1NTZD

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 54
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntzD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntzD01
1LC1A 3PXSA 4RJTA 2FWLA 2V08A 1C6OA 4L3HA 3RMZA 3KHUA 4D6TD 4WQAA 2VHDA 3L4MA 2AIUA 5DF5A 4XYDB 1C6RA 1YEBA 2C1DB 2OZ1A 3SVWA 4WQCA 1GKSA 5TISV 1IRVA 3WUIA 1L0LD 1CYIA 5CIFB 2KS1A 1AKKA 1M6ZA 1CCHA 1LS9A 4FANA 1M70A 5B5EV 3O0RC 3DR0A 4WQDA 4O1QA 1KB0A 2CA3B 1I55A 1CHHA 2Q3EA 1MZ4A 1C6SA 2BPBB 3NBTA 2ZBOA 2BH5X 3C2CA 3VYMA 5KLVD 1SQPD 4WQEA 3CXHD 4K3IA 1H33A 5KAIV 5E79V 2LITA 2ZOOA 2C1VA 2RMZA 1W2LA 2C2CA 4IL6V 1NMLA 1CXCA 1CRHA 3L74D 1WVEC 2CXBA 1KYOD 4WQBA 3ORVA 2A06D 3VNWA 1E29A 1QYZA 2YQBA 3L4OA 1I8PA 2QG4A 5DJQC 1FI3A 1K3HA 1YIQA 1EB7A 3H1KD 4AAMA 2ZONG 3WFBC 3PTZA 4LJIA 1DVHA 4XXLA 1DT1A 4PW9B 2MHMA 3O5CA 4H0JA 4O1WA 1PP9D 1CTZA 3CX5W 1I54A 1EZVD 351CA 2MTAC 2OZ1B 1FI9A 3ZOYA 5CIBB 2GC7D 1IZL0 1BCCD 3RLMA 3OCDB 1CEDA 4PD4D 3KZIV 2C8SA 2Y0EA 1CRGA 1I6DA 1OCDA 3FWLA 1K3GA 1RZ6A 4EDFA 2B12B 3H1ID 4EICA 3O1YA 2D0SA 3L73D 1NTMD 1YICA 2B4ZA 2GIWA 1H1OA 3CP5A 3HQ8A 2CE0A 1N50A 1QN2A 1HJ4A 3SWSA 5CIGB 1IQCA 3PRJA 1S6VB 1H33B 4GEDB 2IBZD 3GG2A 3TF5A 1COTA 3CX5D 3OA8B 3MK7C 3CYTI 1SQXD 3L75D 2BLFB 1I5TA 3GW6A 3H1LD 3L72D 4PJ0V 5GTIV 1ZRTD 1AOFA 1BE3D 3H1JD 3OCDA 3ZOWA 4PWAA 1H31A 1B7VA 1L0ND 1BL9A 2V07A 4H0KA 4Q5PA 2KNCB 2Y0DA 3PXWA 2PCBB 1GQ1A 1LFMA 3WFCC 1L9JC 2DGEA 5CYTR 5CIDB 2CE1A 3HQ7A 1AYGA 1HJ5A 1MG3D 3CWBD 1S5LV 1CRIA 1H9YA 4KMGA 3ZBMA 1HRCA 3A9FA 4JCGA 1YFCA 3OA8A 2LIRA 4U3FD 5H2FV 4FA4A 2PCCB 1FCDC 2EXVA 4Y5RA 1KX7A 1MG2D 1N15A 451CA 5KAFV 1H9XA 3CU4A 1GU2A 4UB8V 1CIEA 3PLNA 2HV4A 1NMIA 2N9IA 1A2SA 3PH2B 1E8EA 1C2NA 1DIQC 1U74B 2K9JB 2ORLA 2N9YB 1SQVD 3SJLA 2FYUD 2N3YA 1NIRA 4WQ8A 2O3JA 1LC2A 1YCCA 1J3SA 1FI7A 2BCNB 4P4QB 1H31B 1C7MA 1HZUA 3ZOXA 4N0KA 1YNRA 3HQ9A 2B10B 3HQ6A 1R0QA 2C1UA 4EIFA 1DIIC 3WC8A 2BGVX 4AANA 3A0BV 4AAOA 1FHBA 4L1QA 1CRYA 5CIHB 2QJPB 2YIUB 1N9CA 1NTZD 1DW0A 1C75A 2BH4X 4FAVA 1GIWA 1W5CT 3RN0A 1CTJA 2L91A 5C9MA 3PXTA 1HROA 1M60A 2GC4D 3TGUD 3RN1A 1C52A 1YEAA 3SXTA 4AX3A 5CICB 1E2RA 1F1FA 5EXQA 4FA1A 1F1CA 2C9XB 2B0ZB 1L9BC 2N18B 5IY51 1FJ0A 3WFEC 1CSUA 1FOCA 5KLIB 2JQRA 1SQBD 1CIGA 2YCCA 3WU2V 5TJHA 1DW3A 4QAOA 1CO6A 1CYCA 2N3BA 1CRJA 1CXAA 3TYIA 5B66V 5DJQB 5C0ZA 1KYOW 4FB1A 2L4DA 1HZVA 1CORA 1CSXA 1KIBA 3PHLA 3DP5A 1DW1A 2JTIB 2QJYB 1CYJA 4FA9A 1OAEA 4V2KA 1H32A 1NU1D 2FRCA 1NTKD 1CNOA 1SQQD 2ZXYA 1HJ3A 1QL4A 3WFDC 1CCRA 1CC5A 1WEJF 3A0HV 5AURA 3ITKA 1QKSA 1N90A 1PPJD 2I8FA 1DVVA 1CSVA 5CIEB 1LMSA 4J20A 3O20A 4MU8A 1ZZHA 1CTYA 2CA4B 3NBSA 4RSZA 1CRCA 3TDKA 2QJKB 2D0WA 1I8OA 2C1DA 1GDVA 2N18C 3NWVA 1VYDA 1U75B 4GYDA 2AI5A 4WQ7A 1IRWA 2RN0A 1HCMA 1CHIA 1YTCA 2ZZS1 1CSWA 5DFSA 1KB9D 1ETPA 3BCCD 3M97X 1BGYD 4EIDA 1A56A 3MK7B 1HH7A 5B6QA 3JBTB 1P84D 2BCCD 1GJQA 1KX2A 4AALA 1CIHA 1RAQA 3ZIYA 1RZ5A 3ZCFA 4EIEA 2XTSB 4A7PA 1JDLA 5GTHV 3DMIA 1NNOA 2Y0CA 1A8CA 4YE1A 3L70D 1CIFA 2PACA 2FYNB 1RAPA 3L71D 4WQ9A 1IO3A 1AOQA 4NFGB 4L3GA 1CHJA 3VMAA 5KKZB 2N9JA 2YK3A 1I6EA 2AXTV 3H1HD 3SLEA 4DY9A 2GB8B 1H32B 1DW2A 1KV9A 4FA5A 4UB6V 3VRDA 1QL3A 155CA 3ZOOA 1C2RA 3X39A 2JWAA 2B11B 2DVHA 3CXHW
chains in the Genus database with same CATH superfamily
4RJTA 2KUBA 1SS1A 4YTPC 2XNDH 4BRYB 1Q90D 3TYYA 3KHUA 3CCVP 2K9YA 2ZT9C 3CWBE 4XFJA 4XYDB 3GMAA 1SFCC 2IFNA 1NTMJ 1IRVA 1L0LD 1CYIA 5CIFB 1JM0A 3LIEA 1M6ZA 3CCQP 2WT7A 5B5EV 3DR0A 3V4WA 1KB0A 2CA3B 3CCSP 2Q3EA 1K73Q 1JOCA 2OQQA 2R5BA 1OVUA 3NBTA 2ZBOA 3C2CA 5KLVD 2WITA 3RL0B 3CXHD 5KAIV 1NU1G 5E79V 1SQQG 2QM8A 1W2LA 1VQ4P 2KSEA 2C2CA 1PGPA 4IL6V 1Y47A 2HPCA 1NMLA 2I8DA 1QLED 4WB4A 1CXCA 3LW5J 1BGYE 4JYBA 1PPJG 2CXBA 1P84I 4HYTB 5KTBA 3M0DC 1BDCA 5CHXA 1NJIQ 1SP4A 1QYZA 2YQBA 1YIJP 2KNCA 2QG4A 5DJQC 5KLVJ 1J2JB 2ZONG 3WFBC 2N1TB 5APSA 1M57D 4XXLA 1SQVG 3VP9A 5GTHE 4L75A 2SPZA 3CX5W 1NTZE 1EXIA 1FI9A 1KC8Q 1AQ5A 4M3LA 4YPCA 3H32A 1HF9A 1P84H 1CEDA 3MTUE 2NRGA 3HD7B 2OARA 4BWNA 1OCDA 2KS1B 2J58A 1K3GA 4EDFA 4O9BA 3H1ID 3LIDA 5CCGD 3O1YA 2AEMA 2GIWA 4I6MC 3CP5A 3L71G 2E75B 2Q3IA 1HH0A 1SQBE 1QN2A 2N1TA 5CIGB 3KZIH 2K9JA 1NKNA 4GEDB 2IBZD 1KILB 3GG2A 3TF5A 1COTA 3CX5D 3OA8B 2ITAA 1SQXD 1L0LE 3L75D 1FE6A 2BLFB 2HFED 3H1IJ 3H1LD 1AOFA 1ZRTD 3B4SA 1BE3D 3H1JD 2M5AB 4ASWA 4PWAA 1H31A 1HGZA 1ZOYC 3D0WA 2WQYC 1L0ND 4GDOA 2E76B 1VQPP 2E74C 1LNQA 5AW3B 2YMYA 5KLVE 4LLHA 1IFMA 3SWKA 5AW9B 3U59A 1RF1C 1VQOP 1YTZT 3HUSB 2JR8A 3TGUJ 1LJ2A 1SQXJ 1OW7A 1HJ5A 1MG3D 1GW4A 3L75J 3V2QA 2PRRA 1ZMEC 1R5SA 1BE3J 1KYOI 3H1JJ 4IOIH 3K5BA 3OA8A 3AE9C 1E79H 2LIRA 1IZNB 1URQC 1YQ4C 1YBKA 2EXVA 4Y5RA 1KX7A 1Y8AA 2R5DA 4AYCA 1MG2D 3FXDA 451CA 1JB0J 2GUSA 2CPBA 2PGDA 1BSHA 2KI7B 2YO2A 1GDTA 3CU4A 1KV4A 3RL0D 1R5LA 2QA4P 1VL2A 2O1JA 4XA4A 3ZDMA 3G3ZA 3HE5B 1HUCA 2ORLA 2N9YB 2FXOA 3A3YB 5CCHA 1BGYG 1ZW0A 3O6QB 3H1IE 1YCCA 3H1HE 3RK2D 3CMEP 4KJMA 3U1CA 1HZUA 4N0KA 3HQ6A 1R0QA 3C9IA 5AW1B 2C1UA 2XNXA 1JCDA 1DIIC 3R2PA 3A0BV 1IFIA 1OXZA 2IBZE 3T97B 1AQTA 2BEQD 1SQXE 2GUVA 1YITP 2Y9ZA 2WPSA 5APTA 2OYIC 2OTLP 3H1LE 2FY8A 1ZRTE 2D2CC 1BE3E 1NTMG 1GIWA 2L91A 1L0NE 3PXTA 1HROA 1M60A 4PJ0E 3AE8C 1YEAA 3O6QA 3SXTA 4RO0A 5EXQA 1RQVA 2K88A 2Z4EA 2NPSC 1M1JC 2W90A 3EQ2A 2C9XB 1AA0A 1JY2O 5IY51 2PAJA 3V6IA 5KLIB 3CXHI 2YCCA 2QVAA 4H13D 2UWJE 1DW3A 1ZR4A 1CYCA 1CRJA 4NPEA 1HJBA 1KILD 5KAIE 3CL3D 3IR9A 1RF1A 1KIBA 3DP5A 2JTIB 1CYJA 2J5UA 5H2FE 4EYYQ 4W80A 1NU1D 1EDJA 2FRCA 1SQQD 2E76D 3WFDC 1HVVA 5KLVG 1OFCX 1N7SB 3ITKA 3BATA 4MN4C 1PPJD 1DVVA 4R4LA 4UB8E 4J20A 2KSJA 2OTJP 1EDLA 2AXCA 3RGUA 1SQPK 2C1DA 2N18C 3V2RA 2ZAEB 3D6ZA 2YXQB 4GYDA 1OZHA 1JMMA 4PD4E 1SQQJ 3I56P 3PP5A 3A0HH 2XU6A 1HCMA 3E1RA 3RK3D 4AQRD 1LGHB 1KMIZ 5AW8B 3BCCD 1M7LA 1HWTC 2QRXA 2ZVOB 3NTNA 1SQPJ 2QSIA 3JBTB 1P84D 2O01H 3SSUA 1KX2A 4IFFA 1CIHA 2B88A 1FBMA 4A7PA 5GTHV 4YXDC 1T6AA 2Y0CA 1A8CA 3UIAA 4Y28J 2FYNB 3AE5C 1RAPA 3L71D 5AW0B 3BCCJ 4L3GA 3VMAA 1S4XA 5KKZB 3OJAB 2WPVB 1FJKA 2N9JA 2YK3A 1FZBA 2OYIA 5DJUB 1BDDA 1AVYA 3VRDA 3X39A 2JWAA 4YXWH 1UIXA 2IBZG 3TSIA 2FFDC 1C6OA 3TGUG 4L3HA 2OYHC 3L75G 3L71J 4U7JA 2VHDA 2AXTH 5DF5A 2OZ1A 1BE3G 3H1JG 2A45G 4WQCA 2JJLA 4HH2A 1JCCA 1NU1E 4NPFX 1SQQE 1YJWP 3HE4B 3L37A 1G1JA 4DJGA 1L4AD 1PPJE 4PV1B 4O1QA 2YNYA 2QJPC 2YIUC 2FXMA 2OYOA 2B89A 3VYMA 1H33A 2KLUA 1OWAA 1GL2B 2ZOOA 2Q7CA 1DEBA 3A5TA 2RMZA 1SQVE 2H7HA 1S72P 1LTTC 5B5EH 3RK3E 3NXSA 1KB9I 2I1KA 3BCCE 3RL0g 1LP1B 3CCRP 1HTLC 1WVEC 4WY4B 1KYOD 1KQSO 1RE4C 3ORVA 3OW2O 3MZWB 3VNWA 1QX8A 4H44B 1N7SD 5E79H 1LTJC 1YIQA 4AAMA 4IL6H 4LJIA 3G4SP 4PW9B 1PZQA 2MHMA 3O5CA 2QJYC 2WSEH 3R4YA 2M3EA 4JF7A 3L71E 1CTZA 1DD4A 1I54A 1CW5A 1IZL0 3RLMA 1JY3P 2FYUK 3OCDB 1FU1A 3USSA 2Y0EA 1I6DA 4WY4A 4EICA 1PGJA 1NTMD 1YICA 5CJ4A 1BSNA 4GOFA 3RBZA 3TK1A 3RK2C 1VF5D 1IQCA 3PRJA 3QWOC 3D6YA 4DCKA 1S6VB 5AVQB 1S1CX 4OGQB 2I1JA 4I7ZC 4I1LA 3MUDC 4N78E 1DD3A 2HPCB 2R3SA 1EC5A 4CPGA 1RF0C 2C0XA 1I5TA 3TNUA 2OYHA 1AFOA 4UB6H 1JY3N 3L35A 4PJ0V 5KJ7C 3OCDA 3AE3C 1ZXGA 2QIWA 1X22A 1E5WA 2V07A 5APQA 3B71A 4Q5PA 2KNCB 2Y0DA 3PXWA 1JUNA 1L9JC 1OMIA 2Q5UA 3HQ7A 4KT0J 2WSFH 5AVRB 3CC4P 5TISH 1KFMA 5EFWB 1NOHA 1GD2E 1DX7A 3Q1MA 1CRIA 4KMGA 1KYOE 3H32B 2W27A 1Q7YQ 1J1EC 5BU8B 4U3FD 5H2FV 4H13C 3VYIA 1FC2C 1SQPG 4C7NA 1LTAC 1NTKK 1FZCB 1N73C 2B9BA 1RHZB 2HR3A 2LKMA 1GU4A 4UB8V 1CIEA 1NMIA 1SLQA 3GF3A 2N9IA 3PH2B 1DIQC 1T2KD 3G71P 2K9JB 2JP3A 3OAKA 2B87B 1JTHA 1ZV8A 1NIRA 4U3FJ 3BCCG 3KYQA 1RY3A 3EFFK 1LC2A 1J3SA 1IFPA 3MIWA 1FI7A 2ZT9B 4P4QB 1NTME 1MZ9A 1H31B 3V5BA 3D71A 3ZOXA 4IFMA 1Q2NA 4H44D 1SFCB 4HJGH 1H8AA 1KN7A 4GOEA 3AE7C 2L5GB 1FZCA 3RK3C 2ZJSE 2JEEA 1FHBA 3M9QA 2IYOA 4HKZH 1NAFA 5AVTB 1C75A 4OVNF 2B87A 3S4RA 1W5CT 3VTPC 2GC4D 3TGUD 3FWNA 3A0BH 4ZKUA 5AVZB 1EDKA 3MUDA 1E2RA 1F1FA 1USDA 2HODA 3CCJP 2OTKE 1K05A 1YI2P 2KB7P 3M9HA 1YYCA 1USEA 1SFCA 5KJ7A 2E42A 1FJ0A 2GA1A 3WFEC 2E5YA 4I2LC 5APXA 1CIGA 1VPCA 3CXHE 1MV8A 4QAOA 4OGQD 2YKQA 5DJQB 1S5LE 2J59M 2K3RA 5GTIH 4U3FE 1HZVA 1CORA 1CSXA 4N6JA 3MGNA 4FA9A 3AEDC 1H32A 1U7JA 1CNOA 1HJ3A 2WVRA 3GHGC 5KAFE 1JEKA 1N90A 2KZIA 3D70A 1FAVA 3G6EP 1LMSA 4Y99C 4RESB 1CTYA 3TDKA 1G1IA 3M0DA 1IK7A 4ASVA 2D0WA 3N7NA 2HYNA 1L4AC 2ZVNB 3WUVA 1S9KD 1VYDA 1N86A 3SFEC 1LTBC 3MD0A 1XTCC 1IRWA 2RN0A 4JQ0D 1CHIA 1YTCA 2WPRA 2ZZS1 4GODA 1KB9D 4EIDA 3VN0A 2K1AA 5B6QA 1JO5A 2KYVA 2BCCD 1GMJA 2IZ1A 1L2PA 2O1KA 1RAQA 3ZIYA 3B5NC 3ZCFA 2N1TD 3L74J 5K5GB 5DJTB 2E74B 2XKMA 2CPSA 1WT6A 3CX5E 3TGUE 3L75E 1AOQA 1RF1B 3F89A 1N2DC 3H1JE 2ZT9D 3A2AA 3FXEA 1S5LX 1GZLA 1LT9C 2BCCJ 1DW2A 4FA5A 3HD7D 5GTHH 1NAYA 1QL3A 1C2RA 4WWIA 2R44A 3IN6A 3JSVC 2B11B 1URQB 1MFZA 1BCCJ 3WU2E 2E75D 1JY2P 2IDBA 3JC22 3RMZA 4D6TD 3L4MA 2AIUA 5B66E 1C6RA 2C1DB 3I55P 4B86A 1IC2A 3SVWA 2H43A 1GKSA 3AEEC 2IYPA 4AUWA 1VF5C 1OVVA 1CCHA 1LS9A 4FANA 2W83C 3CCMP 2WTYA 2XZRA 1MZ4A 4C46A 4D6TJ 2JDIH 2FKWB 4H0LB 2BPBB 1T3JA 1S9KE 1URQA 1SQPD 4K3IA 1VDFA 2H89C 4U3FG 1TU3F 3VP8A 5CCHD 1RQUA 1CRHA 1KB9E 3KXDA 1PIXA 3JCUE 1T3UA 5AVYB 1L4AA 3G9RA 4WQBA 3HTKA 1N7LA 2OYIB 3V2PA 2D2CB 1Z56A 1E29A 1FI3A 1K3HA 3PTZA 2WWWA 1DVHA 3N4XA 3EWKA 3H25A 2NPSB 4H0JA 1PP9D 1GW3A 2V7QH 3B8EB 351CA 2OZ1B 1VQ8P 3ZOYA 3B5NA 2KIKA 2GC7D 4NPDA 1IFJA 3P8MC 3CCEP 2P7JA 1CRGA 3FWLA 5CBNA 1T2KC 4K35A 4DZOA 4GT1A 2QJKC 2ZYAA 2B4ZA 3L70G 1H1OA 3HQ8A 4D6TE 1PP9J 1LTSC 1LT9A 1HJ4A 3SWSA 4JBZA 4C7RA 1H33B 1KILE 2NPSA 3HRNA 1M1JA 2JO1A 1IFNA 3GLMA 3MK7C 5CCGC 3CYTI 4OH8B 4ZNCA 4IL6X 2BEZF 4WBAA 3OA7A 1NH4A 1A02J 1B7VA 1KD1Q 1BL9A 3CX5H 2G3AA 4OWFA 3M06A 4H0KA 2Y9YA 2W6BA 1SQPE 2PCBB 1GQ1A 1LFMA 3WFCC 2A45H 2N9BA 5AW2B 5CIDB 2CE1A 4ZKPA 1J1DB 4PJ0H 1KQLA 1AYGA 1AV1A 3CWBD 1S5LV 1PFIA 5AVSB 3P7KA 1H9YA 1HRCA 5AVUB 1ZLLA 4JCGA 1LWUC 2ZXXA 1Q82Q 1JMBA 4FA4A 1YJNP 1W2EA 1FCDC 1CZQA 1N15A 3CPWO 1P84E 5KAFV 2W8ZA 2H8PD 1ZR2A 1CI6B 5KAIH 4H0LD 1GU2A 3L74G 1EZVI 3CWBJ 1HJ0A 1E8EA 5H2FH 1QL2A 1NWQA 1OVRA 2FYUD 2N3YA 1M90Q 1IO4A 2VRSA 4L73A 1WMKA 2FFDB 3TNUB 2OYHB 4EIJA 3L36A 3KZIE 2BCCG 4UB8H 3Q3DA 3W68A 3Q2YA 3IFMA 3RL0C 1YNRA 3HQ9A 3WC8A 2BGVX 4AANA 3V4QA 1BCCG 1JY3O 5AVWB 1CI6A 2HLOA 4PD4H 2FYUJ 1QEXA 1CSBA 5CIHB 2QJPB 2YIUB 1N9CA 1JNMA 1NTZD 3CMAP 2POHA 3VMYA 1M1KQ 3AE6C 2OGUA 3CD6P 5C9MA 3NFQA 2N1TC 2KLVA 1NTZK 3II6A 3RN1A 2FFDA 5APUA 1KTMA 4C7NB 5CCGA 2ZXEB 3VOPA 2B0ZB 1L9BC 1X0TA 2W6JH 1OX3A 2WSCH 4D6TG 1A02F 1CSUA 1VQ7P 1SQBD 3WU2V 1NTZJ 3L72G 1G2CB 1KZUB 2KK7A 3HD7C 1LTJB 2WZ7A 5B66V 5APVA 1YJ9P 2E5TA 2FBWC 1SQBK 1JTHB 2L4DA 3M0AA 5CMZA 2O01N 2QJYB 3EFGA 1PV3A 1FDIA 3E7KA 2E75C 2V4HA 4V2KA 1NTKD 3IAOA 1L0LK 2W6AA 1QL4A 1QL1A 1LWUA 1SQBJ 1FDOA 2HG5D 4PV1D 1CC5A 1PL5A 1QKSA 1KILC 2KOGA 1CSVA 1DEEG 3O20A 4MU8A 4BRYA 4RSZA 1D7MA 3KQGA 2FYUE 2Z5HA 1RE4A 2WPQA 5KLVK 2KXPB 1G2CA 1L0LJ 1GDVA 1OW8A 1GL2D 2WSSH 1KQGB 1DIPA 1LTJA 2E76C 5CJ0A 4EI2A 3RK2B 1NTKJ 1NHLA 1OIPA 2WMMA 3H6PA 3KPEA 1CSWA 4I7ZB 1ETPA 4WVZA 2HODB 3HUSC 4WY4D 1AJYA 1A56A 3AE4C 3F5HA 1HGVA 5CCHC 3KDPB 1N8RQ 1PP9G 1GJQA 4LGDE 4AALA 4W7YA 2XV5A 1UIIA 4EIEA 2P1JA 1JDLA 2CK3H 2XDJA 3DMIA 3BVHA 3O8ZA 2O01J 4RKUJ 2ZYDA 3L70D 1IO3A 2V7QJ 4GIFA 4NFGB 3AECC 1VQKP 1W5CE 1CHJA 2C0WA 3H1HD 3SLEA 4DY9A 1DH3A 1LT1A 1H32B 4UB6V 1GU5A 1U7MA 3BRVB 3WUTA 1VQ5P 1X9VA 1RF0A 1J1EB 1FJPA 4H13B 1LC1A 3PXSA 2FWLA 2V08A 3L70J 4WQAA 3AEBC 2QE7H 1FZAA 1MFTA 1YEBA 1N73B 3QH9A 4TLFA 3H1HJ 2KZJA 5TISV 1NTKE 1SQXK 1K04A 3HD7A 3WUIA 2KS1A 1AKKA 1M70A 2LXCB 3O0RC 4WQDA 1EQ7A 1L0NK 1ZP0C 3PH0A 1I55A 1CHHA 3CC2P 3A0HE 4DT0A 3GF7A 3CWBG 1C6SA 3L4FA 5APYA 2BH5X 4WQEA 3H1LJ 1GK6A 1RE3C 2LITA 2C1VA 1KILA 1L0NJ 1H89A 1N73A 3RK3B 3L74D 2NZ2A 2M5AA 2JKVA 2FYZA 1M56D 3SWYA 5KLIC 2A06D 3E1IA 1W2BO 3C8VA 3L4OA 1I8PA 2Q1KA 1EB7A 3H1KD 1S2EA 1VQMP 1VQLP 1T8ZA 1DT1A 3Q5PA 1FDMA 1KYOH 2FYUG 3HUSA 3AE1C 3L70E 4O1WA 2MKVA 1FZGA 2ZFCA 1M8OB 1EZVD 2MTAC 3C1LA 5CIBB 5AVXB 1QVGO 1FZFA 1BCCD 1N7SC 4H0LC 3W67A 2WSEJ 1MUUA 4PD4D 3KZIV 2AXTE 2C8SA 4IFDK 2R32A 3H1KJ 1RZ6A 2B12B 4Z1MH 5AVVB 2D0SA 3L73D 2YKPA 1SFCD 1H0TB 5KJ7D 3S9OA 5AW5B 1NTZG 1ZN5A 2CE0A 2LXBA 1N50A 2M8RA 2IPPA 3GHGB 3HE5A 4EOTA 1Q86Q 4Y99B 3GW6A 1U57A 3IF4A 3L72D 5GTIV 3L73J 3ZOWA 3U1AA 1L4AB 1KQFB 2YO3A 1QVFO 4XE5B 2DW3A 2E43A 3HTKB 5B5EE 1HBWA 5M1BA 4GKGA 1VQNP 1SQBG 1K9MQ 1YTZI 3WMM0 2FYNC 1H0TA 2DGEA 5CYTR 2WSCJ 1VQ9P 1FZEA 3M91A 3T97A 5KKZC 2AEFA 1L0LG 3MP7B 5E79E 3LW5H 3L74E 4IL6E 3GHGA 4KHXA 3L72J 1JY2N 3P8CD 3B5NB 1EXJA 1NTKG 3ZBMA 3A9FA 1YFCA 2A06E 2PP6A 2WSFJ 1RE3A 1OW6A 2PCCB 3H1KE 1Y9BA 2M0BA 3CXHH 1NU1K 1R8EA 1SQQK 3NMDA 2BCCE 1H9XA 1S5LH 3CCUP 3P32A 3SFDC 3PLNA 1EZVE 1LT9B 2HV4A 1NO4A 1YHQP 2P10A 2YMKA 1A2SA 1FOSE 1VQ6P 1C2NA 1U74B 1BCCE 1PGQA 1NU1J 1MKMA 1M1JB 1SQVD 3SJLA 2GM4A 4PV1C 4WQ8A 1S3JA 2O3JA 3MHVA 5KAFH 4L74A 2YKOA 5BVZA 2BCNB 1J1DC 1SQVK 2H88C 3AEGC 3L73E 5BU5A 1C7MA 3Q5RA 4N3YB 2B10B 1GL2C 1N7SA 1Q81Q 4EIFA 4UB6E 1VF5B 1K8AQ 3V2NA 2IZ0A 2IBZI 1H88A 4AAOA 1SQVJ 2P58A 3CX5I 4L1QA 1CRYA 3WUUA 4WY4C 2P2UA 4K3AA 2JWDA 3H1IG 3H1HG 2E74D 2A45I 3L72E 1DW0A 2BH4X 4FAVA 4DOJA 1LTGC 3FX0A 4H44C 3RN0A 1CTJA 1FOSF 1RH5B 2QM7A 1C52A 3VMXA 4AX3A 2K37A 5CICB 1FS0E 1XTGB 5TISE 4FA1A 1GTWA 2C9LY 1X79B 1F1CA 2N18B 2RKLA 1SQXG 1FOCA 3S1KA 2JQRA 1URQD 3H1LG 5TJHA 1QGKB 2AEJA 3P8CE 1CO6A 4R4MA 2N3BA 1CXAA 1L0NG 3TYIA 5C0ZA 1KYOW 2BASA 4FB1A 2Q9IA 2ZYGA 3A7OA 5AW6B 2MJZA 4N78D 4JPZB 3AEAC 1PGOA 4BXLA 3PHLA 1IJDB 4LC1A 3AE2C 1DW1A 1WRGA 1OAEA 3PJSK 2Q6QA 3AEFC 2ZXYA 3WU2H 1CCRA 1AVOA 4OGQC 5C39A 5B66H 2C9NY 1WEJF 3A0HV 5AURA 1GK4A 3CCLP 4L76A 2I8FA 5CIEB 3M9BA 4TT3H 1ZZHA 2CA4B 3NBSA 1NKZB 2M3BA 1CRCA 1PP9E 1EDIA 1NYHA 3RBXA 2QJKB 1I8OA 2PFXA 1IK9A 3BASA 5CBOA 5L8RJ 2KP8A 3BRTB 1KORA 4ZMDA 3NWVA 3B5ND 1U75B 2QEXP 1KFNA 2A06G 4PD4I 2AI5A 3FGAD 4WQ7A 3HE4A 3CI9A 5APWA 3H1KG 2IX7C 5DFSA 3M97X 1BGYD 2R3CA 3ABVC 3MK7B 1HH7A 2D2CD 2YXRB 1YQ3C 2P67A 3A0BE 1EZVG 1RZ5A 2XTSB 2Z5IA 1KB9H 1NGMB 1NNOA 5AW7B 3JCUH 1GL2A 2RH0A 1LTIC 1X8YA 4W7ZA 2NPSD 3Q5SA 1SVFA 4QMAA 4YE1A 1IFDA 1CIFA 2PACA 2IFMA 4WQ9A 3VMZA 1FZCC 1BGYJ 1LP1A 3L73G 2WT7B 1I6EA 2AXTV 3I5CA 2GB8B 3CLQA 3CC7P 4JYCA 1KV9A 5GTIE 1NVOA 2LR2A 4HB1A 155CA 3ZOOA 2G8YA 2FXPA 1LWUB 3SWFA 1NTMK 2DVHA 5AW4B 3CXHW
chains in the Genus database with same CATH topology
1LC1A 3PXSA 4RJTA 2FWLA 2V08A 1C6OA 4L3HA 3RMZA 3KHUA 4D6TD 4WQAA 2VHDA 3L4MA 2AIUA 5DF5A 4XYDB 1C6RA 1YEBA 2C1DB 2OZ1A 3SVWA 4WQCA 1GKSA 5TISV 1IRVA 3WUIA 1L0LD 1CYIA 5CIFB 2KS1A 1AKKA 1M6ZA 1CCHA 1LS9A 4FANA 1M70A 5B5EV 3O0RC 3DR0A 4WQDA 4O1QA 1KB0A 2CA3B 1I55A 1CHHA 2Q3EA 1MZ4A 1C6SA 2BPBB 3NBTA 2ZBOA 2BH5X 3C2CA 3VYMA 5KLVD 1SQPD 4WQEA 3CXHD 4K3IA 1H33A 5KAIV 5E79V 2LITA 2ZOOA 2C1VA 2RMZA 1W2LA 2C2CA 4IL6V 1NMLA 1CXCA 1CRHA 3L74D 1WVEC 2CXBA 1KYOD 4WQBA 3ORVA 2A06D 3VNWA 1E29A 1QYZA 2YQBA 3L4OA 1I8PA 2QG4A 5DJQC 1FI3A 1K3HA 1YIQA 1EB7A 3H1KD 4AAMA 2ZONG 3WFBC 3PTZA 4LJIA 1DVHA 4XXLA 1DT1A 4PW9B 2MHMA 3O5CA 4H0JA 4O1WA 1PP9D 1CTZA 3CX5W 1I54A 1EZVD 351CA 2MTAC 2OZ1B 1FI9A 3ZOYA 5CIBB 2GC7D 1IZL0 1BCCD 3RLMA 3OCDB 1CEDA 4PD4D 3KZIV 2C8SA 2Y0EA 1CRGA 1I6DA 1OCDA 3FWLA 1K3GA 1RZ6A 4EDFA 2B12B 3H1ID 4EICA 3O1YA 2D0SA 3L73D 1NTMD 1YICA 2B4ZA 2GIWA 1H1OA 3CP5A 3HQ8A 2CE0A 1N50A 1QN2A 1HJ4A 3SWSA 5CIGB 1IQCA 3PRJA 1S6VB 1H33B 4GEDB 2IBZD 3GG2A 3TF5A 1COTA 3CX5D 3OA8B 3MK7C 3CYTI 1SQXD 3L75D 2BLFB 1I5TA 3GW6A 3H1LD 3L72D 4PJ0V 5GTIV 1ZRTD 1AOFA 1BE3D 3H1JD 3OCDA 3ZOWA 4PWAA 1H31A 1B7VA 1L0ND 1BL9A 2V07A 4H0KA 4Q5PA 2KNCB 2Y0DA 3PXWA 2PCBB 1GQ1A 1LFMA 3WFCC 1L9JC 2DGEA 5CYTR 5CIDB 2CE1A 3HQ7A 1AYGA 1HJ5A 1MG3D 3CWBD 1S5LV 1CRIA 1H9YA 4KMGA 3ZBMA 1HRCA 3A9FA 4JCGA 1YFCA 3OA8A 2LIRA 4U3FD 5H2FV 4FA4A 2PCCB 1FCDC 2EXVA 4Y5RA 1KX7A 1MG2D 1N15A 451CA 5KAFV 1H9XA 3CU4A 1GU2A 4UB8V 1CIEA 3PLNA 2HV4A 1NMIA 2N9IA 1A2SA 3PH2B 1E8EA 1C2NA 1DIQC 1U74B 2K9JB 2ORLA 2N9YB 1SQVD 3SJLA 2FYUD 2N3YA 1NIRA 4WQ8A 2O3JA 1LC2A 1YCCA 1J3SA 1FI7A 2BCNB 4P4QB 1H31B 1C7MA 1HZUA 3ZOXA 4N0KA 1YNRA 3HQ9A 2B10B 3HQ6A 1R0QA 2C1UA 4EIFA 1DIIC 3WC8A 2BGVX 4AANA 3A0BV 4AAOA 1FHBA 4L1QA 1CRYA 5CIHB 2QJPB 2YIUB 1N9CA 1NTZD 1DW0A 1C75A 2BH4X 4FAVA 1GIWA 1W5CT 3RN0A 1CTJA 2L91A 5C9MA 3PXTA 1HROA 1M60A 2GC4D 3TGUD 3RN1A 1C52A 1YEAA 3SXTA 4AX3A 5CICB 1E2RA 1F1FA 5EXQA 4FA1A 1F1CA 2C9XB 2B0ZB 1L9BC 2N18B 5IY51 1FJ0A 3WFEC 1CSUA 1FOCA 5KLIB 2JQRA 1SQBD 1CIGA 2YCCA 3WU2V 5TJHA 1DW3A 4QAOA 1CO6A 1CYCA 2N3BA 1CRJA 1CXAA 3TYIA 5B66V 5DJQB 5C0ZA 1KYOW 4FB1A 2L4DA 1HZVA 1CORA 1CSXA 1KIBA 3PHLA 3DP5A 1DW1A 2JTIB 2QJYB 1CYJA 4FA9A 1OAEA 4V2KA 1H32A 1NU1D 2FRCA 1NTKD 1CNOA 1SQQD 2ZXYA 1HJ3A 1QL4A 3WFDC 1CCRA 1CC5A 1WEJF 3A0HV 5AURA 3ITKA 1QKSA 1N90A 1PPJD 2I8FA 1DVVA 1CSVA 5CIEB 1LMSA 4J20A 3O20A 4MU8A 1ZZHA 1CTYA 2CA4B 3NBSA 4RSZA 1CRCA 3TDKA 2QJKB 2D0WA 1I8OA 2C1DA 1GDVA 2N18C 3NWVA 1VYDA 1U75B 4GYDA 2AI5A 4WQ7A 1IRWA 2RN0A 1HCMA 1CHIA 1YTCA 2ZZS1 1CSWA 5DFSA 1KB9D 1ETPA 3BCCD 3M97X 1BGYD 4EIDA 1A56A 3MK7B 1HH7A 5B6QA 3JBTB 1P84D 2BCCD 1GJQA 1KX2A 4AALA 1CIHA 1RAQA 3ZIYA 1RZ5A 3ZCFA 4EIEA 2XTSB 4A7PA 1JDLA 5GTHV 3DMIA 1NNOA 2Y0CA 1A8CA 4YE1A 3L70D 1CIFA 2PACA 2FYNB 1RAPA 3L71D 4WQ9A 1IO3A 1AOQA 4NFGB 4L3GA 1CHJA 3VMAA 5KKZB 2N9JA 2YK3A 1I6EA 2AXTV 3H1HD 3SLEA 4DY9A 2GB8B 1H32B 1DW2A 1KV9A 4FA5A 4UB6V 3VRDA 1QL3A 155CA 3ZOOA 1C2RA 3X39A 2JWAA 2B11B 2DVHA 3CXHW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LC1 A;  3PXS A;  4RJT A;  2FWL A;  2V08 A;  1C6O A;  4L3H A;  3RMZ A;  3KHU A;  4D6T D;  4WQA A;  2VHD A;  3L4M A;  2AIU A;  5DF5 A;  4XYD B;  1C6R A;  1YEB A;  2C1D B;  2OZ1 A;  3SVW A;  4WQC A;  1GKS A;  5TIS V;  1IRV A;  3WUI A;  1L0L D;  1CYI A;  5CIF B;  2KS1 A;  1AKK A;  1M6Z A;  1CCH A;  1LS9 A;  4FAN A;  1M70 A;  5B5E V;  3O0R C;  3DR0 A;  4WQD A;  4O1Q A;  1KB0 A;  2CA3 B;  1I55 A;  1CHH A;  2Q3E A;  1MZ4 A;  1C6S A;  2BPB B;  3NBT A;  2ZBO A;  2BH5 X;  3C2C A;  3VYM A;  5KLV D;  1SQP D;  4WQE A;  3CXH D;  4K3I A;  1H33 A;  5KAI V;  5E79 V;  2LIT A;  2ZOO A;  2C1V A;  2RMZ A;  1W2L A;  2C2C A;  4IL6 V;  1NML A;  1CXC A;  1CRH A;  3L74 D;  1WVE C;  2CXB A;  1KYO D;  4WQB A;  3ORV A;  2A06 D;  3VNW A;  1E29 A;  1QYZ A;  2YQB A;  3L4O A;  1I8P A;  2QG4 A;  5DJQ C;  1FI3 A;  1K3H A;  1YIQ A;  1EB7 A;  3H1K D;  4AAM A;  2ZON G;  3WFB C;  3PTZ A;  4LJI A;  1DVH A;  4XXL A;  1DT1 A;  4PW9 B;  2MHM A;  3O5C A;  4H0J A;  4O1W A;  1PP9 D;  1CTZ A;  3CX5 W;  1I54 A;  1EZV D;  351C A;  2MTA C;  2OZ1 B;  1FI9 A;  3ZOY A;  5CIB B;  2GC7 D;  1IZL 0;  1BCC D;  3RLM A;  3OCD B;  1CED A;  4PD4 D;  3KZI V;  2C8S A;  2Y0E A;  1CRG A;  1I6D A;  1OCD A;  3FWL A;  1K3G A;  1RZ6 A;  4EDF A;  2B12 B;  3H1I D;  4EIC A;  3O1Y A;  2D0S A;  3L73 D;  1NTM D;  1YIC A;  2B4Z A;  2GIW A;  1H1O A;  3CP5 A;  3HQ8 A;  2CE0 A;  1N50 A;  1QN2 A;  1HJ4 A;  3SWS A;  5CIG B;  1IQC A;  3PRJ A;  1S6V B;  1H33 B;  4GED B;  2IBZ D;  3GG2 A;  3TF5 A;  1COT A;  3CX5 D;  3OA8 B;  3MK7 C;  3CYT I;  1SQX D;  3L75 D;  2BLF B;  1I5T A;  3GW6 A;  3H1L D;  3L72 D;  4PJ0 V;  5GTI V;  1ZRT D;  1AOF A;  1BE3 D;  3H1J D;  3OCD A;  3ZOW A;  4PWA A;  1H31 A;  1B7V A;  1L0N D;  1BL9 A;  2V07 A;  4H0K A;  4Q5P A;  2KNC B;  2Y0D A;  3PXW A;  2PCB B;  1GQ1 A;  1LFM A;  3WFC C;  1L9J C;  2DGE A;  5CYT R;  5CID B;  2CE1 A;  3HQ7 A;  1AYG A;  1HJ5 A;  1MG3 D;  3CWB D;  1S5L V;  1CRI A;  1H9Y A;  4KMG A;  3ZBM A;  1HRC A;  3A9F A;  4JCG A;  1YFC A;  3OA8 A;  2LIR A;  4U3F D;  5H2F V;  4FA4 A;  2PCC B;  1FCD C;  2EXV A;  4Y5R A;  1KX7 A;  1MG2 D;  1N15 A;  451C A;  5KAF V;  1H9X A;  3CU4 A;  1GU2 A;  4UB8 V;  1CIE A;  3PLN A;  2HV4 A;  1NMI A;  2N9I A;  1A2S A;  3PH2 B;  1E8E A;  1C2N A;  1DIQ C;  1U74 B;  2K9J B;  2ORL A;  2N9Y B;  1SQV D;  3SJL A;  2FYU D;  2N3Y A;  1NIR A;  4WQ8 A;  2O3J A;  1LC2 A;  1YCC A;  1J3S A;  1FI7 A;  2BCN B;  4P4Q B;  1H31 B;  1C7M A;  1HZU A;  3ZOX A;  4N0K A;  1YNR A;  3HQ9 A;  2B10 B;  3HQ6 A;  1R0Q A;  2C1U A;  4EIF A;  1DII C;  3WC8 A;  2BGV X;  4AAN A;  3A0B V;  4AAO A;  1FHB A;  4L1Q A;  1CRY A;  5CIH B;  2QJP B;  2YIU B;  1N9C A;  1NTZ D;  1DW0 A;  1C75 A;  2BH4 X;  4FAV A;  1GIW A;  1W5C T;  3RN0 A;  1CTJ A;  2L91 A;  5C9M A;  3PXT A;  1HRO A;  1M60 A;  2GC4 D;  3TGU D;  3RN1 A;  1C52 A;  1YEA A;  3SXT A;  4AX3 A;  5CIC B;  1E2R A;  1F1F A;  5EXQ A;  4FA1 A;  1F1C A;  2C9X B;  2B0Z B;  1L9B C;  2N18 B;  5IY5 1;  1FJ0 A;  3WFE C;  1CSU A;  1FOC A;  5KLI B;  2JQR A;  1SQB D;  1CIG A;  2YCC A;  3WU2 V;  5TJH A;  1DW3 A;  4QAO A;  1CO6 A;  1CYC A;  2N3B A;  1CRJ A;  1CXA A;  3TYI A;  5B66 V;  5DJQ B;  5C0Z A;  1KYO W;  4FB1 A;  2L4D A;  1HZV A;  1COR A;  1CSX A;  1KIB A;  3PHL A;  3DP5 A;  1DW1 A;  2JTI B;  2QJY B;  1CYJ A;  4FA9 A;  1OAE A;  4V2K A;  1H32 A;  1NU1 D;  2FRC A;  1NTK D;  1CNO A;  1SQQ D;  2ZXY A;  1HJ3 A;  1QL4 A;  3WFD C;  1CCR A;  1CC5 A;  1WEJ F;  3A0H V;  5AUR A;  3ITK A;  1QKS A;  1N90 A;  1PPJ D;  2I8F A;  1DVV A;  1CSV A;  5CIE B;  1LMS A;  4J20 A;  3O20 A;  4MU8 A;  1ZZH A;  1CTY A;  2CA4 B;  3NBS A;  4RSZ A;  1CRC A;  3TDK A;  2QJK B;  2D0W A;  1I8O A;  2C1D A;  1GDV A;  2N18 C;  3NWV A;  1VYD A;  1U75 B;  4GYD A;  2AI5 A;  4WQ7 A;  1IRW A;  2RN0 A;  1HCM A;  1CHI A;  1YTC A;  2ZZS 1;  1CSW A;  5DFS A;  1KB9 D;  1ETP A;  3BCC D;  3M97 X;  1BGY D;  4EID A;  1A56 A;  3MK7 B;  1HH7 A;  5B6Q A;  3JBT B;  1P84 D;  2BCC D;  1GJQ A;  1KX2 A;  4AAL A;  1CIH A;  1RAQ A;  3ZIY A;  1RZ5 A;  3ZCF A;  4EIE A;  2XTS B;  4A7P A;  1JDL A;  5GTH V;  3DMI A;  1NNO A;  2Y0C A;  1A8C A;  4YE1 A;  3L70 D;  1CIF A;  2PAC A;  2FYN B;  1RAP A;  3L71 D;  4WQ9 A;  1IO3 A;  1AOQ A;  4NFG B;  4L3G A;  1CHJ A;  3VMA A;  5KKZ B;  2N9J A;  2YK3 A;  1I6E A;  2AXT V;  3H1H D;  3SLE A;  4DY9 A;  2GB8 B;  1H32 B;  1DW2 A;  1KV9 A;  4FA5 A;  4UB6 V;  3VRD A;  1QL3 A;  155C A;  3ZOO A;  1C2R A;  3X39 A;  2JWA A;  2B11 B;  2DVH A;  3CXH W; 
#chains in the Genus database with same CATH topology
 4RJT A;  2KUB A;  1SS1 A;  4YTP C;  2XND H;  4BRY B;  1Q90 D;  3TYY A;  3KHU A;  3CCV P;  2K9Y A;  2ZT9 C;  3CWB E;  4XFJ A;  4XYD B;  3GMA A;  1SFC C;  2IFN A;  1NTM J;  1IRV A;  1L0L D;  1CYI A;  5CIF B;  1JM0 A;  3LIE A;  1M6Z A;  3CCQ P;  2WT7 A;  5B5E V;  3DR0 A;  3V4W A;  1KB0 A;  2CA3 B;  3CCS P;  2Q3E A;  1K73 Q;  1JOC A;  2OQQ A;  2R5B A;  1OVU A;  3NBT A;  2ZBO A;  3C2C A;  5KLV D;  2WIT A;  3RL0 B;  3CXH D;  5KAI V;  1NU1 G;  5E79 V;  1SQQ G;  2QM8 A;  1W2L A;  1VQ4 P;  2KSE A;  2C2C A;  1PGP A;  4IL6 V;  1Y47 A;  2HPC A;  1NML A;  2I8D A;  1QLE D;  4WB4 A;  1CXC A;  3LW5 J;  1BGY E;  4JYB A;  1PPJ G;  2CXB A;  1P84 I;  4HYT B;  5KTB A;  3M0D C;  1BDC A;  5CHX A;  1NJI Q;  1SP4 A;  1QYZ A;  2YQB A;  1YIJ P;  2KNC A;  2QG4 A;  5DJQ C;  5KLV J;  1J2J B;  2ZON G;  3WFB C;  2N1T B;  5APS A;  1M57 D;  4XXL A;  1SQV G;  3VP9 A;  5GTH E;  4L75 A;  2SPZ A;  3CX5 W;  1NTZ E;  1EXI A;  1FI9 A;  1KC8 Q;  1AQ5 A;  4M3L A;  4YPC A;  3H32 A;  1HF9 A;  1P84 H;  1CED A;  3MTU E;  2NRG A;  3HD7 B;  2OAR A;  4BWN A;  1OCD A;  2KS1 B;  2J58 A;  1K3G A;  4EDF A;  4O9B A;  3H1I D;  3LID A;  5CCG D;  3O1Y A;  2AEM A;  2GIW A;  4I6M C;  3CP5 A;  3L71 G;  2E75 B;  2Q3I A;  1HH0 A;  1SQB E;  1QN2 A;  2N1T A;  5CIG B;  3KZI H;  2K9J A;  1NKN A;  4GED B;  2IBZ D;  1KIL B;  3GG2 A;  3TF5 A;  1COT A;  3CX5 D;  3OA8 B;  2ITA A;  1SQX D;  1L0L E;  3L75 D;  1FE6 A;  2BLF B;  2HFE D;  3H1I J;  3H1L D;  1AOF A;  1ZRT D;  3B4S A;  1BE3 D;  3H1J D;  2M5A B;  4ASW A;  4PWA A;  1H31 A;  1HGZ A;  1ZOY C;  3D0W A;  2WQY C;  1L0N D;  4GDO A;  2E76 B;  1VQP P;  2E74 C;  1LNQ A;  5AW3 B;  2YMY A;  5KLV E;  4LLH A;  1IFM A;  3SWK A;  5AW9 B;  3U59 A;  1RF1 C;  1VQO P;  1YTZ T;  3HUS B;  2JR8 A;  3TGU J;  1LJ2 A;  1SQX J;  1OW7 A;  1HJ5 A;  1MG3 D;  1GW4 A;  3L75 J;  3V2Q A;  2PRR A;  1ZME C;  1R5S A;  1BE3 J;  1KYO I;  3H1J J;  4IOI H;  3K5B A;  3OA8 A;  3AE9 C;  1E79 H;  2LIR A;  1IZN B;  1URQ C;  1YQ4 C;  1YBK A;  2EXV A;  4Y5R A;  1KX7 A;  1Y8A A;  2R5D A;  4AYC A;  1MG2 D;  3FXD A;  451C A;  1JB0 J;  2GUS A;  2CPB A;  2PGD A;  1BSH A;  2KI7 B;  2YO2 A;  1GDT A;  3CU4 A;  1KV4 A;  3RL0 D;  1R5L A;  2QA4 P;  1VL2 A;  2O1J A;  4XA4 A;  3ZDM A;  3G3Z A;  3HE5 B;  1HUC A;  2ORL A;  2N9Y B;  2FXO A;  3A3Y B;  5CCH A;  1BGY G;  1ZW0 A;  3O6Q B;  3H1I E;  1YCC A;  3H1H E;  3RK2 D;  3CME P;  4KJM A;  3U1C A;  1HZU A;  4N0K A;  3HQ6 A;  1R0Q A;  3C9I A;  5AW1 B;  2C1U A;  2XNX A;  1JCD A;  1DII C;  3R2P A;  3A0B V;  1IFI A;  1OXZ A;  2IBZ E;  3T97 B;  1AQT A;  2BEQ D;  1SQX E;  2GUV A;  1YIT P;  2Y9Z A;  2WPS A;  5APT A;  2OYI C;  2OTL P;  3H1L E;  2FY8 A;  1ZRT E;  2D2C C;  1BE3 E;  1NTM G;  1GIW A;  2L91 A;  1L0N E;  3PXT A;  1HRO A;  1M60 A;  4PJ0 E;  3AE8 C;  1YEA A;  3O6Q A;  3SXT A;  4RO0 A;  5EXQ A;  1RQV A;  2K88 A;  2Z4E A;  2NPS C;  1M1J C;  2W90 A;  3EQ2 A;  2C9X B;  1AA0 A;  1JY2 O;  5IY5 1;  2PAJ A;  3V6I A;  5KLI B;  3CXH I;  2YCC A;  2QVA A;  4H13 D;  2UWJ E;  1DW3 A;  1ZR4 A;  1CYC A;  1CRJ A;  4NPE A;  1HJB A;  1KIL D;  5KAI E;  3CL3 D;  3IR9 A;  1RF1 A;  1KIB A;  3DP5 A;  2JTI B;  1CYJ A;  2J5U A;  5H2F E;  4EYY Q;  4W80 A;  1NU1 D;  1EDJ A;  2FRC A;  1SQQ D;  2E76 D;  3WFD C;  1HVV A;  5KLV G;  1OFC X;  1N7S B;  3ITK A;  3BAT A;  4MN4 C;  1PPJ D;  1DVV A;  4R4L A;  4UB8 E;  4J20 A;  2KSJ A;  2OTJ P;  1EDL A;  2AXC A;  3RGU A;  1SQP K;  2C1D A;  2N18 C;  3V2R A;  2ZAE B;  3D6Z A;  2YXQ B;  4GYD A;  1OZH A;  1JMM A;  4PD4 E;  1SQQ J;  3I56 P;  3PP5 A;  3A0H H;  2XU6 A;  1HCM A;  3E1R A;  3RK3 D;  4AQR D;  1LGH B;  1KMI Z;  5AW8 B;  3BCC D;  1M7L A;  1HWT C;  2QRX A;  2ZVO B;  3NTN A;  1SQP J;  2QSI A;  3JBT B;  1P84 D;  2O01 H;  3SSU A;  1KX2 A;  4IFF A;  1CIH A;  2B88 A;  1FBM A;  4A7P A;  5GTH V;  4YXD C;  1T6A A;  2Y0C A;  1A8C A;  3UIA A;  4Y28 J;  2FYN B;  3AE5 C;  1RAP A;  3L71 D;  5AW0 B;  3BCC J;  4L3G A;  3VMA A;  1S4X A;  5KKZ B;  3OJA B;  2WPV B;  1FJK A;  2N9J A;  2YK3 A;  1FZB A;  2OYI A;  5DJU B;  1BDD A;  1AVY A;  3VRD A;  3X39 A;  2JWA A;  4YXW H;  1UIX A;  2IBZ G;  3TSI A;  2FFD C;  1C6O A;  3TGU G;  4L3H A;  2OYH C;  3L75 G;  3L71 J;  4U7J A;  2VHD A;  2AXT H;  5DF5 A;  2OZ1 A;  1BE3 G;  3H1J G;  2A45 G;  4WQC A;  2JJL A;  4HH2 A;  1JCC A;  1NU1 E;  4NPF X;  1SQQ E;  1YJW P;  3HE4 B;  3L37 A;  1G1J A;  4DJG A;  1L4A D;  1PPJ E;  4PV1 B;  4O1Q A;  2YNY A;  2QJP C;  2YIU C;  2FXM A;  2OYO A;  2B89 A;  3VYM A;  1H33 A;  2KLU A;  1OWA A;  1GL2 B;  2ZOO A;  2Q7C A;  1DEB A;  3A5T A;  2RMZ A;  1SQV E;  2H7H A;  1S72 P;  1LTT C;  5B5E H;  3RK3 E;  3NXS A;  1KB9 I;  2I1K A;  3BCC E;  3RL0 g;  1LP1 B;  3CCR P;  1HTL C;  1WVE C;  4WY4 B;  1KYO D;  1KQS O;  1RE4 C;  3ORV A;  3OW2 O;  3MZW B;  3VNW A;  1QX8 A;  4H44 B;  1N7S D;  5E79 H;  1LTJ C;  1YIQ A;  4AAM A;  4IL6 H;  4LJI A;  3G4S P;  4PW9 B;  1PZQ A;  2MHM A;  3O5C A;  2QJY C;  2WSE H;  3R4Y A;  2M3E A;  4JF7 A;  3L71 E;  1CTZ A;  1DD4 A;  1I54 A;  1CW5 A;  1IZL 0;  3RLM A;  1JY3 P;  2FYU K;  3OCD B;  1FU1 A;  3USS A;  2Y0E A;  1I6D A;  4WY4 A;  4EIC A;  1PGJ A;  1NTM D;  1YIC A;  5CJ4 A;  1BSN A;  4GOF A;  3RBZ A;  3TK1 A;  3RK2 C;  1VF5 D;  1IQC A;  3PRJ A;  3QWO C;  3D6Y A;  4DCK A;  1S6V B;  5AVQ B;  1S1C X;  4OGQ B;  2I1J A;  4I7Z C;  4I1L A;  3MUD C;  4N78 E;  1DD3 A;  2HPC B;  2R3S A;  1EC5 A;  4CPG A;  1RF0 C;  2C0X A;  1I5T A;  3TNU A;  2OYH A;  1AFO A;  4UB6 H;  1JY3 N;  3L35 A;  4PJ0 V;  5KJ7 C;  3OCD A;  3AE3 C;  1ZXG A;  2QIW A;  1X22 A;  1E5W A;  2V07 A;  5APQ A;  3B71 A;  4Q5P A;  2KNC B;  2Y0D A;  3PXW A;  1JUN A;  1L9J C;  1OMI A;  2Q5U A;  3HQ7 A;  4KT0 J;  2WSF H;  5AVR B;  3CC4 P;  5TIS H;  1KFM A;  5EFW B;  1NOH A;  1GD2 E;  1DX7 A;  3Q1M A;  1CRI A;  4KMG A;  1KYO E;  3H32 B;  2W27 A;  1Q7Y Q;  1J1E C;  5BU8 B;  4U3F D;  5H2F V;  4H13 C;  3VYI A;  1FC2 C;  1SQP G;  4C7N A;  1LTA C;  1NTK K;  1FZC B;  1N73 C;  2B9B A;  1RHZ B;  2HR3 A;  2LKM A;  1GU4 A;  4UB8 V;  1CIE A;  1NMI A;  1SLQ A;  3GF3 A;  2N9I A;  3PH2 B;  1DIQ C;  1T2K D;  3G71 P;  2K9J B;  2JP3 A;  3OAK A;  2B87 B;  1JTH A;  1ZV8 A;  1NIR A;  4U3F J;  3BCC G;  3KYQ A;  1RY3 A;  3EFF K;  1LC2 A;  1J3S A;  1IFP A;  3MIW A;  1FI7 A;  2ZT9 B;  4P4Q B;  1NTM E;  1MZ9 A;  1H31 B;  3V5B A;  3D71 A;  3ZOX A;  4IFM A;  1Q2N A;  4H44 D;  1SFC B;  4HJG H;  1H8A A;  1KN7 A;  4GOE A;  3AE7 C;  2L5G B;  1FZC A;  3RK3 C;  2ZJS E;  2JEE A;  1FHB A;  3M9Q A;  2IYO A;  4HKZ H;  1NAF A;  5AVT B;  1C75 A;  4OVN F;  2B87 A;  3S4R A;  1W5C T;  3VTP C;  2GC4 D;  3TGU D;  3FWN A;  3A0B H;  4ZKU A;  5AVZ B;  1EDK A;  3MUD A;  1E2R A;  1F1F A;  1USD A;  2HOD A;  3CCJ P;  2OTK E;  1K05 A;  1YI2 P;  2KB7 P;  3M9H A;  1YYC A;  1USE A;  1SFC A;  5KJ7 A;  2E42 A;  1FJ0 A;  2GA1 A;  3WFE C;  2E5Y A;  4I2L C;  5APX A;  1CIG A;  1VPC A;  3CXH E;  1MV8 A;  4QAO A;  4OGQ D;  2YKQ A;  5DJQ B;  1S5L E;  2J59 M;  2K3R A;  5GTI H;  4U3F E;  1HZV A;  1COR A;  1CSX A;  4N6J A;  3MGN A;  4FA9 A;  3AED C;  1H32 A;  1U7J A;  1CNO A;  1HJ3 A;  2WVR A;  3GHG C;  5KAF E;  1JEK A;  1N90 A;  2KZI A;  3D70 A;  1FAV A;  3G6E P;  1LMS A;  4Y99 C;  4RES B;  1CTY A;  3TDK A;  1G1I A;  3M0D A;  1IK7 A;  4ASV A;  2D0W A;  3N7N A;  2HYN A;  1L4A C;  2ZVN B;  3WUV A;  1S9K D;  1VYD A;  1N86 A;  3SFE C;  1LTB C;  3MD0 A;  1XTC C;  1IRW A;  2RN0 A;  4JQ0 D;  1CHI A;  1YTC A;  2WPR A;  2ZZS 1;  4GOD A;  1KB9 D;  4EID A;  3VN0 A;  2K1A A;  5B6Q A;  1JO5 A;  2KYV A;  2BCC D;  1GMJ A;  2IZ1 A;  1L2P A;  2O1K A;  1RAQ A;  3ZIY A;  3B5N C;  3ZCF A;  2N1T D;  3L74 J;  5K5G B;  5DJT B;  2E74 B;  2XKM A;  2CPS A;  1WT6 A;  3CX5 E;  3TGU E;  3L75 E;  1AOQ A;  1RF1 B;  3F89 A;  1N2D C;  3H1J E;  2ZT9 D;  3A2A A;  3FXE A;  1S5L X;  1GZL A;  1LT9 C;  2BCC J;  1DW2 A;  4FA5 A;  3HD7 D;  5GTH H;  1NAY A;  1QL3 A;  1C2R A;  4WWI A;  2R44 A;  3IN6 A;  3JSV C;  2B11 B;  1URQ B;  1MFZ A;  1BCC J;  3WU2 E;  2E75 D;  1JY2 P;  2IDB A;  3JC2 2;  3RMZ A;  4D6T D;  3L4M A;  2AIU A;  5B66 E;  1C6R A;  2C1D B;  3I55 P;  4B86 A;  1IC2 A;  3SVW A;  2H43 A;  1GKS A;  3AEE C;  2IYP A;  4AUW A;  1VF5 C;  1OVV A;  1CCH A;  1LS9 A;  4FAN A;  2W83 C;  3CCM P;  2WTY A;  2XZR A;  1MZ4 A;  4C46 A;  4D6T J;  2JDI H;  2FKW B;  4H0L B;  2BPB B;  1T3J A;  1S9K E;  1URQ A;  1SQP D;  4K3I A;  1VDF A;  2H89 C;  4U3F G;  1TU3 F;  3VP8 A;  5CCH D;  1RQU A;  1CRH A;  1KB9 E;  3KXD A;  1PIX A;  3JCU E;  1T3U A;  5AVY B;  1L4A A;  3G9R A;  4WQB A;  3HTK A;  1N7L A;  2OYI B;  3V2P A;  2D2C B;  1Z56 A;  1E29 A;  1FI3 A;  1K3H A;  3PTZ A;  2WWW A;  1DVH A;  3N4X A;  3EWK A;  3H25 A;  2NPS B;  4H0J A;  1PP9 D;  1GW3 A;  2V7Q H;  3B8E B;  351C A;  2OZ1 B;  1VQ8 P;  3ZOY A;  3B5N A;  2KIK A;  2GC7 D;  4NPD A;  1IFJ A;  3P8M C;  3CCE P;  2P7J A;  1CRG A;  3FWL A;  5CBN A;  1T2K C;  4K35 A;  4DZO A;  4GT1 A;  2QJK C;  2ZYA A;  2B4Z A;  3L70 G;  1H1O A;  3HQ8 A;  4D6T E;  1PP9 J;  1LTS C;  1LT9 A;  1HJ4 A;  3SWS A;  4JBZ A;  4C7R A;  1H33 B;  1KIL E;  2NPS A;  3HRN A;  1M1J A;  2JO1 A;  1IFN A;  3GLM A;  3MK7 C;  5CCG C;  3CYT I;  4OH8 B;  4ZNC A;  4IL6 X;  2BEZ F;  4WBA A;  3OA7 A;  1NH4 A;  1A02 J;  1B7V A;  1KD1 Q;  1BL9 A;  3CX5 H;  2G3A A;  4OWF A;  3M06 A;  4H0K A;  2Y9Y A;  2W6B A;  1SQP E;  2PCB B;  1GQ1 A;  1LFM A;  3WFC C;  2A45 H;  2N9B A;  5AW2 B;  5CID B;  2CE1 A;  4ZKP A;  1J1D B;  4PJ0 H;  1KQL A;  1AYG A;  1AV1 A;  3CWB D;  1S5L V;  1PFI A;  5AVS B;  3P7K A;  1H9Y A;  1HRC A;  5AVU B;  1ZLL A;  4JCG A;  1LWU C;  2ZXX A;  1Q82 Q;  1JMB A;  4FA4 A;  1YJN P;  1W2E A;  1FCD C;  1CZQ A;  1N15 A;  3CPW O;  1P84 E;  5KAF V;  2W8Z A;  2H8P D;  1ZR2 A;  1CI6 B;  5KAI H;  4H0L D;  1GU2 A;  3L74 G;  1EZV I;  3CWB J;  1HJ0 A;  1E8E A;  5H2F H;  1QL2 A;  1NWQ A;  1OVR A;  2FYU D;  2N3Y A;  1M90 Q;  1IO4 A;  2VRS A;  4L73 A;  1WMK A;  2FFD B;  3TNU B;  2OYH B;  4EIJ A;  3L36 A;  3KZI E;  2BCC G;  4UB8 H;  3Q3D A;  3W68 A;  3Q2Y A;  3IFM A;  3RL0 C;  1YNR A;  3HQ9 A;  3WC8 A;  2BGV X;  4AAN A;  3V4Q A;  1BCC G;  1JY3 O;  5AVW B;  1CI6 A;  2HLO A;  4PD4 H;  2FYU J;  1QEX A;  1CSB A;  5CIH B;  2QJP B;  2YIU B;  1N9C A;  1JNM A;  1NTZ D;  3CMA P;  2POH A;  3VMY A;  1M1K Q;  3AE6 C;  2OGU A;  3CD6 P;  5C9M A;  3NFQ A;  2N1T C;  2KLV A;  1NTZ K;  3II6 A;  3RN1 A;  2FFD A;  5APU A;  1KTM A;  4C7N B;  5CCG A;  2ZXE B;  3VOP A;  2B0Z B;  1L9B C;  1X0T A;  2W6J H;  1OX3 A;  2WSC H;  4D6T G;  1A02 F;  1CSU A;  1VQ7 P;  1SQB D;  3WU2 V;  1NTZ J;  3L72 G;  1G2C B;  1KZU B;  2KK7 A;  3HD7 C;  1LTJ B;  2WZ7 A;  5B66 V;  5APV A;  1YJ9 P;  2E5T A;  2FBW C;  1SQB K;  1JTH B;  2L4D A;  3M0A A;  5CMZ A;  2O01 N;  2QJY B;  3EFG A;  1PV3 A;  1FDI A;  3E7K A;  2E75 C;  2V4H A;  4V2K A;  1NTK D;  3IAO A;  1L0L K;  2W6A A;  1QL4 A;  1QL1 A;  1LWU A;  1SQB J;  1FDO A;  2HG5 D;  4PV1 D;  1CC5 A;  1PL5 A;  1QKS A;  1KIL C;  2KOG A;  1CSV A;  1DEE G;  3O20 A;  4MU8 A;  4BRY A;  4RSZ A;  1D7M A;  3KQG A;  2FYU E;  2Z5H A;  1RE4 A;  2WPQ A;  5KLV K;  2KXP B;  1G2C A;  1L0L J;  1GDV A;  1OW8 A;  1GL2 D;  2WSS H;  1KQG B;  1DIP A;  1LTJ A;  2E76 C;  5CJ0 A;  4EI2 A;  3RK2 B;  1NTK J;  1NHL A;  1OIP A;  2WMM A;  3H6P A;  3KPE A;  1CSW A;  4I7Z B;  1ETP A;  4WVZ A;  2HOD B;  3HUS C;  4WY4 D;  1AJY A;  1A56 A;  3AE4 C;  3F5H A;  1HGV A;  5CCH C;  3KDP B;  1N8R Q;  1PP9 G;  1GJQ A;  4LGD E;  4AAL A;  4W7Y A;  2XV5 A;  1UII A;  4EIE A;  2P1J A;  1JDL A;  2CK3 H;  2XDJ A;  3DMI A;  3BVH A;  3O8Z A;  2O01 J;  4RKU J;  2ZYD A;  3L70 D;  1IO3 A;  2V7Q J;  4GIF A;  4NFG B;  3AEC C;  1VQK P;  1W5C E;  1CHJ A;  2C0W A;  3H1H D;  3SLE A;  4DY9 A;  1DH3 A;  1LT1 A;  1H32 B;  4UB6 V;  1GU5 A;  1U7M A;  3BRV B;  3WUT A;  1VQ5 P;  1X9V A;  1RF0 A;  1J1E B;  1FJP A;  4H13 B;  1LC1 A;  3PXS A;  2FWL A;  2V08 A;  3L70 J;  4WQA A;  3AEB C;  2QE7 H;  1FZA A;  1MFT A;  1YEB A;  1N73 B;  3QH9 A;  4TLF A;  3H1H J;  2KZJ A;  5TIS V;  1NTK E;  1SQX K;  1K04 A;  3HD7 A;  3WUI A;  2KS1 A;  1AKK A;  1M70 A;  2LXC B;  3O0R C;  4WQD A;  1EQ7 A;  1L0N K;  1ZP0 C;  3PH0 A;  1I55 A;  1CHH A;  3CC2 P;  3A0H E;  4DT0 A;  3GF7 A;  3CWB G;  1C6S A;  3L4F A;  5APY A;  2BH5 X;  4WQE A;  3H1L J;  1GK6 A;  1RE3 C;  2LIT A;  2C1V A;  1KIL A;  1L0N J;  1H89 A;  1N73 A;  3RK3 B;  3L74 D;  2NZ2 A;  2M5A A;  2JKV A;  2FYZ A;  1M56 D;  3SWY A;  5KLI C;  2A06 D;  3E1I A;  1W2B O;  3C8V A;  3L4O A;  1I8P A;  2Q1K A;  1EB7 A;  3H1K D;  1S2E A;  1VQM P;  1VQL P;  1T8Z A;  1DT1 A;  3Q5P A;  1FDM A;  1KYO H;  2FYU G;  3HUS A;  3AE1 C;  3L70 E;  4O1W A;  2MKV A;  1FZG A;  2ZFC A;  1M8O B;  1EZV D;  2MTA C;  3C1L A;  5CIB B;  5AVX B;  1QVG O;  1FZF A;  1BCC D;  1N7S C;  4H0L C;  3W67 A;  2WSE J;  1MUU A;  4PD4 D;  3KZI V;  2AXT E;  2C8S A;  4IFD K;  2R32 A;  3H1K J;  1RZ6 A;  2B12 B;  4Z1M H;  5AVV B;  2D0S A;  3L73 D;  2YKP A;  1SFC D;  1H0T B;  5KJ7 D;  3S9O A;  5AW5 B;  1NTZ G;  1ZN5 A;  2CE0 A;  2LXB A;  1N50 A;  2M8R A;  2IPP A;  3GHG B;  3HE5 A;  4EOT A;  1Q86 Q;  4Y99 B;  3GW6 A;  1U57 A;  3IF4 A;  3L72 D;  5GTI V;  3L73 J;  3ZOW A;  3U1A A;  1L4A B;  1KQF B;  2YO3 A;  1QVF O;  4XE5 B;  2DW3 A;  2E43 A;  3HTK B;  5B5E E;  1HBW A;  5M1B A;  4GKG A;  1VQN P;  1SQB G;  1K9M Q;  1YTZ I;  3WMM 0;  2FYN C;  1H0T A;  2DGE A;  5CYT R;  2WSC J;  1VQ9 P;  1FZE A;  3M91 A;  3T97 A;  5KKZ C;  2AEF A;  1L0L G;  3MP7 B;  5E79 E;  3LW5 H;  3L74 E;  4IL6 E;  3GHG A;  4KHX A;  3L72 J;  1JY2 N;  3P8C D;  3B5N B;  1EXJ A;  1NTK G;  3ZBM A;  3A9F A;  1YFC A;  2A06 E;  2PP6 A;  2WSF J;  1RE3 A;  1OW6 A;  2PCC B;  3H1K E;  1Y9B A;  2M0B A;  3CXH H;  1NU1 K;  1R8E A;  1SQQ K;  3NMD A;  2BCC E;  1H9X A;  1S5L H;  3CCU P;  3P32 A;  3SFD C;  3PLN A;  1EZV E;  1LT9 B;  2HV4 A;  1NO4 A;  1YHQ P;  2P10 A;  2YMK A;  1A2S A;  1FOS E;  1VQ6 P;  1C2N A;  1U74 B;  1BCC E;  1PGQ A;  1NU1 J;  1MKM A;  1M1J B;  1SQV D;  3SJL A;  2GM4 A;  4PV1 C;  4WQ8 A;  1S3J A;  2O3J A;  3MHV A;  5KAF H;  4L74 A;  2YKO A;  5BVZ A;  2BCN B;  1J1D C;  1SQV K;  2H88 C;  3AEG C;  3L73 E;  5BU5 A;  1C7M A;  3Q5R A;  4N3Y B;  2B10 B;  1GL2 C;  1N7S A;  1Q81 Q;  4EIF A;  4UB6 E;  1VF5 B;  1K8A Q;  3V2N A;  2IZ0 A;  2IBZ I;  1H88 A;  4AAO A;  1SQV J;  2P58 A;  3CX5 I;  4L1Q A;  1CRY A;  3WUU A;  4WY4 C;  2P2U A;  4K3A A;  2JWD A;  3H1I G;  3H1H G;  2E74 D;  2A45 I;  3L72 E;  1DW0 A;  2BH4 X;  4FAV A;  4DOJ A;  1LTG C;  3FX0 A;  4H44 C;  3RN0 A;  1CTJ A;  1FOS F;  1RH5 B;  2QM7 A;  1C52 A;  3VMX A;  4AX3 A;  2K37 A;  5CIC B;  1FS0 E;  1XTG B;  5TIS E;  4FA1 A;  1GTW A;  2C9L Y;  1X79 B;  1F1C A;  2N18 B;  2RKL A;  1SQX G;  1FOC A;  3S1K A;  2JQR A;  1URQ D;  3H1L G;  5TJH A;  1QGK B;  2AEJ A;  3P8C E;  1CO6 A;  4R4M A;  2N3B A;  1CXA A;  1L0N G;  3TYI A;  5C0Z A;  1KYO W;  2BAS A;  4FB1 A;  2Q9I A;  2ZYG A;  3A7O A;  5AW6 B;  2MJZ A;  4N78 D;  4JPZ B;  3AEA C;  1PGO A;  4BXL A;  3PHL A;  1IJD B;  4LC1 A;  3AE2 C;  1DW1 A;  1WRG A;  1OAE A;  3PJS K;  2Q6Q A;  3AEF C;  2ZXY A;  3WU2 H;  1CCR A;  1AVO A;  4OGQ C;  5C39 A;  5B66 H;  2C9N Y;  1WEJ F;  3A0H V;  5AUR A;  1GK4 A;  3CCL P;  4L76 A;  2I8F A;  5CIE B;  3M9B A;  4TT3 H;  1ZZH A;  2CA4 B;  3NBS A;  1NKZ B;  2M3B A;  1CRC A;  1PP9 E;  1EDI A;  1NYH A;  3RBX A;  2QJK B;  1I8O A;  2PFX A;  1IK9 A;  3BAS A;  5CBO A;  5L8R J;  2KP8 A;  3BRT B;  1KOR A;  4ZMD A;  3NWV A;  3B5N D;  1U75 B;  2QEX P;  1KFN A;  2A06 G;  4PD4 I;  2AI5 A;  3FGA D;  4WQ7 A;  3HE4 A;  3CI9 A;  5APW A;  3H1K G;  2IX7 C;  5DFS A;  3M97 X;  1BGY D;  2R3C A;  3ABV C;  3MK7 B;  1HH7 A;  2D2C D;  2YXR B;  1YQ3 C;  2P67 A;  3A0B E;  1EZV G;  1RZ5 A;  2XTS B;  2Z5I A;  1KB9 H;  1NGM B;  1NNO A;  5AW7 B;  3JCU H;  1GL2 A;  2RH0 A;  1LTI C;  1X8Y A;  4W7Z A;  2NPS D;  3Q5S A;  1SVF A;  4QMA A;  4YE1 A;  1IFD A;  1CIF A;  2PAC A;  2IFM A;  4WQ9 A;  3VMZ A;  1FZC C;  1BGY J;  1LP1 A;  3L73 G;  2WT7 B;  1I6E A;  2AXT V;  3I5C A;  2GB8 B;  3CLQ A;  3CC7 P;  4JYC A;  1KV9 A;  5GTI E;  1NVO A;  2LR2 A;  4HB1 A;  155C A;  3ZOO A;  2G8Y A;  2FXP A;  1LWU B;  3SWF A;  1NTM K;  2DVH A;  5AW4 B;  3CXH W; 
#chains in the Genus database with same CATH homology
 1LC1 A;  3PXS A;  4RJT A;  2FWL A;  2V08 A;  1C6O A;  4L3H A;  3RMZ A;  3KHU A;  4D6T D;  4WQA A;  2VHD A;  3L4M A;  2AIU A;  5DF5 A;  4XYD B;  1C6R A;  1YEB A;  2C1D B;  2OZ1 A;  3SVW A;  4WQC A;  1GKS A;  5TIS V;  1IRV A;  3WUI A;  1L0L D;  1CYI A;  5CIF B;  2KS1 A;  1AKK A;  1M6Z A;  1CCH A;  1LS9 A;  4FAN A;  1M70 A;  5B5E V;  3O0R C;  3DR0 A;  4WQD A;  4O1Q A;  1KB0 A;  2CA3 B;  1I55 A;  1CHH A;  2Q3E A;  1MZ4 A;  1C6S A;  2BPB B;  3NBT A;  2ZBO A;  2BH5 X;  3C2C A;  3VYM A;  5KLV D;  1SQP D;  4WQE A;  3CXH D;  4K3I A;  1H33 A;  5KAI V;  5E79 V;  2LIT A;  2ZOO A;  2C1V A;  2RMZ A;  1W2L A;  2C2C A;  4IL6 V;  1NML A;  1CXC A;  1CRH A;  3L74 D;  1WVE C;  2CXB A;  1KYO D;  4WQB A;  3ORV A;  2A06 D;  3VNW A;  1E29 A;  1QYZ A;  2YQB A;  3L4O A;  1I8P A;  2QG4 A;  5DJQ C;  1FI3 A;  1K3H A;  1YIQ A;  1EB7 A;  3H1K D;  4AAM A;  2ZON G;  3WFB C;  3PTZ A;  4LJI A;  1DVH A;  4XXL A;  1DT1 A;  4PW9 B;  2MHM A;  3O5C A;  4H0J A;  4O1W A;  1PP9 D;  1CTZ A;  3CX5 W;  1I54 A;  1EZV D;  351C A;  2MTA C;  2OZ1 B;  1FI9 A;  3ZOY A;  5CIB B;  2GC7 D;  1IZL 0;  1BCC D;  3RLM A;  3OCD B;  1CED A;  4PD4 D;  3KZI V;  2C8S A;  2Y0E A;  1CRG A;  1I6D A;  1OCD A;  3FWL A;  1K3G A;  1RZ6 A;  4EDF A;  2B12 B;  3H1I D;  4EIC A;  3O1Y A;  2D0S A;  3L73 D;  1NTM D;  1YIC A;  2B4Z A;  2GIW A;  1H1O A;  3CP5 A;  3HQ8 A;  2CE0 A;  1N50 A;  1QN2 A;  1HJ4 A;  3SWS A;  5CIG B;  1IQC A;  3PRJ A;  1S6V B;  1H33 B;  4GED B;  2IBZ D;  3GG2 A;  3TF5 A;  1COT A;  3CX5 D;  3OA8 B;  3MK7 C;  3CYT I;  1SQX D;  3L75 D;  2BLF B;  1I5T A;  3GW6 A;  3H1L D;  3L72 D;  4PJ0 V;  5GTI V;  1ZRT D;  1AOF A;  1BE3 D;  3H1J D;  3OCD A;  3ZOW A;  4PWA A;  1H31 A;  1B7V A;  1L0N D;  1BL9 A;  2V07 A;  4H0K A;  4Q5P A;  2KNC B;  2Y0D A;  3PXW A;  2PCB B;  1GQ1 A;  1LFM A;  3WFC C;  1L9J C;  2DGE A;  5CYT R;  5CID B;  2CE1 A;  3HQ7 A;  1AYG A;  1HJ5 A;  1MG3 D;  3CWB D;  1S5L V;  1CRI A;  1H9Y A;  4KMG A;  3ZBM A;  1HRC A;  3A9F A;  4JCG A;  1YFC A;  3OA8 A;  2LIR A;  4U3F D;  5H2F V;  4FA4 A;  2PCC B;  1FCD C;  2EXV A;  4Y5R A;  1KX7 A;  1MG2 D;  1N15 A;  451C A;  5KAF V;  1H9X A;  3CU4 A;  1GU2 A;  4UB8 V;  1CIE A;  3PLN A;  2HV4 A;  1NMI A;  2N9I A;  1A2S A;  3PH2 B;  1E8E A;  1C2N A;  1DIQ C;  1U74 B;  2K9J B;  2ORL A;  2N9Y B;  1SQV D;  3SJL A;  2FYU D;  2N3Y A;  1NIR A;  4WQ8 A;  2O3J A;  1LC2 A;  1YCC A;  1J3S A;  1FI7 A;  2BCN B;  4P4Q B;  1H31 B;  1C7M A;  1HZU A;  3ZOX A;  4N0K A;  1YNR A;  3HQ9 A;  2B10 B;  3HQ6 A;  1R0Q A;  2C1U A;  4EIF A;  1DII C;  3WC8 A;  2BGV X;  4AAN A;  3A0B V;  4AAO A;  1FHB A;  4L1Q A;  1CRY A;  5CIH B;  2QJP B;  2YIU B;  1N9C A;  1NTZ D;  1DW0 A;  1C75 A;  2BH4 X;  4FAV A;  1GIW A;  1W5C T;  3RN0 A;  1CTJ A;  2L91 A;  5C9M A;  3PXT A;  1HRO A;  1M60 A;  2GC4 D;  3TGU D;  3RN1 A;  1C52 A;  1YEA A;  3SXT A;  4AX3 A;  5CIC B;  1E2R A;  1F1F A;  5EXQ A;  4FA1 A;  1F1C A;  2C9X B;  2B0Z B;  1L9B C;  2N18 B;  5IY5 1;  1FJ0 A;  3WFE C;  1CSU A;  1FOC A;  5KLI B;  2JQR A;  1SQB D;  1CIG A;  2YCC A;  3WU2 V;  5TJH A;  1DW3 A;  4QAO A;  1CO6 A;  1CYC A;  2N3B A;  1CRJ A;  1CXA A;  3TYI A;  5B66 V;  5DJQ B;  5C0Z A;  1KYO W;  4FB1 A;  2L4D A;  1HZV A;  1COR A;  1CSX A;  1KIB A;  3PHL A;  3DP5 A;  1DW1 A;  2JTI B;  2QJY B;  1CYJ A;  4FA9 A;  1OAE A;  4V2K A;  1H32 A;  1NU1 D;  2FRC A;  1NTK D;  1CNO A;  1SQQ D;  2ZXY A;  1HJ3 A;  1QL4 A;  3WFD C;  1CCR A;  1CC5 A;  1WEJ F;  3A0H V;  5AUR A;  3ITK A;  1QKS A;  1N90 A;  1PPJ D;  2I8F A;  1DVV A;  1CSV A;  5CIE B;  1LMS A;  4J20 A;  3O20 A;  4MU8 A;  1ZZH A;  1CTY A;  2CA4 B;  3NBS A;  4RSZ A;  1CRC A;  3TDK A;  2QJK B;  2D0W A;  1I8O A;  2C1D A;  1GDV A;  2N18 C;  3NWV A;  1VYD A;  1U75 B;  4GYD A;  2AI5 A;  4WQ7 A;  1IRW A;  2RN0 A;  1HCM A;  1CHI A;  1YTC A;  2ZZS 1;  1CSW A;  5DFS A;  1KB9 D;  1ETP A;  3BCC D;  3M97 X;  1BGY D;  4EID A;  1A56 A;  3MK7 B;  1HH7 A;  5B6Q A;  3JBT B;  1P84 D;  2BCC D;  1GJQ A;  1KX2 A;  4AAL A;  1CIH A;  1RAQ A;  3ZIY A;  1RZ5 A;  3ZCF A;  4EIE A;  2XTS B;  4A7P A;  1JDL A;  5GTH V;  3DMI A;  1NNO A;  2Y0C A;  1A8C A;  4YE1 A;  3L70 D;  1CIF A;  2PAC A;  2FYN B;  1RAP A;  3L71 D;  4WQ9 A;  1IO3 A;  1AOQ A;  4NFG B;  4L3G A;  1CHJ A;  3VMA A;  5KKZ B;  2N9J A;  2YK3 A;  1I6E A;  2AXT V;  3H1H D;  3SLE A;  4DY9 A;  2GB8 B;  1H32 B;  1DW2 A;  1KV9 A;  4FA5 A;  4UB6 V;  3VRD A;  1QL3 A;  155C A;  3ZOO A;  1C2R A;  3X39 A;  2JWA A;  2B11 B;  2DVH A;  3CXH W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...