1NTZD

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 54
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntzD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntzD01
3NBTA 4AX3A 3L71D 4A7PA 1CHHA 2Y0CA 1NTKD 1CSUA 1YICA 4AALA 2PACA 4WQ8A 3GG2A 1CYJA 1QL4A 1FI7A 5CYTR 2GC7D 3TF5A 3TYIA 3PLNA 1ETPA 3CX5W 4LJIA 3MK7B 1H33B 1S6VB 3ZBMA 3H1JD 1CRHA 1EZVD 4EICA 2YIUB 2BCNB 4FA4A 4WQ7A 1CTYA 2B10B 5CIFB 3C2CA 2DGEA 1NIRA 1K3HA 3ZOWA 4JCGA 3PRJA 4GYDA 3VRDA 2CXBA 1CSVA 1YFCA 3OA8A 1CXAA 1HROA 3PTZA 2N18C 1C6RA 3SLEA 4D6TD 1CTZA 1RZ5A 1CIHA 1AKKA 1H31A 1KYOW 5DFSA 1DW0A 4QAOA 2EXVA 2AI5A 2DVHA 2C2CA 3HQ8A 1DIQC 1VYDA 2A06D 2JTIB 1GQ1A 2C1VA 2QJPB 1C52A 1DW3A 2N3BA 2N18B 1YTCA 1I6EA 3H1LD 3H1HD 5DJQC 1I54A 3CP5A 1LC2A 1HJ5A 4RJTA 3L75D 2RMZA 1HCMA 2N9IA 5IY51 2Y0DA 1I6DA 2QJKB 5TISV 4PD4D 1C2RA 1MG3D 2GIWA 3DR0A 2OZ1B 1E2RA 4WQ9A 3CU4A 3WU2V 1W2LA 2BH5X 4IL6V 3CYTI 1PP9D 3PXWA 5C0ZA 4FA5A 4H0JA 3SJLA 4YE1A 1HH7A 1RAQA 3PXSA 3RLMA 1L0LD 1CIFA 2CE1A 4L3HA 4AAOA 1N9CA 1CORA 4PWAA 2FWLA 3ZOYA 1C7MA 2B4ZA 4PW9B 1H9XA 1DW1A 1YEAA 2FYUD 2N9JA 1CEDA 1IQCA 3PXTA 2L91A 1CHJA 3OCDA 3KHUA 1M6ZA 1LMSA 1AOFA 1FJ0A 2BH4X 1FI9A 1N50A 1F1FA 2PCBB 2D0WA 2FYNB 2ZBOA 3L72D 1EB7A 5GTHV 4Y5RA 1QYZA 2I8FA 4H0KA 2AXTV 3A9FA 2CE0A 1M70A 3KZIV 3HQ7A 1C6SA 1I8OA 4V2KA 1KV9A 1F1CA 3O1YA 5CIDB 5H2FV 1CRIA 5KLIB 1NTMD 3ZIYA 3NBSA 3X39A 5KKZB 4WQAA 4AAMA 3L73D 2N9YB 3FWLA 1LS9A 4U3FD 1H32B 3O20A 4L3GA 1E29A 4RSZA 4WQDA 1YNRA 3WFCC 1IZL0 1I8PA 1FI3A 4NFGB 2AIUA 2YQBA 1K3GA 2IBZD 3BCCD 2CA4B 5TJHA 1M60A 1CCHA 1C6OA 2C1DB 2ZONG 3DP5A 3TDKA 3L70D 1L9JC 3A0HV 3SXTA 1I5TA 4FA9A 2KNCB 1N15A 2LITA 2ZXYA 4O1WA 1C2NA 1YEBA 1HRCA 4EIEA 1B7VA 1GKSA 3PHLA 1HZUA 1U74B 1ZZHA 2YK3A 1FHBA 2GC4D 5AURA 4FANA 2C1UA 3OA8B 4O1QA 1L9BC 5KAFV 1NNOA 3L4MA 3PH2B 4XXLA 4EDFA 1NU1D 5CIHB 2YCCA 1GIWA 1JDLA 351CA 2Q3EA 1P84D 1DW2A 1SQPD 1RZ6A 1KB0A 3H1KD 1A56A 2ORLA 1NTZD 2BGVX 2JQRA 1H33A 3ZOOA 1CRJA 1N90A 4P4QB 1QL3A 1CYIA 4N0KA 1A2SA 2B12B 3A0BV 1OAEA 5DJQB 1CSXA 1OCDA 1H1OA 2QJYB 1COTA 3NWVA 3WFDC 5B6QA 1DVVA 3O0RC 3O5CA 1DT1A 1GDVA 1PPJD 3ZOXA 2K9JB 4FB1A 1SQXD 1SQQD 1H31B 1KB9D 2LIRA 5CIEB 5C9MA 1DVHA 4PJ0V 1CXCA 4XYDB 5CIBB 1QKSA 2ZZS1 1LFMA 2O3JA 3WC8A 1YIQA 3VYMA 4DY9A 4UB6V 2V08A 5E79V 1I55A 1NMLA 4J20A 1CYCA 1MG2D 4FA1A 5GTIV 5KAIV 1CHIA 1FOCA 1CTJA 1IO3A 1ZRTD 1KIBA 3JBTB 2BLFB 3WFEC 1CO6A 1CRYA 2N3YA 3OCDB 2OZ1A 3ORVA 3ITKA 1GJQA 451CA 2BCCD 1BE3D 1IRWA 1DIIC 2PCCB 4WQEA 3DMIA 1CCRA 1HZVA 4Q5PA 2C9XB 2GB8B 3RN1A 2QG4A 3TGUD 1CSWA 3VNWA 1AOQA 3GW6A 2CA3B 1CRGA 1YCCA 1MZ4A 3WFBC 1S5LV 2FRCA 3HQ6A 1C75A 3CXHW 1BCCD 2XTSB 5KLVD 1SQVD 1KX7A 1CRCA 4UB8V 1CNOA 1E8EA 1NMIA 2B11B 155CA 3RMZA 2MHMA 1LC1A 2HV4A 1H9YA 5B5EV 1HJ3A 4L1QA 1R0QA 1CC5A 2RN0A 3CX5D 1IRVA 1U75B 3CXHD 1CIEA 5EXQA 3HQ9A 3CWBD 2MTAC 4EIDA 1QN2A 3L74D 4WQCA 4WQBA 4MU8A 1A8CA 3H1ID 2VHDA 4AANA 3M97X 1HJ4A 3VMAA 1W5CT 2D0SA 3ZCFA 1J3SA 1L0ND 1RAPA 1WVEC 2C1DA 1KX2A 2V07A 2C8SA 4K3IA 2ZOOA 1AYGA 3SVWA 1CIGA 2BPBB 1SQBD 5DF5A 5CIGB 5B66V 3L4OA 3RN0A 1GU2A 4EIFA 2JWAA 2L4DA 2Y0EA 1H32A 5CICB 3WUIA 4FAVA 1WEJF 4KMGA 1BGYD 4GEDB 1KYOD 3MK7C 2B0ZB 1BL9A 3SWSA 1FCDC 2KS1A
chains in the Genus database with same CATH superfamily
3NBTA 2HLOA 3SWKA 3G3ZA 3GG2A 3IF4A 3KYQA 1CYJA 2NRGA 2B89A 1ZR4A 3TF5A 3PLNA 2IBZI 3E1RA 1GU5A 3RGUA 1EZVD 4EICA 2YIUB 3HE4B 1ZR2A 2D2CD 2XKMA 4XFJA 1OZHA 1CTYA 2QSIA 2B10B 3M9QA 1Y47A 1NHLA 5CIFB 2RKLA 5KJ7D 5H2FE 2DGEA 2CPBA 3H1LG 4JCGA 4AYCA 2QE7H 3KXDA 1CXAA 1L0LG 1HROA 2WPRA 2N18C 1C6RA 4PV1B 3SLEA 3U59A 2WQYC 1P84I 1CIHA 3B5NA 4QAOA 5CHXA 2Y9ZA 2NPSA 1H88A 2C2CA 3HQ8A 1KB9I 1DIQC 1SQVK 3HRNA 2WSFJ 2LR2A 2QJPB 1S4XA 2N18B 2KZJA 1VF5B 5M1BA 2YKOA 3CP5A 1GTWA 2WSSH 4RJTA 3L75D 2RMZA 3WUUA 2QJKB 5TISV 1CI6A 4PD4D 1PPJG 1MG3D 4IL6V 3CYTI 1PP9D 3PXWA 2KI7B 2B88A 2Y9YA 1URQD 5APTA 5AVQB 1HH7A 1RAQA 1L2PA 5AW1B 5KLIC 1JCCA 1CIFA 3GHGB 3T97B 5AVTB 4L3HA 2AEMA 1W5CE 2D2CB 1VQ6P 3CI9A 1CORA 1X22A 2ZT9C 2NPSC 2ZYDA 1KC8Q 2B4ZA 5AW5B 1FS0E 3B5NC 1FDIA 2N9JA 3PXTA 1M6ZA 2PGDA 1G2CB 2W6AA 4AUWA 5L8RJ 1G1JA 2V4HA 1NTKJ 1OFCX 5KLVE 4YXWH 1VQKP 2O1KA 2FKWB 2FYNB 2GUVA 1PGOA 1OXZA 1SQBK 1ZOYC 4ASWA 2E76C 2I8FA 4H0KA 1OW7A 2AXTV 4BWNA 2W83C 1M70A 3KZIV 2W8ZA 4IOIH 4Y99B 4XA4A 3HQ7A 4OH8B 1KV9A 2BEZF 4TLFA 1YJNP 3O1YA 5KLIB 1LTBC 1YJWP 3BCCG 5CJ0A 1OX3A 1SQBJ 2IFNA 3JSVC 3VP8A 1Y8AA 2N9YB 4U3FD 3L70E 4Y28J 1KD1Q 3CWBJ 3O20A 4R4MA 1E29A 2FXPA 4WQDA 1YNRA 2E5TA 3WFCC 1I8PA 2HODB 2AIUA 1KFMA 1K3GA 2IBZD 1VQ8P 1M60A 2WZ7A 2YMKA 3GMAA 3TDKA 3CCVP 1IC2A 1VQ7P 5E79E 2KNCB 1N15A 1R5SA 2XNDH 1T2KD 1A02J 5AVWB 4O1WA 1YEBA 1IFDA 4EIEA 3L72E 3AE1C 1HZUA 1BE3J 3L71E 2M5AA 2YK3A 1FHBA 3CXHE 1IZNB 3UIAA 3L71G 2I1KA 4H44D 2C1UA 4O1QA 3A5TA 1L9BC 4N78E 3PH2B 1GZLA 1M90Q 3A0HE 1GIWA 4GOEA 2Q3EA 1DW2A 5KAIH 1SQPD 3TNUA 1N86A 1KZUB 3EFGA 1YJ9P 2ORLA 1NTZD 3ZOOA 2IPPA 1J1EB 2WMMA 1N73C 2R5DA 4N0KA 3A0BV 1OAEA 1CSXA 3H1HJ 3GHGC 3TGUG 1NTKK 5B6QA 1BDCA 1KB9H 3O0RC 2Q1KA 2HR3A 4XE5B 1VPCA 2R5BA 1PPJD 1XTCC 3CCEP 2FYUE 3CX5E 1SQXD 3LIEA 1H31B 4WY4A 1CXCA 2KSEA 5CMZA 3AE6C 1LFMA 1BE3G 4DY9A 1RY3A 1ZP0C 4IL6X 1DD3A 3AE8C 1JTHB 1CYCA 1KFNA 1MG2D 1IFMA 2ZT9D 1LJ2A 5KAIV 1CHIA 3JBTB 2YXQB 4RKUJ 3KZIE 3NMDA 5AVRB 2KLVA 2P1JA 3KPEA 3D71A 2OARA 2BCCD 1IRWA 1DIIC 4WQEA 1LTTC 1NU1E 5AW3B 3ABVC 4R4LA 2E43A 1W2EA 3SWFA 2YXRB 3GW6A 1CRGA 1MZ4A 2OGUA 1VQLP 2OYIB 1KQLA 4WY4C 4WVZA 5E79H 3CPWO 3D6YA 3CXHW 2ZVNB 2H43A 3AEGC 1HWTC 1KX7A 1L4AB 1IK9A 1DH3A 1P84H 2MKVA 1DEEG 3B71A 4ASVA 3M0DA 2HV4A 2FFDC 1PGJA 2RN0A 1U75B 2M3EA 1RF1B 1SFCD 3CCQP 2B9BA 1FAVA 1SQBE 4EIDA 1AQ5A 4LGDE 1FDMA 3H32B 3CMEP 4MU8A 3RK2C 2WVRA 1MFTA 1S72P 5CCHA 1HJ4A 4GODA 1W5CT 2WSCH 2D0SA 3ZCFA 5AW2B 5CJ4A 1WVEC 1KX2A 1ZLLA 4HKZH 3IR9A 5B5EE 4TT3H 3H1JE 1GU2A 3H1LE 2H88C 4FAVA 2NPSD 2ZXXA 2H7HA 2WWWA 1BGYD 1NTMK 4GOFA 3RBXA 4IL6E 3HTKA 3L71D 1CHHA 1FZCC 2E76B 3L71J 1CSUA 1BCCE 1K04A 2FBWC 4WQ8A 1KYOH 2E74B 1ETPA 3CX5W 4LJIA 3MK7B 5AVYB 1MZ9A 3RK3C 3H1JD 1N7LA 3MUDA 1VQNP 4OWFA 1Q90D 1M56D 1NAFA 2ZXEB 1K3HA 3ZOWA 1PGPA 3PRJA 2CXBA 1DEBA 1CSVA 1EZVI 1EQ7A 3OA8A 1FZFA 3PTZA 5TISE 1LTJA 1NAYA 1J1EC 4ZKUA 4D6TD 5CCHC 1JCDA 3MUDC 1KILC 3AE7C 1AKKA 1Q7YQ 1URQC 5DFSA 3HUSA 1JNMA 3CX5H 1VYDA 1LP1A 2A06D 1GQ1A 3L75E 4JYBA 5KAFE 1JEKA 4YXDC 1OW6A 2E42A 1I6EA 3R4YA 3M06A 3RL0C 2FFDA 1FJPA 5DJQC 4U3FJ 1LC2A 3W68A 2CK3H 1HJ5A 3N4XA 2Y0DA 1ZXGA 3NXSA 3HD7C 3MZWB 2K9JA 1H0TB 3DR0A 1S3JA 2IZ1A 2OZ1B 1NKNA 1M1JA 3OAKA 1ZMEC 1FJKA 4FA5A 3SJLA 4OGQB 4PD4H 3PXSA 3L74E 4N6JA 3RLMA 3P7KA 2AXTE 2QJYC 3N7NA 1NU1J 4AAOA 2O01H 1SQQK 2QEXP 4PWAA 2FWLA 1YEAA 4HJGH 3USSA 4JQ0D 1IQCA 2WT7A 3L73E 1VQOP 3O6QB 1CHJA 3OCDA 2OTLP 1AOFA 2K37A 1FJ0A 3M0DC 3LW5H 2D0WA 3V4QA 1VQ9P 2ZBOA 3L72D 4NPFX 3VTPC 1EB7A 1QYZA 1PL5A 2E5YA 1OMIA 1NVOA 4H44C 4ZMDA 1KYOE 1C6SA 3H1HE 1I8OA 1RH5B 1SP4A 1FOSF 3NBSA 3QWOC 2QA4P 4C7NA 4AAMA 3RK2B 4EI2A 1PIXA 3JCUH 1Q2NA 1OW8A 5B5EH 2AEJA 3EWKA 1LGHB 4YPCA 3MIWA 1FI3A 3AE5C 2OQQA 2YQBA 3H1LJ 5CCHD 1VF5C 3FX0A 1CCHA 3A0BH 2ZONG 3DP5A 2HG5D 3L70D 2KSJA 2LITA 1C2NA 1HRCA 1U57A 3G71P 3H1KG 4DJGA 1SQXK 1LWUB 1B7VA 1A02F 1GKSA 1KMIZ 3PHLA 1MUUA 4H44B 2HPCB 5KTBA 2GC4D 1HJBA 4W7ZA 3PH0A 5AURA 3M9BA 4Y99C 1OIPA 4FANA 2KS1B 1NTKG 2YMYA 4OGQC 1RF0A 5B66H 5GTIH 3G9RA 1NGMB 2YCCA 1S9KE 351CA 1SFCC 1BCCG 2ZAEB 3H1KD 5DJUB 2BGVX 2JQRA 5APQA 1CRJA 3CCUP 1QL3A 3HE4A 3QH9A 1GDTA 1T3UA 1A2SA 2UWJE 2KIKA 2ITAA 5AW9B 5DJQB 3AEDC 1OCDA 1H1OA 5AW8B 1COTA 3NWVA 2H89C 1RQUA 1Q82Q 2WPVB 1JMMA 3O5CA 3BRTB 4PJ0E 1W2BO 1KB9E 2WSFH 4FB1A 5KJ7A 3A7OA 3B5NB 3G6EP 1NTZG 2K3RA 1KB9D 1RE3A 1FZBA 1YHQP 4PV1C 1DVHA 4XYDB 1QKSA 4GDOA 2O1JA 2M0BA 2O3JA 5BU5A 3OW2O 2JJLA 2B87B 2IYOA 1YIQA 3VYMA 2ZYAA 1JY3N 4UB6V 5E79V 1FZCA 1FZAA 3L73J 1N73B 1FZEA 4WWIA 1H8AA 4FA1A 4L76A 3V2RA 2P58A 3L36A 1KQGB 1IO3A 2O01N 1BGYJ 1CI6B 1K8AQ 2FXOA 3WFEC 2IBZE 2YO3A 4RESB 1CO6A 1YBKA 2N3YA 3B8EB 2O01J 3ORVA 1GJQA 1HGZA 1OVRA 2IX7C 1S2EA 2HYNA 1HZVA 1L0NG 2W6BA 2KZIA 3CC7P 1HGVA 2XV5A 1AOQA 2JKVA 2CA3B 2PFXA 1AV1A 1HJ0A 2K1AA 2KK7A 3A0HH 3EFFK 2FRCA 1SQPK 3HQ6A 3I5CA 3LW5J 3V2PA 2HFED 1EC5A 1SFCB 1BCCD 5DJTB 1SQVD 3W67A 2ZFCA 1FBMA 1JUNA 4UB8V 1EDIA 2IZ0A 1R8EA 2C9LY 1J1DB 1NMIA 1G2CA 1JY2P 3TK1A 2MHMA 1QLED 5B5EV 1HJ3A 1LTAC 1EXIA 5GTHE 3CX5D 4CPGA 1IRVA 1NU1K 3VMXA 4IL6H 4RO0A 5TISH 1T6AA 3L75J 1YQ4C 3KZIH 1IFNA 1JB0J 4I7ZC 3SSUA 1WRGA 3L74D 4WQBA 1USEA 4ZNCA 1A8CA 2E74D 4U3FE 3L4FA 1IK7A 4D6TE 3VMAA 4W80A 2KLUA 1ZV8A 1VF5D 5KAFH 1J3SA 1NTMG 1RAPA 2CPSA 2C1DA 4EYYQ 2DW3A 1LTGC 3AE9C 5GTHH 2C8SA 1EDKA 2C9NY 2ZOOA 1AYGA 3B4SA 2BPBB 2JO1A 4C46A 1SQBD 1FOSE 4K35A 1LT9A 4O9BA 1N8RQ 2L4DA 1HUCA 5KLVG 2ZT9B 5CICB 3P8CD 3RK3B 2OYHB 4KMGA 1BSNA 2N9BA 3MK7C 4H13C 4EOTA 1PP9G 1BL9A 3SWSA 3HD7D 3F89A 1FCDC 3VP9A 4AX3A 4A7PA 2HODA 2Y0CA 1GD2E 1NTKD 1KILD 2XNXA 1IFPA 1YICA 1DX7A 3CWBG 2J59M 3VYIA 1FI7A 2JEEA 2GC7D 1M8OB 5EFWB 2NZ2A 1T2KC 1H33B 1MV8A 2JWDA 2QJKC 4NPDA 1LWUC 1ZN5A 4WQ7A 1YQ3C 2IYPA 3CWBE 1WMKA 5AVXB 3C2CA 3FXEA 1NIRA 1MKMA 2R32A 4GYDA 3VRDA 3D6ZA 5AVVB 1L4AD 2WPQA 1PP9E 2YKPA 3HE5B 1CTZA 1RZ5A 3S4RA 3M0AA 1DW0A 2EXVA 1YYCA 3TNUB 1URQA 1SQPJ 4BRYB 2K9YA 3H1IG 1C52A 1DW3A 2A45H 3MGNA 1BGYE 4N78D 4I2LC 3WUVA 3H1HD 1L0LK 1SQQE 1EDJA 3A3YB 3II6A 4I6MC 1HCMA 2N9IA 5IY51 3BRVB 4DCKA 2YIUC 4U3FG 3U1AA 1C2RA 5APSA 2Z5HA 5KAIE 2GIWA 3HD7B 2WSCJ 4H0LC 1KILA 2C0XA 1M1KQ 1E2RA 1SQXJ 3V2NA 3CU4A 3WU2V 2FYUG 2WITA 2Z5IA 3KQGA 1Q81Q 2MJZA 4YE1A 3B5ND 5B66E 3P8CE 1L0LJ 1S5LH 1L0LD 3M9HA 2CE1A 1T8ZA 3KDPB 2G8YA 1QEXA 1JTHA 1GL2B 2A45G 1N9CA 4H0LB 3Q5RA 3M91A 1C7MA 4PW9B 3AEEC 3TYYA 1H9XA 1VQ4P 3SFEC 2FYUD 2FYUJ 2L91A 3WU2H 2QM7A 1AA0A 1PZQA 2A06E 2YNYA 1N50A 1F1FA 2E75C 4JF7A 4Y5RA 2N1TB 3A9FA 2OTKE 2CE0A 2QJPC 3AEAC 4V2KA 2E74C 2LXCB 5CIDB 1KQFB 1CRIA 1KYOI 1L0NJ 4MN4C 2BCCG 1WT6A 1N7SA 1NTMD 1L4AA 1U7MA 3X39A 3MHVA 2PP6A 2C0WA 3V4WA 3H1IE 1RF1A 1H32B 1LTIC 4L3GA 1SQXG 1KQSO 1KILE 3JCUE 4LLHA 4NFGB 2BCCJ 3CC4P 1CZQA 2YO2A 3BCCD 2CA4B 5TJHA 4L73A 1ZRTE 1JY3O 1L9JC 3RL0B 3BCCE 3SXTA 4HH2A 4FA9A 3MP7B 3I55P 2ZXYA 3CXHI 3C9IA 1XTGB 3K5BA 3RK2D 2D2CC 1U74B 1PP9J 1ZZHA 1OWAA 4KHXA 3GLMA 2L5GB 2IBZG 2QVAA 3CLQA 3VMZA 1E79H 3HTKB 1NNOA 3L4MA 4H0LD 4XXLA 3V2QA 2KYVA 1SVFA 3O8ZA 4L75A 5AW4B 4PD4I 1JDLA 1P84D 2NPSB 1SQVJ 1KB0A 1NTZK 1D7MA 4M3LA 3H1JG 1HVVA 4P4QB 3H1JJ 4UB6E 2WSEJ 2N1TD 2PAJA 3S1KA 1NTZE 3WFDC 3H1HG 4DOJA 1YTZI 1K73Q 4U7JA 1X79B 3FXDA 2I8DA 1FE6A 3RK3E 1DT1A 1GDVA 3ZOXA 3Q5SA 1FZGA 1L0LE 3Q3DA 1SQQD 1K9MQ 1SQQJ 2LIRA 5CIEB 1AQTA 2KOGA 3D70A 3P32A 3ZDMA 2ZZS1 1LTJC 2IDBA 3CC2P 4LC1A 1JY2O 3RK3D 2R3CA 2KXPB 5H2FH 1M57D 1AJYA 1I55A 3GHGA 3T97A 3I56P 4J20A 1NJIQ 2ZYGA 4WB4A 3CCSP 2ZVOB 1CTJA 1ZRTD 3L74G 1KIBA 1DD4A 1GK4A 1H0TA 2OZ1A 4DZOA 451CA 2N1TC 1NWQA 3DMIA 1CCRA 4Q5PA 2C9XB 3GF7A 2R44A 1CSWA 3VNWA 3TSIA 1L0NE 3WFBC 2Q7CA 3L73G 1JOCA 4H13B 3C8VA 1QVGO 2XTSB 3WMM0 4JBZA 4HB1A 5APYA 1CRCA 1CNOA 2WT7B 1EZVE 1KV4A 3O6QA 5AVUB 155CA 2K88A 1H9YA 1CC5A 3CCJP 3JC22 1X9VA 1SQPE 1BE3E 3HQ9A 2BCCE 3CWBD 1JM0A 1Z56A 1QN2A 1BGYG 3CX5I 3BVHA 4N3YB 1VQPP 2I1JA 3CXHH 2VHDA 4AANA 1N2DC 3L37A 1VQMP 2AXTH 1NOHA 4K3IA 2AXCA 2KNCA 1CIGA 5CIGB 5B66V 4WY4D 5BVZA 2V7QH 2BASA 2RH0A 2JWAA 1YIJP 2H8PD 1CSBA 1NYHA 4K3AA 2M5AB 1GMJA 1WEJF 1IO4A 2FXMA 1KYOD 1UIIA 3CCMP 3FWNA 1S5LE 3CCLP 2PRRA 4AALA 2PACA 1AVOA 1RE4C 3E1IA 4PJ0H 1QL4A 2E76D 5CYTR 1FC2C 3H25A 3TYIA 1HH0A 1NTZJ 3AE4C 4QMAA 1S6VB 3ZBMA 1CRHA 1FU1A 1LT9C 2A06G 2BCNB 4FA4A 1RF1C 2IFMA 1SQVE 3VN0A 2XU6A 2JR8A 1RE4A 1JO5A 1SLQA 2FYZA 1YFCA 4H13D 4DT0A 1GK6A 4OGQD 5AVSB 3PP5A 1H31A 3PJSK 1KYOW 2P2UA 2QRXA 2AI5A 2WSEH 2DVHA 2P10A 4WY4B 2ZJSE 4UB6H 3H1KJ 2FYUK 2JTIB 2C1VA 1JMBA 1S1CX 2N3BA 3H1IJ 3FGAD 1YTCA 1AFOA 3H1LD 4IFMA 1I54A 3CMAP 3AEBC 1N7SC 3IAOA 1I6DA 1SQQG 3VOPA 5APVA 3CCRP 1NKZB 4WQ9A 3GF3A 1SQVG 4AQRD 1W2LA 2BH5X 2BEQD 3BCCJ 5C0ZA 2W6JH 3AE3C 4H0JA 4C7RA 2XZRA 2Q9IA 2B87A 4JPZB 4HYTB 1LT1A 1UIXA 1FZCB 3NFQA 2OYIA 2GM4A 1N73A 2J58A 1LTSC 2YKQA 1RE3C 4I7ZB 3AE2C 5AW0B 2OYOA 2Z4EA 3H6PA 3ZOYA 3IFMA 3IN6A 5KJ7C 4UB8H 1DIPA 1DW1A 1IFIA 1CEDA 1FDOA 1PV3A 3KHUA 1H89A 1LMSA 2R3SA 3RL0D 3RBZA 2BH4X 1FI9A 1R5LA 1S5LX 3R2PA 2PCBB 1JY3P 3MD0A 4W7YA 5GTHV 3NTNA 4YTPC 5CBOA 1T3JA 2POHA 4D6TG 1VQ5P 3H32A 3TGUE 1F1CA 5H2FV 1PPJE 1SFCA 3LIDA 3WU2E 1BCCJ 4KJMA 2JP3A 1S9KD 3U1CA 3ZIYA 1RF0C 2FYNC 4KT0J 5KKZB 1KORA 4WQAA 1SQBG 3CL3D 2M8RA 1MFZA 2WTYA 1Q86Q 1OVVA 3Q1MA 3L73D 3FWLA 1LS9A 1QL2A 1BDDA 3EQ2A 5AW7B 3L75G 1KTMA 3V5BA 1GU4A 4RSZA 1EZVG 4GT1A 1YI2P 1HBWA 1NTME 1IZL0 1QX8A 2GUSA 1QGKB 4BXLA 1C6OA 2AEFA 2C1DB 4Z1MH 1QL1A 4I1LA 3A0HV 1I5TA 1RHZB 5K5GB 2FY8A 1LT9B 1GL2C 3Q5PA 2WPSA 5C39A 2QIWA 1USDA 3Q2YA 2OYHA 2KUBA 5CCGC 4L74A 2J5UA 3OA8B 1AVYA 3H1KE 5KAFV 1LTJB 4D6TJ 4WBAA 3L70G 2E75B 4EDFA 1NU1D 5CIHB 5APXA 1X0TA 2P7JA 1VDFA 2OTJP 3HUSB 1RZ6A 1A56A 1LP1B 1GW4A 1H33A 3L74J 2KB7P 3WUTA 4ZKPA 1N90A 2M3BA 1CYIA 2B12B 1HTLC 3RL0g 2E75D 2FFDB 2QJYB 2LKMA 1DVVA 2W27A 2XDJA 4B86A 2K9JB 3HE5A 1M1JB 1IFJA 2P67A 1J2JB 5C9MA 1YITP 4PJ0V 1URQB 4BRYA 5CIBB 3G4SP 5GTIE 3WC8A 1QVFO 2Q3IA 1Y9BA 2KP8A 3A0BE 1YTZT 2V08A 5KKZC 1NMLA 4PD4E 1L4AC 3BASA 5CCGA 1JY2N 2OYHC 5GTIV 1SQPG 1FOCA 1M1JC 1LNQA 3OJAB 2BLFB 3OA7A 3AECC 3HD7A 1KILB 1CRYA 3OCDB 3ITKA 3AEFC 1BSHA 1EXJA 1BE3D 2PCCB 2A45I 1TU3F 1E5WA 3BATA 1OVUA 3CD6P 3L72J 3TGUJ 2Q6QA 2GB8B 3RN1A 2QG4A 3TGUD 3L72G 2QM8A 3F5HA 3P8MC 2GA1A 3SWYA 1NU1G 1YCCA 1ZW0A 1S5LV 3A2AA 4IFFA 1NO4A 3E7KA 4UB8E 4JYCA 4NPEA 4GKGA 1C75A 1GL2A 2W90A 1U7JA 4PV1D 5KLVD 1P84E 1NTKE 5BU8B 5KLVJ 1KN7A 1EDLA 1E8EA 2B11B 1L0NK 5APWA 1SQXE 1J1DC 3RMZA 1LC1A 3C1LA 4GIFA 4C7NB 4L1QA 1R0QA 4OVNF 5APUA 1VL2A 3CXHD 1CIEA 5AW6B 5EXQA 2N1TA 3SFDC 2MTAC 1IJDB 1PFIA 4IFDK 5CCGD 5KLVK 3S9OA 2LXBA 1NH4A 3HUSC 1SS1A 4WQCA 3MTUE 1HF9A 2JDIH 1GL2D 1K05A 3H1ID 3V6IA 4EIJA 3M97X 1PGQA 2SPZA 2VRSA 2OYIC 1L0ND 1N7SB 1X8YA 3L70J 1GW3A 2V07A 1NTMJ 5AVZB 3SVWA 5DF5A 3L4OA 3RN0A 1G1IA 1M7LA 2G3AA 1LWUA 4EIFA 3D0WA 2Y0EA 1CW5A 1H32A 2Q5UA 2HPCA 3WUIA 3L35A 1N7SD 5CBNA 4GEDB 2B0ZB 2V7QJ 3VMYA 2KS1A 1RQVA
chains in the Genus database with same CATH topology
3NBTA 4AX3A 3L71D 4A7PA 1CHHA 2Y0CA 1NTKD 1CSUA 1YICA 4AALA 2PACA 4WQ8A 3GG2A 1CYJA 1QL4A 1FI7A 5CYTR 2GC7D 3TF5A 3TYIA 3PLNA 1ETPA 3CX5W 4LJIA 3MK7B 1H33B 1S6VB 3ZBMA 3H1JD 1CRHA 1EZVD 4EICA 2YIUB 2BCNB 4FA4A 4WQ7A 1CTYA 2B10B 5CIFB 3C2CA 2DGEA 1NIRA 1K3HA 3ZOWA 4JCGA 3PRJA 4GYDA 3VRDA 2CXBA 1CSVA 1YFCA 3OA8A 1CXAA 1HROA 3PTZA 2N18C 1C6RA 3SLEA 4D6TD 1CTZA 1RZ5A 1CIHA 1AKKA 1H31A 1KYOW 5DFSA 1DW0A 4QAOA 2EXVA 2AI5A 2DVHA 2C2CA 3HQ8A 1DIQC 1VYDA 2A06D 2JTIB 1GQ1A 2C1VA 2QJPB 1C52A 1DW3A 2N3BA 2N18B 1YTCA 1I6EA 3H1LD 3H1HD 5DJQC 1I54A 3CP5A 1LC2A 1HJ5A 4RJTA 3L75D 2RMZA 1HCMA 2N9IA 5IY51 2Y0DA 1I6DA 2QJKB 5TISV 4PD4D 1C2RA 1MG3D 2GIWA 3DR0A 2OZ1B 1E2RA 4WQ9A 3CU4A 3WU2V 1W2LA 2BH5X 4IL6V 3CYTI 1PP9D 3PXWA 5C0ZA 4FA5A 4H0JA 3SJLA 4YE1A 1HH7A 1RAQA 3PXSA 3RLMA 1L0LD 1CIFA 2CE1A 4L3HA 4AAOA 1N9CA 1CORA 4PWAA 2FWLA 3ZOYA 1C7MA 2B4ZA 4PW9B 1H9XA 1DW1A 1YEAA 2FYUD 2N9JA 1CEDA 1IQCA 3PXTA 2L91A 1CHJA 3OCDA 3KHUA 1M6ZA 1LMSA 1AOFA 1FJ0A 2BH4X 1FI9A 1N50A 1F1FA 2PCBB 2D0WA 2FYNB 2ZBOA 3L72D 1EB7A 5GTHV 4Y5RA 1QYZA 2I8FA 4H0KA 2AXTV 3A9FA 2CE0A 1M70A 3KZIV 3HQ7A 1C6SA 1I8OA 4V2KA 1KV9A 1F1CA 3O1YA 5CIDB 5H2FV 1CRIA 5KLIB 1NTMD 3ZIYA 3NBSA 3X39A 5KKZB 4WQAA 4AAMA 3L73D 2N9YB 3FWLA 1LS9A 4U3FD 1H32B 3O20A 4L3GA 1E29A 4RSZA 4WQDA 1YNRA 3WFCC 1IZL0 1I8PA 1FI3A 4NFGB 2AIUA 2YQBA 1K3GA 2IBZD 3BCCD 2CA4B 5TJHA 1M60A 1CCHA 1C6OA 2C1DB 2ZONG 3DP5A 3TDKA 3L70D 1L9JC 3A0HV 3SXTA 1I5TA 4FA9A 2KNCB 1N15A 2LITA 2ZXYA 4O1WA 1C2NA 1YEBA 1HRCA 4EIEA 1B7VA 1GKSA 3PHLA 1HZUA 1U74B 1ZZHA 2YK3A 1FHBA 2GC4D 5AURA 4FANA 2C1UA 3OA8B 4O1QA 1L9BC 5KAFV 1NNOA 3L4MA 3PH2B 4XXLA 4EDFA 1NU1D 5CIHB 2YCCA 1GIWA 1JDLA 351CA 2Q3EA 1P84D 1DW2A 1SQPD 1RZ6A 1KB0A 3H1KD 1A56A 2ORLA 1NTZD 2BGVX 2JQRA 1H33A 3ZOOA 1CRJA 1N90A 4P4QB 1QL3A 1CYIA 4N0KA 1A2SA 2B12B 3A0BV 1OAEA 5DJQB 1CSXA 1OCDA 1H1OA 2QJYB 1COTA 3NWVA 3WFDC 5B6QA 1DVVA 3O0RC 3O5CA 1DT1A 1GDVA 1PPJD 3ZOXA 2K9JB 4FB1A 1SQXD 1SQQD 1H31B 1KB9D 2LIRA 5CIEB 5C9MA 1DVHA 4PJ0V 1CXCA 4XYDB 5CIBB 1QKSA 2ZZS1 1LFMA 2O3JA 3WC8A 1YIQA 3VYMA 4DY9A 4UB6V 2V08A 5E79V 1I55A 1NMLA 4J20A 1CYCA 1MG2D 4FA1A 5GTIV 5KAIV 1CHIA 1FOCA 1CTJA 1IO3A 1ZRTD 1KIBA 3JBTB 2BLFB 3WFEC 1CO6A 1CRYA 2N3YA 3OCDB 2OZ1A 3ORVA 3ITKA 1GJQA 451CA 2BCCD 1BE3D 1IRWA 1DIIC 2PCCB 4WQEA 3DMIA 1CCRA 1HZVA 4Q5PA 2C9XB 2GB8B 3RN1A 2QG4A 3TGUD 1CSWA 3VNWA 1AOQA 3GW6A 2CA3B 1CRGA 1YCCA 1MZ4A 3WFBC 1S5LV 2FRCA 3HQ6A 1C75A 3CXHW 1BCCD 2XTSB 5KLVD 1SQVD 1KX7A 1CRCA 4UB8V 1CNOA 1E8EA 1NMIA 2B11B 155CA 3RMZA 2MHMA 1LC1A 2HV4A 1H9YA 5B5EV 1HJ3A 4L1QA 1R0QA 1CC5A 2RN0A 3CX5D 1IRVA 1U75B 3CXHD 1CIEA 5EXQA 3HQ9A 3CWBD 2MTAC 4EIDA 1QN2A 3L74D 4WQCA 4WQBA 4MU8A 1A8CA 3H1ID 2VHDA 4AANA 3M97X 1HJ4A 3VMAA 1W5CT 2D0SA 3ZCFA 1J3SA 1L0ND 1RAPA 1WVEC 2C1DA 1KX2A 2V07A 2C8SA 4K3IA 2ZOOA 1AYGA 3SVWA 1CIGA 2BPBB 1SQBD 5DF5A 5CIGB 5B66V 3L4OA 3RN0A 1GU2A 4EIFA 2JWAA 2L4DA 2Y0EA 1H32A 5CICB 3WUIA 4FAVA 1WEJF 4KMGA 1BGYD 4GEDB 1KYOD 3MK7C 2B0ZB 1BL9A 3SWSA 1FCDC 2KS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBT A;  4AX3 A;  3L71 D;  4A7P A;  1CHH A;  2Y0C A;  1NTK D;  1CSU A;  1YIC A;  4AAL A;  2PAC A;  4WQ8 A;  3GG2 A;  1CYJ A;  1QL4 A;  1FI7 A;  5CYT R;  2GC7 D;  3TF5 A;  3TYI A;  3PLN A;  1ETP A;  3CX5 W;  4LJI A;  3MK7 B;  1H33 B;  1S6V B;  3ZBM A;  3H1J D;  1CRH A;  1EZV D;  4EIC A;  2YIU B;  2BCN B;  4FA4 A;  4WQ7 A;  1CTY A;  2B10 B;  5CIF B;  3C2C A;  2DGE A;  1NIR A;  1K3H A;  3ZOW A;  4JCG A;  3PRJ A;  4GYD A;  3VRD A;  2CXB A;  1CSV A;  1YFC A;  3OA8 A;  1CXA A;  1HRO A;  3PTZ A;  2N18 C;  1C6R A;  3SLE A;  4D6T D;  1CTZ A;  1RZ5 A;  1CIH A;  1AKK A;  1H31 A;  1KYO W;  5DFS A;  1DW0 A;  4QAO A;  2EXV A;  2AI5 A;  2DVH A;  2C2C A;  3HQ8 A;  1DIQ C;  1VYD A;  2A06 D;  2JTI B;  1GQ1 A;  2C1V A;  2QJP B;  1C52 A;  1DW3 A;  2N3B A;  2N18 B;  1YTC A;  1I6E A;  3H1L D;  3H1H D;  5DJQ C;  1I54 A;  3CP5 A;  1LC2 A;  1HJ5 A;  4RJT A;  3L75 D;  2RMZ A;  1HCM A;  2N9I A;  5IY5 1;  2Y0D A;  1I6D A;  2QJK B;  5TIS V;  4PD4 D;  1C2R A;  1MG3 D;  2GIW A;  3DR0 A;  2OZ1 B;  1E2R A;  4WQ9 A;  3CU4 A;  3WU2 V;  1W2L A;  2BH5 X;  4IL6 V;  3CYT I;  1PP9 D;  3PXW A;  5C0Z A;  4FA5 A;  4H0J A;  3SJL A;  4YE1 A;  1HH7 A;  1RAQ A;  3PXS A;  3RLM A;  1L0L D;  1CIF A;  2CE1 A;  4L3H A;  4AAO A;  1N9C A;  1COR A;  4PWA A;  2FWL A;  3ZOY A;  1C7M A;  2B4Z A;  4PW9 B;  1H9X A;  1DW1 A;  1YEA A;  2FYU D;  2N9J A;  1CED A;  1IQC A;  3PXT A;  2L91 A;  1CHJ A;  3OCD A;  3KHU A;  1M6Z A;  1LMS A;  1AOF A;  1FJ0 A;  2BH4 X;  1FI9 A;  1N50 A;  1F1F A;  2PCB B;  2D0W A;  2FYN B;  2ZBO A;  3L72 D;  1EB7 A;  5GTH V;  4Y5R A;  1QYZ A;  2I8F A;  4H0K A;  2AXT V;  3A9F A;  2CE0 A;  1M70 A;  3KZI V;  3HQ7 A;  1C6S A;  1I8O A;  4V2K A;  1KV9 A;  1F1C A;  3O1Y A;  5CID B;  5H2F V;  1CRI A;  5KLI B;  1NTM D;  3ZIY A;  3NBS A;  3X39 A;  5KKZ B;  4WQA A;  4AAM A;  3L73 D;  2N9Y B;  3FWL A;  1LS9 A;  4U3F D;  1H32 B;  3O20 A;  4L3G A;  1E29 A;  4RSZ A;  4WQD A;  1YNR A;  3WFC C;  1IZL 0;  1I8P A;  1FI3 A;  4NFG B;  2AIU A;  2YQB A;  1K3G A;  2IBZ D;  3BCC D;  2CA4 B;  5TJH A;  1M60 A;  1CCH A;  1C6O A;  2C1D B;  2ZON G;  3DP5 A;  3TDK A;  3L70 D;  1L9J C;  3A0H V;  3SXT A;  1I5T A;  4FA9 A;  2KNC B;  1N15 A;  2LIT A;  2ZXY A;  4O1W A;  1C2N A;  1YEB A;  1HRC A;  4EIE A;  1B7V A;  1GKS A;  3PHL A;  1HZU A;  1U74 B;  1ZZH A;  2YK3 A;  1FHB A;  2GC4 D;  5AUR A;  4FAN A;  2C1U A;  3OA8 B;  4O1Q A;  1L9B C;  5KAF V;  1NNO A;  3L4M A;  3PH2 B;  4XXL A;  4EDF A;  1NU1 D;  5CIH B;  2YCC A;  1GIW A;  1JDL A;  351C A;  2Q3E A;  1P84 D;  1DW2 A;  1SQP D;  1RZ6 A;  1KB0 A;  3H1K D;  1A56 A;  2ORL A;  1NTZ D;  2BGV X;  2JQR A;  1H33 A;  3ZOO A;  1CRJ A;  1N90 A;  4P4Q B;  1QL3 A;  1CYI A;  4N0K A;  1A2S A;  2B12 B;  3A0B V;  1OAE A;  5DJQ B;  1CSX A;  1OCD A;  1H1O A;  2QJY B;  1COT A;  3NWV A;  3WFD C;  5B6Q A;  1DVV A;  3O0R C;  3O5C A;  1DT1 A;  1GDV A;  1PPJ D;  3ZOX A;  2K9J B;  4FB1 A;  1SQX D;  1SQQ D;  1H31 B;  1KB9 D;  2LIR A;  5CIE B;  5C9M A;  1DVH A;  4PJ0 V;  1CXC A;  4XYD B;  5CIB B;  1QKS A;  2ZZS 1;  1LFM A;  2O3J A;  3WC8 A;  1YIQ A;  3VYM A;  4DY9 A;  4UB6 V;  2V08 A;  5E79 V;  1I55 A;  1NML A;  4J20 A;  1CYC A;  1MG2 D;  4FA1 A;  5GTI V;  5KAI V;  1CHI A;  1FOC A;  1CTJ A;  1IO3 A;  1ZRT D;  1KIB A;  3JBT B;  2BLF B;  3WFE C;  1CO6 A;  1CRY A;  2N3Y A;  3OCD B;  2OZ1 A;  3ORV A;  3ITK A;  1GJQ A;  451C A;  2BCC D;  1BE3 D;  1IRW A;  1DII C;  2PCC B;  4WQE A;  3DMI A;  1CCR A;  1HZV A;  4Q5P A;  2C9X B;  2GB8 B;  3RN1 A;  2QG4 A;  3TGU D;  1CSW A;  3VNW A;  1AOQ A;  3GW6 A;  2CA3 B;  1CRG A;  1YCC A;  1MZ4 A;  3WFB C;  1S5L V;  2FRC A;  3HQ6 A;  1C75 A;  3CXH W;  1BCC D;  2XTS B;  5KLV D;  1SQV D;  1KX7 A;  1CRC A;  4UB8 V;  1CNO A;  1E8E A;  1NMI A;  2B11 B;  155C A;  3RMZ A;  2MHM A;  1LC1 A;  2HV4 A;  1H9Y A;  5B5E V;  1HJ3 A;  4L1Q A;  1R0Q A;  1CC5 A;  2RN0 A;  3CX5 D;  1IRV A;  1U75 B;  3CXH D;  1CIE A;  5EXQ A;  3HQ9 A;  3CWB D;  2MTA C;  4EID A;  1QN2 A;  3L74 D;  4WQC A;  4WQB A;  4MU8 A;  1A8C A;  3H1I D;  2VHD A;  4AAN A;  3M97 X;  1HJ4 A;  3VMA A;  1W5C T;  2D0S A;  3ZCF A;  1J3S A;  1L0N D;  1RAP A;  1WVE C;  2C1D A;  1KX2 A;  2V07 A;  2C8S A;  4K3I A;  2ZOO A;  1AYG A;  3SVW A;  1CIG A;  2BPB B;  1SQB D;  5DF5 A;  5CIG B;  5B66 V;  3L4O A;  3RN0 A;  1GU2 A;  4EIF A;  2JWA A;  2L4D A;  2Y0E A;  1H32 A;  5CIC B;  3WUI A;  4FAV A;  1WEJ F;  4KMG A;  1BGY D;  4GED B;  1KYO D;  3MK7 C;  2B0Z B;  1BL9 A;  3SWS A;  1FCD C;  2KS1 A; 
#chains in the Genus database with same CATH topology
 3NBT A;  2HLO A;  3SWK A;  3G3Z A;  3GG2 A;  3IF4 A;  3KYQ A;  1CYJ A;  2NRG A;  2B89 A;  1ZR4 A;  3TF5 A;  3PLN A;  2IBZ I;  3E1R A;  1GU5 A;  3RGU A;  1EZV D;  4EIC A;  2YIU B;  3HE4 B;  1ZR2 A;  2D2C D;  2XKM A;  4XFJ A;  1OZH A;  1CTY A;  2QSI A;  2B10 B;  3M9Q A;  1Y47 A;  1NHL A;  5CIF B;  2RKL A;  5KJ7 D;  5H2F E;  2DGE A;  2CPB A;  3H1L G;  4JCG A;  4AYC A;  2QE7 H;  3KXD A;  1CXA A;  1L0L G;  1HRO A;  2WPR A;  2N18 C;  1C6R A;  4PV1 B;  3SLE A;  3U59 A;  2WQY C;  1P84 I;  1CIH A;  3B5N A;  4QAO A;  5CHX A;  2Y9Z A;  2NPS A;  1H88 A;  2C2C A;  3HQ8 A;  1KB9 I;  1DIQ C;  1SQV K;  3HRN A;  2WSF J;  2LR2 A;  2QJP B;  1S4X A;  2N18 B;  2KZJ A;  1VF5 B;  5M1B A;  2YKO A;  3CP5 A;  1GTW A;  2WSS H;  4RJT A;  3L75 D;  2RMZ A;  3WUU A;  2QJK B;  5TIS V;  1CI6 A;  4PD4 D;  1PPJ G;  1MG3 D;  4IL6 V;  3CYT I;  1PP9 D;  3PXW A;  2KI7 B;  2B88 A;  2Y9Y A;  1URQ D;  5APT A;  5AVQ B;  1HH7 A;  1RAQ A;  1L2P A;  5AW1 B;  5KLI C;  1JCC A;  1CIF A;  3GHG B;  3T97 B;  5AVT B;  4L3H A;  2AEM A;  1W5C E;  2D2C B;  1VQ6 P;  3CI9 A;  1COR A;  1X22 A;  2ZT9 C;  2NPS C;  2ZYD A;  1KC8 Q;  2B4Z A;  5AW5 B;  1FS0 E;  3B5N C;  1FDI A;  2N9J A;  3PXT A;  1M6Z A;  2PGD A;  1G2C B;  2W6A A;  4AUW A;  5L8R J;  1G1J A;  2V4H A;  1NTK J;  1OFC X;  5KLV E;  4YXW H;  1VQK P;  2O1K A;  2FKW B;  2FYN B;  2GUV A;  1PGO A;  1OXZ A;  1SQB K;  1ZOY C;  4ASW A;  2E76 C;  2I8F A;  4H0K A;  1OW7 A;  2AXT V;  4BWN A;  2W83 C;  1M70 A;  3KZI V;  2W8Z A;  4IOI H;  4Y99 B;  4XA4 A;  3HQ7 A;  4OH8 B;  1KV9 A;  2BEZ F;  4TLF A;  1YJN P;  3O1Y A;  5KLI B;  1LTB C;  1YJW P;  3BCC G;  5CJ0 A;  1OX3 A;  1SQB J;  2IFN A;  3JSV C;  3VP8 A;  1Y8A A;  2N9Y B;  4U3F D;  3L70 E;  4Y28 J;  1KD1 Q;  3CWB J;  3O20 A;  4R4M A;  1E29 A;  2FXP A;  4WQD A;  1YNR A;  2E5T A;  3WFC C;  1I8P A;  2HOD B;  2AIU A;  1KFM A;  1K3G A;  2IBZ D;  1VQ8 P;  1M60 A;  2WZ7 A;  2YMK A;  3GMA A;  3TDK A;  3CCV P;  1IC2 A;  1VQ7 P;  5E79 E;  2KNC B;  1N15 A;  1R5S A;  2XND H;  1T2K D;  1A02 J;  5AVW B;  4O1W A;  1YEB A;  1IFD A;  4EIE A;  3L72 E;  3AE1 C;  1HZU A;  1BE3 J;  3L71 E;  2M5A A;  2YK3 A;  1FHB A;  3CXH E;  1IZN B;  3UIA A;  3L71 G;  2I1K A;  4H44 D;  2C1U A;  4O1Q A;  3A5T A;  1L9B C;  4N78 E;  3PH2 B;  1GZL A;  1M90 Q;  3A0H E;  1GIW A;  4GOE A;  2Q3E A;  1DW2 A;  5KAI H;  1SQP D;  3TNU A;  1N86 A;  1KZU B;  3EFG A;  1YJ9 P;  2ORL A;  1NTZ D;  3ZOO A;  2IPP A;  1J1E B;  2WMM A;  1N73 C;  2R5D A;  4N0K A;  3A0B V;  1OAE A;  1CSX A;  3H1H J;  3GHG C;  3TGU G;  1NTK K;  5B6Q A;  1BDC A;  1KB9 H;  3O0R C;  2Q1K A;  2HR3 A;  4XE5 B;  1VPC A;  2R5B A;  1PPJ D;  1XTC C;  3CCE P;  2FYU E;  3CX5 E;  1SQX D;  3LIE A;  1H31 B;  4WY4 A;  1CXC A;  2KSE A;  5CMZ A;  3AE6 C;  1LFM A;  1BE3 G;  4DY9 A;  1RY3 A;  1ZP0 C;  4IL6 X;  1DD3 A;  3AE8 C;  1JTH B;  1CYC A;  1KFN A;  1MG2 D;  1IFM A;  2ZT9 D;  1LJ2 A;  5KAI V;  1CHI A;  3JBT B;  2YXQ B;  4RKU J;  3KZI E;  3NMD A;  5AVR B;  2KLV A;  2P1J A;  3KPE A;  3D71 A;  2OAR A;  2BCC D;  1IRW A;  1DII C;  4WQE A;  1LTT C;  1NU1 E;  5AW3 B;  3ABV C;  4R4L A;  2E43 A;  1W2E A;  3SWF A;  2YXR B;  3GW6 A;  1CRG A;  1MZ4 A;  2OGU A;  1VQL P;  2OYI B;  1KQL A;  4WY4 C;  4WVZ A;  5E79 H;  3CPW O;  3D6Y A;  3CXH W;  2ZVN B;  2H43 A;  3AEG C;  1HWT C;  1KX7 A;  1L4A B;  1IK9 A;  1DH3 A;  1P84 H;  2MKV A;  1DEE G;  3B71 A;  4ASV A;  3M0D A;  2HV4 A;  2FFD C;  1PGJ A;  2RN0 A;  1U75 B;  2M3E A;  1RF1 B;  1SFC D;  3CCQ P;  2B9B A;  1FAV A;  1SQB E;  4EID A;  1AQ5 A;  4LGD E;  1FDM A;  3H32 B;  3CME P;  4MU8 A;  3RK2 C;  2WVR A;  1MFT A;  1S72 P;  5CCH A;  1HJ4 A;  4GOD A;  1W5C T;  2WSC H;  2D0S A;  3ZCF A;  5AW2 B;  5CJ4 A;  1WVE C;  1KX2 A;  1ZLL A;  4HKZ H;  3IR9 A;  5B5E E;  4TT3 H;  3H1J E;  1GU2 A;  3H1L E;  2H88 C;  4FAV A;  2NPS D;  2ZXX A;  2H7H A;  2WWW A;  1BGY D;  1NTM K;  4GOF A;  3RBX A;  4IL6 E;  3HTK A;  3L71 D;  1CHH A;  1FZC C;  2E76 B;  3L71 J;  1CSU A;  1BCC E;  1K04 A;  2FBW C;  4WQ8 A;  1KYO H;  2E74 B;  1ETP A;  3CX5 W;  4LJI A;  3MK7 B;  5AVY B;  1MZ9 A;  3RK3 C;  3H1J D;  1N7L A;  3MUD A;  1VQN P;  4OWF A;  1Q90 D;  1M56 D;  1NAF A;  2ZXE B;  1K3H A;  3ZOW A;  1PGP A;  3PRJ A;  2CXB A;  1DEB A;  1CSV A;  1EZV I;  1EQ7 A;  3OA8 A;  1FZF A;  3PTZ A;  5TIS E;  1LTJ A;  1NAY A;  1J1E C;  4ZKU A;  4D6T D;  5CCH C;  1JCD A;  3MUD C;  1KIL C;  3AE7 C;  1AKK A;  1Q7Y Q;  1URQ C;  5DFS A;  3HUS A;  1JNM A;  3CX5 H;  1VYD A;  1LP1 A;  2A06 D;  1GQ1 A;  3L75 E;  4JYB A;  5KAF E;  1JEK A;  4YXD C;  1OW6 A;  2E42 A;  1I6E A;  3R4Y A;  3M06 A;  3RL0 C;  2FFD A;  1FJP A;  5DJQ C;  4U3F J;  1LC2 A;  3W68 A;  2CK3 H;  1HJ5 A;  3N4X A;  2Y0D A;  1ZXG A;  3NXS A;  3HD7 C;  3MZW B;  2K9J A;  1H0T B;  3DR0 A;  1S3J A;  2IZ1 A;  2OZ1 B;  1NKN A;  1M1J A;  3OAK A;  1ZME C;  1FJK A;  4FA5 A;  3SJL A;  4OGQ B;  4PD4 H;  3PXS A;  3L74 E;  4N6J A;  3RLM A;  3P7K A;  2AXT E;  2QJY C;  3N7N A;  1NU1 J;  4AAO A;  2O01 H;  1SQQ K;  2QEX P;  4PWA A;  2FWL A;  1YEA A;  4HJG H;  3USS A;  4JQ0 D;  1IQC A;  2WT7 A;  3L73 E;  1VQO P;  3O6Q B;  1CHJ A;  3OCD A;  2OTL P;  1AOF A;  2K37 A;  1FJ0 A;  3M0D C;  3LW5 H;  2D0W A;  3V4Q A;  1VQ9 P;  2ZBO A;  3L72 D;  4NPF X;  3VTP C;  1EB7 A;  1QYZ A;  1PL5 A;  2E5Y A;  1OMI A;  1NVO A;  4H44 C;  4ZMD A;  1KYO E;  1C6S A;  3H1H E;  1I8O A;  1RH5 B;  1SP4 A;  1FOS F;  3NBS A;  3QWO C;  2QA4 P;  4C7N A;  4AAM A;  3RK2 B;  4EI2 A;  1PIX A;  3JCU H;  1Q2N A;  1OW8 A;  5B5E H;  2AEJ A;  3EWK A;  1LGH B;  4YPC A;  3MIW A;  1FI3 A;  3AE5 C;  2OQQ A;  2YQB A;  3H1L J;  5CCH D;  1VF5 C;  3FX0 A;  1CCH A;  3A0B H;  2ZON G;  3DP5 A;  2HG5 D;  3L70 D;  2KSJ A;  2LIT A;  1C2N A;  1HRC A;  1U57 A;  3G71 P;  3H1K G;  4DJG A;  1SQX K;  1LWU B;  1B7V A;  1A02 F;  1GKS A;  1KMI Z;  3PHL A;  1MUU A;  4H44 B;  2HPC B;  5KTB A;  2GC4 D;  1HJB A;  4W7Z A;  3PH0 A;  5AUR A;  3M9B A;  4Y99 C;  1OIP A;  4FAN A;  2KS1 B;  1NTK G;  2YMY A;  4OGQ C;  1RF0 A;  5B66 H;  5GTI H;  3G9R A;  1NGM B;  2YCC A;  1S9K E;  351C A;  1SFC C;  1BCC G;  2ZAE B;  3H1K D;  5DJU B;  2BGV X;  2JQR A;  5APQ A;  1CRJ A;  3CCU P;  1QL3 A;  3HE4 A;  3QH9 A;  1GDT A;  1T3U A;  1A2S A;  2UWJ E;  2KIK A;  2ITA A;  5AW9 B;  5DJQ B;  3AED C;  1OCD A;  1H1O A;  5AW8 B;  1COT A;  3NWV A;  2H89 C;  1RQU A;  1Q82 Q;  2WPV B;  1JMM A;  3O5C A;  3BRT B;  4PJ0 E;  1W2B O;  1KB9 E;  2WSF H;  4FB1 A;  5KJ7 A;  3A7O A;  3B5N B;  3G6E P;  1NTZ G;  2K3R A;  1KB9 D;  1RE3 A;  1FZB A;  1YHQ P;  4PV1 C;  1DVH A;  4XYD B;  1QKS A;  4GDO A;  2O1J A;  2M0B A;  2O3J A;  5BU5 A;  3OW2 O;  2JJL A;  2B87 B;  2IYO A;  1YIQ A;  3VYM A;  2ZYA A;  1JY3 N;  4UB6 V;  5E79 V;  1FZC A;  1FZA A;  3L73 J;  1N73 B;  1FZE A;  4WWI A;  1H8A A;  4FA1 A;  4L76 A;  3V2R A;  2P58 A;  3L36 A;  1KQG B;  1IO3 A;  2O01 N;  1BGY J;  1CI6 B;  1K8A Q;  2FXO A;  3WFE C;  2IBZ E;  2YO3 A;  4RES B;  1CO6 A;  1YBK A;  2N3Y A;  3B8E B;  2O01 J;  3ORV A;  1GJQ A;  1HGZ A;  1OVR A;  2IX7 C;  1S2E A;  2HYN A;  1HZV A;  1L0N G;  2W6B A;  2KZI A;  3CC7 P;  1HGV A;  2XV5 A;  1AOQ A;  2JKV A;  2CA3 B;  2PFX A;  1AV1 A;  1HJ0 A;  2K1A A;  2KK7 A;  3A0H H;  3EFF K;  2FRC A;  1SQP K;  3HQ6 A;  3I5C A;  3LW5 J;  3V2P A;  2HFE D;  1EC5 A;  1SFC B;  1BCC D;  5DJT B;  1SQV D;  3W67 A;  2ZFC A;  1FBM A;  1JUN A;  4UB8 V;  1EDI A;  2IZ0 A;  1R8E A;  2C9L Y;  1J1D B;  1NMI A;  1G2C A;  1JY2 P;  3TK1 A;  2MHM A;  1QLE D;  5B5E V;  1HJ3 A;  1LTA C;  1EXI A;  5GTH E;  3CX5 D;  4CPG A;  1IRV A;  1NU1 K;  3VMX A;  4IL6 H;  4RO0 A;  5TIS H;  1T6A A;  3L75 J;  1YQ4 C;  3KZI H;  1IFN A;  1JB0 J;  4I7Z C;  3SSU A;  1WRG A;  3L74 D;  4WQB A;  1USE A;  4ZNC A;  1A8C A;  2E74 D;  4U3F E;  3L4F A;  1IK7 A;  4D6T E;  3VMA A;  4W80 A;  2KLU A;  1ZV8 A;  1VF5 D;  5KAF H;  1J3S A;  1NTM G;  1RAP A;  2CPS A;  2C1D A;  4EYY Q;  2DW3 A;  1LTG C;  3AE9 C;  5GTH H;  2C8S A;  1EDK A;  2C9N Y;  2ZOO A;  1AYG A;  3B4S A;  2BPB B;  2JO1 A;  4C46 A;  1SQB D;  1FOS E;  4K35 A;  1LT9 A;  4O9B A;  1N8R Q;  2L4D A;  1HUC A;  5KLV G;  2ZT9 B;  5CIC B;  3P8C D;  3RK3 B;  2OYH B;  4KMG A;  1BSN A;  2N9B A;  3MK7 C;  4H13 C;  4EOT A;  1PP9 G;  1BL9 A;  3SWS A;  3HD7 D;  3F89 A;  1FCD C;  3VP9 A;  4AX3 A;  4A7P A;  2HOD A;  2Y0C A;  1GD2 E;  1NTK D;  1KIL D;  2XNX A;  1IFP A;  1YIC A;  1DX7 A;  3CWB G;  2J59 M;  3VYI A;  1FI7 A;  2JEE A;  2GC7 D;  1M8O B;  5EFW B;  2NZ2 A;  1T2K C;  1H33 B;  1MV8 A;  2JWD A;  2QJK C;  4NPD A;  1LWU C;  1ZN5 A;  4WQ7 A;  1YQ3 C;  2IYP A;  3CWB E;  1WMK A;  5AVX B;  3C2C A;  3FXE A;  1NIR A;  1MKM A;  2R32 A;  4GYD A;  3VRD A;  3D6Z A;  5AVV B;  1L4A D;  2WPQ A;  1PP9 E;  2YKP A;  3HE5 B;  1CTZ A;  1RZ5 A;  3S4R A;  3M0A A;  1DW0 A;  2EXV A;  1YYC A;  3TNU B;  1URQ A;  1SQP J;  4BRY B;  2K9Y A;  3H1I G;  1C52 A;  1DW3 A;  2A45 H;  3MGN A;  1BGY E;  4N78 D;  4I2L C;  3WUV A;  3H1H D;  1L0L K;  1SQQ E;  1EDJ A;  3A3Y B;  3II6 A;  4I6M C;  1HCM A;  2N9I A;  5IY5 1;  3BRV B;  4DCK A;  2YIU C;  4U3F G;  3U1A A;  1C2R A;  5APS A;  2Z5H A;  5KAI E;  2GIW A;  3HD7 B;  2WSC J;  4H0L C;  1KIL A;  2C0X A;  1M1K Q;  1E2R A;  1SQX J;  3V2N A;  3CU4 A;  3WU2 V;  2FYU G;  2WIT A;  2Z5I A;  3KQG A;  1Q81 Q;  2MJZ A;  4YE1 A;  3B5N D;  5B66 E;  3P8C E;  1L0L J;  1S5L H;  1L0L D;  3M9H A;  2CE1 A;  1T8Z A;  3KDP B;  2G8Y A;  1QEX A;  1JTH A;  1GL2 B;  2A45 G;  1N9C A;  4H0L B;  3Q5R A;  3M91 A;  1C7M A;  4PW9 B;  3AEE C;  3TYY A;  1H9X A;  1VQ4 P;  3SFE C;  2FYU D;  2FYU J;  2L91 A;  3WU2 H;  2QM7 A;  1AA0 A;  1PZQ A;  2A06 E;  2YNY A;  1N50 A;  1F1F A;  2E75 C;  4JF7 A;  4Y5R A;  2N1T B;  3A9F A;  2OTK E;  2CE0 A;  2QJP C;  3AEA C;  4V2K A;  2E74 C;  2LXC B;  5CID B;  1KQF B;  1CRI A;  1KYO I;  1L0N J;  4MN4 C;  2BCC G;  1WT6 A;  1N7S A;  1NTM D;  1L4A A;  1U7M A;  3X39 A;  3MHV A;  2PP6 A;  2C0W A;  3V4W A;  3H1I E;  1RF1 A;  1H32 B;  1LTI C;  4L3G A;  1SQX G;  1KQS O;  1KIL E;  3JCU E;  4LLH A;  4NFG B;  2BCC J;  3CC4 P;  1CZQ A;  2YO2 A;  3BCC D;  2CA4 B;  5TJH A;  4L73 A;  1ZRT E;  1JY3 O;  1L9J C;  3RL0 B;  3BCC E;  3SXT A;  4HH2 A;  4FA9 A;  3MP7 B;  3I55 P;  2ZXY A;  3CXH I;  3C9I A;  1XTG B;  3K5B A;  3RK2 D;  2D2C C;  1U74 B;  1PP9 J;  1ZZH A;  1OWA A;  4KHX A;  3GLM A;  2L5G B;  2IBZ G;  2QVA A;  3CLQ A;  3VMZ A;  1E79 H;  3HTK B;  1NNO A;  3L4M A;  4H0L D;  4XXL A;  3V2Q A;  2KYV A;  1SVF A;  3O8Z A;  4L75 A;  5AW4 B;  4PD4 I;  1JDL A;  1P84 D;  2NPS B;  1SQV J;  1KB0 A;  1NTZ K;  1D7M A;  4M3L A;  3H1J G;  1HVV A;  4P4Q B;  3H1J J;  4UB6 E;  2WSE J;  2N1T D;  2PAJ A;  3S1K A;  1NTZ E;  3WFD C;  3H1H G;  4DOJ A;  1YTZ I;  1K73 Q;  4U7J A;  1X79 B;  3FXD A;  2I8D A;  1FE6 A;  3RK3 E;  1DT1 A;  1GDV A;  3ZOX A;  3Q5S A;  1FZG A;  1L0L E;  3Q3D A;  1SQQ D;  1K9M Q;  1SQQ J;  2LIR A;  5CIE B;  1AQT A;  2KOG A;  3D70 A;  3P32 A;  3ZDM A;  2ZZS 1;  1LTJ C;  2IDB A;  3CC2 P;  4LC1 A;  1JY2 O;  3RK3 D;  2R3C A;  2KXP B;  5H2F H;  1M57 D;  1AJY A;  1I55 A;  3GHG A;  3T97 A;  3I56 P;  4J20 A;  1NJI Q;  2ZYG A;  4WB4 A;  3CCS P;  2ZVO B;  1CTJ A;  1ZRT D;  3L74 G;  1KIB A;  1DD4 A;  1GK4 A;  1H0T A;  2OZ1 A;  4DZO A;  451C A;  2N1T C;  1NWQ A;  3DMI A;  1CCR A;  4Q5P A;  2C9X B;  3GF7 A;  2R44 A;  1CSW A;  3VNW A;  3TSI A;  1L0N E;  3WFB C;  2Q7C A;  3L73 G;  1JOC A;  4H13 B;  3C8V A;  1QVG O;  2XTS B;  3WMM 0;  4JBZ A;  4HB1 A;  5APY A;  1CRC A;  1CNO A;  2WT7 B;  1EZV E;  1KV4 A;  3O6Q A;  5AVU B;  155C A;  2K88 A;  1H9Y A;  1CC5 A;  3CCJ P;  3JC2 2;  1X9V A;  1SQP E;  1BE3 E;  3HQ9 A;  2BCC E;  3CWB D;  1JM0 A;  1Z56 A;  1QN2 A;  1BGY G;  3CX5 I;  3BVH A;  4N3Y B;  1VQP P;  2I1J A;  3CXH H;  2VHD A;  4AAN A;  1N2D C;  3L37 A;  1VQM P;  2AXT H;  1NOH A;  4K3I A;  2AXC A;  2KNC A;  1CIG A;  5CIG B;  5B66 V;  4WY4 D;  5BVZ A;  2V7Q H;  2BAS A;  2RH0 A;  2JWA A;  1YIJ P;  2H8P D;  1CSB A;  1NYH A;  4K3A A;  2M5A B;  1GMJ A;  1WEJ F;  1IO4 A;  2FXM A;  1KYO D;  1UII A;  3CCM P;  3FWN A;  1S5L E;  3CCL P;  2PRR A;  4AAL A;  2PAC A;  1AVO A;  1RE4 C;  3E1I A;  4PJ0 H;  1QL4 A;  2E76 D;  5CYT R;  1FC2 C;  3H25 A;  3TYI A;  1HH0 A;  1NTZ J;  3AE4 C;  4QMA A;  1S6V B;  3ZBM A;  1CRH A;  1FU1 A;  1LT9 C;  2A06 G;  2BCN B;  4FA4 A;  1RF1 C;  2IFM A;  1SQV E;  3VN0 A;  2XU6 A;  2JR8 A;  1RE4 A;  1JO5 A;  1SLQ A;  2FYZ A;  1YFC A;  4H13 D;  4DT0 A;  1GK6 A;  4OGQ D;  5AVS B;  3PP5 A;  1H31 A;  3PJS K;  1KYO W;  2P2U A;  2QRX A;  2AI5 A;  2WSE H;  2DVH A;  2P10 A;  4WY4 B;  2ZJS E;  4UB6 H;  3H1K J;  2FYU K;  2JTI B;  2C1V A;  1JMB A;  1S1C X;  2N3B A;  3H1I J;  3FGA D;  1YTC A;  1AFO A;  3H1L D;  4IFM A;  1I54 A;  3CMA P;  3AEB C;  1N7S C;  3IAO A;  1I6D A;  1SQQ G;  3VOP A;  5APV A;  3CCR P;  1NKZ B;  4WQ9 A;  3GF3 A;  1SQV G;  4AQR D;  1W2L A;  2BH5 X;  2BEQ D;  3BCC J;  5C0Z A;  2W6J H;  3AE3 C;  4H0J A;  4C7R A;  2XZR A;  2Q9I A;  2B87 A;  4JPZ B;  4HYT B;  1LT1 A;  1UIX A;  1FZC B;  3NFQ A;  2OYI A;  2GM4 A;  1N73 A;  2J58 A;  1LTS C;  2YKQ A;  1RE3 C;  4I7Z B;  3AE2 C;  5AW0 B;  2OYO A;  2Z4E A;  3H6P A;  3ZOY A;  3IFM A;  3IN6 A;  5KJ7 C;  4UB8 H;  1DIP A;  1DW1 A;  1IFI A;  1CED A;  1FDO A;  1PV3 A;  3KHU A;  1H89 A;  1LMS A;  2R3S A;  3RL0 D;  3RBZ A;  2BH4 X;  1FI9 A;  1R5L A;  1S5L X;  3R2P A;  2PCB B;  1JY3 P;  3MD0 A;  4W7Y A;  5GTH V;  3NTN A;  4YTP C;  5CBO A;  1T3J A;  2POH A;  4D6T G;  1VQ5 P;  3H32 A;  3TGU E;  1F1C A;  5H2F V;  1PPJ E;  1SFC A;  3LID A;  3WU2 E;  1BCC J;  4KJM A;  2JP3 A;  1S9K D;  3U1C A;  3ZIY A;  1RF0 C;  2FYN C;  4KT0 J;  5KKZ B;  1KOR A;  4WQA A;  1SQB G;  3CL3 D;  2M8R A;  1MFZ A;  2WTY A;  1Q86 Q;  1OVV A;  3Q1M A;  3L73 D;  3FWL A;  1LS9 A;  1QL2 A;  1BDD A;  3EQ2 A;  5AW7 B;  3L75 G;  1KTM A;  3V5B A;  1GU4 A;  4RSZ A;  1EZV G;  4GT1 A;  1YI2 P;  1HBW A;  1NTM E;  1IZL 0;  1QX8 A;  2GUS A;  1QGK B;  4BXL A;  1C6O A;  2AEF A;  2C1D B;  4Z1M H;  1QL1 A;  4I1L A;  3A0H V;  1I5T A;  1RHZ B;  5K5G B;  2FY8 A;  1LT9 B;  1GL2 C;  3Q5P A;  2WPS A;  5C39 A;  2QIW A;  1USD A;  3Q2Y A;  2OYH A;  2KUB A;  5CCG C;  4L74 A;  2J5U A;  3OA8 B;  1AVY A;  3H1K E;  5KAF V;  1LTJ B;  4D6T J;  4WBA A;  3L70 G;  2E75 B;  4EDF A;  1NU1 D;  5CIH B;  5APX A;  1X0T A;  2P7J A;  1VDF A;  2OTJ P;  3HUS B;  1RZ6 A;  1A56 A;  1LP1 B;  1GW4 A;  1H33 A;  3L74 J;  2KB7 P;  3WUT A;  4ZKP A;  1N90 A;  2M3B A;  1CYI A;  2B12 B;  1HTL C;  3RL0 g;  2E75 D;  2FFD B;  2QJY B;  2LKM A;  1DVV A;  2W27 A;  2XDJ A;  4B86 A;  2K9J B;  3HE5 A;  1M1J B;  1IFJ A;  2P67 A;  1J2J B;  5C9M A;  1YIT P;  4PJ0 V;  1URQ B;  4BRY A;  5CIB B;  3G4S P;  5GTI E;  3WC8 A;  1QVF O;  2Q3I A;  1Y9B A;  2KP8 A;  3A0B E;  1YTZ T;  2V08 A;  5KKZ C;  1NML A;  4PD4 E;  1L4A C;  3BAS A;  5CCG A;  1JY2 N;  2OYH C;  5GTI V;  1SQP G;  1FOC A;  1M1J C;  1LNQ A;  3OJA B;  2BLF B;  3OA7 A;  3AEC C;  3HD7 A;  1KIL B;  1CRY A;  3OCD B;  3ITK A;  3AEF C;  1BSH A;  1EXJ A;  1BE3 D;  2PCC B;  2A45 I;  1TU3 F;  1E5W A;  3BAT A;  1OVU A;  3CD6 P;  3L72 J;  3TGU J;  2Q6Q A;  2GB8 B;  3RN1 A;  2QG4 A;  3TGU D;  3L72 G;  2QM8 A;  3F5H A;  3P8M C;  2GA1 A;  3SWY A;  1NU1 G;  1YCC A;  1ZW0 A;  1S5L V;  3A2A A;  4IFF A;  1NO4 A;  3E7K A;  4UB8 E;  4JYC A;  4NPE A;  4GKG A;  1C75 A;  1GL2 A;  2W90 A;  1U7J A;  4PV1 D;  5KLV D;  1P84 E;  1NTK E;  5BU8 B;  5KLV J;  1KN7 A;  1EDL A;  1E8E A;  2B11 B;  1L0N K;  5APW A;  1SQX E;  1J1D C;  3RMZ A;  1LC1 A;  3C1L A;  4GIF A;  4C7N B;  4L1Q A;  1R0Q A;  4OVN F;  5APU A;  1VL2 A;  3CXH D;  1CIE A;  5AW6 B;  5EXQ A;  2N1T A;  3SFD C;  2MTA C;  1IJD B;  1PFI A;  4IFD K;  5CCG D;  5KLV K;  3S9O A;  2LXB A;  1NH4 A;  3HUS C;  1SS1 A;  4WQC A;  3MTU E;  1HF9 A;  2JDI H;  1GL2 D;  1K05 A;  3H1I D;  3V6I A;  4EIJ A;  3M97 X;  1PGQ A;  2SPZ A;  2VRS A;  2OYI C;  1L0N D;  1N7S B;  1X8Y A;  3L70 J;  1GW3 A;  2V07 A;  1NTM J;  5AVZ B;  3SVW A;  5DF5 A;  3L4O A;  3RN0 A;  1G1I A;  1M7L A;  2G3A A;  1LWU A;  4EIF A;  3D0W A;  2Y0E A;  1CW5 A;  1H32 A;  2Q5U A;  2HPC A;  3WUI A;  3L35 A;  1N7S D;  5CBN A;  4GED B;  2B0Z B;  2V7Q J;  3VMY A;  2KS1 A;  1RQV A; 
#chains in the Genus database with same CATH homology
 3NBT A;  4AX3 A;  3L71 D;  4A7P A;  1CHH A;  2Y0C A;  1NTK D;  1CSU A;  1YIC A;  4AAL A;  2PAC A;  4WQ8 A;  3GG2 A;  1CYJ A;  1QL4 A;  1FI7 A;  5CYT R;  2GC7 D;  3TF5 A;  3TYI A;  3PLN A;  1ETP A;  3CX5 W;  4LJI A;  3MK7 B;  1H33 B;  1S6V B;  3ZBM A;  3H1J D;  1CRH A;  1EZV D;  4EIC A;  2YIU B;  2BCN B;  4FA4 A;  4WQ7 A;  1CTY A;  2B10 B;  5CIF B;  3C2C A;  2DGE A;  1NIR A;  1K3H A;  3ZOW A;  4JCG A;  3PRJ A;  4GYD A;  3VRD A;  2CXB A;  1CSV A;  1YFC A;  3OA8 A;  1CXA A;  1HRO A;  3PTZ A;  2N18 C;  1C6R A;  3SLE A;  4D6T D;  1CTZ A;  1RZ5 A;  1CIH A;  1AKK A;  1H31 A;  1KYO W;  5DFS A;  1DW0 A;  4QAO A;  2EXV A;  2AI5 A;  2DVH A;  2C2C A;  3HQ8 A;  1DIQ C;  1VYD A;  2A06 D;  2JTI B;  1GQ1 A;  2C1V A;  2QJP B;  1C52 A;  1DW3 A;  2N3B A;  2N18 B;  1YTC A;  1I6E A;  3H1L D;  3H1H D;  5DJQ C;  1I54 A;  3CP5 A;  1LC2 A;  1HJ5 A;  4RJT A;  3L75 D;  2RMZ A;  1HCM A;  2N9I A;  5IY5 1;  2Y0D A;  1I6D A;  2QJK B;  5TIS V;  4PD4 D;  1C2R A;  1MG3 D;  2GIW A;  3DR0 A;  2OZ1 B;  1E2R A;  4WQ9 A;  3CU4 A;  3WU2 V;  1W2L A;  2BH5 X;  4IL6 V;  3CYT I;  1PP9 D;  3PXW A;  5C0Z A;  4FA5 A;  4H0J A;  3SJL A;  4YE1 A;  1HH7 A;  1RAQ A;  3PXS A;  3RLM A;  1L0L D;  1CIF A;  2CE1 A;  4L3H A;  4AAO A;  1N9C A;  1COR A;  4PWA A;  2FWL A;  3ZOY A;  1C7M A;  2B4Z A;  4PW9 B;  1H9X A;  1DW1 A;  1YEA A;  2FYU D;  2N9J A;  1CED A;  1IQC A;  3PXT A;  2L91 A;  1CHJ A;  3OCD A;  3KHU A;  1M6Z A;  1LMS A;  1AOF A;  1FJ0 A;  2BH4 X;  1FI9 A;  1N50 A;  1F1F A;  2PCB B;  2D0W A;  2FYN B;  2ZBO A;  3L72 D;  1EB7 A;  5GTH V;  4Y5R A;  1QYZ A;  2I8F A;  4H0K A;  2AXT V;  3A9F A;  2CE0 A;  1M70 A;  3KZI V;  3HQ7 A;  1C6S A;  1I8O A;  4V2K A;  1KV9 A;  1F1C A;  3O1Y A;  5CID B;  5H2F V;  1CRI A;  5KLI B;  1NTM D;  3ZIY A;  3NBS A;  3X39 A;  5KKZ B;  4WQA A;  4AAM A;  3L73 D;  2N9Y B;  3FWL A;  1LS9 A;  4U3F D;  1H32 B;  3O20 A;  4L3G A;  1E29 A;  4RSZ A;  4WQD A;  1YNR A;  3WFC C;  1IZL 0;  1I8P A;  1FI3 A;  4NFG B;  2AIU A;  2YQB A;  1K3G A;  2IBZ D;  3BCC D;  2CA4 B;  5TJH A;  1M60 A;  1CCH A;  1C6O A;  2C1D B;  2ZON G;  3DP5 A;  3TDK A;  3L70 D;  1L9J C;  3A0H V;  3SXT A;  1I5T A;  4FA9 A;  2KNC B;  1N15 A;  2LIT A;  2ZXY A;  4O1W A;  1C2N A;  1YEB A;  1HRC A;  4EIE A;  1B7V A;  1GKS A;  3PHL A;  1HZU A;  1U74 B;  1ZZH A;  2YK3 A;  1FHB A;  2GC4 D;  5AUR A;  4FAN A;  2C1U A;  3OA8 B;  4O1Q A;  1L9B C;  5KAF V;  1NNO A;  3L4M A;  3PH2 B;  4XXL A;  4EDF A;  1NU1 D;  5CIH B;  2YCC A;  1GIW A;  1JDL A;  351C A;  2Q3E A;  1P84 D;  1DW2 A;  1SQP D;  1RZ6 A;  1KB0 A;  3H1K D;  1A56 A;  2ORL A;  1NTZ D;  2BGV X;  2JQR A;  1H33 A;  3ZOO A;  1CRJ A;  1N90 A;  4P4Q B;  1QL3 A;  1CYI A;  4N0K A;  1A2S A;  2B12 B;  3A0B V;  1OAE A;  5DJQ B;  1CSX A;  1OCD A;  1H1O A;  2QJY B;  1COT A;  3NWV A;  3WFD C;  5B6Q A;  1DVV A;  3O0R C;  3O5C A;  1DT1 A;  1GDV A;  1PPJ D;  3ZOX A;  2K9J B;  4FB1 A;  1SQX D;  1SQQ D;  1H31 B;  1KB9 D;  2LIR A;  5CIE B;  5C9M A;  1DVH A;  4PJ0 V;  1CXC A;  4XYD B;  5CIB B;  1QKS A;  2ZZS 1;  1LFM A;  2O3J A;  3WC8 A;  1YIQ A;  3VYM A;  4DY9 A;  4UB6 V;  2V08 A;  5E79 V;  1I55 A;  1NML A;  4J20 A;  1CYC A;  1MG2 D;  4FA1 A;  5GTI V;  5KAI V;  1CHI A;  1FOC A;  1CTJ A;  1IO3 A;  1ZRT D;  1KIB A;  3JBT B;  2BLF B;  3WFE C;  1CO6 A;  1CRY A;  2N3Y A;  3OCD B;  2OZ1 A;  3ORV A;  3ITK A;  1GJQ A;  451C A;  2BCC D;  1BE3 D;  1IRW A;  1DII C;  2PCC B;  4WQE A;  3DMI A;  1CCR A;  1HZV A;  4Q5P A;  2C9X B;  2GB8 B;  3RN1 A;  2QG4 A;  3TGU D;  1CSW A;  3VNW A;  1AOQ A;  3GW6 A;  2CA3 B;  1CRG A;  1YCC A;  1MZ4 A;  3WFB C;  1S5L V;  2FRC A;  3HQ6 A;  1C75 A;  3CXH W;  1BCC D;  2XTS B;  5KLV D;  1SQV D;  1KX7 A;  1CRC A;  4UB8 V;  1CNO A;  1E8E A;  1NMI A;  2B11 B;  155C A;  3RMZ A;  2MHM A;  1LC1 A;  2HV4 A;  1H9Y A;  5B5E V;  1HJ3 A;  4L1Q A;  1R0Q A;  1CC5 A;  2RN0 A;  3CX5 D;  1IRV A;  1U75 B;  3CXH D;  1CIE A;  5EXQ A;  3HQ9 A;  3CWB D;  2MTA C;  4EID A;  1QN2 A;  3L74 D;  4WQC A;  4WQB A;  4MU8 A;  1A8C A;  3H1I D;  2VHD A;  4AAN A;  3M97 X;  1HJ4 A;  3VMA A;  1W5C T;  2D0S A;  3ZCF A;  1J3S A;  1L0N D;  1RAP A;  1WVE C;  2C1D A;  1KX2 A;  2V07 A;  2C8S A;  4K3I A;  2ZOO A;  1AYG A;  3SVW A;  1CIG A;  2BPB B;  1SQB D;  5DF5 A;  5CIG B;  5B66 V;  3L4O A;  3RN0 A;  1GU2 A;  4EIF A;  2JWA A;  2L4D A;  2Y0E A;  1H32 A;  5CIC B;  3WUI A;  4FAV A;  1WEJ F;  4KMG A;  1BGY D;  4GED B;  1KYO D;  3MK7 C;  2B0Z B;  1BL9 A;  3SWS A;  1FCD C;  2KS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...