3L71D

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 74
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l71D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l71D02
3VRDA 1ETPA 3SJLA 1CXAA 4H0JA 2C8SA 2D0WA 2MHMA 3CWBD 1YNRA 4YE1A 2FWLA 4RJTA 1H33B 2ZZS1 1YEBA 4IL6V 2CA4B 2IBZD 2VHDA 3X39A 2GB8B 5C9MA 1NU1D 3VNWA 3JBTB 1QL4A 1CSXA 5IY51 2FYNB 2N3YA 4GYDA 2GC7D 4D6TD 4LJIA 2L91A 1CRYA 4XYDB 1CIFA 5B5EV 2N9JA 1COTA 1DW0A 2PACA 1JDLA 1GU2A 1N15A 2C1DB 3HQ6A 4EIFA 1CC5A 4WQAA 5CIBB 3CP5A 1BCCD 2PCBB 1U74B 3OCDA 2RN0A 1CYJA 3FWLA 3DP5A 3PXSA 3CXHW 1KIBA 1YTCA 2FRCA 3L4MA 4AAMA 1S6VB 3PTZA 3HQ7A 1CSUA 2CXBA 2PCCB 1M70A 2BLFB 3VYMA 4DY9A 2QJYB 5DJQC 3PRJA 1K3HA 2D0SA 1KYOD 3O20A 1AYGA 3TYIA 4N0KA 1PP9D 2Y0DA 4UB6V 4O1QA 1R0QA 4FA4A 1SQVD 1HZUA 4AAOA 1M6ZA 3CX5W 1AOQA 1LC2A 3L70D 1S5LV 2O3JA 1I8OA 3TDKA 2HV4A 1DVHA 1RZ6A 4FAVA 3WC8A 4QAOA 1FHBA 3M97X 2BCNB 1M60A 1IO3A 155CA 4WQBA 4FA5A 1NMLA 3WFDC 1LS9A 1BL9A 1L0LD 1HROA 2C1UA 1FI7A 4FA9A 4WQCA 2YIUB 1BGYD 1QL3A 3H1JD 4NFGB 1ZZHA 5CIDB 2AXTV 3H1LD 1A2SA 5CYTR 4O1WA 1W2LA 1EB7A 1WVEC 4Q5PA 2YQBA 3SVWA 3ORVA 2BCCD 5C0ZA 1FJ0A 1CHJA 4XXLA 1E2RA 3BCCD 5CIHB 1SQXD 1DIIC 1I54A 1RAQA 2CE1A 5GTIV 2RMZA 1FI9A 5DF5A 2N18C 3SXTA 1YEAA 1C52A 3DMIA 1CIEA 1GKSA 1H32B 1A56A 1P84D 3A0BV 3ZOXA 1IZL0 2B4ZA 2C9XB 1FCDC 2KS1A 3C2CA 1CCRA 2B10B 1CNOA 1CRGA 1QYZA 1HH7A 1N90A 5EXQA 4L1QA 5B66V 3WU2V 2B12B 1HZVA 1KYOW 5KAFV 2ZBOA 2JWAA 2B0ZB 4V2KA 1H31A 4PD4D 4FANA 1IRVA 1C6SA 3CX5D 3OA8B 1CRCA 3TF5A 1DW2A 1NTMD 1VYDA 5KKZB 3VMAA 2GC4D 1CYCA 1BE3D 3O0RC 1YCCA 3RLMA 4K3IA 2FYUD 1KX2A 5DFSA 3KHUA 1C2RA 1DVVA 5CIFB 3MK7C 3ZCFA 3NWVA 3PLNA 1A8CA 2ORLA 2DVHA 1I5TA 2Y0EA 1L9BC 1MG3D 4L3GA 3ZBMA 4L3HA 1GIWA 5KLVD 2CA3B 2JTIB 3DR0A 2AIUA 2OZ1B 1IRWA 3SWSA 1B7VA 1GDVA 1C7MA 4PW9B 1CIGA 4GEDB 3WFCC 1HCMA 2JQRA 2XTSB 2I8FA 1IQCA 1KX7A 1RAPA 1WEJF 2ZONG 2C1VA 1KB9D 4AANA 1LMSA 3HQ8A 5B6QA 3RN1A 4EIEA 1ZRTD 5DJQB 2AI5A 3O5CA 2Y0CA 5CICB 1I8PA 4EIDA 4PJ0V 1MG2D 1SQBD 1CHIA 1I6DA 2YK3A 1C6RA 4RSZA 2KNCB 1YICA 5KAIV 5CIGB 1KV9A 1DT1A 1FOCA 2C1DA 4KMGA 4MU8A 5H2FV 1F1CA 1K3GA 2MTAC 1OCDA 1H1OA 4FB1A 3L4OA 5E79V 3L75D 1NNOA 3MK7B 2BH4X 2K9JB 3OA8A 3ZOYA 1CRJA 4WQ8A 2ZXYA 3NBSA 2N18B 2DGEA 5TISV 4WQ7A 1MZ4A 3L74D 1HJ5A 4WQDA 1CSWA 1C75A 1C2NA 3PHLA 3ZOOA 3A9FA 3L71D 3RN0A 3PXWA 3PH2B 4Y5RA 5CIEB 1L0ND 1SQPD 3GW6A 1GJQA 3WFEC 1CYIA 2LIRA 2ZOOA 1CO6A 1KB0A 2OZ1A 2BH5X 4FA1A 1CTZA 4WQEA 1CIHA 3ITKA 1NMIA 4JCGA 2BGVX 1HJ4A 1DW3A 3H1ID 1J3SA 1H31B 3O1YA 351CA 2LITA 1YFCA 3KZIV 1F1FA 3ZOWA 1EZVD 1H32A 1CXCA 1H9YA 4UB8V 1H9XA 1I55A 451CA 1CORA 1RZ5A 2EXVA 4AALA 1CRIA 1HRCA 4J20A 1CTYA 1E29A 1E8EA 2N3BA 1U75B 1CSVA 4A7PA 2A06D 1CEDA 3GG2A 1NTZD 2N9YB 2QJPB 3H1KD 1NTKD 3A0HV 5TJHA 3NBTA 3TGUD 3PXTA 1N50A 1W5CT 1LFMA 4U3FD 2V07A 3CXHD 1CRHA 1AKKA 1GQ1A 3RMZA 2QJKB 3L73D 5GTHV 4EICA 1QKSA 1I6EA 1YIQA 1DIQC 3SLEA 3WUIA 4EDFA 3OCDB 3HQ9A 1AOFA 1NIRA 1N9CA 2B11B 2GIWA 1DW1A 1H33A 1CTJA 2V08A 1LC1A 2CE0A 3L72D 1HJ3A 5AURA 1CCHA 2BPBB 1C6OA 1CHHA 4PWAA 4AX3A 2QG4A 2C2CA 1OAEA 2L4DA 3CYTI 1L9JC 1SQQD 4P4QB 3H1HD 4H0KA 2YCCA 1PPJD 2N9IA 3CU4A 1QN2A 3ZIYA 4WQ9A 5KLIB 2Q3EA 1FI3A 3WFBC
chains in the Genus database with same CATH superfamily
2FBWC 3D71A 2C0WA 4ZMDA 2YMKA 1H88A 3P32A 1VDFA 3A2AA 1OZHA 1KZUB 1SQVJ 1NJIQ 1YNRA 1ZW0A 3H25A 4YE1A 2FWLA 2IFNA 2WSCH 3WU2H 2YNYA 2WPVB 1OIPA 5AW7B 1T3JA 3TGUE 1NU1D 1YQ4C 1QL4A 4GOFA 1M1JB 2K1AA 2XV5A 5IY51 5DJUB 3BASA 4I7ZB 1P84H 3L75G 4GYDA 2GC7D 4LJIA 2L91A 1M7LA 3T97A 1VQMP 1CRYA 4NPEA 5B5EV 1NTMJ 2N9JA 2PACA 1JDLA 4EIFA 3AE3C 3GF7A 1BCCD 3SWKA 1FAVA 3CL3D 2C9NY 3OAKA 3VP9A 1CYJA 3B71A 4YXDC 1FBMA 1SQQJ 1YJ9P 1JY2O 5KJ7D 3CXHW 2FXPA 2QIWA 1KIBA 1YTCA 3S9OA 2FRCA 1YTZT 2H7HA 2PCCB 3P8CE 3MD0A 1M70A 3P7KA 1ZXGA 2YKQA 1NHLA 3CXHI 2IBZI 1GK6A 1L0LJ 1QX8A 3W67A 1K3HA 2KI7B 4H13D 2AEMA 1PP9D 4ZKUA 1R0QA 1GU4A 4WY4B 1L4AC 1HZUA 3U1AA 1M6ZA 3CX5W 2O3JA 3V4QA 2HV4A 1SQBJ 4K3AA 2E74D 4N78E 2E75B 1T3UA 2QEXP 2Z4EA 3E1IA 1RHZB 3SSUA 155CA 4IFDK 2J58A 4WQBA 4FA5A 1AQTA 3RL0g 1NMLA 3GLMA 3BATA 1HROA 4FA9A 3CD6P 4WQCA 2PRRA 1BGYD 1ZP0C 1QL3A 1VQ4P 4NFGB 5CIDB 5BU5A 1LT9B 3H1LD 2GA1A 1VQ5P 3QH9A 1QVGO 4O1WA 3H1LG 1W2LA 4PJ0E 1WVEC 1SQBG 3MTUE 2YQBA 2FYUK 4AQRD 2OARA 1VQNP 5CCHA 3BCCD 1SQXD 3SFEC 4C7RA 1RAQA 1FI9A 5DF5A 3V2QA 1SQVG 1YEAA 2D2CD 4WY4D 1QLED 1T8ZA 1U57A 1OWAA 1A56A 4OWFA 3M9BA 3BCCJ 2M5AB 2KS1A 4IFMA 3S1KA 2G3AA 2WSEH 1CRGA 1QGKB 2WMMA 1GMJA 3Q3DA 1J2JB 1BSHA 5EXQA 4Y99B 2BCCG 5B66V 3WU2V 1GL2D 2VRSA 2B12B 1EC5A 2YKPA 4Z1MH 2H8PD 3RGUA 3GF3A 1X0TA 4LC1A 1BE3G 4IOIH 5CBOA 1RE4A 1FJPA 1H31A 4FANA 3V4WA 3H32A 3A0HH 3D0WA 3TF5A 5CJ4A 3VMAA 1NGMB 1M1JA 3L75E 3M0DC 1JY2P 1FE6A 1YCCA 1ZMEC 3RLMA 4GOEA 3I56P 2BCCJ 2POHA 1KX2A 5DFSA 1DVVA 3C1LA 3PLNA 2ORLA 1LWUA 3Q2YA 4YXWH 1SQXE 2H89C 2K9YA 2QJYC 1VQPP 4L3GA 3ZBMA 2I8DA 2JP3A 1DEEG 2JTIB 2AIUA 1SQPE 3HUSC 2OZ1B 1JTHA 3HE5B 1BE3E 1N7SC 2K9JA 1C7MA 5AVVB 3L73E 4PW9B 1CIGA 1JY3N 1URQB 1AJYA 3U1CA 1LJ2A 2JQRA 1PP9G 1IQCA 4MN4C 1RAPA 3BVHA 2ZONG 4WB4A 5E79E 2IYOA 1FDOA 4EIEA 4KHXA 1FZFA 3O5CA 2Y0CA 5KLIC 2WTYA 1OFCX 4EIDA 1MG2D 3RK2D 1PGJA 2YXRB 1LTTC 2Q6QA 3PH0A 4H44D 1MFZA 5KAIV 3V2PA 2WT7A 2OYIC 3WU2E 5CIGB 1GL2C 1DT1A 1FOCA 2C1DA 5KAFE 4MU8A 1JTHB 1M8OB 3M9QA 2KLUA 1H1OA 4FB1A 2N1TB 1NNOA 3MK7B 3K5BA 2K9JB 2ZFCA 1NOHA 4WQ8A 3JSVC 2NZ2A 3L74G 2HLOA 2WSSH 4L73A 1U7JA 3L74D 2A45H 1KQFB 2ZYAA 1FOSF 1G2CA 1PZQA 3PHLA 3H1JE 3RK2B 1JB0J 1HF9A 5E79H 3GW6A 3WFEC 1CYIA 2O01H 2QSIA 1KYOE 2BCCE 1LP1B 2ZYGA 1J1EB 1EDLA 4FA1A 1CTZA 5TISE 5APTA 4H13B 1DD4A 3P8MC 4TLFA 2O1JA 1Q7YQ 1YFCA 3OW2O 3A5TA 1NVOA 1SQQG 1H9YA 1PV3A 1IFDA 1PIXA 4GKGA 1FZCA 5DJTB 3CXHE 1YBKA 3N7NA 1KILC 4HKZH 1WRGA 4J20A 3H6PA 3L72G 1U75B 2A06D 2D2CC 2N9YB 5AVWB 1NTKD 3A0HV 3ZDMA 2WT7B 1BE3J 1USEA 1HWTC 1N50A 1LFMA 4GODA 4D6TE 1KYOH 3E1RA 1JY3O 1VQ7P 2E75C 3G3ZA 2PP6A 3WUIA 1H0TA 3A0BE 3L70E 1AOFA 4I7ZC 2IZ0A 4HYTB 3KDPB 1N9CA 3CX5I 2GIWA 1EXIA 4U3FG 1VF5B 1CTJA 1KB9E 2HYNA 4EIJA 3L72D 1HJ3A 1KQSO 3M06A 1N7SB 2JEEA 3VMZA 1SP4A 4P4QB 4H0KA 2WWWA 3FX0A 1HJBA 2OTKE 1NTZJ 3CCEP 2Q3EA 3WFBC 3TGUJ 3FXEA 4C46A 2JO1A 1EDKA 1ETPA 1X9VA 2JDIH 5AVYB 2K3RA 2MHMA 3PJSK 1CW5A 2ZZS1 3G9RA 2QVAA 2CA4B 2FFDC 4OGQC 3L71E 2FYUG 3JBTB 5KAIH 4N3YB 1AQ5A 1KFNA 5CMZA 3A0HE 3CWBE 2W6JH 1LGHB 1N15A 2C1DB 1RF1C 2QJPC 5CCHC 3CP5A 2PCBB 3OCDA 1YIJP 4I1LA 1EZVE 2OYIA 3FWLA 3CMEP 3PXSA 3S4RA 2B9BA 1L2PA 2HODB 4AUWA 3VYIA 1NTMK 3L4MA 4AAMA 3PTZA 3HQ7A 4D6TJ 5CCGA 2CXBA 1UIIA 1S72P 1LT1A 2BLFB 3JC22 1WT6A 3T97B 4EI2A 1T6AA 2QJYB 5DJQC 3O20A 1AYGA 4N0KA 2Y0DA 2ZVNB 4O1QA 4FA4A 4DJGA 1JCDA 1E79H 4H44B 2E74C 3FWNA 3D6ZA 1S5LV 1LTJC 1LT9C 2W8ZA 1I8OA 5APUA 1EDIA 4W7ZA 1DVHA 2R5DA 1NU1E 1RZ6A 4FAVA 1GL2A 2M0BA 3G6EP 3M97X 1S3JA 1IO3A 3VN0A 4XE5B 2IYPA 2N1TD 3WFDC 2V7QH 1GU5A 1BL9A 5AVRB 2KSEA 3HD7B 2YIUB 1HVVA 5AW3B 2AXTV 2ZT9C 4UB6H 5CYTR 2KYVA 1PGQA 1Y47A 4Q5PA 1N73C 2C9LY 2BCCD 2P7JA 1FJ0A 4R4MA 1NTZG 1E2RA 5AW8B 1L0NJ 2QE7H 3FXDA 1DIIC 5GTIV 3SXTA 4H0LB 1J1DB 3MUDC 3HE5A 1NU1G 1VPCA 1A02F 1C52A 1OXZA 1RQVA 1H32B 1YYCA 5B66H 1P84D 3A0BV 4GIFA 2B4ZA 1KQGB 2BEZF 1NAYA 2FXOA 2WSFH 1CCRA 1LTSC 1CNOA 3IFMA 1N8RQ 1QYZA 1G1IA 2H88C 1USDA 4L1QA 1DD3A 5AVQB 2QRXA 1L4AA 4QMAA 1YHQP 5KAFV 5APWA 4PD4D 4ZNCA 1IRVA 3SWYA 1M1KQ 1KV4A 1BGYG 1IK7A 2PAJA 3H1KG 1NTMD 4R4LA 2GC4D 1S5LX 3CCQP 1NTKJ 3D70A 4B86A 2LR2A 1QEXA 2FFDA 2Y9YA 3HE4B 5KLVK 2FYUD 2Q3IA 2P67A 1IZNB 1L0LG 1C2RA 1A8CA 1JNMA 3M91A 1MG3D 4L3HA 2XKMA 1K04A 2M3BA 5KLVD 2Q7CA 4WY4C 2E43A 3H1JJ 1YJWP 4N78D 2YO3A 3B4SA 3CCRP 3V6IA 3SWSA 3H32B 1RF0A 2N9BA 3KPEA 2R32A 3C8VA 4GEDB 1L4AD 3WFCC 3HUSA 2QM7A 1BCCJ 2R3CA 2V4HA 2AXTE 1IC2A 3L74J 1R8EA 1Y9BA 3TK1A 1EDJA 3TNUB 5DJQB 2WVRA 1I8PA 4PJ0V 2KSJA 1YITP 1I6DA 2YK3A 1OW7A 1BCCG 3E7KA 4Y28J 3BCCE 1VQ8P 2XZRA 3D6YA 3QWOC 4IFFA 1SS1A 2M3EA 2HPCB 1K73Q 2O1KA 1BCCE 1JOCA 3RL0B 1K3GA 1OCDA 5CCHD 3L4OA 5E79V 3L75D 1RQUA 3I55P 3RL0D 1CRJA 3H1JG 3MHVA 4WQ7A 1KILD 3HUSB 3AEAC 1CSWA 1Q82Q 3HD7A 1FDMA 3L35A 1C75A 1C2NA 4H13C 3PXWA 3PH2B 4Y5RA 5CIEB 3JCUH 1SQPD 2LKMA 1SQXJ 1KYOI 5GTIH 4OH8B 2W6BA 3CC7P 1SQBK 1DEBA 2J5UA 1XTCC 2ITAA 1KB0A 5L8RJ 5AVZB 4TT3H 1PPJE 2ZYDA 1RH5B 2R5BA 3CX5H 3LIEA 2LXBA 2BGVX 1DW3A 1NWQA 3H1ID 1H31B 3PP5A 1F1FA 1X79B 4JYCA 2R44A 3EWKA 1H32A 5APQA 2B88A 3VMXA 1NTZK 1CORA 1CRIA 1OW6A 3A7OA 3TNUA 5KLVG 1ZN5A 2M5AA 1E8EA 3R4YA 2E74B 1CEDA 3M9HA 1FZCC 5TJHA 3NBTA 1L0LK 3PXTA 3Q5PA 1W5CT 5C39A 2O01N 1GK4A 1S1CX 1AKKA 3MP7B 4WVZA 2QJKB 3L73D 1KC8Q 3CI9A 1JY2N 3CX5E 4L75A 1OX3A 2WPSA 2FYNC 3RBZA 2YIUC 3OCDB 1NTZE 1NIRA 4AYCA 1CI6A 1LTGC 3AE7C 1H33A 3RL0C 3CMAP 2BASA 1LC1A 2FKWB 1URQC 2NPSC 1C6OA 4AX3A 2XDJA 1YJNP 1OAEA 2YXQB 1R5SA 1YI2P 2L4DA 2OQQA 3RK3C 4DCKA 2QA4P 1SQQD 4CPGA 2A45G 1LWUB 3KQGA 2R3SA 1QN2A 2OYHA 1JY3P 4W80A 5CBNA 3L4FA 1AA0A 1CXAA 4L74A 1PP9J 3L71G 2D0WA 1SQVE 2W83C 3CWBD 4RJTA 5KLVJ 3NTNA 2YKOA 2IBZD 1VL2A 2VHDA 3X39A 1CZQA 1VF5D 5KAFH 1KILA 2PGDA 1N2DC 2IDBA 2KS1B 1IFPA 1MZ9A 4ASVA 2FYNB 3TYYA 4D6TD 2E76D 4Y99C 2WITA 2RH0A 1T2KD 4XYDB 4XFJA 4RO0A 3GMAA 1VQOP 1U7MA 3AE2C 3LW5H 1DH3A 1COTA 2IBZG 4JQ0D 1CC5A 3CWBG 2RN0A 4GT1A 1NYHA 3H1KJ 4YTPC 3B5NA 3DP5A 2RKLA 5B5EH 1SQQE 5TISH 1IFNA 1SFCD 3RK2C 3H1LJ 1S6VB 1IK9A 3AE1C 1CSUA 3H1IJ 1FC2C 2L5GB 2HFED 3MZWB 2OYHB 3H1HG 3VYMA 3USSA 4DY9A 3R2PA 1NKZB 3PRJA 3CXHH 2Q1KA 2D0SA 2ZJSE 3W68A 3TYIA 3AEFC 4UB6V 2KK7A 1S9KE 2KZJA 1KB9I 1SFCA 1AOQA 3L70D 1JMBA 1SQQK 1LTAC 2YO2A 2XU6A 2H43A 3V2RA 3VP8A 3WC8A 3KZIH 3L73G 2BCNB 4NPFX 1KILE 3MUDA 2P58A 5KJ7C 3L74E 1FOSE 1LS9A 1A02J 1FI7A 1PGOA 2Q9IA 3A0BH 3H1JD 1BDDA 4K35A 4WBAA 4RESB 1S5LE 1KB9H 1RF0C 5K5GB 4PV1C 2KP8A 2WQYC 3SVWA 2A45I 1BSNA 3ORVA 1FZBA 3WMM0 5AW0B 2E5TA 1CHJA 1DX7A 4U3FJ 5CIHB 2CE1A 1BGYE 1BDCA 3L70J 1LTJB 1CIEA 3AE8C 4KJMA 1IFJA 3AE4C 3ZOXA 3AEEC 2I1KA 5CCGC 2C9XB 5APSA 3C2CA 1T2KC 1L0NK 2B10B 3GHGA 1SQXG 4DOJA 3L72J 1JO5A 1N90A 5KAIE 4PV1B 1N86A 1ZRTE 2KNCA 1HZVA 1KYOW 2ZBOA 1QL2A 2JWAA 2B0ZB 1UIXA 3HTKA 4D6TG 1AVYA 2KUBA 1W2BO 1OVRA 1MV8A 1N7LA 2KOGA 4OVNF 4LLHA 3TGUG 3L37A 5AW1B 1VYDA 1KQLA 2V7QJ 2WSFJ 1BE3D 4HH2A 4K3IA 4KT0J 3CCSP 2SPZA 3KHUA 1RF1A 2NRGA 5CIFB 3ZCFA 3NWVA 3GHGB 2DVHA 1FZGA 1VQ6P 1S2EA 4PV1D 2CK3H 3Q1MA 1HGVA 1GIWA 2GM4A 1M57D 2CA3B 1NTKE 3M0AA 3AE9C 4W7YA 1L0NE 1N73A 3DR0A 2OYHC 4ASWA 2B89A 2JR8A 1IRWA 1B7VA 3L70G 2FXMA 1W2EA 1HCMA 2P1JA 2I1JA 2W6AA 2XTSB 4H0LD 4M3LA 1WEJF 1LMSA 1VQKP 3IAOA 3HQ8A 5B6QA 3CPWO 1ZRTD 1HGZA 3HE4A 3UIAA 2W90A 4IL6H 1SQBD 1EQ7A 1JM0A 5KKZC 3AECC 1C6RA 1PL5A 2E76C 3TSIA 4RSZA 2KNCB 1NU1J 1KV9A 1N73B 1L0NG 3IF4A 2NPSB 5H2FV 1VF5C 1DIPA 2MTAC 3II6A 1R5LA 3ZOYA 2ZXYA 1D7MA 3NBSA 5AW9B 2DGEA 1MZ4A 2OGUA 2E75D 2FYZA 1K9MQ 3NXSA 5AVXB 3H1IE 3H1LE 3RN0A 1L0ND 2MKVA 1HJ0A 2ZXXA 2FY8A 2N1TC 3O6QA 1HBWA 2M8RA 3OA7A 2HG5D 2LIRA 4BXLA 2ZOOA 1CO6A 3EFFK 5CJ0A 3V2NA 5B5EE 1VQLP 1Q86Q 4WY4A 1S9KD 3ITKA 1Q90D 3OJAB 4C7NB 3G4SP 3CCUP 1J3SA 2JKVA 5EFWB 2J59M 1S4XA 3ZOWA 4UB8V 1H9XA 451CA 4AALA 3VOPA 4WWIA 1HRCA 2QJKC 1CTYA 1LTIC 2N3BA 1CSVA 3GG2A 4JPZB 1XTGB 4PD4I 3KXDA 4U7JA 5KLVE 2Q5UA 4LGDE 2ZXEB 3L72E 3TGUD 1OMIA 3O6QB 3NMDA 3KZIE 3L36A 1SQPJ 2OYOA 3F5HA 2KIKA 2V07A 2IPPA 1CRHA 2G8YA 1GQ1A 2PFXA 4EYYQ 1FS0E 4C7NA 3SLEA 1GL2B 4EDFA 2DW3A 2IFMA 2E42A 2B11B 3H1KE 3LW5J 5AURA 3B8EB 1MUUA 2BPBB 3FGAD 1CHHA 4PWAA 1SQVK 2QG4A 3CCJP 4U3FE 3CYTI 3CCLP 1LT9A 1EZVI 2KLVA 3H1HD 1Q2NA 3AEBC 1PPJD 2E5YA 3CU4A 3ZIYA 4WQ9A 3MGNA 2K88A 2UWJE 3GHGC 3L71J 3VRDA 3SJLA 3RK3B 4H0JA 4PD4E 2C8SA 1JEKA 2N1TA 1H33B 1YEBA 4IL6V 2W27A 1GDTA 1H8AA 4HJGH 2ZT9B 1ZR2A 2GB8B 2CPBA 5KJ7A 5C9MA 3VNWA 2OTLP 1CSXA 2N3YA 2FYUE 4BRYA 3CLQA 1CIFA 1FZEA 2QM8A 1L0LE 1DW0A 2AXCA 2WZ7A 1GU2A 3HQ6A 1LP1A 4WQAA 5CIBB 1G1JA 1RE3C 1U74B 3JCUE 2WSCJ 2XNDH 5AVSB 4PD4H 1ZOYC 1EZVG 5M1BA 1URQA 5AVTB 1AVOA 3CC4P 1KILB 2FFDB 2JJLA 1GD2E 1SQPK 2ZVOB 3RBXA 1YQ3C 3F89A 3V5BA 1SFCC 4I2LC 2C0XA 1CSBA 1IO4A 1IFMA 1SQBE 1FJKA 1KYOD 2B87A 3AE6C 1J1EC 1SQVD 2AEJA 4AAOA 4YPCA 5GTHE 1FU1A 1Y8AA 3AEDC 1LC2A 3EQ2A 2WPQA 3BCCG 1K05A 1M56D 4H0LC 3TDKA 1P84I 1RY3A 1VQ9P 4QAOA 2WSEJ 1FHBA 1EXJA 1GW4A 1M60A 4IL6E 4DZOA 3C9IA 1JCCA 3ABVC 1PP9E 2P2UA 1AFOA 4BWNA 2IZ1A 1L0LD 5AW6B 2C1UA 3EFGA 4BRYB 1ZZHA 4XA4A 1MFTA 1N7SD 1A2SA 4RKUJ 4IL6X 1EB7A 1KD1Q 3AE5C 1SFCB 5C0ZA 2HPCA 3Q5SA 1JUNA 4XXLA 5GTHH 1OVVA 3CWBJ 1I54A 2RMZA 1CI6B 4EOTA 2N18C 1MKMA 4UB8H 1NTKK 1LNQA 3DMIA 4H44C 1GKSA 2JWDA 1ZR4A 1NH4A 5AW5B 3B5ND 1J1DC 1IZL0 3H1IG 1FCDC 3CC2P 1PFIA 2NPSD 3N4XA 2B87B 3B5NC 5CCGD 1KFMA 3Q5RA 1K8AQ 1HH7A 1NO4A 2ZT9D 4JBZA 2P10A 1H89A 1GZLA 2KZIA 3WUVA 4UB6E 4JF7A 3HD7C 1P84E 4I6MC 1SLQA 4V2KA 1C6SA 3CX5D 2NPSA 1H0TB 2GUSA 3B5NB 1FZCB 3OA8B 1CRCA 2XNXA 3VMYA 1DW2A 4UB8E 5KKZB 1CYCA 1KORA 5B66E 3O0RC 3H1HE 1M90Q 3CCVP 3MK7C 1FDIA 1ZLLA 1I5TA 2Y0EA 1L9BC 1IFIA 3WUTA 1HUCA 3G71P 5CHXA 3L75J 3MIWA 5KTBA 1KTMA 3HTKB 1JMMA 5BU8B 1GDVA 1RE3A 2Z5IA 3M0DA 1SVFA 5BVZA 3BRTB 2I8FA 1WMKA 1KX7A 1W5CE 3P8CD 5APXA 1G2CB 2C1VA 1N7SA 1GTWA 1KB9D 1OW8A 4AANA 2KXPB 3RN1A 5H2FH 2BEQD 2AI5A 3HRNA 5CICB 1RF1B 1CHIA 4DT0A 3U59A 1YICA 2Z5HA 3IN6A 1NTKG 1S5LH 2IX7C 4KMGA 2GUVA 1F1CA 4OGQD 4PJ0H 2BH4X 2OYIB 3OA8A 1TU3F 4OGQB 1BGYJ 4L76A 2N18B 5TISV 5AW2B 4WQDA 1HJ5A 1NU1K 5AVUB 3I5CA 1GW3A 1KN7A 3ZOOA 3A9FA 1OVUA 3L71D 4NPDA 2AXTH 4O9BA 5H2FE 3CCMP 1GJQA 1PGPA 2HR3A 1X8YA 1HH0A 1NAFA 2OZ1A 1FZAA 1ZV8A 2K37A 2BH5X 4WQEA 1CIHA 2Y9ZA 1L4AB 1NMIA 4JCGA 2CPSA 3RK3E 1HJ4A 1YTZI 1IJDB 3O1YA 351CA 2E76B 2LITA 1LWUC 3KZIV 3SWFA 1PPJG 1NTME 3IR9A 2WPRA 2HODA 1EZVD 1LTJA 1CXCA 3LIDA 2YMYA 1I55A 2KB7P 1RZ5A 2EXVA 1E5WA 5APVA 1SQXK 1E29A 3KYQA 4N6JA 4A7PA 1NTZD 1QVFO 2QJPB 3H1KD 3L73J 2LXCB 5APYA 1NKNA 1Z56A 5AW4B 1RE4C 1Q81Q 3VTPC 5GTIE 1HTLC 2D2CB 3O8ZA 2A06G 4U3FD 3CXHD 3AEGC 3RMZA 5GTHV 4EICA 1I6EA 1QKSA 4HB1A 2MJZA 1YIQA 1DIQC 1KMIZ 2A06E 3BRVB 3HQ9A 1X22A 1M1JC 3H1HJ 3WUUA 3NFQA 1DW1A 2O01J 2V08A 4ZKPA 3SFDC 1NTMG 2CE0A 1CCHA 2OTJP 3A3YB 2C2CA 2ZAEB 1L9JC 1LTBC 1AV1A 2YCCA 2AEFA 3HD7D 2N9IA 2FYUJ 1QL1A 3RK3D 4GDOA 5KLIB 2IBZE 1SQPG 4JYBA 1FI3A 1URQD
chains in the Genus database with same CATH topology
3VRDA 1ETPA 3SJLA 1CXAA 4H0JA 2C8SA 2D0WA 2MHMA 3CWBD 1YNRA 4YE1A 2FWLA 4RJTA 1H33B 2ZZS1 1YEBA 4IL6V 2CA4B 2IBZD 2VHDA 3X39A 2GB8B 5C9MA 1NU1D 3VNWA 3JBTB 1QL4A 1CSXA 5IY51 2FYNB 2N3YA 4GYDA 2GC7D 4D6TD 4LJIA 2L91A 1CRYA 4XYDB 1CIFA 5B5EV 2N9JA 1COTA 1DW0A 2PACA 1JDLA 1GU2A 1N15A 2C1DB 3HQ6A 4EIFA 1CC5A 4WQAA 5CIBB 3CP5A 1BCCD 2PCBB 1U74B 3OCDA 2RN0A 1CYJA 3FWLA 3DP5A 3PXSA 3CXHW 1KIBA 1YTCA 2FRCA 3L4MA 4AAMA 1S6VB 3PTZA 3HQ7A 1CSUA 2CXBA 2PCCB 1M70A 2BLFB 3VYMA 4DY9A 2QJYB 5DJQC 3PRJA 1K3HA 2D0SA 1KYOD 3O20A 1AYGA 3TYIA 4N0KA 1PP9D 2Y0DA 4UB6V 4O1QA 1R0QA 4FA4A 1SQVD 1HZUA 4AAOA 1M6ZA 3CX5W 1AOQA 1LC2A 3L70D 1S5LV 2O3JA 1I8OA 3TDKA 2HV4A 1DVHA 1RZ6A 4FAVA 3WC8A 4QAOA 1FHBA 3M97X 2BCNB 1M60A 1IO3A 155CA 4WQBA 4FA5A 1NMLA 3WFDC 1LS9A 1BL9A 1L0LD 1HROA 2C1UA 1FI7A 4FA9A 4WQCA 2YIUB 1BGYD 1QL3A 3H1JD 4NFGB 1ZZHA 5CIDB 2AXTV 3H1LD 1A2SA 5CYTR 4O1WA 1W2LA 1EB7A 1WVEC 4Q5PA 2YQBA 3SVWA 3ORVA 2BCCD 5C0ZA 1FJ0A 1CHJA 4XXLA 1E2RA 3BCCD 5CIHB 1SQXD 1DIIC 1I54A 1RAQA 2CE1A 5GTIV 2RMZA 1FI9A 5DF5A 2N18C 3SXTA 1YEAA 1C52A 3DMIA 1CIEA 1GKSA 1H32B 1A56A 1P84D 3A0BV 3ZOXA 1IZL0 2B4ZA 2C9XB 1FCDC 2KS1A 3C2CA 1CCRA 2B10B 1CNOA 1CRGA 1QYZA 1HH7A 1N90A 5EXQA 4L1QA 5B66V 3WU2V 2B12B 1HZVA 1KYOW 5KAFV 2ZBOA 2JWAA 2B0ZB 4V2KA 1H31A 4PD4D 4FANA 1IRVA 1C6SA 3CX5D 3OA8B 1CRCA 3TF5A 1DW2A 1NTMD 1VYDA 5KKZB 3VMAA 2GC4D 1CYCA 1BE3D 3O0RC 1YCCA 3RLMA 4K3IA 2FYUD 1KX2A 5DFSA 3KHUA 1C2RA 1DVVA 5CIFB 3MK7C 3ZCFA 3NWVA 3PLNA 1A8CA 2ORLA 2DVHA 1I5TA 2Y0EA 1L9BC 1MG3D 4L3GA 3ZBMA 4L3HA 1GIWA 5KLVD 2CA3B 2JTIB 3DR0A 2AIUA 2OZ1B 1IRWA 3SWSA 1B7VA 1GDVA 1C7MA 4PW9B 1CIGA 4GEDB 3WFCC 1HCMA 2JQRA 2XTSB 2I8FA 1IQCA 1KX7A 1RAPA 1WEJF 2ZONG 2C1VA 1KB9D 4AANA 1LMSA 3HQ8A 5B6QA 3RN1A 4EIEA 1ZRTD 5DJQB 2AI5A 3O5CA 2Y0CA 5CICB 1I8PA 4EIDA 4PJ0V 1MG2D 1SQBD 1CHIA 1I6DA 2YK3A 1C6RA 4RSZA 2KNCB 1YICA 5KAIV 5CIGB 1KV9A 1DT1A 1FOCA 2C1DA 4KMGA 4MU8A 5H2FV 1F1CA 1K3GA 2MTAC 1OCDA 1H1OA 4FB1A 3L4OA 5E79V 3L75D 1NNOA 3MK7B 2BH4X 2K9JB 3OA8A 3ZOYA 1CRJA 4WQ8A 2ZXYA 3NBSA 2N18B 2DGEA 5TISV 4WQ7A 1MZ4A 3L74D 1HJ5A 4WQDA 1CSWA 1C75A 1C2NA 3PHLA 3ZOOA 3A9FA 3L71D 3RN0A 3PXWA 3PH2B 4Y5RA 5CIEB 1L0ND 1SQPD 3GW6A 1GJQA 3WFEC 1CYIA 2LIRA 2ZOOA 1CO6A 1KB0A 2OZ1A 2BH5X 4FA1A 1CTZA 4WQEA 1CIHA 3ITKA 1NMIA 4JCGA 2BGVX 1HJ4A 1DW3A 3H1ID 1J3SA 1H31B 3O1YA 351CA 2LITA 1YFCA 3KZIV 1F1FA 3ZOWA 1EZVD 1H32A 1CXCA 1H9YA 4UB8V 1H9XA 1I55A 451CA 1CORA 1RZ5A 2EXVA 4AALA 1CRIA 1HRCA 4J20A 1CTYA 1E29A 1E8EA 2N3BA 1U75B 1CSVA 4A7PA 2A06D 1CEDA 3GG2A 1NTZD 2N9YB 2QJPB 3H1KD 1NTKD 3A0HV 5TJHA 3NBTA 3TGUD 3PXTA 1N50A 1W5CT 1LFMA 4U3FD 2V07A 3CXHD 1CRHA 1AKKA 1GQ1A 3RMZA 2QJKB 3L73D 5GTHV 4EICA 1QKSA 1I6EA 1YIQA 1DIQC 3SLEA 3WUIA 4EDFA 3OCDB 3HQ9A 1AOFA 1NIRA 1N9CA 2B11B 2GIWA 1DW1A 1H33A 1CTJA 2V08A 1LC1A 2CE0A 3L72D 1HJ3A 5AURA 1CCHA 2BPBB 1C6OA 1CHHA 4PWAA 4AX3A 2QG4A 2C2CA 1OAEA 2L4DA 3CYTI 1L9JC 1SQQD 4P4QB 3H1HD 4H0KA 2YCCA 1PPJD 2N9IA 3CU4A 1QN2A 3ZIYA 4WQ9A 5KLIB 2Q3EA 1FI3A 3WFBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRD A;  1ETP A;  3SJL A;  1CXA A;  4H0J A;  2C8S A;  2D0W A;  2MHM A;  3CWB D;  1YNR A;  4YE1 A;  2FWL A;  4RJT A;  1H33 B;  2ZZS 1;  1YEB A;  4IL6 V;  2CA4 B;  2IBZ D;  2VHD A;  3X39 A;  2GB8 B;  5C9M A;  1NU1 D;  3VNW A;  3JBT B;  1QL4 A;  1CSX A;  5IY5 1;  2FYN B;  2N3Y A;  4GYD A;  2GC7 D;  4D6T D;  4LJI A;  2L91 A;  1CRY A;  4XYD B;  1CIF A;  5B5E V;  2N9J A;  1COT A;  1DW0 A;  2PAC A;  1JDL A;  1GU2 A;  1N15 A;  2C1D B;  3HQ6 A;  4EIF A;  1CC5 A;  4WQA A;  5CIB B;  3CP5 A;  1BCC D;  2PCB B;  1U74 B;  3OCD A;  2RN0 A;  1CYJ A;  3FWL A;  3DP5 A;  3PXS A;  3CXH W;  1KIB A;  1YTC A;  2FRC A;  3L4M A;  4AAM A;  1S6V B;  3PTZ A;  3HQ7 A;  1CSU A;  2CXB A;  2PCC B;  1M70 A;  2BLF B;  3VYM A;  4DY9 A;  2QJY B;  5DJQ C;  3PRJ A;  1K3H A;  2D0S A;  1KYO D;  3O20 A;  1AYG A;  3TYI A;  4N0K A;  1PP9 D;  2Y0D A;  4UB6 V;  4O1Q A;  1R0Q A;  4FA4 A;  1SQV D;  1HZU A;  4AAO A;  1M6Z A;  3CX5 W;  1AOQ A;  1LC2 A;  3L70 D;  1S5L V;  2O3J A;  1I8O A;  3TDK A;  2HV4 A;  1DVH A;  1RZ6 A;  4FAV A;  3WC8 A;  4QAO A;  1FHB A;  3M97 X;  2BCN B;  1M60 A;  1IO3 A;  155C A;  4WQB A;  4FA5 A;  1NML A;  3WFD C;  1LS9 A;  1BL9 A;  1L0L D;  1HRO A;  2C1U A;  1FI7 A;  4FA9 A;  4WQC A;  2YIU B;  1BGY D;  1QL3 A;  3H1J D;  4NFG B;  1ZZH A;  5CID B;  2AXT V;  3H1L D;  1A2S A;  5CYT R;  4O1W A;  1W2L A;  1EB7 A;  1WVE C;  4Q5P A;  2YQB A;  3SVW A;  3ORV A;  2BCC D;  5C0Z A;  1FJ0 A;  1CHJ A;  4XXL A;  1E2R A;  3BCC D;  5CIH B;  1SQX D;  1DII C;  1I54 A;  1RAQ A;  2CE1 A;  5GTI V;  2RMZ A;  1FI9 A;  5DF5 A;  2N18 C;  3SXT A;  1YEA A;  1C52 A;  3DMI A;  1CIE A;  1GKS A;  1H32 B;  1A56 A;  1P84 D;  3A0B V;  3ZOX A;  1IZL 0;  2B4Z A;  2C9X B;  1FCD C;  2KS1 A;  3C2C A;  1CCR A;  2B10 B;  1CNO A;  1CRG A;  1QYZ A;  1HH7 A;  1N90 A;  5EXQ A;  4L1Q A;  5B66 V;  3WU2 V;  2B12 B;  1HZV A;  1KYO W;  5KAF V;  2ZBO A;  2JWA A;  2B0Z B;  4V2K A;  1H31 A;  4PD4 D;  4FAN A;  1IRV A;  1C6S A;  3CX5 D;  3OA8 B;  1CRC A;  3TF5 A;  1DW2 A;  1NTM D;  1VYD A;  5KKZ B;  3VMA A;  2GC4 D;  1CYC A;  1BE3 D;  3O0R C;  1YCC A;  3RLM A;  4K3I A;  2FYU D;  1KX2 A;  5DFS A;  3KHU A;  1C2R A;  1DVV A;  5CIF B;  3MK7 C;  3ZCF A;  3NWV A;  3PLN A;  1A8C A;  2ORL A;  2DVH A;  1I5T A;  2Y0E A;  1L9B C;  1MG3 D;  4L3G A;  3ZBM A;  4L3H A;  1GIW A;  5KLV D;  2CA3 B;  2JTI B;  3DR0 A;  2AIU A;  2OZ1 B;  1IRW A;  3SWS A;  1B7V A;  1GDV A;  1C7M A;  4PW9 B;  1CIG A;  4GED B;  3WFC C;  1HCM A;  2JQR A;  2XTS B;  2I8F A;  1IQC A;  1KX7 A;  1RAP A;  1WEJ F;  2ZON G;  2C1V A;  1KB9 D;  4AAN A;  1LMS A;  3HQ8 A;  5B6Q A;  3RN1 A;  4EIE A;  1ZRT D;  5DJQ B;  2AI5 A;  3O5C A;  2Y0C A;  5CIC B;  1I8P A;  4EID A;  4PJ0 V;  1MG2 D;  1SQB D;  1CHI A;  1I6D A;  2YK3 A;  1C6R A;  4RSZ A;  2KNC B;  1YIC A;  5KAI V;  5CIG B;  1KV9 A;  1DT1 A;  1FOC A;  2C1D A;  4KMG A;  4MU8 A;  5H2F V;  1F1C A;  1K3G A;  2MTA C;  1OCD A;  1H1O A;  4FB1 A;  3L4O A;  5E79 V;  3L75 D;  1NNO A;  3MK7 B;  2BH4 X;  2K9J B;  3OA8 A;  3ZOY A;  1CRJ A;  4WQ8 A;  2ZXY A;  3NBS A;  2N18 B;  2DGE A;  5TIS V;  4WQ7 A;  1MZ4 A;  3L74 D;  1HJ5 A;  4WQD A;  1CSW A;  1C75 A;  1C2N A;  3PHL A;  3ZOO A;  3A9F A;  3L71 D;  3RN0 A;  3PXW A;  3PH2 B;  4Y5R A;  5CIE B;  1L0N D;  1SQP D;  3GW6 A;  1GJQ A;  3WFE C;  1CYI A;  2LIR A;  2ZOO A;  1CO6 A;  1KB0 A;  2OZ1 A;  2BH5 X;  4FA1 A;  1CTZ A;  4WQE A;  1CIH A;  3ITK A;  1NMI A;  4JCG A;  2BGV X;  1HJ4 A;  1DW3 A;  3H1I D;  1J3S A;  1H31 B;  3O1Y A;  351C A;  2LIT A;  1YFC A;  3KZI V;  1F1F A;  3ZOW A;  1EZV D;  1H32 A;  1CXC A;  1H9Y A;  4UB8 V;  1H9X A;  1I55 A;  451C A;  1COR A;  1RZ5 A;  2EXV A;  4AAL A;  1CRI A;  1HRC A;  4J20 A;  1CTY A;  1E29 A;  1E8E A;  2N3B A;  1U75 B;  1CSV A;  4A7P A;  2A06 D;  1CED A;  3GG2 A;  1NTZ D;  2N9Y B;  2QJP B;  3H1K D;  1NTK D;  3A0H V;  5TJH A;  3NBT A;  3TGU D;  3PXT A;  1N50 A;  1W5C T;  1LFM A;  4U3F D;  2V07 A;  3CXH D;  1CRH A;  1AKK A;  1GQ1 A;  3RMZ A;  2QJK B;  3L73 D;  5GTH V;  4EIC A;  1QKS A;  1I6E A;  1YIQ A;  1DIQ C;  3SLE A;  3WUI A;  4EDF A;  3OCD B;  3HQ9 A;  1AOF A;  1NIR A;  1N9C A;  2B11 B;  2GIW A;  1DW1 A;  1H33 A;  1CTJ A;  2V08 A;  1LC1 A;  2CE0 A;  3L72 D;  1HJ3 A;  5AUR A;  1CCH A;  2BPB B;  1C6O A;  1CHH A;  4PWA A;  4AX3 A;  2QG4 A;  2C2C A;  1OAE A;  2L4D A;  3CYT I;  1L9J C;  1SQQ D;  4P4Q B;  3H1H D;  4H0K A;  2YCC A;  1PPJ D;  2N9I A;  3CU4 A;  1QN2 A;  3ZIY A;  4WQ9 A;  5KLI B;  2Q3E A;  1FI3 A;  3WFB C; 
#chains in the Genus database with same CATH topology
 2FBW C;  3D71 A;  2C0W A;  4ZMD A;  2YMK A;  1H88 A;  3P32 A;  1VDF A;  3A2A A;  1OZH A;  1KZU B;  1SQV J;  1NJI Q;  1YNR A;  1ZW0 A;  3H25 A;  4YE1 A;  2FWL A;  2IFN A;  2WSC H;  3WU2 H;  2YNY A;  2WPV B;  1OIP A;  5AW7 B;  1T3J A;  3TGU E;  1NU1 D;  1YQ4 C;  1QL4 A;  4GOF A;  1M1J B;  2K1A A;  2XV5 A;  5IY5 1;  5DJU B;  3BAS A;  4I7Z B;  1P84 H;  3L75 G;  4GYD A;  2GC7 D;  4LJI A;  2L91 A;  1M7L A;  3T97 A;  1VQM P;  1CRY A;  4NPE A;  5B5E V;  1NTM J;  2N9J A;  2PAC A;  1JDL A;  4EIF A;  3AE3 C;  3GF7 A;  1BCC D;  3SWK A;  1FAV A;  3CL3 D;  2C9N Y;  3OAK A;  3VP9 A;  1CYJ A;  3B71 A;  4YXD C;  1FBM A;  1SQQ J;  1YJ9 P;  1JY2 O;  5KJ7 D;  3CXH W;  2FXP A;  2QIW A;  1KIB A;  1YTC A;  3S9O A;  2FRC A;  1YTZ T;  2H7H A;  2PCC B;  3P8C E;  3MD0 A;  1M70 A;  3P7K A;  1ZXG A;  2YKQ A;  1NHL A;  3CXH I;  2IBZ I;  1GK6 A;  1L0L J;  1QX8 A;  3W67 A;  1K3H A;  2KI7 B;  4H13 D;  2AEM A;  1PP9 D;  4ZKU A;  1R0Q A;  1GU4 A;  4WY4 B;  1L4A C;  1HZU A;  3U1A A;  1M6Z A;  3CX5 W;  2O3J A;  3V4Q A;  2HV4 A;  1SQB J;  4K3A A;  2E74 D;  4N78 E;  2E75 B;  1T3U A;  2QEX P;  2Z4E A;  3E1I A;  1RHZ B;  3SSU A;  155C A;  4IFD K;  2J58 A;  4WQB A;  4FA5 A;  1AQT A;  3RL0 g;  1NML A;  3GLM A;  3BAT A;  1HRO A;  4FA9 A;  3CD6 P;  4WQC A;  2PRR A;  1BGY D;  1ZP0 C;  1QL3 A;  1VQ4 P;  4NFG B;  5CID B;  5BU5 A;  1LT9 B;  3H1L D;  2GA1 A;  1VQ5 P;  3QH9 A;  1QVG O;  4O1W A;  3H1L G;  1W2L A;  4PJ0 E;  1WVE C;  1SQB G;  3MTU E;  2YQB A;  2FYU K;  4AQR D;  2OAR A;  1VQN P;  5CCH A;  3BCC D;  1SQX D;  3SFE C;  4C7R A;  1RAQ A;  1FI9 A;  5DF5 A;  3V2Q A;  1SQV G;  1YEA A;  2D2C D;  4WY4 D;  1QLE D;  1T8Z A;  1U57 A;  1OWA A;  1A56 A;  4OWF A;  3M9B A;  3BCC J;  2M5A B;  2KS1 A;  4IFM A;  3S1K A;  2G3A A;  2WSE H;  1CRG A;  1QGK B;  2WMM A;  1GMJ A;  3Q3D A;  1J2J B;  1BSH A;  5EXQ A;  4Y99 B;  2BCC G;  5B66 V;  3WU2 V;  1GL2 D;  2VRS A;  2B12 B;  1EC5 A;  2YKP A;  4Z1M H;  2H8P D;  3RGU A;  3GF3 A;  1X0T A;  4LC1 A;  1BE3 G;  4IOI H;  5CBO A;  1RE4 A;  1FJP A;  1H31 A;  4FAN A;  3V4W A;  3H32 A;  3A0H H;  3D0W A;  3TF5 A;  5CJ4 A;  3VMA A;  1NGM B;  1M1J A;  3L75 E;  3M0D C;  1JY2 P;  1FE6 A;  1YCC A;  1ZME C;  3RLM A;  4GOE A;  3I56 P;  2BCC J;  2POH A;  1KX2 A;  5DFS A;  1DVV A;  3C1L A;  3PLN A;  2ORL A;  1LWU A;  3Q2Y A;  4YXW H;  1SQX E;  2H89 C;  2K9Y A;  2QJY C;  1VQP P;  4L3G A;  3ZBM A;  2I8D A;  2JP3 A;  1DEE G;  2JTI B;  2AIU A;  1SQP E;  3HUS C;  2OZ1 B;  1JTH A;  3HE5 B;  1BE3 E;  1N7S C;  2K9J A;  1C7M A;  5AVV B;  3L73 E;  4PW9 B;  1CIG A;  1JY3 N;  1URQ B;  1AJY A;  3U1C A;  1LJ2 A;  2JQR A;  1PP9 G;  1IQC A;  4MN4 C;  1RAP A;  3BVH A;  2ZON G;  4WB4 A;  5E79 E;  2IYO A;  1FDO A;  4EIE A;  4KHX A;  1FZF A;  3O5C A;  2Y0C A;  5KLI C;  2WTY A;  1OFC X;  4EID A;  1MG2 D;  3RK2 D;  1PGJ A;  2YXR B;  1LTT C;  2Q6Q A;  3PH0 A;  4H44 D;  1MFZ A;  5KAI V;  3V2P A;  2WT7 A;  2OYI C;  3WU2 E;  5CIG B;  1GL2 C;  1DT1 A;  1FOC A;  2C1D A;  5KAF E;  4MU8 A;  1JTH B;  1M8O B;  3M9Q A;  2KLU A;  1H1O A;  4FB1 A;  2N1T B;  1NNO A;  3MK7 B;  3K5B A;  2K9J B;  2ZFC A;  1NOH A;  4WQ8 A;  3JSV C;  2NZ2 A;  3L74 G;  2HLO A;  2WSS H;  4L73 A;  1U7J A;  3L74 D;  2A45 H;  1KQF B;  2ZYA A;  1FOS F;  1G2C A;  1PZQ A;  3PHL A;  3H1J E;  3RK2 B;  1JB0 J;  1HF9 A;  5E79 H;  3GW6 A;  3WFE C;  1CYI A;  2O01 H;  2QSI A;  1KYO E;  2BCC E;  1LP1 B;  2ZYG A;  1J1E B;  1EDL A;  4FA1 A;  1CTZ A;  5TIS E;  5APT A;  4H13 B;  1DD4 A;  3P8M C;  4TLF A;  2O1J A;  1Q7Y Q;  1YFC A;  3OW2 O;  3A5T A;  1NVO A;  1SQQ G;  1H9Y A;  1PV3 A;  1IFD A;  1PIX A;  4GKG A;  1FZC A;  5DJT B;  3CXH E;  1YBK A;  3N7N A;  1KIL C;  4HKZ H;  1WRG A;  4J20 A;  3H6P A;  3L72 G;  1U75 B;  2A06 D;  2D2C C;  2N9Y B;  5AVW B;  1NTK D;  3A0H V;  3ZDM A;  2WT7 B;  1BE3 J;  1USE A;  1HWT C;  1N50 A;  1LFM A;  4GOD A;  4D6T E;  1KYO H;  3E1R A;  1JY3 O;  1VQ7 P;  2E75 C;  3G3Z A;  2PP6 A;  3WUI A;  1H0T A;  3A0B E;  3L70 E;  1AOF A;  4I7Z C;  2IZ0 A;  4HYT B;  3KDP B;  1N9C A;  3CX5 I;  2GIW A;  1EXI A;  4U3F G;  1VF5 B;  1CTJ A;  1KB9 E;  2HYN A;  4EIJ A;  3L72 D;  1HJ3 A;  1KQS O;  3M06 A;  1N7S B;  2JEE A;  3VMZ A;  1SP4 A;  4P4Q B;  4H0K A;  2WWW A;  3FX0 A;  1HJB A;  2OTK E;  1NTZ J;  3CCE P;  2Q3E A;  3WFB C;  3TGU J;  3FXE A;  4C46 A;  2JO1 A;  1EDK A;  1ETP A;  1X9V A;  2JDI H;  5AVY B;  2K3R A;  2MHM A;  3PJS K;  1CW5 A;  2ZZS 1;  3G9R A;  2QVA A;  2CA4 B;  2FFD C;  4OGQ C;  3L71 E;  2FYU G;  3JBT B;  5KAI H;  4N3Y B;  1AQ5 A;  1KFN A;  5CMZ A;  3A0H E;  3CWB E;  2W6J H;  1LGH B;  1N15 A;  2C1D B;  1RF1 C;  2QJP C;  5CCH C;  3CP5 A;  2PCB B;  3OCD A;  1YIJ P;  4I1L A;  1EZV E;  2OYI A;  3FWL A;  3CME P;  3PXS A;  3S4R A;  2B9B A;  1L2P A;  2HOD B;  4AUW A;  3VYI A;  1NTM K;  3L4M A;  4AAM A;  3PTZ A;  3HQ7 A;  4D6T J;  5CCG A;  2CXB A;  1UII A;  1S72 P;  1LT1 A;  2BLF B;  3JC2 2;  1WT6 A;  3T97 B;  4EI2 A;  1T6A A;  2QJY B;  5DJQ C;  3O20 A;  1AYG A;  4N0K A;  2Y0D A;  2ZVN B;  4O1Q A;  4FA4 A;  4DJG A;  1JCD A;  1E79 H;  4H44 B;  2E74 C;  3FWN A;  3D6Z A;  1S5L V;  1LTJ C;  1LT9 C;  2W8Z A;  1I8O A;  5APU A;  1EDI A;  4W7Z A;  1DVH A;  2R5D A;  1NU1 E;  1RZ6 A;  4FAV A;  1GL2 A;  2M0B A;  3G6E P;  3M97 X;  1S3J A;  1IO3 A;  3VN0 A;  4XE5 B;  2IYP A;  2N1T D;  3WFD C;  2V7Q H;  1GU5 A;  1BL9 A;  5AVR B;  2KSE A;  3HD7 B;  2YIU B;  1HVV A;  5AW3 B;  2AXT V;  2ZT9 C;  4UB6 H;  5CYT R;  2KYV A;  1PGQ A;  1Y47 A;  4Q5P A;  1N73 C;  2C9L Y;  2BCC D;  2P7J A;  1FJ0 A;  4R4M A;  1NTZ G;  1E2R A;  5AW8 B;  1L0N J;  2QE7 H;  3FXD A;  1DII C;  5GTI V;  3SXT A;  4H0L B;  1J1D B;  3MUD C;  3HE5 A;  1NU1 G;  1VPC A;  1A02 F;  1C52 A;  1OXZ A;  1RQV A;  1H32 B;  1YYC A;  5B66 H;  1P84 D;  3A0B V;  4GIF A;  2B4Z A;  1KQG B;  2BEZ F;  1NAY A;  2FXO A;  2WSF H;  1CCR A;  1LTS C;  1CNO A;  3IFM A;  1N8R Q;  1QYZ A;  1G1I A;  2H88 C;  1USD A;  4L1Q A;  1DD3 A;  5AVQ B;  2QRX A;  1L4A A;  4QMA A;  1YHQ P;  5KAF V;  5APW A;  4PD4 D;  4ZNC A;  1IRV A;  3SWY A;  1M1K Q;  1KV4 A;  1BGY G;  1IK7 A;  2PAJ A;  3H1K G;  1NTM D;  4R4L A;  2GC4 D;  1S5L X;  3CCQ P;  1NTK J;  3D70 A;  4B86 A;  2LR2 A;  1QEX A;  2FFD A;  2Y9Y A;  3HE4 B;  5KLV K;  2FYU D;  2Q3I A;  2P67 A;  1IZN B;  1L0L G;  1C2R A;  1A8C A;  1JNM A;  3M91 A;  1MG3 D;  4L3H A;  2XKM A;  1K04 A;  2M3B A;  5KLV D;  2Q7C A;  4WY4 C;  2E43 A;  3H1J J;  1YJW P;  4N78 D;  2YO3 A;  3B4S A;  3CCR P;  3V6I A;  3SWS A;  3H32 B;  1RF0 A;  2N9B A;  3KPE A;  2R32 A;  3C8V A;  4GED B;  1L4A D;  3WFC C;  3HUS A;  2QM7 A;  1BCC J;  2R3C A;  2V4H A;  2AXT E;  1IC2 A;  3L74 J;  1R8E A;  1Y9B A;  3TK1 A;  1EDJ A;  3TNU B;  5DJQ B;  2WVR A;  1I8P A;  4PJ0 V;  2KSJ A;  1YIT P;  1I6D A;  2YK3 A;  1OW7 A;  1BCC G;  3E7K A;  4Y28 J;  3BCC E;  1VQ8 P;  2XZR A;  3D6Y A;  3QWO C;  4IFF A;  1SS1 A;  2M3E A;  2HPC B;  1K73 Q;  2O1K A;  1BCC E;  1JOC A;  3RL0 B;  1K3G A;  1OCD A;  5CCH D;  3L4O A;  5E79 V;  3L75 D;  1RQU A;  3I55 P;  3RL0 D;  1CRJ A;  3H1J G;  3MHV A;  4WQ7 A;  1KIL D;  3HUS B;  3AEA C;  1CSW A;  1Q82 Q;  3HD7 A;  1FDM A;  3L35 A;  1C75 A;  1C2N A;  4H13 C;  3PXW A;  3PH2 B;  4Y5R A;  5CIE B;  3JCU H;  1SQP D;  2LKM A;  1SQX J;  1KYO I;  5GTI H;  4OH8 B;  2W6B A;  3CC7 P;  1SQB K;  1DEB A;  2J5U A;  1XTC C;  2ITA A;  1KB0 A;  5L8R J;  5AVZ B;  4TT3 H;  1PPJ E;  2ZYD A;  1RH5 B;  2R5B A;  3CX5 H;  3LIE A;  2LXB A;  2BGV X;  1DW3 A;  1NWQ A;  3H1I D;  1H31 B;  3PP5 A;  1F1F A;  1X79 B;  4JYC A;  2R44 A;  3EWK A;  1H32 A;  5APQ A;  2B88 A;  3VMX A;  1NTZ K;  1COR A;  1CRI A;  1OW6 A;  3A7O A;  3TNU A;  5KLV G;  1ZN5 A;  2M5A A;  1E8E A;  3R4Y A;  2E74 B;  1CED A;  3M9H A;  1FZC C;  5TJH A;  3NBT A;  1L0L K;  3PXT A;  3Q5P A;  1W5C T;  5C39 A;  2O01 N;  1GK4 A;  1S1C X;  1AKK A;  3MP7 B;  4WVZ A;  2QJK B;  3L73 D;  1KC8 Q;  3CI9 A;  1JY2 N;  3CX5 E;  4L75 A;  1OX3 A;  2WPS A;  2FYN C;  3RBZ A;  2YIU C;  3OCD B;  1NTZ E;  1NIR A;  4AYC A;  1CI6 A;  1LTG C;  3AE7 C;  1H33 A;  3RL0 C;  3CMA P;  2BAS A;  1LC1 A;  2FKW B;  1URQ C;  2NPS C;  1C6O A;  4AX3 A;  2XDJ A;  1YJN P;  1OAE A;  2YXQ B;  1R5S A;  1YI2 P;  2L4D A;  2OQQ A;  3RK3 C;  4DCK A;  2QA4 P;  1SQQ D;  4CPG A;  2A45 G;  1LWU B;  3KQG A;  2R3S A;  1QN2 A;  2OYH A;  1JY3 P;  4W80 A;  5CBN A;  3L4F A;  1AA0 A;  1CXA A;  4L74 A;  1PP9 J;  3L71 G;  2D0W A;  1SQV E;  2W83 C;  3CWB D;  4RJT A;  5KLV J;  3NTN A;  2YKO A;  2IBZ D;  1VL2 A;  2VHD A;  3X39 A;  1CZQ A;  1VF5 D;  5KAF H;  1KIL A;  2PGD A;  1N2D C;  2IDB A;  2KS1 B;  1IFP A;  1MZ9 A;  4ASV A;  2FYN B;  3TYY A;  4D6T D;  2E76 D;  4Y99 C;  2WIT A;  2RH0 A;  1T2K D;  4XYD B;  4XFJ A;  4RO0 A;  3GMA A;  1VQO P;  1U7M A;  3AE2 C;  3LW5 H;  1DH3 A;  1COT A;  2IBZ G;  4JQ0 D;  1CC5 A;  3CWB G;  2RN0 A;  4GT1 A;  1NYH A;  3H1K J;  4YTP C;  3B5N A;  3DP5 A;  2RKL A;  5B5E H;  1SQQ E;  5TIS H;  1IFN A;  1SFC D;  3RK2 C;  3H1L J;  1S6V B;  1IK9 A;  3AE1 C;  1CSU A;  3H1I J;  1FC2 C;  2L5G B;  2HFE D;  3MZW B;  2OYH B;  3H1H G;  3VYM A;  3USS A;  4DY9 A;  3R2P A;  1NKZ B;  3PRJ A;  3CXH H;  2Q1K A;  2D0S A;  2ZJS E;  3W68 A;  3TYI A;  3AEF C;  4UB6 V;  2KK7 A;  1S9K E;  2KZJ A;  1KB9 I;  1SFC A;  1AOQ A;  3L70 D;  1JMB A;  1SQQ K;  1LTA C;  2YO2 A;  2XU6 A;  2H43 A;  3V2R A;  3VP8 A;  3WC8 A;  3KZI H;  3L73 G;  2BCN B;  4NPF X;  1KIL E;  3MUD A;  2P58 A;  5KJ7 C;  3L74 E;  1FOS E;  1LS9 A;  1A02 J;  1FI7 A;  1PGO A;  2Q9I A;  3A0B H;  3H1J D;  1BDD A;  4K35 A;  4WBA A;  4RES B;  1S5L E;  1KB9 H;  1RF0 C;  5K5G B;  4PV1 C;  2KP8 A;  2WQY C;  3SVW A;  2A45 I;  1BSN A;  3ORV A;  1FZB A;  3WMM 0;  5AW0 B;  2E5T A;  1CHJ A;  1DX7 A;  4U3F J;  5CIH B;  2CE1 A;  1BGY E;  1BDC A;  3L70 J;  1LTJ B;  1CIE A;  3AE8 C;  4KJM A;  1IFJ A;  3AE4 C;  3ZOX A;  3AEE C;  2I1K A;  5CCG C;  2C9X B;  5APS A;  3C2C A;  1T2K C;  1L0N K;  2B10 B;  3GHG A;  1SQX G;  4DOJ A;  3L72 J;  1JO5 A;  1N90 A;  5KAI E;  4PV1 B;  1N86 A;  1ZRT E;  2KNC A;  1HZV A;  1KYO W;  2ZBO A;  1QL2 A;  2JWA A;  2B0Z B;  1UIX A;  3HTK A;  4D6T G;  1AVY A;  2KUB A;  1W2B O;  1OVR A;  1MV8 A;  1N7L A;  2KOG A;  4OVN F;  4LLH A;  3TGU G;  3L37 A;  5AW1 B;  1VYD A;  1KQL A;  2V7Q J;  2WSF J;  1BE3 D;  4HH2 A;  4K3I A;  4KT0 J;  3CCS P;  2SPZ A;  3KHU A;  1RF1 A;  2NRG A;  5CIF B;  3ZCF A;  3NWV A;  3GHG B;  2DVH A;  1FZG A;  1VQ6 P;  1S2E A;  4PV1 D;  2CK3 H;  3Q1M A;  1HGV A;  1GIW A;  2GM4 A;  1M57 D;  2CA3 B;  1NTK E;  3M0A A;  3AE9 C;  4W7Y A;  1L0N E;  1N73 A;  3DR0 A;  2OYH C;  4ASW A;  2B89 A;  2JR8 A;  1IRW A;  1B7V A;  3L70 G;  2FXM A;  1W2E A;  1HCM A;  2P1J A;  2I1J A;  2W6A A;  2XTS B;  4H0L D;  4M3L A;  1WEJ F;  1LMS A;  1VQK P;  3IAO A;  3HQ8 A;  5B6Q A;  3CPW O;  1ZRT D;  1HGZ A;  3HE4 A;  3UIA A;  2W90 A;  4IL6 H;  1SQB D;  1EQ7 A;  1JM0 A;  5KKZ C;  3AEC C;  1C6R A;  1PL5 A;  2E76 C;  3TSI A;  4RSZ A;  2KNC B;  1NU1 J;  1KV9 A;  1N73 B;  1L0N G;  3IF4 A;  2NPS B;  5H2F V;  1VF5 C;  1DIP A;  2MTA C;  3II6 A;  1R5L A;  3ZOY A;  2ZXY A;  1D7M A;  3NBS A;  5AW9 B;  2DGE A;  1MZ4 A;  2OGU A;  2E75 D;  2FYZ A;  1K9M Q;  3NXS A;  5AVX B;  3H1I E;  3H1L E;  3RN0 A;  1L0N D;  2MKV A;  1HJ0 A;  2ZXX A;  2FY8 A;  2N1T C;  3O6Q A;  1HBW A;  2M8R A;  3OA7 A;  2HG5 D;  2LIR A;  4BXL A;  2ZOO A;  1CO6 A;  3EFF K;  5CJ0 A;  3V2N A;  5B5E E;  1VQL P;  1Q86 Q;  4WY4 A;  1S9K D;  3ITK A;  1Q90 D;  3OJA B;  4C7N B;  3G4S P;  3CCU P;  1J3S A;  2JKV A;  5EFW B;  2J59 M;  1S4X A;  3ZOW A;  4UB8 V;  1H9X A;  451C A;  4AAL A;  3VOP A;  4WWI A;  1HRC A;  2QJK C;  1CTY A;  1LTI C;  2N3B A;  1CSV A;  3GG2 A;  4JPZ B;  1XTG B;  4PD4 I;  3KXD A;  4U7J A;  5KLV E;  2Q5U A;  4LGD E;  2ZXE B;  3L72 E;  3TGU D;  1OMI A;  3O6Q B;  3NMD A;  3KZI E;  3L36 A;  1SQP J;  2OYO A;  3F5H A;  2KIK A;  2V07 A;  2IPP A;  1CRH A;  2G8Y A;  1GQ1 A;  2PFX A;  4EYY Q;  1FS0 E;  4C7N A;  3SLE A;  1GL2 B;  4EDF A;  2DW3 A;  2IFM A;  2E42 A;  2B11 B;  3H1K E;  3LW5 J;  5AUR A;  3B8E B;  1MUU A;  2BPB B;  3FGA D;  1CHH A;  4PWA A;  1SQV K;  2QG4 A;  3CCJ P;  4U3F E;  3CYT I;  3CCL P;  1LT9 A;  1EZV I;  2KLV A;  3H1H D;  1Q2N A;  3AEB C;  1PPJ D;  2E5Y A;  3CU4 A;  3ZIY A;  4WQ9 A;  3MGN A;  2K88 A;  2UWJ E;  3GHG C;  3L71 J;  3VRD A;  3SJL A;  3RK3 B;  4H0J A;  4PD4 E;  2C8S A;  1JEK A;  2N1T A;  1H33 B;  1YEB A;  4IL6 V;  2W27 A;  1GDT A;  1H8A A;  4HJG H;  2ZT9 B;  1ZR2 A;  2GB8 B;  2CPB A;  5KJ7 A;  5C9M A;  3VNW A;  2OTL P;  1CSX A;  2N3Y A;  2FYU E;  4BRY A;  3CLQ A;  1CIF A;  1FZE A;  2QM8 A;  1L0L E;  1DW0 A;  2AXC A;  2WZ7 A;  1GU2 A;  3HQ6 A;  1LP1 A;  4WQA A;  5CIB B;  1G1J A;  1RE3 C;  1U74 B;  3JCU E;  2WSC J;  2XND H;  5AVS B;  4PD4 H;  1ZOY C;  1EZV G;  5M1B A;  1URQ A;  5AVT B;  1AVO A;  3CC4 P;  1KIL B;  2FFD B;  2JJL A;  1GD2 E;  1SQP K;  2ZVO B;  3RBX A;  1YQ3 C;  3F89 A;  3V5B A;  1SFC C;  4I2L C;  2C0X A;  1CSB A;  1IO4 A;  1IFM A;  1SQB E;  1FJK A;  1KYO D;  2B87 A;  3AE6 C;  1J1E C;  1SQV D;  2AEJ A;  4AAO A;  4YPC A;  5GTH E;  1FU1 A;  1Y8A A;  3AED C;  1LC2 A;  3EQ2 A;  2WPQ A;  3BCC G;  1K05 A;  1M56 D;  4H0L C;  3TDK A;  1P84 I;  1RY3 A;  1VQ9 P;  4QAO A;  2WSE J;  1FHB A;  1EXJ A;  1GW4 A;  1M60 A;  4IL6 E;  4DZO A;  3C9I A;  1JCC A;  3ABV C;  1PP9 E;  2P2U A;  1AFO A;  4BWN A;  2IZ1 A;  1L0L D;  5AW6 B;  2C1U A;  3EFG A;  4BRY B;  1ZZH A;  4XA4 A;  1MFT A;  1N7S D;  1A2S A;  4RKU J;  4IL6 X;  1EB7 A;  1KD1 Q;  3AE5 C;  1SFC B;  5C0Z A;  2HPC A;  3Q5S A;  1JUN A;  4XXL A;  5GTH H;  1OVV A;  3CWB J;  1I54 A;  2RMZ A;  1CI6 B;  4EOT A;  2N18 C;  1MKM A;  4UB8 H;  1NTK K;  1LNQ A;  3DMI A;  4H44 C;  1GKS A;  2JWD A;  1ZR4 A;  1NH4 A;  5AW5 B;  3B5N D;  1J1D C;  1IZL 0;  3H1I G;  1FCD C;  3CC2 P;  1PFI A;  2NPS D;  3N4X A;  2B87 B;  3B5N C;  5CCG D;  1KFM A;  3Q5R A;  1K8A Q;  1HH7 A;  1NO4 A;  2ZT9 D;  4JBZ A;  2P10 A;  1H89 A;  1GZL A;  2KZI A;  3WUV A;  4UB6 E;  4JF7 A;  3HD7 C;  1P84 E;  4I6M C;  1SLQ A;  4V2K A;  1C6S A;  3CX5 D;  2NPS A;  1H0T B;  2GUS A;  3B5N B;  1FZC B;  3OA8 B;  1CRC A;  2XNX A;  3VMY A;  1DW2 A;  4UB8 E;  5KKZ B;  1CYC A;  1KOR A;  5B66 E;  3O0R C;  3H1H E;  1M90 Q;  3CCV P;  3MK7 C;  1FDI A;  1ZLL A;  1I5T A;  2Y0E A;  1L9B C;  1IFI A;  3WUT A;  1HUC A;  3G71 P;  5CHX A;  3L75 J;  3MIW A;  5KTB A;  1KTM A;  3HTK B;  1JMM A;  5BU8 B;  1GDV A;  1RE3 A;  2Z5I A;  3M0D A;  1SVF A;  5BVZ A;  3BRT B;  2I8F A;  1WMK A;  1KX7 A;  1W5C E;  3P8C D;  5APX A;  1G2C B;  2C1V A;  1N7S A;  1GTW A;  1KB9 D;  1OW8 A;  4AAN A;  2KXP B;  3RN1 A;  5H2F H;  2BEQ D;  2AI5 A;  3HRN A;  5CIC B;  1RF1 B;  1CHI A;  4DT0 A;  3U59 A;  1YIC A;  2Z5H A;  3IN6 A;  1NTK G;  1S5L H;  2IX7 C;  4KMG A;  2GUV A;  1F1C A;  4OGQ D;  4PJ0 H;  2BH4 X;  2OYI B;  3OA8 A;  1TU3 F;  4OGQ B;  1BGY J;  4L76 A;  2N18 B;  5TIS V;  5AW2 B;  4WQD A;  1HJ5 A;  1NU1 K;  5AVU B;  3I5C A;  1GW3 A;  1KN7 A;  3ZOO A;  3A9F A;  1OVU A;  3L71 D;  4NPD A;  2AXT H;  4O9B A;  5H2F E;  3CCM P;  1GJQ A;  1PGP A;  2HR3 A;  1X8Y A;  1HH0 A;  1NAF A;  2OZ1 A;  1FZA A;  1ZV8 A;  2K37 A;  2BH5 X;  4WQE A;  1CIH A;  2Y9Z A;  1L4A B;  1NMI A;  4JCG A;  2CPS A;  3RK3 E;  1HJ4 A;  1YTZ I;  1IJD B;  3O1Y A;  351C A;  2E76 B;  2LIT A;  1LWU C;  3KZI V;  3SWF A;  1PPJ G;  1NTM E;  3IR9 A;  2WPR A;  2HOD A;  1EZV D;  1LTJ A;  1CXC A;  3LID A;  2YMY A;  1I55 A;  2KB7 P;  1RZ5 A;  2EXV A;  1E5W A;  5APV A;  1SQX K;  1E29 A;  3KYQ A;  4N6J A;  4A7P A;  1NTZ D;  1QVF O;  2QJP B;  3H1K D;  3L73 J;  2LXC B;  5APY A;  1NKN A;  1Z56 A;  5AW4 B;  1RE4 C;  1Q81 Q;  3VTP C;  5GTI E;  1HTL C;  2D2C B;  3O8Z A;  2A06 G;  4U3F D;  3CXH D;  3AEG C;  3RMZ A;  5GTH V;  4EIC A;  1I6E A;  1QKS A;  4HB1 A;  2MJZ A;  1YIQ A;  1DIQ C;  1KMI Z;  2A06 E;  3BRV B;  3HQ9 A;  1X22 A;  1M1J C;  3H1H J;  3WUU A;  3NFQ A;  1DW1 A;  2O01 J;  2V08 A;  4ZKP A;  3SFD C;  1NTM G;  2CE0 A;  1CCH A;  2OTJ P;  3A3Y B;  2C2C A;  2ZAE B;  1L9J C;  1LTB C;  1AV1 A;  2YCC A;  2AEF A;  3HD7 D;  2N9I A;  2FYU J;  1QL1 A;  3RK3 D;  4GDO A;  5KLI B;  2IBZ E;  1SQP G;  4JYB A;  1FI3 A;  1URQ D; 
#chains in the Genus database with same CATH homology
 3VRD A;  1ETP A;  3SJL A;  1CXA A;  4H0J A;  2C8S A;  2D0W A;  2MHM A;  3CWB D;  1YNR A;  4YE1 A;  2FWL A;  4RJT A;  1H33 B;  2ZZS 1;  1YEB A;  4IL6 V;  2CA4 B;  2IBZ D;  2VHD A;  3X39 A;  2GB8 B;  5C9M A;  1NU1 D;  3VNW A;  3JBT B;  1QL4 A;  1CSX A;  5IY5 1;  2FYN B;  2N3Y A;  4GYD A;  2GC7 D;  4D6T D;  4LJI A;  2L91 A;  1CRY A;  4XYD B;  1CIF A;  5B5E V;  2N9J A;  1COT A;  1DW0 A;  2PAC A;  1JDL A;  1GU2 A;  1N15 A;  2C1D B;  3HQ6 A;  4EIF A;  1CC5 A;  4WQA A;  5CIB B;  3CP5 A;  1BCC D;  2PCB B;  1U74 B;  3OCD A;  2RN0 A;  1CYJ A;  3FWL A;  3DP5 A;  3PXS A;  3CXH W;  1KIB A;  1YTC A;  2FRC A;  3L4M A;  4AAM A;  1S6V B;  3PTZ A;  3HQ7 A;  1CSU A;  2CXB A;  2PCC B;  1M70 A;  2BLF B;  3VYM A;  4DY9 A;  2QJY B;  5DJQ C;  3PRJ A;  1K3H A;  2D0S A;  1KYO D;  3O20 A;  1AYG A;  3TYI A;  4N0K A;  1PP9 D;  2Y0D A;  4UB6 V;  4O1Q A;  1R0Q A;  4FA4 A;  1SQV D;  1HZU A;  4AAO A;  1M6Z A;  3CX5 W;  1AOQ A;  1LC2 A;  3L70 D;  1S5L V;  2O3J A;  1I8O A;  3TDK A;  2HV4 A;  1DVH A;  1RZ6 A;  4FAV A;  3WC8 A;  4QAO A;  1FHB A;  3M97 X;  2BCN B;  1M60 A;  1IO3 A;  155C A;  4WQB A;  4FA5 A;  1NML A;  3WFD C;  1LS9 A;  1BL9 A;  1L0L D;  1HRO A;  2C1U A;  1FI7 A;  4FA9 A;  4WQC A;  2YIU B;  1BGY D;  1QL3 A;  3H1J D;  4NFG B;  1ZZH A;  5CID B;  2AXT V;  3H1L D;  1A2S A;  5CYT R;  4O1W A;  1W2L A;  1EB7 A;  1WVE C;  4Q5P A;  2YQB A;  3SVW A;  3ORV A;  2BCC D;  5C0Z A;  1FJ0 A;  1CHJ A;  4XXL A;  1E2R A;  3BCC D;  5CIH B;  1SQX D;  1DII C;  1I54 A;  1RAQ A;  2CE1 A;  5GTI V;  2RMZ A;  1FI9 A;  5DF5 A;  2N18 C;  3SXT A;  1YEA A;  1C52 A;  3DMI A;  1CIE A;  1GKS A;  1H32 B;  1A56 A;  1P84 D;  3A0B V;  3ZOX A;  1IZL 0;  2B4Z A;  2C9X B;  1FCD C;  2KS1 A;  3C2C A;  1CCR A;  2B10 B;  1CNO A;  1CRG A;  1QYZ A;  1HH7 A;  1N90 A;  5EXQ A;  4L1Q A;  5B66 V;  3WU2 V;  2B12 B;  1HZV A;  1KYO W;  5KAF V;  2ZBO A;  2JWA A;  2B0Z B;  4V2K A;  1H31 A;  4PD4 D;  4FAN A;  1IRV A;  1C6S A;  3CX5 D;  3OA8 B;  1CRC A;  3TF5 A;  1DW2 A;  1NTM D;  1VYD A;  5KKZ B;  3VMA A;  2GC4 D;  1CYC A;  1BE3 D;  3O0R C;  1YCC A;  3RLM A;  4K3I A;  2FYU D;  1KX2 A;  5DFS A;  3KHU A;  1C2R A;  1DVV A;  5CIF B;  3MK7 C;  3ZCF A;  3NWV A;  3PLN A;  1A8C A;  2ORL A;  2DVH A;  1I5T A;  2Y0E A;  1L9B C;  1MG3 D;  4L3G A;  3ZBM A;  4L3H A;  1GIW A;  5KLV D;  2CA3 B;  2JTI B;  3DR0 A;  2AIU A;  2OZ1 B;  1IRW A;  3SWS A;  1B7V A;  1GDV A;  1C7M A;  4PW9 B;  1CIG A;  4GED B;  3WFC C;  1HCM A;  2JQR A;  2XTS B;  2I8F A;  1IQC A;  1KX7 A;  1RAP A;  1WEJ F;  2ZON G;  2C1V A;  1KB9 D;  4AAN A;  1LMS A;  3HQ8 A;  5B6Q A;  3RN1 A;  4EIE A;  1ZRT D;  5DJQ B;  2AI5 A;  3O5C A;  2Y0C A;  5CIC B;  1I8P A;  4EID A;  4PJ0 V;  1MG2 D;  1SQB D;  1CHI A;  1I6D A;  2YK3 A;  1C6R A;  4RSZ A;  2KNC B;  1YIC A;  5KAI V;  5CIG B;  1KV9 A;  1DT1 A;  1FOC A;  2C1D A;  4KMG A;  4MU8 A;  5H2F V;  1F1C A;  1K3G A;  2MTA C;  1OCD A;  1H1O A;  4FB1 A;  3L4O A;  5E79 V;  3L75 D;  1NNO A;  3MK7 B;  2BH4 X;  2K9J B;  3OA8 A;  3ZOY A;  1CRJ A;  4WQ8 A;  2ZXY A;  3NBS A;  2N18 B;  2DGE A;  5TIS V;  4WQ7 A;  1MZ4 A;  3L74 D;  1HJ5 A;  4WQD A;  1CSW A;  1C75 A;  1C2N A;  3PHL A;  3ZOO A;  3A9F A;  3L71 D;  3RN0 A;  3PXW A;  3PH2 B;  4Y5R A;  5CIE B;  1L0N D;  1SQP D;  3GW6 A;  1GJQ A;  3WFE C;  1CYI A;  2LIR A;  2ZOO A;  1CO6 A;  1KB0 A;  2OZ1 A;  2BH5 X;  4FA1 A;  1CTZ A;  4WQE A;  1CIH A;  3ITK A;  1NMI A;  4JCG A;  2BGV X;  1HJ4 A;  1DW3 A;  3H1I D;  1J3S A;  1H31 B;  3O1Y A;  351C A;  2LIT A;  1YFC A;  3KZI V;  1F1F A;  3ZOW A;  1EZV D;  1H32 A;  1CXC A;  1H9Y A;  4UB8 V;  1H9X A;  1I55 A;  451C A;  1COR A;  1RZ5 A;  2EXV A;  4AAL A;  1CRI A;  1HRC A;  4J20 A;  1CTY A;  1E29 A;  1E8E A;  2N3B A;  1U75 B;  1CSV A;  4A7P A;  2A06 D;  1CED A;  3GG2 A;  1NTZ D;  2N9Y B;  2QJP B;  3H1K D;  1NTK D;  3A0H V;  5TJH A;  3NBT A;  3TGU D;  3PXT A;  1N50 A;  1W5C T;  1LFM A;  4U3F D;  2V07 A;  3CXH D;  1CRH A;  1AKK A;  1GQ1 A;  3RMZ A;  2QJK B;  3L73 D;  5GTH V;  4EIC A;  1QKS A;  1I6E A;  1YIQ A;  1DIQ C;  3SLE A;  3WUI A;  4EDF A;  3OCD B;  3HQ9 A;  1AOF A;  1NIR A;  1N9C A;  2B11 B;  2GIW A;  1DW1 A;  1H33 A;  1CTJ A;  2V08 A;  1LC1 A;  2CE0 A;  3L72 D;  1HJ3 A;  5AUR A;  1CCH A;  2BPB B;  1C6O A;  1CHH A;  4PWA A;  4AX3 A;  2QG4 A;  2C2C A;  1OAE A;  2L4D A;  3CYT I;  1L9J C;  1SQQ D;  4P4Q B;  3H1H D;  4H0K A;  2YCC A;  1PPJ D;  2N9I A;  3CU4 A;  1QN2 A;  3ZIY A;  4WQ9 A;  5KLI B;  2Q3E A;  1FI3 A;  3WFB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...