2YQBA

Structure of p93a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.4 a resolution
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
454
structure length
454
Chain Sequence
b'KLPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKMAHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
total genus 148
structure length 454
sequence length 454
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2yqbA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yqbA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yqbA02
2OV0A 1E2RA 3MX0B 1WEJF 3L71D 1EZVD 1CORA 1CRCA 1I55A 3CX5D 1KV7A 3WU2V 3CZUB 4YSTA 5PAZA 3NP4A 1NTKD 1ASQA 1JZHA 3WC8A 2FQEA 3CDZB 3NJFA 3T6XA 1FHBA 4P5RA 3GDCA 4UAHA 1KYAA 4AKOA 1X9UA 2BH4X 1ADWA 3ASNB 1V10A 1NMIA 1F1CA 2EIJB 2QDWA 2GC7D 2XU9A 1B7VA 3FU8A 3JT2A 1AKKA 1HJ5A 2ORLA 3ASOB 3OM3B 3U25A 1IRWA 1MG2D 2IWFA 1N50A 2BCCD 1SQVD 1L9RA 3CXHW 2BWIA 2MRYA 4AKPA 3X1NA 2BPBB 4DP2X 1ILSA 1GS7A 1WA1X 4M3HA 4L0PB 1DIIC 3GYRA 1CYIA 2IDQA 1JZEA 2HX9A 3G5WA 1XB3A 3TASA 1A56A 1CRJA 1CRHA 2PPCA 1RZ5A 3HQ9A 2N3BA 1L0LD 1JDLA 3RLMA 4FA9A 1MDAA 1MG3D 1IKOP 1SJMA 1WS7A 1ZDQA 5F7BA 5LDUA 4EIEA 2B3IA 3L73D 3OD3A 4HHWA 4K3IA 3NP3A 2GB8B 5A7EA 3FPXA 4BXVA 3NJGA 5DJQC 4GP4B 4UB6V 1BQ5A 4QLWA 5TK4A 3DIVA 5I5MA 2FYNB 1C6SA 1SFDA 1F56A 2UXVA 2IAAC 1CSWA 1HRCA 3DR0A 1JOIA 1ZDSA 4RH4A 1DVVA 1SDDA 2V07A 2IDTA 2FRCA 4FB1A 4JHVA 2BHFA 5I26A 4YSPA 1KDJA 4GP8B 2IBZD 3CXHD 1CYXA 1I6EA 4M4RB 2VHDA 2PPAA 2ZXWB 2ZBOA 3PXSA 3WG7B 2JFCA 4KOCA 2OZ1A 2DWSA 2R7EB 1OF0A 2XYBA 3EF4A 4X4KA 2YCCA 2WO2B 1S6VB 3L4MA 3L74D 1YLBB 3H4FA 1SQPD 3ZBMA 3NSYA 3T71A 3V9CA 1JZJA 2C2CA 1XB6A 1PF3A 2UXGA 1V54B 5TK2A 3SWSA 5AZUA 3AG1B 3NBTA 2MTAC 1NIAA 2I7SA 1S5LV 4IL6V 5I6MA 4AKQA 1HJ3A 1OAEA 2RACA 3NT0A 1E65A 3TU6A 4DP6X 1RKRA 3ZDWA 1WVEC 2AZAA 3NJIA 4CSZA 4H0KA 2XV3A 4DP8X 1CSVA 2HV4A 1N9CA 1R1CA 1XMEB 2CXBA 5DFSA 2BP0A 2CA3B 1PMYA 4E9YA 3TGUD 4A2FA 4AI7A 1U74B 1GS8A 1BGYD 4YL4A 3FSZA 5AFAA 1CYJA 1J9QA 2J5WA 4DP1X 1ET5A 5CICB 1PY0A 3L4OA 4HALA 1H32A 2DVHA 2AANA 2D0WA 3L45A 1I54A 5H2FV 4EF3A 1WA0X 3OCDA 1FOCA 3PXTA 4DP5X 1E67A 1ZRTD 1AG0A 3WNJA 1PZCA 1TU2A 1KX2A 3WKQA 4YSCA 1C52A 5I6NA 1E30A 1OCOB 4KO5A 1OE1A 3C2CA 2HXAA 2GI0A 1HZVA 1ETJA 2CE1A 2PCCB 1I8OA 2B11B 3WFDC 2BW4A 3BQVA 3DKHA 1P84D 1CIFA 3S8GB 5IY5B 2N9IA 3NJKA 4PD4D 4MU8A 5IY51 5KAFV 1YEAA 2N3YA 4FANA 5AURA 1EZLA 2IDFA 4GYBA 1W6LA 4ENZA 3CYTI 1FA4A 2W88A 3N2JA 1J5CA 2HRHA 3H4HA 1ZIBA 4KNTA 3UABA 3VRDA 2CJ3A 1GDVA 1OE2A 1KBVA 1PLBA 3FSVA 1PLCA 4QKTA 1OCDA 4F2FA 1K3HA 4E9QA 4A2EA 3H1ID 3L75D 2BH5X 3X39A 2CALA 2PPEA 4G7QB 2CUAA 2FTAA 1J9RA 1NINA 1YNRA 3PAUA 1GSKA 4YSAA 2L4DA 1F1FA 4DP7X 1PCSA 3EH3B 4L1QA 4N8UA 1ASPA 3OMAB 4A2DA 2GIWA 3O5CA 2AI5A 2WO3B 1GS6X 1SHWA 3NSDA 3PXLA 2EXVA 1OE3A 2VW6A 1SDDB 1IRVA 1DT1A 2C1UA 1W8EA 2FNWA 2CA4B 1NPNA 1C2NA 1X9RA 4TXVB 5D4HA 2FQDA 1AOQA 3L72D 1J9SA 2YAEA 4GXFA 4G71B 3IE9A 3NWVA 4KO6A 2Y1AA 1NTMD 4PJ0V 4BDVA 1HAWA 4EIDA 4FA7B 2V08A 2OZ1B 1BQKA 2C8SA 2C9XB 4GEDB 1B3IA 3HEIB 5I6LA 1ASOA 3S3CB 4G7SB 2PPDA 4WQ9A 4MFHA 2QJYB 2ZXYA 2GC4C 1HAUA 1HCMA 4NFGB 5F7AA 1N70A 3EH5B 1NPJA 3UAEA 4YSRA 1H9YA 1LC1A 1L9OA 1BAWA 1FJ0A 4ZK8A 2XV0A 4P5SA 3A9FA 1QL4A 2J55A 1AZNA 3CG8A 4UB8V 4Y5RA 5E79V 2YXWA 4O1QA 1CO6A 3PAZA 2FWLA 2PP9A 4E9XA 1FI3A 1QN2A 2YXVA 2EINB 2YQBA 2BP0B 2GBAA 1CC3A 3O1YA 2QPDB 3ERXA 4DY9A 1AAJA 1I53A 5B5EV 1KBWA 4YSUA 2AIUA 4RSZA 1RZPA 1JVLA 2DWTA 3HB3B 3S3DB 4FAAB 3DMIA 2BP8A 1KCBA 2PLTA 1NTZD 2YAFA 5EHFA 1SF5A 2A3TA 1W2LA 2N9JA 1KGYE 5I6KA 1H32B 2B0ZB 1ZZHA 1NIBA 2BCNB 1AACA 4E9VA 4P4QB 3SLEA 5I28A 1JERA 1FCDC 1LS9A 3OCDB 2Q9OA 3IN0A 3OMNB 1FI7A 3WNIA 3ABMB 1ET7A 3CU4A 2QDVA 2YAHA 4KO9A 3ZOOA 4YSOA 3UADA 1DZ0A 4N0KA 1N15A 3ABKB 2HX8A 1IUZA 2DYRB 2H47C 4WQAA 2PCYA 2DGEA 2WSDA 1BYOA 2PPFA 1PZBA 4E9WA 2N18C 3JBTB 2TSBA 1L9QA 3NJJA 3WFEC 1A4AA 4WQEA 4XYDB 3FT0A 1IBZA 2AXTV 2LIRA 1W6WA 1IBYA 4AANA 1DW3A 4V2KA 2GIMA 1AZCA 5D4IA 3S3BB 2VN3A 3NBSA 4L3GA 1CHHA 2GC7C 2CCWA 5B1JA 1HJ4A 4E9SA 4YSEA 2BW5A 3CWBD 4WQBA 3FSWA 2B12B 1MG2C 5CYTR 3SVWA 3QJRB 3QJSB 4A66A 1M70A 3OA8A 2XTSB 1K3GA 1E5YA 1UATA 2MTAA 1RAQA 3PAVA 2BWDA 4HCGA 3RYMA 2J57A 5B1BB 1NIDA 2FT8A 3FQ1A 3DTUB 5B3SB 1IQCA 1M9WA 2PCFA 1NNOA 4CSPA 3H56A 3ZCFA 3TYIA 3HQ7A 3VYMA 1SHXA 2P80A 5EXQA 3IEAA 4DPAX 2YIUB 4JCGA 1VLXA 3FS9A 1GR7A 2JTIB 4L3HA 3TBBA 1JZGA 1NU1D 2CAKA 3FQYA 5CIHB 1L9JC 1MG3C 5KLIB 4BWUA 3EHBB 1DW1A 4AAOA 1J3SA 3V9EA 4WQDA 3EH4B 2J56A 4BDVB 1V55B 2W8CA 2VMJA 1DVHA 1M56B 4GP5B 1CUOA 3FPYA 1OV8A 2AVFA 2I8FA 2VM3A 3KW8A 4JHUA 3QJQB 4W9ZA 4A68A 1C2RA 1CTJA 1PLAA 3RN1A 2FQFA 4A2HA 3X2QB 2B08A 2LITA 3RMZA 3A0HV 3X1EA 1PPJD 3BCCD 1MZZA 3WIAA 1KX7A 1JZFA 1FWXA 5D4JA 1CHJA 1C7MA 4D6TD 1CSUA 4HCFA 155CA 3WUIA 2VSKB 3H1KD 5CIEB 3NYKA 1TKWA 4QAOA 2FWLB 1A8CA 1CIHA 1QHQA 3ORVA 3X1FA 1DIQC 2YAQA 1KCWA 1YEBA 5ANHA 1QLEB 2IWEA 1H9XA 4H0JA 1AQ8A 3VNWA 3N55A 4YE1A 1R0QA 1W5CT 1ZPUA 2JKWA 1YTCA 2BP8B 1NDTA 4UANA 2FQGA 2PP7A 1COTA 3T9WA 1JVOA 3X1BA 1MZ4A 4DP9X 2PCBB 1A3ZA 2ZZS1 1ILUA 1YIQA 2VW4A 4G7RB 4PWAA 1H31A 4HIPA 1C6RA 3NJHA 2N0MA 1ZIAA 4GYDA 3ABLB 2PACA 1L0ND 2B10B 3CX5W 2UXTA 4W1TA 1HH7A 3TBCA 4AAMA 3S8FB 2IDUA 4WTQA 1TEFA 1IO3A 2ZONA 3AW5A 1AR1B 3OMIB 3JTBA 3QJUB 4NAJA 3WKPA 1JXFA 1N68A 1NIEA 1HZUA 2VW7A 2GHZA 1E5ZA 2VM4A 1WAEA 1IZL0 4BWTA 5KLVD 1URIA 3FU7A 3PCYA 1BQRA 2XV2A 1QKSA 5CIGB 2TSAA 3IBOA 4YSQA 5B7EA 1EHKB 1H33A 4AALA 2CBPA 3NJNA 1AS6A 3CVBA 1ET8A 5GTIV 1OOWA 2IDSA 3QJTB 1KB9D 1PZAA 1QL3A 1DYZA 451CA 1A2SA 5I6PA 4HZ1A 1GQ1A 5TISV 3H1LD 2HX7A 3OA8B 3TA4D 1BXVA 3ZOYA 3SQRA 2JXMA 1RCYA 1A8ZA 351CA 3CP5A 3CVDA 4BXSV 1ZV2A 3UAAA 2H3XC 4BK5C 4KOBA 5B6QA 1N90A 5CIDB 5PCYA 3SBQA 4KMGA 3H1JD 2OJ1A 4PAZA 2HRGA 4U3FD 1CXCA 1GKSA 2XXFA 5B66V 1EB7A 3T6WA 2C1DA 3O20A 1BE3D 3FU9A 2H5UA 1SQXD 5B7FA 2EILB 1I8PA 3X1GA 4Q89A 1ETPA 4A2GA 3ABGA 2UXFA 1YCCA 2Q5BA 2YAPA 3AG2B 3UGEA 2IH9A 3WI9A 1HROA 3MK7B 3QJVB 1CURA 1MZYA 1NICA 1SQQD 1M57B 4DP0X 3CVCA 2A06D 1TEGA 2YAOA 4F2EA 4Q5PA 1J5DA 3SBPA 1WS8A 5E9NA 1CC5A 5C9MA 5KAIV 5KKZB 2X87A 2ZONG 1RZQA 2X88A 4J20A 4O1WA 5CIFB 1PNDA 2P80D 1I6DA 4G70B 2AFNA 4HCIA 1NMLA 1CRIA 2JQRA 3M97X 4WQ7A 3HQ6A 1GW0A 2GSMB 4DPCX 2C1VA 2FT7A 4KNUA 1GYCA 1CEDA 4K9JA 1NWPA 2FJSA 6PAZA 1CYCA 2D0SA 1NTDA 3PH2B 1CIGA 1AZUA 1SQBD 1E8EA 3UACA 5DF5A 3L70D 3IN2A 1A4BA 1DW2A 9PCYA 2FYUD 1AIZA 2EIKB 5CIBB 1AOFA 2BZ7A 1QNIA 1H31B 4WKXA 1NZRA 1PP9D 3WFCC 2BZCA 2XX1A 1NIFA 2QPEB 1KIBA 4AX3A 1WA2X 1CIEA 4NERA 1QYZA 1BL9A 1YICA 2BO0A 1KYOW 4NB7A 1BYPA 3NJMA 1C6OA 1BXUA 2BGVX 1ID2A 4N4YB 2Y69B 4E9RA 1LMSA 2XUWA 1CTYA 3NSFA 2E86A 3CDZA 3FYEB 3FYIB 1AYGA 3QPKA 2FT6A 1NWOA 3NSCA 3AZUA 3FU7B 2BLFB 2UX6A 2DY2A 4G72B 1GIWA 1GU2A 4AZUA 5B7MA 5GTHV 5B1JC 2MHMA 1OCCB 1KDIA 2XLLA 2XX0A 2QJPB 1H33B 1JXDA 7PCYA 1J9TA 4HHGA 4EIFA 1GY2A 2I85A 5B1AB 1AG6A 1AOZA 1CYWA 1AS7A 1SNRA 3ZOWA 1CCRA 4XXLA 3O0RC 3D12B 4YVNA 1YFCA 2LLNA 1A4CA 1CRGA 3PLYA 2GB2A 3ZX1A 2DYSB 7PAZA 2QT6A 1M6ZA 1GJQA 1JZIA 3AG3B 3QQXA 4EICA 4KNSA 4UF7C 5AKRA 3T6ZA 2YARA 4GY4A 2I7OA 4F7KA 4FA5A 3PXWA 2DV6A 4WQCA 1L9PA 2CE0A 3FQ2A 2ZWNA 1GY1A 1KB0A 1KYOD 1BXAA 1CHIA 1CXAA 1AZBA 2C1DB 1LFMA 1L9SA 3GXUB 1CRYA 3AG4B 3PPSA 3HQ8A 3DP5A 3SXTA 5I5JA 1HFUA 3MK7C 2UX7A 1DW0A 1FFTB 1SF3A 2AZUA 1L9BC 4FAVA 1L9TA 8PAZA 1KV9A 1FI9A 4KO7A 1PAZA 2B4ZA 3SJLA 4FA4A 2GC4D 3C75A 5B1KA 1XB8A 3SBRA 3WFBC 3ZOXA 5DJQB 1CTZA 4DP4X 3A0BV 3OQRA 3H1HD 3KZIV 3MBWB 4Q8BA 2EIMB 4YSSA 5I5IA 1C75A 4BWWA 1H1OA 2YAMA 3KW7A 6PCYA 2HLEB 2NRDA 2XVBA 3FSAA 1OCZB 1A65A 1BEXA 2N18B 1M60A 1U75B 1CSXA 1SFHA 1VYDA 4LJIA 1OCRB 2R7EA 4A67A 5I6OA 2IWKA 2XWZA 4YSDA 1PNCA 4WQ8A 4YVUA 1CNOA 1I5TA 1IC0A 2XXGA 3NJLA 4PCYA 2HZHA 3BVDB 2ZOOA 2IH8A 1T5KA 1RZ6A 4FA1A 1LC2A 2OCCB 1NIRA 1CCHA 3AY2A 3RN0A 4DPBX 1RAPA 2YK3A 2QJKB 1JXGA 4HAKA 3ZIYA 1E29A 4JKNA 1AANA 4E9TA 4PW9B 1BCCD 2VSMB 5FC9A 1AS8A 1AZRA 3T6VA 5C0ZA 2PP8A
chains in the Genus database with same CATH superfamily
1NFDE 2ALAA 2XWBB 3MRHB 1LD9B 3DMMD 4PRPD 1MFEH 3VWKD 1HZHH 5L88L 4TV3A 4AE0A 4M62H 1YEHH 2NXYC 3QNXB 5I1JL 2J8UB 3N1PC 4ZTOH 2NUTA 4JFEA 4ODXB 1CE6B 3E6HA 3RVXD 5FGBA 4MZRA 2LAGB 1HH9B 1MG2D 1EO8L 4HUXB 3LZFL 4R6UA 1I3UA 3MV9E 3LN5B 3X1NA 5HPMB 3VDCA 5I1IH 1SN0A 2LU4A 2IAND 4M3HA 2EKJA 2IGFL 1CYIA 3V6OA 1DEEB 5CBEA 4AH2B 2AF2A 1DQVA 3P30L 1MNNA 4WAFA 3MRKA 3QUXA 4XI5D 5E6IB 5CCGE 5GRJL 2BS71 3JT0A 1MCOL 2EIBA 4P46A 2ZUTA 4FOMA 3VH8A 2C3XA 1QPKA 4IOSD 1BP3B 1HHJB 2VR6A 5GRZA 3E38A 5FCSH 1OAXH 3Q6GH 4OCYL 2YD8A 3CPUA 1LYQA 4P59L 2IV8A 4N8CH 2JTDA 1EGJA 1MSPA 3RWIB 1SOQA 1X7QB 4QRRD 3O45A 5GGRA 4OD3L 1J9CT 3NZ8A 2R9HC 2MTPA 1A1MA 1HN1A 5IB3A 5K9QG 5FK9A 4DGYL 4XVOA 3F62A 2XYBA 4LSRH 2C9XA 3EO9L 3B6SA 5JHDA 3EADA 2UZXB 3SQOH 3SYCA 4Q0XH 3JV4A 1NBVL 3QR0A 3ZHFA 4WVRA 1YMMD 4XMLH 1TVHA 3S97C 1CFQB 1F4YH 5T3XE 1KTLA 5K33A 1AXSA 4Q58C 4AITA 1YJDL 3AMLA 3CFNA 4FEIA 5ACZB 1N26A 2ARJA 2JB6B 2QV2A 3LAFA 3TO4B 3ZDWA 1GOHA 3ZVVA 4CSZA 5CGBA 5A6LA 2GCYB 2HRPL 3FUHA 3VG9C 4DP8X 1FSKC 1N9CA 1NGXA 5I66A 1S46A 4XRCB 3TGUD 3N85L 2CK0H 3MV01 4AI7A 3O4LD 1HHIB 3EYUH 4WO4D 5AFAA 1B0RB 2W9DL 3KVQA 1NGPH 1ET5A 4P2AA 3EJSA 4OV5B 2OZNA 2KQMA 4IKNA 5SX4I 4UI2A 1NAKL 1CS6A 1PDKA 1U9KA 5C0DB 3L45A 2CR0A 4R4FL 3SIKA 1P6FA 1TU2A 5DJCB 3UG4A 4QRAA 1C52A 1T5WA 4B6ZA 1OE1A 4B5ZA 1ZJAA 4XB3A 5KSAC 5FYJL 1P84D 5E8OA 4YDKH 5T5NG 1PVHA 3BE1H 1OP5K 1SJHB 2Q0ZX 4ZQKA 1T04B 4N28A 3VRDA 2P7TB 1R3KA 3FSVA 1DQQA 5JW3H 1A4KA 3DIFB 2ZCZA 3DURB 3V6ZB 1KWKA 2CALA 3NCBB 1P4BL 3KWWB 1HC1A 3T8MA 3KYMB 1F1FA 4XBPA 2VL5A 3NEEA 2UY7B 5MEQA 1GS6X 1WWCA 1UJ3C 2YWZA 3RTQD 2Q3ZA 3BN9C 2F61A 6FABL 3IU3A 4KKLC 1EX0A 4H7VA 4HU8A 2YAEA 3BZ4B 1M6UA 1MCQA 3NIFE 4JR9L 4MJ5A 2KLRA 4PJDB 5JIIA 1CTOA 4ODTH 2C8SA 4R8WL 2YD0A 2K9FB 4ZSOE 5IB5A 1N8ZB 1J0ZA 4G7SB 3DHUA 1MEXL 3W2DL 2CXKA 1MNUL 1HHKB 2XZZA 3KPOA 3L1GA 2A6KA 4EUPA 4AJWA 2ENYA 1AGCB 3QNZB 3RAJH 3ZK0A 3O6KH 4M4PA 1D5MA 4IDJH 2DWYA 3PAZA 2D3NA 2Y4SA 2YXVA 3HMWL 4HJ0C 4L29A 2HKFH 3GJEA 3QG6A 1AAJA 2V7HA 3ARDB 5I19H 3OKNB 3MRBA 2ZSVB 3T65A 4RSZA 3HB3B 5FDWA 4D9QD 3MLUL 2L0DA 3RGVD 2AQPA 1YPZB 35C8H 1BFOB 1F3DJ 3KM2A 4M1DL 4IS6A 2FEJA 2WNKA 3F58L 4WGWB 5CLTA 3EAKA 4N2IA 4AT6B 2F6AA 2Z9TA 3SKUD 4P3DA 4G83A 4X9HA 5IVZB 2EDJA 2QQKL 3TBTA 2D7TH 5A43C 2EDQA 3ARBD 5KSBE 4X8GA 5IV2A 2IGTA 4E9WA 4UIKL 4WQOA 3RU8L 4KKQA 3ZT5A 5IUSA 4WHTA 4Q74A 2NR6C 1JI2A 4AANA 1YEDB 4OCMC 4JKPH 2OJEB 2EDXA 3NBSA 2EABA 1G6RB 3FT3B 5ESQB 4F7CA 1FLRH 3C5ZB 2YRPA 3V7AG 1BGXL 1M1XA 2VJ0A 2XZCH 4ZOCA 3P2DA 1I7RB 3SVWA 1YSOA 3EFOA 4DQAA 1NANI 3VGEA 5L4MA 2VAAA 4GAYB 5DLMH 4RISL 3QDJA 1ZXKA 3CWGA 5HYSB 2WQXA 3OJDB 5HHNB 4DOHE 3HVDA 3L3GB 1G1YA 2X89A 5AZ2H 3VXMB 4DZ8B 5J6HA 2WBWB 4F2MA 3T2OA 5SX4H 2ED6A 1X6LA 3CCHB 4MJ6A 3TCLA 4PD4K 4YPGA 3QE5A 5C0GB 5CD5D 3A24A 1UM6L 3GSXB 3N1FC 4ZS6D 3DSNA 3V0WH 2ZX6A 1HSBA 5KOMC 3RL2B 1R3LA 4L9LB 2DQDL 1J7VR 4XPFL 25C8H 2AVFA 3HBZA 1GJUA 3OAYH 1FYTE 4ZFQA 1HDMA 3LPFA 1B4JL 4NO0D 4JO3L 2XN2A 4YWGL 3X2QB 4HWUA 1PD6A 4I0CC 2OR8A 5I8KH 3L4XA 4AV0A 4X7TA 5E8PB 1QUNA 3V6BR 3MV9D 2BRRH 4LMQE 3LZQA 4N1HB 1NMAH 3QXWA 2OTWA 2HVJB 3PWVB 3VCLA 5FM8A 1IGCL 1H9XA 4GXVH 2VLME 5KVGE 3VXNB 2Z8RA 1CDCA 2ATKB 4YE1A 1JGDA 5EIIA 3FH5A 1ZPUA 5D7EA 4UANA 2FQGA 3S5LA 1P9MC 4QF1B 5I1AA 2JLLA 1BVLA 3X1BA 3DX2A 4DP9X 3IF1B 2ZZS1 3RX5A 4PJ5B 3NFNB 3NJHA 4J3TA 1QLEH 1USQA 5DD5H 4JDZA 2F53B 3WO3B 3S8FB 1AR1B 2HH0H 2WANA 4N1CA 3NUKA 3T04D 3HNSH 4OD2A 4XN1A 3PIQB 4K7FA 4LASL 3FB7B 2QPUA 1PBYA 5D71H 5DSCB 2E7CA 2AGJL 1SLWA 4P9HH 4DK6A 3TEWA 1P1VA 2AQRA 2WLMA 3KGSA 2M2DA 2NY0B 3BSZA 4W6WB 1Y0LB 5DK2B 5ABAA 1FV1B 4L0ZA 2IDCA 3CVBA 1ET8A 5GTIV 1E8WA 5CJOH 1KB9D 4RESB 1VFMA 3MMEB 2HG5A 5T3XD 1GQ1A 2HX7A 5GZOD 3WUWB 2Y22A 3BSZL 1Z3RA 4N8PA 4PJAF 3TO4C 3RFZA 4Z8FH 1NBQA 3QRGH 2EUWA 1M05B 4J6IA 4X7DC 3EJUA 4O5LH 3CVHH 3CK0L 1QR1B 4QO1B 3HS0B 3V9FA 3KPNB 2VMFA 4Z18A 5B6QA 2NYKA 4FQ1L 3TYFA 3W9EB 4CMHC 1XCXA 4ZZKA 2B8OT 1UWEL 2XXFA 4X5LA 4MMZB 1E9QA 1XGQB 4AYMC 2C1DA 3RL1A 1S7UA 3GRWA 2V8MA 3MRQA 3ZDYF 1CO1A 1CBVL 2JCWA 2L04A 4N20A 4Q89A 1T1YB 2FIKA 2MCAA 3EH2A 3GGWB 3VGDA 1L0QA 3GRWL 4LEEA 2LGNA 3HNVL 2YUZA 1P4IL 3DX1A 4M03A 1KCLA 2YAOA 1R3JA 4XBGB 1OM9A 1MRCL 3PXHA 1N64H 1IAIM 4YE0A 3IDYC 4WKZB 1MHPH 5HVWA 1JG9A 4RX4D 5KKZB 2HFGH 4KKPA 4N0RA 4NHUB 5C8JB 3F85A 4WHDA 5T1DL 4M7ZC 4J6RH 1T89A 4HCIA 5AVTB 3M97X 1MRFL 1JTTA 2GSMB 5D72L 2ZNXA 4JY6A 3U4AA 4XCFH 3QRBA 1EHLL 1AXTL 1D6VL 3OWRA 4U0RC 5G55A 5KSVB 4XMKL 2QQNL 4KDTA 1S5IL 3N1QC 1TYJA 2CRYA 3IRCA 9PCYA 3L4YA 3MJGX 3NK4A 5C0JA 2EC8A 2WGNB 3UAJC 1H31B 4AYFA 3LHAA 1RZJC 4Y4FB 4X6CA 3ETSA 4QNPE 1KCSL 1JZ8A 1OPGL 2CR6A 4G8FB 1YICA 4OZGA 1MFDL 4UTAH 4XO5A 2Y69B 1HE8A 4FMFA 1CR9L 4FC3E 1JK9B 5KYUA 3CDZA 3FYEB 4M02A 3QPKA 5GJSL 1A1OB 3C6LD 4XCYA 5DUPH 2COVD 3GXFA 5K9OA 4YAQB 3B3IA 5B1JC 3WI9A 2QKIC 2XICA 4NLHA 4BRJA 2F8OA 3AACA 2WTRB 2C5DC 3BVWA 1FH5H 3BAWA 3L3HB 4WCYH 4X83A 4XX5A 3O0RC 5AOZA 4UT6A 2LLNA 3H42L 1VESA 3SQBB 4OGXL 1QFHA 2ZKMX 3JYCA 4XN2A 1T66C 1YO4A 2XQBH 3KVDD 2CE0A 2OFQA 3BN9D 4KKLD 3ARDC 4D7BA 5DCCA 1NMCB 2IEPA 3OKKB 5MENA 3HB3C 1H15B 3JUZA 1JWSA 3N06B 4L1BA 4PJDE 4PRHA 2ZWZA 3A6BH 3GMQA 3HE7B 3OZKA 3HQ8A 3UGUA 3UBXB 5I5JA 5I0YA 1PEZA 2AXGA 1YEEH 4FFWC 5C7XH 5KSBF 1QBMH 1ZTMA 1Q0YH 3BEWB 4L48A 2D03H 4BQ6A 1ZLSL 4N90E 1C7TA 4YSSA 2VITB 4XNZB 1H1OA 4LHQB 3UC2A 3S48A 4ABQA 1S9VB 1JPGB 1A65A 2CPUA 2YEVB 4M43L 5DR5H 3AS0A 5JO5A 4HJ0D 1IC4L 3U7AA 4K9EH 5BS0B 4NZUH 4TLKA 2XXGA 5I1CL 5H37H 1ZS2A 1VB9A 2K4AA 3IPFA 3LZNA 1KFAH 1YPZE 4PCYA 5EU5B 1E7UA 4MNHB 2IPUK 1SUHA 3RPKA 5LGJB 3DV4B 4ONFL 4X8JB 2C1OA 2Z93A 1F4WL 1OQXA 2Y5TA 1FL5A 2VSMB 1LDPH 2XXCB 2WQVA 1IBHA 1NLBH 2HFFA 4HAGA 1MLCA 5CSBA 3QDMA 2OV0A 3MGTA 1AZZC 3R06A 3ZYJA 1CRCA 1B0GB 1VGKB 1KV7A 3VX1A 5DJZA 1A3LH 3LS4L 3CU7A 1J12A 2C9VA 4KU1A 5JUEL 5BV7B 4DCQA 2O6EA 2NR6D 3FF7A 5DHYB 3FOMA 1IBGL 5FXCH 1SOKA 5E2TH 4NQDA 4N5UA 2NPLX 3TBSA 4HJJL 1FYTD 3RDTC 2DI9A 2XTLA 3ZUCA 5DURB 2X2UA 4BQ9A 4ERSL 5KBDA 2BWIA 2WBJB 5GQBA 3QO1B 1SBSH 4U1MA 2OYKA 4AKPA 4WWNA 3VXME 3KWXA 3KLAA 3SGJA 5ITBH 1SBBA 1COBA 2J8UF 1AGDB 3LXUX 1AHKA 4HG4K 4KBPA 5SX5K 3D0LB 5SWZA 3U4EA 1XWVA 2NT1A 2YXFA 3QXDB 5GJTH 1JDLA 5FYJU 1KENH 3PHAA 2IJ0C 2VLMD 3O3UN 2V9TA 4N2OA 3T4AB 1KJ3L 4PSRA 4F7PB 4KXZI 2V8LA 4ISVA 2GB8B 5TH2B 1PD1A 5AQ0A 4Y2OA 1ZA6B 3FL7A 2P4AB 1EZSA 1D7DA 2AXWA 1KCRH 4MJIB 3ZTNH 3AAZB 1BQ5A 1BX2B 2AJVL 2FYNB 4PY7B 4F58H 3TC9A 4BQBA 1YN6A 4ZMAT 1UADC 2Q2LA 4HF5L 2DKMA 1AR1C 4JHVA 5F0MB 2FR4B 2FJGB 3JVGC 3QQ9C 4DW2H 1LM8V 4OLZL 2KZBA 3PXSA 4QKXB 4UZGA 3ZR6A 3DJSA 1XO8A 2VXQA 1SVZA 5IHUH 1L6PA 4MCNA 1DBBH 2NY0C 1ZHLA 2FB4L 2R27A 3EOBB 4P4RB 3P4NA 1ZGLB 1DHKA 3APNA 3W1ZA 3IAQA 4NCC1 2WZ0A 5J3HC 3U1PA 4PJ5E 5HGAB 1MJ8H 4WJ5B 1HJ3A 1J05B 2PWHA 1JGVH 4WWID 3BMVA 3HS0C 1X5JA 2BY2A 1CF8L 4QRTA 2B1AH 3ZHKA 4D0CA 1BIIA 5KUKA 2IQ9H 1E43A 4MMZC 3G5VA 4GAGH 2FBJL 3OG6B 5CP3H 3NMEA 3IFLH 1CXFA 4AL8L 2ADFH 1QMUA 1SRDA 4FFZA 5L8LB 2YN3A 4TVPH 2NUTB 1NCAL 3W82A 2OYPA 4JFEB 4S0HA 3OCDA 1FOCA 3GRBA 3E6HB 4RGOH 1AG0A 2WBKA 3L4UA 3PV7A 3JTTA 2P9RA 1ZTXH 2H4EA 3TO4D 4KC3B 4ZNCD 3VSVA 2WP3T 4KKCC 3KJ4B 5BRZE 5EDXA 2BW4A 4PLKC 2AI0H 3CMOL 1ADQA 5CBEB 4RWYL 2DQJH 1RSFA 5F1KC 3QUXB 3Q9PA 2A74A 1FPTH 4TS6A 4W93A 1ADQL 1RK7A 3IDNA 4J2XA 1C5CH 4QNPF 4HOZA 1GH7A 4P46B 4RNRA 3VH8B 2A9MH 3HHSA 2XWTA 3LZOA 3BAEH 1OP5H 1YEJH 3RWGA 2YRBA 4FMVA 1SHWA 5JZ7D 3L7EA 3IU4H 2DRUA 4ZTPL 1E6JH 4MD5A 3O45B 5GGRB 1GHFL 2AJYH 3IJ7A 1J8RA 5LCVL 3NZ8B 3L6FA 4RZCA 3I3EA 3WTUA 1A1MB 5CGTA 5IB3B 2B2XH 5C2UB 1AC6A 2C9XB 3B6SB 5JHDB 4H1LG 1UA6L 1IO4C 3JV4B 5C07E 2X9XA 1TVHB 4GH7B 3KVPA 4RWHA 2YJLA 3BPCA 3B2XA 1KTLB 3KR3L 1AXSB 1I8IA 1Z5HA 4KK5C 3T3MF 2WAHA 5IW6A 3WTSA 1VZIA 2ARJB 4PJDF 3UAJD 4GO6B 4ADIA 3ZE1B 1KMGA 1T83A 3NVQA 4KXZH 4XE0A 5KS9F 1CO6A 1XGTA 5ID1A 1MJ7H 1A4JA 1NGXB 2D2OA 5I66B 1LLAA 4XPHH 1NMCC 4ONGL 3IDUA 4U4IA 3FTXA 1MN4A 4BHUI 1TZHA 1R3IL 2D7MA 3F64A 3PQYA 1SHSA 3LYRA 4YFLI 2GJPA 2N9JA 2B0ZB 1NUGA 3SPIA 3ZE2B 3OJVC 3BPNB 1PDKB 1GIGL 2B5IC 1R47A 4B9ZA 1LS9A 5TD4A 3WNIA 1DJGA 1U93A 4N90D 1TU2B 3PS6A 1VIWA 1L3WA 3FT1A 4OLUH 5F7YC 1T5WB 4X9IA 5E8OB 3FB6A 3WFEC 1A4AA 4RGMB 1J5HA 3ARDD 4G2AA 4KROC 4ZQKB 1FN4A 3HB3D 5K1NA 1FO0H 1UEMA 1R3KB 1HJ4A 1DQQB 4Q9RH 1A4KB 3BT0A 5FYLE 5T8IA 2EDDA 3PAVA 2BWDA 1KN2L 3NPSB 5DQDL 3UGXA 4XBPB 2VL5B 3VMPA 4EKJA 4XAKD 3H56A 5MEQB 3SDYH 3TYIA 1YC7A 4UM9A 5IBLC 4LFHD 1DSFL 3TBBA 3IU3B 1UYWH 3F65A 5JOPE 2VDRL 4MJ5B 5CUSH 2PO6A 3PL6C 5BS0E 3ATFA 1OK8A 3SDAA 1C9SA 1CLOL 4DN3L 4TLTA 4HK0A 3DRQA 4I3SL 5IB5B 5C6PB 3KLHC 3C5ZD 1BBJB 2APTA 2G3XA 3GS7A 7CGTA 3ZSSA 1C2RA 1CTJA 1FIGH 2ZE0A 3EDEA 3SCMC 4I18C 4OF0A 3E2HC 4YXKH 1IL1A 1YUHA 3KPOB 3LMJL 3P40A 2A6KB 4GLRI 5D1ZA 3KPRE 1IGFL 4AEEA 1RUML 4EUPB 1RY7B 5HDQH 1Q0EA 1C7MA 5KYYA 3VXMD 2WVSA 1D5MB 1YNLH 5DVOA 1TKWA 1XT5A 5BPPA 4L29B 5DK0A 2TRHA 1T21B 5ANHA 1W80A 3GJEB 3RKDC 3QG6B 2G5BA 2V7HB 4HT1L 4TM9A 3MRBB 3T65B 5FDWB 1WT5C 2VDQL 3B2UC 1KB9K 1U6AL 2ESVA 3V5DA 3DYOA 4IS6B 1PTZA 2VXSL 1R19A 4ZNEE 4GB9A 3RDTD 3ESUF 1IAMA 1OKEA 5I1HH 2WKOA 3P0YH 2DKSA 2IG2H 4PJ7A 4NO2A 4P3DB 4XNMA 5EA0L 1GGUA 3TBTB 3W11D 5EEVA 4I3RL 4NZDA 4J5VA 1PS3A 1VF5C 2CR3A 5TPWL 5IV2B 3D4CA 4WHTB 1UENA 2R51A 1L4IA 2RQ8A 5EC1A 1MPAL 2NW2A 4BE6A 5CCJA 4F7CB 5JIMA 1CDBA 3S37L 1PZAA 1M1XB 1IGIL 2ENPA 4MJIE 3EFOB 2PF6A 1YEKH 4PJ5D 3ULUF 2VAAB 4YHOL 2EICA 3QDJB 3BISA 1ZV2A 5F7NC 5GGQL 3QHZH 3UTOA 4KTGA 5J6HB 3V4VA 1ZSDA 4KMGA 1AR1D 1MWAL 4F2MB 2AXFA 3QQ9D 4TQEH 2KDYA 3ARPA 4MJ6B 3TCLB 5IMMA 4YPGB 5FUCC 3V4VL 2D7OA 3FU9A 3X1GA 1I8PA 2KL6A 1CK0H 4BJLA 1QABA 3DSNB 2NY0D 1HSBB 1YCCA 1R3LB 5DZVA 2EO1A 2DWDA 3L3KA 3TT1L 1CXIA 2YEQA 1HDMB 3ZQWA 1TEGA 3Q9QA 4JKLA 5J3HD 1VA9A 3K8KA 5IHWA 3T0AA 2FBRA 5E8EB 4X7TB 1QUNB 2N7BA 3H7LA 3WGUB 3D2UA 1XXFC 1TTGA 2X88A 3V6OC 2AXHA 1BQHG 3JXAA 1MCJA 3UYRL 2BSEA 2OTWB 3VCLB 3QUXC 3ZYZA 2FT7A 4CN6A 1KLGA 4I0PA 5FUCE 4PG2C 1GXEA 2R59A 1JGDB 3EJYC 5EIIB 5LBGA 1OXYA 5ESAA 5FCUL 3UO1H 1WIPA 3PV6A 3VB8A 5I1AB 1G9MC 1BVLB 2CZNA 3U79A 1BMWA 3ZHLA 4PRAA 3JWNG 1D7CA 3WFCC 2DQEH 4JM4H 1HJCA 2X1WL 4XO4A 4HSQA 2Y7OA 4JDZB 1F11A 4KKCD 3V6OE 3E0GA 4MKMA 4OD2B 4PLKD 4K7FB 3MRJA 4XVJL 2FT6A 5D2LA 2YKLH 1CU4L 2R29H 4GLRH 1CLVA 5GTHV 1VERA 1KACB 5C07D 2NSMA 1SOSA 2HG5B 2NY2B 3H55A 4JRYA 3RFZB 3LH2L 2YMTA 3CTTA 2FUTA 5AVSB 4HUKB 3M6DA 4Y4FD 5C3TA 3T6ZA 3MJ6A 3BD5A 3U7WH 3RIFF 3EYSL 3TYFB 4Q14A 1HWGB 4QXVA 1FE8L 1CHIA 1E9QB 1GGBH 1SPDA 2C1DB 4OFQA 1S7UB 3OF6D 1TZIA 3RL1B 3AG4B 2FX7H 3SXTA 3MRQB 3JWDH 4OR1A 5JHDE 4S0SD 2UX7A 2X53A 4M7LH 2FIKB 5DK3A 3IKCA 3BPNC 4K71B 3SJLA 1A6UH 1MAJA 1NAMA 1R3JB 3KHOA 5TDPA 1SM3H 1ZVHA 1CGYA 3ZE1E 5BXFA 4M5SA 1NAML 4PMEA 4P2OA 5DHEA 4BZ1H 1MAKA 2Q1EA 1JZDC 4E2OA 2X42A 1ZA3A 3ISRA 5EB9A 3DOSA 1NLDH 1UCBL 2LVEA 3HHMA 3QIBC 4XO3A 3V2AR 4WQ8A 4HC1L 4JY6B 2PETA 4UNTA 3NJLA 2ZCLH 3GSNA 3KL3A 4L1LA 2WB1A 3BVDB 4G8GA 4EO5A 3VX0A 1GZQA 2DWEA 5E08H 4GMSL 4OT1L 1LC2A 3ZE2E 1FNLA 4FXTA 4UCFA 5FYLD 4DPBX 5J11C 4UT9A 5JORA 2WQ8A 3WE1A 3HHRB 5C0JB 3F6JA 5FYJE 2VMCA 3SDDB 4AYFB 4A6YH 1AZRA 4LKXA 4X6CB 5FWRA 4LLWA 1R6VA 1ML0A 4OZGB 4A7UA 5KVEL 3GLEA 3GJFA 4C57C 5KYUB 3BYYA 3CDZB 4HS3A 1AHMA 5D8JL 1JMZA 5BS0D 4HKZB 4NXKA 4QHLA 4FYRA 4XCYB 4FN0A 4NOFA 4OF5A 5LBSH 5K9OB 3B3IB 4MDRA 1A14H 1F1CA 2EADA 2YQGA 5L4FA 1OT1A 2BNUA 3ZYOA 4Q4EA 5EUOF 1NGZA 3U25A 3RBGA 2IWFA 3CIQA 2VERN 3GXMA 4Z7QB 2Q8AH 2QELA 4DEUA 3VA6A 1F4XL 1RU9L 5LGKA 1OIOA 1CRHA 3ZO9A 3I9AA 4FQ2H 5CZKA 4TNFA 1H19A 1KJ2A 5DHDA 4JO1H 5AVZB 5IW3A 5MENB 2F58H 4EIEA 1JWSB 4PRHB 1FRGH 4OM1L 3GMQB 3TEUA 1BOYA 1ZXQA 3WNMA 4YIQA 1KJ2L 3KYKL 1KB5L 3DOHA 3VNYA 2A1WL 2DQCL 2ZCHL 3UZVA 5DJQC 3KPQA 4PFEA 1GL4B 3FULA 2HJFA 5LHDA 5SX5H 1MFBL 2HCZX 4LEOA 3TWCH 3P4MA 5DURD 4HOXA 3DR0A 1EEYA 1BMGA 2WBJD 3BWUC 4ZT1A 3F7YA 2GFBA 5D5MF 1BEYH 4PIBA 5JO5B 2DWSA 4JKKA 3RKDD 3LVTA 3HFML 2DQFA 3H4FA 4OCRH 3TBYA 2O1AA 3OMZA 5EU7C 4MNGA 3B2UD 2PMZA 1UACH 4JE4B 2DDQH 4MJID 4IL6V 3LRLA 5IQNA 4AKQA 1J0IA 1KCVH 4K8RC 4Z0BL 1QRNA 4HCRA 2C1OB 2Z93B 4JCLA 2Z35A 1W0VA 1WVEC 4NP4L 2Y5TB 1FL5B 2MWCA 2HFFB 2I69A 1MLCB 3VSTA 5A16A 3QDMB 3MGTB 4HCRL 3R06B 4E9YA 4GXUM 2I5YL 4N2MA 5CJ5A 5DJZB 3D0AA 1J5OH 1MCIA 3EJCA 3HFFA 4NP9A 4OCWH 4H1LA 4DCQB 3BO8A 1P4UA 5F7UA 1OWRM 3FOMB 4JFTA 1FZKA 5I1GH 5AAWC 1I75A 4NQDB 5EU7E 4AVJA 4XNXL 3TBSB 2QSTA 4L4TA 4YOKA 3QDJE 5DS2A 5CAYB 3IDXL 4U1MB 4UZSA 1GYWA 1AGEA 5F7DA 4AC2A 5HDRA 2J8HA 3K6OA 3KLAB 3EYOA 4BCYA 4F2ME 2Q8BL 4MU8A 3JZYA 5F3FA 4LSQH 5SWZB 1OY3B 4Z3JA 3BUIA 3GNML 5E1HB 3IWVA 2C9RA 3BPOB 4QKTA 2DL2A 2ZG1A 4ISVB 4Y88A 2BDNH 3HC0A 4JQXA 1MY5A 4WY7H 1CL7L 4Y2OB 2ARJQ 2OL3H 2CLVA 1OZUA 2OLDA 4JFED 1GSKA 4FFYH 5EU4A 1OAQH 2VR4A 4UOZA 1YEWA 1G7MA 1XGYL 4NS0A 1E2WA 1JNHA 1WG3A 1YN6B 1W15A 2WO3B 4JFVA 5DDHA 1PEWA 5CD3A 2OBGA 1H6FA 1BVZA 3TTYA 3O2DA 4GJTB 4O2CA 1H0DA 2OCJA 2JKIS 2XNAA 5D96B 1MCFA 1N6UA 4GEDB 1MQKH 1QHPA 3IGFA 3QUXD 4EPSA 3WLWD 1ZHLB 2PPDA 3GI8H 2X38A 4R5TA 4P46D 3P4NB 1EWHA 2XWRA 4X7FC 4P04A 3IDJA 1SQ2N 3EH5B 3HMXA 2A99A 1H9YA 4PR5A 3RFZC 5HYQA 2WWKO 4KI1A 1INEL 1I3RA 1VAHA 1QL4A 1WCQA 3HMXL 5BZDA 3Q8EA 3E9UA 1KYOJ 4JGMA 2CRIA 3NCJL 4QRTB 4D0CB 4JFZL 1HJBC 1BIIB 2NCMA 3C08H 3I6LE 1VEOA 2YGOA 3G5VB 1RZPA 2VDML 2FWUA 3TA3A 2NX5A 3LN4A 1CE1H 2GY5A 1MIMH 2X3BA 3ZE1F 5JHDD 3CUPA 1OAYH 1EVUA 3OCDB 1LGVA 3HG3A 3QRLA 2YAHA 3JTTB 4L8SA 2DYRB 1E3XA 2H47C 1LVEA 2VRKA 4HFUL 4OLXH 2TSBA 3CN1A 1T89C 2WY3B 3H9SA 3NESA 4PMFA 4UQ9A 4X6DA 4BD4A 2EDHA 2GIMA 5KVDL 1DUYA 2A74B 3PDOA 4JFWA 3QT2A 2VAJA 2CCWA 1H3TA 3LKSA 4KDTC 4W9IC 3L3IA 3A4FA 4HU2A 4MASA 5CYTR 2CK2A 4LPWA 4OIBA 2XWTB 4HIJA 1WBXA 4N0CD 3WGVB 3SDDC 2FT8A 3DTUB 1NSNH 5FYJD 1PX8A 1TJGL 3RWGB 4CSPA 2P80A 4ZFGH 4P49A 4JCGA 4AIZA 3L7EB 3PGDB 4RMWA 4L3HA 4JPKH 4MD5B 5D93B 1ACZA 4WW1A 1L9JC 3CLEL 3PU7A 3L6FB 4HA1A 1E5BA 4RZCB 1NL0L 1EZVY 5JIDA 1F8TH 2W8CA 4D3CL 1M56B 4OB5H 3DLQR 3HS8A 2UZIL 3VRIA 1P0SE 1DQTA 2QJDA 3LEYL 3BPCB 2LITA 1TNNA 4NQCA 1I8IB 1ZLEA 1MZZA 2R1XA 5IW6B 5D4JA 5DD3L 2VH5H 4X6CE 1YEIH 2X3CA 4NM8H 3FCUB 2J7LA 5CIEB 1XGTB 4OZGE 4AQ8A 5ID1B 4DO5A 2E27L 1A4JB 1KNOA 1UZGA 2O6CA 3E3QC 2C4FU 3N0PB 5CCKL 4FCAA 2OP4H 1L5GA 1TZHB 4AZ8A 3P0GB 3PQYB 4ENED 3WXVH 4NQVA 4G7RB 5AVUB 4MB4A 2VJXA 4W81A 4HDIA 5DEFA 4HIPA 4K2UH 4A04A 2CPCA 4XVSH 2LU3A 5LGYA 4MHHI 5IB4A 2UXTA 3THML 3KYOA 2X9ZA 2VDPH 1IKFL 1D5RA 1U93B 5ERWA 2EECA 4QRFA 3AW5A 2ZKHL 4QYAA 5HYEA 3OMIB 2DM7A 1Q9LA 1BW8A 1RFDH 3QJUB 1BQHA 3A6CH 1QW9A 3FC8A 5T3XH 1QTSA 1HZUA 3FB6B 2DLIA 4XWGH 2CBTA 3ILDA 4HSAC 1SMOA 2BLFA 4URKA 3IBOA 4PRHE 4PTTA 3JTSA 3U2SA 4KY1H 1FN4B 4GAFB 2OMBA 4B9JA 2WQUA 2B4CH 5I6PA 2J21A 4FQCL 3RNKA 3WKYA 1JPST 3PGCA 3TA4D 4XWOC 5GGVL 4LB8A 4KQ4H 4MBRA 1CDUA 4CADA 1Z9SA 4FQXC 2K6ZA 4UOW0 1YAZA 3H1JD 2HLFC 1JNLH 1RZKL 3GBEA 4H5SA 4U3FD 4JN1L 4UM9B 3EXLA 3P69A 4HWBA 3K46A 5DXWA 2H26A 2QPFA 5TE6H 1R75A 3CN2A 2PO6B 4QYOA 3WNLA 2DICA 1G0YR 4HWBL 5F1IA 1D7BA 4HK0B 3HI6L 3DRQB 4HWNA 1UA7A 1E27A 5F0PB 4K5LA 2XRAL 4XXWA 3BVTA 1IL1B 4K8RD 2WLKA 3QDJD 4N2KA 5D1ZB 1SXNA 1TSHA 2Q3AA 2UV3A 4LQ1A 1SEQL 4LMQI 4OZFG 3NJVA 3SGJC 2X89D 5KYYB 3T0EA 3QDME 1TKWB 3BAKA 4R7VA 3ZJAA 5IQMA 2OMVA 2H0FA 2GIYA 5DK0B 4Z5RA 2DMKA 2V17H 3FUDA 4K9JA 3SDCA 5A3ID 3MLWH 2G5BB 3BPOC 5HHOA 3D48R 2MOGA 3OPZH 1B90A 3IN2A 2ESVB 4NQDE 3V5DB 1N67A 1AOFA 4ODHH 2X28A 3WKML 4DN4L 4ZZFA 4ZMWA 2GT9A 3AADB 1JYNA 2R0WL 4R83A 5F21B 4Z0XA 3RX7A 1OLZA 1BMZA 3OJ2C 4PJ7B 4NO2B 3NJMA 1A21A 4XNMB 2NY6B 1CTYA 1WFJA 3FKUS 1A6VH 4KDVA 5SWZE 5D96C 4M5ZL 2NXZB 1ZE3C 3MFGB 3LKQA 3P9LA 1W9XA 2BFVL 1EDHA 3P77A 2Y23A 1PSKL 4XZUA 3RIFK 5EC1B 1JE6A 2NW2B 3RWHA 1YCSA 2BVQA 3GSUA 3C8KA 3RDJA 1JRHL 4YVNA 3GM8A 4L8CB 3ZO0A 1YFCA 4X5PA 3WIIH 1BG9A 1BZDA 1CTMA 3ZTJG 3P3TA 3UMNA 2XA3A 1WRFA 4C47A 4LSDA 1CF1A 4TRPL 3QEGL 2DV6A 2UVEA 1ZSDB 4JVUA 3V4VB 3RVTC 4HIEA 4IM8A 3I6LD 4M7KH 2AXFB 2D3JA 5IMMB 1DJWA 1HXKA 5M94B 1P69B 2X1XR 3O11A 1NKGA 3IDGA 3S35L 3QPQD 4AMKH 4I1NB 2CD0A 2H1PL 4FA4A 5E6YA 4X9FA 5J9PA 2DWDB 2OMTA 3L3KB 4L4VA 4BUQA 3AY4C 1KGJA 4ZX6A 2C8NA 2E4FA 3TH4T 3PWUA 1BVKA 4PJXA 3QS3A 4AUUA 1DQMH 1D5XA 2XVBA 3D2UB 4YHNA 4DKEL 1XSKA 3Q0HA 1LP9A 1VEPA 4U6TA 1TQTA 1XHHA 3KYNA 3WBDA 4PI2A 1WK0A 3ATEA 3DBXA 2R8SH 1PY9A 1KLGB 4I0PB 2EXYC 2F74A 2QEJA 2QQQA 3NN8A 5E5RB 3UJTL 1AKJA 2NDGA 3AS3A 3EJPA 3PV6B 4BKLA 4YGVA 2JKTM 3QUML 1RAPA 1GMEA 2GJJA 5E2VL 4X6BA 4PRAB 1XEDA 1QOKA 2NSXA 4BA8A 2VXTL 5K9KA 4AQ1A 4ELDA 4GEJA 3KLSA 3K4DA 5DT1L 5I71C 4P07A 3L71D 4TTGA 1F11B 3CZUB 1RUAH 3BKJH 3CHRA 3LD8C 4K7PY 1J1OH 5F9OL 3MRJB 1E4XI 2FK9A 1FG9C 2G5RA 5EC2A 5D2LB 5CINL 4MA1B 5C6WH 3UAFA 5L6YH 1QSZA 2X4NA 4APQA 4X0KA 4HMDA 4X6CF 3IGKA 1LO2H 2PN5A 4OZGF 1BQLL 2BOBA 3V5KA 2FJFA 1R33A 3GBDA 5BO0D 5KVGH 3VFUA 4JRYB 4U1GB 5BOPA 3MODH 1OL0A 3SDDD 4K3EL 2FATH 4Y8DC 1WLHA 1T83C 2IDQA 3G5WA 4FADA 1ZHBA 1SXCA 3EZJB 4Y1SA 5L0QB 1DJIA 4F15B 1A7QL 4ECNA 2XQYK 5E24E 3HIZA 4LSSL 3CAFA 1ZDQA 2OM5A 2AQSA 3KHQA 2E6PA 2EDFA 1NMBH 1TZIB 3GDBA 2IGLA 3HI5H 4Z7QF 3NJGA 3V7AE 1IC7H 2AV7A 3IKCB 4GUPA 2E47A 4NO5A 3AB0C 4K0OA 5KAQG 1F56A 1NAMB 1A3QA 1HRCA 1JOIA 1KEMH 3WJMA 1OOAA 1KELH 12E8H 5HHQA 5TDPB 3ZR5A 3GHEL 3QNFA 5AB0A 3TP4A 5BXFB 3WE6A 2MPAL 2F5BH 3ABZA 4P2OB 4U6VL 4P0DA 1F45A 2R2BB 4ACTA 3V52L 3F00A 3Q5OA 4NWUH 1ZA3B 4ODVH 5D1XA 2I07A 1GCYA 3DOSB 3K3QA 3KNBA 4TQ8A 4NKOA 3NSYA 4PRHD 4QXGL 3P0VL 5GGTH 4K94C 1OP3H 4CBPA 2BIQA 1JL8A 3GSNB 2D0HA 3PQYE 5I0ZA 2YPVH 1YQVH 3HPJA 4G8GB 2VT0A 3AG1B 1GZQB 2DWEB 1OTUC 1LO0H 1T0MA 3TU6A 5JORB 1MFAL 3D25A 3R0NA 1QTYT 2EDBA 2Q7AA 4JRXB 4LKXB 4HIHA 3FTGA 1R1CA 2R1WA 4XMUA 2CXBA 2EVIA 4LLWB 1BVOA 1PMYA 2DQHH 1YYLH 3NH7L 1OD9A 3GJFB 1RIHH 1N5AA 2B16A 3QDGA 3FO0H 3MNDA 3QUZA 2CG9X 4YFDB 4HS3B 4P9ML 5IFAH 3U1SL 4QHLB 2K8MA 2C26A 3FDWA 2BNUB 3PYCA 5H8DA 1E67A 3HBPA 4KZDH 1NGZB 5DJ8A 1T3FA 5HI4D 4U05A 1CGTA 3MO1A 1Z0NA 5D1ZC 5KOVC 2VDKL 4N25A 5E99H 3SGEI 4HLJA 1M3IA 3ENEA 4IRJC 2NY5L 1B0WA 1MREH 3QDMD 2HLFD 1EZLA 1GGIH 1QFUH 4ENZA 2IDFA 4XO8A 1KJ2B 3BAIA 4OF8A 2JIXA 3E8UH 4TULL 3EO1A 3QYMA 2ZYSA 2ICES 3OLDA 4MS6A 2CCVA 3IPBA 1E4JA 1I1RA 3R8QA 4YIQB 2XTSA 3LZLA 1VCAA 4UOW1 4DVBA 2IBBA 4NQDD 3UZVB 3ESNA 3KPQB 3L5IA 2HJFB 4Z7OB 4L1QA 4LEOB 3P4MB 2AAVA 1E4XH 4M6ML 1SLUA 2XI9A 4XAWL 3UZQA 4AE1A 1EEYB 3PP4L 4WGKA 1UXSA 2VW6A 2ZOTA 2FNWA 3F7YB 2H1LM 2IFFH 3WXWH 5BQ7A 3HG2A 2GFBB 3B4NA 3FUFA 1Y07A 2NXZC 5SWZD 4FF9A 3QYNA 3BQUC 1S4IA 2YSTA 1J5IA 4ALAL 1OARL 3BI9X 1WFTA 2DQFB 1MJJA 5GSVA 3TBYB 5DMYA 3WTWA 4MLIA 4WUUA 1SMAA 2YFNA 4IEFA 5F7AA 4NLAA 2ESVE 4MNGB 2IXQA 4YSRA 2BZDA 2KERA 5T5NF 3RB7A 5FHBH 2AW2A 1WJ3A 4KV5E 5J13B 1QRNB 3OKEA 3UTPE 4B3EA 2Z35B 4B96A 1W0VB 4X5XA 1CFVL 4XP5L 2FWLA 2PP9A 1XGPB 1WGOA 5C2BL 5D7SL 1YA5A 5A16B 5DHXB 4F80A 4CJ1A 3H6AA 3W38A 4I9WE 3TV3L 3S3DB 2BP8A 5A2KH 3HC2A 4JO8A 4H1LB 2BXZA 1SF5A 2A3TA 3BO8B 3NTCL 3LXCA 4CDGC 4N0UA 1NCOA 1FZKB 2HKHL 1A7NH 1IFHL 1OSEA 4XPTH 3S4SG 4ZO7A 3L4VA 2WB7A 5AWNL 3FQRA 4L4TB 3QDAA 3O3BA 3U83A 3EDKA 4QRPA 2PPFA 2DD8L 1AGEB 5F7DB 3BH4A 1Y1UA 3MNZA 2WM0A 5MEOA 1TQUA 3EYOB 5JXAH 1ETA1 1KJMB 2MFNA 3S3BB 5D4IA 3D39A 3X3GH 2FIRT 2IV9A 4I0PC 1E3FA 4F7MA 3DX6A 1G0XA 1K9TA 2WXQA 2G2PA 4E9SA 4D2NA 3K6FA 3QXTA 4WQBA 3FSWA 1TYRA 3HC0B 3N9GH 3ILPA 5JHLH 1N5YH 1RAQA 3V0DA 2CLVB 3VTAA 3RYMA 5EU4B 3IAGC 3FQ1A 4AQOA 3TIDA 3ZT7A 4UOJA 5KYWA 3N40F 1G7MB 3S36L 2ZXQA 4Q7DA 5C6TH 4YQXL 2OSWA 1JNHB 4FX5A 1G6RH 1SHXA 4MLSA 3SPCA 5J4MA 3RZCA 5DDHB 5AVQB 2LFEA 4IKIA 5CD3B 1WGVA 4JO2H 1CGXA 1MG3C 2K70A 5JDSA 4R4NC 1X4ZA 3QQ4A 1H0DB 4O2CB 3FW6A 4TLUA 1RH8A 2XNAB 2VMJA 4NWTL 4WENB 2XZAH 4RETB 4JHUA 2EXYD 1MAMH 3RA7L 4B7LA 3IDJB 2YHGA 4ZFOL 4UT7H 3A0HV 4U1GC 4PR5B 3BCCD 5HYQB 5AOLA 1I3RB 2AEOA 1EAJA 1XEUA 4D6TD 1RAMA 3Q43A 4O9HH 5DJDA 1D5BB 1UGKA 5BZDB 5L9DL 5L0QC 1A3RH 1A7OH 2IAMC 4F15C 1QHQA 5EZOL 1ZCRA 5AVYB 2K4WA 5EBGA 5D2LE 3BAXA 2JKWA 2WXNA 2XFXA 3TA3B 1SXAA 4TUKL 2NX5B 1CICA 3D18A 3P4OA 3LN4B 2CKBA 5EO0A 5HDLA 1MZ4A 4LSTL 1S9YA 4NKDA 1A3ZA 5IHHA 2DLHA 2X4TA 3CUPB 3MOBL 4OKDA 1ZIAA 5GISL 2R0KH 1FJ1A 2CKBL 4AWJC 2V5TA 4EZKA 4E68A 1S7WA 4KH2A 4OZFA 4L8SB 5FLVA 1JGIA 4P2OC 3LS5L 3TT3L 3GBMH 3MKGA 1OO2A 2G5UA 2FH8A 4OD1L 1E5ZA 4X9GA 3H9SB 5KLVD 4X6DB 1URIA 5LQBL 5LO7A 3BRFA 4YSQA 4ZRGA 1DUYB 4G5AA 3MJ7A 3PDOB 3NJNA 2UWEA 1AS6A 1F0LA 5EOQH 2ICWJ 3PQYD 3LKSB 2D4DA 1DYZA 3L3IB 4A37A 3LNHA 5FR3A 5JXEA 5CS7A 2KZWA 3C87A 4J8RB 2LT9A 2OZ4A 4GG6A 3ULUH 3AUVA 4HIJB 1WBXB 2YK1H 2JXMA 3HC4L 3QUYA 3ZQXA 5KVFL 4BXSV 4GKZA 4QXUL 5CIDB 2OZ4L 3X3FH 3CX2A 3C2SA 1B6DA 4AIZB 2OJZH 1UG9A 4GQ9H 4WW1B 3T6WA 3U36A 3B5GA 5LXGH 1F6LL 3L3OA 5FHAL 2O5ZH 4OJFH 3FN3A 2QZ5A 2XIDA 4YDNA 3BKYL 1M4KA 4YHZH 4WIQA 1XXDC 2FRGP 3WAKA 4ZXBA 2E7LA 4G8GE 3LPPA 3QCVL 3VRIB 1OTUD 1ZV5A 4NQCB 5T33L 5J56B 2R1XB 3FFOA 4JRXE 3BVXA 1IFRA 3GSQA 1TR7A 5BVPH 5T5FL 4B9GA 2VIRA 4YDIH 1RVFH 4J20A 3FT2A 4WZ9A 4ZBJA 2QPSA 4PJ9C 2CO6A 1KNOB 3BT2H 3K2MC 4KNUA 3ML9A 4EIZC 4ZODA 2PW1A 1GKEA 1RV6X 2PO6D 1GYVA 4P2RE 1AZUA 3FBKA 4RA3A 2O5XH 1L5GB 2EE2A 4AZ8B 4R26L 4RBPK 4L1DA 3N5AA 4NQVB 4JPIA 3ME0A 2DQTH 4NQUA 5ADPH 4HDIB 2NY3B 4XPGL 4WKXA 5DEFB 1NZRA 5GZNC 3MUHL 5CLXA 5IB4B 3KYOB 1WA2X 5D1ZD 5ERWB 1BL9A 3BFOA 1G7QA 3QNYA 4G5ZH 2BVTA 3EJZC 1Q9LB 3NSFA 5SV3A 4BEIA 1BQHB 3PUUA 4WFEE 2ZX8A 2PNDA 1ED3A 4HQQL 1GRWA 4R97B 3G3LA 3T8VA 2BLFB 2UX6A 2IH3A 3HJ0A 4KV5F 2DIJA 4PTTB 2QJPB 3JTSB 5CIPA 3U2SB 2WKOF 4GINA 5EH1A 4PJ7F 1GY2A 4A63A 1DFBH 4HIIA 4AEFA 1D5IH 1SNRA 2ESVD 1BDYA 3HG4A 5ADOH 3RNKB 4Z7OE 3PGCB 2BPBA 4PJ8A 3UTPD 2YEZA 4EICA 4LLUA 2ETWA 3U4BL 4CADB 1Z9SB 3PGFL 4IQHA 1Q90A 2NY6D 4LLYA 2ZWNA 4H5SB 1BAFL 2M1KA 1CGSL 1O6TA 3ZKMC 2J88L 2MEJB 4I9WD 2H26B 3WFDL 2NXZD 3C60A 4EJ1C 4FDWA 3I84A 3T5WA 1L7TH 4BM7A 1OW0A 1SF3A 4QYOB 3CFMA 3LIUA 5I17A 5F1IB 1FI9A 5I15L 4CGTA 1JPTH 1Z5YD 2ICWA 2CE6A 4MNGE 3WFBC 2AEQL 2NYYC 4NNPL 1E27B 4M48H 2X6AA 1KEGH 1QRNE 3FONA 3GKZA 4FI8A 2PYEA 2V2XA 3K4AA 4ZO8A 3FSAA 3SE4C 1UGNA 5BVJA 3T0EB 4X0NA 5FYLH 4M8QA 1CSXA 1Z6JT 5E23A 1VPOH 4LJIA 2QHRL 1AYOA 3HLKA 5DUMH 2OMVB 3SDCB 5DEJA 4Z5RB 2FX9L 4F91B 1LWHA 4MXWL 5HHOB 2X2HA 5FDYA 1B2WL 4CW1A 2YD2A 4JQXC 1I3VA 4RLDA 1FBIH 1NIRA 4JM2A 4I77H 3WFEH 1SY6A 2GT9B 1P7QA 3EJQA 3GTVA 4G82A 4L4TE 4Z0XB 3Q1SH 3O2VH 2PCXA 3RP1A 4DTGH 5J1AA 1SY6L 3CLFL 3D2UD 1CORA 3CFIC 4PIRF 3WU2V 5HD8D 4GKLA 1RIVH 1CFSA 3NJFA 2BSED 4IBVA 3E7JA 3LKQB 1PG7L 1F90L 3ASNB 3P77B 3P9LB 4I0PD 4XZUB 1NMIA 2X70A 1AHWA 1CWVA 3RWHB 2BVQB 4YBLB 3GSUB 5AVVB 4ANXA 5L2KA 1MF2H 2R0LH 3C8KB 2PWDA 1EEQA 2XACC 3D07A 2H32A 1UD3A 2ZF9A 3CV5A 5D2LF 4HGKC 4PHXA 4PJ6A 3RVVC 1EIBA 2VZTA 2HX9A 2DN7A 4NJ9H 4Y89A 5CLZA 5IREA 4QR7A 2PPCA 4URTB 3EGXA 3P54A 2YUVA 1HOCA 1Z66A 2QTVA 3D85D 2K8QA 1NEZG 4HIEB 5F6IC 4NQTA 2R4SH 3H1ZA 1MG3D 1IKOP 2BHYA 5E03A 2QHLA 4R4ND 2AABL 4HHWA 3QUGA 1MW3A 2XTJC 3FPXA 2Y36H 5E5UB 2BNRA 3VGBA 4PJBA 4WI7A 1I8MA 3O11B 3IDGB 1EXGA 1BVNP 1RULH 1MCBA 5DGRA 2VLJA 3NGBC 5J9PB 1HESA 2OMTB 1CSWA 4L4VB 5I0XA 5EPMA 3MRNA 4OF6A 3OPUA 4JL2A 4JRYD 4L8SC 2VE6A 1ZLUK 5ACMA 1DUZA 2EVGA 4P2QA 2H3NA 2FX8L 4L9DA 3PWUB 1BVKB 1FNHA 1NM9A 4KFMA 4PJXB 3KBPA 1D5XB 3A5VA 4YHNB 5DZLA 3SHSA 4KKNA 1LP9B 3KYNB 5IMOA 4MJ4A 1DBMH 4LAQH 4IJ3C 1TENA 3DBXB 4ANVA 1MFCH 2R23A 2NX5E 1V54B 1THAA 3VFGH 2F74B 3BMWA 5DZJA 3NN8B 3PNRB 4KQ3H 1AKJB 5A2JH 4BKLB 4YGVB 1QTPA 1E6OH 4D9RE 5G2NA 7TAAA 2OR9L 4X6BB 5JIPA 1XDTT 2AZAA 3GM0A 1TO5A 1TQCB 2XV3A 5CJQL 3R18A 5K9KB 4AQ1B 3QIUA 5KVDE 2WJ7A 2DYPA 4P2OD 1K5NA 4JFQA 3H9SE 1A7PL 2GEEA 4X6DE 2KC0A 4YN3A 4ANKA 2YD5A 4KPHL 5EC2B 1I9RH 3N91A 4AEIL 5AW1B 3UERA 2AANA 2X4NB 4APQB 4X0KB 4B9CA 3LKNA 3LQZA 4EF3A 3W37A 5L88H 4G8GD 4QMEA 5FW7A 4HXAL 3HZYA 3V5KB 2BOBB 2FJFB 1R46A 5HHVH 3VFUB 2F1BA 2HXAA 4XN8A 3V0FA 4FYTA 2B11B 4JRXD 1CIFA 3H3PL 5H35A 5KAFV 1ZHBB 2H7WA 2KLTA 2ERJB 3LZFH 4WDIA 2LHAA 1DE4A 1G4MA 4JJOA 3ARQA 3N2JA 4LGPB 2HVKA 3T4YA 2G9HA 2IGFH 3OSVA 4MXQC 5J1SC 1PCXA 1PPIA 1X4YA 4AQAA 2P24A 4OM0H 4TOYL 2BH5X 2RTTA 4HUNB 5GRJH 2CUAA 1CDGA 1ZS8A 2AV7B 4GUPB 1MCOH 4NO5B 2NY3C 4XNAA 3S4SA 4N8UA 1AFVL 4Y9CA 1ASPA 3OMAB 2WCGA 4NQCE 2QVKA 2K45A 4HG4J 3SY6A 3WJMB 4X7SL 3C5JA 1U95A 2F8IA 5HHQB 3W3BA 4K4KA 4M8VA 1DT1A 1NH6A 1L0PA 3WE6B 4OCYH 1HT6A 4S1RL 2XC8A 3S2CA 4GXFA 4G71B 1G9MH 2DM4A 5B3JE 1KN4L 4WFED 2V3EA 5D1XB 4Z7OF 2I07B 4PJ9D 3KNBB 4J12A 1BBDL 3QR2A 4OD3H 4FZEL 4WQ9A 4NKOB 2QJYB 1EGJH 4GT0A 3S98A 4DGYH 4FFVC 3SPGA 3HPJB 1SYVA 4I9XA 3TVMC 1K6QL 1NEPA 2Y2WA 1NJ9A 1RZKC 1IC1A 1NBVH 1T0MB 3JWNC 5J89A 4ZK8A 5TFSL 2FECL 3D25B 2HSIA 3ES6A 4EZMA 5IROA 1YJDH 2Q86A 3DVIA 4XO9A 4HIHB 3FTGB 2R1WB 3FTWA 3OKYA 5DWUL 5T1MA 1TNMA 4LNVA 3VAEA 4E9LA 4L2LA 3EJZD 5E9DA 4K73A 3FQUA 3KH3A 4JHAH 3MLTA 2VKXA 1N5AB 3QDGB 3QUZB 4PVBA 3K71A 1T2QH 3WCYA 1W2LA 4U6XA 1ZZHA 2XWJA 1QFWM 2VDKB 3CD4A 2W60A 1FCDC 4CC0A 5DJAB 4G9DA 1KTJA 3C5XA 1H3UA 3IN0A 2AMUA 3OZLA 2QDVA 4XXWC 1T3FB 5DJ8B 4M7JH 4YSOA 3JWNE 3MO1B 1QRND 4LCUA 5DS1A 4R4FH 4Y2NA 3MGOA 5JLZA 3T0EC 2QLVB 1LO4L 4Y2LA 3WEOA 2J3SA 4PB9L 3HA0A 1G9HA 2ZKXA 4A7GA 2AXTV 3AU1A 5BW7A 1WZLA 2Z1PA 3GBNH 5HI3D 2AEWA 5FYJH 3ZKMD 1IIIA 2JIXB 2AK1L 3EO1B 4C8XA 1FQ9C 5KJ7E 1E5CA 3D6GA 2XTSB 4ALAH 3BZFA 3CFUA 2J57A 1F4AA 1KTDA 2H6UA 4M6NL 2YMOA 3DRTA 2NYYD 1JD7A 4L4TD 5KG9A 3UZQB 2CHXA 1P4BH 2JTYA 3BH9A 3LPOA 3GO1H 5LGHH 1UXSB 1DCEA 5IVXA 3T0EE 4HWZA 5BQ7B 1OHZA 2WO4A 4JB9H 4FQIH 2FWOA 4PRNA 6FABH 1T6VN 2AJUL 5HHOE 4CSSA 1AOHA 5GSVB 1QAWA 1MJJB 4RA0C 2Y3AA 1JPSH 4WUUB 2C7UA 3GXNA 3MA7A 3FHEA 4IEFB 3MN8A 4XNUH 2IXQB 2GVYA 1OVZA 1HEZA 3GPSA 4WWPA 4GRMA 1V27A 2MKWA 3VNZA 3OKEB 1MEXH 2VN5A 4XP9L 3LPGA 155CA 5I30L 3W2DH 4X5XB 1MNUH 1TTFA 2FWLB 1X9LA 2AKRA 3X1FA 5ICZA 4AQZA 5FA4A 4FS0A 4PLOB 5DMGD 2A4CA 2BP8B 4EUPH 1UOWA 3HMWH 5IUCA 3VD4A 2BIOA 3B83A 3P3RA 2P52A 3BP4A 3PNWA 4MB1A 5K69A 1N7ML 4LRNH 4RMQA 3KJ6L 1CVSC 3TF4A 3A67H 2YUXA 4N0UB 4RAHA 3MLUH 4OFIA 4N2BA 5L8JB 4GUCA 3NBNA 4CAGA 4UMGA 4PJCA 4M1DH 3TBCA 5JYMA 3QZNA 3FQRB 5I82A 1OSPL 3F58H 3O3BB 4QRPB 5E0FA 1CD9B 1EUTA 3MNZB 3UX9B 5MEOB 2X4UA 4MAZA 3ISYA 1IZL0 1F3JA 5JMRA 3ZL4H 3NPZB 3HN5A 3D39B 5B7EA 2CBPA 4UIKH 3RU8H 4F7MB 2ZOKA 3DX6B 3TA3D 2NX5D 1FZJA 1JS4A 1OTTC 1WC7A 4XXCA 1A2SA 3MVSA 3GB7A 5BV7L 3ILPB 2WQSA 4BFNA 1OAZH 2ZCKL 4L4VE 4D9RD 1A8ZA 4X6DF 1BGXH 1H6UA 5D1QC 3TIDB 4OIIL 3U9UA 5KYWB 3R7RA 2H3XC 3WTVA 4KOBA 4HFWA 4G9FB 4G6ML 1Z1WA 2PKDA 3RZCB 4RISH 3WEAA 2DPKA 5JDSB 1LP9E 3H9SD 3QQ4B 3U6XS 1LQSR 4LPYA 2CDGA 4APQC 4PCTA 3R4DA 2N56A 4EN3C 3POCA 1BZ8A 2ZXAA 1MZYA 4LCIL 5D4QA 4C4UA 1O5DT 1UM6H 2JB5L 3SKOA 4ZAKA 1ZLVH 2XVGA 3Q5YA 4M61A 2RAMA 3MRPA 2W0FA 3OGOE 4NC0B 1SXSA 1O6VA 3LQAL 1YEFH 1B4JH 2WUCH 5DJDB 4LXFA 2P80D 4YWGH 2I27N 3JUYA 1I6DA 1ZVNA 4ADJA 4L18A 1NEUA 5F6HJ 5DZPA 5TTRA 4DESA 3EBHA 2CDFA 2ORBL 3EUUA 3QIWC 1GYCA 1NCUA 3UIZA 1QD0A 4NKMA 3B1UA 3DETD 1ZSHA 4OBRA 4XPAL 5HYJA 1CIGA 1SQBD 4AM0Q 2XFXB 2H1XA 2FLBT 2Z8VC 4P9HC 3P4OB 1CICB 3D18B 4R0LC 5DVNA 2CKBB 4PVNA 5EO0B 4QJ4B 2DJSA 3BUQA 1S9YB 4GBXA 4NKDB 5K9JL 1MFUA 2X4TB 4DK3A 2L7QA 3I9IA 4ZMNA 1WTLA 1FJ1B 2C9UA 4NQCD 4TSBL 4FE9A 2G3ZA 1KYOW 1S7WB 4OZFB 3DX0A 4GRLA 1NM4A 3II2A 3LY6A 5JQIB 2CQVA 2NYZA 2ZPKL 4RBPH 5DHMC 4YE4L 2Y72A 3MLRL 2E86A 5A6MA 1AYGA 1ZWIA 2VQ4A 5JMOC 4YJZL 1UWGL 4MQ7A 4JG0L 3RX8A 2CUIA 2E4TA 3EBAA 5F7HA 1KDIA 3GHBH 5CEZL 3MJ7B 2AGJH 2UWEB 4POUB 1SJVA 1LMIA 5B1AB 2BY0A 4F8QA 4GG6B 4QTHA 3CQQA 2NY3D 4EOWH 2QT6A 1M6ZA 1GJQA 2JXMB 3AG3B 3QUYB 2UY6A 4YDVA 4YK4B 1OT4A 3IDMA 4GKZB 3VSUA 1KPRA 2CRMA 4KTDH 3SN6N 2NY1C 3BSZH 4U3XA 4X80H 4GSRA 4NGHL 1GY1A 4GQQA 2ROYA 3IJHA 1KYOD 3Q2NA 1WV7T 5DQJA 3PAYA 3MLVL 3U36B 4FQ1H 4XBEL 4CC4C 3L3OB 3ESOA 5FFGA 3JWOL 3JSSA 2CLRA 3OAUL 4A39A 4KKAC 4ZXBB 5C08A 1XB8A 4FFVD 4JRLA 3DPDA 1RXLA 5GS3A 3KZIV 3KE0A 3CXHJ 3GRWH 5KBMA 3M8OL 6PCYA 4XNQA 3HNVH 2LR4A 3K6DA 3GSQB 4KJQD 2XWXA 1QP1A 1F86A 3WD5L 2VIRB 1KCKA 1WBZA 2QADB 2DF3A 4BZ2L 3U9PL 3FT2B 1VYDA 1NEZA 4X9BA 2IWKA 4KVPA 2CO6B 2X2YA 3MRIA 3QDGE 4F8OA 4IIQA 1MRFH 5D72H 3AY2A 1BM3L 4NOBA 1SLXA 4JPIB 5AW0B 3BEVA 3RIKA 5FGCE 2QQNH 4KJWD 1U8QA 1BPLB 1IEHA 1W8NA 3KLKA 3MV11 1G7QB 3EYFA 3QNYB 5FEBA 4LLQA 3MLZH 3T0ED 1J8SA 1JGLH 3F84A 3QBTB 4PW4A 1KCSH 3Q13A 1BF2A 3RGBA 1ED3B 4OJEH 4DUVA 2V0AA 1ACYL 4FLSA 3M7FB 3SDCD 1MFDH 1KGWA 1X9UA 2IH3B 3KPPA 5HHOD 1CR9H 4UQCA 2DEWX 5CIPB 1U8MA 3VFOA 4AG4L 4HIIB 5C0FA 4LSUH 4YXHL 2DTML 3ZHNA 5M95B 1SQVD 1U4FA 2XZQL 3ARGA 4IBUA 2BPBB 3DX7A 4PJ8B 4NI3A 2YEZB 4LLUB 3TBVA 1TFHA 1KTKE 3H42H 3HC3L 1ZLWK 1L0LD 4LLYB 1BM7A 1JF5A 2XPYA 5I1KL 5EBLA 2AV1A 4UT6H 5DJXA 5F7WC 4DVRL 3C60B 1E40A 3EZ8A 3SJVA 4FHKA 3C12A 1WAAA 5I17B 5HYSG 4CILA 1NOAA 2N7AA 4DGIL 4LDLB 1LO3H 3IM1A 2ICWB 1C6SA 5FFLA 3V4UL 1JGUL 4FD0A 3W57A 4JG5A 1CD0A 1HZHL 3FO2A 3FONB 4GW5A 5INDA 4PJAA 2PYEB 1WFUA 2V2XB 1ZLSH 1FVCA 5BVJB 2J5LB 3L4TA 4M8QB 3I02A 3GC3A 4J2QA 1J1XH 3SBWA 3K4ZA 3L74D 3A47A 2Z64C 1IC5L 4DKAA 3S88L 1PF3A 1ZLUH 4HEPG 1JDDA 3BFWA 4CW1B 5JOFA 4PJXF 5I1CH 4JM2B 3KDMA 1IQDA 1DN0A 2XHNA 3AT8A 4L4VD 1LP9F 3WV0A 5B3NA 1RP9A 1P7QB 3FTYA 5FO7A 1EEZA 4L05A 3G5YA 3FU5A 4R2GB 3RZCC 4ONFH 4W9HC 1F4WH 5J1AB 2ZJSL 1N6QL 4KY2A 4LARH 3GJFK 1CFSB 2CHZA 2GTWA 5ICUA 1OAXL 5KANG 3U0TA 3D39E 1X3DA 5CR1A 1H32A 4GOSA 3P11H 5E94A 2AJZA 4Y5YC 5CZXD 5JUEH 2X70B 1AHWB 2X5PA 1AKJD 1BQUA 1WD9A 4OFKA 3DO7A 2ZXDA 5L2KB 5L8KB 4YSCA 2WCPA 2H32B 4LSRL 2PCCB 1XFPA 4HJJH 3DXAA 3ZMRA 4G9FE 4HGWA 3SQOL 3S8GB 2N9IA 1MHHA 1B9KA 1Q0XL 3OKDA 1IGJA 3EGXB 1HOCB 2FBOJ 1E4WL 3ZRFC 1RUQL 2CJ3A 3BP7A 1GDVA 3HAEG 2V7NA 3DVFA 4F1ZA 2XDHA 2CO4A 2BNRB 4APQD 4PJBB 5C0EA 1I8MB 1J9RA 1FVDA 1U41A 5DHVA 3X11A 2VLJB 3DSFH 4KZCA 4PW3A 5ABZA 3D3VA 5EPMB 2OPCA 3EYUL 3MRNB 4GI6A 4AY0A 1TLKA 4N26A 4LPCA 4Y19A 2VE6B 1DUZB 1NGPL 3UJIH 4H20L 4P2QB 2H3NB 3V0HA 4YX2L 3HJEA 3HKZA 1G7LA 4JN2A 3IWUA 3RRQA 1P1ZA 1T6WA 2YRZA 3FHQA 4YZFE 5CGMA 1XMWA 2Y1AA 2XVLA 3U0WL 1IJ9A 3QIWD 4OAWA 5IMOB 4C56A 3UZEA 3CE1A 4LSPL 4XNBA 4C83A 2R23B 2KLSA 1XSOA 5JXEC 1N70A 1IB5A 1NCCH 4R5VA 1XF5A 2CUMA 4YDKL 5KN5A 3PPEA 3K7UA 3HG1A 3QUYC 1HL5A 2J55A 2VXQH 5F1SA 2Y06H 4Y5RA 1UQSA 3VUAA 4E9XA 1ZEAL 3BRDA 2DMHA 3QIUB 2DYPB 3O41A 1RHFA 1CF8H 1K5NB 4JFQB 3STBA 3AM8A 4K3GA 5D1XD 3EOYG 4MJJA 1WCBA 3BKML 4DO4A 5EHFA 4FG4A 1QKZL 1KGYE 1QO3A 2FBJH 2UWEE 1NCWH 4ZXBC 3RLSA 2E7LC 3RB5A 2KUTA 4P4QB 3LKNB 3QHFL 1FLTX 3AQXA 4TKWA 5KVFE 3TNNA 3TEYA 3HZYB 4AL8H 2G3MA 4GG6E 3MBEA 4GKSA 5E4IA 2D9CA 1IUZA 4WV1A 2PCYA 1OANA 3ARZA 2AJSH 4PWFA 4ODTL 2QADC 2QV4A 3NJJA 2X4PB 5ECJE 1LK2A 4FFZH 2E76C 1Q1JL 3PHOA 5H35B 2EDEA 2RBLA 4WDIB 1AZCA 1DE4B 2ZTBA 1SLVA 4FNTA 2HVKB 4WTZA 2LABA 3T4YB 2G9HB 3QDGD 3QUZD 4R5XA 1AVAA 3NCYP 2EYTB 4MVBC 4KVCL 3BH8A 4AQAB 2P24B 1QEWA 3QJSB 5F88A 1C8PA 4J3XA 3O6KL 4IDJL 2V2TA 2JELH 1ADQH 1ZS8B 3L9YA 1MIEL 4KKAD 3WTXA 3S4SB 2IBGA 1Y7VA 4P4KA 5D1ZI 1M9WA 1G9NL 5ILTL 3C5JB 1U95B 5KYXA 5AZEH 5T3ZL 3BW9A 4ZX4A 4WU7A 2YD4A 4HXBL 1J3SA 1E0OB 1OTSC 1Q72H 3DTXA 5IG7A 2J56A 4ZTPH 3DHPA 3VD7A 4OCSL 3SE9H 1GHFH 1I9JL 2JIXD 1CUOA 4OCXL 3TL5A 4N2FA 1OV8A 4MQTB 2D7TL 4F9PA 5LDSA 1SYVB 3MV8A 3MRRA 5ALBL 2G60H 3ZU8A 3B9KC 5ESVA 1NJ9B 1KX7A 3L3DA 4PJ8C 4OJAA 1G1KA 2O4EA 4JKPL 3H1KD 3ES6B 3KR3H 4M3JA 2Q86B 4BQ8A 4W9KC 1FLRL 4QHMA 5T1MB 4FTDA 4PGBA 2XZCL 2XJKA 3A4DA 5E9DB 1QLRA 2R56H 2ZX7A 2DOCA 3OKLA 3FQUB 5AW9B 3MLTB 3IAPA 1OW0C 1PKOA 2XT1B 3K71B 6TAAA 4U6XB 1XD0A 1ILUA 4DWHA 1T1WA 2XWJB 3PHQA 1EHXA 4WUUD 3BLPX 2I9LA 1R3IH 5D70L 2W60B 4FQPA 5IZ7A 4G9DB 3HCVA 4LRIA 2YPVA 1UFUA 1DBJL 5AG9A 4AAMA 4LP8A 5CJXC 3WIHA 5I75C 2IMMA 4LCUB 4DHLA 1YDPA 2MSPA 5AB1A 3ETTA 3MGOB 3LB6D 2J5LC 5JLZB 3I6SA 2EXWC 2GHZA 3KPSA 4RCAA 1CFNA 3AU1B 3OV6A 5CIGB 4MMXA 1Z5LA 5EDSA 2F5AL 4OQTA 4WI4A 3WDHA 2ZUVA 1I82A 4N87A 3QQ3A 2HVBA 1D6EA 4YBQC 3CSYA 5ICYB 2BRRL 4KKRA 3B2DC 5TISV 4UDUA 2Y6TE 3ZGIA 3IGAA 4EAEA 4ZPVA 3BZFB 1T0PB 4OQTL 3MNWA 3VW3H 1KTDB 3GMRA 5AAMA 3DRTB 4IRSC 2H6PA 3QI9C 5KG9B 3B8YA 3BH9B 2PYEE 3DJRA 4K94H 3EHBC 4QRPD 3UPAA 5FUOH 1UD5A 1L9MA 5IVXB 4HWZB 1CI5A 1KV3A 3L81A 4G43A 2EILB 4LCCA 2FWOB 3CIAA 2A6DA 3D39D 3OAWA 4PRNB 2QSCL 4OH2A 3IBEA 4KI5C 1CURA 3SOBH 3P02A 5H94A 4HS8H 2EDRA 1K2DA 2HH0L 2C7UB 3FUIA 1XSJA 3MA7B 4Q5PA 1CLOH 3HNSL 3HZKA 1BOGA 4B27A 4DN3H 3SBPA 4DGVH 1U2HA 4I3SH 1KLFA 5GIRA 4DNLA 5I2IA 1HEZB 3ZE0B 4DFHA 5JIHA 4GRMB 4RZKA 2WC7A 5LNGA 2ZONG 5CIFB 4G70B 1PNDA 4G9FD 3RZCD 3LMJH 2XIBA 5TGBA 4BSWA 4WQ7A 2AKRB 2DM2A 5ICZB 5FA4B 1CXEA 4U1HA 4Z8FL 5ACLA 4IBWA 3QRGL 1ZOXA 5JW4R 1RQ5A 2EEBA 1NQBA 4B9KC 3CVHL 3BP4B 3PNWB 4PB0H 2X1OA 3ZKQD 3UO8B 1A6WL 4HT1H 4AK2A 3PWPA 1B4RA 5L2KE 2VDQH 4YZFF 4ATTA 2D7QA 3RPIA 1AMXA 1KIBA 2QPEB 4OTXL 4PJCB 5DA0B 2J1ZA 5IKCA 1JNNH 2VXSH 4XNDA 5EIQA 1H6EA 3FFDA 1TLMA 2RALA 5CJ8A 1ZRUA 2JF1A 2X4UB 3S5YA 5JNYA 5KS9A 1F3JB 2XN9A 4PEEA 4G72B 1QSFA 4YLCA 2CGZA 4I3RH 4M1CC 2CU9A 1ETB1 5IOKA 1J9TA 4NZRL 2ZOKB 4UU9A 1MHPL 3RY5A 1CICD 1O9WA 1FZJB 2BNRE 4PJBE 5T1LA 1AG6A 5F0LB 3F3HA 3GB7B 5HXMA 4L1HA 5JQHC 2VLJE 3U82B 3QC5X 1U8OA 5GS2D 3U9UB 1IGIH 2E8YA 4GY4A 2HT3D 4U1IA 4FA5A 1I31A 4HFWB 4P2QE 1KZQA 4A55A