1NTZD

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 54
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntzD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntzD01
1GIWA 1H9XA 4GYDA 3L4MA 3OCDB 2N9YB 3ZBMA 2LITA 2D0SA 3VYMA 1N50A 4QAOA 2MTAC 1NU1D 2L4DA 1QYZA 4Y5RA 5CIBB 3WFDC 1CC5A 1FCDC 4P4QB 4PD4D 1FOCA 3DMIA 2V07A 1C6SA 4WQEA 1IRWA 3RN1A 1EZVD 2RMZA 3PXWA 5TJHA 2ORLA 1I6DA 3CX5W 3L70D 4RJTA 3H1KD 1CSXA 4V2KA 3GG2A 4N0KA 4L3GA 1AOQA 2GB8B 2FYUD 1CXCA 1E29A 4WQCA 4KMGA 2VHDA 1R0QA 2ZBOA 3ORVA 3KHUA 2GC7D 2D0WA 2EXVA 4H0KA 3NBTA 1H33A 1CSUA 2B12B 1HROA 3CX5D 1I8OA 4FANA 2CA3B 1KV9A 3VRDA 4FA5A 1W2LA 1SQVD 5CIEB 1L0LD 3ZOWA 3NBSA 2PCCB 1E8EA 3PXSA 1COTA 1CSVA 3CXHW 3RN0A 5KAIV 3BCCD 1EB7A 4EIEA 1NTMD 5E79V 1RZ6A 4K3IA 2XTSB 4UB8V 1QL3A 2C9XB 3M97X 1DW1A 2L91A 1GJQA 4FAVA 2I8FA 3WU2V 4AALA 5KAFV 3NWVA 1CTZA 3CXHD 5C9MA 3ITKA 1IZL0 1YEAA 3H1ID 4XXLA 2QJKB 2QJYB 1CIGA 155CA 3FWLA 1CIFA 3X39A 1I54A 1HRCA 2RN0A 3WFBC 1AKKA 4H0JA 2BCCD 1N90A 2BLFB 2CXBA 2ZXYA 1CYCA 1NMIA 1CNOA 1MZ4A 1DW2A 1QL4A 1PP9D 3SXTA 4FA1A 1CRHA 1H32A 1SQPD 3L75D 3TDKA 1KB9D 2GC4D 2YQBA 3H1LD 1J3SA 1OAEA 5B5EV 451CA 4WQBA 3WFCC 1L0ND 2Y0DA 1RAPA 5CYTR 4UB6V 2V08A 1C75A 2N3BA 1CYIA 4EIDA 2GIWA 4O1WA 1I5TA 1NTKD 1FHBA 1I8PA 1CHHA 1LFMA 1KIBA 1DIIC 4EDFA 2K9JB 1NIRA 1AYGA 1JDLA 1U75B 3ZOYA 3PLNA 2ZZS1 3CYTI 1IO3A 4O1QA 5EXQA 1CEDA 1C2NA 4D6TD 1H31A 3KZIV 4JCGA 1CTYA 5AURA 2KS1A 2QG4A 5B6QA 2Y0EA 5B66V 3TF5A 2ZOOA 1A8CA 1YNRA 3CU4A 3DP5A 3L74D 3PTZA 2BPBB 1NNOA 3HQ6A 3OA8A 3H1HD 2BH4X 3H1JD 4DY9A 4RSZA 1CHJA 3L73D 3SWSA 4XYDB 3WC8A 4WQ9A 1B7VA 1VYDA 2N9JA 5GTHV 3ZOOA 3SJLA 5CIFB 1H1OA 2QJPB 1H32B 3O20A 3VNWA 1ZRTD 2A06D 3OCDA 4WQDA 1YCCA 1ETPA 4AAMA 3C2CA 1HCMA 5CIHB 2C1UA 1M70A 2JTIB 4AANA 1M6ZA 4PW9B 1FI3A 1RZ5A 3WUIA 1QN2A 5DJQC 4IL6V 1C52A 1LC1A 1CRIA 2Y0CA 2N9IA 1C7MA 1HH7A 1IRVA 1BGYD 2FWLA 1LC2A 3CP5A 4AAOA 1DIQC 1S5LV 4FA9A 5IY51 2PCBB 1FI7A 4YE1A 1PPJD 1GQ1A 2O3JA 2YCCA 3A9FA 3RLMA 4L1QA 1MG2D 2CE1A 3PH2B 4GEDB 1C2RA 1YIQA 1H9YA 1RAQA 3HQ9A 3HQ8A 1BCCD 1WEJF 3VMAA 1LMSA 2FYNB 3TGUD 1K3GA 2ZONG 1NMLA 4WQAA 2JWAA 3A0BV 2JQRA 2PACA 351CA 1DT1A 1BE3D 1N15A 3O5CA 1F1FA 1DW0A 4FA4A 5DJQB 1H33B 3HQ7A 2C1VA 1CO6A 4EIFA 1SQQD 4Q5PA 2CE0A 3ZOXA 5CICB 2FRCA 4PWAA 1BL9A 2B0ZB 3A0HV 5KLVD 1AOFA 2C1DA 1FI9A 2C8SA 1M60A 2IBZD 1QKSA 3PXTA 5CIGB 2AIUA 1CXAA 1LS9A 1DVHA 1CIHA 2DGEA 5C0ZA 1CCHA 3L72D 1KYOD 2OZ1A 1KX2A 4L3HA 3L71D 1SQXD 1WVEC 2BH5X 3PHLA 1HJ5A 2DVHA 3WFEC 5DFSA 1I6EA 2AXTV 1MG3D 1CSWA 2B4ZA 1HJ3A 1KX7A 5DF5A 3GW6A 1E2RA 3O0RC 3DR0A 3JBTB 5TISV 4AX3A 3MK7C 1CCRA 1A56A 1OCDA 1DVVA 1N9CA 2N18C 3ZIYA 1GU2A 2BCNB 1GDVA 1IQCA 1CHIA 2LIRA 1DW3A 4LJIA 1YICA 1P84D 1HZVA 2CA4B 4NFGB 1CRJA 1CYJA 4A7PA 3CWBD 3ZCFA 2C2CA 5CIDB 4EICA 1FJ0A 2YK3A 1A2SA 2N3YA 1K3HA 2C1DB 1W5CT 2B10B 2Q3EA 5GTIV 1CRYA 1I55A 1S6VB 4FB1A 4PJ0V 1NTZD 1HZUA 1YFCA 5KLIB 1C6RA 1SQBD 1L9JC 3MK7B 1HJ4A 1U74B 2AI5A 5KKZB 3PRJA 2OZ1B 3L4OA 1YEBA 4MU8A 1H31B 1L9BC 2N18B 2MHMA 2BGVX 5H2FV 1CTJA 2HV4A 1CRCA 3SVWA 1CORA 4WQ7A 2KNCB 1GKSA 3OA8B 4J20A 2YIUB 4WQ8A 3SLEA 1CRGA 3O1YA 1CIEA 1F1CA 1KYOW 1ZZHA 1KB0A 2B11B 4U3FD 1YTCA 1C6OA 3RMZA 3TYIA
chains in the Genus database with same CATH superfamily
3M0AA 1H9XA 2WSCJ 1P84I 3VYMA 1HH0A 4QAOA 1NU1D 2L4DA 4C7NA 1PGQA 3FWNA 5M1BA 2SPZA 1QYZA 2KB7P 3L74J 1CC5A 3H1HJ 2I1KA 3L73J 3DMIA 1C6SA 1JUNA 3RN1A 5B66H 2J5UA 2ORLA 3AE2C 1I6DA 1GK6A 1JTHA 4YXWH 2E75C 1CSXA 1PPJG 3GG2A 1JY2P 3V2RA 2JO1A 1VQ9P 1E29A 3RK3E 1VQ5P 1RE4C 1SP4A 1U7JA 3ORVA 2OYIB 2XZRA 4H0KA 1YIJP 2ZYDA 1CSUA 2B12B 1OFCX 1VQNP 1Z56A 1HTLC 3H1JE 1KV9A 3RBZA 3MP7B 5CIEB 4BWNA 1YITP 1E8EA 1Y9BA 3HTKB 1R5SA 1VQ4P 5AW2B 1QL3A 2HODB 1M1JB 2R3CA 3GHGC 1BCCJ 1KV4A 3SWYA 4OGQD 3A5TA 3NTNA 3ITKA 2IDBA 2KZJA 2QJYB 4TLFA 5AVRB 1PGPA 3V5BA 1IC2A 1NVOA 4GOEA 1WMKA 1G2CA 1URQD 3A0BH 5H2FE 1CNOA 1MZ4A 2FYUK 1GL2D 1QL4A 1PP9D 3SXTA 1FJKA 3A0BE 1L4AD 1CRHA 4UB6H 1SQPD 1LTAC 2GC4D 3IN6A 4KHXA 3FXDA 4CPGA 2H43A 5DJUB 2P2UA 1MZ9A 1E79H 3A0HH 5CCGC 1SQVK 4HKZH 4H0LC 1GW4A 1M8OB 3A0HE 1URQA 3O6QA 2V08A 4LC1A 1GL2A 1L4AA 4EIDA 3SFEC 2N9BA 4N3YB 1J1DB 1OWAA 1SVFA 2M5AB 3FX0A 1FHBA 2NPSB 5KLVE 3KZIH 2K9JB 2QJPC 4QMAA 3BCCG 2HPCA 1JDLA 2C0XA 1U75B 1MUUA 3CYTI 3CCUP 1EXIA 4M3LA 2AXTE 4L75A 1H31A 2WSCH 1JY3N 4PD4E 1KC8Q 1LWUB 1M90Q 3TF5A 3A3YB 4Y99B 4EIJA 1A8CA 2QJKC 2P1JA 3CU4A 2H89C 2BPBB 2KNCA 2QM8A 3HQ6A 4YTPC 1YTZT 3H1KE 3H1JD 1CHJA 2XNDH 1B7VA 1RE3A 4WBAA 1T2KD 3CL3D 2WT7A 1H1OA 1QVGO 4AYCA 4I7ZC 1H32B 3O20A 3VNWA 3L75G 2A06D 1HUCA 1YCCA 1ETPA 1JCCA 2B9BA 1SQBJ 1HCMA 1M70A 1LT1A 4HYTB 1FI3A 2E74D 1L0NG 3WMM0 4DT0A 4UB8E 1QN2A 2YKOA 3AE4C 3WU2E 3ABVC 2WPRA 1NTME 1AVYA 4FA9A 1PL5A 1Q82Q 2PCBB 4PV1B 1Q7YQ 3HE4B 2FXOA 2M3BA 1GTWA 1GQ1A 2O3JA 1VQOP 1EZVG 3JC22 2E5TA 3BRTB 4XE5B 3SFDC 2Q3IA 1JY3P 2Z5HA 1DEBA 2DW3A 1NO4A 3H1IE 5AVXB 1RAQA 3HQ9A 3HQ8A 3MTUE 2K3RA 1NU1J 1A02F 1NMLA 4W7YA 2M0BA 2JWAA 3RL0D 2R44A 1L2PA 5DJQB 3AE3C 1SLQA 3KDPB 2C1VA 3L73G 4EIFA 2CPBA 1LTSC 3D6YA 4PWAA 2B0ZB 2KLVA 5KLVD 2C1DA 3N4XA 2D2CB 1AQTA 1M60A 4OGQC 3V2PA 5CIGB 4IOIH 1DVHA 2DGEA 1Y8AA 1VPCA 1CCHA 3L72D 1NTKE 4L3HA 3L71D 3F89A 1SQXD 1URQC 4WVZA 1GL2C 3Q2YA 1L4AC 1FOSE 3S4RA 2BEQD 3PHLA 4ZKPA 1HJ5A 2DVHA 2I1JA 5DFSA 4BRYA 2Z4EA 2ZYGA 2ZT9D 2KIKA 3H25A 1MFZA 2B4ZA 3CCEP 3L70E 4NPDA 3GW6A 1HVVA 2XV5A 2PAJA 4RESB 3DR0A 1KB9I 4AX3A 5BU5A 2ZAEB 1SFCD 1LJ2A 1A56A 4H13D 3HD7D 1BCCG 2N18C 3D0WA 4ZMDA 3P32A 2ZXEB 1MFTA 1L0LE 2WWWA 1SFCA 1KD1Q 1NAYA 2YIUC 1JEKA 3CWBD 2MJZA 3ZCFA 3HD7A 2XKMA 1ZW0A 2C2CA 2KI7B 1RE3C 1FJ0A 3CMEP 1LTJA 3TNUB 1A2SA 1PP9J 2B10B 2Q3EA 2IBZG 2E75B 1SQPJ 1LT9B 2ZVNB 1EDLA 1NTZD 3U59A 1HJ4A 2G3AA 4D6TG 2AXCA 1FDIA 1VDFA 1T2KC 2MHMA 1DD4A 3IR9A 2ZYAA 2BGVX 5H2FV 1CTJA 1JMBA 1QL2A 2HV4A 1IFNA 3SVWA 2PGDA 3CC7P 3SLEA 1VQ7P 1KYOW 2E74C 3I5CA 1AQ5A 1YQ4C 3OJAB 3TGUE 2ZVOB 1IJDB 3RMZA 2HYNA 3H1LE 5APTA 2W90A 1GIWA 3B8EB 5AW0B 1AV1A 3L4MA 3ZBMA 1KN7A 1EDKA 1D7MA 2RH0A 5CIBB 1H0TB 3H1JJ 1FZEA 1RH5B 3V2QA 2V07A 4WY4D 4HJGH 4WQEA 1GW3A 2FYZA 3CX5W 3L70D 2GUVA 2P10A 4RJTA 1A02J 3RL0C 2JJLA 2FFDB 2N1TB 3R4YA 2PRRA 2WPSA 4L3GA 1DH3A 2H7HA 4WY4A 2GM4A 1R0QA 3KHUA 3CD6P 1CI6B 3NBTA 2K9YA 1H33A 2Y9YA 2Q6QA 1U7MA 1X79B 2IX7C 1CZQA 5AVYB 2C0WA 1QL1A 1FDMA 1L0LD 3PXSA 1CSVA 3CXHW 3RN0A 2IBZI 4JF7A 2FBWC 2O01J 2WSSH 2XTSB 4UB8V 1FOSF 4N6JA 2C9XB 3MGNA 1N2DC 2L91A 1KQSO 1OW6A 2K88A 1J1EB 2ZT9C 3WU2V 3AEDC 4H44B 1N73A 4AALA 5KAFV 1RF0A 3AE9C 3W68A 1NU1G 1IZL0 4YPCA 1BGYE 2QJKB 1CIGA 155CA 1CIFA 1SFCC 3LIEA 2CPSA 2M3EA 1PPJE 4H13C 1HRCA 2RN0A 3HD7C 4L74A 4H0JA 2ZXYA 1N90A 2BLFB 2CXBA 5KLVJ 4OVNF 1LTJC 1FBMA 1FZFA 2K37A 3TSIA 2E76B 1FS0E 5APSA 2AEJA 2W27A 3H1LD 1J3SA 451CA 3L71J 4WQBA 1SQXJ 1NYHA 1C75A 1GK4A 2OGUA 1JM0A 1SQQE 3EQ2A 4I6MC 3CCLP 3II6A 1OMIA 1N86A 1NKZB 5CJ0A 1DIIC 1NIRA 1LP1B 1H88A 1HGVA 1IK9A 2JKVA 1QEXA 1IO3A 4C7RA 1KYOE 1QGKB 4GT1A 2OYHA 3M9HA 2H8PD 2KS1A 3BRVB 2QG4A 4NPFX 3H32A 2B87A 3EFGA 1K8AQ 2ZOOA 1Q90D 1BDDA 3PTZA 3OA8A 3CWBJ 4DY9A 4XYDB 3WC8A 4WQ9A 1HWTC 1VYDA 1G2CB 2IZ0A 2YMKA 2N9JA 4OGQB 1PP9G 3NXSA 3SJLA 4R4LA 1JY2O 1NTZJ 1SQPG 1L0NK 2QSIA 1PGJA 3IAOA 4AAMA 2J58A 3NFQA 2V7QJ 3CX5E 1YHQP 5KAIE 3C2CA 2C1UA 3PH0A 2E5YA 2JTIB 1VF5B 1M6ZA 4WY4C 1RZ5A 2XDJA 5AW1B 1GL2B 4IL6V 1LC1A 1PV3A 1CRIA 1IFJA 2Y0CA 1C7MA 1ZN5A 1BGYD 3OW2O 2FXPA 2IYPA 3BASA 1S5LV 3S1KA 3WUTA 1FI7A 3AE6C 1PPJD 4XA4A 3CCQP 1SQXK 1RF1B 2HPCB 2O01H 5H2FH 2YCCA 2YNYA 3H6PA 3A9FA 3RLMA 3CXHE 4L1QA 2YO2A 3G71P 2OYIA 1WEJF 1N73C 1RHZB 1LMSA 2FYNB 1RF0C 3CMAP 1NTKJ 5AW3B 3WUUA 2JQRA 2P67A 1N15A 3O5CA 3H1JG 1K04A 3A2AA 4JYCA 1SQQD 5BVZA 2CE0A 3ZOXA 1KB9E 4U3FE 1BL9A 1AOFA 3L70J 2HODA 1M1JA 2B89A 2WT7B 1S4XA 2A06G 3VMXA 1LGHB 1QLED 1AFOA 2R32A 2AXTH 1AJYA 1KYOD 4PD4H 3P8MC 3P8CE 4WWIA 2YKPA 3AE8C 1NKNA 3RK3D 1NTZK 1I6EA 1L0LJ 3T97B 1EZVE 1HJ3A 2KLUA 1KX7A 3B71A 5DF5A 2QIWA 3Q3DA 1E2RA 5KLIC 3JBTB 2BCCG 2NPSD 1FZCB 3CCJP 2FYUE 1CCRA 4BXLA 3UIAA 1OCDA 1X9VA 2WPQA 3AEGC 1GMJA 5GTHE 2OYHC 5C39A 3L73E 1DW3A 2M5AA 3C9IA 4UB8H 1SQVE 2NPSA 5AW8B 2OTJP 1E5WA 5CHXA 1HZVA 4NFGB 1CRJA 1CYJA 2K9JA 4A7PA 3WU2H 5KJ7D 1FZBA 5KAFE 2YK3A 4K3AA 3E1IA 2C1DB 5AW4B 2E43A 5GTIV 4JYBA 1I55A 4FB1A 1N7SB 4PJ0V 2BEZF 1YFCA 2V7QH 2KSEA 3H1LJ 3MK7B 1LWUA 1U74B 5AVWB 3V4WA 2AI5A 3L72G 5KJ7A 5KKZB 3CCSP 3HRNA 3L4OA 1YEBA 3L71G 1SQXG 1W5CE 2P58A 1YJ9P 2KZIA 2ZXXA 1YBKA 3B5NB 1VQKP 1KILB 2WITA 2WMMA 4ZKUA 1Q86Q 4R4MA 4RO0A 4W7ZA 3L74G 1QX8A 3MHVA 3H1HG 4J20A 1IFPA 3MIWA 4WQ8A 1OXZA 2E42A 1F1CA 2B11B 1BCCE 1PZQA 2IFMA 1JY3O 4U3FD 1RY3A 1C6OA 5AVVB 2A45H 4PV1D 5APQA 2OYIC 1HF9A 3OCDB 1MKMA 2LITA 2R5BA 5APUA 2O1JA 1BSHA 1N50A 2MTAC 3RL0g 1JCDA 1X22A 3P8CD 4PD4D 4P4QB 3G9RA 1SFCB 2IBZE 2LR2A 3CWBG 2W6JH 5AVTB 3MZWB 1VQLP 1EZVD 2Q7CA 3E1RA 3PXWA 5TJHA 1K9MQ 3HUSB 1SQBK 3USSA 3NMDA 3H1KD 4EI2A 1M1JC 1WT6A 4D6TE 4V2KA 2Q9IA 1NTZG 4K35A 4N0KA 1OW8A 2GB8B 2D2CD 2FYUD 1CXCA 5APXA 2OQQA 5TISE 2GC7D 2D0WA 2QJYC 1HROA 2C9NY 2CA3B 1AVOA 3Q1MA 3VRDA 1BGYJ 1USDA 1W2LA 1SQVD 2WTYA 3F5HA 3TYYA 2GUSA 2PCCB 1COTA 1JOCA 3CCMP 3VN0A 4KJMA 5KAIV 1S1CX 3M9QA 1EB7A 4Y28J 3N7NA 1NTMD 2W8ZA 3MD0A 4IL6E 2UWJE 1FJPA 1M56D 1NU1K 3RK3C 1S5LH 1GJQA 1WRGA 1P84E 1S5LE 4C46A 4PD4I 1CTZA 1HJ0A 5C9MA 1J1DC 1NHLA 4MN4C 1YEAA 3H1ID 4XXLA 2NPSC 3X39A 1LTIC 1SQQJ 3IF4A 4HH2A 3WFBC 1AKKA 1XTCC 1CYCA 2KYVA 3LW5J 1NMIA 3L70G 4FA1A 2R5DA 3PJSK 3TDKA 4JBZA 1KQFB 4GDOA 2W83C 2YQBA 1LWUC 1RQVA 1OAEA 5KJ7C 2L5GB 4Y99C 3WFCC 2XU6A 3Q5SA 5CYTR 3GHGB 1BE3E 4UB6V 4DZOA 1K73Q 3WUVA 1CYIA 3U1CA 4O1WA 1NTKD 3CI9A 1J2JB 3TNUA 1CHHA 3VTPC 4L73A 1LT9A 4EDFA 1JNMA 1AYGA 5AW5B 2JP3A 1ZP0C 3ZOYA 5AW9B 3JSVC 1Q2NA 4O1QA 4D6TD 1M57D 2WQYC 3KZIV 3Q5RA 1CTYA 5AURA 1N73B 5B6QA 1SQBG 2Y0EA 4ASWA 3B4SA 4DCKA 1YQ3C 4H0LB 1NH4A 1DD3A 3V6IA 1YNRA 3RK2D 3DP5A 3EWKA 4PV1C 3SWSA 1SQPK 3PP5A 4N78E 2RKLA 2BASA 1VQ8P 3M0DA 1IZNB 5GTHV 3ZOOA 3GLMA 1ZXGA 5CIFB 1HBWA 2QJPB 3JCUH 2A45I 3JCUE 4WQDA 1K05A 1X8YA 1IFDA 3D71A 3V2NA 3FGAD 1X0TA 1BDCA 1H0TA 5GTIH 2N1TD 3WUIA 4LGDE 5DJQC 2JR8A 5GTIE 1FAVA 3R2PA 4PJ0H 1RQUA 3FXEA 4PJ0E 4DOJA 2N9IA 4C7NB 2FWLA 4AAOA 2ZFCA 2D2CC 5APYA 5IY51 4YE1A 3BATA 2FFDA 1U57A 2N1TA 4EOTA 4U3FJ 3VOPA 2H88C 1MV8A 1N8RQ 3HE5A 1T3JA 3MUDA 1JTHB 4GEDB 1EC5A 1JY2N 4I7ZB 1TU3F 2KSJA 1CI6A 3BVHA 4Z1MH 4GIFA 1YTZI 3VMAA 3TGUD 2ZONG 4WQAA 1S3JA 2PACA 5AW7B 1BE3D 1F1FA 5AVZB 4B86A 4FA4A 4H44D 1M1KQ 1H89A 3RGUA 4W80A 3HQ7A 4Q5PA 5CICB 2FRCA 3LW5H 2OTLP 1FI9A 3H1KJ 5APWA 3PXTA 1KZUB 1GD2E 3RBXA 3QH9A 1CXAA 1LS9A 1W2BO 2FYUJ 1CIHA 1PFIA 5C0ZA 1KYOH 3AEAC 2Y9ZA 2E76D 2OZ1A 1S72P 2LKMA 3AE7C 1WVEC 1DIPA 1KTMA 1SQVJ 4GKGA 1BGYG 1GU5A 1CSWA 4I2LC 5B66E 2Z5IA 2WPVB 3VMYA 1LT9C 1NTMJ 4N78D 5TISV 1T8ZA 2Q5UA 2Q1KA 1LTGC 1IK7A 1GZLA 1M7LA 1LNQA 3SWFA 1HGZA 1R5LA 3V4QA 3CX5H 1KQGB 5KAIH 1N9CA 4YXDC 3ZIYA 2KP8A 1JB0J 2BCNB 1OZHA 1CHIA 3AEBC 1ZOYC 1H8AA 2P7JA 3H1IJ 4OWFA 3CCVP 3E7KA 3KYQA 1JMMA 1NAFA 5CBOA 3CLQA 2VRSA 1BSNA 1URQB 3O6QB 5KLVK 2G8YA 2KUBA 1L4AB 1LP1A 1SQQG 3BCCE 2A06E 4EICA 1GU4A 3AEFC 1W5CT 3M0DC 4JPZB 2J59M 1CRYA 2OYOA 3RK2C 1C6RA 3CXHH 3G4SP 1L9JC 1IO4A 1ZV8A 2O01N 3D70A 2O1KA 4MU8A 5L8RJ 1IFMA 1ZMEC 1H31B 1L9BC 2M8RA 4KT0J 2N18B 1OVRA 1USEA 3M9BA 1VF5D 2WSFH 1CRCA 2BCCE 3ZDMA 2KNCB 1GKSA 2YIUB 1CRGA 3O1YA 3HTKA 1CIEA 4UB6E 3L4FA 1KMIZ 1KB9H 3L75E 2FFDC 2N1TC 5EFWB 1EXJA 2IZ1A 3U1AA 3RK3B 3MUDC 4D6TJ 4GYDA 1L0NE 2JDIH 2N9YB 4IL6X 2D0SA 3C8VA 4GOFA 2OARA 1NTMK 2WSEH 4Y5RA 3EFFK 3L37A 3WFDC 1S5LX 1G1IA 2IYOA 1FCDC 1FOCA 5BU8B 1EQ7A 1FDOA 1KILE 3KZIE 1RF1A 1Q81Q 3M06A 2PP6A 1IRWA 1OX3A 4WB4A 2RMZA 3CC4P 3L72E 3L71E 2E74B 1SQXE 1J1EC 4H44C 4I1LA 1AOQA 4OH8B 1FE6A 4WQCA 4KMGA 2FY8A 2VHDA 2ZBOA 5GTHH 2EXVA 2AEFA 5CBNA 1ZLLA 3L74E 3H1HE 3CX5D 1I8OA 4IFMA 4FANA 4FA5A 1YYCA 4ASVA 1GDTA 2JEEA 3GF3A 3ZOWA 3NBSA 1S2EA 2E76C 4HB1A 2POHA 3BCCD 1ZRTE 4JQ0D 5KAFH 4EIEA 1EDJA 5E79V 1RZ6A 4K3IA 5AVUB 4U3FG 5KLVG 3M97X 3RL0B 1DW1A 1KYOI 1NTKK 3G3ZA 2KXPB 4FAVA 2I8FA 3M91A 4U7JA 1PIXA 3TGUJ 1DEEG 3NWVA 2JWDA 2MKVA 3CWBE 3CXHD 4LLHA 3T97A 1BE3J 3L36A 3FWLA 1DX7A 3KXDA 1I54A 1VQ6P 2YXRB 1YJWP 5CCHD 3KQGA 1NTZE 4BRYB 2BCCD 1FZCA 3L35A 2KOGA 2QRXA 1YI2P 1DW2A 3H1KG 1H32A 3L75D 3GMAA 1KB9D 1EDIA 3CX5I 2FYUG 2QE7H 5CCHA 5B5EV 2HR3A 1N7SD 3VP8A 1L0ND 2KK7A 2Y0DA 1RAPA 2ZT9B 1L0LK 2N3BA 2K1AA 3AE5C 2GIWA 1I5TA 1CSBA 1SQVG 2NRGA 4NPEA 1I8PA 1LTTC 1LFMA 3W67A 1KIBA 4RKUJ 3B5ND 1N7SA 3HE4A 4H13B 3HD7B 1KILD 3A7OA 3IFMA 1XTGB 1NTMG 5DJTB 3PLNA 3TK1A 2ZZS1 1LTJB 3VP9A 5KTBA 3CXHI 1VF5C 5EXQA 1CEDA 1C2NA 1ZR2A 4JCGA 1KFMA 3B5NA 4TT3H 2V4HA 1VQPP 1KILA 5TISH 5B66V 3H1IG 2LXBA 2NZ2A 3L74D 3CCRP 1NNOA 1HJBA 2W6AA 3H1HD 2BH4X 4RSZA 3L73D 1Y47A 1RF1C 3CPWO 1UIXA 1R8EA 3VMZA 5APVA 1ZRTD 4IL6H 3OCDA 2IFNA 2AEMA 2FYNC 5CIHB 3QWOC 4AANA 3AE1C 3OAKA 4PW9B 3S9OA 2QEXP 1P84H 2A45G 5CMZA 1AA0A 1KORA 1C52A 1HH7A 1NTKG 1IRVA 1LC2A 3CP5A 1EZVI 3I56P 5AW6B 3HUSA 2LXCB 2XNXA 1DIQC 2ITAA 1S9KE 1NWQA 1OVVA 1YJNP 2QM7A 2YXQB 1T3UA 1FC2C 3K5BA 1SQBE 1MG2D 2CE1A 3PH2B 3Q5PA 4IFDK 1C2RA 1YIQA 4XFJA 1H9YA 1NGMB 1FU1A 1BCCD 1K3GA 4GODA 4WY4B 2E75D 3A0BV 351CA 1DT1A 1OW7A 2WZ7A 1DW0A 1LTBC 1H33B 1VL2A 1SS1A 1CO6A 4ZNCA 3OA7A 1L0LG 2YO3A 1FZCC 1CW5A 3A0HV 2IPPA 2C8SA 1ZR4A 2IBZD 1QKSA 4AQRD 2AIUA 3RK2B 2C9LY 1OVUA 2I8DA 2QA4P 5CCHC 1NU1E 1RE4A 1KX2A 4IFFA 2PFXA 2HLOA 1W2EA 2ZJSE 3VYIA 1IFIA 1QVFO 2BH5X 4EYYQ 3WFEC 3D6ZA 2AXTV 1PGOA 1MG3D 4DJGA 3SSUA 3C1LA 1T6AA 2QVAA 3KPEA 3BCCJ 1N7SC 5CJ4A 1VQMP 3O0RC 5AVSB 2B88A 1KQLA 3MK7C 3HE5B 5KKZC 1DVVA 3GHGA 1NJIQ 1GU2A 3TGUG 1GDVA 2GA1A 1IQCA 2LIRA 3B5NC 5E79H 2R3SA 3H1LG 1SQQK 2WVRA 1KILC 4O9BA 5E79E 4LJIA 1YICA 1BE3G 2HFED 3O8ZA 1P84D 2CA4B 4AUWA 2WSFJ 5CCGD 2BCCJ 2W6BA 4H0LD 5CIDB 1FZAA 1UIIA 2N3YA 1K3HA 1S9KD 5K5GB 3AECC 1S6VB 1G1JA 3L75J 3P7KA 1HZUA 5KLIB 1FZGA 3AEEC 2HG5D 2FKWB 2YMYA 1SQBD 3SWKA 3GF7A 5CCGA 1L0NJ 1N7LA 3PRJA 2OZ1B 1OIPA 2OYHB 4L76A 2KS1B 2YKQA 3H32B 2B87B 2OTKE 5AVQB 2WSEJ 1NOHA 1KFNA 1CORA 5B5EH 1JO5A 3HUSC 4WQ7A 2CK3H 3G6EP 5B5EE 1PP9E 3OA8B 1SQPE 1ZZHA 1KB0A 3CC2P 3LIDA 2FXMA 3L72J 1YTCA 3I55P 3TYIA
chains in the Genus database with same CATH topology
1GIWA 1H9XA 4GYDA 3L4MA 3OCDB 2N9YB 3ZBMA 2LITA 2D0SA 3VYMA 1N50A 4QAOA 2MTAC 1NU1D 2L4DA 1QYZA 4Y5RA 5CIBB 3WFDC 1CC5A 1FCDC 4P4QB 4PD4D 1FOCA 3DMIA 2V07A 1C6SA 4WQEA 1IRWA 3RN1A 1EZVD 2RMZA 3PXWA 5TJHA 2ORLA 1I6DA 3CX5W 3L70D 4RJTA 3H1KD 1CSXA 4V2KA 3GG2A 4N0KA 4L3GA 1AOQA 2GB8B 2FYUD 1CXCA 1E29A 4WQCA 4KMGA 2VHDA 1R0QA 2ZBOA 3ORVA 3KHUA 2GC7D 2D0WA 2EXVA 4H0KA 3NBTA 1H33A 1CSUA 2B12B 1HROA 3CX5D 1I8OA 4FANA 2CA3B 1KV9A 3VRDA 4FA5A 1W2LA 1SQVD 5CIEB 1L0LD 3ZOWA 3NBSA 2PCCB 1E8EA 3PXSA 1COTA 1CSVA 3CXHW 3RN0A 5KAIV 3BCCD 1EB7A 4EIEA 1NTMD 5E79V 1RZ6A 4K3IA 2XTSB 4UB8V 1QL3A 2C9XB 3M97X 1DW1A 2L91A 1GJQA 4FAVA 2I8FA 3WU2V 4AALA 5KAFV 3NWVA 1CTZA 3CXHD 5C9MA 3ITKA 1IZL0 1YEAA 3H1ID 4XXLA 2QJKB 2QJYB 1CIGA 155CA 3FWLA 1CIFA 3X39A 1I54A 1HRCA 2RN0A 3WFBC 1AKKA 4H0JA 2BCCD 1N90A 2BLFB 2CXBA 2ZXYA 1CYCA 1NMIA 1CNOA 1MZ4A 1DW2A 1QL4A 1PP9D 3SXTA 4FA1A 1CRHA 1H32A 1SQPD 3L75D 3TDKA 1KB9D 2GC4D 2YQBA 3H1LD 1J3SA 1OAEA 5B5EV 451CA 4WQBA 3WFCC 1L0ND 2Y0DA 1RAPA 5CYTR 4UB6V 2V08A 1C75A 2N3BA 1CYIA 4EIDA 2GIWA 4O1WA 1I5TA 1NTKD 1FHBA 1I8PA 1CHHA 1LFMA 1KIBA 1DIIC 4EDFA 2K9JB 1NIRA 1AYGA 1JDLA 1U75B 3ZOYA 3PLNA 2ZZS1 3CYTI 1IO3A 4O1QA 5EXQA 1CEDA 1C2NA 4D6TD 1H31A 3KZIV 4JCGA 1CTYA 5AURA 2KS1A 2QG4A 5B6QA 2Y0EA 5B66V 3TF5A 2ZOOA 1A8CA 1YNRA 3CU4A 3DP5A 3L74D 3PTZA 2BPBB 1NNOA 3HQ6A 3OA8A 3H1HD 2BH4X 3H1JD 4DY9A 4RSZA 1CHJA 3L73D 3SWSA 4XYDB 3WC8A 4WQ9A 1B7VA 1VYDA 2N9JA 5GTHV 3ZOOA 3SJLA 5CIFB 1H1OA 2QJPB 1H32B 3O20A 3VNWA 1ZRTD 2A06D 3OCDA 4WQDA 1YCCA 1ETPA 4AAMA 3C2CA 1HCMA 5CIHB 2C1UA 1M70A 2JTIB 4AANA 1M6ZA 4PW9B 1FI3A 1RZ5A 3WUIA 1QN2A 5DJQC 4IL6V 1C52A 1LC1A 1CRIA 2Y0CA 2N9IA 1C7MA 1HH7A 1IRVA 1BGYD 2FWLA 1LC2A 3CP5A 4AAOA 1DIQC 1S5LV 4FA9A 5IY51 2PCBB 1FI7A 4YE1A 1PPJD 1GQ1A 2O3JA 2YCCA 3A9FA 3RLMA 4L1QA 1MG2D 2CE1A 3PH2B 4GEDB 1C2RA 1YIQA 1H9YA 1RAQA 3HQ9A 3HQ8A 1BCCD 1WEJF 3VMAA 1LMSA 2FYNB 3TGUD 1K3GA 2ZONG 1NMLA 4WQAA 2JWAA 3A0BV 2JQRA 2PACA 351CA 1DT1A 1BE3D 1N15A 3O5CA 1F1FA 1DW0A 4FA4A 5DJQB 1H33B 3HQ7A 2C1VA 1CO6A 4EIFA 1SQQD 4Q5PA 2CE0A 3ZOXA 5CICB 2FRCA 4PWAA 1BL9A 2B0ZB 3A0HV 5KLVD 1AOFA 2C1DA 1FI9A 2C8SA 1M60A 2IBZD 1QKSA 3PXTA 5CIGB 2AIUA 1CXAA 1LS9A 1DVHA 1CIHA 2DGEA 5C0ZA 1CCHA 3L72D 1KYOD 2OZ1A 1KX2A 4L3HA 3L71D 1SQXD 1WVEC 2BH5X 3PHLA 1HJ5A 2DVHA 3WFEC 5DFSA 1I6EA 2AXTV 1MG3D 1CSWA 2B4ZA 1HJ3A 1KX7A 5DF5A 3GW6A 1E2RA 3O0RC 3DR0A 3JBTB 5TISV 4AX3A 3MK7C 1CCRA 1A56A 1OCDA 1DVVA 1N9CA 2N18C 3ZIYA 1GU2A 2BCNB 1GDVA 1IQCA 1CHIA 2LIRA 1DW3A 4LJIA 1YICA 1P84D 1HZVA 2CA4B 4NFGB 1CRJA 1CYJA 4A7PA 3CWBD 3ZCFA 2C2CA 5CIDB 4EICA 1FJ0A 2YK3A 1A2SA 2N3YA 1K3HA 2C1DB 1W5CT 2B10B 2Q3EA 5GTIV 1CRYA 1I55A 1S6VB 4FB1A 4PJ0V 1NTZD 1HZUA 1YFCA 5KLIB 1C6RA 1SQBD 1L9JC 3MK7B 1HJ4A 1U74B 2AI5A 5KKZB 3PRJA 2OZ1B 3L4OA 1YEBA 4MU8A 1H31B 1L9BC 2N18B 2MHMA 2BGVX 5H2FV 1CTJA 2HV4A 1CRCA 3SVWA 1CORA 4WQ7A 2KNCB 1GKSA 3OA8B 4J20A 2YIUB 4WQ8A 3SLEA 1CRGA 3O1YA 1CIEA 1F1CA 1KYOW 1ZZHA 1KB0A 2B11B 4U3FD 1YTCA 1C6OA 3RMZA 3TYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GIW A;  1H9X A;  4GYD A;  3L4M A;  3OCD B;  2N9Y B;  3ZBM A;  2LIT A;  2D0S A;  3VYM A;  1N50 A;  4QAO A;  2MTA C;  1NU1 D;  2L4D A;  1QYZ A;  4Y5R A;  5CIB B;  3WFD C;  1CC5 A;  1FCD C;  4P4Q B;  4PD4 D;  1FOC A;  3DMI A;  2V07 A;  1C6S A;  4WQE A;  1IRW A;  3RN1 A;  1EZV D;  2RMZ A;  3PXW A;  5TJH A;  2ORL A;  1I6D A;  3CX5 W;  3L70 D;  4RJT A;  3H1K D;  1CSX A;  4V2K A;  3GG2 A;  4N0K A;  4L3G A;  1AOQ A;  2GB8 B;  2FYU D;  1CXC A;  1E29 A;  4WQC A;  4KMG A;  2VHD A;  1R0Q A;  2ZBO A;  3ORV A;  3KHU A;  2GC7 D;  2D0W A;  2EXV A;  4H0K A;  3NBT A;  1H33 A;  1CSU A;  2B12 B;  1HRO A;  3CX5 D;  1I8O A;  4FAN A;  2CA3 B;  1KV9 A;  3VRD A;  4FA5 A;  1W2L A;  1SQV D;  5CIE B;  1L0L D;  3ZOW A;  3NBS A;  2PCC B;  1E8E A;  3PXS A;  1COT A;  1CSV A;  3CXH W;  3RN0 A;  5KAI V;  3BCC D;  1EB7 A;  4EIE A;  1NTM D;  5E79 V;  1RZ6 A;  4K3I A;  2XTS B;  4UB8 V;  1QL3 A;  2C9X B;  3M97 X;  1DW1 A;  2L91 A;  1GJQ A;  4FAV A;  2I8F A;  3WU2 V;  4AAL A;  5KAF V;  3NWV A;  1CTZ A;  3CXH D;  5C9M A;  3ITK A;  1IZL 0;  1YEA A;  3H1I D;  4XXL A;  2QJK B;  2QJY B;  1CIG A;  155C A;  3FWL A;  1CIF A;  3X39 A;  1I54 A;  1HRC A;  2RN0 A;  3WFB C;  1AKK A;  4H0J A;  2BCC D;  1N90 A;  2BLF B;  2CXB A;  2ZXY A;  1CYC A;  1NMI A;  1CNO A;  1MZ4 A;  1DW2 A;  1QL4 A;  1PP9 D;  3SXT A;  4FA1 A;  1CRH A;  1H32 A;  1SQP D;  3L75 D;  3TDK A;  1KB9 D;  2GC4 D;  2YQB A;  3H1L D;  1J3S A;  1OAE A;  5B5E V;  451C A;  4WQB A;  3WFC C;  1L0N D;  2Y0D A;  1RAP A;  5CYT R;  4UB6 V;  2V08 A;  1C75 A;  2N3B A;  1CYI A;  4EID A;  2GIW A;  4O1W A;  1I5T A;  1NTK D;  1FHB A;  1I8P A;  1CHH A;  1LFM A;  1KIB A;  1DII C;  4EDF A;  2K9J B;  1NIR A;  1AYG A;  1JDL A;  1U75 B;  3ZOY A;  3PLN A;  2ZZS 1;  3CYT I;  1IO3 A;  4O1Q A;  5EXQ A;  1CED A;  1C2N A;  4D6T D;  1H31 A;  3KZI V;  4JCG A;  1CTY A;  5AUR A;  2KS1 A;  2QG4 A;  5B6Q A;  2Y0E A;  5B66 V;  3TF5 A;  2ZOO A;  1A8C A;  1YNR A;  3CU4 A;  3DP5 A;  3L74 D;  3PTZ A;  2BPB B;  1NNO A;  3HQ6 A;  3OA8 A;  3H1H D;  2BH4 X;  3H1J D;  4DY9 A;  4RSZ A;  1CHJ A;  3L73 D;  3SWS A;  4XYD B;  3WC8 A;  4WQ9 A;  1B7V A;  1VYD A;  2N9J A;  5GTH V;  3ZOO A;  3SJL A;  5CIF B;  1H1O A;  2QJP B;  1H32 B;  3O20 A;  3VNW A;  1ZRT D;  2A06 D;  3OCD A;  4WQD A;  1YCC A;  1ETP A;  4AAM A;  3C2C A;  1HCM A;  5CIH B;  2C1U A;  1M70 A;  2JTI B;  4AAN A;  1M6Z A;  4PW9 B;  1FI3 A;  1RZ5 A;  3WUI A;  1QN2 A;  5DJQ C;  4IL6 V;  1C52 A;  1LC1 A;  1CRI A;  2Y0C A;  2N9I A;  1C7M A;  1HH7 A;  1IRV A;  1BGY D;  2FWL A;  1LC2 A;  3CP5 A;  4AAO A;  1DIQ C;  1S5L V;  4FA9 A;  5IY5 1;  2PCB B;  1FI7 A;  4YE1 A;  1PPJ D;  1GQ1 A;  2O3J A;  2YCC A;  3A9F A;  3RLM A;  4L1Q A;  1MG2 D;  2CE1 A;  3PH2 B;  4GED B;  1C2R A;  1YIQ A;  1H9Y A;  1RAQ A;  3HQ9 A;  3HQ8 A;  1BCC D;  1WEJ F;  3VMA A;  1LMS A;  2FYN B;  3TGU D;  1K3G A;  2ZON G;  1NML A;  4WQA A;  2JWA A;  3A0B V;  2JQR A;  2PAC A;  351C A;  1DT1 A;  1BE3 D;  1N15 A;  3O5C A;  1F1F A;  1DW0 A;  4FA4 A;  5DJQ B;  1H33 B;  3HQ7 A;  2C1V A;  1CO6 A;  4EIF A;  1SQQ D;  4Q5P A;  2CE0 A;  3ZOX A;  5CIC B;  2FRC A;  4PWA A;  1BL9 A;  2B0Z B;  3A0H V;  5KLV D;  1AOF A;  2C1D A;  1FI9 A;  2C8S A;  1M60 A;  2IBZ D;  1QKS A;  3PXT A;  5CIG B;  2AIU A;  1CXA A;  1LS9 A;  1DVH A;  1CIH A;  2DGE A;  5C0Z A;  1CCH A;  3L72 D;  1KYO D;  2OZ1 A;  1KX2 A;  4L3H A;  3L71 D;  1SQX D;  1WVE C;  2BH5 X;  3PHL A;  1HJ5 A;  2DVH A;  3WFE C;  5DFS A;  1I6E A;  2AXT V;  1MG3 D;  1CSW A;  2B4Z A;  1HJ3 A;  1KX7 A;  5DF5 A;  3GW6 A;  1E2R A;  3O0R C;  3DR0 A;  3JBT B;  5TIS V;  4AX3 A;  3MK7 C;  1CCR A;  1A56 A;  1OCD A;  1DVV A;  1N9C A;  2N18 C;  3ZIY A;  1GU2 A;  2BCN B;  1GDV A;  1IQC A;  1CHI A;  2LIR A;  1DW3 A;  4LJI A;  1YIC A;  1P84 D;  1HZV A;  2CA4 B;  4NFG B;  1CRJ A;  1CYJ A;  4A7P A;  3CWB D;  3ZCF A;  2C2C A;  5CID B;  4EIC A;  1FJ0 A;  2YK3 A;  1A2S A;  2N3Y A;  1K3H A;  2C1D B;  1W5C T;  2B10 B;  2Q3E A;  5GTI V;  1CRY A;  1I55 A;  1S6V B;  4FB1 A;  4PJ0 V;  1NTZ D;  1HZU A;  1YFC A;  5KLI B;  1C6R A;  1SQB D;  1L9J C;  3MK7 B;  1HJ4 A;  1U74 B;  2AI5 A;  5KKZ B;  3PRJ A;  2OZ1 B;  3L4O A;  1YEB A;  4MU8 A;  1H31 B;  1L9B C;  2N18 B;  2MHM A;  2BGV X;  5H2F V;  1CTJ A;  2HV4 A;  1CRC A;  3SVW A;  1COR A;  4WQ7 A;  2KNC B;  1GKS A;  3OA8 B;  4J20 A;  2YIU B;  4WQ8 A;  3SLE A;  1CRG A;  3O1Y A;  1CIE A;  1F1C A;  1KYO W;  1ZZH A;  1KB0 A;  2B11 B;  4U3F D;  1YTC A;  1C6O A;  3RMZ A;  3TYI A; 
#chains in the Genus database with same CATH topology
 3M0A A;  1H9X A;  2WSC J;  1P84 I;  3VYM A;  1HH0 A;  4QAO A;  1NU1 D;  2L4D A;  4C7N A;  1PGQ A;  3FWN A;  5M1B A;  2SPZ A;  1QYZ A;  2KB7 P;  3L74 J;  1CC5 A;  3H1H J;  2I1K A;  3L73 J;  3DMI A;  1C6S A;  1JUN A;  3RN1 A;  5B66 H;  2J5U A;  2ORL A;  3AE2 C;  1I6D A;  1GK6 A;  1JTH A;  4YXW H;  2E75 C;  1CSX A;  1PPJ G;  3GG2 A;  1JY2 P;  3V2R A;  2JO1 A;  1VQ9 P;  1E29 A;  3RK3 E;  1VQ5 P;  1RE4 C;  1SP4 A;  1U7J A;  3ORV A;  2OYI B;  2XZR A;  4H0K A;  1YIJ P;  2ZYD A;  1CSU A;  2B12 B;  1OFC X;  1VQN P;  1Z56 A;  1HTL C;  3H1J E;  1KV9 A;  3RBZ A;  3MP7 B;  5CIE B;  4BWN A;  1YIT P;  1E8E A;  1Y9B A;  3HTK B;  1R5S A;  1VQ4 P;  5AW2 B;  1QL3 A;  2HOD B;  1M1J B;  2R3C A;  3GHG C;  1BCC J;  1KV4 A;  3SWY A;  4OGQ D;  3A5T A;  3NTN A;  3ITK A;  2IDB A;  2KZJ A;  2QJY B;  4TLF A;  5AVR B;  1PGP A;  3V5B A;  1IC2 A;  1NVO A;  4GOE A;  1WMK A;  1G2C A;  1URQ D;  3A0B H;  5H2F E;  1CNO A;  1MZ4 A;  2FYU K;  1GL2 D;  1QL4 A;  1PP9 D;  3SXT A;  1FJK A;  3A0B E;  1L4A D;  1CRH A;  4UB6 H;  1SQP D;  1LTA C;  2GC4 D;  3IN6 A;  4KHX A;  3FXD A;  4CPG A;  2H43 A;  5DJU B;  2P2U A;  1MZ9 A;  1E79 H;  3A0H H;  5CCG C;  1SQV K;  4HKZ H;  4H0L C;  1GW4 A;  1M8O B;  3A0H E;  1URQ A;  3O6Q A;  2V08 A;  4LC1 A;  1GL2 A;  1L4A A;  4EID A;  3SFE C;  2N9B A;  4N3Y B;  1J1D B;  1OWA A;  1SVF A;  2M5A B;  3FX0 A;  1FHB A;  2NPS B;  5KLV E;  3KZI H;  2K9J B;  2QJP C;  4QMA A;  3BCC G;  2HPC A;  1JDL A;  2C0X A;  1U75 B;  1MUU A;  3CYT I;  3CCU P;  1EXI A;  4M3L A;  2AXT E;  4L75 A;  1H31 A;  2WSC H;  1JY3 N;  4PD4 E;  1KC8 Q;  1LWU B;  1M90 Q;  3TF5 A;  3A3Y B;  4Y99 B;  4EIJ A;  1A8C A;  2QJK C;  2P1J A;  3CU4 A;  2H89 C;  2BPB B;  2KNC A;  2QM8 A;  3HQ6 A;  4YTP C;  1YTZ T;  3H1K E;  3H1J D;  1CHJ A;  2XND H;  1B7V A;  1RE3 A;  4WBA A;  1T2K D;  3CL3 D;  2WT7 A;  1H1O A;  1QVG O;  4AYC A;  4I7Z C;  1H32 B;  3O20 A;  3VNW A;  3L75 G;  2A06 D;  1HUC A;  1YCC A;  1ETP A;  1JCC A;  2B9B A;  1SQB J;  1HCM A;  1M70 A;  1LT1 A;  4HYT B;  1FI3 A;  2E74 D;  1L0N G;  3WMM 0;  4DT0 A;  4UB8 E;  1QN2 A;  2YKO A;  3AE4 C;  3WU2 E;  3ABV C;  2WPR A;  1NTM E;  1AVY A;  4FA9 A;  1PL5 A;  1Q82 Q;  2PCB B;  4PV1 B;  1Q7Y Q;  3HE4 B;  2FXO A;  2M3B A;  1GTW A;  1GQ1 A;  2O3J A;  1VQO P;  1EZV G;  3JC2 2;  2E5T A;  3BRT B;  4XE5 B;  3SFD C;  2Q3I A;  1JY3 P;  2Z5H A;  1DEB A;  2DW3 A;  1NO4 A;  3H1I E;  5AVX B;  1RAQ A;  3HQ9 A;  3HQ8 A;  3MTU E;  2K3R A;  1NU1 J;  1A02 F;  1NML A;  4W7Y A;  2M0B A;  2JWA A;  3RL0 D;  2R44 A;  1L2P A;  5DJQ B;  3AE3 C;  1SLQ A;  3KDP B;  2C1V A;  3L73 G;  4EIF A;  2CPB A;  1LTS C;  3D6Y A;  4PWA A;  2B0Z B;  2KLV A;  5KLV D;  2C1D A;  3N4X A;  2D2C B;  1AQT A;  1M60 A;  4OGQ C;  3V2P A;  5CIG B;  4IOI H;  1DVH A;  2DGE A;  1Y8A A;  1VPC A;  1CCH A;  3L72 D;  1NTK E;  4L3H A;  3L71 D;  3F89 A;  1SQX D;  1URQ C;  4WVZ A;  1GL2 C;  3Q2Y A;  1L4A C;  1FOS E;  3S4R A;  2BEQ D;  3PHL A;  4ZKP A;  1HJ5 A;  2DVH A;  2I1J A;  5DFS A;  4BRY A;  2Z4E A;  2ZYG A;  2ZT9 D;  2KIK A;  3H25 A;  1MFZ A;  2B4Z A;  3CCE P;  3L70 E;  4NPD A;  3GW6 A;  1HVV A;  2XV5 A;  2PAJ A;  4RES B;  3DR0 A;  1KB9 I;  4AX3 A;  5BU5 A;  2ZAE B;  1SFC D;  1LJ2 A;  1A56 A;  4H13 D;  3HD7 D;  1BCC G;  2N18 C;  3D0W A;  4ZMD A;  3P32 A;  2ZXE B;  1MFT A;  1L0L E;  2WWW A;  1SFC A;  1KD1 Q;  1NAY A;  2YIU C;  1JEK A;  3CWB D;  2MJZ A;  3ZCF A;  3HD7 A;  2XKM A;  1ZW0 A;  2C2C A;  2KI7 B;  1RE3 C;  1FJ0 A;  3CME P;  1LTJ A;  3TNU B;  1A2S A;  1PP9 J;  2B10 B;  2Q3E A;  2IBZ G;  2E75 B;  1SQP J;  1LT9 B;  2ZVN B;  1EDL A;  1NTZ D;  3U59 A;  1HJ4 A;  2G3A A;  4D6T G;  2AXC A;  1FDI A;  1VDF A;  1T2K C;  2MHM A;  1DD4 A;  3IR9 A;  2ZYA A;  2BGV X;  5H2F V;  1CTJ A;  1JMB A;  1QL2 A;  2HV4 A;  1IFN A;  3SVW A;  2PGD A;  3CC7 P;  3SLE A;  1VQ7 P;  1KYO W;  2E74 C;  3I5C A;  1AQ5 A;  1YQ4 C;  3OJA B;  3TGU E;  2ZVO B;  1IJD B;  3RMZ A;  2HYN A;  3H1L E;  5APT A;  2W90 A;  1GIW A;  3B8E B;  5AW0 B;  1AV1 A;  3L4M A;  3ZBM A;  1KN7 A;  1EDK A;  1D7M A;  2RH0 A;  5CIB B;  1H0T B;  3H1J J;  1FZE A;  1RH5 B;  3V2Q A;  2V07 A;  4WY4 D;  4HJG H;  4WQE A;  1GW3 A;  2FYZ A;  3CX5 W;  3L70 D;  2GUV A;  2P10 A;  4RJT A;  1A02 J;  3RL0 C;  2JJL A;  2FFD B;  2N1T B;  3R4Y A;  2PRR A;  2WPS A;  4L3G A;  1DH3 A;  2H7H A;  4WY4 A;  2GM4 A;  1R0Q A;  3KHU A;  3CD6 P;  1CI6 B;  3NBT A;  2K9Y A;  1H33 A;  2Y9Y A;  2Q6Q A;  1U7M A;  1X79 B;  2IX7 C;  1CZQ A;  5AVY B;  2C0W A;  1QL1 A;  1FDM A;  1L0L D;  3PXS A;  1CSV A;  3CXH W;  3RN0 A;  2IBZ I;  4JF7 A;  2FBW C;  2O01 J;  2WSS H;  2XTS B;  4UB8 V;  1FOS F;  4N6J A;  2C9X B;  3MGN A;  1N2D C;  2L91 A;  1KQS O;  1OW6 A;  2K88 A;  1J1E B;  2ZT9 C;  3WU2 V;  3AED C;  4H44 B;  1N73 A;  4AAL A;  5KAF V;  1RF0 A;  3AE9 C;  3W68 A;  1NU1 G;  1IZL 0;  4YPC A;  1BGY E;  2QJK B;  1CIG A;  155C A;  1CIF A;  1SFC C;  3LIE A;  2CPS A;  2M3E A;  1PPJ E;  4H13 C;  1HRC A;  2RN0 A;  3HD7 C;  4L74 A;  4H0J A;  2ZXY A;  1N90 A;  2BLF B;  2CXB A;  5KLV J;  4OVN F;  1LTJ C;  1FBM A;  1FZF A;  2K37 A;  3TSI A;  2E76 B;  1FS0 E;  5APS A;  2AEJ A;  2W27 A;  3H1L D;  1J3S A;  451C A;  3L71 J;  4WQB A;  1SQX J;  1NYH A;  1C75 A;  1GK4 A;  2OGU A;  1JM0 A;  1SQQ E;  3EQ2 A;  4I6M C;  3CCL P;  3II6 A;  1OMI A;  1N86 A;  1NKZ B;  5CJ0 A;  1DII C;  1NIR A;  1LP1 B;  1H88 A;  1HGV A;  1IK9 A;  2JKV A;  1QEX A;  1IO3 A;  4C7R A;  1KYO E;  1QGK B;  4GT1 A;  2OYH A;  3M9H A;  2H8P D;  2KS1 A;  3BRV B;  2QG4 A;  4NPF X;  3H32 A;  2B87 A;  3EFG A;  1K8A Q;  2ZOO A;  1Q90 D;  1BDD A;  3PTZ A;  3OA8 A;  3CWB J;  4DY9 A;  4XYD B;  3WC8 A;  4WQ9 A;  1HWT C;  1VYD A;  1G2C B;  2IZ0 A;  2YMK A;  2N9J A;  4OGQ B;  1PP9 G;  3NXS A;  3SJL A;  4R4L A;  1JY2 O;  1NTZ J;  1SQP G;  1L0N K;  2QSI A;  1PGJ A;  3IAO A;  4AAM A;  2J58 A;  3NFQ A;  2V7Q J;  3CX5 E;  1YHQ P;  5KAI E;  3C2C A;  2C1U A;  3PH0 A;  2E5Y A;  2JTI B;  1VF5 B;  1M6Z A;  4WY4 C;  1RZ5 A;  2XDJ A;  5AW1 B;  1GL2 B;  4IL6 V;  1LC1 A;  1PV3 A;  1CRI A;  1IFJ A;  2Y0C A;  1C7M A;  1ZN5 A;  1BGY D;  3OW2 O;  2FXP A;  2IYP A;  3BAS A;  1S5L V;  3S1K A;  3WUT A;  1FI7 A;  3AE6 C;  1PPJ D;  4XA4 A;  3CCQ P;  1SQX K;  1RF1 B;  2HPC B;  2O01 H;  5H2F H;  2YCC A;  2YNY A;  3H6P A;  3A9F A;  3RLM A;  3CXH E;  4L1Q A;  2YO2 A;  3G71 P;  2OYI A;  1WEJ F;  1N73 C;  1RHZ B;  1LMS A;  2FYN B;  1RF0 C;  3CMA P;  1NTK J;  5AW3 B;  3WUU A;  2JQR A;  2P67 A;  1N15 A;  3O5C A;  3H1J G;  1K04 A;  3A2A A;  4JYC A;  1SQQ D;  5BVZ A;  2CE0 A;  3ZOX A;  1KB9 E;  4U3F E;  1BL9 A;  1AOF A;  3L70 J;  2HOD A;  1M1J A;  2B89 A;  2WT7 B;  1S4X A;  2A06 G;  3VMX A;  1LGH B;  1QLE D;  1AFO A;  2R32 A;  2AXT H;  1AJY A;  1KYO D;  4PD4 H;  3P8M C;  3P8C E;  4WWI A;  2YKP A;  3AE8 C;  1NKN A;  3RK3 D;  1NTZ K;  1I6E A;  1L0L J;  3T97 B;  1EZV E;  1HJ3 A;  2KLU A;  1KX7 A;  3B71 A;  5DF5 A;  2QIW A;  3Q3D A;  1E2R A;  5KLI C;  3JBT B;  2BCC G;  2NPS D;  1FZC B;  3CCJ P;  2FYU E;  1CCR A;  4BXL A;  3UIA A;  1OCD A;  1X9V A;  2WPQ A;  3AEG C;  1GMJ A;  5GTH E;  2OYH C;  5C39 A;  3L73 E;  1DW3 A;  2M5A A;  3C9I A;  4UB8 H;  1SQV E;  2NPS A;  5AW8 B;  2OTJ P;  1E5W A;  5CHX A;  1HZV A;  4NFG B;  1CRJ A;  1CYJ A;  2K9J A;  4A7P A;  3WU2 H;  5KJ7 D;  1FZB A;  5KAF E;  2YK3 A;  4K3A A;  3E1I A;  2C1D B;  5AW4 B;  2E43 A;  5GTI V;  4JYB A;  1I55 A;  4FB1 A;  1N7S B;  4PJ0 V;  2BEZ F;  1YFC A;  2V7Q H;  2KSE A;  3H1L J;  3MK7 B;  1LWU A;  1U74 B;  5AVW B;  3V4W A;  2AI5 A;  3L72 G;  5KJ7 A;  5KKZ B;  3CCS P;  3HRN A;  3L4O A;  1YEB A;  3L71 G;  1SQX G;  1W5C E;  2P58 A;  1YJ9 P;  2KZI A;  2ZXX A;  1YBK A;  3B5N B;  1VQK P;  1KIL B;  2WIT A;  2WMM A;  4ZKU A;  1Q86 Q;  4R4M A;  4RO0 A;  4W7Z A;  3L74 G;  1QX8 A;  3MHV A;  3H1H G;  4J20 A;  1IFP A;  3MIW A;  4WQ8 A;  1OXZ A;  2E42 A;  1F1C A;  2B11 B;  1BCC E;  1PZQ A;  2IFM A;  1JY3 O;  4U3F D;  1RY3 A;  1C6O A;  5AVV B;  2A45 H;  4PV1 D;  5APQ A;  2OYI C;  1HF9 A;  3OCD B;  1MKM A;  2LIT A;  2R5B A;  5APU A;  2O1J A;  1BSH A;  1N50 A;  2MTA C;  3RL0 g;  1JCD A;  1X22 A;  3P8C D;  4PD4 D;  4P4Q B;  3G9R A;  1SFC B;  2IBZ E;  2LR2 A;  3CWB G;  2W6J H;  5AVT B;  3MZW B;  1VQL P;  1EZV D;  2Q7C A;  3E1R A;  3PXW A;  5TJH A;  1K9M Q;  3HUS B;  1SQB K;  3USS A;  3NMD A;  3H1K D;  4EI2 A;  1M1J C;  1WT6 A;  4D6T E;  4V2K A;  2Q9I A;  1NTZ G;  4K35 A;  4N0K A;  1OW8 A;  2GB8 B;  2D2C D;  2FYU D;  1CXC A;  5APX A;  2OQQ A;  5TIS E;  2GC7 D;  2D0W A;  2QJY C;  1HRO A;  2C9N Y;  2CA3 B;  1AVO A;  3Q1M A;  3VRD A;  1BGY J;  1USD A;  1W2L A;  1SQV D;  2WTY A;  3F5H A;  3TYY A;  2GUS A;  2PCC B;  1COT A;  1JOC A;  3CCM P;  3VN0 A;  4KJM A;  5KAI V;  1S1C X;  3M9Q A;  1EB7 A;  4Y28 J;  3N7N A;  1NTM D;  2W8Z A;  3MD0 A;  4IL6 E;  2UWJ E;  1FJP A;  1M56 D;  1NU1 K;  3RK3 C;  1S5L H;  1GJQ A;  1WRG A;  1P84 E;  1S5L E;  4C46 A;  4PD4 I;  1CTZ A;  1HJ0 A;  5C9M A;  1J1D C;  1NHL A;  4MN4 C;  1YEA A;  3H1I D;  4XXL A;  2NPS C;  3X39 A;  1LTI C;  1SQQ J;  3IF4 A;  4HH2 A;  3WFB C;  1AKK A;  1XTC C;  1CYC A;  2KYV A;  3LW5 J;  1NMI A;  3L70 G;  4FA1 A;  2R5D A;  3PJS K;  3TDK A;  4JBZ A;  1KQF B;  4GDO A;  2W83 C;  2YQB A;  1LWU C;  1RQV A;  1OAE A;  5KJ7 C;  2L5G B;  4Y99 C;  3WFC C;  2XU6 A;  3Q5S A;  5CYT R;  3GHG B;  1BE3 E;  4UB6 V;  4DZO A;  1K73 Q;  3WUV A;  1CYI A;  3U1C A;  4O1W A;  1NTK D;  3CI9 A;  1J2J B;  3TNU A;  1CHH A;  3VTP C;  4L73 A;  1LT9 A;  4EDF A;  1JNM A;  1AYG A;  5AW5 B;  2JP3 A;  1ZP0 C;  3ZOY A;  5AW9 B;  3JSV C;  1Q2N A;  4O1Q A;  4D6T D;  1M57 D;  2WQY C;  3KZI V;  3Q5R A;  1CTY A;  5AUR A;  1N73 B;  5B6Q A;  1SQB G;  2Y0E A;  4ASW A;  3B4S A;  4DCK A;  1YQ3 C;  4H0L B;  1NH4 A;  1DD3 A;  3V6I A;  1YNR A;  3RK2 D;  3DP5 A;  3EWK A;  4PV1 C;  3SWS A;  1SQP K;  3PP5 A;  4N78 E;  2RKL A;  2BAS A;  1VQ8 P;  3M0D A;  1IZN B;  5GTH V;  3ZOO A;  3GLM A;  1ZXG A;  5CIF B;  1HBW A;  2QJP B;  3JCU H;  2A45 I;  3JCU E;  4WQD A;  1K05 A;  1X8Y A;  1IFD A;  3D71 A;  3V2N A;  3FGA D;  1X0T A;  1BDC A;  1H0T A;  5GTI H;  2N1T D;  3WUI A;  4LGD E;  5DJQ C;  2JR8 A;  5GTI E;  1FAV A;  3R2P A;  4PJ0 H;  1RQU A;  3FXE A;  4PJ0 E;  4DOJ A;  2N9I A;  4C7N B;  2FWL A;  4AAO A;  2ZFC A;  2D2C C;  5APY A;  5IY5 1;  4YE1 A;  3BAT A;  2FFD A;  1U57 A;  2N1T A;  4EOT A;  4U3F J;  3VOP A;  2H88 C;  1MV8 A;  1N8R Q;  3HE5 A;  1T3J A;  3MUD A;  1JTH B;  4GED B;  1EC5 A;  1JY2 N;  4I7Z B;  1TU3 F;  2KSJ A;  1CI6 A;  3BVH A;  4Z1M H;  4GIF A;  1YTZ I;  3VMA A;  3TGU D;  2ZON G;  4WQA A;  1S3J A;  2PAC A;  5AW7 B;  1BE3 D;  1F1F A;  5AVZ B;  4B86 A;  4FA4 A;  4H44 D;  1M1K Q;  1H89 A;  3RGU A;  4W80 A;  3HQ7 A;  4Q5P A;  5CIC B;  2FRC A;  3LW5 H;  2OTL P;  1FI9 A;  3H1K J;  5APW A;  3PXT A;  1KZU B;  1GD2 E;  3RBX A;  3QH9 A;  1CXA A;  1LS9 A;  1W2B O;  2FYU J;  1CIH A;  1PFI A;  5C0Z A;  1KYO H;  3AEA C;  2Y9Z A;  2E76 D;  2OZ1 A;  1S72 P;  2LKM A;  3AE7 C;  1WVE C;  1DIP A;  1KTM A;  1SQV J;  4GKG A;  1BGY G;  1GU5 A;  1CSW A;  4I2L C;  5B66 E;  2Z5I A;  2WPV B;  3VMY A;  1LT9 C;  1NTM J;  4N78 D;  5TIS V;  1T8Z A;  2Q5U A;  2Q1K A;  1LTG C;  1IK7 A;  1GZL A;  1M7L A;  1LNQ A;  3SWF A;  1HGZ A;  1R5L A;  3V4Q A;  3CX5 H;  1KQG B;  5KAI H;  1N9C A;  4YXD C;  3ZIY A;  2KP8 A;  1JB0 J;  2BCN B;  1OZH A;  1CHI A;  3AEB C;  1ZOY C;  1H8A A;  2P7J A;  3H1I J;  4OWF A;  3CCV P;  3E7K A;  3KYQ A;  1JMM A;  1NAF A;  5CBO A;  3CLQ A;  2VRS A;  1BSN A;  1URQ B;  3O6Q B;  5KLV K;  2G8Y A;  2KUB A;  1L4A B;  1LP1 A;  1SQQ G;  3BCC E;  2A06 E;  4EIC A;  1GU4 A;  3AEF C;  1W5C T;  3M0D C;  4JPZ B;  2J59 M;  1CRY A;  2OYO A;  3RK2 C;  1C6R A;  3CXH H;  3G4S P;  1L9J C;  1IO4 A;  1ZV8 A;  2O01 N;  3D70 A;  2O1K A;  4MU8 A;  5L8R J;  1IFM A;  1ZME C;  1H31 B;  1L9B C;  2M8R A;  4KT0 J;  2N18 B;  1OVR A;  1USE A;  3M9B A;  1VF5 D;  2WSF H;  1CRC A;  2BCC E;  3ZDM A;  2KNC B;  1GKS A;  2YIU B;  1CRG A;  3O1Y A;  3HTK A;  1CIE A;  4UB6 E;  3L4F A;  1KMI Z;  1KB9 H;  3L75 E;  2FFD C;  2N1T C;  5EFW B;  1EXJ A;  2IZ1 A;  3U1A A;  3RK3 B;  3MUD C;  4D6T J;  4GYD A;  1L0N E;  2JDI H;  2N9Y B;  4IL6 X;  2D0S A;  3C8V A;  4GOF A;  2OAR A;  1NTM K;  2WSE H;  4Y5R A;  3EFF K;  3L37 A;  3WFD C;  1S5L X;  1G1I A;  2IYO A;  1FCD C;  1FOC A;  5BU8 B;  1EQ7 A;  1FDO A;  1KIL E;  3KZI E;  1RF1 A;  1Q81 Q;  3M06 A;  2PP6 A;  1IRW A;  1OX3 A;  4WB4 A;  2RMZ A;  3CC4 P;  3L72 E;  3L71 E;  2E74 B;  1SQX E;  1J1E C;  4H44 C;  4I1L A;  1AOQ A;  4OH8 B;  1FE6 A;  4WQC A;  4KMG A;  2FY8 A;  2VHD A;  2ZBO A;  5GTH H;  2EXV A;  2AEF A;  5CBN A;  1ZLL A;  3L74 E;  3H1H E;  3CX5 D;  1I8O A;  4IFM A;  4FAN A;  4FA5 A;  1YYC A;  4ASV A;  1GDT A;  2JEE A;  3GF3 A;  3ZOW A;  3NBS A;  1S2E A;  2E76 C;  4HB1 A;  2POH A;  3BCC D;  1ZRT E;  4JQ0 D;  5KAF H;  4EIE A;  1EDJ A;  5E79 V;  1RZ6 A;  4K3I A;  5AVU B;  4U3F G;  5KLV G;  3M97 X;  3RL0 B;  1DW1 A;  1KYO I;  1NTK K;  3G3Z A;  2KXP B;  4FAV A;  2I8F A;  3M91 A;  4U7J A;  1PIX A;  3TGU J;  1DEE G;  3NWV A;  2JWD A;  2MKV A;  3CWB E;  3CXH D;  4LLH A;  3T97 A;  1BE3 J;  3L36 A;  3FWL A;  1DX7 A;  3KXD A;  1I54 A;  1VQ6 P;  2YXR B;  1YJW P;  5CCH D;  3KQG A;  1NTZ E;  4BRY B;  2BCC D;  1FZC A;  3L35 A;  2KOG A;  2QRX A;  1YI2 P;  1DW2 A;  3H1K G;  1H32 A;  3L75 D;  3GMA A;  1KB9 D;  1EDI A;  3CX5 I;  2FYU G;  2QE7 H;  5CCH A;  5B5E V;  2HR3 A;  1N7S D;  3VP8 A;  1L0N D;  2KK7 A;  2Y0D A;  1RAP A;  2ZT9 B;  1L0L K;  2N3B A;  2K1A A;  3AE5 C;  2GIW A;  1I5T A;  1CSB A;  1SQV G;  2NRG A;  4NPE A;  1I8P A;  1LTT C;  1LFM A;  3W67 A;  1KIB A;  4RKU J;  3B5N D;  1N7S A;  3HE4 A;  4H13 B;  3HD7 B;  1KIL D;  3A7O A;  3IFM A;  1XTG B;  1NTM G;  5DJT B;  3PLN A;  3TK1 A;  2ZZS 1;  1LTJ B;  3VP9 A;  5KTB A;  3CXH I;  1VF5 C;  5EXQ A;  1CED A;  1C2N A;  1ZR2 A;  4JCG A;  1KFM A;  3B5N A;  4TT3 H;  2V4H A;  1VQP P;  1KIL A;  5TIS H;  5B66 V;  3H1I G;  2LXB A;  2NZ2 A;  3L74 D;  3CCR P;  1NNO A;  1HJB A;  2W6A A;  3H1H D;  2BH4 X;  4RSZ A;  3L73 D;  1Y47 A;  1RF1 C;  3CPW O;  1UIX A;  1R8E A;  3VMZ A;  5APV A;  1ZRT D;  4IL6 H;  3OCD A;  2IFN A;  2AEM A;  2FYN C;  5CIH B;  3QWO C;  4AAN A;  3AE1 C;  3OAK A;  4PW9 B;  3S9O A;  2QEX P;  1P84 H;  2A45 G;  5CMZ A;  1AA0 A;  1KOR A;  1C52 A;  1HH7 A;  1NTK G;  1IRV A;  1LC2 A;  3CP5 A;  1EZV I;  3I56 P;  5AW6 B;  3HUS A;  2LXC B;  2XNX A;  1DIQ C;  2ITA A;  1S9K E;  1NWQ A;  1OVV A;  1YJN P;  2QM7 A;  2YXQ B;  1T3U A;  1FC2 C;  3K5B A;  1SQB E;  1MG2 D;  2CE1 A;  3PH2 B;  3Q5P A;  4IFD K;  1C2R A;  1YIQ A;  4XFJ A;  1H9Y A;  1NGM B;  1FU1 A;  1BCC D;  1K3G A;  4GOD A;  4WY4 B;  2E75 D;  3A0B V;  351C A;  1DT1 A;  1OW7 A;  2WZ7 A;  1DW0 A;  1LTB C;  1H33 B;  1VL2 A;  1SS1 A;  1CO6 A;  4ZNC A;  3OA7 A;  1L0L G;  2YO3 A;  1FZC C;  1CW5 A;  3A0H V;  2IPP A;  2C8S A;  1ZR4 A;  2IBZ D;  1QKS A;  4AQR D;  2AIU A;  3RK2 B;  2C9L Y;  1OVU A;  2I8D A;  2QA4 P;  5CCH C;  1NU1 E;  1RE4 A;  1KX2 A;  4IFF A;  2PFX A;  2HLO A;  1W2E A;  2ZJS E;  3VYI A;  1IFI A;  1QVF O;  2BH5 X;  4EYY Q;  3WFE C;  3D6Z A;  2AXT V;  1PGO A;  1MG3 D;  4DJG A;  3SSU A;  3C1L A;  1T6A A;  2QVA A;  3KPE A;  3BCC J;  1N7S C;  5CJ4 A;  1VQM P;  3O0R C;  5AVS B;  2B88 A;  1KQL A;  3MK7 C;  3HE5 B;  5KKZ C;  1DVV A;  3GHG A;  1NJI Q;  1GU2 A;  3TGU G;  1GDV A;  2GA1 A;  1IQC A;  2LIR A;  3B5N C;  5E79 H;  2R3S A;  3H1L G;  1SQQ K;  2WVR A;  1KIL C;  4O9B A;  5E79 E;  4LJI A;  1YIC A;  1BE3 G;  2HFE D;  3O8Z A;  1P84 D;  2CA4 B;  4AUW A;  2WSF J;  5CCG D;  2BCC J;  2W6B A;  4H0L D;  5CID B;  1FZA A;  1UII A;  2N3Y A;  1K3H A;  1S9K D;  5K5G B;  3AEC C;  1S6V B;  1G1J A;  3L75 J;  3P7K A;  1HZU A;  5KLI B;  1FZG A;  3AEE C;  2HG5 D;  2FKW B;  2YMY A;  1SQB D;  3SWK A;  3GF7 A;  5CCG A;  1L0N J;  1N7L A;  3PRJ A;  2OZ1 B;  1OIP A;  2OYH B;  4L76 A;  2KS1 B;  2YKQ A;  3H32 B;  2B87 B;  2OTK E;  5AVQ B;  2WSE J;  1NOH A;  1KFN A;  1COR A;  5B5E H;  1JO5 A;  3HUS C;  4WQ7 A;  2CK3 H;  3G6E P;  5B5E E;  1PP9 E;  3OA8 B;  1SQP E;  1ZZH A;  1KB0 A;  3CC2 P;  3LID A;  2FXM A;  3L72 J;  1YTC A;  3I55 P;  3TYI A; 
#chains in the Genus database with same CATH homology
 1GIW A;  1H9X A;  4GYD A;  3L4M A;  3OCD B;  2N9Y B;  3ZBM A;  2LIT A;  2D0S A;  3VYM A;  1N50 A;  4QAO A;  2MTA C;  1NU1 D;  2L4D A;  1QYZ A;  4Y5R A;  5CIB B;  3WFD C;  1CC5 A;  1FCD C;  4P4Q B;  4PD4 D;  1FOC A;  3DMI A;  2V07 A;  1C6S A;  4WQE A;  1IRW A;  3RN1 A;  1EZV D;  2RMZ A;  3PXW A;  5TJH A;  2ORL A;  1I6D A;  3CX5 W;  3L70 D;  4RJT A;  3H1K D;  1CSX A;  4V2K A;  3GG2 A;  4N0K A;  4L3G A;  1AOQ A;  2GB8 B;  2FYU D;  1CXC A;  1E29 A;  4WQC A;  4KMG A;  2VHD A;  1R0Q A;  2ZBO A;  3ORV A;  3KHU A;  2GC7 D;  2D0W A;  2EXV A;  4H0K A;  3NBT A;  1H33 A;  1CSU A;  2B12 B;  1HRO A;  3CX5 D;  1I8O A;  4FAN A;  2CA3 B;  1KV9 A;  3VRD A;  4FA5 A;  1W2L A;  1SQV D;  5CIE B;  1L0L D;  3ZOW A;  3NBS A;  2PCC B;  1E8E A;  3PXS A;  1COT A;  1CSV A;  3CXH W;  3RN0 A;  5KAI V;  3BCC D;  1EB7 A;  4EIE A;  1NTM D;  5E79 V;  1RZ6 A;  4K3I A;  2XTS B;  4UB8 V;  1QL3 A;  2C9X B;  3M97 X;  1DW1 A;  2L91 A;  1GJQ A;  4FAV A;  2I8F A;  3WU2 V;  4AAL A;  5KAF V;  3NWV A;  1CTZ A;  3CXH D;  5C9M A;  3ITK A;  1IZL 0;  1YEA A;  3H1I D;  4XXL A;  2QJK B;  2QJY B;  1CIG A;  155C A;  3FWL A;  1CIF A;  3X39 A;  1I54 A;  1HRC A;  2RN0 A;  3WFB C;  1AKK A;  4H0J A;  2BCC D;  1N90 A;  2BLF B;  2CXB A;  2ZXY A;  1CYC A;  1NMI A;  1CNO A;  1MZ4 A;  1DW2 A;  1QL4 A;  1PP9 D;  3SXT A;  4FA1 A;  1CRH A;  1H32 A;  1SQP D;  3L75 D;  3TDK A;  1KB9 D;  2GC4 D;  2YQB A;  3H1L D;  1J3S A;  1OAE A;  5B5E V;  451C A;  4WQB A;  3WFC C;  1L0N D;  2Y0D A;  1RAP A;  5CYT R;  4UB6 V;  2V08 A;  1C75 A;  2N3B A;  1CYI A;  4EID A;  2GIW A;  4O1W A;  1I5T A;  1NTK D;  1FHB A;  1I8P A;  1CHH A;  1LFM A;  1KIB A;  1DII C;  4EDF A;  2K9J B;  1NIR A;  1AYG A;  1JDL A;  1U75 B;  3ZOY A;  3PLN A;  2ZZS 1;  3CYT I;  1IO3 A;  4O1Q A;  5EXQ A;  1CED A;  1C2N A;  4D6T D;  1H31 A;  3KZI V;  4JCG A;  1CTY A;  5AUR A;  2KS1 A;  2QG4 A;  5B6Q A;  2Y0E A;  5B66 V;  3TF5 A;  2ZOO A;  1A8C A;  1YNR A;  3CU4 A;  3DP5 A;  3L74 D;  3PTZ A;  2BPB B;  1NNO A;  3HQ6 A;  3OA8 A;  3H1H D;  2BH4 X;  3H1J D;  4DY9 A;  4RSZ A;  1CHJ A;  3L73 D;  3SWS A;  4XYD B;  3WC8 A;  4WQ9 A;  1B7V A;  1VYD A;  2N9J A;  5GTH V;  3ZOO A;  3SJL A;  5CIF B;  1H1O A;  2QJP B;  1H32 B;  3O20 A;  3VNW A;  1ZRT D;  2A06 D;  3OCD A;  4WQD A;  1YCC A;  1ETP A;  4AAM A;  3C2C A;  1HCM A;  5CIH B;  2C1U A;  1M70 A;  2JTI B;  4AAN A;  1M6Z A;  4PW9 B;  1FI3 A;  1RZ5 A;  3WUI A;  1QN2 A;  5DJQ C;  4IL6 V;  1C52 A;  1LC1 A;  1CRI A;  2Y0C A;  2N9I A;  1C7M A;  1HH7 A;  1IRV A;  1BGY D;  2FWL A;  1LC2 A;  3CP5 A;  4AAO A;  1DIQ C;  1S5L V;  4FA9 A;  5IY5 1;  2PCB B;  1FI7 A;  4YE1 A;  1PPJ D;  1GQ1 A;  2O3J A;  2YCC A;  3A9F A;  3RLM A;  4L1Q A;  1MG2 D;  2CE1 A;  3PH2 B;  4GED B;  1C2R A;  1YIQ A;  1H9Y A;  1RAQ A;  3HQ9 A;  3HQ8 A;  1BCC D;  1WEJ F;  3VMA A;  1LMS A;  2FYN B;  3TGU D;  1K3G A;  2ZON G;  1NML A;  4WQA A;  2JWA A;  3A0B V;  2JQR A;  2PAC A;  351C A;  1DT1 A;  1BE3 D;  1N15 A;  3O5C A;  1F1F A;  1DW0 A;  4FA4 A;  5DJQ B;  1H33 B;  3HQ7 A;  2C1V A;  1CO6 A;  4EIF A;  1SQQ D;  4Q5P A;  2CE0 A;  3ZOX A;  5CIC B;  2FRC A;  4PWA A;  1BL9 A;  2B0Z B;  3A0H V;  5KLV D;  1AOF A;  2C1D A;  1FI9 A;  2C8S A;  1M60 A;  2IBZ D;  1QKS A;  3PXT A;  5CIG B;  2AIU A;  1CXA A;  1LS9 A;  1DVH A;  1CIH A;  2DGE A;  5C0Z A;  1CCH A;  3L72 D;  1KYO D;  2OZ1 A;  1KX2 A;  4L3H A;  3L71 D;  1SQX D;  1WVE C;  2BH5 X;  3PHL A;  1HJ5 A;  2DVH A;  3WFE C;  5DFS A;  1I6E A;  2AXT V;  1MG3 D;  1CSW A;  2B4Z A;  1HJ3 A;  1KX7 A;  5DF5 A;  3GW6 A;  1E2R A;  3O0R C;  3DR0 A;  3JBT B;  5TIS V;  4AX3 A;  3MK7 C;  1CCR A;  1A56 A;  1OCD A;  1DVV A;  1N9C A;  2N18 C;  3ZIY A;  1GU2 A;  2BCN B;  1GDV A;  1IQC A;  1CHI A;  2LIR A;  1DW3 A;  4LJI A;  1YIC A;  1P84 D;  1HZV A;  2CA4 B;  4NFG B;  1CRJ A;  1CYJ A;  4A7P A;  3CWB D;  3ZCF A;  2C2C A;  5CID B;  4EIC A;  1FJ0 A;  2YK3 A;  1A2S A;  2N3Y A;  1K3H A;  2C1D B;  1W5C T;  2B10 B;  2Q3E A;  5GTI V;  1CRY A;  1I55 A;  1S6V B;  4FB1 A;  4PJ0 V;  1NTZ D;  1HZU A;  1YFC A;  5KLI B;  1C6R A;  1SQB D;  1L9J C;  3MK7 B;  1HJ4 A;  1U74 B;  2AI5 A;  5KKZ B;  3PRJ A;  2OZ1 B;  3L4O A;  1YEB A;  4MU8 A;  1H31 B;  1L9B C;  2N18 B;  2MHM A;  2BGV X;  5H2F V;  1CTJ A;  2HV4 A;  1CRC A;  3SVW A;  1COR A;  4WQ7 A;  2KNC B;  1GKS A;  3OA8 B;  4J20 A;  2YIU B;  4WQ8 A;  3SLE A;  1CRG A;  3O1Y A;  1CIE A;  1F1C A;  1KYO W;  1ZZH A;  1KB0 A;  2B11 B;  4U3F D;  1YTC A;  1C6O A;  3RMZ A;  3TYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...