 3A0HV 3PXTA 4WQBA 5DJQC 3WFCC 1L0ND 1SQPD 5KAIV 1N9CA 2C1DB 2ZXYA 1W2LA 1HH7A 2QJKB 2GB8B 1QL3A 2RN0A 3H1LD 4PW9B 1LC2A 4AX3A 1A56A 4V2KA 4FA5A 1CRJA 3L4OA 1KYOD 1IQCA 4RJTA 3H1JD 1E2RA 4PD4D 2EXVA 3ITKA 3SXTA 3C2CA 4N0KA 4AANA 4YE1A 1H31B 4L3GA 4O1QA 4PWAA 1IO3A 4J20A 2D0SA 2RMZA 1H9YA 1RAPA 4H0JA 1YIQA 5CIGB 3OA8B 4EIEA 1YEBA 5CIDB 4EDFA 1KX2A 4EIDA 3PHLA 1GDVA 5TJHA 3CXHW 5CIHB 3VRDA 1C52A 1H9XA 1GU2A 2Q3EA 3L71D 3PTZA 5KLIB 3ZOXA 1RZ5A 2GC7D 3CWBD 5KKZB 2QJYB 2DGEA 3WU2V 3L70D 3L75D 1FI7A 1CIHA 1LC1A 3L73D 1P84D 2N9IA 3VYMA 1PP9D 3X39A 2YIUB 1CXAA 2YQBA 4LJIA 1H31A 1CIGA 1F1CA 3O5CA 1CC5A 1RZ6A 3WFEC 4AAOA 4NFGB 3NBSA 2GIWA 3WUIA 1FJ0A 2YCCA 1CTJA 3OA8A 1HZVA 4P4QB 2CA3B 2BH4X 4AALA 2K9JB 155CA 1QYZA 1KB9D 1IZL0 3ZOOA 1GIWA 1BL9A 3MK7B 3GG2A 3DMIA 2FRCA 4KMGA 3ZIYA 4A7PA 2OZ1B 1N50A 3H1KD 1SQQD 2C9XB 2BLFB 1NTZD 4O1WA 1CSWA 1DW2A 1WEJF 1OCDA 4Q5PA 451CA 5GTIV 3HQ6A 1M6ZA 1LS9A 2KNCB 3WC8A 1NU1D 2JQRA 1J3SA 1MG2D 1VYDA 1KIBA 2ZOOA 3SVWA 2IBZD 1CRIA 1I5TA 3O20A 1H33B 1I6EA 1HROA 3PXWA 1N15A 3H1HD 2N3YA 3A9FA 5CYTR 1AOQA 1CRGA 1C6RA 1NIRA 1I6DA 1CYCA 4U3FD 1C2NA 3CP5A 2MTAC 4RSZA 1CO6A 1R0QA 3CXHD 3TDKA 1FOCA 2B4ZA 2L4DA 4Y5RA 4K3IA 4WQAA 2OZ1A 1C75A 5AURA 3L4MA 1PPJD 1FI9A 1E29A 1BGYD 1NTMD 2LIRA 1CSUA 1AYGA 1CHIA 1AOFA 1H1OA 5KLVD 1L0LD 2FYUD 2B11B 1KYOW 3VMAA 1DW1A 3SLEA 1I55A 1N90A 1QN2A 1K3GA 4FANA 4XXLA 1C6SA 1B7VA 1QL4A 5TISV 3RN1A 1IRWA 1YNRA 2BH5X 3VNWA 1CHHA 1W5CT 3L74D 1U74B 4FB1A 3PRJA 1CXCA 1H33A 2C2CA 2CE1A 2I8FA 2CXBA 3HQ8A 2ORLA 1RAQA 1CEDA 2Y0DA 2AXTV 1LMSA 2KS1A 1ETPA 4GYDA 1CYIA 4EICA 4XYDB 3CU4A 3TYIA 1KV9A 3TGUD 1YFCA 1DVVA 3CX5D 1SQBD 3O0RC 1DW0A 1GQ1A 1H32B 2LITA 3DP5A 4WQEA 2N18C 3KZIV 1JDLA 2YK3A 2PACA 3CYTI 2JWAA 3SWSA 2A06D 3NWVA 1K3HA 3HQ9A 2ZBOA 2PCCB 3ZCFA 1HJ4A 1CNOA 5CIEB 1DIIC 4GEDB 1CRYA 1WVEC 1COTA 2O3JA 3ZOYA 1DW3A 4WQ7A 5C0ZA 3KHUA 1SQXD 3NBTA 4D6TD 1YICA 1A2SA 2AIUA 1S6VB 3JBTB 2DVHA 3DR0A 3WFBC 2FYNB 5EXQA 1EB7A 1CHJA 3SJLA 1BE3D 2N9JA 1DVHA 1CYJA 1L9BC 1YEAA 1YCCA 5B5EV 2N3BA 2B10B 1M70A 1E8EA 1I8OA 4FAVA 2CE0A 3TF5A 3HQ7A 1HJ5A 1H32A 4DY9A 4L3HA 2QG4A 1NMLA 5DJQB 1FI3A 3H1ID 1CSVA 1HRCA 2C1VA 1ZRTD 2D0WA 1HJ3A 5GTHV 1GJQA 1GKSA 1F1FA 4UB6V 2BCCD 1HZUA 2PCBB 5DF5A 2B12B 3BCCD 1FCDC 5C9MA 3RLMA 4UB8V 2ZONG 3L72D 1NMIA 1CRHA 4FA9A 5IY51 3PXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WFD C;  1C7M A;  4PJ0 V;  1NNO A;  2ZZS 1;  1CTY A;  4JCG A;  1I54 A;  1YTC A;  5CIB B;  2HV4 A;  2GC4 D;  4QAO A;  1EZV D;  2FWL A;  2V07 A;  3OCD B;  2QJP B;  1CTZ A;  1CIF A;  4EIF A;  1LFM A;  1DIQ C;  2C1D A;  1SQV D;  3RN0 A;  2C1U A;  3FWL A;  1S5L V;  2Y0C A;  1CIE A;  1IRV A;  2B0Z B;  5B66 V;  3GW6 A;  4WQ9 A;  4IL6 V;  1A8C A;  3MK7 C;  1COR A;  2VHD A;  4WQD A;  3ORV A;  1L9J C;  5E79 V;  1KB0 A;  2BCN B;  5CIF B;  4AAM A;  2C8S A;  1CSX A;  2JTI B;  3A0B V;  5DFS A;  3PLN A;  3ZBM A;  1ZZH A;  1OAE A;  1DT1 A;  4H0K A;  3PH2 B;  3RMZ A;  1AKK A;  1CRC A;  1I8P A;  1MZ4 A;  1KX7 A;  2BGV X;  5KAF V;  1M60 A;  4WQC A;  2CA4 B;  2L91 A;  2V08 A;  2N9Y B;  3M97 X;  4MU8 A;  1QKS A;  2Y0E A;  3ZOW A;  2XTS B;  1U75 B;  4WQ8 A;  2MHM A;  5B6Q A;  1C2R A;  3OCD A;  4FA4 A;  5CIC B;  1HCM A;  1C6O A;  1FHB A;  4L1Q A;  4FA1 A;  3O1Y A;  351C A;  1CCH A;  2AI5 A;  3CX5 W;  1BCC D;  1CCR A;  2BPB B;  5H2F V;  1MG3 D;  2N18 B;  1NTK D;  3A0H V;  3PXT A;  4WQB A;  5DJQ C;  3WFC C;  1L0N D;  1SQP D;  5KAI V;  1N9C A;  2C1D B;  2ZXY A;  1W2L A;  1HH7 A;  2QJK B;  2GB8 B;  1QL3 A;  2RN0 A;  3H1L D;  4PW9 B;  1LC2 A;  4AX3 A;  1A56 A;  4V2K A;  4FA5 A;  1CRJ A;  3L4O A;  1KYO D;  1IQC A;  4RJT A;  3H1J D;  1E2R A;  4PD4 D;  2EXV A;  3ITK A;  3SXT A;  3C2C A;  4N0K A;  4AAN A;  4YE1 A;  1H31 B;  4L3G A;  4O1Q A;  4PWA A;  1IO3 A;  4J20 A;  2D0S A;  2RMZ A;  1H9Y A;  1RAP A;  4H0J A;  1YIQ A;  5CIG B;  3OA8 B;  4EIE A;  1YEB A;  5CID B;  4EDF A;  1KX2 A;  4EID A;  3PHL A;  1GDV A;  5TJH A;  3CXH W;  5CIH B;  3VRD A;  1C52 A;  1H9X A;  1GU2 A;  2Q3E A;  3L71 D;  3PTZ A;  5KLI B;  3ZOX A;  1RZ5 A;  2GC7 D;  3CWB D;  5KKZ B;  2QJY B;  2DGE A;  3WU2 V;  3L70 D;  3L75 D;  1FI7 A;  1CIH A;  1LC1 A;  3L73 D;  1P84 D;  2N9I A;  3VYM A;  1PP9 D;  3X39 A;  2YIU B;  1CXA A;  2YQB A;  4LJI A;  1H31 A;  1CIG A;  1F1C A;  3O5C A;  1CC5 A;  1RZ6 A;  3WFE C;  4AAO A;  4NFG B;  3NBS A;  2GIW A;  3WUI A;  1FJ0 A;  2YCC A;  1CTJ A;  3OA8 A;  1HZV A;  4P4Q B;  2CA3 B;  2BH4 X;  4AAL A;  2K9J B;  155C A;  1QYZ A;  1KB9 D;  1IZL 0;  3ZOO A;  1GIW A;  1BL9 A;  3MK7 B;  3GG2 A;  3DMI A;  2FRC A;  4KMG A;  3ZIY A;  4A7P A;  2OZ1 B;  1N50 A;  3H1K D;  1SQQ D;  2C9X B;  2BLF B;  1NTZ D;  4O1W A;  1CSW A;  1DW2 A;  1WEJ F;  1OCD A;  4Q5P A;  451C A;  5GTI V;  3HQ6 A;  1M6Z A;  1LS9 A;  2KNC B;  3WC8 A;  1NU1 D;  2JQR A;  1J3S A;  1MG2 D;  1VYD A;  1KIB A;  2ZOO A;  3SVW A;  2IBZ D;  1CRI A;  1I5T A;  3O20 A;  1H33 B;  1I6E A;  1HRO A;  3PXW A;  1N15 A;  3H1H D;  2N3Y A;  3A9F A;  5CYT R;  1AOQ A;  1CRG A;  1C6R A;  1NIR A;  1I6D A;  1CYC A;  4U3F D;  1C2N A;  3CP5 A;  2MTA C;  4RSZ A;  1CO6 A;  1R0Q A;  3CXH D;  3TDK A;  1FOC A;  2B4Z A;  2L4D A;  4Y5R A;  4K3I A;  4WQA A;  2OZ1 A;  1C75 A;  5AUR A;  3L4M A;  1PPJ D;  1FI9 A;  1E29 A;  1BGY D;  1NTM D;  2LIR A;  1CSU A;  1AYG A;  1CHI A;  1AOF A;  1H1O A;  5KLV D;  1L0L D;  2FYU D;  2B11 B;  1KYO W;  3VMA A;  1DW1 A;  3SLE A;  1I55 A;  1N90 A;  1QN2 A;  1K3G A;  4FAN A;  4XXL A;  1C6S A;  1B7V A;  1QL4 A;  5TIS V;  3RN1 A;  1IRW A;  1YNR A;  2BH5 X;  3VNW A;  1CHH A;  1W5C T;  3L74 D;  1U74 B;  4FB1 A;  3PRJ A;  1CXC A;  1H33 A;  2C2C A;  2CE1 A;  2I8F A;  2CXB A;  3HQ8 A;  2ORL A;  1RAQ A;  1CED A;  2Y0D A;  2AXT V;  1LMS A;  2KS1 A;  1ETP A;  4GYD A;  1CYI A;  4EIC A;  4XYD B;  3CU4 A;  3TYI A;  1KV9 A;  3TGU D;  1YFC A;  1DVV A;  3CX5 D;  1SQB D;  3O0R C;  1DW0 A;  1GQ1 A;  1H32 B;  2LIT A;  3DP5 A;  4WQE A;  2N18 C;  3KZI V;  1JDL A;  2YK3 A;  2PAC A;  3CYT I;  2JWA A;  3SWS A;  2A06 D;  3NWV A;  1K3H A;  3HQ9 A;  2ZBO A;  2PCC B;  3ZCF A;  1HJ4 A;  1CNO A;  5CIE B;  1DII C;  4GED B;  1CRY A;  1WVE C;  1COT A;  2O3J A;  3ZOY A;  1DW3 A;  4WQ7 A;  5C0Z A;  3KHU A;  1SQX D;  3NBT A;  4D6T D;  1YIC A;  1A2S A;  2AIU A;  1S6V B;  3JBT B;  2DVH A;  3DR0 A;  3WFB C;  2FYN B;  5EXQ A;  1EB7 A;  1CHJ A;  3SJL A;  1BE3 D;  2N9J A;  1DVH A;  1CYJ A;  1L9B C;  1YEA A;  1YCC A;  5B5E V;  2N3B A;  2B10 B;  1M70 A;  1E8E A;  1I8O A;  4FAV A;  2CE0 A;  3TF5 A;  3HQ7 A;  1HJ5 A;  1H32 A;  4DY9 A;  4L3H A;  2QG4 A;  1NML A;  5DJQ B;  1FI3 A;  3H1I D;  1CSV A;  1HRC A;  2C1V A;  1ZRT D;  2D0W A;  1HJ3 A;  5GTH V;  1GJQ A;  1GKS A;  1F1F A;  4UB6 V;  2BCC D;  1HZU A;  2PCB B;  5DF5 A;  2B12 B;  3BCC D;  1FCD C;  5C9M A;  3RLM A;  4UB8 V;  2ZON G;  3L72 D;  1NMI A;  1CRH A;  4FA9 A;  5IY5 1;  3PXS A; 
#chains in the Genus database with same CATH topology
 4W7Z A;  1HJB A;  3HE4 A;  5APU A;  4JCG A;  1I54 A;  1OIP A;  1Q7Y Q;  2Y9Y A;  1GW4 A;  2QJP B;  1MV8 A;  2A06 G;  1LFM A;  2C1D A;  4WY4 D;  3RN0 A;  3FWN A;  1SVF A;  2W6J H;  4KHX A;  3WU2 H;  2B0Z B;  5B66 V;  1JY3 N;  1A8C A;  2CPS A;  4R4L A;  4WQD A;  1KQF B;  3ORV A;  1L9J C;  1KYO H;  3QWO C;  3E7K A;  5CIF B;  4AAM A;  3CC4 P;  4DZO A;  1LT1 A;  1BCC E;  2C8S A;  3B5N B;  3AED C;  2JTI B;  3A0B V;  5DFS A;  3PLN A;  2NPS B;  2RKL A;  1ZZH A;  1OAE A;  1DT1 A;  2KZJ A;  3A5T A;  4H44 C;  1DD3 A;  4L76 A;  1M60 A;  1N7S A;  2ZYG A;  2FBW C;  2CA4 B;  2L91 A;  1M57 D;  3II6 A;  3M97 X;  1YYC A;  2Y9Z A;  1OW7 A;  1NAF A;  2BCC G;  1IK7 A;  3SWK A;  3TNU B;  3CX5 I;  4L1Q A;  4FA1 A;  1JTH A;  2YNY A;  1JY3 O;  351C A;  1W5C E;  3IAO A;  5H2F V;  3L72 G;  1NTK D;  4KT0 J;  4WQB A;  2OYO A;  1W2B O;  3WFC C;  3HE5 A;  1Y9B A;  1L0N D;  5AVT B;  2ZXY A;  4DCK A;  4Y99 C;  1M90 Q;  1HH7 A;  2QJK B;  2GB8 B;  4PW9 B;  3MHV A;  4H13 B;  4AX3 A;  2PGD A;  1A56 A;  1NTM K;  3AE2 C;  3RK3 E;  1LTA C;  2WPQ A;  1WT6 A;  1IQC A;  2J58 A;  2HOD B;  5KLV K;  1L0L K;  4H44 D;  3EWK A;  3L71 E;  4N0K A;  3HD7 A;  4L3G A;  3JC2 2;  3CWB E;  4O1Q A;  4J20 A;  3P32 A;  1OX3 A;  4R4M A;  1S9K D;  2A45 H;  1YEB A;  5AVZ B;  3OJA B;  1FS0 E;  5BU8 B;  2P67 A;  1VQ5 P;  2B87 B;  1KTM A;  3M9Q A;  4I6M C;  2HLO A;  2M3E A;  3P8M C;  2O01 J;  4BRY B;  3B5N C;  1SQB K;  1SLQ A;  2XV5 A;  5AVR B;  3ZOX A;  1LP1 A;  1RZ5 A;  2GC7 D;  4N3Y B;  1KV4 A;  3H1K E;  1SQQ E;  2P58 A;  4EI2 A;  2DGE A;  4IFM A;  1NTZ E;  1IFN A;  3AE6 C;  2N1T B;  1FI7 A;  1CIH A;  3L73 D;  1LT9 A;  2N9I A;  3MD0 A;  1HH0 A;  3X39 A;  1CXA A;  1H31 A;  1YQ3 C;  1CIG A;  3L72 J;  1PIX A;  2QE7 H;  1CC5 A;  4AAO A;  1X79 B;  1E79 H;  3H1L G;  1G1I A;  3WUI A;  1SQX K;  1NKN A;  5BVZ A;  2LR2 A;  3I56 P;  1KB9 D;  1D7M A;  1BL9 A;  1ZOY C;  3GG2 A;  3D6Y A;  1AV1 A;  1FZF A;  1GL2 C;  5E79 E;  2QJK C;  1HGZ A;  2K88 A;  2IYP A;  3G3Z A;  4EOT A;  4O1W A;  1IFD A;  3CXH E;  1DW2 A;  4H13 C;  3B5N D;  3Q1M A;  2ZFC A;  2OYH B;  2KSJ A;  2Z4E A;  2P7J A;  1Y8A A;  2PFX A;  1CI6 A;  3M0D A;  1K05 A;  2GM4 A;  3RBX A;  2FXO A;  1FZB A;  1MG2 D;  1VYD A;  2WPS A;  1X22 A;  3LW5 J;  2KZI A;  1I5T A;  4GOD A;  4L74 A;  4DOJ A;  1VL2 A;  3O6Q B;  2P10 A;  3O20 A;  2FYU E;  1VPC A;  3AE1 C;  1U7M A;  1N15 A;  2N3Y A;  3T97 B;  1CRG A;  1PGQ A;  5GTH H;  2ZVO B;  1LJ2 A;  2H89 C;  2MTA C;  1R5S A;  1CO6 A;  1R0Q A;  2K9J A;  1N2D C;  3TDK A;  1FOC A;  2KS1 B;  2IFM A;  3L70 G;  3BAT A;  5KAI E;  2KB7 P;  3RGU A;  1VQ7 P;  3I5C A;  1L4A A;  1SQV K;  1PP9 G;  1GL2 D;  3P8C D;  4GDO A;  1FI9 A;  2W6A A;  3LID A;  2B9B A;  1TU3 F;  1M56 D;  5AVS B;  1AYG A;  4H13 D;  1CHI A;  1AOF A;  5APT A;  1KYO I;  3WMM 0;  2K9Y A;  4XA4 A;  4OWF A;  3SLE A;  1OMI A;  2N1T C;  2D2C D;  1I55 A;  5CCH C;  4LLH A;  4FAN A;  1AA0 A;  1B7V A;  2NZ2 A;  3WUU A;  3Q3D A;  1JEK A;  2IFN A;  3SSU A;  2QRX A;  1YNR A;  2BH5 X;  1CHH A;  2VRS A;  2A06 E;  4UB8 E;  4FB1 A;  3RL0 D;  4JYB A;  1YJN P;  2M5A B;  4JYC A;  1GK4 A;  3AEG C;  2ORL A;  1KMI Z;  1RAQ A;  1EDI A;  1CED A;  2Y0D A;  1QVF O;  1BDC A;  1CYI A;  4XYD B;  3CU4 A;  3D0W A;  2IBZ G;  1DVV A;  2C9N Y;  3RK2 C;  1DW0 A;  3EFF K;  3DP5 A;  1E5W A;  1RF1 B;  1NH4 A;  1N7L A;  1PGO A;  3M06 A;  5B66 E;  5AW5 B;  1YIT P;  3K5B A;  2OYH C;  3H1H G;  1FOS E;  1NKZ B;  3CCR P;  1SQP K;  2JWA A;  3L4F A;  1Q86 Q;  1FBM A;  3HQ9 A;  4AYC A;  1P84 I;  2PCC B;  3WU2 E;  1S1C X;  4QMA A;  4TT3 H;  2K1A A;  2N1T D;  2N9B A;  1IJD B;  3NXS A;  2ZYD A;  3BVH A;  4U7J A;  2BCC E;  1HBW A;  1UIX A;  3L70 J;  2YXR B;  1RF0 C;  1S6V B;  1NTM G;  5KJ7 C;  5BU5 A;  2KLU A;  2JWD A;  3IR9 A;  3WUT A;  3DR0 A;  3L72 E;  3WFB C;  5EXQ A;  1GU4 A;  1L9B C;  2A45 I;  1E8E A;  4ZKU A;  2CE0 A;  3RK2 D;  1EZV E;  4DY9 A;  3CWB G;  1NML A;  3L74 G;  5H2F E;  1HRC A;  3F5H A;  1EXI A;  1GJQ A;  1GKS A;  4GIF A;  2PCB B;  3V2N A;  4HB1 A;  5DF5 A;  2JEE A;  2E74 B;  2Q5U A;  2ZON G;  3TGU G;  3PXS A;  3WFD C;  1DD4 A;  3L75 E;  1C7M A;  4PJ0 V;  3RL0 g;  1AFO A;  2WSE J;  3B8E B;  2HV4 A;  5KJ7 D;  2SPZ A;  1SQQ G;  1CIF A;  1DIQ C;  1NTZ G;  2GUV A;  2WTY A;  4L73 A;  1WRG A;  1FZC B;  3FWL A;  5L8R J;  1GL2 A;  5CMZ A;  2Y0C A;  1IRV A;  4WQ9 A;  3CI9 A;  2R5D A;  1SQX G;  3MK7 C;  4N78 E;  1DIP A;  1PFI A;  4D6T G;  1NOH A;  5E79 V;  2QM8 A;  3B71 A;  2BCN B;  2W8Z A;  1LGH B;  1SFC C;  3V5B A;  3PH2 B;  1LTJ A;  1AKK A;  1CRC A;  1MZ4 A;  5KAF V;  2AEM A;  3D71 A;  3H1L E;  1QVG O;  2AEF A;  3CCJ P;  1RQV A;  2H43 A;  2V08 A;  1PL5 A;  1M1J A;  3L71 J;  1NU1 K;  2LKM A;  3I55 P;  3VMY A;  2Y0E A;  2W27 A;  3CWB J;  3H1J E;  3A7O A;  2MHM A;  5B6Q A;  3OCD A;  4PD4 E;  3H25 A;  1FHB A;  5GTI H;  2W83 C;  4YPC A;  3GMA A;  1BCC D;  2BPB B;  1MG3 D;  4BRY A;  3V2P A;  3A0H V;  2FYU G;  1X0T A;  3RK3 C;  5KAI V;  1KFM A;  2GUS A;  3AE7 C;  3Q5S A;  1W2L A;  3JCU E;  5CBO A;  3MP7 B;  1LC2 A;  2E74 C;  3SWF A;  2Q6Q A;  1SFC D;  4V2K A;  1SQV G;  2GA1 A;  3L4O A;  2WT7 A;  1SQQ J;  1E2R A;  3MIW A;  1URQ D;  5AW3 B;  2O1J A;  4RES B;  1NTZ J;  3ITK A;  2B88 A;  2E75 C;  2XU6 A;  1KB9 H;  1ZXG A;  1MUU A;  5CCG C;  4PWA A;  3OA7 A;  1FE6 A;  1MFZ A;  2FXP A;  1SQX J;  3L70 E;  4H0J A;  4D6T J;  1ZR2 A;  3CLQ A;  1FZC C;  3E1R A;  2WSF J;  2KLV A;  1PP9 E;  1VF5 B;  3GHG A;  4ZKP A;  3FXE A;  5TJH A;  4HKZ H;  3RK3 D;  3VRD A;  1FJP A;  1C52 A;  2E76 B;  5TIS H;  5GTH E;  3W68 A;  2IZ1 A;  2BAS A;  1GU2 A;  1H88 A;  3L71 D;  3PTZ A;  2WSC H;  2E74 D;  4OGQ B;  3GF3 A;  3CWB D;  1H8A A;  3CPW O;  1X8Y A;  1KIL B;  2R32 A;  1IO4 A;  2ZXE B;  3WU2 V;  1AQ5 A;  2AXT H;  1CSB A;  3T97 A;  1DEB A;  1RF0 A;  5KJ7 A;  2POH A;  1SQP G;  2E75 D;  2OGU A;  5AVU B;  2Q9I A;  2YQB A;  3CCE P;  3AEC C;  3O5C A;  5CCG D;  2FYU J;  3KZI H;  1HTL C;  3A2A A;  3H32 B;  1FJ0 A;  1ZP0 C;  1G1J A;  2IBZ E;  1CTJ A;  3OA8 A;  1M1K Q;  1A02 J;  155C A;  1QYZ A;  3MUD C;  1IZL 0;  1GIW A;  1UII A;  3NFQ A;  3H1H E;  4JBZ A;  5EFW B;  1N50 A;  3H1K D;  1SQQ D;  1FOS F;  4U3F E;  3L35 A;  2QM7 A;  4GT1 A;  1NTZ D;  1CSW A;  1Q81 Q;  1RE3 C;  1H0T A;  4BXL A;  4Q5P A;  3SFD C;  2KNC B;  3G71 P;  4JPZ B;  1EZV G;  1P84 H;  1BGY E;  5B5E H;  1KIB A;  1NTM E;  2ZOO A;  2RH0 A;  3SVW A;  4C7N A;  3HTK B;  3QH9 A;  5KLV E;  1IFP A;  1L0L E;  3V4Q A;  1GDT A;  1H33 B;  3RBZ A;  5K5G B;  2KI7 B;  1GMJ A;  2WVR A;  1T2K C;  2FXM A;  3Q5R A;  1MFT A;  1LTT C;  1VF5 C;  1FU1 A;  2P2U A;  3CXH D;  3L74 E;  3N4X A;  3V6I A;  1RHZ B;  2QJP C;  2B4Z A;  4GOE A;  4Y5R A;  3L75 G;  1FDI A;  4WQA A;  2OZ1 A;  3L4M A;  2YO2 A;  1M8O B;  1G2C A;  1SFC A;  2LIR A;  1CSU A;  1FZG A;  1H1O A;  4OGQ C;  3V2R A;  3TGU E;  2FFD B;  2LXB A;  1SS1 A;  1KIL C;  1URQ A;  2FYU D;  3CX5 E;  1SQB E;  1DW1 A;  5DJU B;  1QX8 A;  2KYV A;  2NPS C;  1S5L H;  4NPD A;  1C6S A;  1EDL A;  2E43 A;  1IRW A;  1W5C T;  4K3A A;  2A45 G;  4IL6 H;  1U74 B;  1EC5 A;  5CHX A;  2BCC J;  1S4X A;  2C2C A;  2CE1 A;  3U1C A;  4AUW A;  2FKW B;  2XDJ A;  5AW9 B;  1RE4 A;  2OTJ P;  4PJ0 E;  2P1J A;  1VF5 D;  3C1L A;  1SQX E;  4GYD A;  4EIC A;  4D6T E;  4WY4 A;  1NU1 G;  2PP6 A;  1KV9 A;  1VQ6 P;  2LXC B;  3O0R C;  4JQ0 D;  1GQ1 A;  1NWQ A;  3H1J G;  1NTK K;  3HUS B;  1JDL A;  2OAR A;  2ZT9 B;  2PAC A;  1L0N K;  3FGA D;  4OGQ D;  2A06 D;  1K3H A;  2ZBO A;  1HJ4 A;  3IN6 A;  1COT A;  2O3J A;  2NPS D;  1JCC A;  1PV3 A;  2KUB A;  3NBT A;  1PPJ G;  3HE4 B;  5KAF E;  1YIC A;  3L75 J;  1VQK P;  1KB9 I;  1BDD A;  2W6B A;  2M3B A;  1CZQ A;  5AVQ B;  3SJL A;  1YEA A;  1M70 A;  1IFI A;  1XTC C;  4FAV A;  3NTN A;  1VQO P;  1H32 A;  5AVV B;  1Z56 A;  2QIW A;  1FI3 A;  4NPE A;  3SFE C;  1OVR A;  1CSV A;  3A0H E;  2C1V A;  1SQV E;  5GTH V;  2E5Y A;  2FFD C;  2BCC D;  5GTI E;  3F89 A;  3VYI A;  1HZU A;  4YXD C;  1FCD C;  5CBN A;  3L72 D;  1CRH A;  3CCL P;  1N7S B;  4FA9 A;  2YK3 A;  2YKO A;  2ZZS 1;  1NU1 J;  3H1L J;  1GZL A;  3S1K A;  3WUV A;  1YTC A;  5CIB B;  3BAS A;  2MKV A;  4QAO A;  3MUD A;  1EZV D;  1YJW P;  2FWL A;  2V07 A;  2JKV A;  3H1J J;  1KIL E;  4Y28 J;  1JTH B;  2C1U A;  3EQ2 A;  2K3R A;  1N73 B;  1RE3 A;  3HE5 B;  3BRT B;  2YXQ B;  3HUS C;  4N6J A;  2ZT9 C;  3O8Z A;  1FDM A;  1USE A;  3AE8 C;  2ITA A;  3CCV P;  2HPC A;  1EDK A;  1BE3 G;  1SQP E;  1T6A A;  2O01 N;  2KIK A;  3TK1 A;  2BEQ D;  1I8P A;  2Z5H A;  1CW5 A;  4U3F G;  4ZNC A;  3PH0 A;  4WQC A;  5M1B A;  2N9Y B;  3H1I G;  3HD7 B;  5CCH D;  1QKS A;  2KP8 A;  2KXP B;  3ZOW A;  2HR3 A;  1IFJ A;  1U75 B;  1KYO E;  3CL3 D;  1GTW A;  4RO0 A;  3PP5 A;  3TYY A;  1C2R A;  1JOC A;  4N78 D;  2IPP A;  2AXT E;  3C8V A;  1EDJ A;  2V4H A;  1OVV A;  1HCM A;  3BCC G;  1BGY G;  5CJ4 A;  3O1Y A;  2JO1 A;  3CX5 W;  1PP9 J;  2N18 B;  4MN4 C;  3Q2Y A;  5KLV G;  1VQP P;  3PXT A;  1L0L G;  1OW6 A;  2R44 A;  2WZ7 A;  5APY A;  3KXD A;  2ZT9 D;  2HFE D;  2RN0 A;  3H1L D;  1LNQ A;  1IFM A;  3B5N A;  3AEE C;  2NPS A;  1LP1 B;  3VP8 A;  4FA5 A;  1CRJ A;  2KSE A;  3H1J D;  1N7S C;  1VQM P;  1VQ8 P;  3R2P A;  2WSS H;  4PD4 D;  4TLF A;  1NHL A;  3CC7 P;  1H89 A;  1LT9 B;  3SXT A;  3KYQ A;  1YBK A;  2V7Q J;  4YE1 A;  3SWY A;  1H31 B;  1FZA A;  2J59 M;  1IO3 A;  1H9Y A;  5AVW B;  3VN0 A;  1SQB G;  2J5U A;  1T3J A;  1Y47 A;  3TNU A;  1P84 E;  3VOP A;  1EXJ A;  3D70 A;  1N73 C;  1KX2 A;  4EID A;  3BRV B;  3PHL A;  1JCD A;  1JMM A;  1ZN5 A;  1HVV A;  1GDV A;  3VMX A;  4HJG H;  3CXH W;  1BSH A;  4IFD K;  3H1H J;  2I8D A;  2PRR A;  1H9X A;  1RH5 B;  5AW6 B;  4U3F J;  4OVN F;  2WSF H;  1RF1 C;  2Q3E A;  5KLI B;  2AXC A;  1CI6 B;  2QJY B;  1FAV A;  3L37 A;  3L70 D;  2HOD A;  3L36 A;  1NTK G;  2I1K A;  1YTZ I;  3HD7 C;  1BGY J;  1L0N G;  1NTM J;  1PP9 D;  2R3S A;  4EIJ A;  4LJI A;  2QVA A;  1F1C A;  5APW A;  5KLV J;  1L0L J;  3WFE C;  4NFG B;  3NBS A;  2GIW A;  1NU1 E;  4I1L A;  1KQS O;  3AE9 C;  4P4Q B;  1KC8 Q;  2K9J B;  1JB0 J;  2B87 A;  3DMI A;  3L74 J;  2JP3 A;  1OZH A;  2ZYA A;  4IL6 E;  1K8A Q;  3KPE A;  4KMG A;  4A7P A;  3MGN A;  1YQ4 C;  1L4A B;  3M9B A;  1LTI C;  5DJT B;  1ZR4 A;  4JF7 A;  451C A;  5APS A;  1S72 P;  5GTI V;  3HQ6 A;  1M6Z A;  5APQ A;  4H44 B;  3TGU J;  1PPJ E;  1SQB J;  3B4S A;  3WC8 A;  1J3S A;  1LT9 C;  2N1T A;  2KK7 A;  5CCH A;  2IBZ D;  1CRI A;  2L5G B;  1R5L A;  4O9B A;  1I6E A;  1AOQ A;  3H1H D;  5CYT R;  4DJG A;  1C6R A;  1I6D A;  4U3F D;  3G6E P;  2OQQ A;  4UB6 H;  1A02 F;  1OW8 A;  3M0A A;  3V2Q A;  2H88 C;  1MZ9 A;  1AQT A;  1S2E A;  3VP9 A;  3L73 G;  2WIT A;  4UB8 H;  1OVU A;  5AUR A;  1GU5 A;  1GK6 A;  1ZV8 A;  4NPF X;  1KQG B;  1BGY D;  3NMD A;  1NTM D;  5KLI C;  1DEE G;  2XND H;  2OYH A;  1USD A;  4LC1 A;  5KLV D;  1L0L D;  3M0D C;  1RQU A;  3GLM A;  2QJY C;  1KYO W;  3VMA A;  4GOF A;  3AEA C;  1N90 A;  1FJK A;  1MKM A;  1K3G A;  1YHQ P;  5AW7 B;  4XXL A;  1J1E B;  5TIS V;  3RN1 A;  3VNW A;  5B66 H;  3O6Q A;  3L74 D;  1ZW0 A;  3PRJ A;  1PZQ A;  1KQL A;  2O01 H;  3V4W A;  2JR8 A;  2AXT V;  3A0B H;  3JSV C;  5APV A;  2KS1 A;  1YTZ T;  2YMY A;  3AE5 C;  2WPV B;  3TGU D;  1L4A C;  2WPR A;  3CX5 D;  1SQB D;  2LIT A;  1LTG C;  2FY8 A;  3KZI V;  2IYO A;  1KFN A;  1BE3 E;  1S5L X;  1SQV J;  3CCU P;  3S4R A;  4IL6 X;  3SWS A;  3NWV A;  1T3U A;  3TSI A;  1LWU B;  3ZCF A;  3KQG A;  3U59 A;  1CNO A;  1VQL P;  1DII C;  1CRY A;  3H1I E;  4BWN A;  1ZRT E;  4XFJ A;  4LGD E;  1DW3 A;  4WQ7 A;  5C0Z A;  5H2F H;  1GW3 A;  2MJZ A;  3KHU A;  4HH2 A;  1SQX D;  3AE3 C;  4D6T D;  2JJL A;  1A2S A;  1EQ7 A;  2AIU A;  3BCC E;  3L73 J;  3JBT B;  2CPB A;  2M5A A;  3N7N A;  2YMK A;  1N73 A;  3MZW B;  2OTK E;  2DVH A;  2FYN B;  1N8R Q;  1HWT C;  2Q7C A;  2N9J A;  1DVH A;  4EYY Q;  1YCC A;  5B5E V;  2N3B A;  1U7J A;  1VQ9 P;  1GL2 B;  2Z5I A;  2C0X A;  1L4A D;  3TF5 A;  3HQ7 A;  1HJ5 A;  3LW5 H;  1RF1 A;  5DJQ B;  3CMA P;  2D0W A;  3G9R A;  3CD6 P;  1W2E A;  1F1F A;  2E76 C;  2D2C B;  1N86 A;  1DH3 A;  1ZME C;  4WVZ A;  1HGV A;  5C9M A;  1LTJ B;  4RKU J;  2UWJ E;  1SQP J;  1VQN P;  1J1E C;  3FX0 A;  1NMI A;  4C7R A;  3C9I A;  3RL0 B;  5AW1 B;  1JNM A;  1NNO A;  1CTY A;  2Q3I A;  1M1J B;  2O1K A;  3OW2 O;  1FC2 C;  3CXH I;  1J2J B;  2GC4 D;  2WSC J;  3OCD B;  1CTZ A;  4EIF A;  4XE5 B;  1QL1 A;  1SQV D;  1QLE D;  1PGJ A;  1S5L V;  5AVY B;  1CIE A;  1T2K D;  3GW6 A;  4IL6 V;  1COR A;  2VHD A;  1KB0 A;  4PD4 H;  1AVY A;  1JY2 P;  1SQQ K;  2E76 D;  1NTK E;  1LWU C;  1HUC A;  4H0L B;  1CSX A;  3ZBM A;  4B86 A;  1NTZ K;  1SP4 A;  1L0N E;  4H0K A;  3RMZ A;  1AVO A;  2XZR A;  2WT7 B;  4GKG A;  3VTP C;  2H8P D;  1KX7 A;  2BGV X;  2OYI B;  1FDO A;  1KIL D;  2QSI A;  4WBA A;  3D6Z A;  2WQY C;  5C39 A;  3JCU H;  4MU8 A;  1RY3 A;  2XTS B;  5CCG A;  4WWI A;  4Z1M H;  2FYN C;  4WQ8 A;  4FA4 A;  1KZU B;  5CIC B;  2ZJS E;  3Q5P A;  4WB4 A;  1C6O A;  1FZC A;  3RK2 B;  3GHG B;  1CCH A;  3GF7 A;  2AI5 A;  2B89 A;  1CCR A;  5DJQ C;  1JM0 A;  1K04 A;  3AE4 C;  1SQP D;  2IX7 C;  1S9K E;  1N9C A;  2C1D B;  4ASW A;  1U57 A;  1DX7 A;  1NVO A;  2D2C C;  2E42 A;  3FXD A;  3R4Y A;  2KOG A;  1QL3 A;  1JY2 N;  1LTJ C;  1OXZ A;  1KYO D;  2ZAE B;  4RJT A;  2Q1K A;  3RL0 C;  3USS A;  2EXV A;  2FYU K;  1M1J C;  3C2C A;  4AAN A;  2PAJ A;  1NYH A;  1S3J A;  4K35 A;  1IK9 A;  3KDP B;  1K73 Q;  2D0S A;  2RMZ A;  1M7L A;  1RAP A;  1JUN A;  1YIQ A;  5CIG B;  3L73 E;  3OA8 B;  4EIE A;  1JMB A;  2K37 A;  5CID B;  4EDF A;  2V7Q H;  2C9L Y;  5CIH B;  4I2L C;  3A3Y B;  1QEX A;  4IFF A;  1NO4 A;  1WMK A;  3VMZ A;  4UB6 E;  1KB9 E;  1JY2 O;  3CCQ P;  2WSE H;  4H0L C;  1H0T B;  2IDB A;  2YKP A;  2FYZ A;  2E5T A;  4C46 A;  5KKZ B;  3EFG A;  3LIE A;  2OYI C;  1BCC G;  3L75 D;  1LC1 A;  1P84 D;  3PJS K;  2YO3 A;  3VYM A;  1EZV I;  4C7N B;  2YIU B;  3AEF C;  2OTL P;  4PV1 B;  3OAK A;  1RZ6 A;  5TIS E;  1KD1 Q;  4W7Y A;  2YCC A;  2HG5 D;  1HZV A;  2CA3 B;  2BH4 X;  3GHG C;  1OWA A;  4AAL A;  2I1J A;  3ZOO A;  3MK7 B;  2WWW A;  4M3L A;  1YJ9 P;  1OFC X;  2FRC A;  2CK3 H;  3ZIY A;  2OZ1 B;  3G4S P;  1R8E A;  2C9X B;  2BLF B;  1LTS C;  1KN7 A;  1J1D B;  1G2C B;  1SFC B;  1QL2 A;  2AEJ A;  1GD2 E;  1KOR A;  4H0L D;  2DW3 A;  3HRN A;  3A0B E;  1WEJ F;  4KJM A;  3KZI E;  1OCD A;  4AQR D;  1URQ B;  1LS9 A;  1K9M Q;  5APX A;  1KIL A;  3P8C E;  2JDI H;  1NU1 D;  2JQR A;  2G3A A;  5CJ0 A;  4OH8 B;  2NRG A;  3CCS P;  4YXW H;  1HRO A;  3PXW A;  3A9F A;  1VDF A;  1NIR A;  3H32 A;  3CX5 H;  3E1I A;  3L71 G;  1CYC A;  1C2N A;  3CP5 A;  1YIJ P;  4RSZ A;  4I7Z B;  1IC2 A;  3RK3 B;  2ZVN B;  4WY4 B;  5AW8 B;  4YTP C;  2L4D A;  4K3I A;  4ZMD A;  1LTB C;  1C75 A;  5B5E E;  1PPJ D;  1E29 A;  1BCC J;  1ZLL A;  4CPG A;  1LWU A;  4PJ0 H;  2YKQ A;  1BE3 J;  1NGM B;  5AW0 B;  4PD4 I;  5KKZ C;  2B11 B;  1VQ4 P;  2KNC A;  4W80 A;  2E75 B;  5KTB A;  3ZDM A;  1QN2 A;  2G8Y A;  1AJY A;  1PGP A;  3AEB C;  3H1I J;  1L2P A;  1QL4 A;  2YIU C;  3HTK A;  3H1K G;  4PV1 C;  2ZXX A;  3H6P A;  1CXC A;  1H33 A;  1N7S D;  2I8F A;  4ASV A;  1HJ0 A;  2R5B A;  5E79 H;  2CXB A;  3HQ8 A;  3BCC J;  3CXH H;  1IZN B;  3IF4 A;  2IZ0 A;  1LMS A;  1ETP A;  3TYI A;  5AW4 B;  2R3C A;  1YFC A;  2XNX A;  5AVX B;  2C0W A;  1H32 B;  2M8R A;  5KAF H;  4WQE A;  1S5L E;  1J1D C;  2N18 C;  1Q82 Q;  1X9V A;  1NAY A;  1HF9 A;  1URQ C;  3CYT I;  2FFD A;  3S9O A;  1XTG B;  3ABV C;  3M91 A;  5CIE B;  4GED B;  1WVE C;  3ZOY A;  4L75 A;  2XKM A;  3IFM A;  3A0H H;  4PV1 D;  2QEX P;  5AW2 B;  5KAI H;  1T8Z A;  1RE4 C;  3UIA A;  2M0B A;  3M9H A;  2HYN A;  1JO5 A;  3HD7 D;  4I7Z C;  1EB7 A;  1CHJ A;  3U1A A;  1BE3 D;  4WY4 C;  2BEZ F;  2W90 A;  4IOI H;  1CYJ A;  2QA4 P;  1YI2 P;  2B10 B;  1JY3 P;  1I8O A;  1QGK B;  3P7K A;  1NJI Q;  1Q90 D;  1Q2N A;  4L3H A;  4HYT B;  3CC2 P;  2QG4 A;  1FZE A;  3H1I D;  1ZRT D;  3MTU E;  1HJ3 A;  3HUS A;  4Y99 B;  3W67 A;  3H1K J;  4UB6 V;  4DT0 A;  2OYI A;  2HPC B;  2IBZ I;  3CME P;  2B12 B;  1NTK J;  3BCC D;  3CCM P;  1BSN A;  3RLM A;  1L0N J;  4UB8 V;  2WMM A;  2H7H A;  5IY5 1; 
#chains in the Genus database with same CATH homology
 3WFD C;  1C7M A;  4PJ0 V;  1NNO A;  2ZZS 1;  1CTY A;  4JCG A;  1I54 A;  1YTC A;  5CIB B;  2HV4 A;  2GC4 D;  4QAO A;  1EZV D;  2FWL A;  2V07 A;  3OCD B;  2QJP B;  1CTZ A;  1CIF A;  4EIF A;  1LFM A;  1DIQ C;  2C1D A;  1SQV D;  3RN0 A;  2C1U A;  3FWL A;  1S5L V;  2Y0C A;  1CIE A;  1IRV A;  2B0Z B;  5B66 V;  3GW6 A;  4WQ9 A;  4IL6 V;  1A8C A;  3MK7 C;  1COR A;  2VHD A;  4WQD A;  3ORV A;  1L9J C;  5E79 V;  1KB0 A;  2BCN B;  5CIF B;  4AAM A;  2C8S A;  1CSX A;  2JTI B;  3A0B V;  5DFS A;  3PLN A;  3ZBM A;  1ZZH A;  1OAE A;  1DT1 A;  4H0K A;  3PH2 B;  3RMZ A;  1AKK A;  1CRC A;  1I8P A;  1MZ4 A;  1KX7 A;  2BGV X;  5KAF V;  1M60 A;  4WQC A;  2CA4 B;  2L91 A;  2V08 A;  2N9Y B;  3M97 X;  4MU8 A;  1QKS A;  2Y0E A;  3ZOW A;  2XTS B;  1U75 B;  4WQ8 A;  2MHM A;  5B6Q A;  1C2R A;  3OCD A;  4FA4 A;  5CIC B;  1HCM A;  1C6O A;  1FHB A;  4L1Q A;  4FA1 A;  3O1Y A;  351C A;  1CCH A;  2AI5 A;  3CX5 W;  1BCC D;  1CCR A;  2BPB B;  5H2F V;  1MG3 D;  2N18 B;  1NTK D;  3A0H V;  3PXT A;  4WQB A;  5DJQ C;  3WFC C;  1L0N D;  1SQP D;  5KAI V;  1N9C A;  2C1D B;  2ZXY A;  1W2L A;  1HH7 A;  2QJK B;  2GB8 B;  1QL3 A;  2RN0 A;  3H1L D;  4PW9 B;  1LC2 A;  4AX3 A;  1A56 A;  4V2K A;  4FA5 A;  1CRJ A;  3L4O A;  1KYO D;  1IQC A;  4RJT A;  3H1J D;  1E2R A;  4PD4 D;  2EXV A;  3ITK A;  3SXT A;  3C2C A;  4N0K A;  4AAN A;  4YE1 A;  1H31 B;  4L3G A;  4O1Q A;  4PWA A;  1IO3 A;  4J20 A;  2D0S A;  2RMZ A;  1H9Y A;  1RAP A;  4H0J A;  1YIQ A;  5CIG B;  3OA8 B;  4EIE A;  1YEB A;  5CID B;  4EDF A;  1KX2 A;  4EID A;  3PHL A;  1GDV A;  5TJH A;  3CXH W;  5CIH B;  3VRD A;  1C52 A;  1H9X A;  1GU2 A;  2Q3E A;  3L71 D;  3PTZ A;  5KLI B;  3ZOX A;  1RZ5 A;  2GC7 D;  3CWB D;  5KKZ B;  2QJY B;  2DGE A;  3WU2 V;  3L70 D;  3L75 D;  1FI7 A;  1CIH A;  1LC1 A;  3L73 D;  1P84 D;  2N9I A;  3VYM A;  1PP9 D;  3X39 A;  2YIU B;  1CXA A;  2YQB A;  4LJI A;  1H31 A;  1CIG A;  1F1C A;  3O5C A;  1CC5 A;  1RZ6 A;  3WFE C;  4AAO A;  4NFG B;  3NBS A;  2GIW A;  3WUI A;  1FJ0 A;  2YCC A;  1CTJ A;  3OA8 A;  1HZV A;  4P4Q B;  2CA3 B;  2BH4 X;  4AAL A;  2K9J B;  155C A;  1QYZ A;  1KB9 D;  1IZL 0;  3ZOO A;  1GIW A;  1BL9 A;  3MK7 B;  3GG2 A;  3DMI A;  2FRC A;  4KMG A;  3ZIY A;  4A7P A;  2OZ1 B;  1N50 A;  3H1K D;  1SQQ D;  2C9X B;  2BLF B;  1NTZ D;  4O1W A;  1CSW A;  1DW2 A;  1WEJ F;  1OCD A;  4Q5P A;  451C A;  5GTI V;  3HQ6 A;  1M6Z A;  1LS9 A;  2KNC B;  3WC8 A;  1NU1 D;  2JQR A;  1J3S A;  1MG2 D;  1VYD A;  1KIB A;  2ZOO A;  3SVW A;  2IBZ D;  1CRI A;  1I5T A;  3O20 A;  1H33 B;  1I6E A;  1HRO A;  3PXW A;  1N15 A;  3H1H D;  2N3Y A;  3A9F A;  5CYT R;  1AOQ A;  1CRG A;  1C6R A;  1NIR A;  1I6D A;  1CYC A;  4U3F D;  1C2N A;  3CP5 A;  2MTA C;  4RSZ A;  1CO6 A;  1R0Q A;  3CXH D;  3TDK A;  1FOC A;  2B4Z A;  2L4D A;  4Y5R A;  4K3I A;  4WQA A;  2OZ1 A;  1C75 A;  5AUR A;  3L4M A;  1PPJ D;  1FI9 A;  1E29 A;  1BGY D;  1NTM D;  2LIR A;  1CSU A;  1AYG A;  1CHI A;  1AOF A;  1H1O A;  5KLV D;  1L0L D;  2FYU D;  2B11 B;  1KYO W;  3VMA A;  1DW1 A;  3SLE A;  1I55 A;  1N90 A;  1QN2 A;  1K3G A;  4FAN A;  4XXL A;  1C6S A;  1B7V A;  1QL4 A;  5TIS V;  3RN1 A;  1IRW A;  1YNR A;  2BH5 X;  3VNW A;  1CHH A;  1W5C T;  3L74 D;  1U74 B;  4FB1 A;  3PRJ A;  1CXC A;  1H33 A;  2C2C A;  2CE1 A;  2I8F A;  2CXB A;  3HQ8 A;  2ORL A;  1RAQ A;  1CED A;  2Y0D A;  2AXT V;  1LMS A;  2KS1 A;  1ETP A;  4GYD A;  1CYI A;  4EIC A;  4XYD B;  3CU4 A;  3TYI A;  1KV9 A;  3TGU D;  1YFC A;  1DVV A;  3CX5 D;  1SQB D;  3O0R C;  1DW0 A;  1GQ1 A;  1H32 B;  2LIT A;  3DP5 A;  4WQE A;  2N18 C;  3KZI V;  1JDL A;  2YK3 A;  2PAC A;  3CYT I;  2JWA A;  3SWS A;  2A06 D;  3NWV A;  1K3H A;  3HQ9 A;  2ZBO A;  2PCC B;  3ZCF A;  1HJ4 A;  1CNO A;  5CIE B;  1DII C;  4GED B;  1CRY A;  1WVE C;  1COT A;  2O3J A;  3ZOY A;  1DW3 A;  4WQ7 A;  5C0Z A;  3KHU A;  1SQX D;  3NBT A;  4D6T D;  1YIC A;  1A2S A;  2AIU A;  1S6V B;  3JBT B;  2DVH A;  3DR0 A;  3WFB C;  2FYN B;  5EXQ A;  1EB7 A;  1CHJ A;  3SJL A;  1BE3 D;  2N9J A;  1DVH A;  1CYJ A;  1L9B C;  1YEA A;  1YCC A;  5B5E V;  2N3B A;  2B10 B;  1M70 A;  1E8E A;  1I8O A;  4FAV A;  2CE0 A;  3TF5 A;  3HQ7 A;  1HJ5 A;  1H32 A;  4DY9 A;  4L3H A;  2QG4 A;  1NML A;  5DJQ B;  1FI3 A;  3H1I D;  1CSV A;  1HRC A;  2C1V A;  1ZRT D;  2D0W A;  1HJ3 A;  5GTH V;  1GJQ A;  1GKS A;  1F1F A;  4UB6 V;  2BCC D;  1HZU A;  2PCB B;  5DF5 A;  2B12 B;  3BCC D;  1FCD C;  5C9M A;  3RLM A;  4UB8 V;  2ZON G;  3L72 D;  1NMI A;  1CRH A;  4FA9 A;  5IY5 1;  3PXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...