1NTZD

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 54
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntzD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntzD01
1CC5A 1NMIA 4P4QB 5CIDB 4D6TD 5CIHB 1EZVD 5KKZB 155CA 1KB0A 3CU4A 5CIEB 1CYCA 3OA8B 2N9YB 3GG2A 1HH7A 2VHDA 2ZXYA 1ETPA 1QKSA 3HQ9A 4PW9B 1HROA 2KNCB 3ZOXA 4AX3A 2Y0CA 1CEDA 1L0ND 1CTJA 2GIWA 4IL6V 1GU2A 2DGEA 4KMGA 1LFMA 1N9CA 1W2LA 5TISV 5H2FV 1C75A 3TYIA 4RJTA 1CRYA 3L73D 5IY51 3VNWA 1PP9D 3L4OA 1GKSA 1A2SA 2BGVX 4N0KA 3VYMA 2ZONG 3MK7C 1DW3A 2JQRA 4FB1A 2I8FA 2Y0EA 4H0KA 3ZOWA 1CO6A 1DVHA 2QJYB 3WU2V 1L9JC 1I8OA 4WQEA 1NTZD 1RAQA 4UB8V 2QJPB 3NWVA 4NFGB 1KV9A 4GEDB 1CRJA 2O3JA 2CA3B 2D0SA 4FAVA 3HQ6A 1FOCA 1ZRTD 1H33B 3PXSA 4PJ0V 3ZCFA 2FYUD 4AANA 1KIBA 5KAFV 1W5CT 3PRJA 2K9JB 5DFSA 1I5TA 1A56A 3H1HD 2B12B 1AKKA 3OCDB 3SJLA 3WFBC 2BCNB 1CYIA 1EB7A 2N3BA 4Q5PA 3NBTA 1CCRA 1F1FA 2N9JA 3MK7B 3CX5D 2D0WA 1M70A 4AAOA 4YE1A 1NIRA 2C1VA 4QAOA 1YIQA 2KS1A 1C2NA 1RZ5A 1LS9A 4WQ7A 3WC8A 2CE0A 1BL9A 1PPJD 1AOFA 1I55A 2N18B 3WFCC 1JDLA 1CIFA 1P84D 2ZOOA 1C6SA 3PHLA 451CA 1CSUA 2CA4B 1N15A 1AOQA 3TDKA 3CP5A 4XXLA 1SQXD 2RMZA 1I54A 1KX2A 3NBSA 1AYGA 1NNOA 5CIGB 1GIWA 1IQCA 4FA5A 1C2RA 3A9FA 1HJ4A 2MTAC 2YK3A 1LC2A 1U75B 1CRGA 3KZIV 1CIGA 3RLMA 3L74D 2V08A 1FI9A 4K3IA 1YNRA 1IZL0 4LJIA 1CRCA 2BPBB 1KX7A 1CRIA 1HRCA 5AURA 2L91A 1CHIA 1N50A 3CXHD 1E2RA 1H31B 4FA9A 1E29A 3L72D 2FYNB 2LITA 1CCHA 4GYDA 4WQ8A 2N18C 3WFDC 3DMIA 3RMZA 4EIDA 1CTYA 1CIEA 1SQBD 2C1DB 3ZOYA 1GDVA 3ZIYA 2YCCA 3PH2B 3ITKA 1N90A 1HZUA 5TJHA 4FA1A 2JTIB 1NTKD 1MZ4A 4PWAA 3CXHW 1HCMA 1GJQA 2OZ1B 2QJKB 5KLVD 1KB9D 2B4ZA 5C9MA 2ZZS1 4EDFA 2A06D 1CSXA 3VRDA 1K3HA 1QL4A 2AI5A 4UB6V 3GW6A 4Y5RA 1H33A 4WQCA 3WUIA 1COTA 1YEAA 1DT1A 3KHUA 1CIHA 5GTHV 5CICB 3DP5A 4U3FD 1H9XA 3H1LD 3A0HV 1M60A 2CXBA 1FHBA 1QN2A 2FRCA 1K3GA 3BCCD 3O0RC 5B6QA 3SWSA 4WQAA 3PTZA 1HJ5A 1C6RA 4DY9A 1BGYD 4EIEA 1DW1A 1S6VB 1YICA 2PACA 1IRVA 1YCCA 1DVVA 5DJQB 3H1KD 3ORVA 3TGUD 3H1JD 2PCBB 5KLIB 4V2KA 1C6OA 3OA8A 3ZBMA 2BH4X 1GQ1A 2Y0DA 4FA4A 1NMLA 3CYTI 4O1QA 4FANA 2V07A 1HZVA 1KYOW 1CSWA 1FI7A 2C1DA 2GC7D 2C1UA 3M97X 1B7VA 1DW2A 1OCDA 1I8PA 3TF5A 351CA 1IRWA 4L3HA 1WVEC 1CYJA 1BE3D 2BH5X 2DVHA 1CHJA 3O1YA 1C52A 2PCCB 4MU8A 1L0LD 4WQDA 1DIQC 2GB8B 1HJ3A 1H31A 1QL3A 5B66V 1YEBA 1CHHA 1BCCD 1CTZA 1S5LV 1LC1A 1MG2D 1FJ0A 1NU1D 2ORLA 4RSZA 3WFEC 5B5EV 2C2CA 3VMAA 1SQQD 4XYDB 3HQ7A 3H1ID 1F1CA 1CRHA 1LMSA 2XTSB 4WQ9A 2YQBA 3PXWA 4L3GA 1CORA 1OAEA 1I6EA 2RN0A 4A7PA 1L9BC 3C2CA 1QYZA 1CSVA 2OZ1A 2BLFB 1DIIC 1H32B 2L4DA 3JBTB 2N9IA 2IBZD 4AAMA 2Q3EA 2LIRA 3L75D 2N3YA 3SXTA 3X39A 2HV4A 1RAPA 4H0JA 2YIUB 3HQ8A 3PLNA 4AALA 3CX5W 1DW0A 1R0QA 2C9XB 4J20A 2AIUA 3O5CA 1KYOD 1NTMD 2FWLA 1SQPD 3OCDA 2CE1A 1H32A 1E8EA 1IO3A 1H1OA 1MG3D 3SLEA 2C8SA 3SVWA 2JWAA 1CXCA 4O1WA 4WQBA 1J3SA 3PXTA 1ZZHA 3A0BV 1C7MA 1A8CA 3CWBD 3O20A 1VYDA 1YFCA 2ZBOA 1FI3A 3L71D 5DF5A 2GC4D 2B10B 3FWLA 5CIFB 1WEJF 2AXTV 5CIBB 1SQVD 5C0ZA 2EXVA 3RN0A 1I6DA 1FCDC 4EICA 1CXAA 1YTCA 5KAIV 2QG4A 1U74B 4L1QA 3DR0A 5DJQC 5E79V 5EXQA 4EIFA 1M6ZA 4JCGA 3L70D 5CYTR 2MHMA 3ZOOA 1RZ6A 5GTIV 2B0ZB 4PD4D 2BCCD 1CNOA 3RN1A 1H9YA 2B11B 3L4MA
chains in the Genus database with same CATH superfamily
1VF5B 2OYOA 2WPRA 155CA 1KB0A 1FDOA 3G3ZA 2C9NY 3GG2A 1HH7A 1ETPA 3GHGA 3G71P 2WT7B 3ABVC 2Z5IA 2FXPA 3NTNA 2GIWA 4PJ0H 3H1IJ 3BCCG 4IFFA 1VQLP 3AEDC 3SFEC 3A5TA 2ZT9B 4RJTA 4XA4A 1RF0C 2XV5A 3USSA 3CCQP 5GTIH 3SWFA 4H0LC 3VMZA 2K37A 4WVZA 1SQVE 1VDFA 3VYIA 1NTME 3VYMA 2A06G 2ZONG 3AEFC 4OGQC 3R4YA 4FB1A 4U7JA 3VOPA 1CO6A 4YXDC 1DVHA 2JKVA 4IL6E 3RBXA 2QVAA 3B8EB 1SQBE 1SQPJ 1KV9A 1KB9I 1Z56A 2K3RA 4GEDB 1RH5B 1KC8Q 1NTZG 2O3JA 2D0SA 3F5HA 2Q7CA 1M57D 1H33B 1SQPE 4PJ0V 5CMZA 1H8AA 1CW5A 5DFSA 1LT9A 1VL2A 3H1HD 2B12B 4PJ0E 3SJLA 5CCGD 5CJ4A 3JSVC 2N3BA 4ZNCA 2FXMA 2WSCJ 2ZXXA 1NIRA 2KS1A 1LP1B 2GM4A 3WC8A 1LS9A 2BEZF 3AE7C 1GL2A 1PPJD 1AOFA 3CL3D 1VQ4P 2N18B 4JQ0D 1YQ3C 1JOCA 1JDLA 1OVRA 3E1RA 4I2LC 1VQPP 2CA4B 5BU5A 1KD1Q 3EFFK 3CCLP 3CP5A 1H89A 1I54A 1SQQK 1WT6A 1IZNB 3NBSA 1EQ7A 1NNOA 1L0LE 1IQCA 1HJ4A 1GL2B 1XTGB 1BCCE 5APXA 5AW1B 1GU4A 5APUA 1HF9A 1FI9A 3A0BH 1IZL0 5K5GB 2YXQB 4GOFA 4PV1B 1KX7A 1RQUA 5CBNA 4YXWH 4FA9A 1H31B 1E29A 3KZIH 4ZKPA 3OJAB 1J1DB 4DZOA 3WUTA 2YO3A 1ZV8A 2IZ1A 3WUUA 3L75G 1CCHA 4BRYB 1NTKG 4WQ8A 2N18C 3MTUE 3DMIA 1U57A 1IC2A 2C9LY 3ZIYA 1SQQJ 3PH2B 2N1TB 3ITKA 1AA0A 1Y9BA 1VPCA 3CX5E 3CXHW 1WMKA 1FZBA 1PGPA 1M8OB 2B4ZA 5C9MA 1OWAA 1EC5A 1K3HA 2O1KA 4UB6V 2FYNC 4WQCA 3WUIA 1COTA 1YEAA 3CX5I 3L73G 1DT1A 5CICB 2IPPA 3H1JG 3PJSK 3H1LD 3L72G 1M60A 1PZQA 3CC2P 2QJPC 4OGQB 1K3GA 2KIKA 3O0RC 5B6QA 3SWSA 5B5EH 2FBWC 2FFDC 2E75C 5H2FE 2LR2A 2XU6A 2PACA 1KILD 3JC22 1T3UA 3L71J 3RK2D 1DVVA 5DJQB 4LGDE 3H1KD 3QWOC 3TGUD 1L0NK 1IK9A 1FJKA 5KLIB 3AE6C 3ZBMA 2Q3IA 3VMYA 3VN0A 4Z1MH 2M5AA 2Q6QA 3HRNA 1NMLA 3CYTI 3QH9A 2FYUG 1FE6A 2W90A 1HZVA 1KYOW 2KOGA 5AW9B 1HTLC 1FZAA 4ASWA 3U1AA 4EIJA 3L74E 2P67A 1OCDA 3TF5A 351CA 1IRWA 1NOHA 2IBZG 3CC4P 1PL5A 1WVEC 2E5YA 2R32A 1Y8AA 2Q1KA 2POHA 1MKMA 4D6TJ 1L0LD 4WQDA 1HJ3A 5KLIC 4WY4C 5AW6B 1YEBA 1ZW0A 1BCCD 1GK6A 2W6BA 1OZHA 1SVFA 1YBKA 3L71E 2A45I 1P84E 4R4LA 1JB0J 2QJYC 3H1ID 4L76A 3A0HH 3B5ND 1YJ9P 5KLVE 2XTSB 2YQBA 1CORA 4IFDK 4A7PA 1G1JA 1FDMA 1CSVA 3R2PA 1AVYA 1ZXGA 2O01H 1H32B 2C0WA 3JBTB 3MIWA 4TLFA 2Q3EA 1DD4A 3BATA 2LIRA 1J2JB 2YMYA 3CWBJ 2YKQA 2N3YA 1E5WA 2E5TA 3K5BA 1LP1A 2Y9ZA 1NTZE 2KYVA 3TGUG 2UWJE 3V2RA 1DW0A 1PP9G 1IFPA 3L70E 4R4MA 1SFCD 1NTZJ 2ZYGA 2AIUA 3O5CA 1NTMD 1BE3E 2H43A 4Y99C 1AFOA 3P8CE 3L70J 2IFNA 1E8EA 1LT9B 3SLEA 5AW3B 2I1JA 2JWAA 1N7SA 2ZXEB 3V2PA 1J3SA 3L37A 3H1JJ 2G3AA 1KQFB 3F89A 2O01N 1RF1C 1YFCA 3LW5H 2ZBOA 1FI3A 1RE4C 2WZ7A 5DF5A 1QL2A 2NPSC 2H8PD 4H13C 2AXTV 5AVSB 1SQVD 2EXVA 4NPFX 3KQGA 1BDDA 4ZKUA 4Y99B 3DR0A 3TGUE 1YHQP 4EIFA 4GDOA 2OTKE 1L4AD 1SQVK 3H1IG 3B5NC 1RHZB 2JP3A 1NTKJ 1FZFA 1L0LJ 4N6JA 5GTIV 2WSSH 4PD4D 1N73B 1T3JA 1H9YA 2K88A 1OFCX 5AVUB 1AVOA 3Q5SA 2LXBA 5DJTB 4D6TD 5CIDB 5CIHB 3MZWB 3RK2B 5APTA 5KJ7D 3P8MC 2OTLP 5CIEB 3OA8B 2N9YB 1ZR2A 3HD7B 2ZXYA 1QKSA 3V6IA 1VQ6P 3HE5B 1LT1A 1HROA 1KFMA 1H0TA 4AX3A 3GHGB 2WPQA 1L0ND 1CTJA 2M8RA 4IL6V 2JDIH 1GU2A 1KYOI 3L75E 1AJYA 5TISV 1RY3A 1PGJA 2QRXA 3L70G 3CPWO 5H2FV 1FJPA 3H1KE 3L73D 1GDTA 2XNXA 5APQA 2QM8A 3L4OA 1SQVG 2B88A 2FKWB 3RL0C 1JCCA 2FYZA 5E79H 2IX7C 1KB9E 2JQRA 1SQBK 4H0KA 3ZOWA 1VF5D 1NTKK 3WU2V 3WMM0 3CXHH 2ZFCA 1L9JC 2R3CA 1EDJA 4WQEA 1NTZD 1PPJE 3G6EP 3Q5PA 1K73Q 1OIPA 1RAQA 3NWVA 3H1JE 5AW7B 3Q1MA 1TU3F 3HQ6A 1OVVA 1IFDA 1EZVE 2KSEA 5AW4B 2OYHC 1ZRTD 2PRRA 5CCHA 3PXSA 2PGDA 3ZCFA 2FYUD 4AANA 2K9YA 5KAFV 1GD2E 3IFMA 2QE7H 3W68A 1X22A 1SQPG 1A56A 3OCDB 4HJGH 2LKMA 2BCNB 1CYIA 1JY3O 1CI6A 2QA4P 4Q5PA 5KLVG 2N1TA 1F1FA 3KDPB 3CMEP 2OTJP 1FOSE 1M70A 4YE1A 1M1KQ 2C1VA 2KZIA 3HTKA 1BL9A 2W6AA 3LW5J 1HJBA 3BRVB 1CIFA 1A02J 1R5SA 451CA 1GMJA 2YNYA 2CPSA 3D70A 3TDKA 2W6JH 1Y47A 1SQXD 2RMZA 1KX2A 4JBZA 3A9FA 3RK3D 2MTAC 4EYYQ 1AV1A 2KS1B 3P8CD 2KLVA 2YKOA 1W5CE 1CRGA 1SQXK 3SSUA 3V4WA 2H88C 1M1JA 3L74D 2V08A 4TT3H 1L0NJ 2P7JA 1CRCA 3D71A 2QJKC 1S5LX 2R3SA 1HRCA 5AURA 2L91A 3C8VA 1CHIA 1YJWP 1N50A 1JM0A 1E79H 1HWTC 1QVFO 2BCCE 3M91A 5L8RJ 1JMMA 3LIDA 1VF5C 1URQC 4WY4A 2P1JA 4PD4I 2WSEH 2ZT9C 3ZOYA 5CCGC 2YCCA 5TJHA 5GTHE 3L4FA 3N4XA 4PWAA 3H1IE 2AXTE 4PD4E 5KLVD 5KJ7A 4JYBA 1KB9D 2M3EA 4EDFA 2OYIC 2XZRA 3TGUJ 2A06D 5TISH 1LJ2A 4Y5RA 1H33A 3O6QB 1NAYA 4IFMA 4H0LB 1CIHA 3CWBG 2O1JA 4U3FD 1H9XA 1MV8A 1XTCC 5CCHC 1ZLLA 4N78E 1NU1G 3PTZA 1HJ5A 2B9BA 5DJUB 2D2CD 1G1IA 1L0NE 1HGVA 1YTZI 4I7ZB 2E43A 4EIEA 2E74C 1FZEA 1SFCC 2KUBA 1DD3A 1Q7YQ 2OYIB 1UIXA 3H6PA 2KXPB 1ZN5A 2KNCA 2WT7A 1YTZT 2PCBB 1HGZA 4H44C 4HYTB 4HKZH 3OA8A 3WU2H 4FA4A 4FANA 1KV4A 3Q2YA 4WB4A 3B5NA 2GC7D 3M97X 1B7VA 2AXTH 1DW2A 2J58A 1GK4A 1YI2P 3L74J 1CYJA 1BE3D 3NMDA 2DVHA 3U1CA 3CCVP 1X8YA 1JMBA 1H31A 4H44B 4JF7A 2ZYDA 1QL3A 2GUVA 4AQRD 4LC1A 4IOIH 1YIJP 2ZVNB 1CTZA 1LTTC 5AVYB 3S1KA 3NXSA 1LC1A 1MG2D 1NU1D 2WPSA 2C2CA 3MD0A 2KZJA 1SQQD 4XYDB 1JY3N 3HQ7A 1NYHA 3CLQA 1N7SC 3L74G 3H1HJ 1Q81Q 4MN4C 1N2DC 4WQ9A 2ZVOB 1ZMEC 5CHXA 5AVRB 2RN0A 3A2AA 1QYZA 3B71A 1IFJA 1P84I 1DIIC 1S5LE 1H88A 2W27A 4AAMA 3L75D 5B66E 3AE1C 3A0BE 3SXTA 3HQ8A 2HYNA 1VQMP 4AALA 1NKZB 1URQB 1BCCG 4J20A 3TNUB 3VP9A 1M90Q 3FWNA 1BE3G 3Q5RA 1IO3A 1H1OA 3SVWA 3BCCJ 2YMKA 4WQBA 2FY8A 2WTYA 1ZZHA 1A8CA 4RKUJ 5CCGA 2M3BA 2R5BA 3BRTB 1BSNA 1HUCA 2QIWA 3N7NA 5KTBA 3II6A 2B10B 2WSEJ 1LWUC 1YQ4C 3RN0A 1I6DA 1FCDC 4EICA 1FU1A 2WMMA 1L0LK 2QG4A 1JNMA 2Y9YA 4UB6E 3CCMP 5DJQC 3AE2C 1SQBJ 5CYTR 1RE3C 1VQOP 3AEAC 2A45H 2W83C 1L4AB 1QX8A 3M06A 1JY2N 1KMIZ 3HUSB 1NHLA 4EOTA 2I1KA 1CC5A 1NMIA 2JEEA 3A7OA 1EZVD 5BU8B 2ZYAA 3U59A 1KZUB 2V7QJ 4N78D 1BGYG 1D7MA 1RE3A 1VQ5P 2Y0CA 1SQXE 1PGOA 2KK7A 3KYQA 4YPCA 1ZRTE 4KMGA 1N9CA 1W2LA 2DW3A 1IFIA 1CSBA 3IR9A 1C75A 3TYIA 2N1TC 1SQQE 1CRYA 5IY51 1GL2D 3VNWA 1GKSA 5CCHD 1A2SA 2BGVX 4WY4D 3MK7C 1DW3A 1RQVA 5CJ0A 2I8FA 4K35A 2P2UA 2OYHA 2VRSA 2E74D 4GT1A 2QJYB 5KLVJ 3E1IA 4ZMDA 1U7JA 1I8OA 1FDIA 2K1AA 4UB8E 5AW0B 1OW8A 2QJPB 2RH0A 1IK7A 4NFGB 1M56D 1KB9H 2CA3B 4FAVA 1FOCA 1NKNA 1PP9J 2FXOA 5AVXB 2P10A 1S9KE 3RL0B 3HE5A 1OW6A 2ZT9D 1VQNP 1KIBA 3MUDC 2QEXP 1W5CT 1EDKA 3RK3E 5APSA 1I5TA 4N3YB 1FOSF 2PFXA 3WFBC 3M9HA 1S1CX 4U3FE 3NBTA 1RF1B 1CCRA 4GKGA 3MK7B 1URQD 2WITA 4AAOA 1BGYJ 3NFQA 1SLQA 5AVQB 3H1HE 1YIQA 1MZ9A 1C2NA 2CE0A 2ZOOA 1C6SA 1P84D 2IFMA 3AE8C 2XDJA 1AOQA 1QEXA 3V4QA 1MFTA 1KILB 4JYCA 4YTPC 2IYOA 2OQQA 3L36A 4CPGA 2ZAEB 1PV3A 1LWUB 2SPZA 1C2RA 4D6TG 2IYPA 2YK3A 3T97A 1T2KD 1X0TA 1S5LH 3KXDA 1LC2A 1U75B 4WBAA 3P32A 3KZIV 2YXRB 1CIGA 1NTMG 2A06E 2IZ0A 1LTSC 5B66H 1DX7A 1YNRA 4H13D 4LJIA 2BPBB 2AEJA 3VP8A 1NU1J 1R5LA 3HD7C 1MFZA 3MUDA 3V5BA 2FYUE 3CCUP 4OGQD 4M3LA 3TNUA 1URQA 4GYDA 2QSIA 3H1LJ 4PD4H 1RE4A 1SFCA 3SFDC 2IBZE 3WFDC 4EIDA 1JCDA 2ITAA 1GDVA 4OWFA 1HZUA 2JTIB 1OX3A 1MZ4A 1HCMA 2B89A 1GJQA 3L35A 2OZ1B 2QJKB 2IDBA 3LIEA 3HE4A 3GW6A 3VRDA 1QL4A 2AI5A 1J1EB 1LT9C 3L72J 1A02F 1HBWA 2RKLA 3EQ2A 2KI7B 3I56P 1HH0A 2CXBA 1VQ7P 1QN2A 1IJDB 2N9BA 2FRCA 3BCCD 1KQSO 4WQAA 3P7KA 1P84H 1C6RA 4DY9A 1T6AA 3VTPC 4H13B 1SP4A 4XFJA 1N86A 1YICA 1NTZK 1KQLA 2W8ZA 5M1BA 4W7YA 3ZDMA 1IRVA 1FS0E 3CXHE 1YCCA 1YITP 1H0TB 4O9BA 1EZVG 1NWQA 3JCUH 1SQPK 1PP9E 3KPEA 3H1LG 4V2KA 2R44A 1S3JA 1LGHB 2WWWA 2Y0DA 3AEBC 3G9RA 2V07A 2M5AB 4AYCA 3E7KA 3B4SA 3RBZA 2HFED 1EXIA 1JY3P 1LTGC 1I8PA 3O8ZA 1WRGA 4L3HA 4RESB 1DEEG 3CCEP 2E42A 3WU2E 2HPCB 3O1YA 1C52A 2PCCB 1Q90D 4H0LD 2GB8B 2H7HA 1USEA 2N1TD 1VQ9P 5B66V 2E74B 2GA1A 1SQXG 1JTHB 1S5LV 2ORLA 3WFEC 2YIUC 3VMAA 3EFGA 1NVOA 3T97B 3O6QA 4DJGA 1F1CA 1AQ5A 1LMSA 3HE4B 4L3GA 3M0AA 2AXCA 3FGAD 4K3AA 4NPEA 2L4DA 2N9IA 2IBZD 1G2CB 2A45G 5BVZA 3X39A 2HV4A 1N7LA 1RAPA 1K8AQ 1LTBC 1X79B 2OGUA 5C39A 1QGKB 3PLNA 3CX5W 3D6YA 1SQVJ 1LTAC 1N7SB 5APVA 1JUNA 1R0QA 2C9XB 2FWLA 2WSCH 3CMAP 5KAFE 2B87A 1NH4A 3IAOA 1MG3D 2Z5HA 3H32B 4HH2A 1CXCA 4I6MC 3GF3A 1NJIQ 5KKZC 1IFMA 4Y28J 1LTJC 1KFNA 3WUVA 1C7MA 3CWBD 1NU1E 3A0HE 2GC4D 5TISE 2NPSA 3Q3DA 3FWLA 2E75B 5CIFB 1WEJF 1L0NG 1ZOYC 1ZP0C 1CXAA 2FFDA 5KAIV 1U74B 1GW4A 1R8EA 2PAJA 3HTKB 2PP6A 1L0LG 1X9VA 4I7ZC 4D6TE 4HB1A 1NU1K 1FZGA 2HPCA 1LTJB 1DIPA 3KZIE 1OMIA 2B0ZB 2BCCD 1CNOA 3RN1A 3GMAA 3TSIA 3W67A 3L4MA 1VQKP 1KORA 1Q2NA 4P4QB 5KKZB 4IL6X 3CU4A 1CZQA 1S9KD 1CYCA 2VHDA 1K05A 4U3FJ 3HQ9A 1MUUA 4PW9B 1J1DC 4C7NA 2KNCB 1NAFA 3ZOXA 3L72E 5KAFH 1CEDA 2MKVA 2BEQD 1K04A 2DGEA 1L4AC 1SQBG 4KT0J 1LFMA 1W2EA 4GOEA 4AUWA 1YYCA 1OXZA 3H1KJ 3OAKA 1PP9D 3BVHA 2JWDA 4GODA 1KYOE 4N0KA 1NGMB 2OYIA 4I1LA 4ASVA 4L75A 3TYYA 3L73E 2Y0EA 3M0DC 2BCCG 2FFDB 1NTMK 4WWIA 3HD7D 4UB8V 4DCKA 1QVGO 1BE3J 1CRJA 4C46A 2D2CB 1BCCJ 4OVNF 1SFCB 4IL6H 4H44D 4BRYA 1GL2C 3H1KG 1GU5A 4KJMA 4PV1D 3PRJA 2K9JB 2WSFJ 1SQXJ 2J5UA 1KQGB 2XNDH 1AKKA 1M1JC 1EZVI 4PV1C 2YO2A 2XKMA 1EB7A 1EDIA 2CPBA 5GTHH 3G4SP 2N9JA 3D0WA 3CX5D 2D0WA 3C9IA 1N73A 4QAOA 3OA7A 4WY4B 2H89C 1RZ5A 4WQ7A 2GUSA 1KYOH 2AEMA 2LXCB 2HG5D 1I55A 1LWUA 3WFCC 3RL0g 2FYUJ 3PHLA 1N8RQ 1CSUA 1N15A 1PPJG 1PIXA 1VQ8P 2D2CC 3SWYA 4XXLA 5AW8B 1M1JB 5EFWB 1PGQA 3UIAA 1AYGA 4QMAA 1PFIA 5CIGB 1GIWA 4FA5A 1N73C 3RL0D 2WPVB 1Q86Q 2WSFH 5APWA 4XE5B 2M0BA 2BASA 4EI2A 3RLMA 1HVVA 4GIFA 3AEEC 4K3IA 1KILA 3S9OA 3H32A 5APYA 3H25A 1CRIA 3CWBE 3M9BA 4KHXA 1LTIC 3CXHD 1E2RA 3L72D 2FYNB 2LITA 3BCCE 1FC2C 1K9MQ 2I8DA 1T2KC 3RMZA 1CTYA 1CIEA 1SQBD 2C1DB 3AEGC 4L74A 1N90A 3I5CA 4FA1A 1AQTA 1CI6B 2HR3A 5KAIE 1NTKD 3RK3C 3BASA 4DOJA 2AEFA 1S2EA 2R5DA 1DH3A 2Q5UA 3GF7A 1IO4A 5AVTB 1FAVA 2NRGA 2K9JA 2IBZI 2ZZS1 2KSJA 5AW5B 3M9QA 1CSXA 4BXLA 2JO1A 4L73A 1EDLA 2J59M 3AE9C 3PH0A 3C1LA 3CX5H 3KHUA 5GTHV 1M7LA 5AVWB 2CK3H 3DP5A 2FYUK 5GTIE 3A0HV 1FHBA 3A3YB 1NO4A 4LLHA 1U7MA 1GZLA 1BGYD 2OYHB 1OVUA 1DW1A 2Q9IA 1S6VB 1BSHA 1S4XA 1ZR4A 2V7QH 2Z4EA 3M0DA 1QL1A 3ORVA 4C7NB 3H1JD 4UB8H 2JR8A 3RK3B 3B5NB 3HD7A 1C6OA 4RO0A 2BH4X 1GQ1A 1FZCA 2WQYC 1S72P 4O1QA 3CXHI 3CI9A 1GW3A 1OW7A 1FZCB 3HUSC 5KAIH 5KLVK 3CCSP 1FBMA 1CSWA 1FI7A 2C1DA 1EXJA 2C1UA 2HLOA 2G8YA 3JCUE 3H1HG 1L4AA 3AE3C 1LNQA 3MGNA 4JPZB 3OW2O 2BH5X 4OH8B 1CHJA 1GTWA 4MU8A 3AE5C 3IN6A 1DIQC 5AW2B 3FXEA 1KILE 5E79E 3H1LE 3V2NA 1CHHA 3HUSA 2JJLA 1IFNA 2HODB 1FJ0A 1FZCC 4RSZA 5B5EV 1KN7A 1HJ0A 2KLUA 3L71G 3MP7B 1LTJA 2MJZA 3PP5A 3AECC 1JEKA 1CRHA 1RF0A 2V4HA 3PXWA 1I6EA 1OAEA 4BWNA 1YJNP 1L9BC 2OARA 3C2CA 4UB6H 3CC7P 2OZ1A 2BLFB 2B87B 2NPSB 2L5GB 4C7RA 3VMXA 3L73J 2ZJSE 4H0JA 1NTKE 2YIUB 2E76C 5AVZB 3I55P 2WVRA 4W7ZA 3FXDA 1RF1A 1Q82Q 3GLMA 1KYOD 3EWKA 3D6ZA 1SQPD 4NPDA 3OCDA 2CE1A 1H32A 1KTMA 2O01J 1J1EC 3FX0A 5KJ7C 1SQQG 4DT0A 2C8SA 2P58A 4O1WA 3S4RA 4W80A 2YKPA 3RK2C 2BCCJ 3PXTA 3AE4C 1JY2P 3A0BV 2E76D 3L75J 3O20A 1VYDA 3V2QA 1G2CA 2QM7A 3L71D 1BGYE 2KB7P 1QLED 1JTHA 3IF4A 1L2PA 5CIBB 5C0ZA 3CCRP 1YTCA 1NTMJ 4L1QA 1BDCA 1T8ZA 1SS1A 3CD6P 5E79V 5EXQA 2NZ2A 2E76B 1M6ZA 4JCGA 3RGUA 3L70D 2C0XA 1UIIA 3CCJP 2NPSD 1KILC 3GHGC 5AVVB 2MHMA 4B86A 3ZOOA 1N7SD 1RZ6A 3MHVA 5B5EE 2E75D 3SWKA 2KP8A 3TK1A 1USDA 5CBOA 1W2BO 2HODA 1JO5A 5H2FH 1JY2O 1DEBA 2B11B 4U3FG
chains in the Genus database with same CATH topology
1CC5A 1NMIA 4P4QB 5CIDB 4D6TD 5CIHB 1EZVD 5KKZB 155CA 1KB0A 3CU4A 5CIEB 1CYCA 3OA8B 2N9YB 3GG2A 1HH7A 2VHDA 2ZXYA 1ETPA 1QKSA 3HQ9A 4PW9B 1HROA 2KNCB 3ZOXA 4AX3A 2Y0CA 1CEDA 1L0ND 1CTJA 2GIWA 4IL6V 1GU2A 2DGEA 4KMGA 1LFMA 1N9CA 1W2LA 5TISV 5H2FV 1C75A 3TYIA 4RJTA 1CRYA 3L73D 5IY51 3VNWA 1PP9D 3L4OA 1GKSA 1A2SA 2BGVX 4N0KA 3VYMA 2ZONG 3MK7C 1DW3A 2JQRA 4FB1A 2I8FA 2Y0EA 4H0KA 3ZOWA 1CO6A 1DVHA 2QJYB 3WU2V 1L9JC 1I8OA 4WQEA 1NTZD 1RAQA 4UB8V 2QJPB 3NWVA 4NFGB 1KV9A 4GEDB 1CRJA 2O3JA 2CA3B 2D0SA 4FAVA 3HQ6A 1FOCA 1ZRTD 1H33B 3PXSA 4PJ0V 3ZCFA 2FYUD 4AANA 1KIBA 5KAFV 1W5CT 3PRJA 2K9JB 5DFSA 1I5TA 1A56A 3H1HD 2B12B 1AKKA 3OCDB 3SJLA 3WFBC 2BCNB 1CYIA 1EB7A 2N3BA 4Q5PA 3NBTA 1CCRA 1F1FA 2N9JA 3MK7B 3CX5D 2D0WA 1M70A 4AAOA 4YE1A 1NIRA 2C1VA 4QAOA 1YIQA 2KS1A 1C2NA 1RZ5A 1LS9A 4WQ7A 3WC8A 2CE0A 1BL9A 1PPJD 1AOFA 1I55A 2N18B 3WFCC 1JDLA 1CIFA 1P84D 2ZOOA 1C6SA 3PHLA 451CA 1CSUA 2CA4B 1N15A 1AOQA 3TDKA 3CP5A 4XXLA 1SQXD 2RMZA 1I54A 1KX2A 3NBSA 1AYGA 1NNOA 5CIGB 1GIWA 1IQCA 4FA5A 1C2RA 3A9FA 1HJ4A 2MTAC 2YK3A 1LC2A 1U75B 1CRGA 3KZIV 1CIGA 3RLMA 3L74D 2V08A 1FI9A 4K3IA 1YNRA 1IZL0 4LJIA 1CRCA 2BPBB 1KX7A 1CRIA 1HRCA 5AURA 2L91A 1CHIA 1N50A 3CXHD 1E2RA 1H31B 4FA9A 1E29A 3L72D 2FYNB 2LITA 1CCHA 4GYDA 4WQ8A 2N18C 3WFDC 3DMIA 3RMZA 4EIDA 1CTYA 1CIEA 1SQBD 2C1DB 3ZOYA 1GDVA 3ZIYA 2YCCA 3PH2B 3ITKA 1N90A 1HZUA 5TJHA 4FA1A 2JTIB 1NTKD 1MZ4A 4PWAA 3CXHW 1HCMA 1GJQA 2OZ1B 2QJKB 5KLVD 1KB9D 2B4ZA 5C9MA 2ZZS1 4EDFA 2A06D 1CSXA 3VRDA 1K3HA 1QL4A 2AI5A 4UB6V 3GW6A 4Y5RA 1H33A 4WQCA 3WUIA 1COTA 1YEAA 1DT1A 3KHUA 1CIHA 5GTHV 5CICB 3DP5A 4U3FD 1H9XA 3H1LD 3A0HV 1M60A 2CXBA 1FHBA 1QN2A 2FRCA 1K3GA 3BCCD 3O0RC 5B6QA 3SWSA 4WQAA 3PTZA 1HJ5A 1C6RA 4DY9A 1BGYD 4EIEA 1DW1A 1S6VB 1YICA 2PACA 1IRVA 1YCCA 1DVVA 5DJQB 3H1KD 3ORVA 3TGUD 3H1JD 2PCBB 5KLIB 4V2KA 1C6OA 3OA8A 3ZBMA 2BH4X 1GQ1A 2Y0DA 4FA4A 1NMLA 3CYTI 4O1QA 4FANA 2V07A 1HZVA 1KYOW 1CSWA 1FI7A 2C1DA 2GC7D 2C1UA 3M97X 1B7VA 1DW2A 1OCDA 1I8PA 3TF5A 351CA 1IRWA 4L3HA 1WVEC 1CYJA 1BE3D 2BH5X 2DVHA 1CHJA 3O1YA 1C52A 2PCCB 4MU8A 1L0LD 4WQDA 1DIQC 2GB8B 1HJ3A 1H31A 1QL3A 5B66V 1YEBA 1CHHA 1BCCD 1CTZA 1S5LV 1LC1A 1MG2D 1FJ0A 1NU1D 2ORLA 4RSZA 3WFEC 5B5EV 2C2CA 3VMAA 1SQQD 4XYDB 3HQ7A 3H1ID 1F1CA 1CRHA 1LMSA 2XTSB 4WQ9A 2YQBA 3PXWA 4L3GA 1CORA 1OAEA 1I6EA 2RN0A 4A7PA 1L9BC 3C2CA 1QYZA 1CSVA 2OZ1A 2BLFB 1DIIC 1H32B 2L4DA 3JBTB 2N9IA 2IBZD 4AAMA 2Q3EA 2LIRA 3L75D 2N3YA 3SXTA 3X39A 2HV4A 1RAPA 4H0JA 2YIUB 3HQ8A 3PLNA 4AALA 3CX5W 1DW0A 1R0QA 2C9XB 4J20A 2AIUA 3O5CA 1KYOD 1NTMD 2FWLA 1SQPD 3OCDA 2CE1A 1H32A 1E8EA 1IO3A 1H1OA 1MG3D 3SLEA 2C8SA 3SVWA 2JWAA 1CXCA 4O1WA 4WQBA 1J3SA 3PXTA 1ZZHA 3A0BV 1C7MA 1A8CA 3CWBD 3O20A 1VYDA 1YFCA 2ZBOA 1FI3A 3L71D 5DF5A 2GC4D 2B10B 3FWLA 5CIFB 1WEJF 2AXTV 5CIBB 1SQVD 5C0ZA 2EXVA 3RN0A 1I6DA 1FCDC 4EICA 1CXAA 1YTCA 5KAIV 2QG4A 1U74B 4L1QA 3DR0A 5DJQC 5E79V 5EXQA 4EIFA 1M6ZA 4JCGA 3L70D 5CYTR 2MHMA 3ZOOA 1RZ6A 5GTIV 2B0ZB 4PD4D 2BCCD 1CNOA 3RN1A 1H9YA 2B11B 3L4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CC5 A;  1NMI A;  4P4Q B;  5CID B;  4D6T D;  5CIH B;  1EZV D;  5KKZ B;  155C A;  1KB0 A;  3CU4 A;  5CIE B;  1CYC A;  3OA8 B;  2N9Y B;  3GG2 A;  1HH7 A;  2VHD A;  2ZXY A;  1ETP A;  1QKS A;  3HQ9 A;  4PW9 B;  1HRO A;  2KNC B;  3ZOX A;  4AX3 A;  2Y0C A;  1CED A;  1L0N D;  1CTJ A;  2GIW A;  4IL6 V;  1GU2 A;  2DGE A;  4KMG A;  1LFM A;  1N9C A;  1W2L A;  5TIS V;  5H2F V;  1C75 A;  3TYI A;  4RJT A;  1CRY A;  3L73 D;  5IY5 1;  3VNW A;  1PP9 D;  3L4O A;  1GKS A;  1A2S A;  2BGV X;  4N0K A;  3VYM A;  2ZON G;  3MK7 C;  1DW3 A;  2JQR A;  4FB1 A;  2I8F A;  2Y0E A;  4H0K A;  3ZOW A;  1CO6 A;  1DVH A;  2QJY B;  3WU2 V;  1L9J C;  1I8O A;  4WQE A;  1NTZ D;  1RAQ A;  4UB8 V;  2QJP B;  3NWV A;  4NFG B;  1KV9 A;  4GED B;  1CRJ A;  2O3J A;  2CA3 B;  2D0S A;  4FAV A;  3HQ6 A;  1FOC A;  1ZRT D;  1H33 B;  3PXS A;  4PJ0 V;  3ZCF A;  2FYU D;  4AAN A;  1KIB A;  5KAF V;  1W5C T;  3PRJ A;  2K9J B;  5DFS A;  1I5T A;  1A56 A;  3H1H D;  2B12 B;  1AKK A;  3OCD B;  3SJL A;  3WFB C;  2BCN B;  1CYI A;  1EB7 A;  2N3B A;  4Q5P A;  3NBT A;  1CCR A;  1F1F A;  2N9J A;  3MK7 B;  3CX5 D;  2D0W A;  1M70 A;  4AAO A;  4YE1 A;  1NIR A;  2C1V A;  4QAO A;  1YIQ A;  2KS1 A;  1C2N A;  1RZ5 A;  1LS9 A;  4WQ7 A;  3WC8 A;  2CE0 A;  1BL9 A;  1PPJ D;  1AOF A;  1I55 A;  2N18 B;  3WFC C;  1JDL A;  1CIF A;  1P84 D;  2ZOO A;  1C6S A;  3PHL A;  451C A;  1CSU A;  2CA4 B;  1N15 A;  1AOQ A;  3TDK A;  3CP5 A;  4XXL A;  1SQX D;  2RMZ A;  1I54 A;  1KX2 A;  3NBS A;  1AYG A;  1NNO A;  5CIG B;  1GIW A;  1IQC A;  4FA5 A;  1C2R A;  3A9F A;  1HJ4 A;  2MTA C;  2YK3 A;  1LC2 A;  1U75 B;  1CRG A;  3KZI V;  1CIG A;  3RLM A;  3L74 D;  2V08 A;  1FI9 A;  4K3I A;  1YNR A;  1IZL 0;  4LJI A;  1CRC A;  2BPB B;  1KX7 A;  1CRI A;  1HRC A;  5AUR A;  2L91 A;  1CHI A;  1N50 A;  3CXH D;  1E2R A;  1H31 B;  4FA9 A;  1E29 A;  3L72 D;  2FYN B;  2LIT A;  1CCH A;  4GYD A;  4WQ8 A;  2N18 C;  3WFD C;  3DMI A;  3RMZ A;  4EID A;  1CTY A;  1CIE A;  1SQB D;  2C1D B;  3ZOY A;  1GDV A;  3ZIY A;  2YCC A;  3PH2 B;  3ITK A;  1N90 A;  1HZU A;  5TJH A;  4FA1 A;  2JTI B;  1NTK D;  1MZ4 A;  4PWA A;  3CXH W;  1HCM A;  1GJQ A;  2OZ1 B;  2QJK B;  5KLV D;  1KB9 D;  2B4Z A;  5C9M A;  2ZZS 1;  4EDF A;  2A06 D;  1CSX A;  3VRD A;  1K3H A;  1QL4 A;  2AI5 A;  4UB6 V;  3GW6 A;  4Y5R A;  1H33 A;  4WQC A;  3WUI A;  1COT A;  1YEA A;  1DT1 A;  3KHU A;  1CIH A;  5GTH V;  5CIC B;  3DP5 A;  4U3F D;  1H9X A;  3H1L D;  3A0H V;  1M60 A;  2CXB A;  1FHB A;  1QN2 A;  2FRC A;  1K3G A;  3BCC D;  3O0R C;  5B6Q A;  3SWS A;  4WQA A;  3PTZ A;  1HJ5 A;  1C6R A;  4DY9 A;  1BGY D;  4EIE A;  1DW1 A;  1S6V B;  1YIC A;  2PAC A;  1IRV A;  1YCC A;  1DVV A;  5DJQ B;  3H1K D;  3ORV A;  3TGU D;  3H1J D;  2PCB B;  5KLI B;  4V2K A;  1C6O A;  3OA8 A;  3ZBM A;  2BH4 X;  1GQ1 A;  2Y0D A;  4FA4 A;  1NML A;  3CYT I;  4O1Q A;  4FAN A;  2V07 A;  1HZV A;  1KYO W;  1CSW A;  1FI7 A;  2C1D A;  2GC7 D;  2C1U A;  3M97 X;  1B7V A;  1DW2 A;  1OCD A;  1I8P A;  3TF5 A;  351C A;  1IRW A;  4L3H A;  1WVE C;  1CYJ A;  1BE3 D;  2BH5 X;  2DVH A;  1CHJ A;  3O1Y A;  1C52 A;  2PCC B;  4MU8 A;  1L0L D;  4WQD A;  1DIQ C;  2GB8 B;  1HJ3 A;  1H31 A;  1QL3 A;  5B66 V;  1YEB A;  1CHH A;  1BCC D;  1CTZ A;  1S5L V;  1LC1 A;  1MG2 D;  1FJ0 A;  1NU1 D;  2ORL A;  4RSZ A;  3WFE C;  5B5E V;  2C2C A;  3VMA A;  1SQQ D;  4XYD B;  3HQ7 A;  3H1I D;  1F1C A;  1CRH A;  1LMS A;  2XTS B;  4WQ9 A;  2YQB A;  3PXW A;  4L3G A;  1COR A;  1OAE A;  1I6E A;  2RN0 A;  4A7P A;  1L9B C;  3C2C A;  1QYZ A;  1CSV A;  2OZ1 A;  2BLF B;  1DII C;  1H32 B;  2L4D A;  3JBT B;  2N9I A;  2IBZ D;  4AAM A;  2Q3E A;  2LIR A;  3L75 D;  2N3Y A;  3SXT A;  3X39 A;  2HV4 A;  1RAP A;  4H0J A;  2YIU B;  3HQ8 A;  3PLN A;  4AAL A;  3CX5 W;  1DW0 A;  1R0Q A;  2C9X B;  4J20 A;  2AIU A;  3O5C A;  1KYO D;  1NTM D;  2FWL A;  1SQP D;  3OCD A;  2CE1 A;  1H32 A;  1E8E A;  1IO3 A;  1H1O A;  1MG3 D;  3SLE A;  2C8S A;  3SVW A;  2JWA A;  1CXC A;  4O1W A;  4WQB A;  1J3S A;  3PXT A;  1ZZH A;  3A0B V;  1C7M A;  1A8C A;  3CWB D;  3O20 A;  1VYD A;  1YFC A;  2ZBO A;  1FI3 A;  3L71 D;  5DF5 A;  2GC4 D;  2B10 B;  3FWL A;  5CIF B;  1WEJ F;  2AXT V;  5CIB B;  1SQV D;  5C0Z A;  2EXV A;  3RN0 A;  1I6D A;  1FCD C;  4EIC A;  1CXA A;  1YTC A;  5KAI V;  2QG4 A;  1U74 B;  4L1Q A;  3DR0 A;  5DJQ C;  5E79 V;  5EXQ A;  4EIF A;  1M6Z A;  4JCG A;  3L70 D;  5CYT R;  2MHM A;  3ZOO A;  1RZ6 A;  5GTI V;  2B0Z B;  4PD4 D;  2BCC D;  1CNO A;  3RN1 A;  1H9Y A;  2B11 B;  3L4M A; 
#chains in the Genus database with same CATH topology
 1VF5 B;  2OYO A;  2WPR A;  155C A;  1KB0 A;  1FDO A;  3G3Z A;  2C9N Y;  3GG2 A;  1HH7 A;  1ETP A;  3GHG A;  3G71 P;  2WT7 B;  3ABV C;  2Z5I A;  2FXP A;  3NTN A;  2GIW A;  4PJ0 H;  3H1I J;  3BCC G;  4IFF A;  1VQL P;  3AED C;  3SFE C;  3A5T A;  2ZT9 B;  4RJT A;  4XA4 A;  1RF0 C;  2XV5 A;  3USS A;  3CCQ P;  5GTI H;  3SWF A;  4H0L C;  3VMZ A;  2K37 A;  4WVZ A;  1SQV E;  1VDF A;  3VYI A;  1NTM E;  3VYM A;  2A06 G;  2ZON G;  3AEF C;  4OGQ C;  3R4Y A;  4FB1 A;  4U7J A;  3VOP A;  1CO6 A;  4YXD C;  1DVH A;  2JKV A;  4IL6 E;  3RBX A;  2QVA A;  3B8E B;  1SQB E;  1SQP J;  1KV9 A;  1KB9 I;  1Z56 A;  2K3R A;  4GED B;  1RH5 B;  1KC8 Q;  1NTZ G;  2O3J A;  2D0S A;  3F5H A;  2Q7C A;  1M57 D;  1H33 B;  1SQP E;  4PJ0 V;  5CMZ A;  1H8A A;  1CW5 A;  5DFS A;  1LT9 A;  1VL2 A;  3H1H D;  2B12 B;  4PJ0 E;  3SJL A;  5CCG D;  5CJ4 A;  3JSV C;  2N3B A;  4ZNC A;  2FXM A;  2WSC J;  2ZXX A;  1NIR A;  2KS1 A;  1LP1 B;  2GM4 A;  3WC8 A;  1LS9 A;  2BEZ F;  3AE7 C;  1GL2 A;  1PPJ D;  1AOF A;  3CL3 D;  1VQ4 P;  2N18 B;  4JQ0 D;  1YQ3 C;  1JOC A;  1JDL A;  1OVR A;  3E1R A;  4I2L C;  1VQP P;  2CA4 B;  5BU5 A;  1KD1 Q;  3EFF K;  3CCL P;  3CP5 A;  1H89 A;  1I54 A;  1SQQ K;  1WT6 A;  1IZN B;  3NBS A;  1EQ7 A;  1NNO A;  1L0L E;  1IQC A;  1HJ4 A;  1GL2 B;  1XTG B;  1BCC E;  5APX A;  5AW1 B;  1GU4 A;  5APU A;  1HF9 A;  1FI9 A;  3A0B H;  1IZL 0;  5K5G B;  2YXQ B;  4GOF A;  4PV1 B;  1KX7 A;  1RQU A;  5CBN A;  4YXW H;  4FA9 A;  1H31 B;  1E29 A;  3KZI H;  4ZKP A;  3OJA B;  1J1D B;  4DZO A;  3WUT A;  2YO3 A;  1ZV8 A;  2IZ1 A;  3WUU A;  3L75 G;  1CCH A;  4BRY B;  1NTK G;  4WQ8 A;  2N18 C;  3MTU E;  3DMI A;  1U57 A;  1IC2 A;  2C9L Y;  3ZIY A;  1SQQ J;  3PH2 B;  2N1T B;  3ITK A;  1AA0 A;  1Y9B A;  1VPC A;  3CX5 E;  3CXH W;  1WMK A;  1FZB A;  1PGP A;  1M8O B;  2B4Z A;  5C9M A;  1OWA A;  1EC5 A;  1K3H A;  2O1K A;  4UB6 V;  2FYN C;  4WQC A;  3WUI A;  1COT A;  1YEA A;  3CX5 I;  3L73 G;  1DT1 A;  5CIC B;  2IPP A;  3H1J G;  3PJS K;  3H1L D;  3L72 G;  1M60 A;  1PZQ A;  3CC2 P;  2QJP C;  4OGQ B;  1K3G A;  2KIK A;  3O0R C;  5B6Q A;  3SWS A;  5B5E H;  2FBW C;  2FFD C;  2E75 C;  5H2F E;  2LR2 A;  2XU6 A;  2PAC A;  1KIL D;  3JC2 2;  1T3U A;  3L71 J;  3RK2 D;  1DVV A;  5DJQ B;  4LGD E;  3H1K D;  3QWO C;  3TGU D;  1L0N K;  1IK9 A;  1FJK A;  5KLI B;  3AE6 C;  3ZBM A;  2Q3I A;  3VMY A;  3VN0 A;  4Z1M H;  2M5A A;  2Q6Q A;  3HRN A;  1NML A;  3CYT I;  3QH9 A;  2FYU G;  1FE6 A;  2W90 A;  1HZV A;  1KYO W;  2KOG A;  5AW9 B;  1HTL C;  1FZA A;  4ASW A;  3U1A A;  4EIJ A;  3L74 E;  2P67 A;  1OCD A;  3TF5 A;  351C A;  1IRW A;  1NOH A;  2IBZ G;  3CC4 P;  1PL5 A;  1WVE C;  2E5Y A;  2R32 A;  1Y8A A;  2Q1K A;  2POH A;  1MKM A;  4D6T J;  1L0L D;  4WQD A;  1HJ3 A;  5KLI C;  4WY4 C;  5AW6 B;  1YEB A;  1ZW0 A;  1BCC D;  1GK6 A;  2W6B A;  1OZH A;  1SVF A;  1YBK A;  3L71 E;  2A45 I;  1P84 E;  4R4L A;  1JB0 J;  2QJY C;  3H1I D;  4L76 A;  3A0H H;  3B5N D;  1YJ9 P;  5KLV E;  2XTS B;  2YQB A;  1COR A;  4IFD K;  4A7P A;  1G1J A;  1FDM A;  1CSV A;  3R2P A;  1AVY A;  1ZXG A;  2O01 H;  1H32 B;  2C0W A;  3JBT B;  3MIW A;  4TLF A;  2Q3E A;  1DD4 A;  3BAT A;  2LIR A;  1J2J B;  2YMY A;  3CWB J;  2YKQ A;  2N3Y A;  1E5W A;  2E5T A;  3K5B A;  1LP1 A;  2Y9Z A;  1NTZ E;  2KYV A;  3TGU G;  2UWJ E;  3V2R A;  1DW0 A;  1PP9 G;  1IFP A;  3L70 E;  4R4M A;  1SFC D;  1NTZ J;  2ZYG A;  2AIU A;  3O5C A;  1NTM D;  1BE3 E;  2H43 A;  4Y99 C;  1AFO A;  3P8C E;  3L70 J;  2IFN A;  1E8E A;  1LT9 B;  3SLE A;  5AW3 B;  2I1J A;  2JWA A;  1N7S A;  2ZXE B;  3V2P A;  1J3S A;  3L37 A;  3H1J J;  2G3A A;  1KQF B;  3F89 A;  2O01 N;  1RF1 C;  1YFC A;  3LW5 H;  2ZBO A;  1FI3 A;  1RE4 C;  2WZ7 A;  5DF5 A;  1QL2 A;  2NPS C;  2H8P D;  4H13 C;  2AXT V;  5AVS B;  1SQV D;  2EXV A;  4NPF X;  3KQG A;  1BDD A;  4ZKU A;  4Y99 B;  3DR0 A;  3TGU E;  1YHQ P;  4EIF A;  4GDO A;  2OTK E;  1L4A D;  1SQV K;  3H1I G;  3B5N C;  1RHZ B;  2JP3 A;  1NTK J;  1FZF A;  1L0L J;  4N6J A;  5GTI V;  2WSS H;  4PD4 D;  1N73 B;  1T3J A;  1H9Y A;  2K88 A;  1OFC X;  5AVU B;  1AVO A;  3Q5S A;  2LXB A;  5DJT B;  4D6T D;  5CID B;  5CIH B;  3MZW B;  3RK2 B;  5APT A;  5KJ7 D;  3P8M C;  2OTL P;  5CIE B;  3OA8 B;  2N9Y B;  1ZR2 A;  3HD7 B;  2ZXY A;  1QKS A;  3V6I A;  1VQ6 P;  3HE5 B;  1LT1 A;  1HRO A;  1KFM A;  1H0T A;  4AX3 A;  3GHG B;  2WPQ A;  1L0N D;  1CTJ A;  2M8R A;  4IL6 V;  2JDI H;  1GU2 A;  1KYO I;  3L75 E;  1AJY A;  5TIS V;  1RY3 A;  1PGJ A;  2QRX A;  3L70 G;  3CPW O;  5H2F V;  1FJP A;  3H1K E;  3L73 D;  1GDT A;  2XNX A;  5APQ A;  2QM8 A;  3L4O A;  1SQV G;  2B88 A;  2FKW B;  3RL0 C;  1JCC A;  2FYZ A;  5E79 H;  2IX7 C;  1KB9 E;  2JQR A;  1SQB K;  4H0K A;  3ZOW A;  1VF5 D;  1NTK K;  3WU2 V;  3WMM 0;  3CXH H;  2ZFC A;  1L9J C;  2R3C A;  1EDJ A;  4WQE A;  1NTZ D;  1PPJ E;  3G6E P;  3Q5P A;  1K73 Q;  1OIP A;  1RAQ A;  3NWV A;  3H1J E;  5AW7 B;  3Q1M A;  1TU3 F;  3HQ6 A;  1OVV A;  1IFD A;  1EZV E;  2KSE A;  5AW4 B;  2OYH C;  1ZRT D;  2PRR A;  5CCH A;  3PXS A;  2PGD A;  3ZCF A;  2FYU D;  4AAN A;  2K9Y A;  5KAF V;  1GD2 E;  3IFM A;  2QE7 H;  3W68 A;  1X22 A;  1SQP G;  1A56 A;  3OCD B;  4HJG H;  2LKM A;  2BCN B;  1CYI A;  1JY3 O;  1CI6 A;  2QA4 P;  4Q5P A;  5KLV G;  2N1T A;  1F1F A;  3KDP B;  3CME P;  2OTJ P;  1FOS E;  1M70 A;  4YE1 A;  1M1K Q;  2C1V A;  2KZI A;  3HTK A;  1BL9 A;  2W6A A;  3LW5 J;  1HJB A;  3BRV B;  1CIF A;  1A02 J;  1R5S A;  451C A;  1GMJ A;  2YNY A;  2CPS A;  3D70 A;  3TDK A;  2W6J H;  1Y47 A;  1SQX D;  2RMZ A;  1KX2 A;  4JBZ A;  3A9F A;  3RK3 D;  2MTA C;  4EYY Q;  1AV1 A;  2KS1 B;  3P8C D;  2KLV A;  2YKO A;  1W5C E;  1CRG A;  1SQX K;  3SSU A;  3V4W A;  2H88 C;  1M1J A;  3L74 D;  2V08 A;  4TT3 H;  1L0N J;  2P7J A;  1CRC A;  3D71 A;  2QJK C;  1S5L X;  2R3S A;  1HRC A;  5AUR A;  2L91 A;  3C8V A;  1CHI A;  1YJW P;  1N50 A;  1JM0 A;  1E79 H;  1HWT C;  1QVF O;  2BCC E;  3M91 A;  5L8R J;  1JMM A;  3LID A;  1VF5 C;  1URQ C;  4WY4 A;  2P1J A;  4PD4 I;  2WSE H;  2ZT9 C;  3ZOY A;  5CCG C;  2YCC A;  5TJH A;  5GTH E;  3L4F A;  3N4X A;  4PWA A;  3H1I E;  2AXT E;  4PD4 E;  5KLV D;  5KJ7 A;  4JYB A;  1KB9 D;  2M3E A;  4EDF A;  2OYI C;  2XZR A;  3TGU J;  2A06 D;  5TIS H;  1LJ2 A;  4Y5R A;  1H33 A;  3O6Q B;  1NAY A;  4IFM A;  4H0L B;  1CIH A;  3CWB G;  2O1J A;  4U3F D;  1H9X A;  1MV8 A;  1XTC C;  5CCH C;  1ZLL A;  4N78 E;  1NU1 G;  3PTZ A;  1HJ5 A;  2B9B A;  5DJU B;  2D2C D;  1G1I A;  1L0N E;  1HGV A;  1YTZ I;  4I7Z B;  2E43 A;  4EIE A;  2E74 C;  1FZE A;  1SFC C;  2KUB A;  1DD3 A;  1Q7Y Q;  2OYI B;  1UIX A;  3H6P A;  2KXP B;  1ZN5 A;  2KNC A;  2WT7 A;  1YTZ T;  2PCB B;  1HGZ A;  4H44 C;  4HYT B;  4HKZ H;  3OA8 A;  3WU2 H;  4FA4 A;  4FAN A;  1KV4 A;  3Q2Y A;  4WB4 A;  3B5N A;  2GC7 D;  3M97 X;  1B7V A;  2AXT H;  1DW2 A;  2J58 A;  1GK4 A;  1YI2 P;  3L74 J;  1CYJ A;  1BE3 D;  3NMD A;  2DVH A;  3U1C A;  3CCV P;  1X8Y A;  1JMB A;  1H31 A;  4H44 B;  4JF7 A;  2ZYD A;  1QL3 A;  2GUV A;  4AQR D;  4LC1 A;  4IOI H;  1YIJ P;  2ZVN B;  1CTZ A;  1LTT C;  5AVY B;  3S1K A;  3NXS A;  1LC1 A;  1MG2 D;  1NU1 D;  2WPS A;  2C2C A;  3MD0 A;  2KZJ A;  1SQQ D;  4XYD B;  1JY3 N;  3HQ7 A;  1NYH A;  3CLQ A;  1N7S C;  3L74 G;  3H1H J;  1Q81 Q;  4MN4 C;  1N2D C;  4WQ9 A;  2ZVO B;  1ZME C;  5CHX A;  5AVR B;  2RN0 A;  3A2A A;  1QYZ A;  3B71 A;  1IFJ A;  1P84 I;  1DII C;  1S5L E;  1H88 A;  2W27 A;  4AAM A;  3L75 D;  5B66 E;  3AE1 C;  3A0B E;  3SXT A;  3HQ8 A;  2HYN A;  1VQM P;  4AAL A;  1NKZ B;  1URQ B;  1BCC G;  4J20 A;  3TNU B;  3VP9 A;  1M90 Q;  3FWN A;  1BE3 G;  3Q5R A;  1IO3 A;  1H1O A;  3SVW A;  3BCC J;  2YMK A;  4WQB A;  2FY8 A;  2WTY A;  1ZZH A;  1A8C A;  4RKU J;  5CCG A;  2M3B A;  2R5B A;  3BRT B;  1BSN A;  1HUC A;  2QIW A;  3N7N A;  5KTB A;  3II6 A;  2B10 B;  2WSE J;  1LWU C;  1YQ4 C;  3RN0 A;  1I6D A;  1FCD C;  4EIC A;  1FU1 A;  2WMM A;  1L0L K;  2QG4 A;  1JNM A;  2Y9Y A;  4UB6 E;  3CCM P;  5DJQ C;  3AE2 C;  1SQB J;  5CYT R;  1RE3 C;  1VQO P;  3AEA C;  2A45 H;  2W83 C;  1L4A B;  1QX8 A;  3M06 A;  1JY2 N;  1KMI Z;  3HUS B;  1NHL A;  4EOT A;  2I1K A;  1CC5 A;  1NMI A;  2JEE A;  3A7O A;  1EZV D;  5BU8 B;  2ZYA A;  3U59 A;  1KZU B;  2V7Q J;  4N78 D;  1BGY G;  1D7M A;  1RE3 A;  1VQ5 P;  2Y0C A;  1SQX E;  1PGO A;  2KK7 A;  3KYQ A;  4YPC A;  1ZRT E;  4KMG A;  1N9C A;  1W2L A;  2DW3 A;  1IFI A;  1CSB A;  3IR9 A;  1C75 A;  3TYI A;  2N1T C;  1SQQ E;  1CRY A;  5IY5 1;  1GL2 D;  3VNW A;  1GKS A;  5CCH D;  1A2S A;  2BGV X;  4WY4 D;  3MK7 C;  1DW3 A;  1RQV A;  5CJ0 A;  2I8F A;  4K35 A;  2P2U A;  2OYH A;  2VRS A;  2E74 D;  4GT1 A;  2QJY B;  5KLV J;  3E1I A;  4ZMD A;  1U7J A;  1I8O A;  1FDI A;  2K1A A;  4UB8 E;  5AW0 B;  1OW8 A;  2QJP B;  2RH0 A;  1IK7 A;  4NFG B;  1M56 D;  1KB9 H;  2CA3 B;  4FAV A;  1FOC A;  1NKN A;  1PP9 J;  2FXO A;  5AVX B;  2P10 A;  1S9K E;  3RL0 B;  3HE5 A;  1OW6 A;  2ZT9 D;  1VQN P;  1KIB A;  3MUD C;  2QEX P;  1W5C T;  1EDK A;  3RK3 E;  5APS A;  1I5T A;  4N3Y B;  1FOS F;  2PFX A;  3WFB C;  3M9H A;  1S1C X;  4U3F E;  3NBT A;  1RF1 B;  1CCR A;  4GKG A;  3MK7 B;  1URQ D;  2WIT A;  4AAO A;  1BGY J;  3NFQ A;  1SLQ A;  5AVQ B;  3H1H E;  1YIQ A;  1MZ9 A;  1C2N A;  2CE0 A;  2ZOO A;  1C6S A;  1P84 D;  2IFM A;  3AE8 C;  2XDJ A;  1AOQ A;  1QEX A;  3V4Q A;  1MFT A;  1KIL B;  4JYC A;  4YTP C;  2IYO A;  2OQQ A;  3L36 A;  4CPG A;  2ZAE B;  1PV3 A;  1LWU B;  2SPZ A;  1C2R A;  4D6T G;  2IYP A;  2YK3 A;  3T97 A;  1T2K D;  1X0T A;  1S5L H;  3KXD A;  1LC2 A;  1U75 B;  4WBA A;  3P32 A;  3KZI V;  2YXR B;  1CIG A;  1NTM G;  2A06 E;  2IZ0 A;  1LTS C;  5B66 H;  1DX7 A;  1YNR A;  4H13 D;  4LJI A;  2BPB B;  2AEJ A;  3VP8 A;  1NU1 J;  1R5L A;  3HD7 C;  1MFZ A;  3MUD A;  3V5B A;  2FYU E;  3CCU P;  4OGQ D;  4M3L A;  3TNU A;  1URQ A;  4GYD A;  2QSI A;  3H1L J;  4PD4 H;  1RE4 A;  1SFC A;  3SFD C;  2IBZ E;  3WFD C;  4EID A;  1JCD A;  2ITA A;  1GDV A;  4OWF A;  1HZU A;  2JTI B;  1OX3 A;  1MZ4 A;  1HCM A;  2B89 A;  1GJQ A;  3L35 A;  2OZ1 B;  2QJK B;  2IDB A;  3LIE A;  3HE4 A;  3GW6 A;  3VRD A;  1QL4 A;  2AI5 A;  1J1E B;  1LT9 C;  3L72 J;  1A02 F;  1HBW A;  2RKL A;  3EQ2 A;  2KI7 B;  3I56 P;  1HH0 A;  2CXB A;  1VQ7 P;  1QN2 A;  1IJD B;  2N9B A;  2FRC A;  3BCC D;  1KQS O;  4WQA A;  3P7K A;  1P84 H;  1C6R A;  4DY9 A;  1T6A A;  3VTP C;  4H13 B;  1SP4 A;  4XFJ A;  1N86 A;  1YIC A;  1NTZ K;  1KQL A;  2W8Z A;  5M1B A;  4W7Y A;  3ZDM A;  1IRV A;  1FS0 E;  3CXH E;  1YCC A;  1YIT P;  1H0T B;  4O9B A;  1EZV G;  1NWQ A;  3JCU H;  1SQP K;  1PP9 E;  3KPE A;  3H1L G;  4V2K A;  2R44 A;  1S3J A;  1LGH B;  2WWW A;  2Y0D A;  3AEB C;  3G9R A;  2V07 A;  2M5A B;  4AYC A;  3E7K A;  3B4S A;  3RBZ A;  2HFE D;  1EXI A;  1JY3 P;  1LTG C;  1I8P A;  3O8Z A;  1WRG A;  4L3H A;  4RES B;  1DEE G;  3CCE P;  2E42 A;  3WU2 E;  2HPC B;  3O1Y A;  1C52 A;  2PCC B;  1Q90 D;  4H0L D;  2GB8 B;  2H7H A;  1USE A;  2N1T D;  1VQ9 P;  5B66 V;  2E74 B;  2GA1 A;  1SQX G;  1JTH B;  1S5L V;  2ORL A;  3WFE C;  2YIU C;  3VMA A;  3EFG A;  1NVO A;  3T97 B;  3O6Q A;  4DJG A;  1F1C A;  1AQ5 A;  1LMS A;  3HE4 B;  4L3G A;  3M0A A;  2AXC A;  3FGA D;  4K3A A;  4NPE A;  2L4D A;  2N9I A;  2IBZ D;  1G2C B;  2A45 G;  5BVZ A;  3X39 A;  2HV4 A;  1N7L A;  1RAP A;  1K8A Q;  1LTB C;  1X79 B;  2OGU A;  5C39 A;  1QGK B;  3PLN A;  3CX5 W;  3D6Y A;  1SQV J;  1LTA C;  1N7S B;  5APV A;  1JUN A;  1R0Q A;  2C9X B;  2FWL A;  2WSC H;  3CMA P;  5KAF E;  2B87 A;  1NH4 A;  3IAO A;  1MG3 D;  2Z5H A;  3H32 B;  4HH2 A;  1CXC A;  4I6M C;  3GF3 A;  1NJI Q;  5KKZ C;  1IFM A;  4Y28 J;  1LTJ C;  1KFN A;  3WUV A;  1C7M A;  3CWB D;  1NU1 E;  3A0H E;  2GC4 D;  5TIS E;  2NPS A;  3Q3D A;  3FWL A;  2E75 B;  5CIF B;  1WEJ F;  1L0N G;  1ZOY C;  1ZP0 C;  1CXA A;  2FFD A;  5KAI V;  1U74 B;  1GW4 A;  1R8E A;  2PAJ A;  3HTK B;  2PP6 A;  1L0L G;  1X9V A;  4I7Z C;  4D6T E;  4HB1 A;  1NU1 K;  1FZG A;  2HPC A;  1LTJ B;  1DIP A;  3KZI E;  1OMI A;  2B0Z B;  2BCC D;  1CNO A;  3RN1 A;  3GMA A;  3TSI A;  3W67 A;  3L4M A;  1VQK P;  1KOR A;  1Q2N A;  4P4Q B;  5KKZ B;  4IL6 X;  3CU4 A;  1CZQ A;  1S9K D;  1CYC A;  2VHD A;  1K05 A;  4U3F J;  3HQ9 A;  1MUU A;  4PW9 B;  1J1D C;  4C7N A;  2KNC B;  1NAF A;  3ZOX A;  3L72 E;  5KAF H;  1CED A;  2MKV A;  2BEQ D;  1K04 A;  2DGE A;  1L4A C;  1SQB G;  4KT0 J;  1LFM A;  1W2E A;  4GOE A;  4AUW A;  1YYC A;  1OXZ A;  3H1K J;  3OAK A;  1PP9 D;  3BVH A;  2JWD A;  4GOD A;  1KYO E;  4N0K A;  1NGM B;  2OYI A;  4I1L A;  4ASV A;  4L75 A;  3TYY A;  3L73 E;  2Y0E A;  3M0D C;  2BCC G;  2FFD B;  1NTM K;  4WWI A;  3HD7 D;  4UB8 V;  4DCK A;  1QVG O;  1BE3 J;  1CRJ A;  4C46 A;  2D2C B;  1BCC J;  4OVN F;  1SFC B;  4IL6 H;  4H44 D;  4BRY A;  1GL2 C;  3H1K G;  1GU5 A;  4KJM A;  4PV1 D;  3PRJ A;  2K9J B;  2WSF J;  1SQX J;  2J5U A;  1KQG B;  2XND H;  1AKK A;  1M1J C;  1EZV I;  4PV1 C;  2YO2 A;  2XKM A;  1EB7 A;  1EDI A;  2CPB A;  5GTH H;  3G4S P;  2N9J A;  3D0W A;  3CX5 D;  2D0W A;  3C9I A;  1N73 A;  4QAO A;  3OA7 A;  4WY4 B;  2H89 C;  1RZ5 A;  4WQ7 A;  2GUS A;  1KYO H;  2AEM A;  2LXC B;  2HG5 D;  1I55 A;  1LWU A;  3WFC C;  3RL0 g;  2FYU J;  3PHL A;  1N8R Q;  1CSU A;  1N15 A;  1PPJ G;  1PIX A;  1VQ8 P;  2D2C C;  3SWY A;  4XXL A;  5AW8 B;  1M1J B;  5EFW B;  1PGQ A;  3UIA A;  1AYG A;  4QMA A;  1PFI A;  5CIG B;  1GIW A;  4FA5 A;  1N73 C;  3RL0 D;  2WPV B;  1Q86 Q;  2WSF H;  5APW A;  4XE5 B;  2M0B A;  2BAS A;  4EI2 A;  3RLM A;  1HVV A;  4GIF A;  3AEE C;  4K3I A;  1KIL A;  3S9O A;  3H32 A;  5APY A;  3H25 A;  1CRI A;  3CWB E;  3M9B A;  4KHX A;  1LTI C;  3CXH D;  1E2R A;  3L72 D;  2FYN B;  2LIT A;  3BCC E;  1FC2 C;  1K9M Q;  2I8D A;  1T2K C;  3RMZ A;  1CTY A;  1CIE A;  1SQB D;  2C1D B;  3AEG C;  4L74 A;  1N90 A;  3I5C A;  4FA1 A;  1AQT A;  1CI6 B;  2HR3 A;  5KAI E;  1NTK D;  3RK3 C;  3BAS A;  4DOJ A;  2AEF A;  1S2E A;  2R5D A;  1DH3 A;  2Q5U A;  3GF7 A;  1IO4 A;  5AVT B;  1FAV A;  2NRG A;  2K9J A;  2IBZ I;  2ZZS 1;  2KSJ A;  5AW5 B;  3M9Q A;  1CSX A;  4BXL A;  2JO1 A;  4L73 A;  1EDL A;  2J59 M;  3AE9 C;  3PH0 A;  3C1L A;  3CX5 H;  3KHU A;  5GTH V;  1M7L A;  5AVW B;  2CK3 H;  3DP5 A;  2FYU K;  5GTI E;  3A0H V;  1FHB A;  3A3Y B;  1NO4 A;  4LLH A;  1U7M A;  1GZL A;  1BGY D;  2OYH B;  1OVU A;  1DW1 A;  2Q9I A;  1S6V B;  1BSH A;  1S4X A;  1ZR4 A;  2V7Q H;  2Z4E A;  3M0D A;  1QL1 A;  3ORV A;  4C7N B;  3H1J D;  4UB8 H;  2JR8 A;  3RK3 B;  3B5N B;  3HD7 A;  1C6O A;  4RO0 A;  2BH4 X;  1GQ1 A;  1FZC A;  2WQY C;  1S72 P;  4O1Q A;  3CXH I;  3CI9 A;  1GW3 A;  1OW7 A;  1FZC B;  3HUS C;  5KAI H;  5KLV K;  3CCS P;  1FBM A;  1CSW A;  1FI7 A;  2C1D A;  1EXJ A;  2C1U A;  2HLO A;  2G8Y A;  3JCU E;  3H1H G;  1L4A A;  3AE3 C;  1LNQ A;  3MGN A;  4JPZ B;  3OW2 O;  2BH5 X;  4OH8 B;  1CHJ A;  1GTW A;  4MU8 A;  3AE5 C;  3IN6 A;  1DIQ C;  5AW2 B;  3FXE A;  1KIL E;  5E79 E;  3H1L E;  3V2N A;  1CHH A;  3HUS A;  2JJL A;  1IFN A;  2HOD B;  1FJ0 A;  1FZC C;  4RSZ A;  5B5E V;  1KN7 A;  1HJ0 A;  2KLU A;  3L71 G;  3MP7 B;  1LTJ A;  2MJZ A;  3PP5 A;  3AEC C;  1JEK A;  1CRH A;  1RF0 A;  2V4H A;  3PXW A;  1I6E A;  1OAE A;  4BWN A;  1YJN P;  1L9B C;  2OAR A;  3C2C A;  4UB6 H;  3CC7 P;  2OZ1 A;  2BLF B;  2B87 B;  2NPS B;  2L5G B;  4C7R A;  3VMX A;  3L73 J;  2ZJS E;  4H0J A;  1NTK E;  2YIU B;  2E76 C;  5AVZ B;  3I55 P;  2WVR A;  4W7Z A;  3FXD A;  1RF1 A;  1Q82 Q;  3GLM A;  1KYO D;  3EWK A;  3D6Z A;  1SQP D;  4NPD A;  3OCD A;  2CE1 A;  1H32 A;  1KTM A;  2O01 J;  1J1E C;  3FX0 A;  5KJ7 C;  1SQQ G;  4DT0 A;  2C8S A;  2P58 A;  4O1W A;  3S4R A;  4W80 A;  2YKP A;  3RK2 C;  2BCC J;  3PXT A;  3AE4 C;  1JY2 P;  3A0B V;  2E76 D;  3L75 J;  3O20 A;  1VYD A;  3V2Q A;  1G2C A;  2QM7 A;  3L71 D;  1BGY E;  2KB7 P;  1QLE D;  1JTH A;  3IF4 A;  1L2P A;  5CIB B;  5C0Z A;  3CCR P;  1YTC A;  1NTM J;  4L1Q A;  1BDC A;  1T8Z A;  1SS1 A;  3CD6 P;  5E79 V;  5EXQ A;  2NZ2 A;  2E76 B;  1M6Z A;  4JCG A;  3RGU A;  3L70 D;  2C0X A;  1UII A;  3CCJ P;  2NPS D;  1KIL C;  3GHG C;  5AVV B;  2MHM A;  4B86 A;  3ZOO A;  1N7S D;  1RZ6 A;  3MHV A;  5B5E E;  2E75 D;  3SWK A;  2KP8 A;  3TK1 A;  1USD A;  5CBO A;  1W2B O;  2HOD A;  1JO5 A;  5H2F H;  1JY2 O;  1DEB A;  2B11 B;  4U3F G; 
#chains in the Genus database with same CATH homology
 1CC5 A;  1NMI A;  4P4Q B;  5CID B;  4D6T D;  5CIH B;  1EZV D;  5KKZ B;  155C A;  1KB0 A;  3CU4 A;  5CIE B;  1CYC A;  3OA8 B;  2N9Y B;  3GG2 A;  1HH7 A;  2VHD A;  2ZXY A;  1ETP A;  1QKS A;  3HQ9 A;  4PW9 B;  1HRO A;  2KNC B;  3ZOX A;  4AX3 A;  2Y0C A;  1CED A;  1L0N D;  1CTJ A;  2GIW A;  4IL6 V;  1GU2 A;  2DGE A;  4KMG A;  1LFM A;  1N9C A;  1W2L A;  5TIS V;  5H2F V;  1C75 A;  3TYI A;  4RJT A;  1CRY A;  3L73 D;  5IY5 1;  3VNW A;  1PP9 D;  3L4O A;  1GKS A;  1A2S A;  2BGV X;  4N0K A;  3VYM A;  2ZON G;  3MK7 C;  1DW3 A;  2JQR A;  4FB1 A;  2I8F A;  2Y0E A;  4H0K A;  3ZOW A;  1CO6 A;  1DVH A;  2QJY B;  3WU2 V;  1L9J C;  1I8O A;  4WQE A;  1NTZ D;  1RAQ A;  4UB8 V;  2QJP B;  3NWV A;  4NFG B;  1KV9 A;  4GED B;  1CRJ A;  2O3J A;  2CA3 B;  2D0S A;  4FAV A;  3HQ6 A;  1FOC A;  1ZRT D;  1H33 B;  3PXS A;  4PJ0 V;  3ZCF A;  2FYU D;  4AAN A;  1KIB A;  5KAF V;  1W5C T;  3PRJ A;  2K9J B;  5DFS A;  1I5T A;  1A56 A;  3H1H D;  2B12 B;  1AKK A;  3OCD B;  3SJL A;  3WFB C;  2BCN B;  1CYI A;  1EB7 A;  2N3B A;  4Q5P A;  3NBT A;  1CCR A;  1F1F A;  2N9J A;  3MK7 B;  3CX5 D;  2D0W A;  1M70 A;  4AAO A;  4YE1 A;  1NIR A;  2C1V A;  4QAO A;  1YIQ A;  2KS1 A;  1C2N A;  1RZ5 A;  1LS9 A;  4WQ7 A;  3WC8 A;  2CE0 A;  1BL9 A;  1PPJ D;  1AOF A;  1I55 A;  2N18 B;  3WFC C;  1JDL A;  1CIF A;  1P84 D;  2ZOO A;  1C6S A;  3PHL A;  451C A;  1CSU A;  2CA4 B;  1N15 A;  1AOQ A;  3TDK A;  3CP5 A;  4XXL A;  1SQX D;  2RMZ A;  1I54 A;  1KX2 A;  3NBS A;  1AYG A;  1NNO A;  5CIG B;  1GIW A;  1IQC A;  4FA5 A;  1C2R A;  3A9F A;  1HJ4 A;  2MTA C;  2YK3 A;  1LC2 A;  1U75 B;  1CRG A;  3KZI V;  1CIG A;  3RLM A;  3L74 D;  2V08 A;  1FI9 A;  4K3I A;  1YNR A;  1IZL 0;  4LJI A;  1CRC A;  2BPB B;  1KX7 A;  1CRI A;  1HRC A;  5AUR A;  2L91 A;  1CHI A;  1N50 A;  3CXH D;  1E2R A;  1H31 B;  4FA9 A;  1E29 A;  3L72 D;  2FYN B;  2LIT A;  1CCH A;  4GYD A;  4WQ8 A;  2N18 C;  3WFD C;  3DMI A;  3RMZ A;  4EID A;  1CTY A;  1CIE A;  1SQB D;  2C1D B;  3ZOY A;  1GDV A;  3ZIY A;  2YCC A;  3PH2 B;  3ITK A;  1N90 A;  1HZU A;  5TJH A;  4FA1 A;  2JTI B;  1NTK D;  1MZ4 A;  4PWA A;  3CXH W;  1HCM A;  1GJQ A;  2OZ1 B;  2QJK B;  5KLV D;  1KB9 D;  2B4Z A;  5C9M A;  2ZZS 1;  4EDF A;  2A06 D;  1CSX A;  3VRD A;  1K3H A;  1QL4 A;  2AI5 A;  4UB6 V;  3GW6 A;  4Y5R A;  1H33 A;  4WQC A;  3WUI A;  1COT A;  1YEA A;  1DT1 A;  3KHU A;  1CIH A;  5GTH V;  5CIC B;  3DP5 A;  4U3F D;  1H9X A;  3H1L D;  3A0H V;  1M60 A;  2CXB A;  1FHB A;  1QN2 A;  2FRC A;  1K3G A;  3BCC D;  3O0R C;  5B6Q A;  3SWS A;  4WQA A;  3PTZ A;  1HJ5 A;  1C6R A;  4DY9 A;  1BGY D;  4EIE A;  1DW1 A;  1S6V B;  1YIC A;  2PAC A;  1IRV A;  1YCC A;  1DVV A;  5DJQ B;  3H1K D;  3ORV A;  3TGU D;  3H1J D;  2PCB B;  5KLI B;  4V2K A;  1C6O A;  3OA8 A;  3ZBM A;  2BH4 X;  1GQ1 A;  2Y0D A;  4FA4 A;  1NML A;  3CYT I;  4O1Q A;  4FAN A;  2V07 A;  1HZV A;  1KYO W;  1CSW A;  1FI7 A;  2C1D A;  2GC7 D;  2C1U A;  3M97 X;  1B7V A;  1DW2 A;  1OCD A;  1I8P A;  3TF5 A;  351C A;  1IRW A;  4L3H A;  1WVE C;  1CYJ A;  1BE3 D;  2BH5 X;  2DVH A;  1CHJ A;  3O1Y A;  1C52 A;  2PCC B;  4MU8 A;  1L0L D;  4WQD A;  1DIQ C;  2GB8 B;  1HJ3 A;  1H31 A;  1QL3 A;  5B66 V;  1YEB A;  1CHH A;  1BCC D;  1CTZ A;  1S5L V;  1LC1 A;  1MG2 D;  1FJ0 A;  1NU1 D;  2ORL A;  4RSZ A;  3WFE C;  5B5E V;  2C2C A;  3VMA A;  1SQQ D;  4XYD B;  3HQ7 A;  3H1I D;  1F1C A;  1CRH A;  1LMS A;  2XTS B;  4WQ9 A;  2YQB A;  3PXW A;  4L3G A;  1COR A;  1OAE A;  1I6E A;  2RN0 A;  4A7P A;  1L9B C;  3C2C A;  1QYZ A;  1CSV A;  2OZ1 A;  2BLF B;  1DII C;  1H32 B;  2L4D A;  3JBT B;  2N9I A;  2IBZ D;  4AAM A;  2Q3E A;  2LIR A;  3L75 D;  2N3Y A;  3SXT A;  3X39 A;  2HV4 A;  1RAP A;  4H0J A;  2YIU B;  3HQ8 A;  3PLN A;  4AAL A;  3CX5 W;  1DW0 A;  1R0Q A;  2C9X B;  4J20 A;  2AIU A;  3O5C A;  1KYO D;  1NTM D;  2FWL A;  1SQP D;  3OCD A;  2CE1 A;  1H32 A;  1E8E A;  1IO3 A;  1H1O A;  1MG3 D;  3SLE A;  2C8S A;  3SVW A;  2JWA A;  1CXC A;  4O1W A;  4WQB A;  1J3S A;  3PXT A;  1ZZH A;  3A0B V;  1C7M A;  1A8C A;  3CWB D;  3O20 A;  1VYD A;  1YFC A;  2ZBO A;  1FI3 A;  3L71 D;  5DF5 A;  2GC4 D;  2B10 B;  3FWL A;  5CIF B;  1WEJ F;  2AXT V;  5CIB B;  1SQV D;  5C0Z A;  2EXV A;  3RN0 A;  1I6D A;  1FCD C;  4EIC A;  1CXA A;  1YTC A;  5KAI V;  2QG4 A;  1U74 B;  4L1Q A;  3DR0 A;  5DJQ C;  5E79 V;  5EXQ A;  4EIF A;  1M6Z A;  4JCG A;  3L70 D;  5CYT R;  2MHM A;  3ZOO A;  1RZ6 A;  5GTI V;  2B0Z B;  4PD4 D;  2BCC D;  1CNO A;  3RN1 A;  1H9Y A;  2B11 B;  3L4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...