2YQBA

Structure of p93a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.4 a resolution
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
454
structure length
454
Chain Sequence
KLPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKMAHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 148
structure length 454
sequence length 454
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2yqbA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yqbA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yqbA02
1A2SA 4PWAA 3OCDB 1I54A 4A2FA 2L4DA 3FSVA 3SJLA 1JXDA 5B7FA 3RLMA 2N18C 1E67A 1J9TA 4L1QA 2GI0A 1K3HA 3O1YA 1NICA 1C6OA 1KBWA 2YAEA 3X1BA 1J9SA 1PY0A 2WSDA 3DTUB 1GJQA 3PAZA 3FSWA 5E9NA 4E9SA 1SF5A 1QL3A 2YAPA 1WVEC 5AURA 5FC9A 3OM3B 5LDUA 155CA 3T6XA 2V08A 2ZXYA 3S3BB 5KKZB 2V07A 3A9FA 1CHJA 2BLFB 4E9QA 1XB8A 1CHIA 2GC4D 1N15A 2C8SA 4KO7A 2BP8B 2JFCA 2UX7A 2X87A 2W8CA 1KIBA 3PLYA 4UANA 5F7BA 1NTDA 5I5IA 2J57A 4WTQA 2PCBB 2PP9A 3PH2B 1J3SA 3DKHA 4YSCA 1GW0A 1SJMA 2BZCA 2XVBA 3SXTA 3L45A 6PCYA 3CXHW 3HQ6A 1HZUA 1B7VA 1H31A 1QHQA 1SQVD 1CSXA 1DW1A 3HQ7A 4WQ8A 1AZNA 2HX8A 1BXUA 1CIEA 1PF3A 2OCCB 4M3HA 4BDVA 1CYJA 3VYMA 3FQ1A 4YSSA 3X1GA 1CRIA 2PPEA 1AS8A 3NJNA 1JERA 1HFUA 2YQBA 3BCCD 5PAZA 1E5ZA 2I7SA 1CIHA 3M97X 1KDIA 4AKPA 5AKRA 4U3FD 1M9WA 1DW0A 2FYNB 1L9OA 3MBWB 4KNTA 3DR0A 3CVCA 4WQAA 3FPXA 4DPAX 4E9YA 2UX6A 1A65A 3ZBMA 1KYOD 4DP9X 4DP7X 4K3IA 1AG6A 4HZ1A 2BW4A 4AI7A 2H5UA 3ABMB 2AZUA 1ETPA 3HB3B 2VW4A 3JT2A 1CCHA 5CIHB 3WFBC 1JZJA 4BXSV 4E9RA 4ZK8A 4NERA 3MK7C 2N9JA 2PACA 4HCIA 3N55A 1S6VB 5B1AB 1XB3A 2LLNA 5PCYA 3S3CB 2QPEB 5B6QA 4GP5B 2TSBA 3NSCA 3WIAA 5I6OA 3O20A 4KOBA 2YAQA 3OMNB 4XXLA 1CYWA 2XV3A 3X2QB 3ZIYA 1H1OA 1NMLA 1WS7A 1CCRA 1PLAA 3VRDA 1N68A 2CAKA 2IAAC 4JHUA 4PCYA 2AIUA 1PP9D 2YIUB 1AZUA 1L9JC 3OD3A 3NSDA 1HRCA 1OCDA 2EIMB 3PAUA 2FT8A 4BDVB 3G5WA 351CA 3NJFA 4YSQA 2CJ3A 2MHMA 3AG2B 1YNRA 3C75A 1PPJD 3PCYA 3GXUB 1I55A 3L73D 1SDDA 1SHWA 2CALA 3CVBA 4CSPA 2H3XC 1NWPA 4NB7A 5ANHA 4BXVA 5CICB 2VW7A 3RN1A 4W1TA 4YSTA 5CIGB 4F2FA 1IQCA 3QJSB 2IDFA 1CRJA 5B1JC 1OOWA 2EIJB 1N50A 1VLXA 3V9EA 3ORVA 1KB0A 2PP7A 2BP0B 1C52A 1CUOA 1BXVA 1A3ZA 2PPDA 2PP8A 2BWDA 2DYRB 1P84D 1F56A 2YXVA 1KV9A 1FHBA 1I6EA 2IBZD 1AS6A 1SFDA 2GIMA 1IUZA 5EHFA 2BGVX 1X9RA 1HJ5A 2XUWA 2XU9A 2N9IA 4HHGA 1NIBA 1H33A 2R7EB 4N0KA 3CVDA 2I7OA 2CUAA 4DP6X 2BZ7A 4DPCX 1DZ0A 2WO3B 2UXFA 4L3HA 3FT0A 3SWSA 2CA3B 2YAHA 2GB2A 4KO5A 3OA8B 4JKNA 3FU8A 1H32A 3FU7A 3N2JA 1GIWA 3WNIA 2CA4B 2IWFA 3NT0A 3CX5D 5H2FV 2ZONA 1QN2A 5KAFV 1M70A 1RZPA 1GR7A 1ET7A 1W6LA 1EZVD 5B1BB 2UXVA 2ORLA 1YIQA 1RZ6A 3DP5A 3IN0A 7PCYA 3S8FB 4AAMA 2EXVA 2J55A 1OE1A 9PCYA 2YCCA 3OCDA 2XYBA 1BXAA 4V2KA 2XX0A 2VMJA 3L4MA 1RCYA 3NJMA 1NIAA 3T9WA 2FYUD 3WU2V 3X1NA 4CSZA 2IH9A 2ZZS1 3RN0A 3L71D 4UF7C 2HX7A 3O5CA 1A8ZA 3WG7B 4QLWA 1CRCA 4E9VA 4HHWA 2OZ1A 2IWKA 3NJKA 2DV6A 3TU6A 1BQ5A 3CWBD 3NBSA 3QJRB 4D6TD 5B3SB 3CU4A 4UB8V 1ASPA 1CC3A 2FRCA 1NIDA 1HJ3A 1F1CA 2WO2B 3H56A 1H33B 1BEXA 1H32B 4MFHA 1XB6A 3PXSA 1FCDC 2LIRA 4YSPA 1U75B 2B3IA 1PZAA 2C1UA 3QJTB 5B1JA 2XXGA 4A66A 1V10A 2MTAA 1DIIC 3EH3B 1SQQD 1KB9D 1AANA 1GS7A 2AVFA 3WFEC 1C6RA 4H0JA 4WQ7A 1ET8A 4BWUA 3KW8A 1HROA 2ZWNA 4FA7B 1CRGA 1BGYD 3NP4A 2BP8A 1HZVA 4FA4A 3ZOYA 4GY4A 1AOQA 1FOCA 1WEJF 3SLEA 1L9QA 1NIEA 4KNSA 4KNUA 4YSRA 1BCCD 2FQDA 1MG2C 3RMZA 1N70A 2J5WA 2B08A 2IDQA 2QJKB 4N4YB 1DW2A 3WUIA 3FSZA 2BHFA 2H47C 5GTHV 3UAAA 1PZCA 1AACA 3EF4A 1GU2A 2YAMA 1C2NA 1SQBD 1L0LD 2Q5BA 4PJ0V 3ABGA 4P5RA 1NTZD 4A67A 1SNRA 1NNOA 3TYIA 5D4JA 3TBCA 3OQRA 2XV0A 3CG8A 4A2DA 1CHHA 5TK2A 5B5EV 1JDLA 1N90A 4P5SA 1NPJA 1MDAA 1GS8A 1OCRB 1IO3A 1ZRTD 4A2GA 1X9UA 1H9XA 1NWOA 3U25A 2A3TA 4Q5PA 5CIBB 1A4AA 1AG0A 3WFCC 1JOIA 3UGEA 1JVLA 1CXAA 3OMIB 1PZBA 3UACA 4L0PB 5I6PA 4DP2X 2UXTA 1FJ0A 2FNWA 4GXFA 1M56B 1EB7A 1AS7A 1E30A 1SHXA 2VSMB 4UAHA 4W9ZA 1BQRA 1NU1D 2C1DA 3L75D 3L72D 4AANA 1M57B 1R1CA 1XMEB 5B66V 4AAOA 2DYSB 3SQRA 3NSYA 1RKRA 1W5CT 4G72B 2GB8B 3IE9A 1KBVA 1MZZA 4EIFA 4EIDA 3PXLA 4DP5X 1FI9A 2OJ1A 2XV2A 1OCZB 1TKWA 2BPBB 1JZIA 3AG1B 5C9MA 2I8FA 3T6VA 2AI5A 1SDDB 1OV8A 4GEDB 4Q89A 3QPKA 4M4RB 1GKSA 3T6WA 1AR1B 1MZ4A 1RZQA 3L70D 3FU7B 5I6MA 2ZXWB 2HV4A 2YAFA 1CO6A 1QL4A 2QJYB 1JVOA 1GDVA 2EILB 2PCCB 3CYTI 3NSFA 1DT1A 3KZIV 1CYIA 4J20A 3WC8A 2IDUA 2XXFA 1H9YA 2B4ZA 3PPSA 1I5TA 1KYAA 1NPNA 2CCWA 4KOCA 4YSOA 3AZUA 1OCCB 4DP0X 5I5MA 1DYZA 2FWLA 1YTCA 1C7MA 2A06D 4HALA 5DJQB 1RAQA 1OAEA 1ZZHA 5E79V 1RZ5A 1NIFA 1PLBA 1WS8A 1C75A 3AW5A 2D0SA 4BWWA 1E65A 1NTMD 4XYDB 1CXCA 5TK4A 1KCWA 2B0ZB 1EHKB 3FPYA 3ASNB 4DP1X 1AZBA 1TEGA 4A2EA 3UAEA 4G7RB 3FSAA 1FA4A 3L4OA 2ZBOA 3FQ2A 3NYKA 1CSVA 4FAAB 4AKOA 3NJGA 5I6KA 2C1VA 1UATA 3IN2A 4FA9A 1C6SA 5IY5B 1A4BA 1CEDA 3DMIA 1DVVA 1MZYA 1PNDA 1L9PA 3JTBA 3OMAB 4PW9B 1HAWA 3GDCA 4G7SB 4Q8BA 7PAZA 1KYOW 1PLCA 2P80D 4EIEA 2Y1AA 1YFCA 3EH5B 1PCSA 3DIVA 5KLVD 2HLEB 2ZOOA 1KDJA 5KAIV 1ASOA 5B7EA 4HIPA 4AKQA 2MTAC 3VNWA 1PAZA 2HRGA 3AY2A 3H4FA 1E29A 451CA 2LITA 2NRDA 2JQRA 2J56A 1LC2A 5CYTR 1L0ND 2GHZA 3CXHD 3T6ZA 1ASQA 4FAVA 4PAZA 1KCBA 1YEAA 2GIWA 2DWSA 3FQYA 3NJJA 1ZV2A 1U74B 4DP8X 1AAJA 4E9XA 4F7KA 5DFSA 3C2CA 2IDSA 1E5YA 2FWLB 3UABA 1RAPA 1FI7A 1YLBB 4QKTA 4YL4A 5I6NA 1QKSA 4BWTA 4ENZA 1JXFA 2HRHA 4O1WA 3CZUB 3PAVA 3GYRA 1AQ8A 1LC1A 2FQFA 2EINB 4EICA 2OV0A 4BK5C 5AFAA 1NIRA 1HAUA 1ID2A 1BAWA 2QJPB 2BH5X 2DGEA 4LJIA 3FYIB 3A0HV 2GC4C 2MRYA 2PLTA 3H1ID 3CDZB 1HH7A 1W2LA 5DJQC 3H1LD 2B12B 3NJIA 1AZCA 1KV7A 4YE1A 1L9TA 4K9JA 4FANA 3HQ8A 3D12B 4FA1A 5CIFB 1SQPD 3A0BV 1CIGA 4GYDA 4GP8B 1A4CA 2XTSB 2XLLA 1WA2X 1I8OA 2X88A 3IBOA 4YSEA 2R7EA 1DW3A 3CP5A 1JZEA 2VM4A 3ZX1A 3H1HD 4G7QB 3TBBA 5I26A 3H4HA 1MG3C 3UADA 2BCCD 2BCNB 2B11B 2JTIB 5CIEB 1CORA 1PNCA 1V54B 2IWEA 2QPDB 1OE2A 3QQXA 1C2RA 1FI3A 4AALA 2DVHA 5KLIB 3EHBB 3X1FA 2AZAA 1J9QA 3L74D 1YICA 1JZHA 1N9CA 4KO9A 4YVUA 5B7MA 3MX0B 1M60A 3H1KD 3HQ9A 3KW7A 3ZCFA 3OA8A 2DWTA 2GC7D 1GY2A 2GC7C 2PCYA 2YK3A 3TA4D 3WNJA 1KX2A 2Q9OA 2XX1A 2GBAA 3O0RC 1AYGA 5C0ZA 2QDWA 1QLEB 2B10B 1W6WA 4X4KA 2VW6A 4G71B 2BO0A 5B1KA 4MU8A 3ABLB 2FT6A 3FS9A 1J9RA 1ZIBA 2AANA 4F2EA 4YVNA 4KMGA 2QT6A 5IY51 5D4HA 3NWVA 4N8UA 1T5KA 1HJ4A 1YEBA 2PPAA 1SQXD 1CTZA 1KX7A 3CX5W 1L9RA 1PMYA 2N0MA 2N3BA 1CYXA 4HCFA 3X1EA 1ZIAA 1COTA 4WQCA 2EIKB 2GSMB 5I5JA 5A7EA 4NAJA 1LFMA 2IDTA 4A2HA 2AXTV 4L3GA 1ETJA 1QNIA 4GP4B 3ZDWA 1CSWA 4P4QB 1IBYA 1E2RA 2D0WA 1ZDQA 2IH8A 5CIDB 1AOFA 1ADWA 4H0KA 1R0QA 2JXMA 3ZOXA 1OE3A 1SFHA 3SBRA 1L9BC 4YSUA 1J5CA 3H1JD 2RACA 3QJQB 4E9WA 4E9TA 2I85A 4QAOA 3FYEB 4G70B 5D4IA 1GY1A 3X39A 2FTAA 3CDZA 3NP3A 3ZOWA 4JCGA 3S3DB 1I6DA 2BH4X 2ZONG 4PD4D 1S5LV 1ILSA 2E86A 3QJUB 5TISV 3NBTA 5DF5A 4HAKA 3PXWA 2TSAA 1EZLA 2FQEA 1A8CA 1FFTB 3IEAA 2CE1A 1OCOB 1IKOP 4JHVA 1CRHA 1BYPA 3ABKB 2VSKB 3NJLA 2BWIA 4GYBA 2JKWA 3WKQA 1LS9A 2VM3A 4WQEA 1NMIA 2PPFA 3ASOB 1CC5A 1W8EA 1ZDSA 2DY2A 4WQDA 1NTKD 4O1QA 1LMSA 2Y69B 3QJVB 1GS6X 1GQ1A 1L9SA 2N3YA 4YSDA 1OF0A 4A68A 1CTJA 1NZRA 1BE3D 1CIFA 1IZL0 4AX3A 1GSKA 1JZFA 4DP4X 5I28A 1H31B 5GTIV 4NFGB 1F1FA 2CE0A 2FT7A 2HXAA 3T71A 4IL6V 2YAOA 1V55B 2QDVA 4HCGA 2W88A 5EXQA 1BYOA 3FU9A 1URIA 5F7AA 1DVHA 1NDTA 3ERXA 3SBPA 5I6LA 3AG4B 3WFDC 1YCCA 4WKXA 4KO6A 2N18B 2VHDA 2HX9A 4DPBX 1VYDA 2OZ1B 3TGUD 1DIQC 1CYCA 4TXVB 1CNOA 4DY9A 2PCFA 3V9CA 1J5DA 1AOZA 2YXWA 1TU2A 3EH4B 2C2CA 2HZHA 2BW5A 1CSUA 1SF3A 4RH4A 2FJSA 4FB1A 1BQKA 1CRYA 1FWXA 5AZUA 3TASA 3BQVA 1IBZA 4RSZA 2C1DB 1E8EA 6PAZA 3BVDB 1KGYE 1I8PA 1WA0X 1WA1X 3WI9A 1NINA 3HEIB 3SBQA 4EF3A 1BL9A 1JZGA 3WKPA 4WQBA 4Y5RA 2AFNA 3NJHA 1HCMA 1B3IA 4YSAA 4FA5A 2FQGA 1A56A 1ZPUA 1MG2D 1K3GA 2VN3A 1AIZA 4AZUA 1GYCA 4WQ9A 2UXGA 1IRVA 1QYZA 3S8GB 3ZOOA 2C9XB 1AZRA 1JXGA 2CBPA 1TEFA 3SVWA 1ET5A 1M6ZA 3JBTB 1AKKA 3MK7B 2P80A 2XWZA 2YARA 4UB6V 1I53A 8PAZA 1CURA 1IC0A 2BP0A 1CTYA 3AG3B 1WAEA 3RYMA 1ILUA 1IRWA 2PPCA 1MG3D 3PXTA 2CXBA
chains in the Genus database with same CATH superfamily
3PHOB 4NKOA 2D2OA 2K0RA 2VABA 4GAYA 2PTUA 1YEKH 3MKKA 4HWBL 4X4XB 5DYFA 4Z5RB 2OMBA 3D18B 5GS2D 1OP3H 4N0UA 4M56A 4NM8H 4P07A 5EOCJ 3IDJB 3J8F7 3MRDB 1J8RA 1NGYB 4AM0B 2RALA 1I8KA 2ARWA 3V4UL 3T6XA 4P2OB 5EU7C 4GQQA 4XNZB 1FE8H 1UXSA 2L8AA 4IM8A 2RMNA 2NY1B 3GSWA 2VXTL 3CFKA 3MNZB 3W9EA 5F0MB 2V2TA 3BW9A 1FE8L 5KN5A 3W0WD 2R15A 3DKHA 1D9KD 1D5IL 4JGJA 1HZUA 1W72H 1HHGB 2X89A 1O5DT 3EGXB 5IFAL 1SXBA 3RZWA 3UTQA 5I17B 3W9EB 3FQ1A 3ULVC 4K3EH 4MCNA 3I74A 1B90A 3KYOA 2NDGA 5HI4C 2CA3A 3Q6FB 1BYNA 3CVHB 1S7XB 3U0WL 4PRHB 3KPRA 4J3OH 2LU5A 4Q2ZA 1JZ7A 2ADGB 2PCXA 4HUVA 5DZJA 4W93A 4KNTA 3B7SA 3DR0A 1ZGLA 3KXFA 2AGJL 1EEUA 4LHUG 3PP4L 5E2UH 4MZIA 2ATKA 4DP7X 3JTSA 3QG6B 1KTKE 2AZUA 1A22B 2RFXA 2VW4A 2YBRB 3WFBC 4I18C 3ARVA 5DMKA 4ZUWA 5JZ7D 4P2OC 4WZ9A 4EDWL 3S3CB 2HVJA 4DEPC 5SWQA 3QJFB 1OL0A 4QOKE 3BHBB 4NI6A 4P5TB 4XCFH 5C8JB 4YC2B 1BJ1J 2MNJB 2NZ9C 4P23D 2H2SC 4XH2A 4HSAC 1YMHB 4QD2E 3T0XA 4MX7A 4NC1E 1JYVA 1H3TA 3F7RA 3EG9A 2W0PA 4X98A 1KPUB 4CSPA 4MJIE 4XPFH 3QA3B 1VZIA 3JWNH 1KIUA 4K3GA 3MRBA 2FO1A 5I1LA 1RPUA 3GKWH 3SBWA 1DEEA 3BKJH 4GJTB 3T08A 3VG9B 3WIIL 1BAGA 3HUJE 1KPRB 1OOWA 4DAGL 4FLSA 4KY1H 1C8QA 4RQQB 3GI8H 5D2LB 2FK9A 3THML 4HJJL 3NZUA 1EAJA 1GZPA 1N64H 1CFNB 5IQ9A 2J8UB 5E9DB 1P84D 2L04A 3NCCB 4ZW3A 2G2PA 2V6HA 1E3XA 5ID1A 4BUGA 3VXNA 1ODUA 5LN4A 2R7EB 2ETWA 4FL4C 2RJMA 4GLRH 3RTQC 2ZKWA 5IGXL 1LMKA 4LQFL 3PWNB 1QSFB 4I2XB 5D6CA 3WIHL 1VHPA 1MCFA 3LY6A 4WI4A 1X7QB 2ADJB 3ULVL 3FU8A 4ZUUA 1S5IL 2VR8A 3NACH 4HS8H 4XP1H 1JGEB 1EVUA 2Z9TA 2EIBA 5KBKA 1RZPA 3VTTA 3AS3A 2JK5B 3L13A 1RZ6A 1IGIL 3S8FB 5C0BA 4K3DL 2YLHA 2J55A 1OE1A 2WN2A 2ZSVB 4LKCB 5FUCE 4LSUH 3DIFB 1X5LA 1KFAL 5BRZD 2YPVA 4LPVA 4Q9QL 5F0LB 3OAYH 1JXKA 4B9JA 5L0QB 1T7ZA 4ZSOB 2WC7A 4XNUH 5E2VL 5F3HA 4YHNB 3SYOA 4DK5A 4K71C 4AGPA 3CU4A 3DSNB 2Y7OA 4XPGL 4ACPA 3RTQD 2I26N 3ZZ1A 1LO5B 3EH3B 1QRNA 3BAKA 1S7VA 3WFEC 4WI0A 2DLFH 1X5JA 1UZ8A 4DEPB 3T2NH 2N7BA 4KXZH 2G75A 2QTEA 1EJFA 5FLUA 1I7TB 3U2SA 1UWGH 3VI3B 3IRZA 3ZRFC 1OVZA 2FJFA 1JF6A 3UTOA 3ZHFA 5DMIL 2FX7L 3QJHA 3PP3H 2Z1KA 35C8L 1R0AL 2AK4D 2EDOA 2PTTB 2XZQL 3A5VA 4BFRA 2OJEA 2YAMA 3IE4A 1C2NA 3K71A 1OOAA 1SQBD 1GRWA 4JN1H 1JFHA 3GLAA 4X42A 2IAND 4HK3N 1KYOJ 4L4TA 1EX0A 2D03H 4JPSA 4BFEA 3CG8A 5H37H 5TK2A 3F7VA 4L5FE 3VXNB 1WFMA 3WJJA 1MFAH 2YEQA 3RWEA 5I73B 3FCTA 2F1AA 5IESL 1ECZA 4WW1B 3HZKA 1KBKA 2A9AA 1NGWA 3ZHNA 2M8XA 2JB6B 4K7PY 4AV4A 1JNLL 4UQ9A 3X17A 1JPFA 2OSWA 2A6JB 3ZMRA 5HJBA 1NFIB 4S0TD 3F05A 4AAOA 3B7RL 3NSXA 5I1JL 2HUHA 4KJQD 1JNLH 2OR9H 2LFGA 2XY2A 1JV5A 3DX9A 5G4MA 3WSQH 2Y6SC 1QI5A 3LCYA 1Z9MA 4X98B 3DX6B 2JB5H 1N18A 4RFOL 3HMXH 2LVEA 1FGVH 2JMRA 3GSQB 1IZJA 1E40A 4YE4L 2EDTA 2WIIA 3CHQA 2CRIA 4ODTL 1CO6A 4Q74A 4I5BB 2ZWYA 4KO7A 1DT1A 5D7HA 2ZUTA 1VEMA 1H9YA 1QG3A 2I32A 5DD1L 4V11A 3D85D 4CMHC 1DYZA 1QHPA 3MJ9A 3BKML 5AW3B 1U8HB 5D72H 1X4YA 1UA3A 1AZBA 1WC7B 3UAEA 1U6AH 2ICWI 1IT9H 5D55A 4FADA 1OF2B 1ZGLB 2NYZA 5IVNA 3V0WL 4HUMB 2H6PB 1FNAA 1IEAB 1R6VA 3DHUA 3OMAB 2F2HA 5DMJB 3ASWA 1X5IA 4CC4A 1A6PA 1PCSA 1JDDA 4N2HA 4JS7A 3DMMC 1EERB 1C7TA 3ZO9A 3WTYA 1HQ4A 1SOSA 1U3YA 4AQOA 2OTUA 1GZQB 2J56A 5F7HA 3ZOAA 2B1OA 3HJ0A 5CZXD 4UTAL 3S3PA 3A4EA 4M5ZH 3T6ZA 4TNFA 3FHEA 1UWXK 2X7LB 3QA3A 1EZVX 4KKAD 2FL5A 4QRPA 3UZQA 2AAAA 4NM4L 1EHAA 2QSCL 4QXTA 3DO7A 1XZ0B 1FI7A 2ENSA 4QKTA 5G55A 3K1DA 2R29L 2HWZH 1IM3A 2COQA 5I19L 4NO3B 1NCBH 4M1CC 2W95A 2FQFA 2AITA 2ENPA 2W07A 1I9JL 3DO4A 2BOCA 1I7UB 3BWZA 3FRPB 2ISDA 4XPTH 1BPVA 7TAAA 2DGEA 2GC4C 3HPJB 2B20A 3BN9C 4GMTH 4HXAL 3KYNA 4J4PC 4XCYA 3TVMB 1P4UA 1KB5A 3SDXA 1S9YB 2HPOA 3VW3H 1R17A 4MHHG 2F54E 4K9JA 1HN1A 2FWSA 2XC8A 2UZXA 1ZOXA 3I85A 3VFRB 3VSTA 2X88A 1E7UA 2R7EA 1D9KC 1S7TA 1I75A 3B7UX 1SXZA 3QULB 4Z7WA 1J5HA 5F8RC 2R1XA 2WLJA 2C1PA 3DYPA 1TU2B 4XPFL 3LEVH 5I26A 5J9PB 4RGNE 3Q6FA 4X8GA 1IFHH 2E7CA 3OG6B 4J3SA 3QQXA 4YXHL 3OLIA 3TCXA 3TJEL 3RKPA 4FG2A 4XBGB 2N7AA 3BO8B 4P9ML 1BOYA 3MRPB 3SE9H 4LSPH 5I1LB 1I7ZA 2Z6FA 2ALWA 4PVLA 5AW1B 3TF7C 3IJ8A 4WI2A 5CSGA 3D39A 2QDWA 5DJYB 1KPUA 5FLVA 2OMTB 4FKHA 1A4KB 2GTWB 1HSAB 2DI9A 2K6YA 4K7PX 4OF3A 2MQGA 4P9HC 1BD2E 5AUMB 1MWAL 3UZVB 5I18H 2D3VA 5DD5H 2VITB 1DN0B 2AEQH 3GRBA 4OCNC 4LVEA 4N8VG 4JREB 1DJHA 2JJTA 2NXZC 1XGQA 2ZUUA 4JFDA 3WJLA 4Z77A 2ZXCA 5JHLA 2FIKB 3N04A 4YFDB 3SCMD 3PQYB 1OHZA 4U33A 3AUWB 4WK0B 1BZ7A 1J5CA 2GK0A 3H1JD 3FTYA 4WU5A 2UUDK 5ADOH 3BPCB 2UZIL 2WK2A 5CP3H 4DOHB 1TQUA 1OSZB 2N3JA 3ATBA 3LN5B 4LCCA 3RJDA 3TBYA 2Y2YA 5I1JH 3QJUB 3HUJF 4A6YB 4PJFB 4F7MB 3MUUA 1CXLA 3S5ZA 4DNLA 3NBTA 5ACZB 2DKUA 5ALBL 5E08H 4OF8A 1BFOA 5C08A 3DUSA 3KYOB 4ZXBA 4APQD 4AUJA 4TVPE 3I50L 3L4TA 1NUFA 4XTRD 4Y8DC 2VXTH 4C4KO 3WFCL 2GJJA 3MOBL 1OM9A 1U91A 2FX9L 4I0PA 3K6IA 4PV9B 3T77A 2E3VA 4QXTB 3WDJA 4WQEA 4PGDB 5L8JB 4Z7VF 1HC1A 3V52H 4JPKL 3V7MA 3KWWB 4O1QA 3AS2A 2YUZA 3GHBH 3MOBH 2C34A 2NY0C 2EVIA 1HZKA 1H6UA 1GQ1A 1JPSH 4B9KC 2IXQA 3ROLA 1BE3D 3FO1B 3DVNA 4R84A 3GMLB 3FTVA 3U6RB 2FR4A 4PG2A 1FL5A 4D7BA 5KBNC 3HAEA 4F9LC 3EFFA 4JFEB 5EXQA 1LILA 5FHAH 2XG4A 3R7RA 5ES4B 1N12A 2G3NA 1NC2A 1MLBA 3BAYA 2XRAL 3V0WH 2C7UB 1G5GA 3KLHC 5I1KL 4DY9A 3KL3A 2GJPA 3U1QA 4OFVA 4BE6A 3MVSA 5EUOA 1OWRM 1J7VR 1ZHBB 4KQ3L 2AJZA 3MKGA 3TASA 4Z7VA 4HUKB 1TEYA 4RSZA 4ELKA 3GXTA 3H6AA 2AKRA 2OPCA 3MJ8A 1HE8A 4M5ZL 2RBLA 1AR2A 3ECUA 4R0LB 4NOFA 1DFBH 3MTXA 5DS2A 3ZMNA 4YSAA 4FA5A 4H2CA 3Q9PA 1RURH 2P8MB 2H4EA 3QUHA 3OJVC 3IMUA 4KKLD 3RVWC 1AIZA 3KYAA 2EECA 4OF7A 1J86A 3GZKA 1RJLA 1M6ZA 2V3FA 1ZE3C 2NY2D 2NXYD 1UOLA 4C4BA 1JWMA 2EEFA 4UV4H 5L4FA 5CEYB 3ESUF 1PG7W 1XCWA 1XSIA 2OSYA 3H85A 4FQXA 5F3FA 3UTTD 1TXKA 2X41A 2PPCA 3H9HA 4GXUM 4P05A 2Z0UA 3SJLA 1JXDA 4YK4C 1UH2A 2AKRB 1E67A 2ZXAA 3O45B 2GI0A 1DE4A 4ZPVA 4NP4H 2FIRT 4KUCF 1L3WA 1NLDL 4B96A 1FIEA 3QRGH 4J6RH 4MQTB 4HEPA 2V9RA 2HT3D 3ARED 5LDUA 155CA 3CPLA 4ZXBC 2C9QA 4WFGD 1BLIA 2O1AA 4Y9FA 4EE2A 2BNRA 2J4WH 3H9YA 5LB1A 2R23A 3OKLA 4R2GD 3OXRB 3QORB 3HMXA 3O6KH 1MWAH 5I18L 3IGUA 5IB1B 4WFEE 3BLBA 5I1IH 3DGGA 1BM3L 4PJ8C 4JFTA 4ALAH 1INDL 1TKWB 4LMQI 4XBMA 1H31A 4PS4H 3NOIA 5EU6E 3BQVA 1CSXA 4OB5H 3WKYA 2IIJA 3VO0A 3CZKA 2PPEA 2ED8A 1M2VB 1PIGA 3MV11 3TZVA 3VWKA 1UJ3B 2XQYK 5AKRA 1W0WA 4GSRA 2VQ1A 3CC1A 4HWZA 5GPRA 3IGAA 2QADC 3LVTA 2EQDA 4ZFZA 4V33A 4K3IA 2Y1YA 1SN2A 4HZ1A 5LBSL 2VT0A 4YZFF 2OZ4A 3SDXE 1Y07A 5B39A 3IGFA 1R47A 1AGBB 2F54A 3BSGA 3IVKA 1MCWM 2R69A 1KBGL 3AREA 3FO0H 4S0SD 4O5LH 5C2BH 5I6OA 4CKVX 3R1GL 1JV2B 2QSTA 3I2CL 1GSMA 3L7FB 3P77B 5IWLA 4GRWF 1A7OL 1YY9D 3X2QB 1WS7A 1IB5A 2CAKA 3N42F 1I1CA 4EDXA 2VQ4A 3U4EB 4N0FB 3L3JB 1A14L 3HFML 2A73B 4JLRA 4M7KL 1WWBX 1T20A 2R0ZH 4QIRA 3BESR 4DGIH 2IV9A 4IKIA 3PIQB 1YNRA 5KEZA 4XPHH 4TSAL 4NB7A 4N0YL 4QHLA 3GPEA 4NJAH 4KOBA 4P3DB 4XWGH 1E7VA 1TMQA 4RVBA 4XNXL 1JPSL 4FLQA 3EYUL 5DUJA 3VI3A 3V9EA 3U2SB 1KB0A 1SJEA 4MJIA 2BP0B 4NUJB 1QTSA 3C60C 1IKFL 5KUMA 3WEAA 4DCQA 2PPDA 3ZTDC 4XWGL 2BWDA 1C5BL 5IEKB 2BSTA 2YXMA 3VWJD 2HKHH 2PYEA 1UWEL 5T3XL 1SBSH 5A2JH 4WCYL 3GIVA 5FGBA 5DVOA 2I7OA 1KIQA 2FSEA 1HS6A 2H6UA 3DV4A 4L3HA 4U1NB 1YEGL 3KWWA 2ZTBA 3Q8EA 2FJHB 4AH2B 4O00A 1QP1A 4NQEA 4YDVA 5KG9B 2IWFA 4XNAA 4OZFH 5TQ0H 1Q72H 1D5XA 2XKNB 4J7RA 1ZLDA 1HINH 4JKPL 2FO4B 2UXVA 3QAZB 3SPHA 2DW5A 5ADOL 3GBNH 2E7BA 3L4UA 1PS3A 1AQMA 3QH3A 3DETD 4H20L 4JZNA 5A16B 2KQMA 3GI9L 3U0TB 3RN0A 2GK0B 3Q2NA 3RWGB 4WHTB 1UH3A 3CN1A 3FO2A 5KYWB 3BAEL 3IU3B 3P54A 4G6FB 2ID5A 5G5DA 5TH2A 2WO2B 2WZ6A 3Q7JA 3PDDA 2XN1A 4PREA 3RWIB 1K2DB 4CGTA 5GS1A 1OAKL 5L6YL 1XF3B 4MA7L 1GS7A 3QIBD 5T1KB 3WU1A 5LKNA 4B27A 1QLRA 1XF1A 4OR1A 5BVPL 4O4YH 1XL4A 3ES6B 3F7LA 4KNSA 4LCVA 3RL2B 4R5TA 1M71A 3JVFC 3WJMA 4M5SA 5FECB 1MUJA 3TIDB 3HFFA 5FO7B 3CSGA 4HKXA 3CZJA 1LEGA 5CIPH 3GGWA 1TITA 3ZKNC 3WO3B 5LAXA 5L8KB 4PJ0V 3VWJB 3ZE2F 4DSYA 3Q8AA 4WEUD 1E6JL 4Q0XH 5D4JA 2A6KA 2OFQA 4NN6C 2PCPA 5E5MA 1KB5B 3SDXB 3SIKA 3D87B 3IKCA 4V2CB 2APBA 4PIBA 1UQSB 2ZOKB 3FCSB 5DS8B 1HNFA 5I30L 4V1DB 3OAWA 5DRWA 4JPWL 4KI5D 3U25A 1BVZA 3ZDYF 3Q43A 4WFHD 2UZXB 2YRZA 1FVCA 5I30H 1UGNA 2E47A 3BIAX 4UTCA 4F93B 1XMEB 2OCFD 5KG9A 5B38A 3RVTD 1ITCA 5CXPA 1D7BA 4JGNA 2DM4A 4XO5A 4FP8H 1FN4B 4PM1A 2I8FA 1UXWA 4NZJA 3HRZB 4WWID 1BZ8A 3AMKA 2J6WA 3JVGA 3W5NA 3ESVF 3FQNA 4ELDA 3N41F 4U2ZA 3FF8A 4PJ5A 1NDMB 5I6MA 3DX8B 1FZJA 2ED9A 1QL4A 1YN7A 4K23H 1B2WH 3NESA 2X2YA 3CYTI 1QFUH 3U2IA 5D8JL 2H6PA 2UZPA 3LXCA 4I1NB 3L9RB 3L9EA 3U2JA 3K5RA 1FYTD 5ERWB 4WUUA 3UYRH 1WK0A 2X4SB 5E79V 2NY7L 3HLAB 5A6IA 1KCWA 2MTPA 4XXWC 5ICXB 3NJGA 1HXMA 1RUQH 2NYKA 3P4OB 4L0ZA 4OCSH 1GW6A 5EIVA 1HEJC 3HMWH 3QNXB 1F45A 1RZKL 1S9WA 4S2SA 2F5AL 3U46B 4AVIA 4MBOA 4MD4A 2W80C 1F58H 2A9BA 2W94A 2BP5M 4GXVL 1KDJA 2WJ5A 1KCUL 5GJTH 3C2SA 3X13A 1JV2A 1CS6A 2LFEA 5JIPA 1CDIA 2BSRA 1KC5H 4IS6B 1REIA 4WO4C 3KPNB 4KKRA 4NQCB 3RX7A 3UTSE 4URKA 3DETC 4PJBB 4WFGE 4F7KA 2IAMB 5HSFA 2PO6B 5E8PB 4KJWD 2IDSA 2X4OA 5EBWA 3AWGA 1KF9B 5CD3A 4Y2DC 3BFWA 3O9WB 3GMPB 1MWAA 1H8LA 5IT2H 1TPXC 3SQOL 3JBG7 4YXKH 3RDJA 2JCCF 2M2DA 4XRCB 1JYXA 1BAWA 4KI1A 4DJMA 1VRSA 2MRYA 4O2FB 1T0MB 3CBJB 4DN4H 2BSCA 3VI4E 1UASA 2GJ6D 1KV7A 1KYDA 2BERA 2ZIDA 1DBKL 1A5FL 2CBMA 4LASH 4X6CB 4XP9L 1SVZA 4OD2A 3QDHA 2F1EA 4A63A 1MCQA 3LRKA 4DEUA 1QSED 3OPZH 1JZEA 4N2CA 2QELA 3Q5OA 3RAJL 4XPHL 4L29B 1QSFA 3H4HA 1A6ZB 1E50A 3ZYZA 1N8ZB 5SWZA 4PS3A 1V54B 4WJKB 3RLSA 3LH8A 2DVHA 1QRKA 1RXLA 2ERJC 3B37A 5ERWA 3SKMA 3D3VD 5DZAA 4QHNB 5B7MA 3G5XA 1ZT7B 4KV5E 2HT3C 4YNYB 4M4RA 5AFAA 3SZKC 3TJHC 1X5YA 5B3NA 5IMMB 4FQIH 5FW6A 1JCVA 4LFHG 4DQOH 2AJSH 1LP9E 3UC0H 5E8OA 3RTLA 3QORD 1JGVL 2WLNA 2DICA 5C0RL 3PXHA 3NUKA 4U3CA 2OL3B 1UGKA 3FS9A 3QG7H 2WHVA 2JI3A 5B39G 1WQVT 2I9TB 1THAA 2IANA 5F96H 1OZUA 3MXVL 4XMLH 3LRSB 3MLZL 3CCHA 3ARFA 3CX5J 4M5YL 4OI7A 3QWNA 1SUHA 5E8DL 5T3XD 5L4IA 1QNIA 4GP4B 4Z3EA 1CSWA 1F4YH 4PJIB 4AIZA 4E41D 4ZXBB 4JKPH 4FNTA 1MKFA 4YIQB 4QRSB 4DW2L 4R0LA 4YJZL 5SV4A 1NAKL 1P84J 4JFVA 4XWOC 4OUUB 3QUXC 5IM7B 1FFNA 2JCCE 5FF6A 1ZMYA 2NXYB 4J8RA 3X39A 4ZW7A 3S37H 1IGIH 3FU5A 2Q7AA 1ZSHA 4UNVA 3M17A 3BVXA 1O7VA 4NO5A 3VFVA 3VWJA 1C08A 5HJGA 1EZLA 1R3KA 3IEAA 4HISA 3ZUNC 1KXQA 4X6FA 1OK8A 4Z6AT 4JFDB 2XFXA 3MV8D 4IKKA 5DFVD 4ABUA 4HP5A 1DVFC 5D7JD 1VPOL 1E4WL 2RHEA 2ZG2A 4OVVA 2BNQB 4ZAKB 5MEQB 5GSVA 1H0DB 3QO0A 3RJQB 1GSKA 2KQNA 3ZXAC 3DBXB 4NFGB 2FT7A 5AAWA 2IGFH 5D1XD 1OGAE 3MRBB 5I5RA 2HA1A 4YHPA 5J1AB 3V4UH 2QDVA 2V5YA 4NZRL 1MCHA 1CDCA 4HC1H 4KK9C 1YSOA 3B7YA 3B2PA 3GXDA 5EU3B 5TDPA 4YL9A 3ZRSA 4BEIA 1ACYH 4HSCX 1MAMH 4WWPA 1T83C 2R29A 2ZCKH 3VXUE 3E6FA 4IRJC 5TF1L 3O2VH 1NBCA 5E9DD 1W9XA 1VYDA 4RMTA 3G6DL 2PXYC 5L2KD 1UXWB 2XA8L 3UEQA 5IB3A 3DJRA 5EU6A 2HZHA 3GQFA 1OAUH 2YN3A 1BQKA 1EK3A 1KCRH 1M4KA 3RI5F 4K9EC 1A47A 2NX5D 3VXSD 2JV6A 3ZKND 4AQAB 1SM3H 1JN6B 4ODWB 4Q9RH 3PHAA 1TNNA 5EZOL 4MZ2A 3OJDB 2ZCLH 3P2BA 5DRWB 2D7PA 1LD9A 3G6AB 2B7DT 4ZDHB 1SLUA 5CIPA 5AAMC 2WQVA 3DSFH 4JM4H 3T0EE 4W9GC 2C9XB 4PJEF 4G9FB 4JFEE 3KLAB 5HGGS 4DUXA 4UB6V 3UBFA 5C97A 2ZP8A 1CURA 5C7XL 3AQZA 4P3WA 1IRWA 3RA7L 4A39A 2IVFC 2ZYHA 4JO1H 3TO4D 4AH2A 5BV7C 1T03H 1FNSH 4Z3IA 2L4DA 3DHJA 2OZ4L 3IJYB 5HDOA 4UM9A 1WZ1H 2DQDH 3VH8A 1K3HA 3D39E 5CBEA 4LT7A 2IPTL 3GIVB 3L5HA 3QQDA 3MCKB 4EN3D 5A1AA 5GGRA 4E9SA 2X70A 3GI8L 3H3BC 3THMH 3QR2A 1YPZE 1P4IH 4CDHA 4EI6A 2Y1ZA 1KEML 1I3VA 2BNQD 4FOMA 4PLKC 4NQVA 5JA9A 2X40A 3OWRA 3GMMB 2Z31C 4U1HA 4IKLA 3OKMA 1U41A 1FLTX 1NGYA 4AM0A 2BP8B 2OMUA 2JFCA 4X5LA 3N9GL 5I5IA 5EOTA 4UANA 4Y4FB 3HS9A 4PJ6A 4ISVB 4KY1L 1Z9LA 2HLFC 4P9HL 1KCUH 5I1HH 4S1DC 3AB0B 2UWEA 4JQIH 5EO0B 2AABH 1AZNA 4MNGE 3NCFB 4NQXA 3LNFA 4AEHH 1QAWA 3UO1L 4JPQA 2LABA 4YSSA 3NJNA 1XEUA 2VISA 3BCCD 4GW5B 3RU8H 4BYHA 1E5ZA 1PLGL 1NSNH 3HZYB 5ICYA 1B0IA 2DDQH 3U36B 1OGTB 1RZJH 4PWKA 3VXUB 3RBGA 4E9YA 4M6MH 3D30A 4LNRB 1UJ3A 4TM9A 4AC4A 4KZ0A 3LPWA 5I66A 2AMGA 5CIHB 2PW1B 4G43A 4LF3A 5SV3A 3UPCA 3RPIA 1X5KA 3O9WA 3MK7C 3BMVA 5HHVL 3BGAA 4KROB 3GS0A 3HG1E 3B1UA 3HNSH 1Q1PA 3OAUL 1PSKL 4F8LA 1ZV5A 1G84A 5MEPB 2KDGA 2EXYC 2R2CA 5SX5K 2AXJA 1ZJBA 3QS2A 4MQSB 3MV9A 1HRCA 3NH7L 2XWEA 1IC5H 3X3FH 4JG1L 5CLWA 2NNCA 2OSLB 1ZCRA 1WCBB 2CALA 2DM3A 4JDZB 2BFVH 3UFIA 1OT2A 2ICEC 5TE4L 1UURA 1ZLEA 3UERA 4PV8B 4W1TA 4N22A 3EJJX 5E94A 1QSZA 3RX8A 1VLXA 5ICZB 4A6YL 1EZVY 5IG7A 2ZOWA 2PP7A 3MUY1 4PFEA 4D8PA 4L2YA 3ULSB 2CHZA 4XMPH 2WQ8A 3LS5H 2IGFL 3PWUA 1N2RA 3QQ4A 1YDPA 3NSJA 3QZPA 2H41A 3MPCA 4GQPH 2KLSA 5BV7L 4OT1L 4Q58C 4ZW6A 1EZUA 3NRQA 5HY9A 1X9RA 3HCVA 1LXMA 3RVUD 2GJ6E 2D4DA 3MUGB 3B2DC 3ZDXE 1F4XL 3MV9B 4IOSD 4MAYD 2BK8A 4N0KA 2CUAA 1HXKA 2HJFA 3ZE1F 1OY3B 2BOBB 5JHMA 1G9NL 4A55A 4ODHH 4IRSD 2GB2A 2O72A 2LU7A 2KZBA 1OALA 3CX2A 4YDIL 3W39A 2YZ8A 5I0WA 5AW9B 3NACL 1E9QB 1RK0A 3G9AB 3FU7A 3U6XA 2IH1A 5KSVA 2Q20A 2B4CC 3AU0A 1U8LB 1LE9A 4RSYA 2K8QA 1C8PA 3QC6X 4FNRA 1Q9LA 2KUTA 1ET7A 3AAZA 5FUCC 5AW7B 3S3SA 3LX9A 1AD0A 2A74A 3IN0A 1MFDH 1YEWA 2YUWA 3HLKA 3IDGB 5CKGA 2DIAA 5MI0C 1IBFA 4KTEL 2CNZA 3QWOB 5IVXB 4Z0XA 4FXTA 1QNZH 3N85H 2ZKHL 3WG7B 2KPNA 4NCC1 1E5BA 3OKDB 4KTEH 3KG5A 4OLWL 5E2VH 4BKTC 4GRMB 4P4RB 1BQ5A 3U9PH 5C86A 5EF1A 1ASPA 1F13A 3SJVE 5DS8A 2P3YA 4WEBH 4YSPA 3C5XA 5C0GB 5JPNC 5DUBA 4H8WC 4HYTB 3PWNA 4I2XA 4P46B 1QR1B 3P1VA 4MVBD 2J1WA 4JFOA 3KW8A 3SDAB 3SD2A 2HLFD 4ZS7H 4LL1A 4KMLB 1JF1B 3WIFA 3QFJE 1MW3A 5KYYB 1S7VB 1FAIH 3BCDA 4F3FB 3OJ2C 4GRLD 4G9FE 1S3KH 1D7CA 1DQLL 1Z5HA 4AYID 3HG1D 4TLTA 4GFXA 3UYOD 3VMOA 3V0VB 1AACA 1E2WA 5TPWH 1BVNP 1ZVSB 1KOAA 5CZVL 4QRUA 3LZQA 4GSDL 4TVUA 4JREC 4UV7H 3UBGA 1U8KB 3CLEL 1F8TL 2WBJD 4UOW1 2L7UA 1MF2L 3TT3L 2MIZA 4QJ5B 1RIUH 5DJ8A 1SJVA 4OLZL 2R2BA 4KXAA 4OQTA 1ZLWK 2Q3AA 5BW7A 3CQPA 3GKZA 4MQXC 1CXAA 1M3JA 1PZBA 4WIQA 4AG4H 4DP2X 4O2EA 2UXTA 4WFHE 1SHXA 4XPAL 4V1DA 4L5FL 4HXAH 1MLCA 3L75D 5BVJA 1IAIH 4HD5A 3BPLB 1KLGB 5GHWL 2R29H 3ZPDA 4EIFA 3GBDA 4H5SA 4LSTL 3FTGB 3PUUA 4O51A 4EKXA 2B14A 3FSOA 4UI2A 2VITA 5IFHH 4BZ2H 3RIFK 4HZAA 1WCBA 4WW2A 4Y4FA 5DRXA 3WIIH 3IJHB 5C09A 2CGYA 3QEHB 4GUPB 5GGRY 3L70D 1CI3M 4CN4A 4E42A 2ZXWB 1PZSA 2ZF8A 1ITBB 3MRHA 3WCYA 1N4XH 3DRTB 1XF4B 2EE2A 4ODUA 1AXIB 4HMCA 4X6DA 1MFBH 4DP0X 5I5MA 4BFKA 1NGZB 4W70A 3GC3A 4YBQD 4NRYB 3QG7L 1TVBA 4RFEA 3O0RH 5KJ4A 3VH8B 2X42A 4XYDB 5SWZE 4YHPB 1EHKB 4I3GA 3FPYA 1U6AL 3ASNB 4L4TE 5L4JA 1WHPA 3EYSL 2APFA 3RWIA 3L4OA 1A2YA 4AKOA 3T3PF 3I6LD 3O0RL 2P5PA 3IJ7A 3KGUA 3HJEA 5D1XB 3WFHA 5EU6D 1OSPL 4Y4HA 4YSRA 2I69A 1UXSB 4ETYA 3QRFM 4JFED 3O6ML 5A2AA 2G0LA 2GSIB 3O8XB 5DZLA 5E6UB 3W0WE 5C92A 2WCGA 4N2KA 4HLZG 4MD5B 4OM1H 3HUJB 2XWDA 3PFQA 1IAIM 3GBLA 2VABB 4GAYB 1YEAA 1CXHA 2O5XL 4P2OD 1P5UA 1DQMH 3ML9A 3F62A 5C09D 4KZEH 4NKIL 1WGOA 2F58H 3L16A 4APXB 2I5YL 3EO9H 4QTFA 3E3QE 1W80A 5JQ6H 2FL5B 2Z4QB 4OFKA 4YHLH 2EINB 4EICA 3TL5A 5A43C 4XPTL 2DQGH 3VSUA 2J8UE 5E9DE 5D70L 3F6LA 2XZAL 3MYJB 2MPAL 4BUQA 1IM3B 4LHJB 3QUXD 4GKLA 1QBAA 4AJYV 2X6VA 2VN6A 2B12B 4AIXA 5EFIB 5JW5A 5D7SL 5KVDE 1O75A 1MFUA 4ERSL 2BSTB 1KBGH 1LYQA 1T0NA 5J6GA 4NXKA 4E5XG 4NM8L 35C8H 1RK7A 4NC2B 5T1MB 4X6BA 4F92B 4CBZA 1YC7A 2L4OA 5E8OB 1P9MA 4FQ2L 3WNMA 1RUKL 1ZT4B 5IR1A 3H9ZA 5KLIB 3BUDA 2FBJH 3RBSA 4CJ0A 1YICA 1FH5L 4WGVB 4YVUA 2BSDA 1X5AA 3AVEA 1I1YA 3MX0B 4G8GE 3EOAA 4WW2B 2GC7D 2ZWZA 5EZIL 43CAA 3CVHH 5KVGE 5A40E 4N24A 4UNTA 4GG8A 5FKAB 1O7DE 4H26A 4MD0A 4AZ8B 2XN0A 2OS7A 1BQLL 1Q0YL 1XT5A 5IJVB 4X83A 1QBBA 2K7PA 4YVNA 3QI9D 2JJSC 1Q9WA 5H35B 2R56L 3LS4H 2X4UB 3OC5A 2V17H 2N3BA 1MRDL 5EN2A 5LGHL 1CE6B 3BIBX 3F3HA 4XCCL 3EJZC 2X4RA 1UB6B 1LFMA 2OMYA 4J3OG 2AXTV 1RUPH 1ROCA 3D0VA 3F7YA 1HL4A 1S78C 5KZCB 1MRDH 1XSOA 1ZDQA 2IPKA 2IH8A 2FDBP 5DC4B 5KS9E 1EHLL 4X8XA 4OZFG 5K59E 5FYKD 1CICD 1YNLH 2JXMA 3BP5B 4LBEA 5JO5B 1EEYB 1QWHA 3L3KB 3QW9A 1C5DB 3QJQB 2MCMA 3WN5B 4E9WA 1XIWD 4XPAH 2ZICA 4YHOH 2BIQA 1SDAB 1LVEA 1ZHNA 4UDTA 4DFIA 1YJDC 2L3BA 1DQJB 3L1OL 4IOSA 1IAIL 2ZONG 4ZAKA 3PWUB 4JW3A 4XOCA 1QUPA 2VE6A 1J87A 2YPVL 3D34A 3H2WA 3ILQC 4HAKA 4YDLC 3PWVA 5H35A 3K91A 5JORA 3U48A 1CLZH 2FQEA 5C0DB 2VLRE 5HPOA 1A6AB 1DDHA 2VSDA 3RWEB 3FZUC 4OGAD 1WHOA 1AY1H 3CV5A 4K94L 1T1YB 3TYFA 3FHAA 2DQEH 4M4PA 5EU5A 4AC2A 4L37A 1WAAE 3FQTA 3TO2A 5D5ME 5ADPH 4PRPA 1EAPB 1GOFA 3OKOA 2BWQA 3T0ED 3PRZA 1JZFA 5K1JA 4PRIA 3VXOB 1LO5A 4JM2C 4RX4A 5B8CA 1KYOK 1N64L 2X6AA 3QQ9C 1A6TB 4HCGA 5ESVA 5I8OL 1S3KL 3FU9A 4JFHE 5F7AA 1H3VA 1LQBC 2VR3A 1OAZL 2ZCHL 3DVNB 3IFPB 4IRZH 4M7ZC 2H9GA 3QP3A 4HHAA 4LRIC 4DOHE 1GC1H 2Q86A 5HGHA 4IU3A 3B3IB 2PW1A 4G43B 4JFYB 2Q7YB 3G5ZA 1CYCA 4W9IC 3EZJB 1LDPL 3RTQB 3MRJA 5LBVA 2RCSH 1HHKB 1YJDL 1ZS2A 4AGQA 4AV0A 5KSVB 4GMSL 3BSZL 4KKPA 5CD3B 1IE4A 3BUYB 1J5OH 3T3ME 1OARH 1AGFB 3BVDB 3OAUH 1UKTA 1YZZA 4NAQA 5H37A 3UTSD 3KPPA 3ZO0A 3JZYA 3SEPA 1J05A 1JZGA 2EUWA 4LSUL 3KDPB 4O5LL 2X4TB 2C9UA 4WNJA 1AFVH 3RFRA 4B9PA 4MD0B 1A56A 3UTTB 5EUOB 1JZ2A 2ARJA 4MB3A 1TEFA 1UD4A 4BZ2L 3BWUC 4X5RA 3L8QA 3CFMA 2VDKH 5LN8A 2XBDA 1H5BA 3O8XC 4FFWC 1RLWA 4QO1A 2VYRE 3BX7C 5MERB 3MRKA 2G3MA 3SYQA 3S5LG 1EUUA 5AENA 2WINB 1W8NA 1YEJL 3FSVA 4OZGE 1P0SE 1CL7L 1C6OA 2YAEA 2P4AB 4QAMB 4GSXA 4YBHA 2PO6D 3DTUB 2IXQB 4LU5H 3KCPB 2H0JA 2BC4A 5LCVL 3TJHD 1QFUL 1YQ2A 2H6OA 2OP4L 3V5HB 3IDYC 1BWMA 4G59C 1LWJA 4E9QA 1CHIA 3UXFA 1NCWL 4EJ1C 5C3TA 3WS6A 2EO9A 1OSPH 3AUVA 4ZTEA 4ODUB 2J57A 3S37X 1UB6A 5HYIA 1H3WM 1UUNA 2HG5B 5JNYB 1IE5A 2VDLB 4EOWL 2NY1D 5EEUA 4Z7IA 1B7VA 3PDOB 2WJ7A 3COOA 5DTFB 1KCSH 5DRXB 3PUCA 4NQED 3NCMA 2BNUA 1P4BH 4F2MA 2CIIB 2CDEB 1JHLL 3MLTB 4PJHB 1NA8A 4XH2B 4WSKA 1PZ5B 3K6NA 4TNVK 1KDIA 3VX0A 4XP4L 2NCMA 3SKOB 2Y2WA 2F6AA 1E8XA 1T2QL 4Z77B 1F3DJ 3RIKA 5BZWB 3CVCA 4FFZH 3E6HA 4JM2D 4CBPA 3JZ7A 3MROB 4Y2DD 4XBEH 5F88A 4LIQE 4E0RA 3O41A 5DD1H 4GW4A 5DD6A 1AZZC 4U0QB 4KI5F 5C0CA 1XCTA 5EF3A 1AP2B 2EDYA 4PTUA 5I2IB 5D7SH 3KR3L 3WIAA 1YUHB 4GP5B 3NSCA 4OD3H 3D85A 1MCSA 3IF1B 4Z8FL 1QSEE 3ZYIA 4G5AA 4P2QA 3ZIYA 4QHKI 1BGXL 1GIGL 2AIUA 4XMKL 2NYYD 3V7AG 1IBDA 1PP9D 3V0FA 1FNGA 4HEME 5JLZA 1FZOB 4KHTH 3G5WA 4AOFA 4ETQA 3MRQA 2AF2A 1TO4A 2FGZA 1PPJD 4FHJA 2DMGA 3F58L 2JIXD 5C3IA 2CLVA 2VQTA 1SEBA 1CBVL 1Z0MA 4PWGA 3E1F1 5BNXD 2BMKA 2F1BA 1AP2A 4PTUB 3L3OA 2WLYA 4ODVH 4R7LA 3JVGC 4PJBF 1G7JA 3WHE1 1CBVH 2DYRB 4XZ4A 5LNDA 5DQDH 2BHUA 1E5UI 4PGCA 3L2NA 1IMHC 1AS6A 2K70A 3Q2VA 3U1SL 5IFJA 1GZHA 3V5KA 1KLGA 1R46A 4JFFA 3KYNB 5CSBA 4UZSA 4UOZA 2H7WA 4DQAA 4OF5A 4WI7A 1MHHB 3QEUA 2WYTA 3TBWB 4LCWA 4J23A 1KGCD 3C2AH 3NGBB 1L3NA 4AYFB 4YHKH 1RZIB 2GI7A 3OGOE 5EO9A 5EZJA 5LXGL 1NFDA 1A9EA 5AL0A 1MQKL 4ZNEE 3WEMA 4E9LA 3LIZH 3TCTA 2AS5M 4KH9A 5BRZA 4FA8A 1MVUA 1EFXD 3PV6B 4FHKA 4Y4HC 1ZS8B 4XN7A 2CU9A 2DMKA 2R0KL 1ZEAH 5ECJE 3ZE0F 2Q76A 3H3PH 2IWKA 1NCGA 2WGNB 4OD1L 3TVMC 5FYKL 4ZMLA 3ARDA 1IC7H 1JF1A 2HB0A 3WIFB 3ZKMD 3IXTB 2D7NA 2NY4B 5H94A 3X12A 2FRCA 3IJHA 3H56A 4HGKC 1H32B 2CUHA 4R4FH 7FABL 3P0GB 4MCZA 4Y5XB 5I8KH 3FO2B 4FXGA 2HN7B 4JRYB 2Z8WC 1INDH 2PYEE 5DXWA 2AV1A 5F88B 3A0OA 2E7DA 2IALB 3WHXB 2VZSA 3HG1B 1C5CH 5F9AC 1JK9B 4P9MH 3RY6C 1EAOA 4MRCA 4FF9A 5CUSH 2BSBA 4N0FA 1IGJA 3MRFB 5B4MC 3SHSA 1N70A 4FE9A 1DBMH 1JFQH 3BRGC 1NCIA 3ARBA 1DW2A 2WXJA 3D3VB 2BHFA 4XOAA 2VTFA 2VR9A 4QT5B 4G80B 1T22B 1DLHA 3N42B 3F65A 4I8DA 1WISA 3IJEB 4MASA 4YGVA 1L0LD 2NY6B 3P0VL 5LBSH 1CN4A 5I82A 3UJIL 3CMGA 1FFOB 2CKBB 3SSGA 2NW2B 3FB5B 3US9A 1CF1A 5FGCB 4FLHA 4HDIA 1GS8A 5ALBH 2W81C 1QFWM 1Z5LB 4DH2A 3QUMB 4Y5YC 3UGEA 5I6XC 5E9AA 3ZSSA 32C2B 3U9UB 2V5MA 3LXBA 4NHUA 5B8CC 3BD5A 4CMHB 4RA0C 1J10A 2VZTA 2ZOLB 4IRZA 2C1DA 3UP1A 1IX2A 4DK3A 4MMXB 3MLVH 2MCAA 1ZHLB 3QPXL 1P7QD 1VFAA 3QZWG 5CLYA 3FN3A 3DDFA 3UBXB 3WTWA 5F1IA 1TKWA 1JZIA 4C58B 3LH2L 2FLMA 1NL0L 1F6FB 1BVOA 3EOBA 3NPSB 1T66C 1LTXA 1D6VL 1P7KA 1Q94B 2G5BA 4JM4L 4NJAL 4O02L 3JV4B 2YAFA 4Y9GA 3TOPA 1M6OA 2JTDA 3PQYE 4QR7A 3ZR6A 1LO0L 4UIKL 4JDZA 2H0EA 2IDUA 4L1TA 3TBTB 1MI5A 2CDGB 3V0HA 3KCWA 4MJ2A 4A37A 4BJLA 4HPOL 3T1FA 3A6BH 5CN1A 3GPSA 5DJQB 1RAQA 5IEHA 2WLIA 4JRYD 4JO3L 3FUHA 2HMIC 2H1LM 2UY6A 2Q76B 5LGYA 3A23A 3UC0L 3QIBC 4G7RB 2P49B 1U30A 1VENA 2I9LB 3FO1A 1R34A 1XR9B 3QHFL 3MV7B 1R3LB 2H0PA 3GNML 3C09B 3VXPA 2J8OA 1JGIA 2EVGA 4M8UA 4EVNB 2BVQB 4UYPA 1JGLH 1M7DB 3I9GL 1DCLA 1A1OB 4QRFA 2WUBH 3ZKMC 3GHPA 2ZOOA 2F53B 1B3JA 3GJFA 3LIUA 1PAZA 3D09A 3BPOB 3UIZA 4NRXB 1MVYA 4WNQB 1RHHA 1TETL 3G7TA 2ZSVA 3Q1SH 4LKCA 3EYVA 1OTTD 3EJRA 4JUTA 3AM8C 2DWSA 2GIWA 4Y4HD 5CHNB 3BH9B 1E8YA 1IGJB 5D6DA 4XTRC 5DFSA 2XI9A 4X7SH 5LUMA 2J8UF 1EAQA 1FSKB 3F7QA 4Z7VB 3SJVA 1SGKA 1YLBB 2CGRL 4YL4A 4ZUWB 4KNQA 3OXRA 3QORA 1NSNL 4WI5A 5EO0A 5D7IB 3FAWA 2G3XA 5TJWK 5JW3H 4FG4A 3QEQA 3R7QA 2AQQA 4P2QE 1FJ1A 4TQIA 4MCZB 1OGAB 4PJ8A 4YPJA 3KXFB 2WLLB 4YO0A 1CDGA 1M2OA 3NJIA 1VFUA 3HW7A 3QHZL 2FE0A 1XF5B 5JHLH 2VZVA 1MIEH 1SMAA 2X9XA 1P84K 1ACXA 3MR9B 1E27B 5HVFB 1HVXA 5INCA 4FA1A 1A8JH 1SQPD 4JZJB 2R69H 1R4XA 2X38A 4GP8B 2XTSB 5DYOB 1NLDH 3PHQA 3D0LA 2O5NA 3MLRL 1UA7A 1ZTXL 2WZ0A 4BK4A 3MLWH 2CCVA 5HDBE 1TENA 4P23B 4KPHH 4QRAA 2YD3A 3ZL4L 4AGNA 4OV5B 4Q14A 5AYUH 3RWDA 1K4CB 5CN2A 1XF2A 3LSOA 3MRMB 1S7QA 1T1WB 1FPTH 1P7BA 2D3NA 2Z7UA 5HDQH 2NUTA 3ZIMA 4ANUA 2I60H 4MX7B 3IKKA 2GHWB 1QUNB 4AT6A 2X4RB 2NTSP 4NN5C 3JWNG 2ZXBA 1TOXA 2E4FA 4UQAA 4W9HC 2N1TE 2JSFA 2R1XB 4M00A 3APDA 3QQ3B 2HCZX 4G71B 4AE0A 2BO0A 5B1KA 5SWQB 2CUMA 4X6FB 1ZIBA 2GJRA 2AANA 4Y4KB 4KMGA 2ZCKL 3SDDD 4N8UA 1N5AB 1C08B 2PPAA 3VI3F 4QRPE 5FKAA 1PMYA 3RWFA 1KENH 1MH5B 5GRJH 1CFSB 5HHPA 4N5EC 1ZIAA 2EIKB 2R1WB 3ZZLA 1XGUB 3QNYA 2H3NB 5KVDL 1I7RA 3EGSB 5BOJA 5JYMA 3HE7C 3P9MA 2UV3A 1WLHA 1N6VA 3QQ3A 5GRJL 4B7IA 2Y2TA 3P30H 2VLME 4NUMA 2GYSA 1CL7I 3QIUC 4OIFA 3TO4A 1G4RA 4XB7A 1VFMA 3LH2H 4X8JB 3RDTD 4YSUA 1YEJH 3BPLC 2RACA 3II1A 4LESA 4UT6L 3CTTA 5CZRA 3BH8A 3OKNA 4GI9A 4FFYH 3QO1B 2XG5B 3FUMA 4D94A 5JHDD 3HR5A 1QA9A 3A4FA 3MLVL 4NZTL 3WL9A 3S96B 5DJ6B 2P5WB 1I1AA 1KIRA 5IB2B 1JNNL 4K94C 4XMXA 3ZTEA 1I3RA 2XWTB 2OL3A 3NCYP 3SDDB 4NCDA 3MNVA 3OLEA 5DZOA 4UNUA 3R4RA 3WKQA 1TTFA 3PYCA 3CIAA 3LNIA 2MCG1 3GS7A 1KEMH 2WINA 4YDZA 1EJ6A 1F58L 1N3NB 1F1DA 2XFXB 1K2DA 1TDQA 2AQSA 5A3IC 2R2EB 1P4LA 4AX3A 1LD9B 4KGJA 3DXAD 4N20A 5E95B 1DVXA 5BO0D 2C3VB 4JDEB 1VESA 3QGVA 2VLLA 3E8UL 1EFXA 4N6QA 5D9SA 3RZCA 2VH5L 3II3A 4MNHB 4MXVF 5EIIA 4GG6B 3BVVA 1BSIA 4TUJB 2VLJD 4JNXA 4N2AA 4JQVC 1Y6KR 1VZHA 1EA9C 4X9GA 2XVKA 3UBHA 1SVBA 2D0HA 1RJYB 3GTNA 1E6OH 1OD9A 3OHXA 2YXWA 3G9VA 4HV8B 4BK5A 4DGYH 2AK1H 1H3GA 1OP3K 3QXUA 1VAHA 4YOKA 2DF3A 3MRMA 4IU2B 1PY4A 3KR3H 4WI8A 3SDDC 4BKLB 1MPAL 3SN6N 3ZMEA 2OXHB 3PP4H 3GBNL 4WO0A 5JOEA 2WXQA 5FM4A 5DC9B 4LHQB 4K7FA 3NJHA 3WENA 4L3FA 5IHWA 3QPXH 1TTCA 2EDLA 5DYOA 4OW6A 3MRCA 5AB0A 2WWKO 3W38A 2UY6B 5LGJA 4RAVA 5GGSB 3SKNA 4BIKA 1GOGA 1UZ6E 3PS6A 4KRMB 3JBTB 1OAYL 3HZKB 4OCXL 3WLBB 1I53A 3SO3B 1A5FH 5J7CC 4AXWA 4HEPG 4XNQB 3RYMA 3ENEA 1ILUA 3VI3E 2E9JA 2TAAA 4YDJB 3VQ1C 4LPXA 1BBJA 1TUPA 5F9JA 3P4NA 3RLMA 1J9TA 1XGRB 3GZOA 4AYSA 1DVZA 1KBWA 3GZPA 4TPRH 2DBLL 4HPOH 1J9SA 2X2HA 4EBQH 6FABL 3V4PH 1QL3A 4U1LA 4CNIA 4KDVA 4BFIB 1IC4H 1G7IA 4X6EB 1JE6A 1G9HA 3QCUH 4KPHL 2FUTA 3ZL4H 2BLFB 3HC2A 1W15A 2BOCB 3MREA 4C59B 3IPFA 4FNPA 2BFVL 2K78A 4XMLL 3V4PL 3L3HA 2B59B 3N9GH 2RTTA 3GNMH 4PJGE 3OR7B 3POHA 1CGUA 4HOMA 2PCBB 2V2WA 1THCA 2GTZA 1J3SA 1YNKL 4RDBA 4ZI8A 3TURA 3D0WA 1VSCA 3VXRB 4Z7WF 5LXVA 3L45A 6PCYA 4B9CA 3CJJA 1YEIH 4ONFL 3G3LA 1DW1A 4WQ8A 4L4VA 2OMYB 1R5IA 1CYJA 1TJXA 3EOYG 3TA3A 4ZQKB 3BPNB 4G7VL 4ZMOA 3QXAA 1KACB 2WXIA 3DX0A 5EEZA 2BRRL 1EDHA 1G7IB 2QSQA 2OYKA 5A2BA 4OZIF 3FDWA 4HGMA 3TNMB 3T0BA 2AJZB 1L9OA 1MSPA 3QUYD 1EMTL 4WQAA 4JRXD 4KROD 2PWEA 4G80A 2CJUH 2FEEI 2XZCH 2YC1A 4M62H 3TXAA 4HK0A 5E1QA 1T89A 1YY8B 4TQEL 2ICWA 3ABMB 3TH2T 4MD4B 3N1MC 3U9PL 1EMTH 1NC4D 4AW4A 4TOYH 2N9JA 2LLNA 5KSBF 1CT8B 4PBDA 4X7EC 4OZFA 1IU1A 3OMNB 4KC3B 3F83A 2YEZA 3HNTH 4RBPK 2MPAH 4PMFA 3SDCA 2YD9A 3O3UN 4R96A 2NLJA 2OMZB 2BVPB 3MC0A 1Z7JA 2WUCH 1OCDA 4CRPA 3QI9B 4N2DA 1QPPA 1QSEA 1R24B 3AG2B 3HN5A 1QPKA 2DEYX 3CVBA 1IAKA 1U8JA 3IWVA 1DE4B 4KVCL 4ZPVB 1PQZA 5TE7L 4Y7OC 5ALCL 5GIRB 4P2QD 4JFSA 3QUYB 3QJSB 4PJEB 1U2YA 4Y0GA 4JM2B 5DO2C 5AVQB 4JKWA 4XO8A 2XKSA 3ORVA 3QDME 5I71C 5CEYA 1G6RB 4KMTH 2PP8A 1NJ9B 3EHBC 2AQ1A 4U0RB 4OLYH 5ACZA 2YQGA 5LBGA 4MCYA 4MDJB 4OT1H 5I66B 2DWXA 5LDSA 2VN5A 1RH8A 3BRFA 2BDNH 3BFOA 3BVNA 2X1QA 4RNRB 2DTML 1LEIB 4RA3A 4ZOBA 2WXOA 3QVAA 1V5JA 1WFJA 1ND0A 3ZDZE 2PW2B 5CNHA 2DIEA 1FNLA 3VXRD 2WO3B 1KV3A 3IU4H 2J88H 1CU4H 3UCQA 2UZYB 4P5TC 3O6FD 1X7SA 4L2LA 2P42B 4EI5D 3NGBC 4LKXB 4N0RA 1F8TH 1GIWA 3T3MF 2V7HA 4TQ8A 1AKPA 1QO3B 1CD1B 2JIXB 4PJ5E 2CH8A 3VFTA 5B1BB 1EZVD 4M02A 3ECBA 3NPSC 1CTNA 4GOSA 4QGTA 5AWNL 4QUOA 3SE4A 1JZDC 2WWNA 4HCRL 2BMKB 4CSZA 2R83A 5ID1B 1OPGL 3KPRB 2E76C 3HMXL 1UZ8B 2N56A 5HHMB 2R59A 5CILH 3V4LA 4F7EB 2SODB 1WRFA 3GMNB 5J8OA 3ISRA 4K5NA 3TWCH 1D6EB 1BECA 2WNXA 1TR7A 4ELMB 5ACMA 1OP5K 1CC3A 5C0AA 3VYPA 1OKEA 2ZYRA 1R75A 1KJ2B 4S1RH 3VQMA 4NXSA 3ULVD 3MLSL 4YHNA 5F3HB 2GVYA 1YUKB 1JXJA 1SQQD 2Z4QA 3HE6C 4GRLB 4WKZB 1C6RA 1UJTA 2ZOUA 5F7YC 2NY2C 4BWUA 1E90A 1I7RB 4PGDA 4G3YL 3ARGC 4PRAB 4FFYA 3TN0A 5C07A 3DIFA 4GY4A 1AOQA 1HL9A 2FQDA 1Q8MA 2YA0A 4QRRB 5KTEL 1XIWB 1RJYA 2F19H 3VGFA 4X0KA 3V6ZA 3C5SA 5DI8A 1MHCA 3ZK0A 1OSZA 3LN5A 4LCUB 1MCNA 5EIQA 3FRPA 2D7QA 1NLBH 3EYOB 4MJ5A 2Q5BA 1VEOA 3HI6L 4N68A 4LSSH 2A83B 4PJHA 5DU7A 2CJTA 3ESPA 4PWHA 2GFBA 4N85A 5I74C 1ACZA 1N90A 1EWHA 5JR1H 3MV8B 1NPJA 2JH2A 2PF6A 1ZRTD 4HJ0C 2NZ9D 4P23C 2IDCA 4GAFB 4OJFL 4LSVH 4L1SA 4NHCH 3MFGB 2HWZL 4QRTB 3WLWD 1XH2A 4YEEA 4FG0A 1WFTA 5EOQH 5JZ7C 1DN0A 1DQVA 4NRYA 4AEIH 4GBXA 3QNZA 5DJ0B 4NFCA 3NSYA 4JG9A 1IC5L 4TQPA 4UAOB 1MJ7H 3D4GA 4WK4B 4F3FA 4GI6A 5EWIL 4OCXH 4NQSA 5IB2A 4AUUA 5CS7A 1H5BC 3GMRA 4IRSC 4JAMB 2GEQA 2WLLA 3MRPA 3QPKA 1OW0A 1U3NA 3ZN6A 3PGCA 3RGBA 3UGUA 4CN6A 4P3DA 1WC7A 5GGUA 4Y2OA 1FAKT 4JHWL 1MDTA 1NMBH 4FQJH 3VFTB 3FBQA 1I5TA 1SOKA 2O6EA 5D7EA 5TGBB 2VC2B 3T2NL 3HC0A 2YZ1A 5DHVA 3US1A 1CDHA 4FQ1H 2YPLD 2BNRB 5F7WC 4YHYB 4Z7NF 2K6WA 4GRMA 2AQ2A 4EXKA 5FW7A 5IVXF 2WXNA 5E5UB 3QUXA 3ZL2A 3V4VA 4QXWA 1YY8A 3JXAA 1USZA 1H6EA 4FQ1L 5DK3A 1G9NH 1LM8V 1RHHB 3PHOA 4BQCA 4LSQH 2WXFA 4KVPA 2GEEA 1C6SA 1ML0A 1GH7A 1U3HD 2WTRB 3HHRB 4TLUA 1K5NA 5DD0H 1L9PA 5IK3A 2A74B 4XCEA 2DLIA 4OIIH 2BY2A 3OB0H 4EIEA 3B9KC 3P0YH 4A2MA 3HE6B 2M26A 4DZBB 1Q4NX 3GB7A 1G7HA 4XX1E 4NO3A 2WBXA 4LHUA 4FQXB 3GUTB 3MMEA 3UMNA 3E6FB 1JD9A 3RVXC 2LITA 3KS0J 4G9DA 4PP2B 3RVVD 1BIHA 4I9XA 4ZX4A 1NKGA 3KPOA 4OGQC 4QRRE 1VCBC 3MRJB 3NFSL 1XBRA 5E8NA 5ANMA 1O0VA 4YHMH 2DH3A 1U8JB 4B97A 1U74B 4W6YB 3W81A 5IBUG 4IHOA 3H55A 4NI3A 3FRUB 3FUIA 3FCTB 3HC3L 3QI9A 3FXIC 2BFGA 1QKSA 1SLXA 1JXFA 2HRHA 3JV6B 4OZHE 1QR1A 1F90H 1F0LA 2BY0A 2XTSA 3L4WA 4P4KC 5E2WH 1CFMA 4FNSA 1SOQA 4OCRL 2CHWA 4L8DB 1ZT7A 1F90L 3AXHA 3O9WD 3S35L 5IKCB 1OGPA 1T1ZB 4JO1L 2LTQC 1NGPH 5L7XL 3QBTB 4PRPB 1OXYA 1T03L 3BJ91 3WOVA 1I8MB 2BIPA 2O6CA 2FJGB 2P44B 1BBJB 3B9DA 4NC1C 3VFUB 4Z5RA 4GXVH 1U58A 3L1EA 2CWRA 4D9LL 4HK0B 5F1OB 1QEWA 4H8HA 1MLBB 4YBLC 3U0PB 4WUUE 1IEHA 3QJXA 1DQLH 3TT1H 4DKEL 1J1OH 1TTRA 4L4TD 2IMNA 4G7QB 2RR3A 2XT1B 3REVA 3IDUA 4KKLC 3VXMB 2BCCD 5ESAA 3IGLA 3ECQA 1I1FB 4ZX6A 3U0WH 5BRPA 2JQAA 1E6OL 5FFGA 4KK9D 3EHBB 1T7VA 3CFCH 3QARA 1J9QA 5I0DA 4AIZB 3IGAB 1TT6A 1F2QA 4IMKC 4KO9A 1JWMB 1M60A 1CFVL 4ZJ9A 4RMBA 3GRGA 2DL2A 2YK3A 5GIRA 2Q9OA 2GBAA 2KLTA 3S5YA 5L2KE 4Y16C 3V0AC 1E2ZA 4A7GA 2YOCA 1IIKA 1G6VK 5I1KH 3AT0A 4MU8A 4G1MB 3RGVC 3W3BA 4QXGH 5T3ZH 4APQB 4KX8A 3TPKA 4BZYA 3HC4L 3KEHA 3S2CA 4AQ8C 2PETA 1UADC 3R19A 4KVNL 4F37F 1ODAA 3TZVD 2DJMA 4HCFA 3QDMB 3BUQA 5JIQA 5KOVC 2RCSL 2W60A 1IBYA 4UT7H 2HVBA 2YKLL 3GBMH 5D1QC 1HL8A 1AR1C 1HI6B 4ZYKB 1BX2B 1OE3A 2AQTA 2XWJA 4E9TA 1HNGA 3FYEB 4ECNA 5D1ZD 2Y5QA 1WITA 3LIZL 5D4IA 3B2UD 3L1OH 3MO1A 2I07A 5C9KA 2J6EA 2G5BB 2AEOA 5F70A 4KHXL 3IMRA 1EXGA 1EO8L 4FQIL 4XAKE 4MXVE 4NPYB 5IB5A 3WMPA 4JM2F 4JDTL 5BS0A 3CMOL 1EDYA 3HLAA 25C8L 1CXEA 5AG8A 5BUGA 1OLLA 1DQJA 2XWBA 1QPXA 4NIYE 4F9PA 1BYPA 3ABKB 3BPNC 4FFZA 5I16A 2BIOA 1B0GA 3LS5L 3OZ9L 3RPIB 1OM3H 4M48L 3ASOB 3QJOA 1P6WA 3DI3B 2Z31D 3V6FA 4YSDA 4NUGH 1M7XA 5GJSL 4A68A 5HYJE 2ICEB 1DL7H 1FRGL 2F74A 5GTIV 2ZNWA 3VFMB 3CWGA 2ITDA 3VXMD 3KL5A 4XMPL 1GCYA 4MJ6A 2NT0A 2F19L 4AL8L 1OAXL 1NKOA 3G6AA 5CWSB 2UYLA 3IFLL 2OK0L 1RP8A 2LGNA 4WWKD 5IW6B 3KHQA 4YS4A 5CP7A 3KGTA 1CICC 2Y22A 3IMSA 5KS9A 3W37A 4HUNB 3HAEH 3OKOB 3SQBB 4MNHA 1OAXH 3VXQA 1WEJH 2EC9T 1ICTA 2YD7A 5L2JA 3AY4C 1J5DA 3P4NB 1AJ7H 2ATKB 2B3RA 2XNAA 3QYMA 2J1ZA 4U1GC 2Z31B 5BZDB 2YFNA 1ZAGA 2HJKA 3SO5A 1CRYA 4NKIH 4HBCL 1FDLL 1TF4A 1JIBA 3UMTA 2WWKT 4N25A 3I75B 2VMCA 3UH8A 1YQVH 2KS0A 4L1BA 5JW4Q 1AFVL 5ISZA 2IEPA 2X70B 4ZXBD 2ZKHH 4FFZL 1ZT1B 2YD5A 4MCMA 3OZKA 1KXTB 4R5VA 3VB9A 3DX3A 1QKZH 2XYCA 4HUWA 1DSWA 3HG4A 1ET5A 2ICWJ 5HYQA 4W9EC 4URTB 5F7DA 1WFNA 2CO7A 4F5CE 4EZKA 4JJ5B 2YHGA 3KPRD 2VLRB 4BCZA 4A7VA 2WANA 1A2SA 3C09C 4A2FA 3G6DH 1BFOB 5C08B 3UAJA 1BF5A 3H8NA 3AB0C 2F5BL 4F57L 2Y5TB 2Y36L 2YFOA 4GUPA 4BFJA 2VXSH 3BC9A 2CO6B 5HDBF 3ZE1B 4JKKA 5LWYH 3OTTA 1YAIA 5AVZB 4F37K 3LTVA 5CJ8A 4IJ3B 5AW8B 1WVEC 4XNXH 3CC5B 2ICES 1DP0A 1NCWH 4H5SB 3PWPB 2AJ3A 2P24B 4HPYH 2ADIA 3JWDL 3S34L 1KG0A 3T8VA 3G6JA 3GSOB 3IM1A 3CFNA 1DBAL 2JKIS 4OUOA 5EBLA 1ZHKA 4U1KB 3LKRB 2DJUA 3HC0B 3MLYH 5F1KC 1GGCH 1P53A 1XGYL 1SEQH 2AQ3A 1BMZA 5IHUL 4NQDE 4R26H 4AQ1B 5DVKA 2NOYA 1SQVD 4FFVC 4Q8BA 4M1GL 2E7LA 2F8OA 2ORBL 4AGLA 1JYNA 2CO6A 1QTPA 4G8EA 5J4MA 1E4KA 1YMMA 2A9CA 3L7EB 4U1NA 1R3HA 1RZKC 1GTFA 2B5IC 1MRFH 3NAAL 4ZOAA 4PB0L 3LZOA 1A0QL 1A7QH 3QNZB 4JGUA 1PIFA 4YE4H 3ZBMA 4XN4A 4XBEL 4LCIL 4PRPD 4XVTL 3I75A 2Z8VC 3N1FC 3AGVA 2H5UA 5ILTH 5LCVA 3VJ6B 5ITFB 5JPNA 5IHZA 5BJTB 4OLVL 4ZK8A 1N7ML 1FH2A 3DVGB 3I02B 1FL3A 4HIHA 1S6VB 4W9KC 5PCYA 2VN4A 2JI1A 4O2CA 1HDMA 3QFJA 2O61A 1T3FB 2ZSWB 2XCMC 3BKMH 2EKSB 4H8QA 4PCYA 4YLCA 5I1HL 5JMOC 1OGSA 5D7IA 4ZTOL 2YIUB 1MY7A 1L9JC 2AABL 2YRBA 3FOLA 4HCRA 1YPZA 3IAPA 4B60A 5BOPA 1UD3A 4YSQA 3LYRA 3C6LC 4JRXB 3C75A 1I55A 3T04D 2G5UA 4PJGF 3JWNE 2H3XC 2VSCA 3MLRH 5CICB 4YSTA 3RN1A 1MHPH 5CIGB 1IBGH 3WV0A 2CK2A 5AG9A 2OK0H 2ZWLT 2EIJB 5LG1A 5C07B 4KQ4L 3D33A 5AYUL 3UTSA 5DQ9B 5I75C 2CLRB 4ZFOA 1YEEL 1AD0B 4GT0A 4IOFD 5TDNB 1LL1A 2WBJC 2IQ9H 1F11B 1DBML 1JFQL 4QRUB 3V6OC 5JTWA 3VFNA 1TVBB 4FXKC 1YEEH 5T5FL 1NIBA 3CVDA 2Q3XA 4G8FA 4NPYA 2CM5A 2FZ3A 4NZDA 2WVVB 4FLOA 3MSPA 4Y16D 4WHDA 3N2JA 5I16B 1V7NH 4TULL 4Q9CA 4WY7H 2ZONA 1RIHH 5KAFV 1NAMB 3WDIA 4YHLL 5SWZB 5AW2B 2DS4A 4NX0A 4AQZA 2NTFB 4O51B 1TJHH 2XYBA 4V2KA 2EE9A 4WI3A 3DARA 2EO1A 3P30L 4J3VA 3T9WA 3FO9A 5DRNA 3X1NA 4XPGH 1LE5B 4ANWA 3N6YA 1GJIA 4L3ED 3WNPA 2HX7A 4TUOA 1OHQA 3S0PA 1W91A 3AFLA 5AVYB 3F01A 1KIPB 1AO7D 4HJUA 4TN9A 5E1AB 5B3SB 4APQA 4MFHA 1F1CA 4NQDD 2JQZA 5AZEL 5J3HC 3TTSA 4XMUA 5HYJB 1WF5A 3ARDB 4F1ZA 2HFEB 1HKLL 3EYQD 5HHXH 3UROR 3TIEA 3WXWH 2NR6A 3AROA 1V10A 4FZEH 3AAZB 4NN7B 4NO0B 2FBJL 5I9QC 1KXHA 4JO4L 3D0VB 3K5SA 4Z7VE 1JHKH 2AI0L 5JIKA 5T33H 1VGKB 1HZVA 4FA4A 5T5FA 4D3CL 5E0QA 4J27A 1FOCA 1HNYA 5FYLH 5IQMA 1JYWA 2J6EH 1T4WA 4HJIA 3WAKA 5EBMA 3AJ7A 3ZT5A 2Y3AA 5DJ2B 2HFTA 2X28A 2APWA 4AL8H 1W16A 1ZY9A 3PY9A 2HFEA 4LL4A 2OAAA 2EDDA 2XSKA 5LQBL 2J3SA 1WDAA 2APXA 3EJTA 1PZCA 4XI5C 4EDWH 3V4PA 1GZHC 3LEXB 4WCYH 3RWJA 1OK0A 3LQMA 1FVCB 1DBAH 3CFJB 3SDAA 1FYTE 1CGWA 1QWUA 5E23A 4H0HB 3IFPA 4P5RA 1NTZD 4ONGL 2QVFB 4OFYA 4RIRA 1RU9H 3ARFD 5ESAB 5EIIG 2WP3T 1QABA 1MWOA 2Q7NA 3DRQB 5FIEA 5IJDC 3WJJC 3WKMH 1TLMA 2YPVH 5DMGD 1AG0A 1HINL 1QEWB 2X3CA 3KYKL 1XGPA 4FXGB 4KDTC 4E41E 1HSBA 1MCBA 2Q3ZA 1G7JB 2G9HA 1HDMB 3L81A 3QFJB 5ELIA 1MCDA 4CU7A 1M57B 3TIDA 5KVFH 4QRQB 2KDYA 3HN8A 5DJDB 5E1IA 2VLKE 3CBKB 5C08E 1HE7A 4KBPA 4XNMA 1WZAA 2MQ0A 1COBA 5DO2D 3T6VA 5JOFB 2C9SA 5DJ0A 2EDHA 5D2LA 3ZGHA 1DQDL 2BOLA 2ESVD 3BZ4B 3CSTA 4JG0H 1VGEH 3SE4C 4EN3B 1J0YA 3LKOA 3FU7B 3D9AL 1IM9B 3GMOB 3GEWB 1EJOL 4MMZA 1EDQA 2XXFA 3G08B 3IS0X 3PWPE 5AAMA 2G2NA 5IBTH 3NRPA 1F4AA 3M86A 4GKNA 5ISZD 5IHBA 3NZHL 3D2UA 4HS8L 4RFNC 5F3BB 5JPMA 3VD9A 3MROA 4Y9BA 5JDSA 4DP1X 1HK6A 4LDEB 3SY6A 2XV6B 43C9A 3F84A 3FT3B 3MRRA 1IL1B 5D5MF 3WY4A 2C1VA 2Y7LA 5BO1L 4FA9A 2QJDA 1DBBL 3N1QC 4FCAA 3ZW3A 3KPMB 4LLVB 1ZRUA 3JWNC 2CLZB 1ZA3A 3TN0C 4BH8B 5L2KA 4NKOB 1YFCA 3VSVA 5DD3L 2ZD0A 5F9JB 4Y5XA 2CBTA 2QQNL 4AVHA 4UT9A 3ZDXF 5HVHC 1PDKA 4ZOEA 3VNWA 4ISVA 3H42L 4P5KA 3RNKB 3VD2A 2FJHA 4KDWA 3QYNA 3HIZA 4CVXB 5ABZA 1J0KA 1YEDB 3OKEA 4JFUA 3WJMB 2GHZA 5AB9A 5E5RB 4GS7B 2EUVA 1ZA6A 4NZ8A 2QADB 3IFNL 2J5LB 5AAWC 3HAEB 4GMTL 4LDOB 2FO8A 3UABA 6CGTA 1K8DB 1FYHB 4C8XA 4Z7OB 1XD0A 1KXTA 5AVVB 2V37A 3S5LA 1HAUA 4QF1A 3GXPA 5D5MA 3CZNA 4KFZC 2VKWA 3INOA 2PLTA 4K9EH 4M7JH 4M8QB 4ORGA 1PDKB 4MAUH 4WSJA 1L9TA 4LQFH 5DD6B 3UTZA 5HYSB 3VTMA 1OGAD 2VOTA 3M1CA 2JKSA 1BFVH 3WEXA 4P5TA 4YQXH 3O81A 2J4WL 1MCPH 4TF4A 1E9PB 3FW6A 1U3JA 4DKDC 1U92B 3RHWK 1CFSA 4E41B 3FQWA 2C8NA 2EXTA 3BUIA 4EI5B 5FYJH 1A4JB 5AKTA 1AC0A 4R97C 3F64A 1K72A 1LK2B 1MNNA 4R8WH 1P4BL 1BREA 3AREB 4G8AC 2VDMB 4HFUL 5JXEA 1TSRA 3W1ZA 1JVKA 2NNXA 2ZX5A 3W0WA 4MJ6B 5IQLA 1I7UA 4WF7A 4G6ML 3VDCA 4Q97A 4X4KA 2VW6A