2YQBA

Structure of p93a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.4 a resolution
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
454
structure length
454
Chain Sequence
KLPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKMAHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 148
structure length 454
sequence length 454
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2yqbA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yqbA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yqbA02
1JZEA 3SXTA 1CYJA 4GP5B 4E9SA 1CC5A 4YSCA 4GP4B 2ZBOA 4AI7A 3HQ6A 3H1JD 1H31B 2LITA 2PCYA 1GS7A 1YICA 1QN2A 1SQXD 3ZDWA 4YSAA 1PF3A 2B4ZA 1CCRA 1NZRA 3EH5B 1ET5A 3NBTA 3FT0A 3GDCA 1CSXA 1PZCA 1CIHA 3FQYA 2FQFA 1HJ4A 3RN0A 2VSKB 4HALA 2BO0A 3O0RC 5DFSA 4KOCA 351CA 4F2FA 2FNWA 3WC8A 1BQ5A 4UAHA 3X1EA 2H47C 3UAAA 4Q5PA 1A4CA 2IAAC 2IDTA 4GYDA 2N0MA 4KO5A 2VW4A 2FQDA 1NNOA 2MHMA 2OCCB 3CP5A 3IN2A 3NJKA 3UAEA 4HIPA 3AZUA 3IEAA 1E29A 1OF0A 2FT8A 4BWUA 4ENZA 4GP8B 1NTKD 2PPCA 1KGYE 1XB6A 2GBAA 4DP4X 1GU2A 2AIUA 1FHBA 3NJHA 1FWXA 5I6MA 1EZVD 3DTUB 1AG6A 4HHWA 3ZCFA 4NERA 3U25A 1TEGA 3NP3A 1GIWA 1KV9A 1W2LA 1J3SA 3TASA 4G72B 1NWPA 3EH4B 2C1VA 2H5UA 2BCCD 3SJLA 4WQBA 1RZQA 2YAMA 3MBWB 3NYKA 1WA0X 1FI3A 1GYCA 1L9TA 2NRDA 5AZUA 1E8EA 2GSMB 1NMIA 2R7EA 2VM3A 4A68A 1AOZA 3ABGA 2DWSA 1I6EA 1IRVA 1RAQA 1E30A 2CE1A 1QL4A 1W6WA 2GC4D 2B3IA 4FA7B 3WKQA 2UX6A 1A4AA 4PCYA 3CDZB 3NT0A 1DT1A 2CALA 2IWEA 1HZVA 1BEXA 2GIWA 1E5YA 1SHXA 4M4RB 3MX0B 2MRYA 1W6LA 4PWAA 3NJGA 2EIMB 2W8CA 1H9XA 2I8FA 2BP8B 2CCWA 2FWLB 4JCGA 3FSWA 3NSFA 1CSUA 1QL3A 1M9WA 3ZBMA 1IBYA 1BYOA 2YCCA 4DP8X 3PXTA 3AG4B 3OA8A 3OMAB 4KOBA 1DW3A 1EHKB 5DJQC 3KZIV 2VMJA 1J9QA 2PPDA 2OZ1B 3N2JA 3PAZA 1RCYA 1BAWA 2ZXWB 2FRCA 1UATA 3UABA 3X1GA 1SDDB 1DVHA 3RYMA 4BDVA 5I6NA 1XB3A 3EHBB 3VYMA 1JZJA 4DP7X 1PNCA 3RMZA 1OOWA 155CA 3VNWA 1A56A 4WQAA 5CIDB 3VRDA 4WQDA 1NIRA 2FQGA 1A4BA 1KX2A 2TSAA 4U3FD 3H1ID 2DY2A 2BH5X 1IZL0 1LFMA 4DY9A 5H2FV 1JDLA 2AANA 4YSQA 1HJ5A 1W5CT 5DJQB 1GY1A 5CICB 1WA1X 1N68A 1RZPA 2DVHA 1C52A 2JQRA 5F7AA 1W8EA 7PCYA 2OZ1A 2FYNB 2C1DB 1PMYA 1BCCD 2GIMA 3NBSA 1SF5A 3T6VA 2DYSB 1CIEA 4BXSV 4L3HA 3KW8A 4YSDA 3SLEA 3X1FA 1ADWA 3FYEB 5DF5A 1PPJD 5EXQA 1FJ0A 2HX7A 3V9CA 1ID2A 3GYRA 3SWSA 1A8CA 1CRIA 4P4QB 1L0LD 3DKHA 1I8PA 3CX5W 1I5TA 1NIAA 3WFBC 3HEIB 3OMNB 3T6XA 4A2FA 4WQ8A 1YEBA 1CYXA 2ZONG 4Y5RA 3X39A 1CTZA 4NB7A 4UANA 1WEJF 2QJPB 5TISV 1NDTA 1HZUA 2XXFA 2X87A 1CORA 1V54B 1CTYA 1ILSA 4QKTA 3TGUD 3CXHD 1MG3C 3FQ2A 4EIDA 5D4HA 4G7RB 1QKSA 1OE3A 1IRWA 8PAZA 5B7MA 3OCDA 4AKQA 1KYOW 4WTQA 6PCYA 3CZUB 1JVOA 4AKOA 2A06D 3ZIYA 1I55A 3TYIA 1GR7A 1AZNA 4YSTA 5I28A 4YSSA 3OA8B 3NJLA 4JHVA 4TXVB 1JVLA 1CSVA 5I6KA 5KAFV 4NFGB 3O1YA 2RACA 4E9RA 1DIQC 2E86A 3ZOOA 1JZGA 4UB8V 1ZIAA 2DYRB 3OM3B 3BQVA 2BH4X 3JBTB 4FA1A 5F7BA 3WFEC 4AANA 3CXHW 2GHZA 3EF4A 1GDVA 2YAEA 5PAZA 1HH7A 1GQ1A 2FTAA 2UXTA 1C6RA 3FSAA 3FSZA 3PCYA 1OE2A 1LC2A 1SF3A 1CRGA 2UX7A 4CSZA 4N0KA 1AZCA 4A2EA 1CHJA 2B10B 1QHQA 4L3GA 3WUIA 5B7EA 2D0WA 3PXWA 1ZDSA 3FSVA 4DPAX 1AS8A 1CTJA 3D12B 2C9XB 3CU4A 1NTMD 1GS6X 4KO6A 1I8OA 1ETPA 1H32B 5CIGB 2AZAA 3ERXA 1AIZA 1ASQA 4A2HA 3AG1B 4EIFA 1NINA 1F56A 1J5CA 451CA 1I53A 2CUAA 3QJSB 4AKPA 1OCOB 1A8ZA 4WQCA 1EB7A 2CAKA 4K3IA 2XUWA 2C8SA 3A0HV 1BGYD 3FU9A 4DP6X 2YK3A 1ASPA 3S3BB 3RN1A 4A2GA 3OQRA 2EINB 1YEAA 3UGEA 3X1NA 4A67A 1DW1A 1RZ5A 2UXVA 1H33A 3HQ7A 3ZOXA 4O1QA 2DGEA 1M56B 3C2CA 2FQEA 3BVDB 4QLWA 1COTA 4E9VA 1NIDA 4DPBX 3SVWA 3FU7A 5E9NA 4EICA 1JXDA 7PAZA 1CEDA 1NWOA 1AYGA 1IBZA 3FYIB 3IN0A 1DZ0A 4BDVB 1PLCA 3JT2A 2YAFA 1WVEC 4WQEA 2PP9A 1XMEB 1PZBA 2BWDA 1PLAA 2DWTA 1CUOA 1MG2D 5CIEB 4IL6V 1KBVA 1S6VB 2J56A 1AS7A 1SFDA 2XYBA 5I6PA 5I5JA 2AXTV 2BLFB 1YNRA 3ZOYA 2WSDA 9PCYA 1A65A 2IBZD 2IH8A 2XV2A 1JZFA 3PAUA 1GW0A 4YSRA 1I6DA 3H1HD 3WI9A 1L9JC 1AR1B 4FA4A 5FC9A 1CYCA 1YTCA 3A0BV 3NJNA 2CXBA 1TEFA 5B66V 3L74D 2IWFA 3O20A 2LLNA 4PJ0V 1MDAA 4UB6V 2YARA 3IE9A 2N9JA 1H32A 5B6QA 1ETJA 2IWKA 1DW0A 1C6OA 1GJQA 5CIHB 1KBWA 3H1KD 2GC7D 2WO2B 1AZRA 1CXCA 1N70A 1ZRTD 2J55A 1AOFA 2CE0A 2HLEB 1L9OA 1FI9A 3NJFA 1PZAA 1SQPD 1C7MA 1RZ6A 3FPXA 2Q9OA 3QJTB 3CWBD 2CBPA 3PLYA 1IQCA 2XV0A 4KMGA 2YAHA 2ZXYA 3HQ9A 5B1JA 2H3XC 1M6ZA 3AG3B 1SQBD 1ET8A 1M70A 1GKSA 4KNTA 4CSPA 4E9YA 3FS9A 1AACA 1ASOA 2YAPA 3UACA 4BWWA 5KAIV 4BK5C 2L4DA 1H33B 5B1BB 4HCFA 1BE3D 1YFCA 1NICA 3DIVA 1IC0A 1C2NA 1R1CA 1VYDA 1WS7A 4KNSA 2CA3B 2ZONA 1CNOA 1RAPA 2ZZS1 2AFNA 2C1DA 1N9CA 2W88A 2PPFA 3CYTI 1JERA 3L4MA 4QAOA 2B12B 3ABKB 4LJIA 1HRCA 2BHFA 3ZOWA 1HJ3A 1M57B 4MU8A 3L70D 4ZK8A 1H1OA 3MK7B 2V07A 1PLBA 1WAEA 2B11B 5GTIV 1YCCA 3N55A 4YSOA 3S3CB 3QJVB 2EILB 1L0ND 1MZYA 3ASOB 1SQVD 3T6WA 3OMIB 2PCBB 1P84D 2ORLA 1YIQA 1F1CA 3DR0A 1J5DA 4KO9A 2PPEA 4YVNA 5I6LA 1MG2C 1RKRA 4FAVA 1K3GA 1KIBA 1CC3A 1LS9A 1QLEB 5C0ZA 1CXAA 1BQRA 4UF7C 5AKRA 1JZHA 2N18B 5CIBB 4O1WA 2BZ7A 1CRHA 2I7SA 2YXVA 3SBPA 1QYZA 1J9RA 1CURA 3CVCA 4X4KA 1BXVA 4G7QB 1JOIA 1KB0A 3WIAA 1JXFA 1KB9D 2BWIA 1FI7A 2AI5A 1PY0A 2GC4C 2YAOA 4E9TA 1OCCB 2V08A 4BWTA 5A7EA 4F7KA 4W9ZA 1CRYA 3FU8A 3OD3A 1SHWA 2I7OA 4AZUA 1BXAA 5AURA 1LC1A 4EF3A 1L9PA 3SQRA 4JKNA 2J5WA 4K9JA 1DVVA 1ZPUA 2CA4B 3SBRA 5KLVD 4KNUA 1CCHA 3NWVA 1IUZA 3L4OA 2BW4A 2N3YA 1FOCA 2JXMA 1AANA 2PCCB 1B3IA 4DP9X 3OCDB 5KLIB 1NU1D 1KDJA 2AZUA 2B0ZB 4G71B 1V10A 2N3BA 1AAJA 1ET7A 4DP0X 4YL4A 1NTZD 4Q8BA 3S8FB 3IBOA 5I5MA 4HHGA 3NSDA 1AZBA 1PP9D 3DP5A 4FA9A 3V9EA 3FU7B 1AZUA 3AW5A 3H4FA 4FA5A 1K3HA 1XB8A 3NJMA 1ZIBA 5KKZB 1IO3A 1FFTB 4YE1A 2VSMB 2WO3B 3ABLB 5I26A 2XX0A 5B1KA 1X9UA 2J57A 1C6SA 3O5CA 1YLBB 2JKWA 1L9BC 2QPEB 1CRCA 1LMSA 2PLTA 2FWLA 4WQ7A 5CIFB 1OCZB 2HX9A 2YAQA 4J20A 3CDZA 4RH4A 2VM4A 5B5EV 2PCFA 3BCCD 3T9WA 3H4HA 3CVBA 4BXVA 1KV7A 2AVFA 4WKXA 1PCSA 3L75D 5D4IA 4A2DA 2XX1A 1J9TA 1T5KA 3WU2V 4A66A 1NIBA 2GC7C 5AFAA 5I6OA 3ABMB 3NSCA 5E79V 4GY4A 4HCIA 3T6ZA 1FA4A 2FYUD 1AOQA 1NTDA 2Y1AA 2FJSA 5IY51 1CYIA 5B3SB 4EIEA 1U74B 2R7EB 1OAEA 1JZIA 2Y69B 2HV4A 3PXSA 1AS6A 2MTAC 4YSEA 2BGVX 2P80D 2ZWNA 3S3DB 1H31A 1AG0A 1E5ZA 2HRHA 2XWZA 1MZ4A 2N18C 2GB8B 1L9SA 4HZ1A 5TK4A 2BP0B 3SBQA 2GI0A 1SJMA 5TK2A 5ANHA 3DMIA 1F1FA 1HCMA 2ZOOA 4V2KA 2BP8A 1MG3D 1OE1A 3CVDA 5LDUA 1NIEA 4KO7A 3H56A 4P5SA 1X9RA 1SNRA 3JTBA 1WA2X 4HCGA 2PACA 1ZDQA 3T71A 3MK7C 3TBCA 4YSPA 4L1QA 1CHIA 1CSWA 2VN3A 1OCDA 1FCDC 4DP2X 4WQ9A 3CG8A 2A3TA 2XTSB 2I85A 4NAJA 1CIGA 4PW9B 3TBBA 3X2QB 1L9QA 1HAWA 1QNIA 2HZHA 2IDSA 5CYTR 1SDDA 1J9SA 2JFCA 1M60A 1NIFA 2BPBB 3L71D 5I5IA 1SFHA 5B1JC 2MTAA 2QPDB 2FT6A 2QT6A 1TKWA 3QPKA 1ZV2A 1NPNA 2VW7A 2P80A 2EIJB 2EIKB 4E9QA 2VW6A 4AAOA 4PAZA 4N8UA 1B7VA 1C2RA 4XYDB 4FB1A 4DP1X 4HAKA 4W1TA 1CO6A 2IDFA 3FQ1A 4GYBA 2X88A 3TU6A 1HROA 1R0QA 2D0SA 1CIFA 2C2CA 4AX3A 2BP0A 1HAUA 1OV8A 2PP8A 3G5WA 3HB3B 2EXVA 1IKOP 1MZZA 4DP5X 1N90A 1EZLA 2CJ3A 1DW2A 2BZCA 1GSKA 3ASNB 2HX8A 3RLMA 4G70B 5EHFA 5IY5B 3L73D 1KX7A 1PNDA 3NJJA 1KCWA 1AQ8A 3M97X 3ZX1A 1NPJA 4GEDB 4XXLA 3PPSA 6PAZA 4E9WA 2B08A 2HXAA 2QDWA 3QJQB 3KW7A 3L72D 3NJIA 1N15A 2OJ1A 1WS8A 3AY2A 1E65A 1C75A 1GS8A 2QDVA 1BXUA 1SQQD 5GTHV 1BQKA 1JXGA 3NSYA 4YSUA 3S8GB 3WG7B 4L0PB 5B7FA 3L45A 3PH2B 1KDIA 1DIIC 5C9MA 2XV3A 4FANA 1CYWA 2IH9A 3QJRB 1KYAA 1U75B 2PP7A 2XVBA 4DPCX 2HRGA 2XLLA 2XU9A 4RSZA 1L9RA 1OCRB 4MFHA 4PD4D 3WFDC 3ORVA 1N50A 3A9FA 3QJUB 3QQXA 2YQBA 3C75A 1KYOD 1VLXA 2Q5BA 2UXGA 1H9YA 1CHHA 2BW5A 4G7SB 2IDQA 2GB2A 1URIA 4FAAB 1GY2A 4YVUA 2QJYB 3FPYA 4D6TD 1DYZA 4N4YB 4AALA 1V55B 1A3ZA 1S5LV 1I54A 2DV6A 4H0JA 2TSBA 3WFCC 2JTIB 4P5RA 1NMLA 3TA4D 1BL9A 3X1BA 3WKPA 1ILUA 3NP4A 4AAMA 1HFUA 1ZZHA 5B1AB 2BCNB 2YIUB 3GXUB 2OV0A 3PAVA 3CX5D 1BYPA 1E67A 2QJKB 2LIRA 4M3HA 4E9XA 4Q89A 4GXFA 3WNJA 1PAZA 1A2SA 1AKKA 5PCYA 3UADA 1KCBA 2N9IA 2YXWA 1CRJA 3AG2B 3WNIA 2XXGA 3HQ8A 2FT7A 2VHDA 1TU2A 1E2RA 2PPAA 2UXFA 3EH3B 3PXLA 4JHUA 5D4JA 3H1LD 2IDUA 4F2EA 4H0KA 2C1UA
chains in the Genus database with same CATH superfamily
3S5ZA 3D08A 1ZTXE 3OAYK 3WXWH 4AENB 5DRWB 5AVTB 3UCQA 5HHQB 3GSRB 4HIIA 4C54A 5HHOD 2OJEB 1QN2A 2H6UA 2CRIA 3CTTA 1LO3L 2GITA 1CCRA 3NBTA 1KZQA 5J56B 3BDXA 1CZ8H 2WLIA 3HI5L 4G9FE 5BOZG 3HN3A 1E90A 3ZL2A 4HOMA 4U1JA 4KO5A 1XSKA 3K4ZA 1AFVL 1U8HB 3FQUB 2NUPA 4NN5B 4WLCA 3WLWD 2I9TB 1OVZA 2F53E 3GSVB 1BWWA 4WI3A 5FGCE 3T3ME 1E2WA 2JTYA 1NTKD 5GS1A 3LN9A 3MGTA 2D3NA 1KIUA 1XB6A 2VZUA 4P2QE 4L29A 1RVFH 1ZVSA 2BC4A 2V2XA 3FTUA 4RDQG 1I8IA 3T04D 2A99A 4OZ4A 1KV9A 2XG4A 2DJMA 3ECVA 3UYPA 2G5RA 3SJLA 4PRDB 5LGYA 4R8WL 5IF0B 4F9PA 5GGQL 5A2FA 4P57B 4K9EC 1NBYA 5EBLB 1CI5A 1MOEA 3ZL4L 1RAQA 1CFSB 4I0PC 2GC4D 3WKQA 4TSCH 4XN1A 4GMTL 1M9SA 2XQ0A 3LIZA 1PYWA 3NJGA 4RDQF 5ICYA 1FORL 3V4PB 3IDXL 2YS4A 3TYFA 3BW9A 3NA9H 1S3RA 4JFQB 2E56A 3QZBA 3O4LD 3NFSL 2CHDA 4ZX3A 4FQJH 1GGUA 3N50A 1KCSH 1T21B 2VT0A 1TO4A 2H26B 1FZOB 2WQXA 3C5SA 4HFUL 4NCDA 2D7PA 4F5CE 4G1MA 4FLRA 5HI3D 3UTSA 5EF2A 1WAAF 3G6AB 4ZX5A 3PWLB 1H3VA 2CKBA 1XGZA 4LBAA 2TSAA 3GSNH 4LIQE 5JXEC 1M6OA 4DY9A 3EG9A 1F97A 1JDLA 2ESVD 5F7AA 1N68A 5JYMA 5CLTA 1C52A 4QTFA 1W8EA 1CD1B 3WS6C 1MKFA 3SY0A 2IPTH 3HCVB 4L3HA 1D5RA 4M93B 4YSDA 3SLEA 1QFOA 3M86A 4PUBH 3PHAA 1XO8A 1PCXA 3P4OA 2LU7A 1XGYL 3AM8A 1VGEH 3IJ7A 1YMMA 3IGFA 1QABA 4FULA 4A2FA 1F1AA 1IGIH 3SJVD 3X39A 1T1XA 5D7LB 5BXFB 1WEJF 1F11A 4TSBL 3FL7A 3LHPH 4MNHB 2X3CA 4QKTA 2CG9X 1A7PH 2J8UF 4FYQA 4K7FA 3V0FA 2VC2L 2ZKYA 2BMKB 3TO2B 3NFNA 1CGTA 5IVXF 4DZ8A 4KNQA 1PX3A 1I55A 5I66B 1KBPA 2P8MA 1U3HB 4YGVB 4OZGE 1QUNA 1HZKA 3TO4D 3DBSA 4NN5C 4AW4A 4UB0H 5IB3B 2JKXA 3NK4A 1FN4B 1G1YA 1GIGL 2J1KA 3R4RA 4QRAA 1SUHA 2ZSWB 2UY7B 4I0PA 5HDQH 1YEGL 4APQD 2VB5A 2E9WA 1U8KA 3B5GA 1MSPA 1JGLL 1G5AA 2HAZA 4BGDA 1C6RA 1FFQA 4LT7A 4NT6B 3L16A 1LC2A 1CXEA 3IAQA 3QIWC 5GSVB 5I19L 2FAUA 1CDYA 4K7FB 2VXVL 4ELMF 2D0WA 1S8DA 4F7PB 3EOAB 4E41A 1NKRA 4OW6A 5K9QI 3VGHA 3D12B 5CXPA 4BSVA 3LPWA 4FMVA 1WFNA 3QUML 4X8CA 3TZVB 2DQIL 3T0EA 2ZXQA 5SWSB 3QUXC 1Q4NX 3BX7C 5C0AD 1SQ2N 4PY8J 3CXHJ 3MV01 2WBXA 1T89C 2FIKA 3QUKB 4JY6A 4LOVA 4Q6IB 1BGYD 1FFOB 3TCXA 3FO9A 2C7FA 5GXBB 1KB3A 3MGOA 4MA8L 5I74B 2ZICA 2HFFB 4HPOH 4LU5H 2VO8A 5LXVA 3O45B 1WLHA 4P5MB 1KJ2L 3QUYD 4LCUB 3NIFE 1TTUA 4FQLH 3P2BA 1UXWA 4XPHL 5AW8B 1YEKL 3MCYA 3UIZA 4B0MM 5HPMA 3ARQA 3IS0X 3D0AA 2ITDA 3B1UA 2VR7A 2KMWA 1NL0H 2ZXEB 4ATWA 2XTJD 1JZ6A 3VB9A 2LQRA 2XT1B 4O4YL 3L3JB 5D1ZD 5EBWA 5LKNA 4XP1L 2BH0A 2BS8A 1MG2D 2JB5H 4WFED 5JHBA 5A6IA 1K3IA 1A65A 4YPGB 3WI9A 3ULUH 2R2CA 1OF2B 1W0YT 1K5NB 4KV5F 2XQYA 4LHUA 5JQ6L 1AR1B 2NXYB 2C9SA 3NOIA 3EJPA 1QUNB 2VR6A 1GAFH 4H2CA 2HFEA 2OL3H 2KKQA 5ACZB 2I24N 3CVHH 1ES0B 2J6EL 1DW0A 3MV8B 3DX8A 3P02A 4NUPA 1XCWA 1UB5A 4LSPH 4FFYL 2YQ2A 3D85D 4MCNA 3QI9D 4RAUB 3KPSA 4LU5L 2W07A 1RZ6A 1F4XL 1NKOA 3PHSA 4X6EB 1KB9K 4ENED 4QHLA 2EDQA 3CPLA 4QXGL 1WC7B 5EPMA 1AZVA 3JWOL 4MNHA 2P5WA 3N43B 2IADA 7TAAA 4IIZA 4GUQA 4P46A 3LMJH 2OAAA 4NZJA 3EYOB 4W9JC 4HK0B 4HKZB 1RZKC 4KQ4L 4XR8C 1XH3B 3BPOB 5KAIV 3HMXA 4KTGA 1H33B 1ZE3H 1BE3D 1DJIA 1R1CA 5MI0B 3U7YH 2ZONA 4OLUL 1RAPA 1RHHB 3WDIA 5CEZE 4P3DB 2QZ5A 3L4MA 4J3OC 3KPOA 1EMTH 4QXTB 4MU8A 3K6SA 3T1WA 2V07A 3C12A 3PWVA 4Z7UA 3T08A 3CSYB 4JANA 5GTIV 3HG0A 4OD2B 4WEBL 4QOKD 5C09A 4MA7L 1G6RL 1UXLA 4EN3C 4UOJA 1MZYA 2MKWA 1XD0A 2FH6A 4IS6B 3ZT5A 2AF2A 4QRUA 1YIQA 3FUNA 2FSEA 4CA4A 1PZSA 1RUQL 4UF7C 1MCWM 4UTAH 1KTLB 1PGRB 2I7SA 3ELQA 3NJXA 4NX0A 5CIPB 5KVMC 3SKOA 2VLKD 1J8HE 3CVCA 1BFVH 5IVXE 4MJIA 3PDGA 4Z76B 4ZTEA 1F90L 1F4YL 2X4QA 1U95B 2H41A 1XWVA 5A7EA 2MNUA 4ZW8A 3DVFA 2A83B 4JZNB 2DICA 4M7ZB 1S78D 4KKAC 4P2OA 1JMZA 1SHWA 4UINH 4ZAKA 5AURA 3JTSA 4HVBA 4JKNA 5AOJA 4JL2A 2IGFL 5GGTL 2CUMA 3CHRA 1N3NB 4IU2A 4ZUUA 3LKRB 3PWUA 3SBRA 3VU2A 1WCBA 4W4OA 3D09A 5DS8B 4AQ1C 3C2SA 4G6JL 1YY9C 1BQUA 4PMEA 1YMHA 4BFRA 4AUJA 1T0NB 3FO2A 2N3BA 4DEPC 2K7QA 1LO2H 1SJXA 2WC7A 3HAEB 3NRFA 4X42A 4F1ZA 4EIBA 4G42A 1QX1A 2XG4B 1KXQA 4UQAA 4B3VA 3LDBB 3MO1A 1RZKL 4PRDA 5EO9A 1KCVH 1ZIBA 3BP5B 4MX7A 3QUMB 1AD0A 5KKZB 3A6CH 1T0OA 3ENEA 3W0WE 1YEJL 2VDRB 5IOKA 4NPKA 4Z7OF 1KJ2H 4FFWC 3O5CA 1J1PH 3UERA 1UC6A 5I23A 4L9DA 2ZCLL 2WCSA 5CIFB 4IHOB 1MUJA 3FO1A 4HJTA 4OGXH 3ZYIA 1XHHA 4LK4A 5CJOH 2D9CA 3ARFD 3SDXA 4P2RB 5KS9E 4GBXA 1YEIH 5FPIA 4KQ0A 1I3UA 3BAWA 4HUWA 2OL3A 4NQDB 4XPFH 3IJEA 3BT2L 1HZLA 5HDBF 4CVWA 2X3AA 5E79V 4S1QL 3HZVA 4PJCA 5D2NE 2DQIH 3OB8A 5F9JA 3MV11 4NBYB 2WXJA 3IDXH 4M56A 3RVUD 2H9GA 1U74B 1UA3A 1OAEA 1MIMH 2Y69B 1ZHKA 4NRZA 3AGVA 3FUDA 4LHUD 4BFOA 4WFGD 1OW0A 1T7VA 4N26A 2BVQA 3BUQA 5DURB 1QFWM 2GFBB 3P54A 3MGAA 4L23A 1DSWA 3SBQA 5KSBA 1NCCH 5JMRA 5I1IH 3RGVB 2H4EA 1G9ML 1VSCA 2Z8SA 3WFZA 1MFNA 2DTSA 1WYJA 3KL5A 4KFZC 2R2BA 4HCGA 5KSUA 5HJBA 4FP8H 5AYUH 3QUGA 4WQ9A 2HN7B 2EC9T 4JY5H 5KG9B 1VACB 1B0IA 4W4OC 3HRZC 1H15B 1SDDA 4OCMC 5C2UB 2RAMA 5C97A 4RBPH 3KWVA 4P2OC 3VD9A 2P45B 3DGDA 2M83A 1ODAA 2Y5EA 5E5MA 2XKSA 1LP9F 4J28A 4EAEA 4L1DA 4FB1A 3OAWA 1F8TH 3MFFA 3P0YH 4W1TA 5LN8A 4WW2F 4TULL 5GGSB 3KYNB 2D0HA 2X88A 5E6IA 1BZQK 1MZZA 3QDGD 1HQ4B 5EO9B 3RFZB 1DW2A 2JLPA 5JORB 2J21A 5DZPA 3BKML 2FLRT 3RP1A 1RURH 3WTWA 3BXNB 3NJJA 2B7DT 3WFCH 4WNJA 3SO3C 1CLZL 4ZNEA 5KVFH 1KB5A 4N2AA 4G8EA 4W68A 1AIFA 1EIBA 3PGCB 1O5PA 3TNNB 1HCFX 5DQ9A 1N3NA 1HH6B 1VKXB 4K2UH 4QT5A 4PJAB 4DEPB 5LAPA 2H1PH 2WQSA 3ISWA 1EEYB 4L9LB 2X28A 5HHQA 5B39B 2GJZA 1H8SA 2FO8A 5CR8A 3O41A 2Z91A 2DQTL 4AM0A 2XACC 3OR7B 5HVGB 5DS2A 3HAEG 2E59A 1ZJAA 5DK0A 3N06B 1IEHA 1C12A 1U8PA 4IMKC 2NSQA 4JFDA 4OZFG 3X3FL 2AK4B 5GQBA 1JF1B 2YD5A 5AAWA 3EXLA 1KN4H 2APFA 4N6RA 4ZO7A 1YO4A 5D72H 4NNXA 2BOBA 3AABA 3II2A 2FH8A 4WUKL 3B5HA 1HDMA 3SCMB 4H0JA 2CDEA 5FO8A 3KBPA 5E2VL 3LKSB 2R29H 3Q48A 4M03A 5D1XA 4YHZH 5DA0B 1R34A 1C1EL 2IANB 4ZSOA 5IB5B 4YFDB 4NWUH 2J88H 2WN2A 4DCQB 3QARA 1QA9B 1GHFL 4U1MA 3ATBA 2UY6B 1H3UA 4RAVB 5IQ7H 2CO6B 1MRDH 2VDKL 3AG2B 1DZBA 4MNQB 3K8LA 1YZZA 3W2DL 4Y16D 4MRCA 3C5XA 3UX9B 2WLJA 4XMPH 1OP9A 2VIRB 2WXOA 4GS7C 4PJHF 1H31B 2EDEA 4CRPA 5MENE 1QLFA 3FTWA 3C9NB 5AYQA 3LKOA 3ULAB 1PF3A 2NNFA 3B9VA 4IJ3B 4LSUH 3GDCA 3S8FB 1CIHA 1AFVH 3NRQA 1A6ZA 3GTVA 4Z5RA 3KHOA 4LLWA 5CU9A 1MRDL 2N0MA 1CU4H 2XV6B 3A4DA 2FQDA 3MQIA 3RBGA 1NNOA 3NJKA 4BELD 1BA9A 2X4RA 1LO3H 1YUHA 1JZ2A 1KCUH 3W9DB 3QWQB 5DXWA 4OFPA 2XIBA 1KGYE 1FHBA 4RGMB 5CJ8A 3WXWL 2X9YA 4X9BA 3ECQA 5E2VH 5GIRA 5KJRH 1TQCC 5HYJA 1QBLH 3H9ZA 5AG9A 2XVLA 4Z7QE 1UEMA 2OJZH 1XH3A 2QQKL 4WQBA 3NYKA 4U1IA 4Z0BL 2PW2A 1FI3A 1KELH 2RTTA 4NO0D 5GGUB 1DSFH 5SX4I 3SBWC 2HKFH 4DNLA 4FZ8L 3GIVB 1KY6A 1NCDH 3E8UH 1IV8A 1KXTB 2I25N 4NYLA 3CUPB 4EDXB 4CVXB 5L7XH 3UO1H 4Z7UB 1DT1A 1NFDA 2K6YA 1A9EB 2F5BH 2IBZX 2ZXAA 3VXTA 3UTOA 4M48L 4XPBL 4UQEA 4PWAA 1H9XA 2VDLB 4LLAA 3TJHD 5IJVA 1G84A 3BOVA 4QHUA 3HPLA 2VDML 3HZYA 3WSQH 3BH9B 1KB5L 4J3OF 1DW3A 1QW9A 2FWUA 5DJQC 1E4KC 2R1WA 2YPLA 3T3PF 2NY0B 3N2JA 5IW3A 1QEWA 5DD5H 3GJFK 2FRCA 3K91A 2CUIA 1A1OB 1AGFB 5ID1B 5E2UH 5ECJE 1XB3A 2K8QA 3F6IA 4L4JA 4FL4B 1UH4A 2Y07L 3WHXB 3R8QA 1R3HB 1F5WA 1PD0A 1X3DA 2FQGA 2HG5A 1NIRA 3NDYE 3P2TA 2DWDA 4TNGA 2Y5TB 3BZEA 4YR6B 1ZD6A 2HRPH 4MQSB 3SPIA 3T8XB 4AY0A 1KTJA 1RH8A 1ROWA 3FU5A 3NBSA 4FNTA 3VD0A 4RBPK 4WTZG 2XNAB 3UTTB 4L4TB 5IJCC 1EJFA 5IKCB 4TL4A 4JJOA 1N18A 2W0PA 1FGVH 3OMNB 5GPRA 3T6XA 2EC9U 4PRPE 5I1LB 2E9GA 2HVKA 2E7LA 3O3DB 4U1GC 4LCWE 2VXQL 2C3VB 3PGFH 2ZXGA 4GRLA 3FQ2A 1JPSL 4XVOA 2HCZX 2AXJA 3EOBB 1N2RB 2GTWB 4YSTA 3KYOB 5ACZA 3OA8B 3O2WH 4F7TA 5FYKH 4YHYB 4MLIA 4P5MA 5I6KA 5IEHA 3CFBA 5FV1L 4NFGB 2LV4A 1JV5A 1KGJA 3V8CA 5F72S 2BIQA 5MEOA 4HKBB 4WEMB 3O3EA 1GDVA 3MV7D 1HH7A 1TQCB 4CDGC 1NGZA 4MCYB 5I76A 5LGJA 1F41A 1OE2A 3F84A 1P7QD 2B1AL 1I1FA 2L7JA 4NNPL 1RLBA 4E68A 3IFPA 5CJOL 3MROA 1IBGL 5HPMB 3BSZL 4Z7NE 2NNAA 3V4VA 1ZDSA 4JM2A 1K4DA 3D4ZA 4G6FB 1VADA 3UJTL 5SX5H 4PVBA 2KYIA 4CN1A 3GC3A 3MJ7A 3TF7C 3FC8A 1I1AB 3F58L 4OBRA 1AVAA 1UM6L 1DHKA 3MRMA 1NSNL 4HHAB 4OD2A 5C09E 5EMYA 1FIGH 3B83A 3WNLA 1A8ZA 3AU0A 1RZ7H 4JY6B 3D2UD 3QZLA 2UZYA 2WGNB 3E2HC 4UV7H 1TENA 2HWZL 5DZVA 1W2KT 2COQA 1JSYA 4I5BB 3CSPA 2FEEI 5CSGA 2ZUVA 1JHLH 3PWPE 3TO2A 3IJYA 1ZK9A 2DQFA 4QLWA 1XAUA 1M2VB 2ENJA 4DN4L 1MI5B 4BFBD 3FJTA 4JUSA 2OMYB 1MCIA 1OPOA 2BVYA 1KNOB 1I1RA 4NWUL 4UNVA 3P1VA 1WVEC 4AG4H 1Q1JL 1CD0A 3Q1SH 4WQEA 4FL4C 5CJQL 3LOWA 4D9LL 5F3BB 1XGUB 4ONGL 2L3BA 1P4IL 2QQLL 4ZFFB 1CUOA 5FF6B 2XYBA 4GAYB 5CZXD 1R4XA 2DMBA 2XN9B 1BFVL 1BVZA 2NY2D 3N44F 5GJSL 5LCVA 1L9NA 3TT1L 3QJXA 3RNKA 1X7QA 5J6GA 4FA4A 4XXWA 2I07B 3A0BV 4XPTH 4Y5VA 5B38A 4Z0XA 1JL8A 2YJQA 3FUMA 4PJ0V 2BDNH 3U2JA 4K3EL 1OANA 2ZYIA 4PJFA 2DQTH 4YL9A 3MMEB 2GC7D 3ZR5A 3AAZB 3IFOB 5B39A 2HLEB 4KZCA 4WEBH 3RL1B 1S3KH 4M1DL 4KI1A 1T21A 2F68X 1OQOA 3DTDA 1AGEA 1M70A 2AK4A 1EXGA 2A38A 1FC1A 5KS9A 5E1GA 3QORD 2NW2A 2QTEA 3U7AA 2HPOA 3I02A 2QKIB 4RCAA 3SQBB 3UPAA 5CR1A 2XWCA 4BSWA 4N0RA 1QTPA 2YRPA 1R5IA 2CA3B 4OZHB 2AKRB 5EU4B 4HJ0C 1ORSB 3BKMH 2Y0SA 4F7TB 5IEHB 1ORQB 4PJ8D 5DDHA 2F74B 4ZQTA 5I16B 2WLZA 1LDPH 4BZ2L 4ZK8A 2CBQA 3UTQA 1WAEA 2WNXA 4AGNA 1AQDB 4RRPG 4IQHA 3WHE0 3HVNA 5EZOL 3CN4A 3GSNB 1L0ND 3K6DA 3LZRA 4ABQA 2WPGA 1YEDB 4GKOA 1TCRB 2J6EH 4W9FC 4Q56A 2Q8AL 3T0EC 2X05A 3DLQR 3BKYH 3IDJB 1NUGA 4DGYH 1MFEL 5E6ID 3SDCD 1VEPA 1QFWL 1LQBC 1URZA 1J9RA 1T4WA 1F18A 3MCKA 4YHMH 5TDNB 3TBYB 2HSIA 5AYUL 5GRYA 3C60D 3H53A 4TUOA 1XR8A 1KB0A 3WIAA 4DFIA 3VGBA 3TOPA 3D87B 3V10A 5KVEH 4O51A 1Z3GH 3SDDC 1EVUA 3T2OA 2V08A 2ZP0T 4BWTA 4WKZB 1CE6A 3DOSA 3RNKB 1GGTA 4PB9H 3MLUL 5E5MB 4WFGE 2VH5H 3NZ8B 4MA1B 1DJYA 4JNXA 2LFEA 4DESA 1LE5A 5KLVD 3BMVA 2PCCB 3WJJC 3HHMA 4DP9X 5JOEA 3LKSA 3EOYG 3QQ9C 3HZVB 2HRLA 3GSRA 3I9GH 5F9JB 4ZOBA 3U0PB 3IBOA 4Q0XH 4XP6H 1B0RB 2ICEC 3E3QC 1AQMA 3HG1E 2Q7NA 1BQLL 4LSRH 3GPEA 4U1IB 2XJKA 3QO0A 1KEMH 4PGBA 4I88A 2Z8WC 3ABLB 3QQ4A 3UPRA 4MJJA 1QFWI 3R19A 1T1YA 1LL1A 3MOAL 2NX5D 1L9BC 3ECWA 3QJOA 4K94L 4NKIH 2K9UA 3WO3B 1WBXA 2HX9A 3BUTA 3ZMEA 4GQ9H 1A9VA 5B5EV 3SDYL 3Q3GB 3PDDA 3ZIMA 3L75D 2Y1YA 1MELA 4XP4L 4TNFA 2JCCE 3ARFA 3O9WC 4O2CA 2Q3AA 2WBJB 3S34L 4JPSA 2FEDC 2KC0A 1CMOA 4UT9L 1CGXA 1XCXA 1DVYA 1KN2L 4PJFF 3S5YA 4L48A 2Y1AA 4UQDA 5IBTL 1F45A 3QYNA 4Y1AB 4P06A 5AVWB 1C12B 4AQEA 2WIMA 1AS6A 3W5MA 3OJDB 5C07A 1AG0A 5A43C 3EZJB 4JPKH 2KT6A 2HRHA 4ELMA 2Q0ZX 4D0BA 1SYVB 4LSQL 3S3JA 4DVBB 1DTUA 1MFAL 1HCMA 2EYSB 4QEGA 2Q10A 5EF0A 4ZFGL 4U3XA 4TPRL 1AO7B 1MW2A 1BM3H 2X1QA 1WA2X 3OKKA 4DKTA 1DEDA 3KE0A 3ARSA 5EUKB 4U0QB 1UKQA 2EDDA 4I2XE 3X2QB 2PTTB 3DRTB 1L9QA 4BD4A 2NY1B 1IL1B 3QPQD 4OZHF 5FUCE 2PYED 1AXTL 1JK9B 4AAOA 5D7LA 1BQHB 3HC0B 5BXFA 2PABA 4PGEB 5D1ZI 4NM4H 2UYLA 3MREA 4JO3L 4XZ4A 5HYQB 1FG2B 3PV6B 1HAUA 1TQUA 4G6FD 1RUAH 3QDMA 4R4FL 1SXZA 3QO0B 1EMTL 4MWFB 4OSUL 3ZOAA 1GSKA 3IPFA 4Z7IA 3POCA 4QRQB 5AD0B 1CD1A 4G70B 3UPRB 1IM3A 4XN7A 2M8XA 2X2HA 2YQ3A 5HHPB 5T33H 1FH2A 2JJTC 4U1NA 2E8YA 1BZ8A 5EOQL 2FHCA 4I0PD 5E8NA 3PL6C 1WS8A 2VLLB 3CZFB 3K1KC 1LE5B 2QSCL 2NTSP 3ZHNA 2BJML 3LIZH 1I8MA 1A0QH 2OBGA 1OAZH 4FJYA 3DUUA 2ZX9A 5B7FA 1D5XA 1HH9A 4XN4A 3H8NA 2R23B 3QUZD 2X4NB 2WIIA 2VH5L 2XVBA 3MZGB 3SGEH 4AM0B 1XZ0A 2FJHB 4FA8A 1PQZA 3RU8H 3C75A 3NCFB 3WS3B 3MODL 3RVWC 2X4PB 3VXOA 4HBCL 3SPHA 1Z3GL 1NC4B 5LWYH 3MA7B 3U6RB 5EOTA 1R5VB 4D0CA 2OMUA 4FLSA 4N8CL 3ULUL 1C08A 5TE6H 1CLCA 5BO1H 3QFJA 3O9WB 4NQDA 5JW4N 3LRSA 2EO1A 5BOPA 3ULVC 1RUKL 4I48A 3RTQA 3DVIA 3TA4D 3E80A 5LHDA 4QXUL 4M1GL 2AV1A 2MQGA 5JHLH 1H0DB 2F19H 1DQLL 4ATTA 1BYPA 5D1XD 1H3XA 5IF0A 2IIJA 2LAAA 4I85A 3I3BA 2VL4A 4BSJA 4EBQL 2WK2A 3MRHA 4FADA 1KCBA 1UGNA 2X4OB 1HHIB 4JO1H 5IFJB 4JDTH 3FQWB 2YXWA 2YLKA 3IMUA 1MY7A 1OLLA 4GKLA 2IXQB 4HEMA 3VFTB 3RJOA 1JWUA 4GT7A 4GSUA 5FECB 1F58H 2XDHA 3WEXB 1OD7A 1JZEA 4WU5B 1D7FA 5T1LA 3UTZA 1MQ8A 4D0BB 4YSCA 4K7PY 3C2AH 4M6OH 5C0AE 1CO1A 4PLJD 3VXRE 3MJ8B 2I5YH 5ICZB 2APTA 4R5VA 3ATAA 5AEAA 1HKLL 4I87A 3QUMH 5DFSA 1JJUA 1WGVA 4PJAE 5FA4A 1BFSA 1WZAA 1Z0MA 4J3OD 2VN5A 1NCJA 3Q2LA 2O6EA 3S4SB 3BLBA 1CXKA 1DVXA 4QAWA 3M8OL 5TD4A 4AQ8C 1TYRA 3QRBA 1T04A 2XPYA 2GBAA 4Q9BA 1MCPH 4GT0A 1U8NB 4OFKA 2D7OA 1U8OA 5TDNA 3CH8A 1Z7JA 2YMXH 2CD0A 4M8QA 3BAXA 3NIFF 2C1OB 5CGBA 5FB8B 1AE6H 1NCOA 3ETBF 2KZBA 2X7LA 3PYCA 3QI9C 5KYYA 1WA0X 1HINL 4YC2C 4UBDC 4KPHL 3MJ9L 1CGYA 2PW1A 1CFNB 3NTCH 3UTTE 4Q2ZA 3RFZC 1I6EA 1XGUA 4HH9A 3REVB 2O4EA 2EACA 3KPMB 5L0QC 3L7EA 1CFTA 3LNDA 5A2KH 3MV9E 5F3HB 1FJ1B 4WHDA 1U3YA 3OLGA 2TRYA 1MF2L 1F4AA 2A6IB 2Y06L 4FNQA 3SO3B 5KBMA 2A0LD 3DPBA 4J3OH 3QCVH 2CIKA 3EO0B 3MX0B 5DHVB 4N2LA 1XH2A 4XX1E 3EUUA 4DOHE 5CD5D 5F9DC 4NQCA 2NDGA 1PPIA 3JXAA 4FQQB 4LOUD 4WUUB 3OKEB 4B9JA 3MLSL 5DEFA 4YX2L 1RK0A 2GW5A 4G5ZH 3IGKA 1P1ZB 1O0VA 4EI6A 1L7TL 1A9BB 4F8PA 3NBNA 3T6QC 1UATA 1A1MB 1GGCL 1NSNH 4NHUB 3DOIA 3T0DA 4B6ZA 3BGFB 4Y16B 4R83A 4LSTL 2KDGA 5TF1H 3K2MC 3LN5A 3PJSA 3KPQA 4XCEA 4FA6A 3VH8B 4AH2A 4LCCC 4X8XA 2Q1EA 2AI0H 1VIWA 1YDPA 2AITA 4LPCA 5FCSH 3V6OA 4U3FD 4GG6A 4IKLA 4DO4A 4I5BA 4ABWA 4EKXA 5DJQB 2JKLA 4YZWA 3ZT7A 4K3HA 5I18L 3GT6A 3HRPA 2PCPB 3QUXD 4V2BA 3SD2A 2HKAA 1PY4A 5KAQG 2GG1A 1ZS8A 5DDHB 2Z31B 3FYEB 3SCMD 1PPJD 2XXCB 3NCYS 3SKOB 3UZVB 4EEEA 3U4AA 3O8XB 4Q9RH 2E9BA 3IGUA 3DURB 1KYDA 4J5VA 1NFIA 2VE6B 4PJIB 3ROLA 5HYSA 1OTUD 2YXMA 1SN5A 3QG7H 1N8ZB 1CTYA 15C8L 3UBFA 1M1XA 2LVCA 3IB4A 1CXLA 1KJVA 2QTVA 3O2VL 2GY7B 2WMPB 1TJXA 4H26A 2NNXA 1SLVA 4WGWB 5JNYB 3L2MA 4JRYB 4MD4A 4ADJA 1JVLA 5HJ3B 3IMWA 3UEQA 4A39A 4J3UA 4OKDA 4BBWA 3PWVB 1OARH 3ZOOA 5DQDH 1FE8L 2BNQA 2FHFA 3NEXA 3O8XA 4HAFA 4G43A 4QRRA 3LXCA 3HE6B 2Z4QB 2YAEA 1X6LA 2EAEA 2GFBA 3SD5A 1GQ1A 4FJ6A 5JIQA 2H2PC 3UJJL 2JELL 5TPWH 4E41B 3EYVB 4HJSA 4DUVA 4ZMWA 5HYJD 1I85C 3ZLQC 3IBEA 2HRPL 4YC2B 4JFWA 2V2WA 3RG1C 5DLMH 1MCHA 4DPAX 2QKSA 5DS1A 1FL5A 2Y6SD 5D6DA 3MV8A 2PYEA 4UM8A 4HUWB 4IYKA 5C0BD 3GXIA 4NLAA 2WLHA 3DJZA 3AG1B 3QEHB 2NY7H 4IRJB 2NTFB 1F56A 1AQDA 1AP2B 4NP9A 1JGVL 4RISL 1I53A 2Y36H 5T5FH 3V7AG 1SZNA 1TZOA 3HE6D 4TL5A 2LGNA 2Z4QA 3M07A 5BV7L 4K8RD 3QZNA 4KKLC 4S1RL 2ADFH 4QHUB 43C9B 1NEUA 4M43L 4WFFE 2OMXA 2YD7A 3FU0A 3CDGA 3QHTC 4Z18A 4PJ5A 3REWA 2OZ4H 4PLNC 5LXGH 4Y4FD 4QHMA 1EX0A 4KGLA 4N2FA 4ODTL 5HHOA 5IHUL 3BUDA 2ORBL 1AMYA 2EUXA 2WYHA 2L0DA 3QFGA 3CZSA 5GZND 2Q7AA 5IM7A 3MLXH 4OCWL 5TE7L 3Q01A 2WV3A 3E8UL 3DX4A 2NY0C 4X7CC 2WP3O 2VKWA 3RUGE 4DTGH 3B9KD 4PS3A 3MVSA 5EUOF 2V4LA 3FO9B 1KELL 2G9KA 4C57C 1AH1A 3WUWG 3PAUA 1JZFA 4PJAF 2OMTA 1MHEB 2FJGA 2HFFA 3EHBD 2QADC 4HWEH 3BSGA 3L74D 3N0AA 3QNYA 1KBGL 2N3JA 3VWJD 4J3VA 4PHXA 3M7OA 4RMRA 2AXFA 2HTKD 5IHZA 2VMDA 3WMSA 4X83A 1FO0B 4ILDA 2WO2B 5DRNB 1NEZA 4JFDD 1V7NH 4BV1A 1G0YR 1X5GA 3GINA 3RL1A 1I82A 1PZAA 2G3NA 1ZLVK 1RJCA 4UBDD 2D31B 5CCJA 1AY1L 4RA3A 3IGLA 4LPWA 4XMLL 6CGTA 1HKFA 1TZIB 4NKMB 3VFMB 3UGXA 1AIFB 5KANI 5MEND 1OTSC 5AW4B 3D3VB 1N10A 5DVNA 4WUUD 3K6SB 1EGJL 1PYWB 3B8YA 2OSLB 3KLLA 4X98B 5IR1B 5J7CC 5ACLA 2XYCA 5E94B 1DJXA 1U91B 1YJDC 1NFDF 3GJFH 4ZQKA 2YD4A 4I9WD 2C3XA 5CSBA 4Y1AE 4RVBA 1SM3H 4ONHA 3QZWB 3N55A 3UG3A 3SQOL 1AR2A 1U8HA 3FQUA 5A2BA 4NUQA 3FKUS 5BCAA 1YEFH 4FZEL 5DMIH 1ONQA 1OO2A 1TJGL 1UWEH 1J0KA 4Z95L 1P5UA 1C1EH 3T65B 4R0LC 4H0HB 5I1LA 1JCKA 2YHGA 3VXSB 3QXDB 2CXGA 3N9GL 4OZ4B 4GW5B 2E7HA 4KK9D 1W72L 2BXZA 4KKNA 4F92B 1QYZA 3JVGA 2OTWB 1GC1L 2H7WA 1CURA 4X4KA 1M4KA 1P5VA 1BXVA 1MREL 1JOIA 2DJUA 4N0UE 2ZQKA 1J5OH 3ELAT 1MNUL 1OTTC 1ADQA 4KITB 4FLOA 2IPUG 4XI5C 4Z7WE 5FM8A 1QA9A 3X12A 2EVIA 4HJEA 1NH6A 4AJWA 5KBPA 1Y07A 2X2IA 2K45A 3GBDA 5DRXB 4AZ8B 2HYMA 2VR5A 3NA4A 2MNWA 3BAIA 1HH6A 3VMNA 1PKQB 2IWGA 4MMZB 4QI3A 3Q8FA 1A6UH 1O9VA 2AZUA 2DAVA 3N41F 3S35L 4MS8D 4R7DA 4DW2H 2IBGA 3KM2A 5DWUH 5EU6E 4BCXA 4KROC 4Z7NF 3MBWA 2OP4H 2XWDA 1LK2A 1J87A 1P84J 3QNZA 1PD6A 2YFNA 4YNYA 3FU7B 3MRPA 4J1UA 2X3BA 1OAYH 1CLZH 3D4GA 5KEZA 3EJZD 2IH3A 3V6FA 1BFOA 3HOGA 2P5EB 2O5XL 4ODSL 1MUJB 3QI9A 2QPEB 1TTCA 4L4VE 2VSDA 1XR9B 1B90A 2FJUB 4BFKA 2BS71 1JPTL 1JWMB 3CXDL 4O2FA 1KV7A 2NY4B 1E27A 4A2DA 3VSUA 2R69L 1J9TA 3LKPA 4K4KA 4AVJA 3OAUH 3MBEA 2X5PA 2CGYA 2F08A 5BO0D 3ABMB 2NXYD 3EOAA 4JS7A 1AR1D 1NTDA 3KWWB 4PJ5E 4Q6IC 1JV2A 8PAZA 1JNHB 5DT1H 4YSEA 1KC5H 5DRWA 3RGVA 2X70A 2OR7A 4QHKJ 4QRPA 5KTEH 4OVUA 2VIRA 4HGMA 1SYVA 4HZ1A 1DBJL 3CZLA 2GI0A 4EIGB 5J1SC 4QY8A 3V5DB 5EA0L 4V2KA 3IDMB 4M3KB 5ADPL 3OPUA 4JK0D 1U8QA 2ZG3A 4NQVB 4XN2A 3C8HA 1PZ3A 1FRGH 4PWGA 5JW5B 1U58B 1FCDC 3L5IA 3CG8A 4DP2X 4F7CA 4CMMB 2ATPB 4CKQA 2IDSA 2OCFD 2JFCA 5AW0B 5HHVL 1Q9LA 2EDXA 3RVTC 5C0AA 1T0MB 3QZWG 1BSIA 4HV8A 4QRPD 4B9FA 1CDGA 1S7RB 5FYJD 3TH2T 1R0QA 4OGXL 3SPVA 1NMBL 1LEGB 4NQSA 2WTRB 4R97B 1OAXL 4WV1A 2E74C 3C60C 1OAUH 3VI4E 3VRJA 3ZZLA 3GFUA 5F71A 3VQMA 3J27A 3ULUC 2VJ0A 3RLMA 5CIPH 1TEYA 1HHKB 4J6IA 1NCWL 1AGBA 1R46A 1Y18A 4QWWC 3VD4A 5DQJB 4NYLB 3ZX1A 3A6CL 5CN2A 3WS6A 4XXLA 4EPSA 6PAZA 3QIWB 2V7NB 3MRGB 1EFXD 1WK0A 1XCQA 2WKGA 3CNKA 2CO3A 3K80A 3BQUC 1S7XB 4FX5A 4ZTPH 1EO8L 1T0MA 3VH8A 4AH2B 1F6AB 4QNPF 5DJZB 4AGOA 2E7DA 4NWTH 3NSYA 4QHLB 3H9YA 5MI0C 4JQVC 4F37K 4JGUA 1IAII 4U6YA 2ZKHL 2RQ8A 3C9NA 1B6UA 4L0PB 4ESKA 1BAGA 4Z77A 4ZI8A 2P4AB 4ZJ9A 1ZT4A 1AO7D 2P5WD 1I4FA 4ZT1A 3WYRA 3P3SA 2XLLA 1E5AA 1SMDA 3KPNB 3KXFB 4IBQA 2ITCA 4N2NA 2EDLA 1FV1B 1JWUB 3RDTD 4M9PA 2F53D 3KPSD 4GIOA 5BMFL 1BFOB 1F4YH 4YH6A 4YXHL 1J8HD 2EDTA 5DFTA 3PQYD 2NOYA 3MNZA 1YQ2A 1N0XL 3CHOA 5JIMA 1U3ZA 4M61B 4WI0A 5DUPL 3KBFA 3T2QA 4Q9QH 4PJ6A 4FQHA 3SBWA 3V5HA 3B7YA 2CK0H 3GBNL 1I1FB 4OIAA 2ZCHL 1OALA 5KVGE 3CX5D 1ECYA 2X1OA 4E9XA 4Q89A 4DK5A 5SWSE 4QHMB 2A6JB 3LH8A 3UOAB 1DQQA 3FQWA 1OWWA 1U93A 3VI4F 1Z9PA 2C4FT 4MVBD 1VFBB 5E0QA 5FYKD 4B5ZA 4B9ZA 1XDTT 2FT7A 3LCYA 3VG9B 2UXFA 3K2IA 5DZOA 5CCKH 1DL7L 2VITA 1DBAL 2L4OA 3F85A 4OY9A 4Y7MA 5IHBA 4P46B 1FFRA 3AU1A 3HQ6A 2VJXA 4NJAL 4BFIA 4NIKB 1CBVL 3L3HB 4MJ2A 2YSSA 4GSDH 5HI5C 2HUEA 4QNPE 3B56A 2E47A 3EJJX 3H7BB 2Q86A 4MNQE 5JLZA 4I9XA 5FO9A 2VDQH 3JWOH 3W56A 1BQ5A 3LXAA 4R4BB 3X1EA 2DJSA 3EADA 1ML0A 3GMQA 2DEXX 3PQYE 5I8EA 4BGLA 4BE6A 4YXLL 2A9ML 3DTXB 1UXSB 4A7QA 2B4CL 3FTGB 1E6OL 3CZGA 5K33A 4L0YA 5DFVC 2ZOLA 1K8IA 3BFWA 5DVKA 4D0DA 3RZCA 1SLUA 5IHHA 5E1QA 5DO8A 1SGKA 1F3DH 3U46B 3BDYL 3C60B 4NERA 1UCBL 1CF8H 1EZUA 2VNCA 1JZDC 2R4SL 1GYCA 2XZCL 4EZLA 1SEBA 3ME0A 4NENA 4APQA 1CE1L 3NAAH 3T2NL 2OL3B 3DOHA 3QPXH 4M5YH 3BQUB 2HT4D 1GCFA 3JUZA 3AVEA 2CE1A 3QR0A 3DRTA 3HIZA 5FS5A 2R1YA 4RGNC 2CALA 2OMZA 5JIKA 1G7IB 2B59A 1YEKH 4PP2A 3QK0A 4JDZA 5F0MB 4F7MB 4HU8A 2IDCA 3KHQA 5CWSB 1TTGA 2VE6A 4JO4L 4PJIA 3HZYB 4PW4A 4WWID 5DO2C 1J1XL 5DSCA 4BJLA 5FCUH 3OXRB 1H3GA 2P48B 3ZBMA 3UZVA 2YCCA 1WFTA 3B7SA 4HJJH 4JFPB 1M05B 2N1KA 2G3ZA 1HXYB 3WJLA 4M7ZC 4YDKL 4XNQB 5GJTL 3VTAA 3L3IA 5L2KA 3AS1A 3ZE1E 4OT1H 4J3BA 4OLZL 1K8DA 2C3HA 1DJWA 5FFGA 3I50H 1BM7A 3R06B 5E9DE 3EHBB 4YIQA 4HXBH 3IMTA 1TITA 3UBGA 4QRUB 1I3VA 3QAZB 1YMME 4HIXL 2VXVH 3PP3K 3VW3H 3GRBA 2K78A 4WQOA 3TC9A 4HUMB 2DVHA 5F7EL 2PXYB 3DPDA 1EAPB 3VFVA 1RIUH 3ZE0B 4J8RB 2YKLL 1CIEA 1JGLH 1M7IB 3FUIA 5GHWH 1I9RH 2HJKA 5EXQA 2CHZA 2ZAHA 4OI9A 2HX7A 1DE4A 2YC1A 3EW3B 3ESMA 4L8BA 4P4QB 2BWQA 4Q52A 1I8PA 5H94B 2AVGA 2XN9D 1EHNA 3MRLB 3NIDF 1SLWA 4S1DC 4XCCL 4BZ1A 3MACL 2Z92B 3X14B 3FHQA 1NM4A 4Y2DA 1HZUA 2XXFA 4LARH 4HD5A 4I3GA 3CXHD 4MHHG 5E4EB 2YPVA 5D4HA 3DUHA 4ZXBA 1PVHA 1DVFB 4PJ7E 1UZ8A 3LNGA 3RUGF 1QPKA 2OK0L 4LPUA 3MOBH 5E4AA 4WUUA 4TMPA 4HULB 3LRHA 2K4AA 3DC0A 5C0GB 4IBYA 4X2UA 3HAEH 5TFSL 3FO0H 3OM3B 2OM5A 4CC4A 2YC1B 2V2TB 1AD0B 3MRKA 5EOCL 2R2EA 4G43B 2EEBA 4IRSA 4QRRB 3FH8A 3CFIC 5T1JA 1I8LA 1BZ7B 1E9OA 3NN8A 2DQHH 2AK4E 2X4SA 3LRMA 5SWQA 2P5WB 2FTAA 4NDMA 1AQHA 1WEJL 4J3SA 1BLNB 1ETZB 4N25A 2XQYG 4JM2B 4CSZA 5HYSG 5JOPD 2X6BA 1P1VA 1MWOA 1X4ZA 3G3LA 1DVZA 1AS8A 3CFTA 1KPRA 1QWNA 3DV4A 1EFXB 4JHAH 5AWNL 2ZPKL 3R06A 4P2OB 5DJDA 5HDRA 3WDHA 3V9FA 2EZ0C 5DRNA 3DURA 2QVMA 2CAKA 3GK8L 4HS6A 5IQMA 4M5SA 4O2EA 2EO7A 4ICWA 1PZ5A 5I1EH 2LT9A 1IAIL 4KI5E 2VDPB 1U4EA 1NGWA 2MTPA 3OQRA 1YEAA 1SXBA 1FORH 3B2MA 3V0AC 1IBHA 3I02B 3SQBA 1BZEA 5CKAA 1FPTH 3ZKQD 4E9VA 2PUQT 7PAZA 1DQTA 1X5MA 2JE8A 2HH0L 1CEDA 2Z31D 5GRWA 3BVXA 1JK8B 2F1EA 3TA3C 5ABZA 3Q43A 5DHDA 2ICES 1MHPL 1F4WL 1FZMB 3L4VA 4PJGB 1LEKA 5KZCB 1NJ9A 1AS7A 4C56B 5FA3B 4YDVB 5E6IC 1OGAE 4EQ2A 1I6DA 1V8HA 5C0BA 4Y2OA 5DMGD 2EICA 3TVMD 2YUZA 1E6JH 1G1CA 3AS0A 3KYAA 2YARA 4P4KB 4PD4J 3GI9L 3GPSA 2R9HC 4RSYA 1C6OA 1KBWA 5EG6C 3BVNB 3GJEA 1R3JB 1UD4A 5T3XL 2VRKA 5TQ2H 4KKLD 1NDGB 4ZUVB 1C7MA 4XCNA 2XG5B 3ARTA 4MASA 1IQCA 4MXVE 3HI5H 2FX9L 5CO1A 1OP3K 5EZLA 1DVFC 1W8OA 1ZTMA 2EO9A 4POZC 3P0VL 5TDPA 4Z0XB 4Y2OB 2BHYA 4PVLA 4M5ZH 4XGZB 1YFCA 3D8MA 1KB9J 2HT2C 2I60H 5I16A 4CU8A 2VLRE 4LJIA 3RWIA 3HPLB 1A7RH 2R23A 5LUMA 1FHGA 1VPOH 2GAZA 1AGDA 1UKSA 4LKCB 4TF4A 4XXDA 4APQC 1EEZB 4ZBJA 4LLVB 5DZ9A 2A6JA 3GLZA 3T6WA 4CBZA 3ES6A 1B4LA 1E9PA 4BFNA 1BQHA 3HC0A 3M88A 3ARGD 4G8GD 4L4VB 4KRLB 4XC1H 1YAIA 4NNXB 4QIRA 2WVUA 3U4KA 2R9HD 1MG2C 2MOQA 3V4PL 1MJ8H 3SCMA 2WW8A 1JP5A 3QEGL 3AU1B 5CIBB 4B97A 1TT6A 43CAB 1C8PA 4H44C 2PW2B 3FDWA 5E2TL 4WVRA 5E0FA 3LIUA 3HCVA 2F58L 4G7QB 1YNLH 3VFRA 4JFQA 3DMMB 1U4FA 1A6WL 1OCCB 5AVRB 4OQTL 5EULV 3RTQD 3ZE2E 2EYRB 1CRYA 1RZFH 3QHFL 5DZJA 5AW5B 4UQBA 2BNRD 5FEBA 1HL8A 1PSKH 3NCYP 4EF3A 3EOTH 4R5XA 4ZPVB 1MN4A 2CA4B 2WNWA 1NCGA 3P2DA 4XNMB 5LJYH 4R96B 1P9MC 1OPGH 3ZHFA 2B0ZB 3F8UB 4NZUH 1IARB 1UOVA 4DP0X 1P6AB 4ZMAT 4DGUA 3BAEH 5SWZB 4CNIA 3CFMA 2IPKA 3EJTA 4Q8BA 4Y5XA 4BQBA 1ZA3B 4DQAA 1JDAA 4FG6D 8FABA 2RCSL 3PNWA 3H42L 4JFEB 1FGNL 1GMIA 4HH8A 4ZNEE 3IDUA 5FWQA 4JHWL 4HDIA 1NC4A 2OR9H 2GJ6B 4LQFL 2IJ0C 4JX0A 1YLBB 1M3IA 2OW7A 4X6DA 3DPBB 3Q5OA 4MNQA 4ZRGA 1OCZB 2X9WA 2FATH 3NCJL 5B4MC 3UMTA 3Q13A 5KZCD 5C0DA 5D4IA 3CHSA 1S7RA 4DCQA 2XJLA 1V3KA 3UTPD 4Y1TA 3L3GA 4MKTA 2X9ZA 4J39A 1EVTC 2IEPA 2F5AL 4AEEA 4DO5A 2NY5L 4EDWL 2K6ZA 1OCWL 4KK9C 3V4VB 1OOAA 4R6UA 2VWEE 4N3TA 4JFDB 4YEEA 4YO0A 2X53A 1OM3H 2MTAC 1SOSA 1FNEA 3CSFA 5EC1A 1HHGA 2XFGB 5IJKC 4N6RB 4XVJH 3UMNA 3IETA 4K7PL 1MZ4A 3I2CL 4JO2H 4HD9A 3RA7H 3H9SB 3Q2NA 1N7ML 1IC7H 3TBWA 1BAFL 2J6EA 4AGQA 3IXTB 1MIEL 4E42B 5DJYA 1BJ1J 1SNRA 1MJUH 2IANA 3JTBA 4TVPE 2OYMA 1ZHKB 3OB0K 5CKGA 3SE4A 4QXVA 3B7TA 1IRAY 4JAMA 5BQ7A 4HJGA 5MENA 3GIVA 4WFHD 4X99A 3QPQC 3U83A 4DFHA 2CSPA 2JK5B 2XI9A 3MXWL 1GZHC 1W0VB 4DP1X 4F2MB 3AUWB 4XVUC 1RD6A 3MRCB 2WXPA 4BFIB 3TU6A 2C2CA 3T0BA 3JWDL 3CXHK 1FZJB 3CFKB 1IGTB 5D7HA 1J18A 1FV1A 3U0WH 1NAKH 2W91A 3C5JB 1KFGA 4PJ9D 4ZD3H 2MEJB 4ZUSA 4AEHH 5DR5H 1WFOA 5B22A 5IY5B 4UQ2A 1VF5C 3Q06A 4DKEL 4X7SL 3MRHB 3CCHA 4D8PA 5I8OL 3N5AA 5ICXB 4JAMB 4HK3J 3VUAA 5ANME 3RAJH 4X99B 2D03L 4KK8D 3NZUA 3AY2A 4FQ2L 3WTUA 5DJZA 1D2OA 4U4BA 1M1SA 1NANH 4LOFA 1BXUA 1BQKA 2WVVA 3RIFF 3WG7B 1WTLA 5HYJB 2MOGA 1G6VK 1FVCB 1IFHL 3II3A 1O6VA 2VWEC 3GJFB 1CDIA 1JPGB 1F86A 1XV8A 3LRGA 1BFTA 2A1WL 4BQ6A 5DEFB 2PP7A 2ZUYA 3B4NA 5D2LA 3LZFL 3W5NA 1P4UA 4KROB 2R4RH 2ZTBA 3OR6B 1HHGB 3HE7B 1SBSH 4Z1PA 4IOSA 4JJ5A 2FWOB 3U36A 1UTDA 4JR9L 2AAVA 2IDQA 2XIIA 2DQEL 5BVPL 4YVUA 3DVNA 4B27A 4X4ZA 4KHXL 1DYZA 3ZTEA 3Q6FB 5LVEA 4OTXL 4P2QB 3D34A 4OGAD 2ESVA 1XF5A 1NMLA 2DI9A 1JTTA 1YN7B 4EOWL 2O72A 1B0WA 1BCIA 2F8VA 4K5MA 5B1AB 1ZZHA 1AQKL 1BP3B 3PAVA 1JZ3A 4FLQA 3OAZK 2ZYSA 4HQQH 4FDWA 5EV7A 5SX5K 2XZQL 3FTVA 3DK0A 2N9IA 3MRJB 2W95A 1WZKA 4MA1C 3W3BA 1T03H 1KEGH 4FTVB 2GSIA 1K6QH 5LO7A 2VDRL 4HKZA 5L4JA 3VG0H 3ZKMD 4K9EH 4U1SA 3RKDD 3WIHA 1BMZA 4KRPD 1LEIB 5TE4L 5H35A 2LOEA 2IFGA 3P3YA 1FF5A 1MJ7L 5C2BH 5GRJL 2NQCA 4F2FA 4GMSL 2YEZB 1JPFA 1RK7A 4OLVL 5LCVH 2ZG1A 1Z9LA 4AMKL 2F54D 1KTRL 2JKSA 1A4CA 1UACL 4RAUA 4GYDA 1LE9A 1AI1L 2C1PB 4MDRA 4X5RA 3P30H 4ZW3A 1JD7A 5FYLD 1D7BA 3AZUA 3HNVH 1OAKL 1E29A 1OF0A 3RX5A 4AT6A 5SWZD 4XMZA 3B1TA 2A83A 1B88A 2XWRA 4JZNA 4DGIH 5BS0B 1GU2A 4PRPA 3VXPA 1E5UI 4LNRB 1XL4A 3DTUB 4AK1A 3VRLF 4QJ4B 1KWGA 3AROA 1J11A 1J3SA 1RFDL 4V11A 1NWPA 3V2AR 3MCKB 1N6VA 4LCIH 3BZDA 5DMKB 2VO5A 5IGXL 1TNNA 3SN6N 2V7NA 3MRGA 3WAKA 4Z7WA 3JTTB 4WJ5A 5D96B 4JRXA 2Z7WA 3IFLH 2E6PA 4FA7B 1CS6A 1JPST 2GAZB 1R19A 4XNXH 5CCHE 1O7DE 3RX9A 1BEXA 2GIWA 4F1SA 3FFDA 4L18A 3I75B 1YNTA 4K23H 3AS3A 1ZKAA 3BZ5A 3CDGB 2ZXBA 1B9ZA 3QDHA 4FXLA 5LB1A 4RGNE 2N56A 4A7GF 4NGHH 3EYQC 4OB5H 3GSWB 4JPVL 5C70A 3IRZA 3SDDB 1ZV9A 2Y22A 4G8GB 3B7RL 3HA0A 4UM9A 5SWSA 1S7QB 4XNUL 2LU5A 2NY1C 2UWEE 1EFXA 5IHLB 2OZ1B 3R7RA 3IMRA 1B0GB 3L4ZA 4AV5A 5IM7B 3BIKB 5D2LF 1IC5H 1SDDB 1DP0A 2CR6A 4DP7X 4OLWL 1K4CB 3RNQB 1E8XA 2YMTA 1VDGA 1WTGT 4M6AA 4X7DC 3HPJB 2JKJA 3SDXF 3T1FA 3H1ID 2AANA 2VRAA 4N2OA 3U0TA 4NQUA 3C60A 4TVUA 2YK1L 5CS7A 1KENL 2JJVA 2J25A 3ULVF 2V9UA 1ETZA 4KKPA 4PR5A 3QUHA 2GIMA 1R75A 2GI7A 4J4PC 1RHHA 4L3EB 4P2YA 2DLFL 3TH4T 1X9QA 4NUJB 3Q8AA 3TLRA 3TBYA 2WQWA 4LCWB 3X1FA 3D69B 3QDMB 5ILTL 4I3SL 1CB4A 2EE0A 2EADA 4PJBB 4HOXA 1R5WA 3OB0H 4KMTL 4ZFFA 4FD0A 1XGRB 5I15L 4U1LA 1ZY9A 2Y5TA 2DQGH 3DSFL 1CYXA 2ZZUT 5FA3A 1J1OL 1D7DA 1QACA 1RULL 1IC4L 3JQOB 2GVYA 1AHKA 2YA0A 4UQIM 3STZA 4G83A 5ADOH 2EKSA 5JLZB 5AW9B 1Z5HA 2H0PA 4Y19B 5AW1B 1NGPH 2VISA 1UASA 1QKSA 3EH2A 4MDJB 5G5DB 4KZDH 4LSSH 2XKUA 1A6AB 4KDTC 2Q8BL 3QFJE 1AZNA 1NCAL 3S5LA 3QWRD 4NO2B 5EUKA 3EDKA 5IMLA 3B2UC 4XTRD 5HHNA 1CWVA 4KAQH 2A77L 2CLZB 3WJJA 4DKFL 3FH7A 4DEWA 1BDYA 4UB8V 1RZGB 4FA1A 5B8CC 3QRGL 4P04A 2FGWL 5E4EC 1YNTB 5L8LB 4QMEA 4LLMB 4J2QA 3DXAB 2Y2YA 4HUXA 3WD5H 3L6FB 1G1OA 2BLFA 5BJTA 1HIML 1B4RA 4GAJL 4JN1L 3O11A 4NQXB 5EU5A 5TQ0H 3I9PA 4AYEC 3LQZB 3HUJB 4UZSA 3IDNA 4R7VA 3CU4A 1I9IL 2N7SA 1I3GH 4AQ8A 1QYGL 1Q0XL 2P24B 2X0VA 2QGBA 5ISZB 1QSVA 1K3ZA 1FFPB 3DSNA 4Y88A 1I9JL 1ASPA 3LS4H 5HYFA 4OLXH 4YHKL 1YY9D 2B0SL 4MLSA 3UGEA 3C08H 1DW1A 2XN0A 5M7QA 4PTUA 4L3EA 4WFEE 2IFFH 4IM8A 3ETTA 12E8H 1C16B 5C0RH 3HR6A 4IDLA 1KXVA 4EICA 2EC8A 4M7JL 1SXAA 4H4NA 3H2QA 2PYEB 3IN0A 2VLRB 1TTBA 3UGUA 2XG5A 2PP9A 2WKLA 2YZ1A 3G08B 3GHBH 4FXKB 4OCSL 3STZB 2OULB 2G2RA 3LKRA 3OL2A 3P4OB 4I2XA 5BRZD 1Y0LB 3ZOYA 2CDFB 3ASWA 2RALA 3DSNB 3EHBC 3C8KA 3Q8CA 2X12A 4L5FL 4OLYL 2FX8H 2OMXB 4LBEA 3KPSE 3BVWA 4LGSB 4MZ3A 1GPOL 2ZWLT 2AJVL 3K3QA 4N9GA 2Q2EB 5A1AA 4QRSA 1XEDA 3QJHA 1KIPB 4JZOB 1BPVA 3O41B 1EAJA 3L9RA 1GJQA 3O6FB 3H0TB 2PXYC 2PO6A 1Q8MA 2DLHA 1H8LA 4NQCE 1BQSA 4GSRA 2F54E 2GJ6E 1UOKA 2H1LM 5JHAA 2Q87A 1SQPD 3LVTA 1O7VA 5GGSY 2FD6L 3LPPA 3TIEB 4KI5C 4WJG3 1RHFA 2AEOA 3EGDB 3M17A 5E8NB 3GMMB 2EH8H 4ZFOL 5TH2B 1PX8A 5FGBA 4M8VA 3N1QC 2JKNA 3FS9A 4BWWA 5DUMH 3U1SL 1NCIA 2L4DA 2VN4A 3LJ3A 5D7SH 5TTRA 5IJVB 1MQKH 3CMGA 4LRNH 3JUYA 4K3DH 2AFNA 1T6BX 1N9CA 3NACL 1HRCA 5T3ZD 3OAYH 3TV3H 1M2OA 3TWCL 4HUCA 3VA6A 3BPNB 1DQQB 1JYXA 2VLJA 1NLBH 3LKQB 5I73C 4K5LA 3IMVA 5KS9B 1QBAA 4KZEL 2KL6A 5ESVB 3S36H 4GO9A 1BVLB 1G0XA 2CBOA 3K5SA 3PGCA 3RDTC 3IF1B 1IBDA 3LN5B 2XWEA 3HS0B 2VGLM 3FQXB 5F6HJ 4G11A 3U48A 1YSOA 4R26L 2R0KH 1CRHA 4JM2C 1VACA 4YN3A 5CLYA 1LEIA 1LO4L 1PG7X 2AJSL 3HKZA 3O81A 4PRAA 1NAMH 3U1PA 3MTXA 4FCHA 3U82B 4K07A 1PY0A 3GSVA 5IKCA 5JZ7C 4IKNA 5JDJA 1UUNA 5EU7C 4ZUWA 1PQZB 2E75C 3MGTB 1KUMA 5JMOC 1V7MH 1NLDL 2RD0A 3SQRA 4OJDH 3GKWH 4UNTA 4KKQA 1SDAB 1HH9B 3TTYA 3NWVA 4KKBD 4MNGE 4PJ5D 2EDMA 4UMGA 2R0WH 2XBDA 3OCDB 5KLIB 1SY6H 2DWDB 4QLRA 1Q0YL 5FO8B 3FUHA 4KVNL 2G3MA 3ET9F 1RK0B 2F8IA 4QRQA 1PP9D 1J0JA 1NMAH 5AOLA 1YEEH 2CHNA 3O4LE 4NBZB 1T2QL 4KQ3H 5DCCA 4NRXB 1NQBA 1U8JB 1DJHA 4IBZA 1IGYB 3AT0A 5BZWA 3IWUA 2HTLD 3OKDB 4M6MH 4H25B 4JN2B 4MB5A 4KY1L 4U3SA 1IKFL 1E4JA 3ZK0A 1ZPLA 4TUKH 4J20A 1S9VB 1RMFH 1TZGL 3IU4H 1FQ9C 3Q7JA 2GJZB 1CDUA 1GYUA 3IJHA 1IBBA 5FKAA 2QR0A 5FLVA 2J4WL 3ZDYF 3FB5B 4ZDHA 1VADB 4LP5A 4P4KC 3C8DA 4G7YH 3T6ZA 4MAYA 4MZ2A 2LTQB 3LNIA 2FJSA 5IY51 3GXFA 3N1MC 1FO0H 4PJ7B 5CM1A 2VDPH 3RJQB 3KJ6H 4RWYL 3P3RA 3CCHB 4D8PB 1KYUA 4Y8DC 4U3SB 1P0SE 3F64A 3K72B 2BP0B 1J7VR 4LNRA 5F96L 5DHYB 3VU1A 4KO7A 1TVBB 3H56A 5EC2B 4AC2A 5KW9L 5DHVH 2D0FA 3TV8A 1EZVX 4O02A 2B2XL 3CN0A 3HMWH 2IPKB 4WAFA 3UC0L 1HQRB 1WUNT 1JPGA 3IMSA 4EN2A 2HMID 2I85A 3AWGA 1WFUA 2O1AA 3N85H 2UZIL 2H26A 5CYTR 1IZKA 1DBBL 1A1MA 2G4GA 2YIHA 4NHUA 4Q4EA 4TNVK 5E00B 1LWJA 3RDTB 3FT3B 3NIGE 3N04A 2WLNA 3PG2A 5KVFE 1NPNA 4PRHE 4YDNA 4A7VA 2EIJB 3UTPE 1YA5A 3UTZB 2ED8A 4N8UA 5IMMB 3IT8D 3WFDH 2C26A 1YNKH 3LXBA 1L0YA 1TJIL 5E7BA 4JFZH 4BINA 1VZIA 5DHYA 2AXWA 3PWPA 4NUGH 2DB8A 3ZTNH 5F7WC 1IAKB 1TVDA 5C9JA 4JFOB 1A1NA 5F7YC 4ODBD 4Y5VC 4Z7VB 5K9OA 1KCWA 4IOIB 4ONFL 3HTLX 4FKHA 3B37A 5F89B 5HHME 1I3RB 3RLSA 5DGQA 4G6KL 3R8BB 4UTBL 3D9AH 4R4ND 3KW7A 3DROA 5DU7A 5EF1A 4Z3IA 3LEYL 4IJ3C 3OPZL 3JWNE 3Q5YA 3HVDA 4GH7B 1U8OB 2MPAL 3GUFA 4OD1H 4WIQA 1IEBA 3ARWA 3L3HA 4JFXA 5F6IC 1F3JB 3D25A 1I7UB 2AQ1A 1Z5YD 3F2LA 1Q9OA 2BNRE 2E9IA 3AGWA 1Y6NR 1YPZB 5E8EA 4GUPA 2XU9A 3BUBA 3EO1B 1L9RA 3LZPA 5DFWH 5T1KA 7PCYA 3WFDC 3HE7A 3BD4A 1MJJB 3KYMA 4P2CG 3VWKA 3OPZH 2KHAA 4OD1L 4A7UA 4I18B 2D3JA 3V4VL 4K8RH 2G75A 3WUZA 4ODHL 4TQ8A 3P9WB 35C8H 2YGPA 3VD7A 5D7KE 4NO3B 3D0VB 5EPMB 4M4PA 4D6TD 1YJDH 1KPUA 3DROB 5D7JA 5CJBA 1V55B 3KXFE 4JB9L 3PNRB 5JHDB 1RZJL 3WIIL 5JXEA 3EYUL 1LK3H 3HI1A 2TSBA 3P73B 4OJFL 4OZIF 3NP4A 3VE0A 1QUPA 2WBWB 2EIZB 3EO9L 1YEHL 1VGKB 1N64H 4OCXL 5GRVK 1D5IL 4D9QD 1PLGH 2V8LA 3QVAA 1AGCA 1DQDL 4O51B 1BD2D 2CO1A 5L6YL 3CDFA 2R0LH 4YBQC 5AD0A 4C59B 1VFAB 4PGCB 2XXGA 3VSVA 1EDQA 3IYLW 5BS0A 1YVLA 4NZRH 2FE0A 1REIA 5L8JB 4PJXB 4A2LA 2EDJA 3GMOB 4JFED 4JM0A 1KJVB 4LFHG 5I9QC 1DFBH 1D5ZB 2IV8A 5D71H 5KUMA 3D3VA 1UYWH 4PJXF 2UZIH 4GEIA 3TZVC 2GTQA 1NZRA 3EH5B 3FT0A 4S1SL 3FQYA 2B15A 2HFGH 4KU1A 1Y1DA 1Q90A 3HMWL 2ID5A 4F9LC 2BRRH 3WEMA 3FU3A 2Z8RA 3LKNA 2BVOB 3LB6C 1INEL 2W1NA 4ELKB 4XPAH 3PHOB 2O5ZH 4LGRB 4BWUA 3JTSB 3EFOB 5IK3B 3V6FB 5C08E 4Y19E 5D70L 1KFAH 4DP4X 1ZXQA 2AIUA 5EIIA 1CF1A 1RIHL 3BKCL 5DC4B 1EZVD 3BPLB 3L13A 4TLSA 3TM6A 1TEGA 4XOEA 4XGZA 4XWOC 4K15A 4MQXD 4YXKL 4YBQD 1QRNE 1A7QL 2G4EA 2QV2A 5DC0A 1CTMA 2D8KA 3EYFB 1NFDE 1TOXA 1ZCRA 4NSKB 4YZFF 2AJUL 1KJMB 2MCMA 3ECBA 3NT0A 4OJYA 5DA4A 5ABDE 1CDJA 2Z92A 1KJ3L 5C8JB 2BNUB 2NZIA 4JLRB 1JF1A 5FHBH 4LLDB 2OXHA 2VOTA 4HIJB 1KGIA 1S4IA 2I07A 4FNUA 4LSVH 1XTLA 3L54A 2E8ZA 4K7PX 4GEJA 4Z7OE 2BVEA 1M71B 1KGXA 5C0FB 1DJGA 4IRZH 1EHKB 4UM8B 3LRLA 2WUBH 3PAZA 4G7VL 5HPOA 2QVKA 2Y2TA 4TN9A 5I6NA 3WUWB 3IDIA 4CMMA 3VCLB 3SE9H 4TUJB 4HFWB 1XMWA 1DQJA 2HJLB 3QEQE 4HIEA 2ENSA 4XB7A 3QXWA 2ZWKA 4OGYL 3BJLA 2YSTA 5EU3A 3ARBB 3MSPA 5JW3L 3AJ7A 4C4BA 4XB3A 1CL7H 3JV6B 2P8PB 1JYVA 2R29A 3ALXA 4H1LG 4PCSA 2YPVH 4TQEL 5I30H 4MJIB 4ZTOL 4XB8A 3DX7B 1MCEA 4H0LC 3TURA 4HWUA 1DDHA 4CW1B 3QUKA 5D5MB 3TH3T 2IAMB 4PJEF 1CRIA 4C56D 1F2XK 5K1NA 3DKHA 4NC1E 5DC2A 4QPEA 3IGAB 2NY4C 4B9KC 2P43B 4BH8B 3VB8A 3S36L 2NZ1A 5C6PB 1CORA 2QHRL 3M1OA 5D9SA 3WIHL 4UQ3A 3GBMH 1ZHBA 2DS4A 2H45A 3S35X 5J11C 2Y6TE 3LZNA 3SGKC 3ESOA 4WTQA 4DERA 4HCRL 1S9VA 1MFBL 5FLUA 1QRND 2Z0UA 5IHZB 5IBLC 2DH2A 2VERN 2H0FA 3NACH 5ESQA 5FUZL 4UM9B 2XN9E 3FCBA 4F2ME 2ZJSL 1URLA 2CGRL 2JMRA 4N0YH 3VFSA 3BIAX 4MD5A 3TNMA 4E9RA 3TYGL 5JHDE 5CFHA 4HA1A 5F7BA 5D5MA 2VQUA 1OGTB 3HLAA 1JNNL 2YBGA 4WEUD 1UM4H 3DYOA 4N1HB 5KSBB 5DMGC 4WDIB 5F7DB 1AC6A 4YK4B 3ALPA 5K69A 3I6SA 3FAWA 1C5BL 1YMMD 1ZHBB 4HEME 1ZK5A 1CHJA 4JG5A 2P52A 5KSAC 9CGTA 4GG6B 1XVSA 5DMKA 3BKJH 1ZGLM 1S9XB 1FAKT 2HLAB 2QGCA 4UMSA 4G6AC 5D93B 4U3HA 5INCB 4WO4D 1MDTA 4A2HA 3VSTA 3MRNA 1VCAA 3K5RA 3U4BL 3SE8H 2LHAA 4AKPA 4F8TA 4XX1G 2A5UA 5JXAH 3HNTL 5AKSA 1H3TA 3EYSL 4N20A 2AQRA 2E4TA 3JV6A 5E08H 3OHXC 5IMKB 1BD2E 4OM0H 3CIQA 1BBDL 5HGHB 5ES4B 2FB4L 2FQEA 4P07A 3DWTA 3SKUD 3WELA 5AG8A 4XCYA 3EJCA 1KWKA 2F0CA 2NSMA 1M1XB 3QWOB 1XH1A 1AYGA 1Q94A 5IB5A 4HMDA 1FZMA 2EVFA 3H7BA 4HKXB 1MW1A 4H88H 2MCG1 3ZVVA 1WO2A 3C5ZB 3N40P 3WE1A 2WAQA 1DLHA 5I5JA 3VXUB 4J4PA 4MAUL 1I9JH 3JWOC 3QZMA 4NHCL 5K1JA 3W1ZA 3DXAA 1FL3B 1LJMA 1CCZA 1TQBB 2DI8A 2IC2A 3E1ZA 2FBJH 3R0NA 5I1GL 2R0ZH 4KJPD 5KJ7E 1Q0XH 2HP4A 4IEFB 5K59E 2NNCA 3QCTL 4HETA 2VCOA 3LPFA 3WN5B 3WBDA 3IE9A 4GXVL 2V9TA 1A47A 2QQNL 4U0RB 3S2AA 4K3JH 4PJHE 1FVEB 4G1MB 1ZRUA 1FI9A 2D3VA 1HIMH 3FTZA 4A6YL 1TQSA 1TG8A 3NSJA 4AXWB 2XRAH 4K3JL 1G0DA 5DQ9B 3NZHH 1TZHA 1SQBD 2YJLA 3GI8L 4HKBA 4NQVA 3SDXE 1NBZB 3QCTH 3UAJA 3RHWF 1T7XA 2HUHA 3KG5A 1NGZB 1IIKA 2QLVB 4MCYA 5I1GH 5LGJB 3IVKB 4KNSA 4YAQB 3GRWA 3MLYH 1NGYA 4OCYL 4YDJA 3DBXB 3RY4A 4XZUB 1T83A 4KTEH 1I4FB 1AYRA 3T8MA 3MLRL 3OHXA 4NQSB 5KYUA 1EHXA 3TS8A 4JPWL 3ESVF 4ZMOA 1J88A 2QPSA 1SJHB 2OZ4A 5IB4B 2JJTA 1MRFL 3KM1A 3KJ4C 2JK5A 5C7XL 1B2WL 2YBRB 4RSVA 3QUXA 1FJ1A 4ELME 3WLBB 3OZ9H 3IXAB 4G8IB 4GQPH 4RZKA 1BBDH 3SOTA 2WY3B 2ZUWA 2N18B 3QA3B 4XPGL 2OFQA 3CX5K 4RQQB 3DK2A 5JW5A 4R84A 4PW3A 3GZOA 4MZIA 3GLAA 4PJ8B 5ENWA 1A3LL 4AL8C 3BEVB 1KENH 2GC4C 2ZYHA 1R3IL 4GPVA 3MRNB 2GY5A 4RAVA 2FSDA 5CZVH 4GRWH 5C0IB 3VWKB 2VQ1B 2ENPA 1QAWA 2AEPL 1P4BL 2I7OA 3ROOB 5B3JE 2I9LB 1UWXK 3RBSA 3N42B 3ZY7A 3IETB 4RFEA 3KPPA 1WIPA 2XICA 3VVVA 1QFHA 5BQDA 1B4JL 2N3YA 1FOCA 1FBIL 2J20A 2NY6C 3BI9X 2W60B 4X5PA 3GHEH 5DJ8A 1W91A 4PJHA 5EEXA 1H8OA 1QI5A 4S0SD 3HMXH 4LLYB 1A21A 5KBDA 4PS8A 5AOZA 1X5XA 4TS6A 4KJYB 5CLXA 3V9EA 1N6QL 4LCUA 1KTKE 3F6LA 4QOKB 2DQDL 5EN3A 2VDQB 1BIIA 4ZFOA 2R1WB 1CLOL 1BBJA 3EFFB 1CFVH 4NJ9L 1X9UA 2W81C 1P84K 4PBWD 3F01A 4X4XB 4XWOD 5L88H 2H6PB 5LNDA 3X3GL 5F93C 3FTSA 4PB0H