1NTZD

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 54
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1ntzD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1ntzD01
3VMAA 3PXWA 2ZOOA 1LS9A 2N3BA 3WFBC 1GIWA 1DW0A 1CORA 1KYOW 2AIUA 2BCNB 1FHBA 3RN0A 4EICA 4WQBA 2BH5X 4XXLA 4EIEA 1I5TA 2PCBB 3SWSA 3KZIV 1FI3A 5IY51 4PWAA 1CCHA 1A2SA 1CRGA 1CTYA 1KB9D 3VRDA 1KYOD 4WQEA 2YQBA 1W2LA 3ZOOA 3ZOYA 3CYTI 4EDFA 3OA8B 1CYCA 1NTZD 1C6SA 1RZ6A 5KAFV 1IZL0 2N9JA 3PTZA 2FYNB 1ZRTD 4IL6V 2YCCA 5KKZB 1F1CA 2BPBB 1CHJA 1HJ3A 1OAEA 2RMZA 1GQ1A 3BCCD 1NIRA 1I6EA 3DMIA 2O3JA 2OZ1A 3VNWA 4RSZA 1SQQD 3A0BV 2ZONG 1DW3A 4H0KA 1NNOA 1S5LV 1CHIA 3PLNA 4J20A 2C1VA 1CTJA 1YEAA 1K3GA 1CSVA 1FCDC 4JCGA 2GC4D 1I8PA 1AOQA 3NWVA 1J3SA 2N18C 3GW6A 1RAQA 3ZOXA 1CIHA 2QG4A 3HQ9A 4KMGA 2Y0CA 3ITKA 1LC1A 1N90A 2BCCD 1QL3A 2GC7D 1N9CA 1HROA 5CIHB 2PACA 1HCMA 1I6DA 1CCRA 4QAOA 1DIIC 2A06D 1JDLA 1HRCA 1E29A 1AOFA 4WQCA 3CX5W 1F1FA 1CXCA 1WEJF 2Y0DA 4EIDA 4AAMA 4V2KA 1IRWA 1PPJD 2VHDA 1FJ0A 2CE0A 1IO3A 1QYZA 5DF5A 1GKSA 3L75D 155CA 1M70A 3L73D 2CA4B 1YFCA 1HZVA 3HQ6A 2V07A 2QJPB 2DGEA 1GJQA 3MK7B 4O1WA 5C0ZA 1M60A 1NTMD 2Q3EA 1ETPA 3L4MA 2FWLA 2HV4A 2N9IA 2Y0EA 1FI9A 4L3HA 4GEDB 3TGUD 3CP5A 3RN1A 2B12B 1L9BC 3M97X 2C1UA 1H32A 1KV9A 1MG2D 1OCDA 3NBSA 3OCDB 3WUIA 1CEDA 1DVHA 1B7VA 1C6RA 4RJTA 1CSWA 1YNRA 3HQ8A 1CXAA 1AYGA 4YE1A 1GDVA 2BH4X 2GIWA 3CWBD 5CIFB 1HZUA 4O1QA 1A56A 2AXTV 4LJIA 3ZIYA 4AANA 5CICB 3SJLA 2C1DA 3VYMA 4N0KA 1CNOA 3CU4A 1CIGA 5EXQA 2B0ZB 4U3FD 4WQ7A 1CYJA 1H33A 451CA 3KHUA 2D0WA 2IBZD 2B4ZA 2JTIB 1FI7A 1QN2A 4UB6V 4MU8A 2ZZS1 2YIUB 1CIFA 2C9XB 4DY9A 5CIBB 3H1JD 5DFSA 1U74B 3O1YA 2ZBOA 1M6ZA 2XTSB 2CE1A 1YIQA 1H32B 3ZBMA 2JWAA 1SQVD 1LMSA 3WFEC 4AX3A 5CIDB 1CIEA 1YCCA 351CA 3HQ7A 4FA1A 1GU2A 4Y5RA 5KAIV 2MTAC 3C2CA 1L0LD 3FWLA 1E2RA 1H9XA 4FA9A 1KB0A 3MK7C 1AKKA 3PXTA 1CC5A 1YTCA 1ZZHA 3RLMA 4EIFA 4Q5PA 5KLIB 3OCDA 2C1DB 3PH2B 1W5CT 4PD4D 1NU1D 3RMZA 4WQAA 1H33B 1MG3D 1SQBD 5B66V 2L91A 1CRCA 4PJ0V 1I55A 2LITA 3PHLA 4AALA 2RN0A 3PRJA 2KS1A 3CX5D 3CXHW 1CYIA 4WQ9A 2QJYB 4A7PA 5C9MA 1BE3D 2L4DA 1VYDA 2EXVA 3O5CA 1KIBA 2C2CA 1QL4A 1QKSA 1CSUA 4H0JA 1WVEC 1R0QA 2FYUD 2JQRA 3CXHD 3DR0A 1LFMA 1U75B 3H1HD 2LIRA 4D6TD 1BL9A 5AURA 1COTA 1CRIA 2K9JB 3H1KD 2C8SA 2GB8B 3L71D 4FAVA 3X39A 3WC8A 3SVWA 3TF5A 1L9JC 4FA5A 3TDKA 2YK3A 2I8FA 3L74D 1FOCA 1I54A 2CA3B 3L70D 5CIGB 1C2RA 5DJQB 1K3HA 1IRVA 5B5EV 1RZ5A 3L72D 3SXTA 2B10B 5GTHV 1NTKD 1CRYA 3WFCC 1CRHA 4GYDA 1NMIA 1P84D 4L3GA 1DT1A 5B6QA 2BGVX 4P4QB 1C2NA 2DVHA 1SQXD 1MZ4A 3WU2V 1HJ5A 1KX2A 1H31B 1C52A 1NMLA 3H1ID 3ZCFA 1E8EA 2AI5A 2FRCA 1DIQC 2QJKB 1HH7A 1H9YA 4NFGB 1CTZA 4UB8V 1EB7A 1A8CA 2ORLA 2D0SA 1DW2A 4FANA 4XYDB 5GTIV 2B11B 5TISV 3O0RC 1N50A 1C6OA 1CO6A 3SLEA 4AAOA 1H1OA 2PCCB 3GG2A 1YEBA 1IQCA 4PW9B 5TJHA 1BCCD 1BGYD 5KLVD 1CRJA 2CXBA 1LC2A 1C7MA 3PXSA 3NBTA 3WFDC 2BLFB 3A0HV 5H2FV 3A9FA 3DP5A 4K3IA 5CYTR 1C75A 4FA4A 1I8OA 1EZVD 5DJQC 3L4OA 3TYIA 1DVVA 4FB1A 5E79V 1HJ4A 2MHMA 4WQDA 2OZ1B 1CHHA 1L0ND 1DW1A 3OA8A 5CIEB 2KNCB 1YICA 2V08A 2N18B 1KX7A 4WQ8A 3JBTB 1PP9D 1N15A 1RAPA 3H1LD 1CSXA 3ORVA 2ZXYA 1H31A 3O20A 4L1QA 1SQPD 1S6VB 2N3YA 3ZOWA 2N9YB
chains in the Genus database with same CATH superfamily
2O01J 3PXWA 3CWBG 1GIWA 3O6QB 1FJKA 2WZ7A 2XU6A 2AIUA 3RGUA 1LT9C 2QJKC 3RN0A 4WQBA 2BEQD 1VQ6P 1AVYA 1AQ5A 2BH5X 4EIEA 5AVQB 1ZV8A 5B5EE 3KZIV 1CCHA 3VRDA 1T3JA 1X22A 1S72P 1PGJA 5KLIC 3CYTI 3HD7D 2Q7CA 2YO3A 1RZ6A 1IZL0 1HVVA 3Q5SA 1YJWP 2E74C 2YCCA 5KKZB 2BPBB 1NTME 3I56P 4GOEA 1OAEA 2D2CC 2HPCB 3DMIA 1BDDA 1JY2P 1KZUB 3L73J 1J2JB 3PH0A 1NNOA 1AFOA 1R8EA 2C1VA 3A2AA 1L0LK 4UB8E 1CSVA 2W6AA 1Y9BA 2N1TD 5TISE 2YNYA 3V2NA 3CWBE 1URQC 1RAQA 3TGUJ 1NVOA 1JTHA 1KB9I 1KYOI 2YKOA 3CLQA 4KT0J 2IX7C 2QG4A 1HJ0A 2Y0CA 1CW5A 1N90A 1AJYA 1QL3A 1HF9A 3V2QA 3U1CA 1T2KD 5DJTB 1HCMA 2OARA 2KZIA 3MZWB 1CCRA 4QAOA 1DIIC 2B87B 4WY4B 1IJDB 1HRCA 2IBZE 1NTZJ 2ZT9D 2RH0A 4XA4A 2YXQB 4ZNCA 1L0NG 5E79E 3IAOA 3WUVA 5DF5A 3AEAC 1YIJP 1S3JA 1GKSA 1IFJA 155CA 5AW6B 3F5HA 1M70A 2FYUK 3L73D 5AW7B 1YFCA 1G2CB 1SQPG 3S1KA 1VQ7P 1PFIA 5AVUB 2FYNC 2H88C 3M0DC 3E1IA 2P58A 5C39A 2NPSA 3FX0A 1KB9H 1KYOH 4Y28J 3AEGC 4ASVA 4NPFX 3TGUD 1FZBA 1SQVJ 3GLMA 1YHQP 4PD4E 2B12B 1L9BC 4L75A 3NBSA 4I7ZB 5BU8B 1YNRA 3HQ8A 3KZIE 1CXAA 1AYGA 2WMMA 1FDMA 5B66H 1VQ8P 5APVA 1VQ9P 4PJ0H 4DOJA 5CIFB 1HZUA 4KJMA 1J1EC 3WMM0 1A56A 2ZYAA 1SQXG 2YMKA 2AEMA 4LJIA 5CICB 1R5LA 1NU1J 3P8CE 3C9IA 2E76C 1CNOA 1CIGA 3CXHE 3IF4A 4D6TE 3V4WA 451CA 2E75D 2NPSB 2P1JA 1JY3N 2ZZS1 2P67A 2C9XB 1BE3J 2J59M 3CCMP 2JO1A 4DY9A 5DFSA 1U74B 1X8YA 3QWOC 3HE5A 3QH9A 1W2EA 1SQVD 2FYZA 5APSA 1YCCA 4U7JA 351CA 2QJPC 3B5NA 3H1KJ 1E2RA 4FA9A 4RO0A 1YITP 2JR8A 4WY4D 2LXCB 1AV1A 4EYYQ 1IZNB 1U7MA 3RLMA 2B89A 3A7OA 3O8ZA 1NU1D 3RMZA 1SQXE 1IO4A 4WQAA 3L72J 5B66V 1NTKJ 4PJ0V 1I55A 1D7MA 1L4AC 4K35A 4I1LA 2LITA 1JCCA 2PGDA 1YQ3C 2RN0A 2KS1A 5AVSB 2QIWA 2R5BA 2FFDC 1VQOP 2C0WA 5C9MA 1BE3D 1VYDA 2E42A 4N78E 2HLOA 2C2CA 1Q90D 3B5NB 1QL1A 3VMYA 1H89A 1LFMA 1U75B 3TGUG 1VQMP 1NOHA 2W83C 5APWA 1PV3A 3H1KD 5KLVE 1S9KE 5CCHA 2LXBA 3L71D 3X39A 4FA5A 4KHXA 4QMAA 1FZCA 1NTZG 3L74D 1RQUA 1FOCA 1M8OB 3P8MC 3L70D 1IRVA 3L72D 1GL2A 2B10B 3P32A 2KS1B 1NTKD 3CX5I 4H13C 1W5CE 3BVHA 4GYDA 3T97A 1JM0A 1FS0E 3GMAA 1X9VA 1P84D 4L3GA 2M8RA 2GUSA 5B6QA 2HFED 1PP9E 3F89A 2OYHA 2YMYA 5K5GB 3SFEC 2WSSH 3KYQA 2IFNA 3G6EP 3D70A 2K88A 2QM7A 1H0TA 3ZCFA 4H44B 1M56D 1SQVG 3TGUE 2QJYC 3V6IA 2KNCA 3H1LJ 5APYA 2BCCG 4NFGB 2K1AA 1FZCB 5APUA 2I8DA 4BRYA 3CC4P 2POHA 4IFMA 2J5UA 4FANA 4XYDB 1KB9E 1KYOE 3LIEA 1GL2B 2BEZF 1JY3O 1C6OA 3AE3C 1NTZE 3T97B 1FZFA 2W8ZA 2WTYA 4WVZA 1C7MA 3CCRP 2KOGA 3WFDC 1LWUB 5H2FV 2N9BA 3HE4A 5B66E 3U1AA 1WT6A 2AEFA 4PJ0E 1JB0J 4FA4A 1I8OA 1EZVD 1H0TB 3MP7B 1BE3G 1HUCA 1HJ4A 5CBNA 4WQDA 2OZ1B 3B5ND 3A0BH 2XZRA 1S5LH 2ZAEB 2KNCB 2V7QJ 1NTMK 1RE4C 3RK3B 3HD7A 1KX7A 4WQ8A 4BRYB 3JBTB 1AVOA 1N15A 3H1KG 3H1LD 1CSXA 2IDBA 1SQQJ 2ZXYA 4XFJA 3O20A 1LTBC 2BCCE 3GHGB 1DIPA 1G1IA 3HTKB 4C46A 4HH2A 3VMAA 4N3YB 2ZOOA 1OWAA 1H88A 1DW0A 3HRNA 3OA7A 3HE4B 1JY2N 1S1CX 1FHBA 4EICA 4LC1A 4DCKA 1NTKG 1I5TA 1Q82Q 3EQ2A 1PPJE 1YJNP 1Y8AA 1FI3A 4PWAA 1CRGA 1CTYA 2V7QH 2QM8A 2N1TA 4U3FG 3RBXA 2YQBA 1W2LA 1GMJA 3NFQA 2C9LY 1LGHB 1C6SA 5KAFV 5AVYB 2N1TC 2WVRA 3HD7B 3V4QA 1ZRTD 5CCHD 1FDOA 1OW6A 4H44D 1ZW0A 1NAYA 1JO5A 1HJ3A 4JPZB 1NIRA 1KQSO 1OFCX 1S5LX 1YTZT 3M0AA 3VNWA 1SQQD 3A0BV 1DW3A 1GD2E 1S5LV 1NH4A 4J20A 3V2PA 1YEAA 2ZT9C 1K3GA 2WSCJ 1AOQA 2N18C 2YO2A 1LTTC 3CCSP 2QRXA 3HQ9A 4KMGA 1SQBG 1LC1A 2GC7D 1DH3A 3V2RA 1N9CA 1HROA 2PACA 3MIWA 1KTMA 1EDJA 1I6DA 2YXRB 5H2FE 4U3FE 1JDLA 3E1RA 3NXSA 1VPCA 1E29A 5APTA 1ZR4A 2Z5HA 3CX5W 2W6JH 1WEJF 1CXCA 2Y0DA 3WUTA 3FWNA 4V2KA 1IRWA 1X79B 3RK3D 2WSCH 2CE0A 1L0NK 1UIIA 3L75D 1QX8A 2AXCA 1QEXA 1HZVA 1N8RQ 2V07A 2KP8A 1MZ9A 1M7LA 1MV8A 1GJQA 2C0XA 4O1WA 5KKZC 1N2DC 1E5WA 5CCGA 1BSHA 4JQ0D 3Q2YA 2N9IA 4L3HA 4ZKPA 4GEDB 5GTIH 1OVUA 1JCDA 5AVTB 3AE8C 1OXZA 4I6MC 4HKZH 1SQBE 2C1UA 1DVHA 1OCDA 1FC2C 1L0LJ 3AEFC 2QVAA 2R3SA 2OYOA 1CSWA 1RF0A 1RE3A 1GDVA 5CJ0A 2BH4X 3CX5E 1HGZA 4MN4C 4RKUJ 3MHVA 4WB4A 2KK7A 3WUUA 2AXTV 5KAFE 2B87A 1JNMA 4AANA 4WY4A 1SQXK 3VYMA 1JY2O 2O01H 5EXQA 2I1KA 4WY4C 4WQ7A 1MUUA 1H33A 1KQFB 3H6PA 2SPZA 2B4ZA 1QN2A 4R4LA 4MU8A 3A0BE 2YIUB 3L35A 4GODA 1S5LE 2E75B 3EFGA 1ZP0C 1SP4A 1G2CA 3TYYA 3O1YA 2ZBOA 1DX7A 1M6ZA 2CPBA 1LJ2A 2CE1A 1YIQA 3ZBMA 2FYUJ 3H1HJ 1LT9B 1KQGB 1YQ4C 1CIEA 3G9RA 2PAJA 3HQ7A 4FA1A 4Y5RA 3VTPC 1GW4A 1L0LD 1H9XA 2LR2A 5KLVK 1KB0A 3D71A 2GM4A 2Z5IA 1NWQA 2IYPA 3VYIA 3CC2P 3CCVP 1Q81Q 1LT1A 4EIFA 4Q5PA 5KLIB 3MGNA 3S4RA 1VQ5P 1Q2NA 3SWYA 1FZGA 4OGQB 4GIFA 1JEKA 1H33B 1MG3D 2L91A 4I7ZC 1OMIA 2D2CB 3PHLA 3L37A 3WU2H 4ASWA 3CXHW 1SS1A 3NTNA 1K04A 2ITAA 2W90A 1KIBA 1QL4A 1CSUA 4H0JA 2FYUD 2P10A 1GTWA 3H1HD 1L2PA 2LIRA 1BL9A 1HWTC 1LTAC 2NPSC 2K9JB 4Y99B 1KILA 2G8YA 5AW4B 1ZMEC 4FAVA 3WC8A 1WMKA 4PV1C 1VF5B 2KSJA 1IFDA 1KORA 4WWIA 1I54A 2WPRA 5CIGB 1C2RA 1HH0A 4GOFA 1NTZK 1FDIA 5DJQB 4IOIH 1BCCJ 1BGYJ 1NYHA 2AXTE 1L0NE 3II6A 3WFCC 1VQ4P 5CCGD 3D6YA 3CCEP 2BGVX 3W68A 3JCUH 3AE9C 1SQPE 3TNUA 2I1JA 2DVHA 1Z56A 2H8PD 1GZLA 3WU2V 4DZOA 1YYCA 5AW9B 1KILB 1T8ZA 1H31B 1NMLA 3H1ID 2AI5A 1CSBA 1NGMB 3R2PA 4B86A 2WPSA 1HH7A 1CTZA 3G3ZA 2ORLA 3L71J 3CI9A 4CPGA 2NRGA 2LKMA 2XNDH 3B5NC 4OGQD 2R44A 3SLEA 4AAOA 1G1JA 2P7JA 3L74J 4TLFA 3GG2A 3L70J 5TJHA 1BCCD 1P84I 1BGYD 1W2BO 1FU1A 1CRJA 2CXBA 3RBZA 2D2CD 3GF3A 2E76B 3NBTA 3LW5J 4ZMDA 1S4XA 3A9FA 2WWWA 4IL6H 3TNUB 3L73G 5CYTR 1C75A 3RL0B 3MUDA 4OWFA 1Y47A 2DW3A 3TYIA 1GU5A 2K3RA 2M0BA 1SLQA 1CHHA 1XTGB 3OA8A 5AW3B 3HUSA 5CIEB 1YICA 1URQD 2FYUG 4DT0A 2Y9ZA 1IK9A 3U59A 3H1HG 3BRTB 1RAPA 1N86A 3LIDA 1VF5D 3D0WA 3AECC 4HJGH 3LW5H 2PRRA 2O1JA 5CCHC 1LNQA 1P84H 2FKWB 4H44C 2N3BA 1KMIZ 1CORA 1KYOW 5AW5B 2BCNB 1S2EA 5AVZB 4C7NA 4XXLA 5EFWB 1FZCC 2ZJSE 4I2LC 1GW3A 1ZR2A 1A2SA 1EZVI 1L4AB 1ZN5A 5CMZA 1GL2C 3L73E 3JC22 3ZOYA 3OA8B 4IL6X 1KN7A 3HUSB 1LWUA 2FFDB 2N9JA 3PTZA 1KILD 2OYHC 4IL6V 1PL5A 4JF7A 1LWUC 1CHJA 1SFCB 4HYTB 1N73A 1GQ1A 3AE6C 3WU2E 2OQQA 3D6ZA 4IFFA 2OZ1A 1EC5A 3CL3D 4RSZA 1KD1Q 4H0KA 3CMEP 1M1KQ 1QVFO 1CHIA 2HR3A 3PLNA 2IZ0A 4YPCA 1LTJB 2KYVA 1FCDC 3Q3DA 5KJ7D 2GC4D 4C7NB 2QE7H 3RK2B 1IK7A 3RK3C 4DJGA 1FBMA 3GHGA 3GW6A 2OYIA 3TSIA 1BCCG 1BGYG 3HTKA 2E76D 1NU1G 2WSFJ 4ZKUA 3ITKA 3GHGC 1USEA 2WPQA 4OVNF 1SQBK 3M9QA 3RL0D 3AEDC 1RQVA 2A06D 2CK3H 1JMBA 2KZJA 1RF1A 1AOFA 4L73A 1N73B 3CWBJ 1KFNA 2HG5D 1NJIQ 1USDA 3CCJP 2VHDA 1OZHA 4UB6H 4JYCA 4O9BA 2M5AB 2HODA 2CA4B 1SQVE 1PGPA 5AW1B 1JMMA 1Q86Q 3MD0A 3HQ6A 1PZQA 3L71G 2KSEA 3HD7C 4YXWH 1MKMA 2OYIB 3MK7B 2Y9YA 5C0ZA 2WQYC 1NTMD 4JBZA 3H1JJ 3UIAA 1GK6A 3L74G 3L4MA 2FWLA 3L70G 2Y0EA 5TISH 1BGYE 3L72G 3CP5A 1J1DB 1L4AD 1K05A 1NU1E 3W67A 2KUBA 2A45H 1H32A 1DD4A 3OCDB 1CEDA 1RF1B 2XNXA 1CI6A 5DJUB 1C6RA 4RJTA 1EDKA 3AE1C 5CHXA 2GIWA 3CWBD 2W6BA 4O1QA 4H0LB 2H89C 3VP9A 1BE3E 5AVRB 1SFCD 2HODB 2KXPB 2C9NY 3SJLA 2C1DA 1IFPA 4IL6E 1FZEA 2IZ1A 3CU4A 3CCLP 3N7NA 1DEBA 2B0ZB 3M06A 3FXEA 1T2KC 3L75J 1CYJA 3IN6A 1ZXGA 1CZQA 2IBZD 3C8VA 3H1KE 2JTIB 3R4YA 4UB6V 3L71E 3B71A 1CIFA 3RK2D 1GK4A 2XKMA 3M9HA 4AYCA 1PIXA 3H1JD 4C7RA 2XTSB 3L74E 1H32B 1CI6B 3VN0A 2JWAA 5AVVB 2ZVNB 3L70E 1LMSA 4NPDA 4D6TJ 3VP8A 5CIDB 2WPVB 3L72E 2CPSA 2MTAC 2WSEJ 1NTKE 1QVGO 4PD4H 1AKKA 2A06G 1P84E 5GTHH 4AUWA 1OIPA 1EZVG 2C1DB 3PH2B 3EWKA 1K9MQ 1KILE 5CJ4A 1W5CT 4PD4D 2RKLA 4OH8B 1A02J 1CRCA 3V5BA 1E79H 1VQLP 3CXHH 3H1LG 2E5YA 1QL2A 3OAKA 2KI7B 2WSEH 1SQPK 3OW2O 1SQXJ 3P8CD 5AW8B 1YTZI 2WT7A 3BRVB 1M1JA 1FOSF 2JQRA 3CXHD 3DR0A 4LLHA 4D6TD 1CRIA 1YBKA 1T6AA 1FE6A 5CCGC 1M57D 2C8SA 1FJPA 2YIUC 2AEJA 2E75C 3SVWA 1R5SA 3TF5A 2FY8A 1LT9A 2O1KA 2YK3A 2A06E 4H0LD 1IC2A 3A0HH 1EZVE 1RF0C 1RE3C 3SFDC 2A45G 2XDJA 1K3HA 1RZ5A 1QLED 1EDIA 3JSVC 5GTHV 5KLVJ 2KB7P 1CRYA 1CRHA 1NMIA 3BASA 1DT1A 1X0TA 4L76A 3USSA 2O01N 4P4QB 1SQQG 2IBZG 3H1LE 2WT7B 3A5TA 4OGQC 1M1JB 1NO4A 1N7SB 1SQXD 2JP3A 1MZ4A 3H1JG 4UB6E 1HJ5A 1SVFA 3FXDA 3K5BA 2H7HA 2YKPA 2FRCA 1DIQC 1IFIA 2QJKB 3CD6P 1PP9J 1ZOYC 1KQLA 2Q3IA 2R3CA 2FXOA 1EB7A 1OW8A 2D0SA 4HB1A 4N78D 1URQA 5GTIV 2K9JA 3O0RC 2OTLP 1N50A 1IFMA 1CO6A 1M90Q 1H1OA 2PCCB 1ZLLA 3AE2C 4YXDC 4PW9B 4Y99C 3ZDMA 5KLVD 1ZRTE 1S9KD 1LC2A 2E74B 2OTKE 2K9YA 3PXSA 1GU4A 3A0HV 1VF5C 3L75G 3Q5PA 3N4XA 1KFMA 5KTBA 1DEEG 1VQPP 2M3EA 1SQQE 5DJQC 3L4OA 2FBWC 1DVVA 1YJ9P 1GDTA 4LGDE 3H1JE 1LTGC 2ZFCA 2WITA 2IYOA 5L8RJ 2V08A 3BCCJ 1YI2P 4D6TG 3M0DA 3H1IJ 1PP9D 2GUVA 1URQB 1AQTA 2P2UA 1MFTA 1H31A 2N3YA 1S6VB 1MFZA 4EOTA 1JTHB 1NAFA 1KILC 1LS9A 3NMDA 3WFBC 4R4MA 4N6JA 2E43A 4W80A 3H25A 3RK3E 2PCBB 4Z1MH 3SWSA 2BCCJ 2KLVA 5KJ7A 5IY51 5GTHE 1KB9D 1KYOD 4WQEA 3L75E 3AE5C 3ZOOA 1HGVA 5KJ7C 4EDFA 1N7SD 1CYCA 1NTZD 2IFMA 3AE7C 2L5GB 2FYNB 3VOPA 2YKQA 1RY3A 1EQ7A 1F1CA 2IPPA 2ZXEB 3IR9A 2UWJE 4RESB 2RMZA 3BCCD 1I6EA 2QSIA 2O3JA 3RL0C 3SWFA 2NZ2A 3AEBC 1NKZB 2ZONG 1SQVK 1LTIC 1L0LG 2V4HA 1PGOA 4XE5B 1CTJA 3E7KA 1EXJA 4JCGA 1FAVA 2ZVOB 4PV1B 1I8PA 4GDOA 3NWVA 1J3SA 1LTSC 5GTIE 2E74D 2Q5UA 3ZOXA 1J1EB 5KLVG 1PGQA 1CIHA 4L74A 3MTUE 2BCCD 4BWNA 1NU1K 3L4FA 2JWDA 5CIHB 2JDIH 3A0HE 2Q9IA 1T3UA 1DD3A 1L4AA 4WQCA 2FXPA 3KDPB 1F1FA 2QEXP 3TK1A 4EIDA 4AAMA 5AVWB 3MUDC 1PPJD 1FJ0A 2M3BA 4EI2A 4W7ZA 2FFDA 1IO3A 1QYZA 1PP9G 3KPEA 1OVRA 1U57A 4U3FJ 3Q5RA 3HUSC 1A02F 3HE5B 1SFCA 2QJPB 2ZXXA 1L0LE 2DGEA 1M60A 2Q3EA 1UIXA 1SFCC 4EIJA 5KAIH 1ETPA 1K8AQ 1U7JA 2HV4A 2BASA 3CCQP 1FI9A 1LTJA 4GKGA 2GA1A 3M9BA 3AEEC 3B4SA 3RN1A 1EXIA 3M97X 1KV9A 1LTJC 1MG2D 3WUIA 1QGKB 5AVXB 1B7VA 1NTKK 1FZAA 3I55P 3RK2C 3I5CA 4YE1A 1VL2A 1OVVA 5H2FH 2PFXA 3BATA 3Q1MA 3ZIYA 1KV4A 5BVZA 1SQBJ 3BCCG 3OJAB 2XV5A 4N0KA 3VMZA 3H1IG 2FYUE 2NPSD 3H1HE 4U3FD 2HYNA 3KHUA 2D0WA 3B8EB 1N73C 1FI7A 4PV1D 2M5AA 3KXDA 2MKVA 2JEEA 5CIBB 2OTJP 2Q1KA 1NTMJ 2JKVA 1HJBA 3A3YB 5BU5A 3WFEC 4AX3A 1JUNA 1GU2A 5KAIV 3H32A 2ZYDA 3C2CA 3FWLA 2OYIC 3MK7C 4H13B 5B5EH 4M3LA 3PXTA 2A45I 1CC5A 2VRSA 1YTCA 1ZZHA 3OCDA 3S9OA 3G4SP 3ABVC 1JY3P 3CX5H 1J1DC 3PP5A 1PPJG 2OYHB 1SQBD 5KAFH 1RF1C 2MJZA 2IBZI 3BCCE 3H1IE 3IFMA 4AALA 3PRJA 1VQKP 2OGUA 3JCUE 3CX5D 3SWKA 1CYIA 4WQ9A 2QJYB 2K37A 4H0LC 2WSFH 4A7PA 1RE4A 2L4DA 2PP6A 2EXVA 3O5CA 4IFDK 1BSNA 1QKSA 2J58A 1KC8Q 4UB8H 1WVEC 2QA4P 3H32B 1R0QA 3KQGA 5AURA 4WBAA 1COTA 1BCCE 1OW7A 3L36A 1LP1A 2GB8B 5AW0B 1RHZB 3RL0g 1L9JC 3TDKA 5AW2B 1Q7YQ 5M1BA 2I8FA 4PD4I 2CA3B 5B5EV 1H8AA 3SXTA 3EFFK 3M91A 1AA0A 5E79H 1K73Q 3VMXA 2ZYGA 1WRGA 3CC7P 2Q6QA 2G3AA 1N7LA 1SQQK 1C2NA 3G71P 4YTPC 3CXHI 2JJLA 4GT1A 4BXLA 2B9BA 3FGAD 3GF7A 3C1LA 4TT3H 1L0NJ 1KX2A 3CCUP 1C52A 1LP1B 2B88A 2KLUA 1HTLC 1E8EA 2FXMA 1EDLA 1XTCC 2E5TA 3CPWO 2R32A 4H13D 1H9YA 4UB8V 5APXA 4AQRD 1SQPJ 1A8CA 1GL2D 5KAIE 1DW2A 1BDCA 2KIKA 2B11B 5TISV 1VDFA 1OX3A 3SSUA 3KZIH 5CBOA 4NPEA 1FOSE 3AE4C 1RH5B 1YEBA 1IQCA 2N1TB 1JOCA 3O6QA 2BLFB 2AXTH 3DP5A 4K3IA 2R5DA 1NKNA 2W27A 4JYBA 3CMAP 4FB1A 5E79V 2MHMA 1IFNA 1NTMG 2ZT9B 1L0ND 1HBWA 1DW1A 1VQNP 2H43A 5APQA 3P7KA 1TU3F 2N18B 3PJSK 1N7SA 4K3AA 3ORVA 1M1JC 1NHLA 4L1QA 1SQPD 1N7SC 2HPCA 3ZOWA 2N9YB 2Z4EA 4W7YA
chains in the Genus database with same CATH topology
3VMAA 3PXWA 2ZOOA 1LS9A 2N3BA 3WFBC 1GIWA 1DW0A 1CORA 1KYOW 2AIUA 2BCNB 1FHBA 3RN0A 4EICA 4WQBA 2BH5X 4XXLA 4EIEA 1I5TA 2PCBB 3SWSA 3KZIV 1FI3A 5IY51 4PWAA 1CCHA 1A2SA 1CRGA 1CTYA 1KB9D 3VRDA 1KYOD 4WQEA 2YQBA 1W2LA 3ZOOA 3ZOYA 3CYTI 4EDFA 3OA8B 1CYCA 1NTZD 1C6SA 1RZ6A 5KAFV 1IZL0 2N9JA 3PTZA 2FYNB 1ZRTD 4IL6V 2YCCA 5KKZB 1F1CA 2BPBB 1CHJA 1HJ3A 1OAEA 2RMZA 1GQ1A 3BCCD 1NIRA 1I6EA 3DMIA 2O3JA 2OZ1A 3VNWA 4RSZA 1SQQD 3A0BV 2ZONG 1DW3A 4H0KA 1NNOA 1S5LV 1CHIA 3PLNA 4J20A 2C1VA 1CTJA 1YEAA 1K3GA 1CSVA 1FCDC 4JCGA 2GC4D 1I8PA 1AOQA 3NWVA 1J3SA 2N18C 3GW6A 1RAQA 3ZOXA 1CIHA 2QG4A 3HQ9A 4KMGA 2Y0CA 3ITKA 1LC1A 1N90A 2BCCD 1QL3A 2GC7D 1N9CA 1HROA 5CIHB 2PACA 1HCMA 1I6DA 1CCRA 4QAOA 1DIIC 2A06D 1JDLA 1HRCA 1E29A 1AOFA 4WQCA 3CX5W 1F1FA 1CXCA 1WEJF 2Y0DA 4EIDA 4AAMA 4V2KA 1IRWA 1PPJD 2VHDA 1FJ0A 2CE0A 1IO3A 1QYZA 5DF5A 1GKSA 3L75D 155CA 1M70A 3L73D 2CA4B 1YFCA 1HZVA 3HQ6A 2V07A 2QJPB 2DGEA 1GJQA 3MK7B 4O1WA 5C0ZA 1M60A 1NTMD 2Q3EA 1ETPA 3L4MA 2FWLA 2HV4A 2N9IA 2Y0EA 1FI9A 4L3HA 4GEDB 3TGUD 3CP5A 3RN1A 2B12B 1L9BC 3M97X 2C1UA 1H32A 1KV9A 1MG2D 1OCDA 3NBSA 3OCDB 3WUIA 1CEDA 1DVHA 1B7VA 1C6RA 4RJTA 1CSWA 1YNRA 3HQ8A 1CXAA 1AYGA 4YE1A 1GDVA 2BH4X 2GIWA 3CWBD 5CIFB 1HZUA 4O1QA 1A56A 2AXTV 4LJIA 3ZIYA 4AANA 5CICB 3SJLA 2C1DA 3VYMA 4N0KA 1CNOA 3CU4A 1CIGA 5EXQA 2B0ZB 4U3FD 4WQ7A 1CYJA 1H33A 451CA 3KHUA 2D0WA 2IBZD 2B4ZA 2JTIB 1FI7A 1QN2A 4UB6V 4MU8A 2ZZS1 2YIUB 1CIFA 2C9XB 4DY9A 5CIBB 3H1JD 5DFSA 1U74B 3O1YA 2ZBOA 1M6ZA 2XTSB 2CE1A 1YIQA 1H32B 3ZBMA 2JWAA 1SQVD 1LMSA 3WFEC 4AX3A 5CIDB 1CIEA 1YCCA 351CA 3HQ7A 4FA1A 1GU2A 4Y5RA 5KAIV 2MTAC 3C2CA 1L0LD 3FWLA 1E2RA 1H9XA 4FA9A 1KB0A 3MK7C 1AKKA 3PXTA 1CC5A 1YTCA 1ZZHA 3RLMA 4EIFA 4Q5PA 5KLIB 3OCDA 2C1DB 3PH2B 1W5CT 4PD4D 1NU1D 3RMZA 4WQAA 1H33B 1MG3D 1SQBD 5B66V 2L91A 1CRCA 4PJ0V 1I55A 2LITA 3PHLA 4AALA 2RN0A 3PRJA 2KS1A 3CX5D 3CXHW 1CYIA 4WQ9A 2QJYB 4A7PA 5C9MA 1BE3D 2L4DA 1VYDA 2EXVA 3O5CA 1KIBA 2C2CA 1QL4A 1QKSA 1CSUA 4H0JA 1WVEC 1R0QA 2FYUD 2JQRA 3CXHD 3DR0A 1LFMA 1U75B 3H1HD 2LIRA 4D6TD 1BL9A 5AURA 1COTA 1CRIA 2K9JB 3H1KD 2C8SA 2GB8B 3L71D 4FAVA 3X39A 3WC8A 3SVWA 3TF5A 1L9JC 4FA5A 3TDKA 2YK3A 2I8FA 3L74D 1FOCA 1I54A 2CA3B 3L70D 5CIGB 1C2RA 5DJQB 1K3HA 1IRVA 5B5EV 1RZ5A 3L72D 3SXTA 2B10B 5GTHV 1NTKD 1CRYA 3WFCC 1CRHA 4GYDA 1NMIA 1P84D 4L3GA 1DT1A 5B6QA 2BGVX 4P4QB 1C2NA 2DVHA 1SQXD 1MZ4A 3WU2V 1HJ5A 1KX2A 1H31B 1C52A 1NMLA 3H1ID 3ZCFA 1E8EA 2AI5A 2FRCA 1DIQC 2QJKB 1HH7A 1H9YA 4NFGB 1CTZA 4UB8V 1EB7A 1A8CA 2ORLA 2D0SA 1DW2A 4FANA 4XYDB 5GTIV 2B11B 5TISV 3O0RC 1N50A 1C6OA 1CO6A 3SLEA 4AAOA 1H1OA 2PCCB 3GG2A 1YEBA 1IQCA 4PW9B 5TJHA 1BCCD 1BGYD 5KLVD 1CRJA 2CXBA 1LC2A 1C7MA 3PXSA 3NBTA 3WFDC 2BLFB 3A0HV 5H2FV 3A9FA 3DP5A 4K3IA 5CYTR 1C75A 4FA4A 1I8OA 1EZVD 5DJQC 3L4OA 3TYIA 1DVVA 4FB1A 5E79V 1HJ4A 2MHMA 4WQDA 2OZ1B 1CHHA 1L0ND 1DW1A 3OA8A 5CIEB 2KNCB 1YICA 2V08A 2N18B 1KX7A 4WQ8A 3JBTB 1PP9D 1N15A 1RAPA 3H1LD 1CSXA 3ORVA 2ZXYA 1H31A 3O20A 4L1QA 1SQPD 1S6VB 2N3YA 3ZOWA 2N9YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMA A;  3PXW A;  2ZOO A;  1LS9 A;  2N3B A;  3WFB C;  1GIW A;  1DW0 A;  1COR A;  1KYO W;  2AIU A;  2BCN B;  1FHB A;  3RN0 A;  4EIC A;  4WQB A;  2BH5 X;  4XXL A;  4EIE A;  1I5T A;  2PCB B;  3SWS A;  3KZI V;  1FI3 A;  5IY5 1;  4PWA A;  1CCH A;  1A2S A;  1CRG A;  1CTY A;  1KB9 D;  3VRD A;  1KYO D;  4WQE A;  2YQB A;  1W2L A;  3ZOO A;  3ZOY A;  3CYT I;  4EDF A;  3OA8 B;  1CYC A;  1NTZ D;  1C6S A;  1RZ6 A;  5KAF V;  1IZL 0;  2N9J A;  3PTZ A;  2FYN B;  1ZRT D;  4IL6 V;  2YCC A;  5KKZ B;  1F1C A;  2BPB B;  1CHJ A;  1HJ3 A;  1OAE A;  2RMZ A;  1GQ1 A;  3BCC D;  1NIR A;  1I6E A;  3DMI A;  2O3J A;  2OZ1 A;  3VNW A;  4RSZ A;  1SQQ D;  3A0B V;  2ZON G;  1DW3 A;  4H0K A;  1NNO A;  1S5L V;  1CHI A;  3PLN A;  4J20 A;  2C1V A;  1CTJ A;  1YEA A;  1K3G A;  1CSV A;  1FCD C;  4JCG A;  2GC4 D;  1I8P A;  1AOQ A;  3NWV A;  1J3S A;  2N18 C;  3GW6 A;  1RAQ A;  3ZOX A;  1CIH A;  2QG4 A;  3HQ9 A;  4KMG A;  2Y0C A;  3ITK A;  1LC1 A;  1N90 A;  2BCC D;  1QL3 A;  2GC7 D;  1N9C A;  1HRO A;  5CIH B;  2PAC A;  1HCM A;  1I6D A;  1CCR A;  4QAO A;  1DII C;  2A06 D;  1JDL A;  1HRC A;  1E29 A;  1AOF A;  4WQC A;  3CX5 W;  1F1F A;  1CXC A;  1WEJ F;  2Y0D A;  4EID A;  4AAM A;  4V2K A;  1IRW A;  1PPJ D;  2VHD A;  1FJ0 A;  2CE0 A;  1IO3 A;  1QYZ A;  5DF5 A;  1GKS A;  3L75 D;  155C A;  1M70 A;  3L73 D;  2CA4 B;  1YFC A;  1HZV A;  3HQ6 A;  2V07 A;  2QJP B;  2DGE A;  1GJQ A;  3MK7 B;  4O1W A;  5C0Z A;  1M60 A;  1NTM D;  2Q3E A;  1ETP A;  3L4M A;  2FWL A;  2HV4 A;  2N9I A;  2Y0E A;  1FI9 A;  4L3H A;  4GED B;  3TGU D;  3CP5 A;  3RN1 A;  2B12 B;  1L9B C;  3M97 X;  2C1U A;  1H32 A;  1KV9 A;  1MG2 D;  1OCD A;  3NBS A;  3OCD B;  3WUI A;  1CED A;  1DVH A;  1B7V A;  1C6R A;  4RJT A;  1CSW A;  1YNR A;  3HQ8 A;  1CXA A;  1AYG A;  4YE1 A;  1GDV A;  2BH4 X;  2GIW A;  3CWB D;  5CIF B;  1HZU A;  4O1Q A;  1A56 A;  2AXT V;  4LJI A;  3ZIY A;  4AAN A;  5CIC B;  3SJL A;  2C1D A;  3VYM A;  4N0K A;  1CNO A;  3CU4 A;  1CIG A;  5EXQ A;  2B0Z B;  4U3F D;  4WQ7 A;  1CYJ A;  1H33 A;  451C A;  3KHU A;  2D0W A;  2IBZ D;  2B4Z A;  2JTI B;  1FI7 A;  1QN2 A;  4UB6 V;  4MU8 A;  2ZZS 1;  2YIU B;  1CIF A;  2C9X B;  4DY9 A;  5CIB B;  3H1J D;  5DFS A;  1U74 B;  3O1Y A;  2ZBO A;  1M6Z A;  2XTS B;  2CE1 A;  1YIQ A;  1H32 B;  3ZBM A;  2JWA A;  1SQV D;  1LMS A;  3WFE C;  4AX3 A;  5CID B;  1CIE A;  1YCC A;  351C A;  3HQ7 A;  4FA1 A;  1GU2 A;  4Y5R A;  5KAI V;  2MTA C;  3C2C A;  1L0L D;  3FWL A;  1E2R A;  1H9X A;  4FA9 A;  1KB0 A;  3MK7 C;  1AKK A;  3PXT A;  1CC5 A;  1YTC A;  1ZZH A;  3RLM A;  4EIF A;  4Q5P A;  5KLI B;  3OCD A;  2C1D B;  3PH2 B;  1W5C T;  4PD4 D;  1NU1 D;  3RMZ A;  4WQA A;  1H33 B;  1MG3 D;  1SQB D;  5B66 V;  2L91 A;  1CRC A;  4PJ0 V;  1I55 A;  2LIT A;  3PHL A;  4AAL A;  2RN0 A;  3PRJ A;  2KS1 A;  3CX5 D;  3CXH W;  1CYI A;  4WQ9 A;  2QJY B;  4A7P A;  5C9M A;  1BE3 D;  2L4D A;  1VYD A;  2EXV A;  3O5C A;  1KIB A;  2C2C A;  1QL4 A;  1QKS A;  1CSU A;  4H0J A;  1WVE C;  1R0Q A;  2FYU D;  2JQR A;  3CXH D;  3DR0 A;  1LFM A;  1U75 B;  3H1H D;  2LIR A;  4D6T D;  1BL9 A;  5AUR A;  1COT A;  1CRI A;  2K9J B;  3H1K D;  2C8S A;  2GB8 B;  3L71 D;  4FAV A;  3X39 A;  3WC8 A;  3SVW A;  3TF5 A;  1L9J C;  4FA5 A;  3TDK A;  2YK3 A;  2I8F A;  3L74 D;  1FOC A;  1I54 A;  2CA3 B;  3L70 D;  5CIG B;  1C2R A;  5DJQ B;  1K3H A;  1IRV A;  5B5E V;  1RZ5 A;  3L72 D;  3SXT A;  2B10 B;  5GTH V;  1NTK D;  1CRY A;  3WFC C;  1CRH A;  4GYD A;  1NMI A;  1P84 D;  4L3G A;  1DT1 A;  5B6Q A;  2BGV X;  4P4Q B;  1C2N A;  2DVH A;  1SQX D;  1MZ4 A;  3WU2 V;  1HJ5 A;  1KX2 A;  1H31 B;  1C52 A;  1NML A;  3H1I D;  3ZCF A;  1E8E A;  2AI5 A;  2FRC A;  1DIQ C;  2QJK B;  1HH7 A;  1H9Y A;  4NFG B;  1CTZ A;  4UB8 V;  1EB7 A;  1A8C A;  2ORL A;  2D0S A;  1DW2 A;  4FAN A;  4XYD B;  5GTI V;  2B11 B;  5TIS V;  3O0R C;  1N50 A;  1C6O A;  1CO6 A;  3SLE A;  4AAO A;  1H1O A;  2PCC B;  3GG2 A;  1YEB A;  1IQC A;  4PW9 B;  5TJH A;  1BCC D;  1BGY D;  5KLV D;  1CRJ A;  2CXB A;  1LC2 A;  1C7M A;  3PXS A;  3NBT A;  3WFD C;  2BLF B;  3A0H V;  5H2F V;  3A9F A;  3DP5 A;  4K3I A;  5CYT R;  1C75 A;  4FA4 A;  1I8O A;  1EZV D;  5DJQ C;  3L4O A;  3TYI A;  1DVV A;  4FB1 A;  5E79 V;  1HJ4 A;  2MHM A;  4WQD A;  2OZ1 B;  1CHH A;  1L0N D;  1DW1 A;  3OA8 A;  5CIE B;  2KNC B;  1YIC A;  2V08 A;  2N18 B;  1KX7 A;  4WQ8 A;  3JBT B;  1PP9 D;  1N15 A;  1RAP A;  3H1L D;  1CSX A;  3ORV A;  2ZXY A;  1H31 A;  3O20 A;  4L1Q A;  1SQP D;  1S6V B;  2N3Y A;  3ZOW A;  2N9Y B; 
#chains in the Genus database with same CATH topology
 2O01 J;  3PXW A;  3CWB G;  1GIW A;  3O6Q B;  1FJK A;  2WZ7 A;  2XU6 A;  2AIU A;  3RGU A;  1LT9 C;  2QJK C;  3RN0 A;  4WQB A;  2BEQ D;  1VQ6 P;  1AVY A;  1AQ5 A;  2BH5 X;  4EIE A;  5AVQ B;  1ZV8 A;  5B5E E;  3KZI V;  1CCH A;  3VRD A;  1T3J A;  1X22 A;  1S72 P;  1PGJ A;  5KLI C;  3CYT I;  3HD7 D;  2Q7C A;  2YO3 A;  1RZ6 A;  1IZL 0;  1HVV A;  3Q5S A;  1YJW P;  2E74 C;  2YCC A;  5KKZ B;  2BPB B;  1NTM E;  3I56 P;  4GOE A;  1OAE A;  2D2C C;  2HPC B;  3DMI A;  1BDD A;  1JY2 P;  1KZU B;  3L73 J;  1J2J B;  3PH0 A;  1NNO A;  1AFO A;  1R8E A;  2C1V A;  3A2A A;  1L0L K;  4UB8 E;  1CSV A;  2W6A A;  1Y9B A;  2N1T D;  5TIS E;  2YNY A;  3V2N A;  3CWB E;  1URQ C;  1RAQ A;  3TGU J;  1NVO A;  1JTH A;  1KB9 I;  1KYO I;  2YKO A;  3CLQ A;  4KT0 J;  2IX7 C;  2QG4 A;  1HJ0 A;  2Y0C A;  1CW5 A;  1N90 A;  1AJY A;  1QL3 A;  1HF9 A;  3V2Q A;  3U1C A;  1T2K D;  5DJT B;  1HCM A;  2OAR A;  2KZI A;  3MZW B;  1CCR A;  4QAO A;  1DII C;  2B87 B;  4WY4 B;  1IJD B;  1HRC A;  2IBZ E;  1NTZ J;  2ZT9 D;  2RH0 A;  4XA4 A;  2YXQ B;  4ZNC A;  1L0N G;  5E79 E;  3IAO A;  3WUV A;  5DF5 A;  3AEA C;  1YIJ P;  1S3J A;  1GKS A;  1IFJ A;  155C A;  5AW6 B;  3F5H A;  1M70 A;  2FYU K;  3L73 D;  5AW7 B;  1YFC A;  1G2C B;  1SQP G;  3S1K A;  1VQ7 P;  1PFI A;  5AVU B;  2FYN C;  2H88 C;  3M0D C;  3E1I A;  2P58 A;  5C39 A;  2NPS A;  3FX0 A;  1KB9 H;  1KYO H;  4Y28 J;  3AEG C;  4ASV A;  4NPF X;  3TGU D;  1FZB A;  1SQV J;  3GLM A;  1YHQ P;  4PD4 E;  2B12 B;  1L9B C;  4L75 A;  3NBS A;  4I7Z B;  5BU8 B;  1YNR A;  3HQ8 A;  3KZI E;  1CXA A;  1AYG A;  2WMM A;  1FDM A;  5B66 H;  1VQ8 P;  5APV A;  1VQ9 P;  4PJ0 H;  4DOJ A;  5CIF B;  1HZU A;  4KJM A;  1J1E C;  3WMM 0;  1A56 A;  2ZYA A;  1SQX G;  2YMK A;  2AEM A;  4LJI A;  5CIC B;  1R5L A;  1NU1 J;  3P8C E;  3C9I A;  2E76 C;  1CNO A;  1CIG A;  3CXH E;  3IF4 A;  4D6T E;  3V4W A;  451C A;  2E75 D;  2NPS B;  2P1J A;  1JY3 N;  2ZZS 1;  2P67 A;  2C9X B;  1BE3 J;  2J59 M;  3CCM P;  2JO1 A;  4DY9 A;  5DFS A;  1U74 B;  1X8Y A;  3QWO C;  3HE5 A;  3QH9 A;  1W2E A;  1SQV D;  2FYZ A;  5APS A;  1YCC A;  4U7J A;  351C A;  2QJP C;  3B5N A;  3H1K J;  1E2R A;  4FA9 A;  4RO0 A;  1YIT P;  2JR8 A;  4WY4 D;  2LXC B;  1AV1 A;  4EYY Q;  1IZN B;  1U7M A;  3RLM A;  2B89 A;  3A7O A;  3O8Z A;  1NU1 D;  3RMZ A;  1SQX E;  1IO4 A;  4WQA A;  3L72 J;  5B66 V;  1NTK J;  4PJ0 V;  1I55 A;  1D7M A;  1L4A C;  4K35 A;  4I1L A;  2LIT A;  1JCC A;  2PGD A;  1YQ3 C;  2RN0 A;  2KS1 A;  5AVS B;  2QIW A;  2R5B A;  2FFD C;  1VQO P;  2C0W A;  5C9M A;  1BE3 D;  1VYD A;  2E42 A;  4N78 E;  2HLO A;  2C2C A;  1Q90 D;  3B5N B;  1QL1 A;  3VMY A;  1H89 A;  1LFM A;  1U75 B;  3TGU G;  1VQM P;  1NOH A;  2W83 C;  5APW A;  1PV3 A;  3H1K D;  5KLV E;  1S9K E;  5CCH A;  2LXB A;  3L71 D;  3X39 A;  4FA5 A;  4KHX A;  4QMA A;  1FZC A;  1NTZ G;  3L74 D;  1RQU A;  1FOC A;  1M8O B;  3P8M C;  3L70 D;  1IRV A;  3L72 D;  1GL2 A;  2B10 B;  3P32 A;  2KS1 B;  1NTK D;  3CX5 I;  4H13 C;  1W5C E;  3BVH A;  4GYD A;  3T97 A;  1JM0 A;  1FS0 E;  3GMA A;  1X9V A;  1P84 D;  4L3G A;  2M8R A;  2GUS A;  5B6Q A;  2HFE D;  1PP9 E;  3F89 A;  2OYH A;  2YMY A;  5K5G B;  3SFE C;  2WSS H;  3KYQ A;  2IFN A;  3G6E P;  3D70 A;  2K88 A;  2QM7 A;  1H0T A;  3ZCF A;  4H44 B;  1M56 D;  1SQV G;  3TGU E;  2QJY C;  3V6I A;  2KNC A;  3H1L J;  5APY A;  2BCC G;  4NFG B;  2K1A A;  1FZC B;  5APU A;  2I8D A;  4BRY A;  3CC4 P;  2POH A;  4IFM A;  2J5U A;  4FAN A;  4XYD B;  1KB9 E;  1KYO E;  3LIE A;  1GL2 B;  2BEZ F;  1JY3 O;  1C6O A;  3AE3 C;  1NTZ E;  3T97 B;  1FZF A;  2W8Z A;  2WTY A;  4WVZ A;  1C7M A;  3CCR P;  2KOG A;  3WFD C;  1LWU B;  5H2F V;  2N9B A;  3HE4 A;  5B66 E;  3U1A A;  1WT6 A;  2AEF A;  4PJ0 E;  1JB0 J;  4FA4 A;  1I8O A;  1EZV D;  1H0T B;  3MP7 B;  1BE3 G;  1HUC A;  1HJ4 A;  5CBN A;  4WQD A;  2OZ1 B;  3B5N D;  3A0B H;  2XZR A;  1S5L H;  2ZAE B;  2KNC B;  2V7Q J;  1NTM K;  1RE4 C;  3RK3 B;  3HD7 A;  1KX7 A;  4WQ8 A;  4BRY B;  3JBT B;  1AVO A;  1N15 A;  3H1K G;  3H1L D;  1CSX A;  2IDB A;  1SQQ J;  2ZXY A;  4XFJ A;  3O20 A;  1LTB C;  2BCC E;  3GHG B;  1DIP A;  1G1I A;  3HTK B;  4C46 A;  4HH2 A;  3VMA A;  4N3Y B;  2ZOO A;  1OWA A;  1H88 A;  1DW0 A;  3HRN A;  3OA7 A;  3HE4 B;  1JY2 N;  1S1C X;  1FHB A;  4EIC A;  4LC1 A;  4DCK A;  1NTK G;  1I5T A;  1Q82 Q;  3EQ2 A;  1PPJ E;  1YJN P;  1Y8A A;  1FI3 A;  4PWA A;  1CRG A;  1CTY A;  2V7Q H;  2QM8 A;  2N1T A;  4U3F G;  3RBX A;  2YQB A;  1W2L A;  1GMJ A;  3NFQ A;  2C9L Y;  1LGH B;  1C6S A;  5KAF V;  5AVY B;  2N1T C;  2WVR A;  3HD7 B;  3V4Q A;  1ZRT D;  5CCH D;  1FDO A;  1OW6 A;  4H44 D;  1ZW0 A;  1NAY A;  1JO5 A;  1HJ3 A;  4JPZ B;  1NIR A;  1KQS O;  1OFC X;  1S5L X;  1YTZ T;  3M0A A;  3VNW A;  1SQQ D;  3A0B V;  1DW3 A;  1GD2 E;  1S5L V;  1NH4 A;  4J20 A;  3V2P A;  1YEA A;  2ZT9 C;  1K3G A;  2WSC J;  1AOQ A;  2N18 C;  2YO2 A;  1LTT C;  3CCS P;  2QRX A;  3HQ9 A;  4KMG A;  1SQB G;  1LC1 A;  2GC7 D;  1DH3 A;  3V2R A;  1N9C A;  1HRO A;  2PAC A;  3MIW A;  1KTM A;  1EDJ A;  1I6D A;  2YXR B;  5H2F E;  4U3F E;  1JDL A;  3E1R A;  3NXS A;  1VPC A;  1E29 A;  5APT A;  1ZR4 A;  2Z5H A;  3CX5 W;  2W6J H;  1WEJ F;  1CXC A;  2Y0D A;  3WUT A;  3FWN A;  4V2K A;  1IRW A;  1X79 B;  3RK3 D;  2WSC H;  2CE0 A;  1L0N K;  1UII A;  3L75 D;  1QX8 A;  2AXC A;  1QEX A;  1HZV A;  1N8R Q;  2V07 A;  2KP8 A;  1MZ9 A;  1M7L A;  1MV8 A;  1GJQ A;  2C0X A;  4O1W A;  5KKZ C;  1N2D C;  1E5W A;  5CCG A;  1BSH A;  4JQ0 D;  3Q2Y A;  2N9I A;  4L3H A;  4ZKP A;  4GED B;  5GTI H;  1OVU A;  1JCD A;  5AVT B;  3AE8 C;  1OXZ A;  4I6M C;  4HKZ H;  1SQB E;  2C1U A;  1DVH A;  1OCD A;  1FC2 C;  1L0L J;  3AEF C;  2QVA A;  2R3S A;  2OYO A;  1CSW A;  1RF0 A;  1RE3 A;  1GDV A;  5CJ0 A;  2BH4 X;  3CX5 E;  1HGZ A;  4MN4 C;  4RKU J;  3MHV A;  4WB4 A;  2KK7 A;  3WUU A;  2AXT V;  5KAF E;  2B87 A;  1JNM A;  4AAN A;  4WY4 A;  1SQX K;  3VYM A;  1JY2 O;  2O01 H;  5EXQ A;  2I1K A;  4WY4 C;  4WQ7 A;  1MUU A;  1H33 A;  1KQF B;  3H6P A;  2SPZ A;  2B4Z A;  1QN2 A;  4R4L A;  4MU8 A;  3A0B E;  2YIU B;  3L35 A;  4GOD A;  1S5L E;  2E75 B;  3EFG A;  1ZP0 C;  1SP4 A;  1G2C A;  3TYY A;  3O1Y A;  2ZBO A;  1DX7 A;  1M6Z A;  2CPB A;  1LJ2 A;  2CE1 A;  1YIQ A;  3ZBM A;  2FYU J;  3H1H J;  1LT9 B;  1KQG B;  1YQ4 C;  1CIE A;  3G9R A;  2PAJ A;  3HQ7 A;  4FA1 A;  4Y5R A;  3VTP C;  1GW4 A;  1L0L D;  1H9X A;  2LR2 A;  5KLV K;  1KB0 A;  3D71 A;  2GM4 A;  2Z5I A;  1NWQ A;  2IYP A;  3VYI A;  3CC2 P;  3CCV P;  1Q81 Q;  1LT1 A;  4EIF A;  4Q5P A;  5KLI B;  3MGN A;  3S4R A;  1VQ5 P;  1Q2N A;  3SWY A;  1FZG A;  4OGQ B;  4GIF A;  1JEK A;  1H33 B;  1MG3 D;  2L91 A;  4I7Z C;  1OMI A;  2D2C B;  3PHL A;  3L37 A;  3WU2 H;  4ASW A;  3CXH W;  1SS1 A;  3NTN A;  1K04 A;  2ITA A;  2W90 A;  1KIB A;  1QL4 A;  1CSU A;  4H0J A;  2FYU D;  2P10 A;  1GTW A;  3H1H D;  1L2P A;  2LIR A;  1BL9 A;  1HWT C;  1LTA C;  2NPS C;  2K9J B;  4Y99 B;  1KIL A;  2G8Y A;  5AW4 B;  1ZME C;  4FAV A;  3WC8 A;  1WMK A;  4PV1 C;  1VF5 B;  2KSJ A;  1IFD A;  1KOR A;  4WWI A;  1I54 A;  2WPR A;  5CIG B;  1C2R A;  1HH0 A;  4GOF A;  1NTZ K;  1FDI A;  5DJQ B;  4IOI H;  1BCC J;  1BGY J;  1NYH A;  2AXT E;  1L0N E;  3II6 A;  3WFC C;  1VQ4 P;  5CCG D;  3D6Y A;  3CCE P;  2BGV X;  3W68 A;  3JCU H;  3AE9 C;  1SQP E;  3TNU A;  2I1J A;  2DVH A;  1Z56 A;  2H8P D;  1GZL A;  3WU2 V;  4DZO A;  1YYC A;  5AW9 B;  1KIL B;  1T8Z A;  1H31 B;  1NML A;  3H1I D;  2AI5 A;  1CSB A;  1NGM B;  3R2P A;  4B86 A;  2WPS A;  1HH7 A;  1CTZ A;  3G3Z A;  2ORL A;  3L71 J;  3CI9 A;  4CPG A;  2NRG A;  2LKM A;  2XND H;  3B5N C;  4OGQ D;  2R44 A;  3SLE A;  4AAO A;  1G1J A;  2P7J A;  3L74 J;  4TLF A;  3GG2 A;  3L70 J;  5TJH A;  1BCC D;  1P84 I;  1BGY D;  1W2B O;  1FU1 A;  1CRJ A;  2CXB A;  3RBZ A;  2D2C D;  3GF3 A;  2E76 B;  3NBT A;  3LW5 J;  4ZMD A;  1S4X A;  3A9F A;  2WWW A;  4IL6 H;  3TNU B;  3L73 G;  5CYT R;  1C75 A;  3RL0 B;  3MUD A;  4OWF A;  1Y47 A;  2DW3 A;  3TYI A;  1GU5 A;  2K3R A;  2M0B A;  1SLQ A;  1CHH A;  1XTG B;  3OA8 A;  5AW3 B;  3HUS A;  5CIE B;  1YIC A;  1URQ D;  2FYU G;  4DT0 A;  2Y9Z A;  1IK9 A;  3U59 A;  3H1H G;  3BRT B;  1RAP A;  1N86 A;  3LID A;  1VF5 D;  3D0W A;  3AEC C;  4HJG H;  3LW5 H;  2PRR A;  2O1J A;  5CCH C;  1LNQ A;  1P84 H;  2FKW B;  4H44 C;  2N3B A;  1KMI Z;  1COR A;  1KYO W;  5AW5 B;  2BCN B;  1S2E A;  5AVZ B;  4C7N A;  4XXL A;  5EFW B;  1FZC C;  2ZJS E;  4I2L C;  1GW3 A;  1ZR2 A;  1A2S A;  1EZV I;  1L4A B;  1ZN5 A;  5CMZ A;  1GL2 C;  3L73 E;  3JC2 2;  3ZOY A;  3OA8 B;  4IL6 X;  1KN7 A;  3HUS B;  1LWU A;  2FFD B;  2N9J A;  3PTZ A;  1KIL D;  2OYH C;  4IL6 V;  1PL5 A;  4JF7 A;  1LWU C;  1CHJ A;  1SFC B;  4HYT B;  1N73 A;  1GQ1 A;  3AE6 C;  3WU2 E;  2OQQ A;  3D6Z A;  4IFF A;  2OZ1 A;  1EC5 A;  3CL3 D;  4RSZ A;  1KD1 Q;  4H0K A;  3CME P;  1M1K Q;  1QVF O;  1CHI A;  2HR3 A;  3PLN A;  2IZ0 A;  4YPC A;  1LTJ B;  2KYV A;  1FCD C;  3Q3D A;  5KJ7 D;  2GC4 D;  4C7N B;  2QE7 H;  3RK2 B;  1IK7 A;  3RK3 C;  4DJG A;  1FBM A;  3GHG A;  3GW6 A;  2OYI A;  3TSI A;  1BCC G;  1BGY G;  3HTK A;  2E76 D;  1NU1 G;  2WSF J;  4ZKU A;  3ITK A;  3GHG C;  1USE A;  2WPQ A;  4OVN F;  1SQB K;  3M9Q A;  3RL0 D;  3AED C;  1RQV A;  2A06 D;  2CK3 H;  1JMB A;  2KZJ A;  1RF1 A;  1AOF A;  4L73 A;  1N73 B;  3CWB J;  1KFN A;  2HG5 D;  1NJI Q;  1USD A;  3CCJ P;  2VHD A;  1OZH A;  4UB6 H;  4JYC A;  4O9B A;  2M5A B;  2HOD A;  2CA4 B;  1SQV E;  1PGP A;  5AW1 B;  1JMM A;  1Q86 Q;  3MD0 A;  3HQ6 A;  1PZQ A;  3L71 G;  2KSE A;  3HD7 C;  4YXW H;  1MKM A;  2OYI B;  3MK7 B;  2Y9Y A;  5C0Z A;  2WQY C;  1NTM D;  4JBZ A;  3H1J J;  3UIA A;  1GK6 A;  3L74 G;  3L4M A;  2FWL A;  3L70 G;  2Y0E A;  5TIS H;  1BGY E;  3L72 G;  3CP5 A;  1J1D B;  1L4A D;  1K05 A;  1NU1 E;  3W67 A;  2KUB A;  2A45 H;  1H32 A;  1DD4 A;  3OCD B;  1CED A;  1RF1 B;  2XNX A;  1CI6 A;  5DJU B;  1C6R A;  4RJT A;  1EDK A;  3AE1 C;  5CHX A;  2GIW A;  3CWB D;  2W6B A;  4O1Q A;  4H0L B;  2H89 C;  3VP9 A;  1BE3 E;  5AVR B;  1SFC D;  2HOD B;  2KXP B;  2C9N Y;  3SJL A;  2C1D A;  1IFP A;  4IL6 E;  1FZE A;  2IZ1 A;  3CU4 A;  3CCL P;  3N7N A;  1DEB A;  2B0Z B;  3M06 A;  3FXE A;  1T2K C;  3L75 J;  1CYJ A;  3IN6 A;  1ZXG A;  1CZQ A;  2IBZ D;  3C8V A;  3H1K E;  2JTI B;  3R4Y A;  4UB6 V;  3L71 E;  3B71 A;  1CIF A;  3RK2 D;  1GK4 A;  2XKM A;  3M9H A;  4AYC A;  1PIX A;  3H1J D;  4C7R A;  2XTS B;  3L74 E;  1H32 B;  1CI6 B;  3VN0 A;  2JWA A;  5AVV B;  2ZVN B;  3L70 E;  1LMS A;  4NPD A;  4D6T J;  3VP8 A;  5CID B;  2WPV B;  3L72 E;  2CPS A;  2MTA C;  2WSE J;  1NTK E;  1QVG O;  4PD4 H;  1AKK A;  2A06 G;  1P84 E;  5GTH H;  4AUW A;  1OIP A;  1EZV G;  2C1D B;  3PH2 B;  3EWK A;  1K9M Q;  1KIL E;  5CJ4 A;  1W5C T;  4PD4 D;  2RKL A;  4OH8 B;  1A02 J;  1CRC A;  3V5B A;  1E79 H;  1VQL P;  3CXH H;  3H1L G;  2E5Y A;  1QL2 A;  3OAK A;  2KI7 B;  2WSE H;  1SQP K;  3OW2 O;  1SQX J;  3P8C D;  5AW8 B;  1YTZ I;  2WT7 A;  3BRV B;  1M1J A;  1FOS F;  2JQR A;  3CXH D;  3DR0 A;  4LLH A;  4D6T D;  1CRI A;  1YBK A;  1T6A A;  1FE6 A;  5CCG C;  1M57 D;  2C8S A;  1FJP A;  2YIU C;  2AEJ A;  2E75 C;  3SVW A;  1R5S A;  3TF5 A;  2FY8 A;  1LT9 A;  2O1K A;  2YK3 A;  2A06 E;  4H0L D;  1IC2 A;  3A0H H;  1EZV E;  1RF0 C;  1RE3 C;  3SFD C;  2A45 G;  2XDJ A;  1K3H A;  1RZ5 A;  1QLE D;  1EDI A;  3JSV C;  5GTH V;  5KLV J;  2KB7 P;  1CRY A;  1CRH A;  1NMI A;  3BAS A;  1DT1 A;  1X0T A;  4L76 A;  3USS A;  2O01 N;  4P4Q B;  1SQQ G;  2IBZ G;  3H1L E;  2WT7 B;  3A5T A;  4OGQ C;  1M1J B;  1NO4 A;  1N7S B;  1SQX D;  2JP3 A;  1MZ4 A;  3H1J G;  4UB6 E;  1HJ5 A;  1SVF A;  3FXD A;  3K5B A;  2H7H A;  2YKP A;  2FRC A;  1DIQ C;  1IFI A;  2QJK B;  3CD6 P;  1PP9 J;  1ZOY C;  1KQL A;  2Q3I A;  2R3C A;  2FXO A;  1EB7 A;  1OW8 A;  2D0S A;  4HB1 A;  4N78 D;  1URQ A;  5GTI V;  2K9J A;  3O0R C;  2OTL P;  1N50 A;  1IFM A;  1CO6 A;  1M90 Q;  1H1O A;  2PCC B;  1ZLL A;  3AE2 C;  4YXD C;  4PW9 B;  4Y99 C;  3ZDM A;  5KLV D;  1ZRT E;  1S9K D;  1LC2 A;  2E74 B;  2OTK E;  2K9Y A;  3PXS A;  1GU4 A;  3A0H V;  1VF5 C;  3L75 G;  3Q5P A;  3N4X A;  1KFM A;  5KTB A;  1DEE G;  1VQP P;  2M3E A;  1SQQ E;  5DJQ C;  3L4O A;  2FBW C;  1DVV A;  1YJ9 P;  1GDT A;  4LGD E;  3H1J E;  1LTG C;  2ZFC A;  2WIT A;  2IYO A;  5L8R J;  2V08 A;  3BCC J;  1YI2 P;  4D6T G;  3M0D A;  3H1I J;  1PP9 D;  2GUV A;  1URQ B;  1AQT A;  2P2U A;  1MFT A;  1H31 A;  2N3Y A;  1S6V B;  1MFZ A;  4EOT A;  1JTH B;  1NAF A;  1KIL C;  1LS9 A;  3NMD A;  3WFB C;  4R4M A;  4N6J A;  2E43 A;  4W80 A;  3H25 A;  3RK3 E;  2PCB B;  4Z1M H;  3SWS A;  2BCC J;  2KLV A;  5KJ7 A;  5IY5 1;  5GTH E;  1KB9 D;  1KYO D;  4WQE A;  3L75 E;  3AE5 C;  3ZOO A;  1HGV A;  5KJ7 C;  4EDF A;  1N7S D;  1CYC A;  1NTZ D;  2IFM A;  3AE7 C;  2L5G B;  2FYN B;  3VOP A;  2YKQ A;  1RY3 A;  1EQ7 A;  1F1C A;  2IPP A;  2ZXE B;  3IR9 A;  2UWJ E;  4RES B;  2RMZ A;  3BCC D;  1I6E A;  2QSI A;  2O3J A;  3RL0 C;  3SWF A;  2NZ2 A;  3AEB C;  1NKZ B;  2ZON G;  1SQV K;  1LTI C;  1L0L G;  2V4H A;  1PGO A;  4XE5 B;  1CTJ A;  3E7K A;  1EXJ A;  4JCG A;  1FAV A;  2ZVO B;  4PV1 B;  1I8P A;  4GDO A;  3NWV A;  1J3S A;  1LTS C;  5GTI E;  2E74 D;  2Q5U A;  3ZOX A;  1J1E B;  5KLV G;  1PGQ A;  1CIH A;  4L74 A;  3MTU E;  2BCC D;  4BWN A;  1NU1 K;  3L4F A;  2JWD A;  5CIH B;  2JDI H;  3A0H E;  2Q9I A;  1T3U A;  1DD3 A;  1L4A A;  4WQC A;  2FXP A;  3KDP B;  1F1F A;  2QEX P;  3TK1 A;  4EID A;  4AAM A;  5AVW B;  3MUD C;  1PPJ D;  1FJ0 A;  2M3B A;  4EI2 A;  4W7Z A;  2FFD A;  1IO3 A;  1QYZ A;  1PP9 G;  3KPE A;  1OVR A;  1U57 A;  4U3F J;  3Q5R A;  3HUS C;  1A02 F;  3HE5 B;  1SFC A;  2QJP B;  2ZXX A;  1L0L E;  2DGE A;  1M60 A;  2Q3E A;  1UIX A;  1SFC C;  4EIJ A;  5KAI H;  1ETP A;  1K8A Q;  1U7J A;  2HV4 A;  2BAS A;  3CCQ P;  1FI9 A;  1LTJ A;  4GKG A;  2GA1 A;  3M9B A;  3AEE C;  3B4S A;  3RN1 A;  1EXI A;  3M97 X;  1KV9 A;  1LTJ C;  1MG2 D;  3WUI A;  1QGK B;  5AVX B;  1B7V A;  1NTK K;  1FZA A;  3I55 P;  3RK2 C;  3I5C A;  4YE1 A;  1VL2 A;  1OVV A;  5H2F H;  2PFX A;  3BAT A;  3Q1M A;  3ZIY A;  1KV4 A;  5BVZ A;  1SQB J;  3BCC G;  3OJA B;  2XV5 A;  4N0K A;  3VMZ A;  3H1I G;  2FYU E;  2NPS D;  3H1H E;  4U3F D;  2HYN A;  3KHU A;  2D0W A;  3B8E B;  1N73 C;  1FI7 A;  4PV1 D;  2M5A A;  3KXD A;  2MKV A;  2JEE A;  5CIB B;  2OTJ P;  2Q1K A;  1NTM J;  2JKV A;  1HJB A;  3A3Y B;  5BU5 A;  3WFE C;  4AX3 A;  1JUN A;  1GU2 A;  5KAI V;  3H32 A;  2ZYD A;  3C2C A;  3FWL A;  2OYI C;  3MK7 C;  4H13 B;  5B5E H;  4M3L A;  3PXT A;  2A45 I;  1CC5 A;  2VRS A;  1YTC A;  1ZZH A;  3OCD A;  3S9O A;  3G4S P;  3ABV C;  1JY3 P;  3CX5 H;  1J1D C;  3PP5 A;  1PPJ G;  2OYH B;  1SQB D;  5KAF H;  1RF1 C;  2MJZ A;  2IBZ I;  3BCC E;  3H1I E;  3IFM A;  4AAL A;  3PRJ A;  1VQK P;  2OGU A;  3JCU E;  3CX5 D;  3SWK A;  1CYI A;  4WQ9 A;  2QJY B;  2K37 A;  4H0L C;  2WSF H;  4A7P A;  1RE4 A;  2L4D A;  2PP6 A;  2EXV A;  3O5C A;  4IFD K;  1BSN A;  1QKS A;  2J58 A;  1KC8 Q;  4UB8 H;  1WVE C;  2QA4 P;  3H32 B;  1R0Q A;  3KQG A;  5AUR A;  4WBA A;  1COT A;  1BCC E;  1OW7 A;  3L36 A;  1LP1 A;  2GB8 B;  5AW0 B;  1RHZ B;  3RL0 g;  1L9J C;  3TDK A;  5AW2 B;  1Q7Y Q;  5M1B A;  2I8F A;  4PD4 I;  2CA3 B;  5B5E V;  1H8A A;  3SXT A;  3EFF K;  3M91 A;  1AA0 A;  5E79 H;  1K73 Q;  3VMX A;  2ZYG A;  1WRG A;  3CC7 P;  2Q6Q A;  2G3A A;  1N7L A;  1SQQ K;  1C2N A;  3G71 P;  4YTP C;  3CXH I;  2JJL A;  4GT1 A;  4BXL A;  2B9B A;  3FGA D;  3GF7 A;  3C1L A;  4TT3 H;  1L0N J;  1KX2 A;  3CCU P;  1C52 A;  1LP1 B;  2B88 A;  2KLU A;  1HTL C;  1E8E A;  2FXM A;  1EDL A;  1XTC C;  2E5T A;  3CPW O;  2R32 A;  4H13 D;  1H9Y A;  4UB8 V;  5APX A;  4AQR D;  1SQP J;  1A8C A;  1GL2 D;  5KAI E;  1DW2 A;  1BDC A;  2KIK A;  2B11 B;  5TIS V;  1VDF A;  1OX3 A;  3SSU A;  3KZI H;  5CBO A;  4NPE A;  1FOS E;  3AE4 C;  1RH5 B;  1YEB A;  1IQC A;  2N1T B;  1JOC A;  3O6Q A;  2BLF B;  2AXT H;  3DP5 A;  4K3I A;  2R5D A;  1NKN A;  2W27 A;  4JYB A;  3CMA P;  4FB1 A;  5E79 V;  2MHM A;  1IFN A;  1NTM G;  2ZT9 B;  1L0N D;  1HBW A;  1DW1 A;  1VQN P;  2H43 A;  5APQ A;  3P7K A;  1TU3 F;  2N18 B;  3PJS K;  1N7S A;  4K3A A;  3ORV A;  1M1J C;  1NHL A;  4L1Q A;  1SQP D;  1N7S C;  2HPC A;  3ZOW A;  2N9Y B;  2Z4E A;  4W7Y A; 
#chains in the Genus database with same CATH homology
 3VMA A;  3PXW A;  2ZOO A;  1LS9 A;  2N3B A;  3WFB C;  1GIW A;  1DW0 A;  1COR A;  1KYO W;  2AIU A;  2BCN B;  1FHB A;  3RN0 A;  4EIC A;  4WQB A;  2BH5 X;  4XXL A;  4EIE A;  1I5T A;  2PCB B;  3SWS A;  3KZI V;  1FI3 A;  5IY5 1;  4PWA A;  1CCH A;  1A2S A;  1CRG A;  1CTY A;  1KB9 D;  3VRD A;  1KYO D;  4WQE A;  2YQB A;  1W2L A;  3ZOO A;  3ZOY A;  3CYT I;  4EDF A;  3OA8 B;  1CYC A;  1NTZ D;  1C6S A;  1RZ6 A;  5KAF V;  1IZL 0;  2N9J A;  3PTZ A;  2FYN B;  1ZRT D;  4IL6 V;  2YCC A;  5KKZ B;  1F1C A;  2BPB B;  1CHJ A;  1HJ3 A;  1OAE A;  2RMZ A;  1GQ1 A;  3BCC D;  1NIR A;  1I6E A;  3DMI A;  2O3J A;  2OZ1 A;  3VNW A;  4RSZ A;  1SQQ D;  3A0B V;  2ZON G;  1DW3 A;  4H0K A;  1NNO A;  1S5L V;  1CHI A;  3PLN A;  4J20 A;  2C1V A;  1CTJ A;  1YEA A;  1K3G A;  1CSV A;  1FCD C;  4JCG A;  2GC4 D;  1I8P A;  1AOQ A;  3NWV A;  1J3S A;  2N18 C;  3GW6 A;  1RAQ A;  3ZOX A;  1CIH A;  2QG4 A;  3HQ9 A;  4KMG A;  2Y0C A;  3ITK A;  1LC1 A;  1N90 A;  2BCC D;  1QL3 A;  2GC7 D;  1N9C A;  1HRO A;  5CIH B;  2PAC A;  1HCM A;  1I6D A;  1CCR A;  4QAO A;  1DII C;  2A06 D;  1JDL A;  1HRC A;  1E29 A;  1AOF A;  4WQC A;  3CX5 W;  1F1F A;  1CXC A;  1WEJ F;  2Y0D A;  4EID A;  4AAM A;  4V2K A;  1IRW A;  1PPJ D;  2VHD A;  1FJ0 A;  2CE0 A;  1IO3 A;  1QYZ A;  5DF5 A;  1GKS A;  3L75 D;  155C A;  1M70 A;  3L73 D;  2CA4 B;  1YFC A;  1HZV A;  3HQ6 A;  2V07 A;  2QJP B;  2DGE A;  1GJQ A;  3MK7 B;  4O1W A;  5C0Z A;  1M60 A;  1NTM D;  2Q3E A;  1ETP A;  3L4M A;  2FWL A;  2HV4 A;  2N9I A;  2Y0E A;  1FI9 A;  4L3H A;  4GED B;  3TGU D;  3CP5 A;  3RN1 A;  2B12 B;  1L9B C;  3M97 X;  2C1U A;  1H32 A;  1KV9 A;  1MG2 D;  1OCD A;  3NBS A;  3OCD B;  3WUI A;  1CED A;  1DVH A;  1B7V A;  1C6R A;  4RJT A;  1CSW A;  1YNR A;  3HQ8 A;  1CXA A;  1AYG A;  4YE1 A;  1GDV A;  2BH4 X;  2GIW A;  3CWB D;  5CIF B;  1HZU A;  4O1Q A;  1A56 A;  2AXT V;  4LJI A;  3ZIY A;  4AAN A;  5CIC B;  3SJL A;  2C1D A;  3VYM A;  4N0K A;  1CNO A;  3CU4 A;  1CIG A;  5EXQ A;  2B0Z B;  4U3F D;  4WQ7 A;  1CYJ A;  1H33 A;  451C A;  3KHU A;  2D0W A;  2IBZ D;  2B4Z A;  2JTI B;  1FI7 A;  1QN2 A;  4UB6 V;  4MU8 A;  2ZZS 1;  2YIU B;  1CIF A;  2C9X B;  4DY9 A;  5CIB B;  3H1J D;  5DFS A;  1U74 B;  3O1Y A;  2ZBO A;  1M6Z A;  2XTS B;  2CE1 A;  1YIQ A;  1H32 B;  3ZBM A;  2JWA A;  1SQV D;  1LMS A;  3WFE C;  4AX3 A;  5CID B;  1CIE A;  1YCC A;  351C A;  3HQ7 A;  4FA1 A;  1GU2 A;  4Y5R A;  5KAI V;  2MTA C;  3C2C A;  1L0L D;  3FWL A;  1E2R A;  1H9X A;  4FA9 A;  1KB0 A;  3MK7 C;  1AKK A;  3PXT A;  1CC5 A;  1YTC A;  1ZZH A;  3RLM A;  4EIF A;  4Q5P A;  5KLI B;  3OCD A;  2C1D B;  3PH2 B;  1W5C T;  4PD4 D;  1NU1 D;  3RMZ A;  4WQA A;  1H33 B;  1MG3 D;  1SQB D;  5B66 V;  2L91 A;  1CRC A;  4PJ0 V;  1I55 A;  2LIT A;  3PHL A;  4AAL A;  2RN0 A;  3PRJ A;  2KS1 A;  3CX5 D;  3CXH W;  1CYI A;  4WQ9 A;  2QJY B;  4A7P A;  5C9M A;  1BE3 D;  2L4D A;  1VYD A;  2EXV A;  3O5C A;  1KIB A;  2C2C A;  1QL4 A;  1QKS A;  1CSU A;  4H0J A;  1WVE C;  1R0Q A;  2FYU D;  2JQR A;  3CXH D;  3DR0 A;  1LFM A;  1U75 B;  3H1H D;  2LIR A;  4D6T D;  1BL9 A;  5AUR A;  1COT A;  1CRI A;  2K9J B;  3H1K D;  2C8S A;  2GB8 B;  3L71 D;  4FAV A;  3X39 A;  3WC8 A;  3SVW A;  3TF5 A;  1L9J C;  4FA5 A;  3TDK A;  2YK3 A;  2I8F A;  3L74 D;  1FOC A;  1I54 A;  2CA3 B;  3L70 D;  5CIG B;  1C2R A;  5DJQ B;  1K3H A;  1IRV A;  5B5E V;  1RZ5 A;  3L72 D;  3SXT A;  2B10 B;  5GTH V;  1NTK D;  1CRY A;  3WFC C;  1CRH A;  4GYD A;  1NMI A;  1P84 D;  4L3G A;  1DT1 A;  5B6Q A;  2BGV X;  4P4Q B;  1C2N A;  2DVH A;  1SQX D;  1MZ4 A;  3WU2 V;  1HJ5 A;  1KX2 A;  1H31 B;  1C52 A;  1NML A;  3H1I D;  3ZCF A;  1E8E A;  2AI5 A;  2FRC A;  1DIQ C;  2QJK B;  1HH7 A;  1H9Y A;  4NFG B;  1CTZ A;  4UB8 V;  1EB7 A;  1A8C A;  2ORL A;  2D0S A;  1DW2 A;  4FAN A;  4XYD B;  5GTI V;  2B11 B;  5TIS V;  3O0R C;  1N50 A;  1C6O A;  1CO6 A;  3SLE A;  4AAO A;  1H1O A;  2PCC B;  3GG2 A;  1YEB A;  1IQC A;  4PW9 B;  5TJH A;  1BCC D;  1BGY D;  5KLV D;  1CRJ A;  2CXB A;  1LC2 A;  1C7M A;  3PXS A;  3NBT A;  3WFD C;  2BLF B;  3A0H V;  5H2F V;  3A9F A;  3DP5 A;  4K3I A;  5CYT R;  1C75 A;  4FA4 A;  1I8O A;  1EZV D;  5DJQ C;  3L4O A;  3TYI A;  1DVV A;  4FB1 A;  5E79 V;  1HJ4 A;  2MHM A;  4WQD A;  2OZ1 B;  1CHH A;  1L0N D;  1DW1 A;  3OA8 A;  5CIE B;  2KNC B;  1YIC A;  2V08 A;  2N18 B;  1KX7 A;  4WQ8 A;  3JBT B;  1PP9 D;  1N15 A;  1RAP A;  3H1L D;  1CSX A;  3ORV A;  2ZXY A;  1H31 A;  3O20 A;  4L1Q A;  1SQP D;  1S6V B;  2N3Y A;  3ZOW A;  2N9Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...