2YQBA

Structure of p93a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.4 a resolution
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
454
structure length
454
Chain Sequence
KLPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKMAHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
total genus 148
structure length 454
sequence length 454
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2yqbA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yqbA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yqbA02
3OMIB 1DIQC 1GDVA 2AVFA 1DW1A 2X87A 1QKSA 4A2FA 1KDJA 2ZONA 2ZBOA 1SDDA 2I85A 1COTA 2V08A 3L73D 2GSMB 5AURA 1OCCB 4HAKA 3CX5W 2QDWA 4AI7A 1PLBA 1GJQA 2BZ7A 2XV3A 1AKKA 2JXMA 2CXBA 3FT0A 3OM3B 4E9YA 1JXFA 4U3FD 1B3IA 2C1VA 1WS8A 4YVUA 3DIVA 1YTCA 3KW7A 2JFCA 3OMNB 1OV8A 1NMIA 4WQBA 1AG6A 1MG3C 1CIGA 3L4OA 4A2GA 1A4BA 2PCCB 1CRHA 3N2JA 3OQRA 1BQRA 4P5RA 1ZV2A 1NWOA 3WKPA 4FANA 3FPYA 4E9VA 1IZL0 3PAUA 1E2RA 4XYDB 2PACA 1OCZB 2GI0A 4ENZA 2PLTA 2YXVA 1CIHA 1KBWA 5CIGB 1OE3A 2IWEA 1I6DA 4KO5A 4DPAX 1YEBA 1U74B 1C6SA 4Q8BA 2J55A 6PAZA 4ZK8A 1FI9A 1SQQD 2FQEA 3UABA 5D4JA 1JVLA 2XXGA 4DP2X 3FYEB 2D0WA 1B7VA 2VMJA 3PH2B 1NICA 2XLLA 4BXSV 3WFCC 2HX8A 3ASNB 3ASOB 3OD3A 5DJQB 1GS7A 1RAQA 3RLMA 2BW4A 1BEXA 2FQDA 2VM3A 1TEGA 1V55B 3T6XA 1C7MA 1OCRB 5B3SB 1XB6A 1QL3A 1RZPA 3VNWA 2AXTV 2B10B 3L4MA 5E79V 1CTYA 2IWKA 3OCDB 2DYRB 2BP8A 3AZUA 5FC9A 1H33A 1U75B 3A0HV 1N50A 2ZZS1 1PNCA 2VSKB 1OE1A 2VW4A 4DP7X 2FQFA 1AOFA 2R7EA 4GYBA 4BK5C 3H56A 1EHKB 4E9XA 2CA4B 1GQ1A 5E9NA 5I6KA 2B11B 3DR0A 3IBOA 2FYUD 1SQPD 4XXLA 4WQ8A 1GIWA 2UXFA 4F7KA 1FA4A 4HALA 1I55A 3CVCA 4TXVB 1M60A 1JZIA 1BXUA 2NRDA 4WTQA 4YSQA 3PCYA 3X2QB 3ABMB 3T9WA 1ILUA 1L9RA 2H47C 4AAMA 1ET8A 3HQ7A 4KNUA 2FYNB 4J20A 3EF4A 1ETPA 1AZRA 3WNIA 1H32A 4E9RA 1PNDA 1KYOD 4A68A 2N3BA 1LS9A 1PZBA 3WUIA 2YAEA 2C8SA 2CE1A 1I8OA 1M70A 2MHMA 1BQ5A 1JXGA 2ZONG 3ABLB 4AKOA 4DP4X 2FWLA 1L9OA 1C52A 3PLYA 3PXSA 1CRCA 1AYGA 4KMGA 4N8UA 2XX1A 4PW9B 2GC7C 1AOZA 2DWTA 2HRGA 3CVDA 4WQ7A 1X9RA 3CVBA 3H1LD 1CXAA 1HRCA 1ASQA 4D6TD 1TKWA 2GIMA 2P80A 2PP7A 3FSVA 3PPSA 2CBPA 3PXLA 4DP6X 1AQ8A 1I5TA 5I6MA 4NAJA 1ZIAA 2TSAA 3NJFA 2BP0A 3FSAA 4JHUA 1JERA 2FT8A 3HEIB 4DY9A 1CURA 1CRGA 1HAUA 1QL4A 3O5CA 1NNOA 1J9TA 1NPJA 4DP0X 2HZHA 2YXWA 1A8ZA 3QJRB 1MZYA 8PAZA 2IDFA 4HHGA 2JKWA 3L45A 5CICB 3SBRA 3FU7A 4KO6A 5I26A 1L9TA 1V10A 1MZ4A 3KZIV 3SXTA 2AI5A 2FJSA 2P80D 4A2EA 2VN3A 5ANHA 4E9QA 2N18C 3FQYA 1IC0A 1E65A 2H3XC 3CXHD 1IBZA 3HB3B 3QJTB 3D12B 5I5IA 2B3IA 3X1EA 5I6OA 3DP5A 4LJIA 4AALA 1HZVA 1FHBA 3NJIA 4JHVA 2GC7D 1V54B 3ZIYA 3ERXA 4HCGA 2DV6A 1CCHA 1PPJD 1GW0A 2ZWNA 4QAOA 1FWXA 2E86A 3CDZB 4PCYA 4DP5X 4WQDA 1CSXA 2BWDA 5KAIV 3EH4B 2W88A 3S8FB 4GP8B 3UACA 3ZOWA 1T5KA 7PAZA 1K3HA 1S6VB 1DVHA 2XTSB 3JT2A 3PXTA 1ASOA 3NSYA 3JTBA 2XV0A 1H31B 4IL6V 3VYMA 5B7FA 3H1KD 1KBVA 4HIPA 1YCCA 2BH4X 1N68A 2BPBB 3SBPA 1CHJA 2C1DA 4FAVA 4EF3A 2QT6A 5TK2A 3FU8A 1ID2A 1TU2A 1OAEA 1BXVA 1AS6A 4DP8X 2B0ZB 3OA8A 3BCCD 3L70D 1RCYA 2EIKB 4RH4A 1KB9D 3L72D 3TA4D 4DPBX 3NJKA 4MFHA 1KDIA 1X9UA 2UX7A 2Y69B 4PJ0V 1NTMD 5B1JC 1IRVA 1KYOW 2PPFA 4EIFA 4V2KA 4K3IA 3EH3B 4AAOA 3MBWB 3O1YA 1CUOA 2B4ZA 2B08A 5AZUA 2WO2B 3ABKB 6PCYA 3MK7B 3AW5A 1J9SA 2PPCA 1PZCA 1HJ5A 3BVDB 3UGEA 2I8FA 1SDDB 1HROA 5TISV 3FYIB 3PAZA 4KNTA 1WAEA 2UXTA 5B1JA 3FSZA 1ZIBA 1VYDA 2YCCA 1GU2A 1KX7A 2Q9OA 2IWFA 4GY4A 5B1KA 4EICA 1LC2A 2YIUB 2YARA 3NSDA 1AZBA 3PAVA 3IN0A 4GXFA 1GR7A 2YK3A 2CALA 5B7MA 3CG8A 2J5WA 1NIFA 3NSFA 4N4YB 1W6WA 4YL4A 1AS7A 2AANA 2RACA 1AACA 4KNSA 1KYAA 5I5MA 1RZ5A 1EZLA 2Y1AA 1DT1A 2HLEB 3T6VA 1H9YA 1HJ4A 3OCDA 3T71A 3UAAA 351CA 1MG3D 2HV4A 4W1TA 4YSOA 4E9SA 3WC8A 3QJSB 4NERA 1XB3A 2DVHA 1L9PA 1BE3D 2QJPB 1BQKA 1BCCD 1MZZA 3GYRA 1K3GA 3HQ6A 1J5CA 1RZ6A 3CXHW 4H0JA 2OZ1B 5C0ZA 4JCGA 5D4HA 1PZAA 1J9QA 3GDCA 4KO7A 4HZ1A 3H4FA 4A2HA 2VW7A 2OV0A 1E5YA 1M57B 2PCFA 3NP4A 2WO3B 5EXQA 5B66V 2YAHA 4G7QB 1KV9A 1NTZD 2WSDA 3H4HA 4P5SA 4HHWA 1NMLA 2DYSB 2VW6A 3X1BA 2BP8B 2C1UA 1PP9D 3SVWA 1A3ZA 2GHZA 1CC5A 3AG4B 2GIWA 2BGVX 5DF5A 1RAPA 1KIBA 1CCRA 1YLBB 2R7EB 2XU9A 2CUAA 1ZRTD 1OF0A 451CA 5F7BA 1YIQA 1HJ3A 1CORA 1UATA 2PPAA 3FS9A 4K9JA 2N9IA 1QLEB 2VSMB 4KO9A 3A9FA 3X39A 1GKSA 1BXAA 1NIAA 1MG2C 1NTDA 1WA2X 2IDSA 2IH8A 1C2RA 2L4DA 3WI9A 5EHFA 1CRIA 2DGEA 3NBSA 2N9JA 3MX0B 5B1AB 5CIBB 2IDTA 1KX2A 1W2LA 1PMYA 1GS8A 1QNIA 1HFUA 1GS6X 3OMAB 4YVNA 1BAWA 3NJNA 1JZGA 4GP4B 2LIRA 1E8EA 1PF3A 2BCCD 4O1QA 2AZAA 5GTHV 1RKRA 2QPDB 3BQVA 3H1HD 3SLEA 4BWTA 3HQ8A 4DP9X 1FOCA 1NIDA 4DPCX 1AR1B 1CRYA 2GB8B 1URIA 2XX0A 3N55A 1SNRA 3X1NA 4AKPA 3NP3A 1A8CA 1L9SA 3ZCFA 2ZXWB 1WVEC 3GXUB 4YSCA 4WQ9A 3NJGA 1NIEA 3CU4A 5B6QA 5CIHB 3QJQB 5I5JA 5PCYA 1I8PA 2OJ1A 4GEDB 5KKZB 3QJVB 2BZCA 1MG2D 1H9XA 1N15A 3AG3B 1GYCA 2BP0B 1C2NA 1BYOA 2CAKA 3CZUB 1NIRA 2BWIA 1QHQA 2I7OA 3FQ2A 1ET7A 4UB8V 3CDZA 2IDQA 4QLWA 3RN0A 1CYXA 1PCSA 3DTUB 1NTKD 1DIIC 1BGYD 5I6PA 3WG7B 4FA7B 1H1OA 2DWSA 2IDUA 2B12B 3C2CA 4F2EA 3T6WA 4E9TA 1SF3A 2EIMB 1J5DA 4Q89A 2YAFA 4AX3A 3ZX1A 4YSSA 2N3YA 2CE0A 4PD4D 1CEDA 1IBYA 2BW5A 3A0BV 4NFGB 4FB1A 1KGYE 1IKOP 1R0QA 4M3HA 3UAEA 3V9CA 1KB0A 5TK4A 3HQ9A 4AKQA 4BDVB 1CSVA 3ZOXA 2PCYA 2BHFA 1HAWA 4G72B 3M97X 4WQCA 2GC4C 3UADA 1EZVD 1L9QA 1A56A 4MU8A 3IE9A 3QJUB 1IUZA 4L3HA 4YSPA 3ZBMA 3TBCA 4UB6V 1L0ND 4A66A 4L1QA 1ZZHA 2I7SA 4CSZA 2GBAA 1YNRA 3O20A 2PP8A 2MTAC 3H1JD 4FA4A 1A4AA 1KCBA 3ZOOA 3EH5B 3WKQA 5B5EV 5CYTR 4X4KA 4PAZA 2VM4A 1IRWA 1CIEA 1CYCA 3FU9A 2EINB 1DZ0A 1CXCA 2H5UA 2XVBA 4F2FA 2PPDA 4DP1X 3AG1B 2XWZA 1FI3A 1DVVA 1CIFA 1CNOA 1S5LV 5DJQC 4AANA 2XXFA 3KW8A 1SHWA 2XUWA 2V07A 2C1DB 3VRDA 4EIDA 4AZUA 1SFHA 1YFCA 1AAJA 2MTAA 5I6NA 3JBTB 2A3TA 2PCBB 1L9JC 1ZDQA 3TYIA 3C75A 3T6ZA 3RN1A 1F56A 5I28A 2X88A 3FPXA 1LC1A 1WEJF 2VHDA 3H1ID 3OA8B 1AZUA 1GY1A 1SFDA 1XMEB 4KOCA 4W9ZA 1ET5A 2BO0A 5CIFB 1L0LD 1AOQA 2GC4D 4L0PB 3AG2B 1SQXD 4WKXA 1CHHA 1F1CA 1LMSA 1P84D 1FFTB 4GP5B 3SWSA 1NIBA 5I6LA 3G5WA 4Q5PA 1ASPA 4G7RB 2DY2A 1YICA 2YQBA 1WS7A 2QJKB 4HCFA 1E67A 1CSUA 3SBQA 1GSKA 2C9XB 1VLXA 3NT0A 5F7AA 1CYJA 1N9CA 1N70A 2ZXYA 1NPNA 2FTAA 2YAQA 3ABGA 2YAPA 1NWPA 5KAFV 3NJHA 5IY51 1PLCA 1AIZA 1NU1D 3CWBD 1AANA 2OZ1A 2A06D 4YSUA 1HZUA 1CO6A 4PWAA 5KLIB 1TEFA 2FQGA 4FAAB 2OCCB 3X1GA 2ORLA 2QDVA 1E5ZA 1PLAA 1J3SA 4FA5A 1RZQA 1KV7A 1PAZA 1CYIA 4GYDA 1QYZA 3PXWA 3S8GB 4EIEA 4YE1A 4UANA 1M56B 4N0KA 1HCMA 2QJYB 4NB7A 2HXAA 1FCDC 2PPEA 1JXDA 1YEAA 2D0SA 2J57A 1ZPUA 3X1FA 4FA9A 3WU2V 1H33B 1W8EA 4G70B 3NJLA 1EB7A 3DMIA 1J9RA 5A7EA 3ZOYA 2CCWA 2PP9A 1C6OA 1OCDA 3RMZA 1SF5A 5IY5B 1DW3A 4BWUA 5LDUA 4FA1A 4Y5RA 1DW0A 1A4CA 2JTIB 1I53A 1SJMA 3CX5D 5C9MA 1WA0X 2AFNA 1C75A 1M9WA 5B7EA 4E9WA 1N90A 1SHXA 2TSBA 2EIJB 3EHBB 3ORVA 3NBTA 2N0MA 4A67A 1CC3A 4M4RB 1W5CT 4L3GA 4YSRA 2XYBA 3NJMA 1ILSA 4BWWA 3TGUD 1F1FA 2AIUA 3FQ1A 3S3DB 1C6RA 3L75D 5H2FV 1OCOB 3TBBA 3WFBC 1H32B 2QPEB 2J56A 3SQRA 1CRJA 2FRCA 1A2SA 1A65A 5GTIV 1OOWA 1NZRA 3L74D 1CTZA 4WQEA 2FWLB 2MRYA 2EILB 3DKHA 2FT6A 5AKRA 3S3BB 2BCNB 3S3CB 1ADWA 2LITA 3CP5A 1JZFA 3WIAA 2EXVA 1W6LA 2BH5X 2HX9A 4UAHA 1KCWA 4WQAA 1AZCA 2HRHA 2ZOOA 4YSEA 5KLVD 4G7SB 1ZDSA 1JZEA 1CHIA 3O0RC 2UXVA 2CA3B 3IN2A 155CA 3IEAA 1E29A 1JZJA 1QN2A 2JQRA 1DW2A 1BL9A 3NJJA 1LFMA 1E30A 2FNWA 4KOBA 4HCIA 1R1CA 3FSWA 5AFAA 1JVOA 1M6ZA 2BLFB 2XV2A 2UXGA 3FU7B 4JKNA 2FT7A 3V9EA 2UX6A 5CIEB 2HX7A 4G71B 2YAMA 2IBZD 1MDAA 4P4QB 2LLNA 2GB2A 1FJ0A 1H31A 4RSZA 2W8CA 5DFSA 3QPKA 4YSAA 3L71D 1NINA 1CTJA 1SQBD 3CYTI 2IAAC 1BYPA 3NSCA 4UF7C 3WFDC 1DYZA 1JDLA 1ETJA 2AZUA 4BDVA 3NYKA 4YSTA 3TASA 5D4IA 1WA1X 2C2CA 1CYWA 3WFEC 4YSDA 1IO3A 1AS8A 1JZHA 4H0KA 4A2DA 2YAOA 3SJLA 1AG0A 1HH7A 2N18B 5CIDB 1XB8A 3WNJA 3MK7C 4CSPA 3AY2A 1NDTA 1L9BC 1JOIA 2CJ3A 3TU6A 2IH9A 4O1WA 3QQXA 4QKTA 1SQVD 4BXVA 2Q5BA 1GY2A 5PAZA 5B1BB 3U25A 7PCYA 1IQCA 1CSWA 1PY0A 1OE2A 9PCYA 1I6EA 3ZDWA 1AZNA 1FI7A 3NWVA 3RYMA 1I54A
chains in the Genus database with same CATH superfamily
4Z95H 4JHWL 1MCBA 5E9DA 4E42A 1QABA 4EI5D 5J1AB 1MHCA 5AKSA 3VYPA 5FW6A 5M94B 1SDDA 2WD0A 2O61B 3D4YA 3QIBB 1HHJA 3LMJH 4JDTL 4MWFB 4F24A 1JHTB 3GIZL 4IOFC 5DHEA 2AJUH 2BHUA 4X6BA 4DUXA 3GHEH 1B3IA 1NANI 3KYMB 3OKYA 4I9WE 4AXWA 4IOSA 1RUAH 1YTCA 2Z93A 3L16A 4OF6A 4M5YH 3QUZB 3VXUA 4PJAE 4O2CB 4YFEA 2X05A 4CVZA 4NUPA 4X5PA 2CO1A 5E99H 4FXKA 1KLFA 3UYPB 1BVZA 1F3JB 3PJSA 3Q06A 1V3MA 1CFTA 2P24B 5D7IA 1SBSH 1OCZB 2PACA 4QHKI 1FL3A 4Q52A 4LDOB 3QJFB 1FNHA 1SEBA 3BEWB 3QUYB 4QHKJ 4WY7L 3JZYA 3REVB 4ZMYA 1AMXA 4H13C 5F3FA 5HJ3B 1ZV9A 3WO4C 3IMUA 2D0WA 5EN3A 3BVXA 1E4JA 2YZ1A 4NRYA 5ALBL 2VLRD 2ZCLL 3UTTD 2JI1A 3EO9H 4JO5A 1EJFA 1DJHA 3P4NB 2O4EA 2ZCHH 1HZKA 2AXJA 3NTCH 5FCSH 4EN3C 3BVUA 3PHQB 4UINH 4ELMB 2WYHA 4O9HL 1N50A 4NGHH 1NFDE 4PS4H 5GRVL 3CWGA 4BK5C 5HXMA 5I6KA 3Q3GB 2BSSA 2R69H 5T3XH 1FNLA 1A3QA 1G6RH 3GO1H 1AYRA 1O7SA 2BP5M 2QKIB 4G3YH 4PJBA 4WTQA 5F89B 3LEYL 2FB4H 2XVLA 2A1WL 1WD8A 2ZCZA 4GIAA 3SY0B 4L4VD 5JIDA 3SCMC 4YX2H 2CJUH 4L9DA 1AI1H 5E2WH 5GGTA 1V3LA 1CXFA 2FWLA 4QDGA 5IQ7H 1E5AA 4Q9RH 1HESA 3O3DA 3MRHA 1YEFH 3KPLA 1CL7I 3O4LD 3H1LD 1KUMA 2EIZB 4QOKD 5I1HL 2P80A 3A67L 5A2LH 3PPSA 5ACMA 1JPFA 4KH9A 4E9VA 2DH3A 2D7QA 4NAJA 2KI6A 1XF2A 4YXKL 2XN9A 5IT2H 3WTVA 1KLUB 2E46A 2YD2A 1D7FA 2E0PA 1WCQA 2HTKC 1QFPA 1IBFA 4L0ZA 1A4JB 3AM8A 4JCMA 4NO2A 4A2EA 1IC0A 4ZD3L 3IAGC 4APQC 3QJTB 3C08H 1UACH 1ZHLA 3HAEB 5JR1H 2JCCA 3IJSA 4H8QA 5DEZA 3NFSL 1V54B 2A6KB 5BVPH 2SEBA 3ALXA 3EGXA 1IC4L 1FNSL 4UTBH 5IFHH 1SDYA 4YBQD 1KC5H 4PCYA 3EH4B 4GP8B 2X6CA 3GK8L 3QIBC 2P7TA 3PXTA 2VE6A 5A16A 2XPGA 1PTZA 4KC3B 3WL9A 5JPNB 5SX5H 2C3GA 4K5OA 4Q14A 5ACZB 1J86A 2R0ZH 5EFIB 2D8KA 2DKUA 4XMTA 2VTFA 1RZGB 3QUZC 2QGCA 3LRKA 1XR9A 3VXQB 1Z3GH 4WO4C 3EDFA 2EYRB 4QWWC 4D2NA 1ZSDB 4OF8A 3S96B 1YY8A 4YC2B 4HCRA 3FOLB 1U3YA 3GRGA 3VI3E 3IU4L 1LJMA 1VFUA 4F8PA 2YA1A 4LPXA 3BCCD 3BSHA 4N5ED 4P2RB 3SHSA 3L72D 2R29A 1SJEB 4H40A 2HMID 4P5KA 3RVUD 4YJZL 5I15H 3GMOA 3NQIA 4KKPA 5EO1B 3CSTA 5KYNA 2F7OA 4AGNA 3FHQA 3ZY7A 3ARDD 4R4BA 1YRKA 1ES0A 1KJ2B 1UOVA 3NPSB 4MAUL 5LJYH 3KBEA 3AFLA 4R9HA 3BUPA 3WTUA 1NMBH 1U21A 1WAEA 2FSEA 5CP7A 1S5IH 2WQVA 1ZA6A 3UZEC 1DQDH 4MRBA 2NX5B 5HVHC 3QJOA 5SX4H 4XNBA 5F1OB 3SPVB 4E5XA 3CCHB 4NQVA 3ROLA 1RUKL 2W60A 2HVKA 4XPFH 4YFDB 1IAIL 4N8VA 2WVUA 2KERA 1KYAA 2HYMA 2HLEB 1K3ZA 1KNOA 3MRBA 5I71B 5D5MF 4XCEB 2QKIC 1JGVL 4KVNH 5IB1B 1IMHC 3T8MA 1WWAX 1BBJB 1ZTXH 4YDKH 4XH2B 3FTUA 4QRRE 4KKAD 4L8BB 2BNUB 3TN0D 1E42A 2X89A 3VWJB 1XF1A 4PJXB 4K4KA 3D9AH 5GGRY 3LNHA 3ZKNC 1BLIA 1BZ9B 1NGPH 2EE2A 4JRXA 5DK0B 4Z7NB 2WBWB 5JUEL 1Y1DA 3Q2NA 1QSEA 4GAJL 1H15B 1ZWIA 4JANA 1NMLA 3HBPA 3VFUB 2PYED 4IRJB 4X99A 3T6QC 1QX1A 3G5VB 2FBOJ 2XU9A 1K5NA 3RGBA 4XI5C 5IF0A 5CIPH 1PPIA 4LEBA 2YPLE 4OZ4A 1I1CA 4JZJB 4AM0Q 2CRIA 1R24B 4KHXH 1MHEB 4POZD 2VN7A 1DFBL 1JYWA 4N26A 1FFPB 1P1ZA 2F61A 4MNQA 5E00B 1KX2A 3IFNH 4N0UA 3BPNB 1FZOB 2R0LH 3H2QA 4IM8A 1ITBB 1GS6X 3LIZA 3QUKB 3NJNA 4H25A 1WC7A 2JF1A 4FQXC 5CP3H 4R84A 3FUHA 2HKHL 1HWGB 4CW1A 3BQVA 4Y7OC 4QY8B 4H8PA 1RI8A 2A83A 3L3OB 1N6QH 1EFXB 3JBG7 1OGAB 4QRBA 1SMAA 1FFQA 1F02I 4WQ9A 3UDWC 2OMUA 5HI3C 2IBBA 4Y2NA 2V8MA 3BRGC 1S9WB 5JORA 5JPNC 4L4JA 3CZUB 1DUYA 3WMQA 4R7LA 2FWUA 1M53A 1UVQA 3BAJA 5L8JB 1RUAL 1BZ7A 3EO1A 4XCCL 1E3XA 4OFYA 2XCMC 4M5YL 5HYJB 3HBGA 3TO4A 2VXVH 3BZFA 3K5SA 3RPKA 5E99L 1AD0A 4YC2C 1SBSL 5F9WC 2R4RH 3G6JA 2OMBA 1CN4A 4YHKH 1MCOH 4PQXA 2F5AH 2E7HA 3U2SB 2X4QA 3OHXC 1NKOA 2COVD 4WHDA 3TBSB 4PUBH 3MNWB 4BFJA 5CJXA 2O5ZH 1FJ1B 4X50A 2NY6D 3ZOXA 1FNEB 5IBTL 1BVOA 3WIFA 2VDRL 2GC4C 4GNKB 3HNTH 5HHVH 2X70A 4XE5B 2UUDH 2K8MA 3ZBMA 3UTSE 3EO9L 3RU8H 2OQJB 1DJZA 4L1QA 1DP0A 3MFGB 3OGCA 3Q13A 3FU3A 1BD2E 1Y6NR 1QBLL 1DQQA 2KDGA 1CGWA 3NTCL 3RDTD 4UINL 1IRWA 1TTBA 3FU9A 5FUOH 3MRFA 1ZHNA 4F2MB 5JHDB 3ARFA 3TTYA 3MRQB 1S5LV 5F7HA 3TEWA 3D52A 3KW8A 3OKLA 2R69L 2HN7B 3PWNB 5GGVH 5T3XL 2OMYA 3BPCA 3T6ZA 4G11A 3H7LA 2GK2A 2BIOA 4D9QE 5I71C 1G6RL 5T1LA 3QQ4A 4WW2B 3H55A 3IYLW 2BRQA 3PDDA 3QORC 1Q9KB 4J2QA 4PJ9A 1L0LD 4K7PH 1I82A 3C5SA 2PWHA 5EIIA 1JVKA 2BOCB 4JLRB 3TBWB 1IBGH 3CDGA 4JFEA 2IALB 1BF5A 4Q5PA 2W9DH 4YX2L 1I1FB 1NUDA 3JYCA 2PNDA 4HCFA 4MCYB 3V0WH 1AI1L 3BFOA 4WSGA 2F0CA 3BWUC 4ZAKD 3L5HA 5GRUL 2YAQA 3ABGA 5KAFV 5IY51 3VFGL 2LU3A 2VIRB 3PWJB 4NFBA 3O4OB 1YEFL 3F00A 4I13B 4MQXD 3MV9B 3MRGB 4JG1L 1F0LA 3NIGB 1DCEA 4IRJC 4L48A 4D9RE 4OFIA 4R96B 5HGAA 3SDDC 2IPKA 4DTGL 1GGTA 1PAZA 4NUGH 2DJSA 4XBPA 2P48B 1DJGA 3P4OB 1M56B 1RSYA 5IT2L 1BFOB 4XN1A 1JXDA 3F65A 2YGPA 1CWVA 3HN8A 3MV7A 1KV3A 2BSRA 4M1GL 4JO1H 1NAKH 1D9KD 5AW3B 1C6OA 3RPBA 1CK0L 1YECH 2QMJA 5MENB 3SQBB 5KW9H 1JUFA 1U8KA 3P9LB 4YNYA 1O7DC 1SOSA 3P2DA 2EO7A 4N2EA 5I24A 1A4CA 3C08L 1QRNB 4IU3A 3ULUH 1MCKA 4PW9A 2JMRA 1M9WA 4WI0B 5B7EA 1YUKB 5JR1L 1HCFX 3VNZA 4CILA 5BVPL 1LD9B 5LG6A 3NBTA 1ZT1B 1HU8A 4NAQA 5IFHL 2AQTA 4LEOB 4HF5L 3QCVL 1KC5L 4PR5B 1F1FA 2H2SD 2JB6A 3FQ1A 1C12A 3I50L 3MLYH 3P4MA 2X4SA 1FL6A 1A2SA 3GSUA 4RDQG 1XGPB 4L8DB 1VGKB 2DLTA 4QT5B 2QR0B 1JRHI 4OM0H 1U9KA 1IARB 3S34H 1RJCA 1ADWA 3I74A 5DVLA 3RVWD 1KWGA 3MKKA 3WIAA 5L9DH 1Z3GL 3S37L 1UJ3B 2FX7H 1HXMA 5EBWA 2HRHA 4ZUSB 1T3FA 1YMMA 5C0BB 5E5RB 1MIMH 3RUGA 3ZMNA 1L5GA 4XXWA 2Q2LA 1W2KT 2QQLH 1XWVA 4XAKD 1IGFL 4KOBA 5I15L 1ZLDA 3LN4A 3IMBA 1PDKB 2B9AA 3NIDB 3HB3D 3POCA 1F11B 3V52L 4N6RB 3DX1A 4L23A 3FB8A 1OO2A 1CVRA 5AEAA 3W9DB 4PRIB 5CJBA 2ATKA 4IMKC 4TLKA 4AGMA 3BVNA 2BVQB 4QCIB 3WN5A 1NMBL 4PJ5B 2DQEH 4ECNA 5GS0H 5CINH 1S5IL 1DQDL 1BAFH 5IMMB 3SGDH 2Z64C 1BQHA 1IKFL 2YAOA 1M2VA 4ZO6A 4XPFL 1Y1UA 1TPXB 3HLKA 3B7YA 2Q5BA 3BKCH 2OXHA 4NQQA 5ICZB 3MLSL 1I1RA 4HFWB 4G42A 3ZDWA 4WW2C 4PRPE 4FNLH 1DL7H 1BVKB 2DQGL 2ZTBA 4Z3JA 1OSPH 2VSDA 4A7GF 2P26A 4YDKL 4IBZA 4WU5B 5IMKA 5IR1B 4MAYC 4HAKA 5AURA 1JDCA 4MA8L 3FHEA 43CAA 3ME0B 4AQ8A 1DBBH 2LFEA 4TM9A 5AYTA 3CFIC 1GYAA 4E9YA 1UOKA 3D9AL 4HUMB 1OTSD 4C83B 5KSUA 1NGPL 1DN0B 1WS8A 4U1SB 1Z0NA 3SGEI 1ZLUK 2GUYA 5D1QD 3WFEH 4R7DA 4BCZA 3UTTE 4G9FB 3BDXA 3OJVC 1ZV2A 1PSKH 3IK2A 3FPYA 2CDGA 4JFDA 3PAUA 3DPBA 4C56A 4CBPA 5IB5A 1KTDA 2L7UA 3D39E 2WBJA 1XGRB 4JFZH 2XWJB 4Q8BA 2IBZX 4DGYL 2FZ3A 4QTHB 1QFWH 1AO7A 4KHXL 32C2B 1CG9A 4ANXA 3U0WH 3ARBC 5ALCH 1NCWH 1NICA 1N3NB 4R5TA 3SKOA 1EX0A 3IFNL 5D71H 3Q8AA 3GSVA 2VM3A 4MDIB 3PNWA 1G6RA 1UXSA 1GGIH 1EJOH 5C0GB 2UUDK 3GFUA 4P5MA 4RMUA 3A0HV 1SJHA 3U0PB 1PNCA 4DAGH 5BS0A 3FQXA 2FQFA 1V7ML 2R7EA 1N6QL 1EHKB 1VDGA 2ADGA 2ATPB 5TQ2H 5IZ7A 2NY4D 1SQPD 3T4AB 1WAPA 2AJVH 4BE6A 4HALA 3CVCA 1REIA 4FCHA 3O4LE 3V0VA 4S1RH 3APFA 2DMKA 1HN1A 1U8MB 1HL8A 4QOKE 2VDLL 3WFHA 2CGRH 1B4RA 1I1AB 2AXGA 4DVRL 5BNXD 1UJ3C 2PXYD 5KSBF 4X98A 3DHPA 1QHOA 3HBQA 1P9MA 4LBEA 1BQ5A 3ABLB 4OCLC 2R4RL 1EUTA 3W5MA 2XBZA 4YHKL 4KROD 5EIVA 5IQOA 5E8PA 4FQCH 4KKRA 1G9MC 2WXQA 2DBJA 1A6TA 4LHUD 2OR8A 1A9BA 4PUBL 1FH5H 3DPDA 4J3OH 4LFHD 4UT7H 1EEQA 3HVDA 2B2XL 1FFOA 3CDCA 4YO0A 4YHPB 2XG5A 3HNTL 4NKOB 5HHVL 4PJFB 1DDHA 1JERA 3IMVA 2DD8H 1HAUA 4N9GA 3RU8L 1NPJA 3DRTB 3HPLB 2ZG1A 3HRZA 3OB0K 4KZ0A 4EI6A 1R0AH 1D5MA 1CMOA 3ALPA 3HPJB 3M88A 3FAWA 1NC2A 4F8OA 4PRNA 4WHCA 1TZOA 3EYVA 5D72L 2AAVA 1MPAH 3U83A 4XNQB 5GXBB 5DS2A 2GSGB 2P4AB 2YBGA 3K0WA 4PP1D 1R3LA 4C59B 1O6SB 2V4LA 3HS0B 1TNMA 5IB4A 2XQYK 3EJSA 1OAYL 1QSFB 2CCVA 2ORBH 5FEBA 5IQ9B 3K6SB 4TNWF 1IBGL 3OVUB 4ZBJA 2W9DL 2QGDA 5K9JH 3UAJC 4XC3L 1QTSA 3RIFF 4IL6V 3CFQA 2CKBB 3H1KD 4OSUL 3SDXA 4K3JH 2EICA 2ZX5A 4WTZG 3ULVD 1G94A 5C97A 3T5WA 3FU8A 3MNMA 4QJ5B 1OVZA 2WLLA 4EQ2A 2APXA 1OAEA 2QSVA 5TDPA 4MXVE 2APBA 5SWSD 4DF9A 3PWVB 3OA8A 4NUGL 1JWUB 5FXCH 5AAWC 1PAMA 2WXKA 2APFA 3GEFA 5E5UB 3CFUA 5EC1A 5JTWA 5CLYA 1P4LA 4BJLA 1HHKA 1MVUA 2UX7A 4MX7A 5B1JC 1SVZA 3U48A 2RIKA 4KK6C 3MBWB 4AAOA 4JO1L 2C9XA 5KYYA 2B08A 3ABKB 2D2CC 3GMRB 4PPTA 3B6SB 3RL1B 2D3NA 2I8FA 4QEGA 1G5GA 3ULUL 4WHYG 3AWFA 1EBAA 2V37A 1EAPA 1QNZH 1ZIBA 4X7EC 5KJRL 4H88H 2WXIA 2YIUB 3AXLB 4WWKD 1T21B 5DJCB 5EU5A 1T66D 1R33A 3VVVA 1KIPA 4WI8A 2R1WA 1A6WH 4O02B 5D2NC 4J6RH 4MD5B 3MLYL 1MHPH 2LU4A 1TLKA 1ZK5A 1HSAB 2ZXBA 3S7GA 4PJAB 1E4XH 2P46B 2CR6A 3T6VA 1I7RA 4Q6YA 2CXKA 1XB3A 2NNCA 2PYEE 2WHVA 3F01A 3S34L 4ALAC 4ANVA 3LPGA 5FO8A 5AVZB 4F8LA 2FEDC 2WTPA 5D4HA 4UIMB 5T5NF 1PD1A 5L9DL 2WUCH 4A2HA 2FX7L 5I8CA 2KKQA 2VN5A 1IM3B 1Z9SA 4PJHF 1HNGA 1F5WA 2VXSL 2QBWA 3DDGA 1U42A 4KNQA 1MIML 4BK4A 5AKVA 4L8SA 4YOKA 2AXWA 2OTUA 1F4AA 2EDYA 4OCYL 4AY0A 4KRPB 1OB1A 2Q7NA 2ENQA 2O5NA 5DRWA 4NO3A 1T04A 4CN6A 1KIQB 3T3ME 1NFDB 1VEOA 3LQZA 3WUWA 4F5CE 3VRJA 1QLEB 2DQIH 2A38A 1WA2X 5HGBB 2W0LA 3MUZ1 5DZLA 1ZHBA 3E1ZA 4WI3A 2DQEL 5GS0L 5CINL 2DGEA 3NBSA 3PL6C 1GL4B 1BAFL 2GT9A 2WP3T 2OMTB 1QNIA 3O8XB 3LXBA 3OMAB 4XO4A 1JDAA 1E8EA 1WHOA 3O0RL 4Z5RB 3BKCL 4JZNB 3H1HD 1FAIH 3US0A 3PABB 2GB8B 2E9JA 1NGXB 2UZPA 3HS0C 1MY7A 2OLDA 3NP3A 3WUZA 1OSPL 4QHMA 1AJ7H 2YRZA 4FLRA 1E0OB 1QD0A 3WELA 1TKWB 2XN9D 3B7RL 1RJLB 1S78D 1DBBL 2WVTA 3D18A 3QBTB 2NYKA 1EFQA 1GYCA 5EEWA 4OZGF 5HDLA 5TJWK 3WBDA 3PPEA 5FGBC 3TEZA 3GSRB 1CLCA 4MJIA 3C60D 4RAUA 1BGYD 2ED7A 4OCXL 3WG7B 3WFEL 3BP6A 3TYGH 1RUPH 4WV1B 4DFIA 2ZXCA 1PSKL 5ETUA 1NLBH 3EFFA 4YEFA 3TA3B 2AXFB 4I9XA 4JFZL 3VTMA 1N4XH 5D7JB 3GGWA 5KYXB 1QFWL 3IGFA 1S7WA 3QDHA 4Z7WE 3C6LD 2GHWB 3U0WL 1IGMH 5ALCL 1NCWL 3M97X 5BV7C 2PR4H 1E50A 2H32H 3IE9A 2ZG3A 3N43B 4XNZB 4BRJA 5D71L 2X4UA 1DBAL 2ZXGA 1LP9B 1RZJC 4RGMC 5MEPB 4HFUH 3FZUC 3POHA 1YNRA 1GGIL 3DMMB 4I18C 2WTRB 1KCBA 1UGKA 2APSA 4U49A 2O6CA 4TUUA 2Y5TB 2H3NB 1N64H 3U4BH 1CIEA 4DAGL 5HHPA 2PPDA 4XTRD 3V4PL 4Y5VB 4I0PD 3UPRA 2OA9A 1SFHA 3D69A 1L9JC 2WZ5A 2X4OA 3IFOB 4UOQA 2VLJD 2KC0A 1LO4L 4CJ0A 1T1YA 1U3HA 5BCAA 2HT3C 4S1RL 4EKJA 5DD0H 3VI3B 1U2CA 2YUWA 4Y8DC 1CQKA 1V7NH 2CGRL 5TDOB 3T1FB 4AK2A 1P84D 1G87A 1ADQL 1NIBA 2HT2C 5I6LA 4B60A 4AV5A 3MBXH 3MNDA 4FJ6A 1RPQA 1QFHA 2XKNB 3FT4B 4UQEA 3FSOA 3AACA 4EUPH 2WJ5A 3GC3A 1VJSA 1E27B 4P04A 4LOVA 4FQCL 4IIQB 1T5XA 5JYMA 3E80A 1KGJA 4O2EB 4YN3A 1FH5L 2YQ3A 4UT7L 3CHXA 4JDEA 4MB5A 3BJ91 3ZT7A 1RZQA 5E9AA 3SDAB 1AYOA 4B9JA 4DVBA 4RX4A 2XQYA 2DD8L 3OKEA 2RR3A 1CL7H 5ADOL 4U6HA 3KYAA 4P2OB 4F8NA 1HQRA 2ZOLA 3K2KA 1R0AL 3DMIA 5AUMA 2AI0L 4KKCC 1QW9A 3DJ9A 3QZMA 3O8XC 1E5UI 1EMTH 4M03A 3WDHA 5KSVB 1DW0A 4JRXD 4PH8A 3L3GB 4QRRB 5ECGA 1MPAL 4BSVA 1N90A 3GD1C 1QSED 1KIRB 3BEVB 3P0VH 5HDBB 4AIOA 2DQJH 1ZGLP 4KX9A 3ORVA 1P7QB 3IVKB 1L7TL 2H41A 1F13A 3FUJA 1MW0A 4HXAH 4JN2A 3FO1A 4YSRA 4C55A 3NJMA 1Q0EA 4NUJB 4AUJA 4PS8A 3VWKB 3UJIH 3SQRA 1SHMA 5J6HB 4KXZI 3F64A 4WGKA 5K9JL 4PJCE 1JWMB 4XAKE 5KSAB 2OW7A 1G9NC 4L4TA 4K3JL 4MNQD 5EORH 3S3BB 4TUKL 3BW9A 3HG1A 2NXZB 5DGRA 2YPLB 2APVA 3HC0A 3QI9B 2ZX8A 3UTOA 2L7QA 1WIUA 2A9DA 3D0LA 3VXRA 5HYIA 4WV1C 5LGJA 4JFTA 3K72A 3I9GL 5DYOA 4S1DC 4YHIA 4OCRL 2IDCA 3TA3C 3RKDC 1H0DA 1K85A 1E29A 1OGSA 4YDIH 5D7JC 5C0AA 1EO7A 1YEEH 5CJ5A 4DEUA 1BJ8A 1P6FA 1MCPH 1R34A 4Y2DA 1BZOA 1RZIB 3V6OA 4P4QB 4XNZC 5CJQH 3V0AC 1S7TA 4KZCA 3NSCA 3DMMC 1R75A 1C7SA 4JFXA 1NCOA 4Q2ZA 1K9TA 1N59B 2JJSC 4LVNB 4G80A 1HH6A 5HYEA 1WTGT 5BXFA 4WFFD 3MRCA 4J1UA 1A6WL 3MRLA 5FCUH 4J6RL 1CZ8L 3SDCB 2YA0A 1ND0B 3L5IA 4I77H 4DIXA 2ID5A 1YNKL 1IQCA 5D1QE 5EOCJ 4CL7A 3H9SD 3VAEA 3WKNA 4AMKH 1DIQC 2HFEB 1GDVA 4MCZB 5F8QC 5IG7B 3N06B 5JLZB 3K2IA 4GW1A 2XYCA 2ZONA 1RHHB 3KWWB 4X4ZA 1EV2E 1OCCB 2XZCH 4P2CG 4BH7A 2WUCL 2BZ7A 2XV3A 3L7EA 3OM3B 3QCUH 3SE3C 1BIHA 3MJWA 3ZLQC 3N0AA 4ODVH 4AZ8B 4D0DA 4UT6H 3D25A 2JFCA 4N2DA 4OKVB 1KBBA 5IJCC 4PB0H 5D1XA 5EWIL 2J5LB 3UTSB 3ZPDA 1AG6A 1CDUA 5BW7A 3ARFD 4AH2B 4EAEA 4GBXC 4DQOL 4PGBA 3GLEA 4JKLA 1NGWA 1OP4A 2ZP9A 4RWYH 1BD2B 3MV01 1IZL0 4K9EH 5E8EB 2VDQH 3VD3A 4X6DE 1FN4A 1ECYA 2YXVA 3S48A 1CIHA 4IBYA 4DPAX 1U74B 1QEWB 4P59H 1MCHA 1A4KA 4KX7A 5T1LD 3RZCC 4AMWA 4OQTH 1FZKB 4TVPH 1IBBA 1ROCA 3AT0A 4PJ9D 5KVMC 3UABA 3V4PA 5L8LB 1KB5L 1J0HA 4HV8A 1B7VA 3AU1B 4JEGB 4QRSB 2IQAA 4V33A 1KY7A 5BJTB 5MI0C 2ARJB 4X6FB 4QRTA 5DJQB 4U7SA 2BW4A 3VA2C 4PJIA 2DL2A 2P8MB 4OZIA 1C7MA 2VR5A 4GAYA 2YSTA 2L7JA 3G7TA 4ZZKA 1H33A 3BAEH 4KMQA 3UOAB 2VSKB 1XSJA 1ADQA 2NZ1A 3B9KB 5HI4C 5C08B 1L0QA 1WITA 2Y4SA 2P49B 5BQ7B 1AJ7L 2YEVB 1GGCH 4N0CC 5D1ZC 4D0BB 2DQFB 5KN5A 1IL1A 2VZUA 4FFWD 3T0VA 4UTAH 5L2JB 5TTRA 4TXVB 1NC4A 5CWSB 1OK0A 4IK6A 2OL3H 4Y5XC 1AHKA 3WLBB 5KSAC 4UBDC 4E36A 4EXPX 3C12A 3VXSD 3DYOA 1LK3H 1EVTC 4WTWA 3AS3A 3MRDA 4NN7B 5JO5A 2J2ZA 3MMEA 4PJGE 3QI9C 3B7UX 3DGGA 3UBXA 4DZ8A 3TYGL 1RUPL 2YAEA 2B9BA 1SGKA 2YMXL 4IRSA 1YPZF 1B4LA 1NLBL 3EOBB 1CTMA 1XF3B 1RZKC 1N4XL 4ODUA 4MYPA 4J28A 4G9DB 3KVDD 1E9PB 3LZLA 2ED8A 3RWHB 2NY2B 2EH7H 3GRWH 4I1NB 2W1NA 5LGYA 3V4VH 2BC4A 1ITCA 1I5TA 1L9MA 1MCFA 2TSAA 3NJFA 2M2DA 2PR4L 3RWCA 1S7QB 4KDTA 4N0RA 5I73B 2AJZA 5I1DA 2HZHA 1PX3A 4KTYA 1E3FA 2DQCH 2E27H 1LL1A 1IFHH 4U1KA 4X4XB 5J1SC 1N64L 3U4BL 4LVNC 4GKOA 2GITB 1YHPA 4V2CB 1E65A 5J3HD 2AJSL 5E94A 1KB3A 3BKJH 5EZOH 3UJTH 1FGNL 1YVLA 3MUHL 3NJIA 4GUCA 4HEPG 5JHLH 2BNRB 3ETSA 3RG1C 4L5FL 3ZIYA 4QHNB 5D5MA 5LWYH 3VTAA 4Z7UB 3QRLA 1TVBA 2V9TA 1LO0H 3L4UA 1PVHA 5JIKA 1KTRL 2AF2A 2H6OA 5E95B 5SWSE 1RZFL 4DO5A 4G8FA 4GXUM 2YJLA 2PMZA 4HIQA 5HYSA 1A3RH 1WBXA 3L1FA 3MRMB 2BIIA 5C0FA 2XTSB 5D1ZI 5AVQB 3HAEH 1OK8A 4ADGA 3OC5A 2F5BH 1JFQL 3LN5B 1N68A 5IB3A 3VXMA 4U7MA 1TF4A 1XZ0A 5F7EL 2NZIA 4HQQL 5GHWH 2F53D 3NBNA 5EDXA 3S5ZA 2XXMB 2ZF8A 4GKSA 1TITA 4F15C 4MCNA 4ZUVA 3REWB 3F6JA 4LLYB 5GSVA 3TYFB 5E08H 3VXUE 4FFZH 1A22B 3MNZB 4PGDB 5K9KA 4G82A 5T1MB 4G8GA 1PLGH 1Z1WA 2VLKA 4ONHA 3PGCA 1IRVA 4X0KB 2QSCH 3QPQD 4LDCA 2X1XR 4F37K 2FJHA 1UOWA 3GQFA 2AEQH 2CLZB 5FYKL 1DVXA 3TZVD 1HJ5A 3L3KA 3PIQB 1EMTL 2D7NA 4ZFFB 1AOHA 2R2EB 3II3A 3QZWB 5IBLC 4OFDA 4JQIL 3WIHH 1TZ8A 3T4YB 3GEWB 3FSZA 3P0VL 5DC2A 4ZSOB 1QQDB 2DQJL 5IV2B 3NSDA 3T77A 3Q9QA 2ZX7A 5DJ6A 4N4YB 4KJYA 5KTEH 3LKOA 4YL4A 3CFEA 4MB3A 4XZUA 2EVGA 2VLRB 3UTTB 3M1CA 4KY1H 4N8CH 2UZYA 1MFEL 3V0HA 2F2HA 4KBPA 1L9PA 2YKLH 1OP3K 2QJPB 1SMOA 2PF6A 5IEKA 1K3GA 3D39B 5EORL 4HJUA 4NN7C 5T3XD 2V9UA 2ZOUA 1ZMYA 4GAGH 4PJBE 2DMCA 4L1BA 2F15A 4FNPA 1X5HA 1KB5A 5FK9A 2ICEA 5TFSH 4YDIL 3TBVA 5AOJA 3S35H 5FYLH 2YO3A 3KM2A 3K6IA 1CICC 2F19L 3RE0A 1FP5A 1YEEL 1UXLA 4FQJH 1WBYA 1T89A 2GIWA 4QF1B 5GISH 2WXLA 1H3TA 4D0CA 3WFBL 4L4VB 1RK0B 1DVSA 5CJQL 3FO2A 2WNKA 3K7UA 3IDXH 5C6TL 1NDGB 1KGWA 4ZXBC 3KXFD 3LPFA 2HVJA 3A9FA 1GKSA 1WG3A 4X5WB 3DTXB 4FI6A 2L4DA 4K71B 2XQBH 2GSIA 4X6CE 4Z1PA 4K3DH 3O11B 5D96B 1FYHB 4HUWA 3NCCB 3UFIA 4FA6A 2XN9E 2IOOA 3O4LB 5B4MC 4W93A 3LS4L 5TGBA 4XHJC 1QA9A 4EEEA 4QOKB 3QWRD 2LVEA 5E94B 1JZGA 4LLDA 3SIKA 1U8CB 3LH8A 2CKNA 5TH2A 2BNQD 3V9FA 4DP9X 4U1MB 1IQWH 2WLNA 4MHHI 4TULH 2RQ8A 1WBZA 3BH9B 4Y16A 5ENWA 2XPZA 4DN3H 4AMKL 1F86A 2IGFH 2XACC 5IK3B 1ZLVH 4C58B 2JCCE 3GMMB 3ARED 4U6YB 3TURA 2QSTA 4YWGL 5CHNB 1N0LB 1UH4A 2OJ1A 3H6JA 2UVFA 3BUDA 2EDQA 3PQYD 1PFCA 2V5SA 4GUOA 4ODVL 2I9LB 3QUML 4K23H 4XVUD 1TZIB 4PY7B 2NDGA 1OWRM 1Z3RA 1ULVA 5IWLA 2OTWB 3CH1A 4UT6L 2Z31C 1L9NA 2GYSA 4PB0L 3FJTA 5E56A 5C0DA 3SBWC 4YHZL 5KYWB 3TPKA 1AGEB 4QHPA 3VU2A 4RWYL 4K9EL 2VDQL 3QNYA 1N18A 2ICWB 4A6YB 4I1PA 2G0KA 5E1IA 4DN4L 2D7OA 3SGEH 3WS6C 1NFIA 4P59L 1IBYA 4X80H 2WSPA 4OQTL 4TVPL 4TNWK 3GSOB 1CGUA 1MEXH 3LZFL 1NCCL 3SZKC 1MLCB 1HNYA 3O6FD 3RIFK 4LAJH 4QYAA 3HLAA 5HGHA 1F6FB 2VLJE 3B8YA 4NO0B 3TO2A 5DFVC 4GEIA 3U9PH 1UM4L 4XP1H 4FC3E 5I0DA 5EB9A 1CDGA 5CYTR 3BAEL 2V3DA 1KCSH 3OZKA 4BZ1H 3P73B 2OI9B 1A1OA 3F12A 2YBRA 2PN5A 2XWZA 2E8ZA 5DA0B 2XXFA 3K1KC 3RWDB 4QNPE 1GGCL 3ARDB 2HFFB 2BDNH 4EUPA 2ILLA 4DETA 4UTAL 4AYMC 3AU0A 3BDBA 4FNRA 1U8LA 3VFRA 4IEFB 1K8IB 3CIAA 1R9FA 2AJYL 2OL3L 4LVHC 2GTZB 3HMXA 4OLXH 4WFHE 4WKXA 3W1ZA 4MMZC 1F1CA 1HE8A 3VGAC 1HEZA 4FGMA 1LNUA 2FIKB 3TCLA 5HI5C 3DUHA 4JY5H 4NI6A 3TC9A 4WGVB 4HKXA 2WINA 1NPNA 4P9HH 2CBOA 3N9GH 5H94A 1PLCA 3EOAA 4KX8A 2YD6A 1VACB 3SEPA 5C0IA 1UT1A 2WMPA 5KLIB 4HIEB 4OJYA 1LTXA 3B56A 3S36L 2QDVA 2EH7L 1E5ZA 3GRWL 4HOZA 4GG6F 3V4VL 4JRXE 1BVNP 2A7BA 4JQIA 1RIHL 4GQQA 3E9TA 1QSEE 2F54D 3L9RA 1CPUA 3TN0B 5AOKA 4MS8C 2C34A 2EACA 2UWEF 4HGKC 3NA4A 4NQCA 2HJKA 4OJAA 2IPTH 4OGAC 4XPAL 2DQCL 4LPYA 4U6VL 3V7AG 5FGCE 1T2XA 1EB7A 4BKSC 1IFHL 3DX8A 4YLBA 3ZOYA 4XXCC 2WBKA 4X7DC 1HWHB 4BFGA 2PYEB 4CC4A 4HKBB 2WQ8A 5BUGA 2G3ZA 3AC0A 3BKJL 1UD4A 4KUZH 5EZOL 3SOTA 2OCJA 4MNQE 2PCFB 3QDJD 1E5BA 3NEEA 2UYLA 3RFZB 4N0UE 1JMZA 1Z6JT 4FMVA 4JBSA 5LWYL 2VDOH 4IJ3B 3QJZA 4ESKA 1LO0L 1PQZA 1CI3M 1UZ8B 4QRQB 4P8QA 2BS71 2H0PA 1OCOB 2O5YH 4XNYH 1QLFA 2J56A 2CUHA 5E0QA 1A3RL 2VLLA 1NMAH 4J3UA 5AW9B 2PUQT 2VDPB 2N4IA 1YA5A 3IS0X 4H0GA 3HZYA 5JA8B 2WLYA 4JM2F 4JAMB 4JR9H 3T0EA 2R1YB 1JZ7A 2J71A 4NNYB 1JYNA 1U33A 4PV8B 1HHHB 1OALA 2NUPB 4MDJA 1OTUD 4B6ZA 5FFGA 3JWOH 3US9A 1J48A 1DVTA 4DCQB 1QFUH 4OD1H 4EIBA 2JQRA 1G0DA 2F8VA 3MDJA 3UO8B 2HKAA 2VABA 2BLFB 4WFFE 3G6JE 3ZDXE 2QSCL 1M3IA 3CSGA 2K8QA 3LHAA 4KJPC 3B43A 2AEQL 1FNFA 4N68A 1LK2B 3EH2A 3QPKA 2BINA 3S6CA 3TVMB 4LP8A 3Q2LA 3OAZH 4JREB 5AB0A 1DYZA 3H9HA 3IDGB 2JELH 4GEJA 3VQMA 3TEYA 4MJID 4KPHH 1JGDA 3WY2A 3RVUC 4AJYV 2OI9C 5DK2A 5DHVB 4DZBB 1WZ1H 1CFNA 2E75C 2JLLA 3AXHA 3QNZA 1JNHA 1YN6A 3LKNB 4X9IA 3VGBA 5KTEL 1O75A 1TCRA 3AMLA 3QUMA 4NYLB 1LO5B 4KY1L 1KMGA 2X0WA 1FI7A 3MCKA 5I75C 3PV7A 1CFSB 3DUUB 1YJDL 3MSPA 3QZBA 2YKLL 2NNAA 3RDTB 1A1MB 1KDJA 2ZBOA 1FCGA 1XZWA 1NGZB 1U8IA 3L3HA 3Q5TA 3TNNB 1DE4A 5KSBA 3OWRA 4ONFH 1ZLVK 4Z7WB 3UP1A 4GAGL 4YFLI 1A02N 4NBYB 4OQTA 3DX6A 4LP5A 3V0DA 2ENSA 5HYQA 3AS1A 2C1VA 4OTXL 4XN5A 2DIJA 1UG9A 2Z1KA 3ZUCA 5B21A 5TFSL 5EFIA 4KMLB 3S35L 1XH2A 1JNNL 2WW8A 5FYLL 3P3YA 4BQ6A 1A7PH 3C8KB 2UZXA 5F2FA 3RTLA 3T65A 3WD5H 1FVCA 4I87A 1BGXH 4NKIL 1RFDH 5C7XH 1OE3A 1J0ZA 1ZANH 2ZXEB 4I5BB 4KKAC 2IWEA 3T2NH 1GTFA 5IM7A 1MWAH 5C71A 4WVRA 4N2IA 5GSRB 1U3HD 5CS7A 2ICWI 4QXUH 4PRDA 1QBAA 3DARA 2XT1B 4ZAKB 2GAZB 2XQBL 1NEZA 1YEKH 5E6IA 2ICWJ 3BLKA 3PH2B 1VPOH 4APXB 5GZNC 3ASOB 1FBIL 4UTAA 5E1AA 4BYHA 3RL2A 2OL3A 3CNKA 2HLAA 3T2PA 2P8PB 4RESB 3VXSE 5FA4B 3OCDB 2DYRB 2BP8A 4Y4FD 3K4AA 4RRPA 1KEML 2R23B 4MVBC 4TULL 1OP5H 2FECI 4POZC 4IJ3C 4DN3L 1O9VA 1RK1B 1XV8A 2IGFL 5A6IA 4ES9A 3ULUD 1I9IH 2PO6B 3G04B 4LXFA 3HNSH 5F0PB 1X3DA 2YPKA 4MD4A 1JYXA 1D9KB 4PYHA 4WQ8A 2HB0A 4TLTA 4NRXB 3ARPA 1M60A 5EBGA 3V5HA 1P4BH 1JPGB 3RFRA 1ZE3H 1MVYA 4ONOA 3MFFA 4K23L 2NNFA 4UB0H 3GRWA 3T9WA 3ZN6A 3OAYK 4GAFB 3V4VA 3DV4A 4NQDD 1PNDA 3W2DH 1ODAA 1X44A 4F33A 4WW1B 4HU2A 2DEXX 2EKSA 3BESR 3HI1A 1J9CT 3PXSA 1NUNB 1QBMH 3P77A 2ENJA 4YAQB 2CHWA 3DHJA 4G2AA 4MMXB 1X5JA 3H42H 4FG4A 4QTFA 4X80L 1KPRA 4ALAH 2WWKT 5ICXA 1E6OL 1MEXL 4FXGA 2RAMA 1YMME 4MB1A 2IXQB 4LOUD 3W9EB 3DSNA 2ZSVA 4Y19A 4GRWH 3RUGE 1DQLL 1ZIAA 5GRZA 3CZFB 4YDLB 2GFBB 4CADB 3O6KH 5EU3A 3D51A 3DDFA 3TVMC 3JV0A 3U9PL 1AXTH 4JREC 4L4TD 5DRZA 3SBRA 4MMYB 4CBZA 3LZRA 4ODWB 4BQ8A 4PJCB 4BZ1L 4GS7C 4LU5H 2OBGA 1W72B 3CXHD 2ZXAA 3HB3B 5ADPH 1D6EB 3D12B 4ORGB 5GS0D 3FW6A 2BDNL 1WJ3A 4DJMA 4M61B 1HHIB 5ICYA 2CK2A 2OYLA 5LAPA 2R4SL 1F1DA 4B96A 2J43A 5A3ID 5C86A 4ONGL 2F53E 1ZHKB 4Y2DD 3RGVA 3RP1A 1PG7X 2CE6A 4ZYKB 3SN6N 5JIQA 4JFQA 5IJKA 3ESOA 1I7TB 3NZ8A 1T5KA 4JY5L 1M05A 3CHQA 4OCSH 1K3HA 3RNKB 1BMWA 1UWXH 4PJHA 3KDMB 4P9HL 1KBVA 4M8UA 5IROC 5IW6A 4DWHA 3KL0A 3O0LA 2CDEA 1Q0YL 3N9GL 5D4QA 1WFIA 4JQXC 2ZOKA 5EUOF 4AENB 3CBRA 4FAVA 1JK8B 3F7QA 3VJ6B 4AJ0A 1CJYA 3LH2H 4F80A 3SYQA 1LWRA 1A66A 1OTTC 2EIKB 1H6FA 4DPBX 3WNNA 2WXPA 3HZKB 1PY9A 3CZSA 1KDIA 2IPTL 4TVUA 4F7PA 5FDWA 1QVOA 1HVXA 4ZAKC 5K39B 4JFDE 1KYOW 4POYA 2FRGP 4C56E 3NFNB 3R1GH 4FE9A 3OR6A 1G9HA 4LAQH 5D1QB 4HOWA 4YDJA 1J9SA 3PY9A 3N3EA 2A74A 1J1OH 1S8DA 1FYTA 2OMXA 3QNFA 1HROA 1C08A 3ARGC 5KUKA 1IVTA 4KNTA 4KUZL 5F8RC 3S8WA 3UJJL 1IGJA 2R0WH 2YCCA 5D1XD 4TNVF 4HUVA 1JIBA 3F6LA 4Y9EA 5T3XE 1QKZL 3QG6A 4PV9A 1MCWW 3VCLB 2VDOL 4QO1B 1UB5A 4UQ2B 1D5BB 5BV7H 2PO6C 2G9HA 5DZNA 2O5YL 4XNYL 3IRCA 2H1XA 2CLVB 1RZJH 2JKRM 1NMAL 2Q1EA 3MLWL 4V2BA 4FKEA 2DQUH 4AIZB 4BM7A 4OZGA 1ZGLB 4B0MM 3BN9D 1VFOA 4JR9L 3AGVA 1FL5A 3M8OH 1VHPA 1U8HB 1UUNA 4O4YH 4ATWA 4KXZH 4UAOB 5FHAL 3QZPA 2MHAA 4V11A 1FC1A 2H2SC 5JOEA 3DX7A 1RZ8A 3EUUA 3JWOL 3NZHL 4JL1A 5B66V 2NY4B 3OPZH 3BPOC 1AY1H 1QFUL 4OD1L 4YZFE 4KQ3H 5B3JE 3G08A 3PXHA 5HTSA 1ZLWK 3X1BA 5DYFA 4RFEA 1JHLH 1CC5A 2DBLH 1SXCA 1JGEA 1JG9A 1UFUA 2EDFA 3ZRFC 4WSKA 4BFKA 2CUAA 2ZXDA 3MOAL 3A6CH 1UATA 1CORA 1JCVA 2PXYB 4XMXA 3VXTB 2IBZY 4OCWH 4GINA 4JJ5B 4JHAH 4J3OD 4P23D 1NOAA 4BKLA 5JQHC 4KROB 3KMDA 4Q97A 4KPHL 3U9UA 2YD4A 3CXFA 4GSDL 4LHUB 4RGNC 4ZUWA 3RWIB 4F8QA 3N85L 4JG0H 1WZ1L 4KXBA 1MELA 4FG0A 5JXAH 3EYQD 4IRSD 2J6EL 4YVNA 1G7QB 2QLVB 3OF6D 4A39A 2LIRA 5LHDA 1X4YA 4PJGB 3BD4A 1TYRA 3A4FA 3JV5A 1AC0A 4B3EA 1KACB 3F2LA 3TIDA 3N40F 3KPPA 1CRYA 4BUQA 4GI6A 3KPSD 4ZT1A 5F1NA 1KLGB 3QULB 3JT0A 4KK8D 5DTFB 4E41D 1BFVH 2DLGA 1AKJA 3NFPA 4GMSH 4NC1C 3VX1A 3FXIC 3CU4A 2J44A 5I5JA 3BD5A 6TAAA 4TQPA 1OP5K 4IGBA 1Y18A 3QJVB 2MQ3A 4ONFL 1G7IA 3MOQA 2WBXA 3O9WC 4RQQA 4HIXH 1NIRA 3VE0A 1XGUA 1E9OB 4O58H 3ORJA 3QAQA 3IJYB 4UQ3A 2ZYHA 1ZT7B 2YD1A 2MSPA 3LRSB 3L4TA 5DEGB 4B9IA 3I2CH 4LKCB 1A7PL 4M1CD 2IDUA 4HJGB 3WD5L 4HLZH 3L3DA 4HKZA 1DO5A 3APDA 5EULV 3SDXE 3FUDA 1AGFA 1RFDL 3FQTB 4M3KB 2YAFA 4OT1H 3T2NL 1MWAL 2GTWA 3UAEA 4BZ1A 3MLVL 3LEXA 4QXUL 3IGLA 5DCCA 4BDVB 3ULSB 2QVKA 2D4FA 1G4MA 1VPOL 4QXTB 2Q6WA 5D1QC 3X13A 2G75B 3OR7A 3UMTA 5HPMA 3CPLA 1OY3B 4YSPA 5I0YA 5DWUH 1KTLA 2BSTA 3GSNB 2AJXL 2Z91B 3O20A 5SWSB 2X4RB 3HE7D 4MLIA 4ZRGA 4UDUB 2VM4A 3PWLA 3HN5A 4UIKH 1JZ8A 4A37A 1TO5A 4JB9L 1W0WA 2ZX6A 3DUSA 4E42B 4NCC2 3BUYA 5IMLA 4D9LL 1C5BH 1PZDA 2V07A 1I9IL 4IBTA 2RFXA 2X7LB 4MZIA 4EZJA 4Q7DA 2MTAA 1HHJB 2K7PA 4PRBB 1IRAY 2PCBB 1JV5A 3I02A 3T08A 4PG2C 4G8GD 3H1ID 4X6BB 1P4BL 5AW8B 2VLKD 4OAWA 1MWOA 3GTNA 4N1EA 4J3BA 4UB0L 3AG2B 3DJZA 2Z93B 3VXUB 1LMSA 3LZQA 4OGZA 2VXQH 4PRHD 4CVZB 4M6AA 2W65A 4WWKB 2F54E 1KLFB 1YEGH 3W2DL 3PJSB 3WO3B 4AYEC 1CFTB 5F7AA 3KS0H 4P4KC 3D2UA 1SYVB 1QPPA 4Q4EA 5C3LD 2YAPA 2XI9A 1P53A 4JFYA 4O51A 1F1AA 3PP4L 1SEBB 4KTDL 2W07A 2EQDA 5CJOH 4ODXA 2A06D 3KYNA 2VLMD 3H42L 4ALAL 4HAFA 4HX1B 4PJ6A 1IZJA 4JKWA 4NRYB 5CMAA 2CDFA 3GZKA 4JNXA 4JCWA 2BMKA 3IF1B 5DQ9A 3O6KL 3QDJE 3RY4A 3GB7A 3ARBA 1KGCD 4UYPA 4CVXB 4KROC 3NG5A 3MTRA 4HC1H 1DVFC 1XXDC 3CFJA 2CXGA 4UDTB 3FFCD 5I9QB 3U2IA 5DHYA 3GJFB 5ADPL 1TO4A 4XP6H 1RVFH 5CZXD 1F41A 4Z0XA 3EOTH 2VMEA 4XVJH 5CCKH 2VMDA 2OMVA 2QSQA 3O3BB 4PJBB 1U41A 1HJCA 4ZPTA 5GGRA 1ILSA 4PWJA 5F7LB 3D2TA 1NBZA 3TBBA 4W9FC 4OCSL 5IEHA 3WY1A 5FKAA 1NZRA 4ACPA 1IB5A 3L74D 3T0XA 2FWLB 2QADB 1U92A 3IDNA 3O3DB 5AKTA 3JWDC 3FBKA 3RNQB 4BZYA 4RLDA 3KVQA 4OV6F 3IXTB 2AV7B 5MEOB 4IMLA 4M4PA 1GOFA 1JPFB 4LNVA 4ELMF 3PF2A 2CHZA 4X6CB 3SQOL 1LEKA 2BP3A 3Q6FB 2DWXA 2E8YA 2NY0C 3L5WA 2XN9B 1IAKA 4MJIE 5CEZH 4ZMWA 4KK5D 5GS1C 1VB9A 3CFCH 2YS4A 3PHOB 1D5XB 3I6LD 2J6EA 3R1GL 2BVPA 3WJLA 1MDAA 3C60B 2X0VA 4PYGA 2OSLB 3UG5A 4E2OA 4YSAA 4FQQB 2X9ZA 1J1OL 3FCTA 2N56A 1ZHLB 3S97C 2JCCB 3IJSB 2QTVA 3WFDC 4IKIA 3NABH 3QDGA 2R0WL 3BPLC 2SEBB 4Z8FL 3EGXB 5LXGH 2GVYA 5INDA 4JJHA 1JZHA 1BOYA 3PGDA 3WNJA 5FHBL 3LDBC 3FHAA 3C6LB 1L9BC 4F7TA 5JOPE 2CZNA 5BV7L 1M7DA 1S7SB 4H5SA 4MJ6B 1T4WA 2XVGA 5DVPA 2P7TB 2EO9A 2R2HB 2XETA 4H7VA 5ESVB 1DIIC 3LCYA 2DQUL 4G6AD 4XOBA 4W9EC 3DX9A 3K5RA 4HAGA 1H5BB 1WGOA 5CO1A 2WYTA 4FLQA 3M8OL 5CD3B 4Y4KD 4O4YL 3CX5W 3A24A 1T5WA 4FXKC 4LHUG 4EIGB 1MWAA 1GJQA 1YY8B 1RP8A 4LFHG 1IKNA 4R97C 1YPZA 1JXFA 2CIKA 2G0LA 2R56H 1N0XH 1UD8A 1WFUA 4LCCC 4LL4A 5E8NA 4KTEL 3OPZL 1AY1L 1OV8A 5B39G 5JW4Q 5FF6A 3BZEB 4KQ3L 2VLJB 3HG3A 1QRKA 3PWPA 1M7UA 4JQVA 2NXYD 4PCKA 4ACTA 1JHLL 4P5RA 5D55A 2DBLL 3WKPA 4LSPH 4LPUA 4R7VA 1JXJA 1SXNA 2PLTA 2O72A 2RMNA 4ZFQA 1GZQB 4U1LA 1YY9D 1F97A 4OV5A 5C0JB 3A6CL 1MF2H 4H1LB 2YD8A 5FV2A 4OCWL 2YPVH 4JHAL 1OAKH 2LHAA 3TCXA 4AE0A 5CP7B 1BJ1J 1ZK9A 5DMIL 1CS6A 1ZT4A 3ULUE 3CLEL 5D9SA 4RAHA 2JKLA 2F1EA 3BZ4A 4IOFD 3DVGA 4NQVB 4E5XB 4M6MH 2W60B 4PW4A 4PGCB 2KZBA 5I9QC 1TVDA 2BHZA 2C9PA 4NZUH 2BVUA 1DQJB 3VFTB 3VNWA 5C8JA 4WWOA 1EXGA 2P5EA 3FRPA 4OI9A 1HINH 4NQDE 3S4SA 3G5YA 1LDSA 4ISVA 1NAMA 4HG4K 5D2NA 3AVEA 1U8JA 2ROXA 1KYDA 5DSCA 3CV5A 2VQ4A 4UM9A 1UA6H 4XNDA 1NPUA 5L7XH 3F62A 5DJDA 3R8BB 4HIXL 1GAFH 3OZLA 2QADC 4JRXB 4NPYB 3KLLA 4O58L 1G7MB 3HQ7A 1QSEB 3FTVA 1ZWIB 4RDQF 3VTTA 1HCYA 4ETQB 5HJBA 4FEMA 4M7ZC 4A68A 3ARSA 3QR1A 2XOTA 5KBKA 5F9OH 5BRPA 1A47A 2WVVB 5CCGE 4EN3D 5FGCB 1K5NB 4L4TE 2BVEA 5DVMA 1L9OA 3U36B 3W3BA 4OT1L 5EN2B 1YDPA 1KPUA 1S78C 1VFBA 1JWSA 5C09D 5T1KA 3BH4A 2A5UA 1FDLH 4I48A 1S46A 2MQCA 1P1ZB 4XODA 5E0FA 2PP7A 2MOVA 3FCSB 4MNQB 2Z92A 3AM8C 4N0UB 1RPUA 5C0AE 3IMSA 1GKEA 1N5YH 5IB2B 3NK3A 3PV6B 1NNOA 2ZKHH 3HI5H 4YHNA 3SD2A 1UYWH 2HUEA 3PL6A 3KJ6H 4CW1B 4CNIA 4FNUA 1ZAGA 4RAVA 3SCMD 3V6OE 3UZQB 5HDQL 4PJXF 3IKKA 3M1BA 1K72A 4FMKA 2A83B 1TSHA 4XE0A 4E9QA 5ANHA 1OOAA 5F3BB 2H3XC 2RBLA 1IBZA 4Z7NF 2EYTA 3EH1A 5F1SA 2OMUB 4JRYD 4KKQA 1HZVA 4JHVA 1KJVB 3BE1H 4MNGE 3VQLA 2GUOB 3A22A 4RMBA 4PWFA 4FERA 4X9BA 2ZWNA 4D94A 1FWXA 4LT7A 1OARH 3P30L 1CSXA 3EO1B 2QVTA 5A2FA 3PWUB 5GJTL 3BZFB 4HPHA 4JDVA 3AB0C 1YEGL 4OFKA 1TTFA 3BC9A 3QIUA 4XNUH 1MW3A 2EAEA 2NQCA 4BHUA 4CUCA 4HULB 2E7MA 5I2IA 4NNXB 3ZDXB 3OXRA 3EJTA 3IAPA 4MKMA 1DLFH 2K0RA 5EPMB 3SBPA 4R3SA 5CJOL 5AZ2L 4CC0A 3KLSA 3S0PA 3MPCA 2DDQH 2ZOTA 4M7LT 3W0WD 4X4YA 2B0SH 5AWNL 3QJXA 5IW1A 1BXVA 3ZK0A 3ZU8A 5FGSA 3P9MB 1YEJH 2X70B 3L70D 1HL5A 1EHAA 5D1XE 4RZKA 2V9RA 2G60L 3NJKA 4MFHA 1G7JA 4JM0A 4FTVA 1QP1A 4N2NA 1BQLL 2VDMH 2C3VA 2Y69B 1DQQB 3KWUA 5DDHA 5FOJA 4AQOA 1E8XA 1LE5A 5CSZA 4WI4A 3QIBD 2ZPKL 5C07A 1ZHNB 2WO2B 4HC1L 5A1AA 1WLHA 3ARFB 3AW5A 1NBCA 1P7BA 4LSVH 1TENA 4NM8H 2ZSWA 2W0FB 1VCBC 3OKLB 4HZLA 4Q6IA 4TVPD 4NIKB 4ODTH 3QR2A 4I18A 5TISV 4XP6L 1RVFL 4TYUA 1XCQA 2GKIA 4KZEH 3BPCB 3BGMB 3MOBL 3IXAB 3EOTL 4IHOA 1B2WH 4LIQL 2IWFA 4U1HA 4QWWD 4EICA 2WN2A 3QQ4B 4WO4D 2BS8A 5AL8A 5T1LB 4PJIE 4PW3A 3FCGA 2E6QA 3CG8A 4PJ9B 5E1GA 5EG6C 1BWWA 4LGSB 2DZEA 3L2NA 4OZIE 3WEXA 1X9QA 5EIIB 1A6AA 2CM5A 3CDGB 4U1IA 2Y1AA 3JTTA 1SLXA 2ZKMX 1A21A 3MNVA 3T8VA 4ZOBA 5JNYB 1RZ6A 4H0JA 1EA9C 1J9QA 2RA1A 3R0NA 1YAIA 2JTYA 4H8WC 3AQDA 3K6DA 1BX2A 1TTRA 4IS6A 1M57B 2VSCA 3HG0A 1DQIA 4HK3J 2NQDA 4OJDH 2PTUA 1A0QH 5CEZL 1UADC 4YE4L 5EU7C 1KYUA 4UQ9A 3FB6A 2MQ0A 3VFSB 3LKPA 2OP4H 3WTWA 2X1PA 3VXSB 2BSRB 4HUKB 4ZFGH 4NDMA 2PTVA 2MJWA 4XBGA 1JUFB 1U8KB 1TDQA 4PJ8A 2FEEI 4WIQA 1N26A 1OP9A 5EZLB 4IU3B 2JKSA 3KPSE 4E41E 3EXJA 3SGKA 1AD9A 2EADA 2WWNA 5ISZD 1P84J 2A4CA 2V7NB 4W81A 5LXGL 2YOCA 1AGBA 3NESA 2ALAA 3N44B 3ZKND 2GEQA 3P4MB 3CQQA 1MH5A 2X4SB 1RJYB 1ID5I 1BQUA 2Q8BH 1KJ3H 4EIZC 1QWHA 5E1QA 3NIGF 4ZX4A 2BIHA 5HY9A 1U2YA 2LOEA 4H1LG 1SNRA 2DWYA 1MI5A 3ZCFA 1CXKA 2ZXWB 4Y19D 3ZE0E 3TO4C 3BH8A 4E5XG 4WWPA 5DK3A 5I0WA 5L2KA 1HXMB 5D5ME 1UEYA 5G55A 1T3FB 1YMMB 3AG3B 3V10A 3II2A 3GXDA 4AGPA 3RTQA 4HD5A 2DI9A 5KBPA 3E6FA 4KI5F 2KZKA 5CJXC 4I88A 2AERT 4LLQA 4FQXD 2DLIA 4LSPL 2GJ6D 3KL5A 4RFNB 5FM5M 2XWRA 2ZUQB 2GEEA 3RI5F 2UWEA 2ATKB 2VZ1A 3IDYB 1MIEH 4XNAA 4Z76A 3WN5B 2YPVL 1OAKL 2FJUB 1BREA 3B2UC 3IGAB 5HI3D 3NZSA 1XCWA 1M2VB 4XNXL 4FL4C 4M6ML 43C9B 1RUMH 2KL6A 4G8GE 2F53B 1ZZHA 3OZ9H 4NZUL 2VLKE 2MEJB 2PP8A 3D4ZA 1A4AA 2W9LA 4ADIA 2JJSA 3KLHC 1IU1A 4G42B 2DICA 1MFAL 2NR6A 1U91A 2H5UA 3FQRA 1ONQB 2K1MA 4QAMB 5ABAA 2VR8A 5LCVL 4P2RD 4TQEL 2X6VA 4KUCD 4L29B 1UA6L 2BVOB 4FQLL 4R7XA 3FPXA 3TZVB 3NIDF 3RHWK 5L7XL 4GW5A 2VHDA 4P4RA 1ZS8B 1CLZH 1H9VA 1UFGA 2VLME 3QUXA 3H3BC 5KSUB 3KM1A 4JM2A 1GMEA 1GAFL 3GM0A 2GC4D 1OZUA 1WFNA 3HG4A 4M6NL 2WOYA 4ZPVB 4ABUA 1FLRL 5GRXG 4BELD 2VDRB 4R7DB 1DANU 1OIOA 2X4PA 1T1WB 1YICA 4TNVK 4NQXB 5F9OL 3CSPA 4NXSA 3DPBB 3GMPA 3I6KA 2RALA 1KTDB 1ZOXA 3FB5B 4L3CB 1KGCE 3DIDA 3FKUS 4LCWA 4QRUA 4FFWC 5ERWB 1AHWC 2N1TE 4NKMB 5LN8A 4HC1A 4K0OA 1KBKA 5DUPH 1CG9B 1FDLL 2ORLA 4FZEL 4UV4H 3FB7B 4PM1A 1KULA 1UWFA 2B59A 2W92A 2ZKYA 5I76A 1CTNA 3LKQA 3QORD 1N7MH 1G6RB 2NTFA 4HKJB 1UXSB 5FYLD 1N5YL 2W95A 3HI5L 4QXGH 3V2AR 4V1DD 3VYOA 4HUXA 1D2OA 4FFYL 4NHUA 2OK0H 3H7BA 3WU2V 5JW4N 4G70B 3KJ6L 3ZE1B 1KB9K 5A7EA 2P5WA 3FQXB 1T2JA 4Z3EA 4RFOH 3U4EB 1NM4A 3VGFA 2VQUA 2B7DT 2DMGA 3NQKA 5HHNA 2CUIA 3BE1L 4MSWB 3O3EA 3V0VB 1H6UA 3KPQA 4MNHA 1X5IA 3SDDD 3LPOA 1OGPA 3BLBA 3EGSA 3RX9A 1OARL 3WFHB 1T1XB 3WY3A 2O1AA 4BUHA 5KZCD 3GMLA 3DWTA 3TPUB 4CMHB 2VRQA 2AJ3B 1TNNA 4K8RL 3PJLA 2I24N 5JDSA 4XNMA 3QNXB 3I6LE 3OLDA 5AKRA 4XXWC 1DLFL 4JKKA 2BNQB 1A6TB 3R0MA 4NSKB 1A9BB 5SWZD 1E43A 2DDQL 4FHBD 4XP4L 4XXDA 3MCLH 4RFNC 4GMTH 3OJMB 5EIIG 3GIVB 1EJ6A 1TQWA 3RVXC 2EJ1A 1YEJL 1FG9C 2XG5B 3AREB 2UXVA 3G5XA 2ZUQC 3EKCA 4RISL 3HS9A 5ABDE 1BVLA 2FBJH 5DS8B 1EFXD 4ZFOL 2QL1A 2E9IA 3WN5C 3D30A 1ZEAH 5SV3A 2VDML 4AQEA 5I8OH 5FUCE 3VI4E 4QUOA 1N9PA 1A14H 1D5MB 2UX6A 1QOKA 1Q90A 2QKSA 5L88H 2BVTA 1CLOH 2LLNA 4IGBD 4BBWA 1EXHA 3HMWH 3GHBH 5DFSA 4NM8L 4LSVL 2M26A 4PRNB 2C9QA 4I2XA 1G7HA 1G1YA 4FQIH 3VDBA 3EYVB 2VDNH 4ODTL 3RBGA 4MA7H 4KZEL 4Z77A 1KG0A 5AG8A 3BFQG 5TDNA 2R2CA 2EDEA 4NAMA 1UEMA 4HW6A 3QXAB 5IB4B 4I3RH 4F91B 5EOQL 5I1EH 4R7NA 4Z7AA 4PTTA 4BXVA 3MRNA 4AQ8C 1JZ4A 3IDIB 1GYWA 5J6GB 4BFEA 4KI1A 4NN5C 3DNKA 3VA6A 3SDXB 4N2OA 4L2YA 3MLRL 5DHDA 1MRFH 2IAMA 4IOIA 4AE1A 3L73D 1CYGA 5IIEA 5LUMA 5HHOA 4LQFH 1R46A 3S3SA 4AI7A 3QQNA 1AKKA 2WLLB 4H0IA 5K9QG 1L3WA 5TDPB 5IJDC 2WCPA 1F4WH 4C4UA 1UENA 2YPVA 4JPWH 2WBJC 3GUFA 3C8HA 4YVUA 1IEHA 1N8ZB 4BFNA 4NOBA 4UM8A 1XEDA 1HHKB 1MVUB 2PCCB 1NEPA 2MKWA 3E7JA 5IQNA 4LEXH 1NWOA 4CU8A 3EDJA 4Q74A 3RILA 4ZFGL 3D48R 5EO9A 5CIGB 2YK1L 4U3HA 5JW3H 4QRPA 2B5IC 1X5LA 4DP2X 1SQQD 4KITB 2YGQA 3QFJD 1EAPB 4NUQA 4GUPA 2YKKA 4DK3A 1LO3H 4MAYD 5LCVA 2VMJA 4HPOH 4X7TA 3W81A 2HX8A 4NIYE 1ZJBA 4NHCH 1OT4A 1RAQA 1KIPB 3K4ZA 4A38A 5IKCA 2R1WB 3TT1H 1NMCC 4G5AA 1IBHA 1SJXA 3MLTB 2IWKA 1DQVA 5CEYA 2Q8BL 1KJ3L 1MREH 2EC9T 2F54B 1I7RB 2BS9A 5CCJA 1TT6A 5EEVA 4ZMZA 4OLZH 4GYBA 4LQ1A 3F83A 3VD1A 4JFSA 2AMUA 2A6DB 5EF3A 3Q8CA 3S98A 1X5KA 1P0SE 4E9XA 3IMWA 2Z4QB 3IBEA 3UZVA 2FEJA 1RURH 3RQ3A 4MKTA 5CIPB 1P9MC 5C09E 3MX0A 1Q0XH 2P8LB 1HIMH 1D6VL 2JI3A 3ARBD 5DJXA 1J12A 3SYOA 3CDYA 1YNTF 5FO2A 3PCYA 3X3FH 2NW2A 3ABMB 4M4RA 3IJ8A 5LB1A 4ANKA 5DRNB 3N1MC 4L8SB 1VKXA 5BRQA 3SPJA 4CSTA 4K7PX 3QDJB 5EU6A 2F58L 3STZA 3HCVA 3MC0A 5EUOA 2G2NA 2IFGA 2FLBT 4B3VA 1OB1B 4YDZA 3MV11 3SD5A 4G59C 5DRWB 2D03H 3NEOA 3OLIA 4NO3B 4AT6A 4IBVA 1T04B 4FFYA 3U4KA 2H8PA 3T0EE 3L6FA 3WUWB 1ZLSH 2YC1B 1I4FA 3BCFA 3OKOA 1QI3A 3QISA 1MIEL 3CVBA 3HRZC 4PJAF 2AK1H 1T0NB 3LZNA 4NX0A 3ESUF 1VADB 1XVSA 4JRYE 2WLKA 3IFLL 4JFHD 3D3VA 3MA7B 1RUML 3QJHA 1QL4A 4KXCA 5ECJE 3S5LG 3OZ9L 1AHMA 8PAZA 4IKLA 3WHE1 5LQBL 3L5XH 4JPIB 5CICB 4NJ9L 1CT8A 3RDJA 3W37A 2QVIA 3GHPA 1L9TA 4YPGA 1MZ4A 2FGWH 4BFRA 2WAHA 3SXTA 2AI5A 1JZ2A 4JPSA 1URZA 4QHMB 5E6UB 4J3SA 3QEHB 1M7XA 4YLCA 3IRZA 1PX4A 5D8JH 4XHQA 5I6OA 1LQSR 2HJLA 4TNEA 4AEEA 2ZNWA 2EYSB 2MH4A 4HCGA 3OL2A 1CLZL 1UWEL 1LEIB 3AQYA 5F71A 3S8FB 4HUUA 4MJIB 4RAUB 2R39A 1PJ9A 1INQA 1EHLH 3KEDA 3VFOA 4LSTH 3V55A 1CFVH 5ETUB 5CBAA 5DU7A 1UD6A 1KELH 4XMWA 5IOKA 3DK2A 3GGWB 4WKZA 3SPGA 3X17A 3NDYE 5KSBE 3B3BA 4UZGA 1EJ8A 5DUPL 1BF8A 4LDEB 5IGXH 1EWHA 4UV4L 4TVPE 2Z8VC 3QQ3B 4DEPB 2B0ZB 5I23A 1CCZA 3EYFA 3KJ4C 1QTPA 4RH4A 3WS6A 4OGQC 2DQMA 5MERA 1N7ML 1BZDA 4QXGL 3U46A 1I7ZA 2WGNB 3ZGHA 2OK0L 1NTMD 2W38A 2GJJA 3IAQA 4EIFA 3BKYL 1FH2A 2XSKA 4U3XA 5HHPB 3GLAA 4R26H 2XKUA 2PTTA 3UAJD 3MK7B 4TPRH 4XCNB 1M6OA 1PZCA 2ZWLT 4RFOL 2FJFA 2FHCA 3UPRB 5C7ZA 3VXNA 2OCFD 1U95B 3MLZH 4PWKA 3WMSA 4PJEF 4U1GC 2X4OB 2Q9OA 1A25A 2IG2L 3IJ9A 1T1YB 1U3HB 4GXFA 1C5DB 3IN0A 3FTXA 2EUZA 5L4FA 3FTYA 5J6SA 4TRPL 4L3FA 1I9RL 1NIFA 1WZKA 3DRQA 3NSFA 2J5WA 3QHFH 1FV1A 3HUJF 1E2WA 2N3JA 4BFBD 4F7CA 3KYKL 3QA3B 4P46C 5I19H 1KXTB 1G9EA 3RB7A 5IMOB 3EHBC 2K4WA 2PWFA 4KK6D 3DROA 3N43F 4L8SC 1T5XB 2Q76A 4Y4FB 1LP9F 1UKSA 3VFNB 3V6BR 1EEYA 4LSSH 2HLFD 3C9NB 1R3HA 4JDEB 3BFWA 3F7RA 4JX0A 4FABH 3C09C 3MCLL 3QG7H 1E4HA 4GMTL 2DIEA 5C92A 2NY5H 4DVBB 4BK8A 5ISZE 1ZRUA 3VACA 3OKEB 2FBJL 5AQ0A 5FGRA 1KTBA 3CBKB 1EQWA 1F3DH 4HEMA 3FQNA 5E2UH 1HQRB 25C8L 2A9MH 2ZOLB 3IMRA 4FN0A 4MJHA 4WI6A 2BGVX 5FYKU 4M1DL 5A2BA 2CLRB 5L88L 4BA8A 1N5AA 2FX8H 4UM9D 1CLOL 4NQDB 1MFCH 3VI3F 1HJ3A 3FS9A 2ZUTA 3TP4A 3X39A 2D2OA 2IDSA 1NTDA 3HG5A 4X5XB 4MA7L 4BSVB 4ZMPA 3BYTA 4Y19E 2CJSA 4JO2H 2Z9TA 5C0EA 3EJRA 1UB6B 2WKGA 3P11L 4AWJC 1W2LA 2CBTA 4U6TA 2IV8A 4JN2B 4I3RL 2PWGA 2D4DA 5ESQA 3ZOAA 3TNMB 2AZAA 4QLRA 4Y7MA 1J18A 1R3JA 2JIXA 2ZUSA 5KVEH 4XRCA 4AKPA 5K5YA 2VR7A 1A8CA 3FQUB 4E68A 3ETBJ 4L4TB 1IGYA 2XRAL 4FOMA 3BW9B 5DD1H 3ISWA 1MRFL 3HC0B 1C16A 1WH0A 4H20L 2P44B 5I8EA 1IFRA 5E1HB 5D7HA 4OZHF 1F2QA 3F84A 4Q0XH 3F04A 1B0GA 2FYYB 3BAWA 3GMNB 4YHIB 5GGQL 3ZKMD 4Z7IA 3PL6D 3NH7H 4JPWL 1H0DB 1NLDL 3V6ZB 1J11A 3DJTA 3CFDB 3VRLE 5C0AB 4Q9QH 3OAWA 4MJ4A 4S2SA 2RB8A 3HW7A 2QTEA 2DLFL 3A23A 1AE6H 4PJHE 4X5RA 5BOZG 4Y2DB 5HDBF 1DVQA 4DEPC 2AQ1A 1XAUA 4Q89A 1FRGH 1L7IH 1T6VN 5HGDB 4JY4B 5JW3L 4PD4D 2CE0A 1UZ6E 1TZHA 4I8DA 5J1AA 5ACLA 1E3ZA 3AQZA 1ACXA 5EF0A 5L6YL 2O61A 4Y2OB 3JWDH 5CILL 1CSVA 1LO3L 4MWFA 1OAJA 1JHTA 4Q2ZB 4U05A 4OF0A 4J7RA 4MNGB