2YQBA

Structure of p93a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.4 a resolution
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
454
structure length
454
Chain Sequence
KLPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKMAHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
total genus 148
structure length 454
sequence length 454
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2yqbA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yqbA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yqbA02
1C6OA 3AZUA 1I6DA 1J5CA 1SF3A 1N9CA 1IUZA 1SFHA 1CCHA 1BQ5A 3IE9A 4F2EA 2IWEA 4Q89A 2PPAA 2FYNB 5EXQA 1CO6A 2W88A 1DT1A 3L45A 4YSTA 1RAPA 2BO0A 1N70A 1PCSA 3GYRA 3OQRA 3FPXA 4E9YA 5D4JA 2Y69B 1CURA 1CHHA 1SF5A 3DKHA 4YSUA 4K3IA 4AZUA 1E2RA 2YAMA 1FCDC 3SBRA 4DPBX 351CA 4EIEA 3CX5D 2HX7A 1JZEA 1E65A 2PPEA 5B6QA 2C2CA 1ASOA 2P80D 2CJ3A 2YAFA 2YXWA 5D4HA 1CCRA 4KMGA 4KO9A 3WNIA 1V54B 2YAEA 1NTDA 3KW8A 1BCCD 3NJGA 1AQ8A 3HB3B 3O5CA 2AFNA 4DPAX 1JVLA 1PNCA 3CWBD 4WQEA 2N18C 1L9SA 1YIQA 2XWZA 1SFDA 2CXBA 4JKNA 5GTIV 1HZUA 2QPEB 1I55A 3NBSA 2C1UA 2XV3A 4BWTA 4KOBA 3WG7B 3RN0A 1K3GA 2IDQA 3L75D 3BVDB 4G70B 1WA2X 3FSZA 3ZCFA 1E5ZA 1HFUA 1LMSA 2GB2A 1ZV2A 1PY0A 3UAAA 3L73D 3C2CA 4MU8A 3DR0A 3NJLA 3PCYA 4FA1A 3NJMA 2EILB 1SDDA 3AG3B 2IDTA 1L9OA 2HLEB 4DP2X 1BQRA 1RZ6A 1ET5A 3EF4A 1GU2A 2CE1A 2OCCB 4BXVA 1SQQD 8PAZA 2UXGA 2MTAC 1YICA 1KB9D 3WFDC 1JZHA 1TEFA 4FAAB 4WQDA 1KCBA 4E9RA 1OE1A 2L4DA 2R7EB 4WTQA 4WQCA 2JQRA 1AIZA 2BLFB 1J9QA 2DWSA 2XYBA 2N9JA 1AZRA 3HQ6A 1JVOA 2PPDA 4HHGA 3WKPA 4BDVB 1FA4A 1BYOA 4ENZA 4QKTA 4JCGA 2QPDB 2GSMB 1WVEC 2YAOA 5I6NA 1ADWA 4DP1X 4XXLA 4PW9B 3FPYA 1J9SA 3RN1A 1GDVA 1H32A 3CG8A 3HEIB 1L9PA 2BP0B 2J55A 3OMNB 3FYEB 4YSAA 5I6LA 1KYOW 3CZUB 1AACA 2FQGA 3CDZB 5E9NA 3FU8A 1C52A 3NP3A 3WU2V 2EINB 4A2FA 3SQRA 1C2RA 4WQBA 4NAJA 1CHIA 1H9XA 1RAQA 1PMYA 4O1WA 3H4HA 1S6VB 4N0KA 3ZOYA 2X87A 1SHXA 2CBPA 3EH3B 3NJJA 4DP8X 6PCYA 4V2KA 1YLBB 3FU7B 1M6ZA 1L9BC 1GS8A 2CCWA 1YTCA 1E30A 2VM4A 4G71B 4WKXA 3U25A 3SXTA 4AAOA 1ASQA 4A2EA 1A8ZA 5I5MA 1OAEA 5TK4A 1QL4A 2XX1A 2PCYA 2H47C 1OCCB 2FQFA 5B1JC 4L3GA 1OE2A 5IY5B 1AKKA 1AS6A 3DMIA 3PXWA 4KNUA 1CORA 5FC9A 2HX8A 1OCZB 1NIEA 3UGEA 4WQ7A 1ILSA 3MBWB 1SNRA 2PP7A 3WC8A 1ZZHA 4G7RB 6PAZA 4ZK8A 1T5KA 3X1FA 2CA4B 1PPJD 3WNJA 4PD4D 2EIJB 5A7EA 1KBVA 1DIIC 4GP4B 1QLEB 1L9QA 2XXFA 1NU1D 3WFBC 1WA1X 2VSMB 2AIUA 2PCBB 1A56A 1M9WA 1BGYD 5CIBB 1IKOP 1WAEA 1WS7A 3PLYA 3WFCC 5I5IA 4DY9A 1CTJA 1BAWA 2YAHA 4PWAA 2IWKA 1SQPD 1PAZA 2I7SA 4YSEA 1KX2A 4P5RA 4QLWA 2YAQA 3O20A 3JTBA 1J5DA 5B1BB 2I7OA 4G7QB 2B12B 4KO6A 3UACA 1CRYA 1S5LV 2ORLA 1L9TA 2J57A 4DP7X 1AANA 1NWOA 4KNTA 5CIEB 2R7EA 4YSOA 3S3BB 1W6LA 3NSDA 3CVCA 4BWWA 2QJPB 1BXAA 5DFSA 2MHMA 4BDVA 1H31A 3TASA 5CYTR 1UATA 1GIWA 1GYCA 2OV0A 7PCYA 4E9SA 2IAAC 1QNIA 3QJUB 4NB7A 5B66V 5C9MA 3T9WA 3A0BV 2BP0A 1ZRTD 1W2LA 5DJQC 3X39A 1JXDA 1MZYA 1RZQA 2B3IA 1AZUA 3CDZA 3FYIB 1LFMA 4GP8B 5AZUA 1ILUA 1BXVA 1CUOA 1W6WA 3X1EA 4BXSV 1AZNA 1HRCA 2AZAA 2XV2A 1AZBA 2ZWNA 4A67A 3NYKA 3H1JD 1PP9D 4DPCX 1AR1B 1FWXA 1CYIA 1FI7A 3ORVA 1XB8A 2VHDA 2PLTA 5D4IA 1PZCA 1NINA 3VNWA 2E86A 3FU7A 155CA 2HXAA 1JDLA 2VW7A 3VRDA 3NWVA 5KLVD 3L70D 1X9UA 2QT6A 1H9YA 1JOIA 4UANA 4GP5B 1HJ3A 1U75B 3TU6A 1HAWA 4EIFA 1I8PA 1OF0A 5CIHB 4AKQA 1IO3A 1IZL0 1DW1A 4PCYA 5KLIB 2IH9A 1JZIA 1DW3A 2XUWA 3T71A 2BWDA 4FA7B 2VM3A 1C2NA 2XV0A 1OOWA 1WA0X 2LITA 1OCRB 2FJSA 3DTUB 3SBPA 1N68A 3S8FB 3V9EA 1KYAA 4GEDB 1B3IA 2DYRB 2QJKB 1KX7A 2BGVX 2JXMA 3QQXA 4GYBA 2XU9A 4KOCA 4F2FA 1ETPA 1MG3D 4RSZA 1QYZA 2VMJA 4E9VA 4E9QA 2B4ZA 3OMIB 1ET7A 1I8OA 2LLNA 1RKRA 3WI9A 3FSAA 2YQBA 1LC2A 3UAEA 4HCIA 1CYJA 3FU9A 1CSVA 1RZPA 3EH5B 4AKOA 3ZBMA 1CIFA 2AI5A 1ZIBA 5TISV 2GIMA 1BL9A 4O1QA 3L74D 1KDIA 2PPCA 2GC7D 2Q9OA 2DWTA 1LC1A 3WKQA 3PXSA 1BEXA 1J9TA 3CP5A 2YK3A 3TYIA 3BQVA 3GXUB 1NIDA 4AX3A 3X1BA 1BE3D 3L4OA 3EH4B 1GSKA 1H31B 1GR7A 3HQ9A 2PPFA 3FSVA 1H1OA 1JXGA 1A65A 2GC4D 5I6MA 4KO5A 3QJVB 2BCNB 1L0ND 3L71D 1TEGA 3PAUA 1FI9A 4A2GA 2C1DB 1DZ0A 2GI0A 4FA9A 1BQKA 3MX0B 3QJTB 2JKWA 2PP8A 3G5WA 5E79V 2GIWA 1GJQA 4WQAA 4HCFA 2UXFA 3O1YA 1GW0A 3H4FA 1JERA 1NTKD 2ZZS1 3RLMA 5KKZB 2J56A 1K3HA 1AS8A 2X88A 2VN3A 1VYDA 3NSYA 2HX9A 1YEAA 3IN2A 3QJSB 4Q8BA 1V10A 4K9JA 1IRWA 2RACA 3NSFA 3AG2B 4N8UA 2FWLA 3CVDA 1CNOA 5AKRA 4DP4X 5B3SB 3NP4A 2YXVA 1CXCA 1HROA 1PZBA 2HRHA 3FT0A 2BZ7A 2FQDA 1QN2A 3HQ8A 1CSXA 3QPKA 1CIGA 3T6VA 1NNOA 1NMIA 1H33B 1AOZA 2BZCA 4YSCA 1YCCA 1AG0A 1KIBA 4EICA 3HQ7A 1JZGA 1HJ4A 2FNWA 3TBBA 2ZXWB 2B0ZB 1WS8A 3CVBA 3D12B 3ERXA 3S3DB 4DP6X 1COTA 1EHKB 2BH4X 5CIGB 2UX6A 1MG2D 3CXHD 3AG1B 1YNRA 3NJHA 2N0MA 2H3XC 4L0PB 2FTAA 2YARA 4GYDA 3IEAA 3TBCA 1PLCA 2Y1AA 1TKWA 2VW6A 1CRJA 2PCFA 1NZRA 1PNDA 3DP5A 5CIFB 451CA 3ABLB 1ID2A 9PCYA 1J3SA 2JTIB 4YVUA 2BH5X 3ZOWA 1EZVD 4Y5RA 4GY4A 5B7MA 1CHJA 1DVVA 1NTMD 2EIMB 4N4YB 1QKSA 1OV8A 3H1LD 2FQEA 4G7SB 3ABMB 1F56A 3ZDWA 2LIRA 1NPNA 1XB6A 1KV7A 2EIKB 2BCCD 1N50A 2C9XB 4NFGB 1CEDA 4HCGA 4A2HA 2YCCA 3SLEA 4D6TD 3WIAA 2TSAA 5I6PA 3ABKB 1L0LD 3C75A 1NPJA 3KZIV 1OCDA 1CIEA 1AOQA 1SQBD 4IL6V 3PXLA 1E8EA 1CRHA 1IC0A 2D0SA 4X4KA 4FA5A 2C1DA 2FRCA 3ZIYA 4YSQA 2GHZA 3ZX1A 1E5YA 5I26A 1I53A 3X1GA 2V07A 1KB0A 2H5UA 1B7VA 5KAIV 1CXAA 2FT7A 2PP9A 3UADA 1C6RA 2XTSB 2ZXYA 5F7AA 4FAVA 2BW5A 4KO7A 2IBZD 4UB6V 1N90A 1MZZA 3H56A 4HHWA 4DP0X 4A2DA 4EIDA 3WUIA 1MDAA 1EZLA 4J20A 5B1AB 3OA8B 2BWIA 3NSCA 4LJIA 2N3BA 1GKSA 1CYCA 2BW4A 4UB8V 2UX7A 3PAVA 1DW0A 4UF7C 3PPSA 1HH7A 4P4QB 2DY2A 2FYUD 3X1NA 1CTZA 2CE0A 3RMZA 2FWLB 1M70A 1E29A 1SHWA 4JHVA 4YSDA 4CSZA 1H33A 1ZPUA 4YE1A 2QDWA 1PLBA 3FS9A 4H0JA 3T6ZA 3S8GB 1W5CT 2ZBOA 1LS9A 3A0HV 1CTYA 1NWPA 2HRGA 2WSDA 2V08A 4CSPA 2N18B 1GY2A 1MG3C 4DP5X 2CUAA 1A3ZA 1M60A 5B7EA 5C0ZA 5EHFA 5I5JA 4PJ0V 2UXVA 1GS7A 5GTHV 3A9FA 2I85A 2YAPA 4NERA 1NIBA 3AW5A 2CALA 3X2QB 1NIRA 4F7KA 5DF5A 4AKPA 5AFAA 2D0WA 1CSWA 4UAHA 2GC7C 2WO2B 4YSSA 1TU2A 3M97X 1CSUA 4FA4A 1DVHA 2IDSA 3ASOB 1J9RA 4W9ZA 1RZ5A 3FQ1A 1ET8A 3NJNA 3TA4D 1IQCA 1SQXD 3CX5W 2CAKA 4YSPA 1I6EA 1DW2A 2FT6A 2VSKB 3H1ID 1FOCA 1CYXA 1XMEB 2GC4C 3PAZA 4YSRA 1NIAA 1V55B 1C7MA 1IBZA 2J5WA 2WO3B 4M3HA 1A2SA 1RCYA 4FANA 4G72B 1QL3A 1IRVA 5I6KA 3QJRB 4L1QA 1A4BA 4H0KA 3KW7A 3S3CB 1WEJF 1I54A 1M56B 4WQ8A 1A8CA 2I8FA 1E67A 1KGYE 1KYOD 4JHUA 2NRDA 1L9RA 3EHBB 1VLXA 1GY1A 2XX0A 4W1TA 1NDTA 1AZCA 3T6WA 1ASPA 1X9RA 2P80A 2HZHA 1L9JC 3ZOOA 3OM3B 3ASNB 1HJ5A 4E9WA 1ZDSA 3NJFA 2N3YA 1NIFA 3OA8A 1YFCA 3JBTB 1AS7A 1CYWA 1HAUA 2A3TA 1DIQC 1A4CA 2AVFA 5ANHA 3FQ2A 1KV9A 1JZJA 3RYMA 1NTZD 3SVWA 5TK2A 5AURA 2AZUA 2JFCA 4P5SA 2OZ1B 4AALA 4XYDB 4HZ1A 2TSBA 1C6SA 1R1CA 3VYMA 2DYSB 4DP9X 7PAZA 1MG2C 1OCOB 1FFTB 4FB1A 1GS6X 3QJQB 3CYTI 2HV4A 3PH2B 1CC5A 1XB3A 2B11B 3N2JA 5B1KA 1AYGA 1KDJA 1FHBA 1ZDQA 1MZ4A 1PF3A 3GDCA 3O0RC 3PXTA 4M4RB 3OCDB 1HCMA 2CA3B 2IDFA 2OJ1A 4U3FD 2BP8B 1FI3A 3AG4B 3NT0A 2PACA 2AANA 2GBAA 1CC3A 4MFHA 2DV6A 4KNSA 2QDVA 5F7BA 1CRGA 4L3HA 1URIA 5I6OA 1FJ0A 3H1KD 1OE3A 3SBQA 2YIUB 5H2FV 2C1VA 3NJKA 1R0QA 2ZOOA 3JT2A 1DYZA 4BWUA 3MK7B 1I5TA 2A06D 2MTAA 2W8CA 4HIPA 2IH8A 1P84D 4Q5PA 4WQ9A 1W8EA 5B5EV 1SJMA 2BHFA 3UABA 4A66A 5PCYA 1QHQA 3NBTA 1CRCA 1N15A 1AAJA 2PCCB 2FT8A 1SQVD 1CIHA 2N9IA 2B10B 1AOFA 1ZIAA 1PLAA 4A68A 4BK5C 5LDUA 1JXFA 3ZOXA 4EF3A 1BYPA 3L72D 1JZFA 2XXGA 1F1CA 3TGUD 3CXHW 1KCWA 3T6XA 1M57B 4YVNA 2VW4A 5DJQB 3IN0A 4AANA 4E9TA 1AG6A 2XVBA 1C75A 3FSWA 1ETJA 2MRYA 2ZONA 2AXTV 1KBWA 3NJIA 1YEBA 3SWSA 1HZVA 1SDDB 2QJYB 3MK7C 2GB8B 4HALA 1CRIA 3AY2A 5CICB 4PAZA 4RH4A 5PAZA 2B08A 3OD3A 2EXVA 4AI7A 3IBOA 5I28A 1F1FA 4GXFA 2XLLA 3FQYA 3H1HD 4TXVB 2ZONG 4QAOA 5B1JA 2BPBB 1A4AA 4YL4A 2OZ1A 3OMAB 3L4MA 5B7FA 5CIDB 2Q5BA 1GQ1A 3V9CA 1NMLA 3BCCD 3DIVA 1U74B 1NICA 5IY51 3SJLA 5KAFV 3WFEC 2IDUA 1H32B 1IBYA 4HAKA 2IWFA 3N55A 1BXUA 2DVHA 2UXTA 3ABGA 2DGEA 3OCDA 4E9XA 2C8SA 1EB7A 3CU4A 1PZAA 2BP8A 4AAMA
chains in the Genus database with same CATH superfamily
2NXZC 3OAUH 4F1SA 4NWUL 1MI5E 2F6AA 4X8CA 3ULUD 5K39B 4P9ML 4ATWA 1N8ZA 5FIEA 4ORGA 1XO8A 5F7KC 1N70A 1CGYA 4HIEB 1MCLA 1UENA 1YNLL 4MA3A 1JGUH 2Y69B 2ZOLA 5D4JA 3II1A 4YSUA 1EJOL 3SPVB 3UC0H 3LKRB 4PWEA 5LDUA 1JE6A 1O5PA 4Q9CA 1E65A 4LGPB 2P80D 3GM8A 5ILTL 4LVEA 4D8PA 5CN3A 2A6IB 2P5EA 3I75B 2BP3A 1P5UA 2GK2A 4PRHD 4QRFA 3QCVH 4XVUD 4NQDA 3T0EE 3GDBA 4LVOB 3SY0B 2ETWA 5DK3A 5EUKB 3SE9L 2FSEA 1QWUA 2QPEB 5I75C 3GMMB 1GJWA 1MHPH 3B5HA 4MD5B 3L75D 2YD2A 4HDIB 4L4JA 4P59L 4OFPA 1DEEB 4GRLD 2CLZA 1N5YH 1AXTH 1FAIH 1FZOB 4B53A 3PCYA 3WOVA 3BH9A 4UT9A 4N0FA 4JR9L 4EI5B 3BAIA 2GK0B 3TEXA 5FYJL 1BDYA 2HVKA 4W9IC 4N2LA 1T7ZA 5DJAA 5BMFH 4HK0A 4TLSA 3TPUA 2JLPA 4U33A 2IBGA 5JQHC 2BLFB 1SUJA 5C0GA 1AZRA 4Q6IB 2OW6A 4J4PD 1BYOA 4MB3A 4J3XA 4WV1C 3S9DB 1DZBA 2DLFL 3HCVA 2NY0D 1MFNA 1MJUL 4HH8A 4HK3N 4FLRA 1H32A 2D0FA 1MFDH 4U3SA 3C09C 3V79C 2WK2A 3LKPB 3DECA 2BY3A 2B77A 2CD0A 3VGEA 1QFWI 4GUPA 5DS1A 3SQRA 5C86A 4WQBA 1DQJB 3EJZC 1BD2D 2P7TB 1X4XA 2I24N 4QUOA 4QYOB 1LNUB 4OF8A 5F9WC 3QK0A 1MNUH 4E42B 2CCWA 2F0CA 1YTCA 3BZ5A 5CZXC 3U25A 2G5BA 4JPWH 3BAYA 1KPUB 4N6RA 4FG6C 3L3JB 1T7WA 1S5HB 4XBEH 3SODB 4HIHB 3WKML 3QUXD 3LZFH 3BD3A 5FK9A 3UZVA 5FGBA 5I73B 4A7UA 3AVEA 3TV3H 4DEWA 4WWOA 3VI4E 5FCUH 1IM3A 4ODSL 3DX1A 4KDWA 1T5KA 5F9DC 1XCQA 4K8RD 3SKMB 2LU7A 1XF4A 3MLTB 1RZ7L 2QHLA 2WKGA 4GP4B 4JM2C 2BSSA 2R0LL 4KI5C 5E6ZA 2VSMB 5DJXA 3FHEA 1FL5B 5CIPA 1BGYD 2NW3B 1DVSA 1U92B 5IQOA 3OKMB 3FQWA 3UIZA 1RU9L 4YBLB 3PWLA 4DCQB 4Z7NB 3MLZL 1JCVA 4F5CE 1LEIB 1IAKB 3O2VH 5IBUB 3RVWC 1FF5A 4LSVL 1CB4A 3GMQB 3LB6C 4FYTA 1MCWW 3IMBA 5TF1H 3BDYH 2QLVB 3IJYB 3P2DA 1DVXA 3WXVH 3LKSA 1YECL 5AALA 1D6EB 4EIUA 2NY5C 3T1FA 5L2JB 5ID0B 3GBMH 1XIWB 5ICUA 5I71B 3W9DB 2XTJC 5IFJB 4EMZA 4KJPD 4ZSOA 5D6DA 1OGAB 4OSUL 1UC6A 1LFMA 3SBWA 4PGJA 4PGBB 5LCVH 1HRCA 1C5BH 1KPVB 2DRUA 3CV5A 3K91A 4RGMC 1IT9H 1AD9B 1N9PA 2E7LC 1U8LA 3WUWA 1KBBA 3HMWL 1KSRA 1WAAF 4UTAA 1RJYA 3P1VA 5DQDL 2W07A 4IBVA 4G82A 4JE4B 4XB3A 3TBVB 3MRFA 2ZKHH 4XXDA 3FXIC 4MZ3A 2DYPB 1EHLL 4Z76B 3WTYA 3FQXA 1HJ3A 1U75B 4HFUL 5EBGA 1OTSD 4X80L 5G4NA 1IO3A 1IFHL 1MPAH 4FLSA 4MX7A 4KUZH 5F9OH 4MNQE 1U91A 4J1UB 3GJFA 5FM8A 4GT0A 4PGDB 2LITA 1YVLA 4I0KA 1YN7A 2XPGB 3ZKMD 1KBGL 1I8MB 4X7SH 1G7PA 1RURL 1BM3L 1KX7A 2JXMA 3KLSA 4HX1B 1ETPA 2N01B 2XOTA 4P46A 1MCRA 1I8OA 4JFFE 2X3BA 2NY4D 3MV9B 5DVMA 3K2IA 3IT8D 5EB9A 3SCMC 3MSPA 1ZVSB 5I6XB 4IOFD 3SE3A 1UD5A 5CSGA 3K6DA 3L5XL 1NFIB 1V7ML 3CIQA 4B9JA 3AS1A 3BQVA 3P0VL 4AVJA 3FOLB 3MXVH 3GWJA 1BE3D 2WIIB 5D71L 5C3LD 1FYTD 4OFYD 4PB9L 3HAEG 3HZKB 4XO8A 5F7HA 4QXGL 4ZUVA 3HI1A 4GRWB 1L0ND 4QOKD 4TVSa 1Q1JH 2WTRB 4X8JA 1P53A 2C1DB 3EO9H 1ADQA 1K8DA 1VB9A 1FL6A 5IB1B 1A14L 4IK6A 4AQZA 3QHTC 1CFTB 1A1OA 5IQ9B 2PW2B 2VXQL 4YHMH 4Q8BA 3WEMA 5I1KH 1MCIA 3PNWB 5C0AA 1GTFA 4XX1E 4G6JL 5I0WA 1IRWA 1DBML 1EDHA 1YEJL 3KM2A 3QUYC 4M5SA 2FWLA 1QZNA 3ARGC 5EDXA 4RZCB 1JNLH 4HPHA 1QN2A 3WE6A 1PVHA 2AJSL 3LNGA 4NPJA 2FJFB 1Z6JT 3MLWH 4RX4D 5CFHA 2FL5A 3VG9C 4WO4B 3UAJC 4PV1C 2ZX8A 3CFEB 4R0LC 2W60B 1OCWH 2WY3B 3CHXA 4IYKA 3BRFA 4WDIA 3MUJA 4FFWC 1PX8A 2K0RA 2YPLE 4YHNA 3NFSH 2F7PA 2EICA 2H9GB 4WIQA 5T3ZH 4EN3B 2XPZA 2N0MA 4C59B 1G4MA 2J8UF 3D69B 4P3CL 3RWIB 4AVHA 5C70A 5IIEB 3LNHA 2HN7A 3PS6A 2ADFH 4FXGB 4FQHB 4K55A 3IFLL 1T4KA 3D09A 3VB8A 3HE7D 3IDIA 1DVVA 4G8FB 2GITB 4PJDE 4MQSB 5KTEH 1XB6A 4AM0A 2EIKB 4WI4A 3DBXA 5GS0L 4HJ0C 2DEYX 3G08B 3JYCA 1ODUA 4N2KA 2VOTA 3MBEA 3ABZA 3VMOA 5AD0A 5DS8B 5FR3A 2HFTA 2W9EL 4RNRB 5C6TL 1XGUA 1XBDA 3RGBA 3QEUB 4GKNA 1JTOA 2KT6A 1E8EA 3RJQB 3ZL2A 4PJIE 1P0SE 3GB7A 3IRPX 3UO1H 2VERN 4BSJA 3MX0A 3ZW3A 4YSQA 4TOYH 2OMUA 5F7EL 1OWWA 2CIKA 4QNPE 1S9YB 2BS9A 3ENEA 4ZAKD 4UIKH 2XTSB 1ED3A 1MZZA 4BFJA 2HJFA 3FBQA 3ARFD 4R7NA 4MMZC 2I60L 1KLUB 4ODUB 4WNQB 1N3NA 4ONFL 4WSKA 4RIRB 4Y7MA 5EO1A 5I16A 1FVDB 1NBYA 32C2A 2FYYA 3MMEB 4AITA 5GZNA 4R5TA 1KENL 1C12A 4CSZA 1GMIA 1T5XB 3ZTDC 5CILL 1VHPA 4L1HA 3QULB 4U7SA 5HDQH 4TVPE 3FS9A 3KNBA 4NQTA 4L23A 2VH5L 5HI3C 3A0HV 3FB6B 5E6IC 3ULUH 3Q13A 2V08A 5KBNC 1LO3L 4DP5X 4JM0A 1EHAA 2SEBB 3SOBL 3BD4A 1R46A 5CZRA 4PGZA 2EXWD 5E8EA 3DHJA 4ZFOL 1GS7A 3T3PE 2X2JA 5JO5B 3MACH 1AR1C 1F00I 3AM8C 4BGDA 5EU5A 4G6AD 5DVOA 1KIQB 4IOSD 3H0TB 3U0PA 3PQYA 2BY2A 1CFQB 1RZ5A 1KN2L 3QHFH 3DOSB 2FBJL 4HG4K 3CU1A 5KYNA 3ULUE 2CWRA 1JNHB 4G5AA 5C0CB 3GKZA 4WI2A 4HK3J 2Y06L 5DD1L 1I9IH 3ZE1E 1WTLA 2JKXA 3AUVA 2V7NB 4L1BA 4AT6B 3BPOB 5C08B 4CVUA 2WAHA 3F6JA 2OSWA 1VFOA 3I6SA 2WVVA 4OTXL 1MQKH 4QY8A 3EDDA 2YN5A 3JQOB 4KMQA 3BPNB 1OP5K 4DFIA 3KPRB 4NHUA 4LRNH 3KYAA 3UZQA 1V7NL 4OR1A 5K1VA 1AHKA 2OXGA 4PRHE 5AZ2L 5JHDD 3AJ7A 4I3GA 2Q3AA 2XZZA 5IEKB 3CPUA 1DVFB 2F5AL 2MKWA 1HK6A 1MIMH 2A3TA 4Y4FB 1YEDA 1X5KA 4I3SL 4NQUA 1NCWL 4FLQA 3KLAA 1JNNL 1CF8H 1IE4A 5HYFA 2JFCA 2YQGA 3ETTA 4TSCH 3SIKA 1S8DA 2YLHA 4O02H 2A9NL 2F8IA 3G7TA 1E43A 1S7UB 3H53A 3WCYA 4HZ1A 5F7YC 1PX3A 1TTBA 3F58H 3C5SB 3D85A 4NN6C 4WW2C 4YXLL 1ZEAH 5KS9F 2YPVA 2K6ZA 1O6SA 5T3XL 1QFOA 1J9CT 4WAFA 3TJPA 1TVBA 3ULSA 4FQ1H 2BP8B 3KYOA 1IL1B 3FONB 3NCWA 4HCRA 2CO4A 3CDYA 2W0FA 3ZZSA 4DUXA 1M7UA 1OEZW 1DL7L 1ZANH 4W9HC 2ADGA 4KNSA 4WHCA 1CRGA 1BZOA 3VH8G 4YUEH 5E9AA 1N8ZB 4LBEA 2YMOA 4ORGB 5HDWA 3TO2A 3L4XA 3EO0A 4XB7A 2KLSA 2W8CA 4MA3B 2ZOLB 4AK2A 1OGPA 2J8OA 1BD2E 3OQ3B 4A66A 3IB4A 4JO2L 5HGAB 3DX9A 5D5MF 1S3KH 3UX9B 3F83A 5DMKA 4D8PB 3EUUA 2P5EB 2FT8A 3QC6X 4H1LA 1P5UB 4WV1A 1NDMA 3I2CH 1QSED 1YEHH 4NQDB 1E7UA 5JNYA 3ARTA 2FSEB 5L9DH 1HEJC 3NH7L 4NWTL 3GXFA 4AE1A 1DBBL 1OQXA 1A02N 1MY5A 4G3YH 2CLZB 3MU3A 1GTNA 3BH9B 3W2DH 2X05A 5MP6L 1UACH 4N0FB 2JI3A 5PAZA 3AY2A 5I75B 3RUGA 1DN0A 5C7XH 1WTGT 2HVKB 2X89D 3BSZA 1XGTA 3P9LB 4XP5H 5DJAB 1P2CA 2YD9A 4HK0B 1F02I 1S2EA 1WAPA 2DLGA 3TPUB 1A4AA 1RPQA 1VF5C 4NYLA 1L4IA 2NY2D 5C0GB 5CIDB 1LP9E 4LPTA 3MA9H 5TF0A 3BCCD 3VRLF 3S5LG 4BKLA 1UH4A 2BOBA 3HCVB 1TVDA 3NTCH 1H32B 5L2KA 5BOJA 4JM2A 3O6ML 4HAKA 3QSKB 3LIZH 1IC4H 4R2GB 4U3SB 5DHXB 3CU4A 3ROLA 2R4SH 5DI8A 4OVVA 4L2LA 4UCFA 2EH8H 4G7YL 2O5XL 4GUPB 4OJCA 1UM5H 4PP1C 1SFHA 4ERSL 3O3DA 2XCMC 2W88A 3ARSA 4I0CC 5H2BA 3AWFA 3MN8A 3CHRA 2G5BB 4N6RB 3EJJX 4NNPL 2WOYA 3BWSA 2VXTL 2YUXA 5FK9B 4KK5C 1HWGB 3UZVB 3MOQA 4LSQL 1DJHA 4IRJD 2HWZL 4AEIH 4NM8H 3U9PH 4A6YL 2P43B 1QPXA 4K3JH 1IM3B 2XA8L 3LCYA 5FHBH 4I1NB 1XCQB 2YZ1A 3G6JF 4B9CA 1KFAH 1XF4B 4JKNA 1H5BC 1WZ1H 4GIAA 1TUPA 2EE2A 2BSSB 1SN5A 2VLLA 3TF4A 1NCHA 5DJXB 2G3XA 1IILE 4BIKA 2W81C 2X2YA 2EP6A 2AQ3A 4H4NA 3NJMA 2E7LA 4CRPA 3PWLB 2A0LC 4B95C 1FVEB 1F2QA 3HBGA 4MJHA 4O9HH 4UM9A 4CGTA 1OE1A 2L7JA 4D7PA 4ZW8A 4Q9RH 2IFGA 1AIZA 1QBAA 2O6EA 3GMRA 4BEIA 4U2ZA 1U0QA 4D3CH 5HHQA 3LKSB 4OI8A 4GI8A 3LHAA 2AJYH 1WVEC 4G42A 4MJIA 4S1DD 3T1FB 3CU7A 2YXFA 4P5TB 3ATAA 3OMNB 4KKLD 4ZSOB 3FYEB 4ZFZA 4HS6B 5F1KC 1JI2A 5I30H 4XNBA 5HBBA 1E3ZA 3WU2V 1YEIL 5GIRA 3STLA 2PWFA 4JB9H 4QLRA 1TETL 1HESA 4JPQA 1O7DC 1U8LB 1QW9A 2HFFA 3WUWB 1H15A 2I5YL 2V3DA 4QOKE 3BGMA 1YQVH 1RJYB 2LU5A 1T0OA 2W07B 2XBTA 3SCMA 3SEPA 3L8QA 4HUNB 4GS7B 2H47C 3R8QA 2ZIDA 3MRFB 4HAFA 3JWOC 4XXDB 4P04A 3ZL4H 1UCBH 2F7RA 3GJFK 5IY5B 3HC3H 4KNUA 3FQXB 5FC9A 3NPSB 4NUGH 1N5AA 2B9BA 4MX7B 3W57A 3X1FA 2ZTBA 1E40A 2YUWA 1U91B 4IIQC 1DLFL 2Y7NA 5EZLB 1YN7B 1FV1A 4I3RH 1G7PB 4XMVA 2OSLA 2JXMB 5T5FA 3QR1A 1HH9B 2ODHA 1I7TA 3B5GA 3UTSA 1QFWM 3OR7B 3O20A 2FEEI 3WLWC 2G5UA 1RUKL 1C5CH 4X42A 4B96A 1CRYA 1A7OL 3MNWA 1ZGLP 1A5FL 3QUYA 3QUMH 1FSKC 2QSCL 3ZHNA 3T6QC 3V52L 3ARGA 5KBDA 5IGXL 3FH7A 2F8OA 4OQTL 2W80C 4YGAB 5FO9A 1MCOH 4LLDA 2Z0UA 4OZHA 1B2WH 3ZE0B 12E8L 7CGTA 3VD2A 4JFZL 2O61A 5D93B 3GS7A 1Z2KA 3UAJA 3QG6A 2I07A 4Y4HC 3BEWA 3J07A 1ZRTD 3AT9A 1GGIL 3NPZB 5D7IA 4X8JB 4ZUVB 5AW6B 4F2EA 1FC2D 4B9ZA 5CGMA 1F3RB 3KLKA 1K8DB 4BXSV 4J3TA 1OAJA 1FL6B 1QA9A 2HFGL 1Y18A 3KMDA 5IQ7L 4FKKA 4J6RH 4WJG3 1XGYL 3GNMH 1A1OB 5KZCB 1TJMA 2CIIA 2BSTA 1NCBH 3DVGA 4KJWC 4WI9A 5C0AB 4TRPL 1XV8A 4NZFA 3UJJL 4X5WA 5DUML 1JK8A 4HW6A 4RMRA 3DHMA 2AQ2A 1P4BH 2BNRD 3WE6B 2JIXA 4FZ8H 4HSCX 5CIHB 1G4RA 3O4LD 1S9XA 5SWSD 2FL5B 3MBWA 4N8CH 2H1PL 4XPTL 2CUIA 1NC2A 2UWEA 4OZGE 4WDIB 3SZ6A 2EE9A 2F54A 4KXCA 1NC4D 2AXJA 2WD0A 1MAJA 2RHEA 3CJJA 4DTGL 2KERA 1A21A 1ZSHA 4YHNB 2WLJA 4UT9H 3HZ3A 1OANA 4M7KH 5AW9B 3VD9A 4KTEH 4PUBH 5LBSL 5GSRA 3EDKA 4OGZA 4R4NC 5IJDC 4HJJH 2HN7B 4Y5YC 1ETB1 1RUQL 3E6FA 1MCQA 1XH3A 3ESNA 4AE0A 4YX2H 1RAMA 3U46B 1T4KB 2WJ7A 4MMZA 1KB5L 3UAEA 4NM4L 3IDIB 4QRRD 1PL3A 1CG9A 4HQQL 5D1QE 2K6YA 2EE3A 3GBNH 1HL9A 1RPKA 4N2EA 3ALWA 5I18H 1J1XL 3IDJA 2EO1A 2D2OA 3X1BA 1YYLL 2VUOA 3EH4B 1X5LA 3MBEB 5AD0B 5LXVA 1TENA 3CXDL 1XGUB 5E6IA 3PABA 4XB8A 3L71D 4LIQH 5GJSL 3VFGL 3GB7B 3KPPA 3TH2T 1ZAGA 3MX0B 4NQED 2OMUB 1KY7A 3DVFA 2SODB 2GJ6A 5IB2A 2GIWA 2CIKB 3DMMC 1G9ML 4M7ZC 2PO6D 2UXFA 3AM8A 3H4FA 3W0WD 5EC1A 3QJFA 1QFUH 1AS8A 1FQ9C 1IAIH 1ED3B 3P4OA 3U82B 3QZBA 1YEAA 4FJ6A 1AGDA 2HJFB 2N56A 2OZ4H 4JRYA 3RFRA 3NIDB 1FHGA 5B3SB 5EO1B 4L8CA 1T5WA 5JHDE 3NSXA 1NBYB 32C2B 4UDTA 2FYYB 1RXLA 4RETB 4LIQE 2P9RA 1C12B 3NACL 4XMWA 1AOZA 3SOTA 3FRUA 1GYAA 3LH2H 2FX7H 4YSCA 4OCRL 3KNBB 1AYOA 1OT1A 2YSTA 2VDKL 3MRDA 3VDAA 5DMIL 3V7MA 3TIEA 2F61A 3M6DA 2OYKA 5LNGA 5A40E 4WI0A 5E8EB 1DBJL 2WHVA 5GS0C 1MCHA 2ICCA 2YARA 2ZYIA 4NENA 5TDPA 1OSPH 3TBCA 4ZMAT 5EU5B 2IADA 3U0PB 3PQYB 2FDBP 1IKFL 1S4IA 2Y3AA 3F12A 3IVKA 2XDHA 3PUCA 4NX0A 3BAJA 4NHCH 4P2OC 4NJAH 3GM0A 1L9MA 1ID5I 2QADB 3PGFH 1MNNA 3VDBA 3SLEA 4HEMA 3DDFA 4JN1H 2AXGA 1ZHNA 1OCDA 4EKJA 4WW2A 3T04D 3PWJA 4MVBD 3S36L 4ZMYA 2WVVB 4X4KA 5F0JB 4QY8B 2OKMA 5DRXA 3RZCD 4G8GA 3K2UL 4NHUB 3UZQB 4HWNA 4N0CD 5J6HA 1P7QD 5AYTA 3K4AA 2OXGB 2NY1C 2C9AA 1CXAA 2FT7A 3HHMA 2NXZB 3OAYH 1UVQA 2CGRL 1E8YA 5EIQA 2ARJQ 3DNKA 3SO3C 2YHGA 4AQOA 1ORQA 1MVUB 3KL0A 1DDHA 1G1OA 2BWIA 1YEDB 4Q6YA 1WFIA 4PJEA 4YGVA 4HUCA 1DUZB 1CYCA 3WV0A 1NFDE 3KLAB 3GMNB 1HT6A 1EFXA 4IKLA 2VTFA 5DJZA 3W38A 2FHFA 4TUJB 1OARH 1S8DB 4PJBA 3RDTC 1ZPUA 4Q4IA 2X1XR 3K4DA 3MLRH 5E2TH 3GK8H 3D85B 1IU1A 4PJ9D 2DKUA 1HE8A 2P5WD 1V3KA 4V2BA 5FGSA 2X2IA 1R17A 1O6SB 2R0KL 1BA9A 3ARDC 4N9GA 5DR5L 1TVBB 3ULSB 3A9FA 4R4FH 3KYOB 3RIFF 5CCKL 1E8ZA 2CALA 2W0FB 4F7KA 3G6DH 3VM5A 4OZIE 4XWGL 2ADGB 4GG6F 2D0WA 1ODAA 2JQZA 3HIZA 2ZWKA 4UAHA 4OJAA 2YO3A 4LBEB 3TO2B 3EO0B 1SXNA 4XNUL 3VRIA 2VMCA 3NCYP 2UZYB 3S37H 1LDPL 3HS9A 2LQRA 4PJ7F 3PAZA 1ZY9A 3DX9B 3TFKC 5DMKB 3N9GH 1F3DJ 4M3HA 4H1LB 2WP3O 3NCMA 4WV1B 2WLLA 1NDMB 5GRUH 3CVHL 4RESB 3NRFA 1FO0H 5JNYB 4C4UA 3S3CB 4G59C 4KAQH 1YAZA 2Y22A 3QJOA 4RFEA 1I1FA 4XBPB 3VXPA 1NPUA 2R51A 2CUHA 3C09B 4MDIA 3C2AH 1XCTA 2AW2A 1KGYE 4FL4C 4M1DH 1LM8V 1AGEA 2WZAA 1IBGH 4AC4A 4HG4J 4KQ3L 3C8HA 1ASPA 3T6WA 5HYQA 2PR4L 4NBXB 1YJDC 4P4KC 5F9WB 4JGJA 4IDLA 3RUGB 1DN0B 2WCGA 4OLUH 4OD3H 5CINL 1XGTB 4PJAF 1P2CB 4IBLT 4WUKH 1A6AA 3TBTA 2DW5A 4DK5A 4PV8A 4N2AA 3BVNA 3HNSH 4L4VD 4NYLB 4NQCD 1A6ZA 5J9PA 2Z92B 1MG2C 5DC0A 1H3WM 3MRIA 2BOBB 3QR2A 5SWZD 4PN6A 5ACMA 3LEYH 1G1YA 1NKOA 1OLZA 3BN9C 1H5BA 4I88A 4JM2B 2IGTA 3Q5OA 3UP1A 2BVTA 3ROLB 5DI8B 1NCJA 1NOLA 2KBGA 4TLUA 2XZAL 3BH4A 2PACA 1GKEA 4OD1H 1FDLH 2DV6A 3D2UA 4MQ7A 1I9JL 3U4BL 3NMEA 4ALAL 3O3DB 5IQMA 5JXEC 5LUMA 4NP4H 1JGDA 5H2BB 3V0VB 5K69A 1G84A 4BFBD 4BWUA 2A06D 4XVTH 2ZCKH 4XCFH 5HDRA 3PGCA 1RLBA 4HS8H 3ECQA 1XCXA 1FG2A 2GABA 1GCFA 4M9OA 1CRCA 1N15A 1T80A 1NUGA 3IDUA 1MFAH 4FFVD 1I1CA 4Z3GA 1MEXH 3KLHD 1INDL 4OGYL 2FUQA 2J6EA 1DVTA 3ARRA 4GKZA 1Q0YH 5CD5D 2VW4A 2WPGA 3QRGL 2VLLB 3FSWA 2E8YA 2XQYK 4HT1H 2MRYA 3HW7A 2ERJC 2AXTV 3DGCR 3S2CA 4RGMB 4Y9BA 1Z3GH 1J8HA 1YEBA 2A6KA 1SXBA 2VWEE 3K4ZA 4CU8A 3BISA 4M7LT 2BSRA 1L0PA 1OB0A 4I8DA 2I27N 4L48A 1F1FA 2EDFA 3GIVB 3ARPA 1D7BA 3JUZA 2E9WA 5MEQA 1KC5L 3INUH 2B1HL 3GMRB 2F7OA 4DKEH 5ES4B 5EBMA 2H7WA 4U1GC 4G42B 4MJIB 4M62H 3K0WA 4L9LC 3IJSB 4APQD 2HKHL 4P9HL 4IIQA 4ZFZB 4POZD 3REVA 5FV2A 5JDJA 2JF1A 4E9XA 4PQXA 4RCAA 3ETBJ 5KW9L 3OAZK 3HFML 5TE7H 5GIRB 3STLB 5DFTA 1MH5A 5LNDA 1SF3A 3BCFA 3DX7A 1MLCA 2A2QT 4YEEA 2HFFB 1H15B 3LXBA 1KYOK 3BGMB 5JZ7D 3VW3H 3ISWA 3SCMB 4P0DA 2O6CA 1CD1A 2DQTL 3D7PA 2IANA 2VSKB 1JPFA 5B6QA 4XXCC 5I6KA 2CJ3A 3A6BL 2YKLL 3T3PF 1RVFL 2NY7H 4UTBL 3ECVA 3IDGA 1N5AB 4GAYA 1JVLA 2RQ8A 4Y4HA 2Q2LA 3R4DA 4LHJB 2BNRE 3WG7B 1K3GA 4Y9CA 1Z9SA 3O4LE 1FV1B 5SWSE 5L4FA 3HG1D 2OSLB 2AMGA 3VI3A 3DR0A 1XZ0A 2I32A 3WEXA 4CDHA 1MFVA 1YPZA 4YHLH 4ZYKA 4F8PA 1SRDA 1I7TB 3UTSB 5F89A 1MWAH 2D8KA 2C3WA 4JG0L 4Z7NF 4BZ2L 4LQ1A 4FAAB 4CKQA 5LGJA 1TPXC 2Z4QA 3MNWB 1KCBA 5LAPA 3QUYB 4E9RA 3ARGB 5K59E 2FNBA 2WYHA 2Z3FA 2JQRA 4PIRF 3WHE1 3AT0A 2XYBA 3QZLA 5FO9B 1BVNT 2PPDA 4LAQH 4OZHB 3U1PA 4OV5A 4JCGA 3QUKB 4MJ2A 1B6DA 3VG9B 1JP5A 2O61B 3IXTA 3WY4A 4DP1X 3QG6B 4QRRE 5C2BH 2I07B 4PJGE 3BEWB 5D7IB 2VCOA 2GJJA 4PJ6A 2IFFH 2YZ8A 4YHOL 4JO8A 2QR0A 2D0HA 1QA9B 1Y18B 1UZGA 2YWYA 1S6VB 4FTVD 4DP8X 4OLYH 4Y5YA 4PIBA 2BHYA 4G71B 2VM4A 2BSTB 5E08L 1IM9A 1YEKL 3ZTNH 5F72S 5A2KH 3DVGB 4NQEE 1IGJA 3GI9L 2B4CL 5LO7A 4X5WB 3MCKA 2E27L 4JRLA 4IBUA 3GMLA 1JK8B 3DMIA 1JG9A 1NBCA 3W0WE 4W9JC 1NSNH 3QCUH 3MYZA 4Z7VA 1X9QA 1OCZB 4PWGA 2JIXB 4PI0A 1E2ZA 3MCLH 4HBCH 3UYPA 4X4YA 1S9XB 1T4WA 1I3RA 3MBWB 5FS5A 3SE8H 2VXQA 3FO1A 1AKJA 1DO6A 3WNJA 1QSVA 2AAAA 2UWEB 2F54B 4OJFL 1CO1A 3FHAA 1MLBA 5TE6L 2WUBH 5KVFE 2F74A 3S35X 1EGJL 3DMMA 3FF8A 3NAAH 2C26A 2Y7OA 5GSRB 5K1NA 3BSZH 1RK1A 4OZFG 2CDGB 3EBGA 3OZKA 3EYSL 3FQUA 3E6FB 4I87A 3CPLA 4PVNA 1XH3B 5IVXE 2ALWA 2B12B 1OK0A 5L0QC 4CC1A 3BWUF 3S7GA 4MMZB 2ZAGA 3HKZA 3KPQA 1CG9B 5EOQL 5HDOA 4BQ8A 3S3BB 3TBWA 5ALCL 2WTPA 4AC2A 2B8OT 1C8PA 3QEGL 5ANMA 2KZBA 4RDQF 2YS4A 2CBQA 5DJ0A 3US0A 5E6IB 3IAQA 3X39A 4FMVA 3PABB 3LZRA 5E24E 2EDYA 3GSNL 4GRWF 2B9AA 3KPPB 1AZNA 4BSWA 2XV2A 4JFSA 2GJ6B 2X42A 5IB2B 1ZXQA 2DZEA 3H6JA 2P48B 3V9FA 1AR1B 1NFAA 4RAHA 4FXKC 3I6LD 1SJEA 4XHJC 3QJFB 1FGNH 5EC1B 2GY7B 3L9EA 4Z18A 4OIFA 2EVIA 1AGDB 5C0JA 1RZJH 4P2RD 5E2JA 4P2OA 3KXFA 3OHXC 3PP4H 1T5WB 4JFEA 3LS4H 4UOZA 4UDTB 1HAWA 2GKIA 4OCSL 1AI1H 3N04A 4GKLA 4H2AA 4Q58C 1DW1A 4E9LA 3FRUB 2CA4A 3WFEH 4FA7B 4ZPTA 4OM1L 1W16A 1FFOB 2VJ8A 3BAEH 3X3GL 4EN2A 3MRDB 3TIEB 4OF5A 4FNRA 3JBG7 4WI0B 4J28A 5CUSH 1B3IA 2QJKB 1M71A 4OKDA 4X6DA 5TDPB 3V6OE 2P5WE 1XT5A 4WHDA 2WZ0A 1TNNA 3Q0HA 4FKEA 4X9BA 5D7LD 5GPRA 2G60L 1F86A 3IVKB 2O6FA 3EH5B 2CKBH 4ZFOA 3QRBA 5TISV 4O1QA 4DAGL 1G9MC 2DWTA 4LDCA 3DETC 2IQ9H 3RDTA 3ZDZE 1NIDA 4NGHL 2J4WH 2VN4A 3RY5A 4MRBA 4MS8C 2AXGB 1ZHNB 1UURA 4IDJL 3HQ9A 4NN6B 4WW2B 4MBOA 2J1YA 2PTTA 2WLHA 3ZKQD 3Q6FA 5DRXB 3QJTB 4G8GB 4FQPA 3ARDA 5J6HB 3MRCA 1OZTG 4K5NA 2APXA 2ZF8A 1D6VL 4Z7OE 1JERA 1IGMH 1NMCC 2O5YL 5KKZB 3AWEA 1UVQB 5C0BA 3S35H 3GGWA 4GUOA 3B7YA 1UWEL 3ZDXB 1KGXA 1GKOA 1ORQB 2RACA 1DDHB 1IC7H 3DSNA 3KYKH 5TDNA 4YGVB 4X6BB 2VSDA 3G6AA 2HRHA 1R47A 1EFXB 1FZKA 1G9HA 4EI5D 1TMCB 3IMUA 5JIMA 4PJBB 4LP5A 4KX7A 4KVNL 1YEFH 4BCXA 4GW1A 4PW3A 1S7RA 3FN9A 4EICA 4K5LA 3ECBA 5K9OA 5AWNH 2PTVA 3F7KA 4L4VE 4LXFA 4NQCE 3CFIC 4N9GB 3QUGA 4XX1G 3H42L 1NBVH 2D2CC 4CGUB 4YMPA 1TKWA 1CD8A 3TWCL 2BFVH 5SWZE 3FJTA 1VACA 2MOGA 1HKLH 3WL9A 4YVUA 1NLDL 2ZWLT 3MV11 4P4KA 3KGTA 2K9FB 1JV2A 1NGZA 1MCWM 1F90H 3VRIB 5LGHH 1SYSA 4GSDL 1QBLH 3MLYL 3GXTA 3PUUA 1URLA 4I13B 4A2HA 4BELD 4D6TD 3V6BR 3ZUCA 2C3VB 4C4KO 2APSA 1OP3K 2WLLB 2V3FA 2X10A 4NKMA 3SDCC 4N2MA 3T1WA 5JUEL 4YPGA 4AGPA 4ZD3H 4RFEB 1I1FB 4EUPH 4MDIB 2VDLH 2V7HA 4PYGA 1HJCA 1KB0A 2WZ5A 5KAIV 4JKPH 5AB9A 2X12A 3VXME 1C6RA 4XTRD 3KDMA 1AGEB 2JV6A 4OW6A 1VESA 5D8JH 5C97A 5I76A 2DQHL 5HYQB 1J5HA 4AMWA 2AJVL 5CFAA 1GHFL 4OLEA 3WFHA 5JXEA 2YEQA 3CZJA 1PJ9A 4GG8B 1YDPA 3OXRA 1H3PL 2UX7A 2WSKA 3BEVA 4UF7C 2DMBA 4HHAA 5DC4B 5F0LB 5KG9A 1L7TH 2AK4D 3OSKA 5DHYA 2YJLA 1A6VL 1E29A 4PV8B 4TNWK 2WQUA 1MVFA 1EANA 1H33A 1RJLA 2D7MA 1WEJH 1KB9K 1A6ZB 4M5ZH 4U1NA 5J9PB 3QG7H 1JPSL 35C8H 3TM6A 1CTYA 3MRIB 4I2XE 3DROA 4HZAA 1UA6L 4I85A 4PG9A 1H5BB 1U41A 5SX5K 1ZGLM 2KZ1B 1UHVA 3HUJE 2FIKA 3N1FC 1OQOA 2AV1A 1NIBA 5BO1L 4PCKA 5AFAA 3D2UB 4MQ7B 2X4NA 4Y9FA 2NQCA 3NA9L 2BSDA 1JGDB 1ROWA 1K85A 2DEWX 1AH1A 3QNZA 1JGLH 3PDGA 3PGCB 4YSRA 1FG2B 2NYKA 5E99H 4PWKA 1RCYA 4H8HA 1CLCA 1IFGA 4GW4B 1WZMA 2Y7SA 2ZYSA 4L9LA 1DFBL 3N43B 4OFVA 4GKZB 3LQAL 4UV4L 4QKXB 4HUMB 4JHUA 1U2YA 4Y8AA 4WHTA 1VLXA 5IHHA 5KAQG 4A6YA 1QR1A 1J8HB 3CXHK 5TE4L 2A6KB 3ZOOA 4YDIH 5HI4C 1ZDSA 1NIFA 2R0WH 1U3HC 1YC8A 1G9NL 2YLKA 1J88A 3HG1E 5AOJA 5GS2D 5TK2A 2AZUA 5MEQB 4LSSH 1NAMH 2KQMA 4XXCA 5IFAH 2Z0BA 5AL8A 4ALAC 5EBMB 4GXUN 4XP1H 1OCOB 3WTUA 2IGFH 1U36A 2HLFC 4TVUA 5CGYC 2VMDA 4GB9A 4LCIL 4R26H 4IIQB 3REVB 1EDYA 5JIDA 1CVSC 2B2XH 3IGKA 1BIIA 3WIIH 2WINA 1JHKL 3H7BA 1MVYA 2EQDA 4ODVL 3DX7B 1MLCB 3Q8CA 5F7BA 3HR6A 1FJ0A 2PXYD 5G4MA 3D6GA 3SBQA 3J2PA 2R29L 2NYYC 3G04A 2BVUA 3EYQD 4EBQL 1CD1B 1FSKB 1JVKA 1TTFA 2IANB 3RAJL 1LWRA 1JPFB 2AABH 3K6FA 2LT9A 4FTVE 4YBHA 5EUOA 3MZGB 1PLAA 2QFRA 1JRHI 3IDGB 4K3EH 4AMXA 1T22A 4GAYB 4LCYA 3ZGHA 5IZ7A 3GSQB 1ZLDA 4Y4HB 5AW8B 4XNQA 3ATFA 3OGOE 4WO4D 2LVEA 1Z9SB 1SUHA 3QCTL 3PPEA 4X6CA 3KPOA 3CFCL 5EU3A 1JPTH 1XZ0B 4KQ4L 5D7SL 3VI3B 3SWSA 4JL2A 1YPZB 3WEXB 1RULH 4ZYKB 1I1AB 3Q05A 4C56D 1JV5A 5F89B 3GZPA 4AI7A 4Z0BL 1T03H 4LCWB 1BWWA 2JELL 5LGJB 3U79A 4TSBH 3VM7A 1W91A 2Q10A 5JR1L 3C9NA 3EFFA 3LNEA 4KXDA 4APXA 2CUMA 2VDRL 3MQIA 1JXJA 1KYUA 5IHUL 4YBQD 4OV5B 1YUHA 3PYCA 3UGXA 3DVIA 4GKSA 1AXIB 4F2MA 3EYUL 5ISZA 2W0KA 4KJYA 3ABGA 2UXTA 3E3QE 3IJHA 5FOJA 3V4VH 3V6ZA 2C8SA 3ZE2E 3MJ7A 3L48A 2QR0B 3MLSL 4OQTA 1X6LA 1W0YT 3AZUA 3N0AA 4KV5F 5FOBA 4ODHL 1NCDH 2F68X 3K5SA 4Z8FH 5D1ZI 3I3DA 5IB4B 2Z4TA 3RBSA 4Y5YB 3GXPA 3RZWA 3UMTA 1IM9B 4K5PA 1F4AA 2NOYA 4TQPA 3M7OA 2DLEA 2Q76A 1N19A 5IB4A 4G1MA 2Y7QA 3MCKB 4PJFA 2UVFA 3GMLB 3PWVB 3I6LE 3Q2WA 3OF6D 3FHQA 3MXWL 2CPUA 5DT1H 1QABA 2YQ2A 3UYPB 4X4YB 5L8LB 5JXAH 1GYVA 2V4LA 4P2RE 2RALA 3FO1B 1K6QH 1AKJB 2WLYA 2UZXA 1U8HA 3RY4A 2DQGL 3PWPA 5JW4N 2DQUL 3NBSA 3AADB 3BN3B 4KOBA 4WWID 3RN0A 1F3JA 1IFRA 2F74B 3HJ0A 4MJJA 1ZWIA 3BMWA 5I1JL 3DMMB 4P49A 4M7ZB 4FXKA 1MAKA 3MI6A 3RWFA 4S1SH 2BOLA 3FQUB 3CPLB 5DD6A 1JZ2A 2F1AA 3IU4H 5KVGH 1WHOA 1IV8A 2FX8L 4ELME 3KPQB 3OHXA 3N1PC 4IRSC 3TBWB 4WQCA 2FE0A 2QPSA 5LBSA 4GQ9L 4TQ8A 3WDHA 1U4EA 1XH1A 2CJUL 2XZCL 3OKLA 5D7LE 1QKZH 3PJLA 3OZ9L 5HI5D 4ZDHA 1RZGB 1IGIL 3ZE0F 2OA9A 2O5NA 3PXHA 2HCZX 3CZGA 2YC1A 3RVXD 2B4CC 5KANI 5G5DA 3HB3D 3GS0A 4EOWH 5GGTH 2Y5TA 5E9NA 2AJ3B 4XI5C 4MLSA 5BCAA 4KMTH 4BSWB 4DHLA 5KVGE 5D9SA 5C08D 4C54A 5KSBA 1XSOA 1TXKA 1SHXA 3A4FA 3HI6L 1SJEB 3KPRD 1M6ZA 1L9BC 1E30A 3UGUA 2YD8A 5C0JB 3LKNB 1Z9LA 5E0FA 3TYGL 4P2OB 3KXFB 3PXWA 3OLEA 2XFGB 4JFEB 4TUKH 25C8H 3O8XA 1WCBB 1NIEA 3N40P 1LO5A 1EO8L 1NBZA 8FABA 3MNVA 3ZZ1A 4ZK8A 3SGKC 1EJFA 2CA4B 3AGVA 4MWFA 2G2NA 4ZPTB 1KBVA 1YYMH 4HUXB 4DKFH 2IAMD 3LZNA 2F58L 5KVDL 2K1MA 5ADOL 1W15A 1U6AL 2IBZY 1QW8A 4PRPA 2IWKA 4X6DB 4A38A 2NY1B 1TTUA 3TA3B 2R1XA 5I1HH 4W81A 3SPHA 5HY9A 1IQDA 3SO3B 1XCWA 5ABZA 3IMSA 4NI6A 2Y6SC 1A4JA 5D2LA 1UD2A 3CBRA 4ZFOB 4X7FC 5EIIA 2DQEL 3H3KA 1UZ6E 2R2EA 2B1AH 3MKGA 4PBWD 4JPVL 3RDTB 4G9FA 1EMTL 3KGUA 3X17A 1MCCA 3WXWH 4H8VA 4JGUA 3U7WH 4E9SA 2UY6A 4HJEA 5F3HA 3T9WA 4PRID 4TTGA 3ETSA 2PTTB 1QATA 1JXDA 3OAWA 1O9WA 1W6WA 2AZAA 3CXFA 3DI2B 4FKHA 4XO9A 3ARDB 5EIVA 3MRCB 4HYTB 1DDTA 2ZUWA 3HC2A 4PWJA 4YWGH 2H0PA 4GQRA 4WI6A 1E4KC 3GGWB 1EXGA 2O30A 3RPKA 2FATL 4TPRL 1WPCA 5KANG 3DSNB 5TDNB 1X9UA 2XHNA 3G6AB 4S0SD 4JG1L 3NIDF 1GGCL 4H88L 1FZKB 1A6WH 1UWGL 2V9QA 1OAKL 4J3OD 4R8WL 5HSFA 3FOMA 4GW1B 5A6MA 1S7RB 1CXKA 3QPXL 2AEWA 1IX2A 3RVUC 3ECBB 5K9OB 3SDCA 2AK4E 2DQIL 2CR0A 4AIOA 4JNXA 5HYSG 1KYAA 3QA3A 4GXVL 4FL4B 1TKWB 4NRYB 1F42A 1FNFA 4E9VA 3OMIB 1BECA 1WSST 1VACB 3CFTA 4K3HA 3WL9B 2HKAA 2C1OA 1JV2B 1KJ2H 1NGZB 2CSPA 5IW6A 2D7TL 1RUAL 2XX1A 1SYSB 1BL9A 4O00A 1IVLA 3MLVH 2AV7A 3QIWC 3CAFA 4PW4A 3WHXA 1MFEH 2VR8A 4ZNCD 3B7RL 2KH2B 4E68A 3S3SA 4O2FA 1SVBA 3IRZA 1LK3H 1H31B 1LGVA 1R5VA 1H1OA 4AQAB 5JPMC 4AL8L 2AP2A 4NKMB 3VFPA 4JFDD 5E95B 3FU5A 1A3RL 3FFCA 2Y5QA 1M3IA 4YPGB 3GSUB 2JKWA 2VXVH 3G5WA 1IM3D 2V7HB 4WQAA 1CL7H 4G1EB 3S88H 5A2CA 3KDMB 5I76B 2WLIB 4JVWA 3VB9A 3CVHA 4OUOA 3MNDA 5HHNA 1ITCA 3WFHB 1UKSA 1Q0EA 3TJHC 2I26N 1YDPB 3OXRB 2YXVA 1HROA 3BEVB 4V1DD 1ZSDA 3CDFA 4HHAB 4OGXL 3IJ8A 5KG9B 5DHYB 4LCUA 3OKNA 1NNOA 3KL5A 3Q43A 1H33B 1RJLB 2I9TA 4QRUA 4U1NB 4IBQA 1U2HA 5I1AA 4JPKH 1E2VA 3LY6A 3DROB 2V17H 3CFKA 4KKRA 4PG9B 3CVBA 3D12B 2MTPA 1TQUA 3IWUA 3MJ9L 4KFMA 5ESAA 2FIKB 5AVTB 4Z6AT 5JW3L 1T0MA 3QFJA 3KJ6L 4FZEL 4D9LH 2ERJB 2AV1B 4N25A 5DUPL 3MRKA 4Z7AA 2AHIA 2F19H 3X3FH 2X4NB 3MBXH 3B2VL 4OF0A 1CK0L 4JANA 3I50L 2EIMB 1U3HA 4LLAA 3Q1SH 3L1OH 3T2NL 1QKSA 3MTXA 3QNZB 4JX0A 3WAKA 3H1ZA 1CEDA 2H6PA 1PU0A 1BZEA 4MHHI 5F0PB 5GHWH 1KIUB 3B43A 2GUYA 1OTTD 3V55A 4MXVE 4UZSA 1EBPA 1KXQE 1MFCL 5AKSA 1CRHA 4L9LB 5I1EH 4JFQA 3ZIYA 4YHZL 3X1GA 2AEQH 2H5UA 4GBXB 4X99A 5CJQL 4WHTB 4UAOC 4A6YB 1QR1B 3C8DA 4OD2A 2MNJB 3BRGC 2O6PA 3WUIA 2XJLA 3P54A 3ZHDA 1KWKA 1Z5LA 3QIUD 4L3CA 4LEXL 3ZXAC 4RGOH 5FYLH 2CE0A 4P46D 1IJNA 2IOIA 2OR9L 2H4EA 3MRLA 1GOFA 4C56E 4F93B 3VG0H 3VQLA 3OAUL 3H7LA 3TN0D 3NDYE 3Q8BA 1ZVHA 1FYHB 2P3YA 4AYBA 2HRGA 2ZWSA 4XMUA 1QNZH 3RWDA 1QVOA 2C8NA 1JGUL 4Y2LA 1UM6H 3CUPB 2JCCA 3UC0L 1Q0XH 2DIBA 1BIIB 4KI5F 2Z93A 1TO5A 3IGLA 2WINB 3H7BB 4Z78A 2JKLA 4ZS7L 2B0SH 1IO4C 4NJ9H 4OB5L 4YSSA 4FA4A 1BX2A 3MRRA 3ZDYE 1R3IH 1CU4L 1KB9J 3LMJH 3LQAC 4KRNA 3LRLA 2NXYC 4J7RA 5DFVC 3ORJA 1TPXB 2FT6A 2LTQC 3HAEA 1MHPL 5KZCD 2C9XA 4JFUA 1XMEB 4UT7H 4H8QA 4N0RA 1MN4A 1RK7A 3FDWA 2G5RA 4NSKA 5C0AD 1X5AA 1FLRH 1N5YL 1AXTL 3EXJA 2FR4B 5EUOB 3D4CA 2O93L 3P3RA 4K07A 1T22B 3QJRB 4LCYB 5CJXC 2V2WB 1G9NC 1KGUA 4X9GA 3RIAK 4Y4KB 4XNQB 2FYVA 3LPFA 2O5ZH 5BMFL 4EXPX 3EO1A 4LLVA 4HWZA 4NZRH 3EJYD 2F5BH 3PWUA 1KN4H 3KPOB 4X6CB 5HP5A 5EU3B 2HAZA 1DSFH 1EO7A 3AU1A 3FNKA 1S9VA 1JV5B 5CSZA 2AKRA 2C7FA 1IAOA 1DIQC 4B3VA 4ZG1A 1SM3H 3RYMA 1MFDL 3SVWA 4G2AA 1A3QA 1BXXA 2ZOWA 3C9NB 3EFFB 4APXB 4FA8A 2HT4D 1A22B 2IVFC 3RU8H 1XR8A 2DYSB 3VWJC 1YUHB 1GS6X 3BOVA 2WV3A 4MSWA 4QO1A 2H3KA 3EJRA 1MNUL 4GKSB 5AOKA 1XB3A 4PP2A 4F2MB 5ISZB 2IV9A 3BWZA 4JPWL 5LAXA 3NZ8A 4KJYB 4DVRH 3IJHB 3NABL 3V6ZB 1QHPA 3MJ7B 4XBEL 4DGWC 1QEWA 3LZFL 3KGRA 2EUZA 5FOBB 2AANA 1CBJA 2CDEA 5I6OA 1UWFA 2DN7A 2GBVA 1OP5H 5BQDA 5FCUL 3GSOA 4Y19A 3UYOD 3V4PH 2ZOOA 2GSGA 5L0QB 1EIBA 5F21B 3FULA 4LLWB 5BUGA 2Q76B 5C08E 1W8EA 5I74C 1R3LA 1WIPA 2Y7QB 4G1MB 4JEGB 4PJFB 4HUUA 5DHVH 3DSFH 4IRSA 4EVNB 3B2UD 3QYNA 4UNUA 3VYOA 1JXFA 5HVHC 1BGXH 3TBSA 2H2SD 2UZXB 1U8HB 2FHBA 3PWPB 2WWKT 1MJ8H 1M57B 3O2VL 1HOCA 1F3JB 4XOBA 3IJ9A 4GOSA 5EEVA 3KH4A 1F8TH 1SJHA 1ZWIB 5TF1L 3BFOA 2HMID 3D4YA 4DK3A 2L7UA 1VADA 3B6SA 3KYMB 3WXVL 4PWFA 5J8OA 4FXKB 4IGBD 2P44B 4PAZA 5L8JB 4QR7A 4UQCA 3GBML 5DD6B 3IPFA 3MOAL 2IOOA 4IOIA 2ZAIA 5FV1L 5JLZB 3WTXA 3QRFM 3SHSA 3OHXB 2DJ4A 1VZIA 4UDUA 1EGJA 4M56A 3L4MA 3PQYD 1C5BL 2D31A 1MAMH 3OKLB 4OF6A 1K4DA 2VN5A 1XR9A 1QFPA 3DIVA 4OZHF 4ZDHB 4MASA 3UBXI 2FWOA 4XO4A 3SGKA 4HPOH 1KZYA 1L9NA 3L17A 2YC1B 1IBYA 1YAIA 5G5DB 4MQXD 1XD1A 2Y5TB 4IJTA 5D7IF 4TYUA 2ZKHL 3VD5A 1CIUA 5KUMA 4PJHA 3ZGIA 3T2PA 3EGSA 1N9CA 4PRIE 5FKAA 4KKBD 5KSBB 2IWEA 2CHWA 1DT1A 1MPAL 4NCC2 3GYRA 4K71C 4FF9A 3DKHA 4KUZL 4XBGA 1FBIH 5F9OL 3ARZA 1DSYA 3C5ZD 4Q52A 3W11D 5C0EA 2AGJH 3O8XB 2N59A 3P4LA 4X7SL 4MRCA 5DYOA 3V7AE 3T2QA 2OTUA 1LO5B 1VGKA 2HP4A 3P0YH 2RMNA 3SN6N 3MNVB 4LOEA 5BRZA 3K72A 4GAJH 4MWFB 3PHSA 2Y1VA 3BSGA 1AO7D 5DMGD 2UWEF 4KKQA 2Y36H 5KVMC 4FFZH 2J6WA 4FERA 3D06A 4PRPB 1EEYA 3AB0C 4OCXH 2R1XB 1NMCB 2Q20A 5DD0H 4H20H 1INEL 3MXVL 4X4ME 1DQMH 1E4KA 5HY9B 1KGJA 3HS8A 1BWMA 2WXRA 3LVEA 1AJ7H 1ZJAA 2VDKB 3WFDC 2Z7WA 3O6LH 3LXUX 1Q8MA 4G80A 3S5ZA 1O7VA 3F00A 3EW3B 2BPBA 1Q1JL 3MRMA 3CQQA 3EO9L 5EIIB 2BZDA 2R2EB 1JVOA 2OP4H 3DO4A 5F7UA 4NLAA 2QVKA 2W0LA 4G9FB 3UG5A 2VDNH 5FFGA 4GMSL 4OI7A 2UY6B 5F3HB 3HBPA 3VH8A 4YHML 1L9PA 1QG3A 1TSHA 4YSAA 5I1KL 2WXGA 5EV7A 1CGWA 5AOMA 1DSWA 2GSIA 3U83A 1C52A 2KI6A 5IJVA 1T21A 4LPWA 1WIUA 2WWNA 1JNLL 2X87A 6PCYA 3EH3B 3MLWL 4AEHL 4JHWH 2HRLA 4ANUA 4JFDE 4UILH 3QVAA 1OCWL 4B41A 5K9QI 1OAEA 1FNAA 2PCYA 2FQFA 3BAXA 1J12A 3RVVC 3NFSL 4M6AA 1HCVA 5K9JL 3EJSA 2FO1A 4AYID 5T3ZL 3QIWA 1C7SA 1U8KA 3UGEA 3EH1A 5AAPA 4RMUA 2PP7A 1HSAA 3FCUB 2EXSA 3FOMB 4NZ8A 6PAZA 1PPJD 4DIXA 5GS1C 3VQ2C 2ADFL 4IHBA 4V1DE 2Y24A 2GFBA 5JPMA 3SDCB 4JKKA 2WXFA 3CHPA 1I7UA 4OGAC 5JIQA 2YAHA 4KKPA 1AIFA 1THCA 4N2CA 2MOVA 3QA3B 2KHAA 5L2KD 3QJHA 1FL3A 1L5GA 1OGSA 4JM2D 5D2NE 1BV8A 5KOMC 2C1OB 1GC1L 4DOHB 3BKJH 5DUBA 3C6LD 3S5LA 4Y5XC 4H40A 2OCJA 3UO1L 3CVCA 4KJQC 4ZSOE 5CP3A 2AV7B 2WBWB 4TOYL 2WN2A 5A3ID 1N6VA 4PGCA 3WHXB 1OB1A 5GISL 4FQXC 2PMZA 4O2FB 4UIKL 2HT3D 4HXBH 1R5VB 5C9MA 1EAPA 2VABA 5DJQC 4ODTH 4WW2F 3VFPB 3VCLA 5I26A 3FFCB 3U9UA 1E28A 2DWYA 1WAAA 3CFMA 4U0RB 2OK0L 3FO9A 3KEDA 3LNFA 2W91A 3TX4A 5JMOC 2XTJD 3N06B 4ZUUA 4AIXA 3CVHB 5HDQL 2Q7AA 5A2LH 3RGVC 4ZO9A 3RWCA 5FUCC 2BFGA 3AGWA 4R96A 3NWVA 3ULUL 3ZDXF 4G6FB 3F84A 3RGHA 5JHAA 4Z3EA 3ME0A 1ZSDB 4IKJA 1TZHA 2BXZA 3APCA 4KMLB 4LCUB 1WJ3A 3OKNB 2WVSA 1BLNA 2I9TB 5KLIB 2WW8A 4PJBF 1JZIA 4QRUB 4UM9D 1R0AH 3S5YA 3EAKA 4JREC 1AGFA 5I1AB 2IXQA 4PS4L 1C2NA 1F6LL 3CFKB 2F1BA 4HULB 2A77H 5ESAB 1T0MB 1U2CA 1Z9OA 3QFJB 5ITFA 1NLBH 1MG3D 4YHIA 2B59A 4DW2H 1I9IL 3QHZH 3MRKB 1G7IA 3WIHL 4NFBA 1NCTA 4BFOA 2QKSA 3O11A 4AL8C 2FBOJ 3ARED 3E2HC 1VFBA 3MVSA 4JANB 4P5MA 5ICZA 1U3HB 2VB5A 5EDSA 1MQKL 1VSCA 1ZIBA 2PPCA 5CSBA 4LRNL 4M02A 3NQKA 2H6PB 2YK3A 4CL7A 1M7IA 4TTDD 5KSAC 3MJ6A 5DEGA 1OAXH 1E0OB 2PPFA 1XH2A 4WUUD 1JZ5A 1Q4NX 3F04A 2J43A 3HPJA 1TEGA 2A73A 1MIML 1TQCC 4KVCH 4JFQB 4PB0H 3G3LA 3RX8A 2XWEA 5C0AE 4ABVA 1H3UA 3ZJAA 1CF8L 1M9SA 1NEZG 2NTFA 2P46B 4TSCL 1UYWL 4X99B 4O02L 4OIAA 3SDDD 4XPAL 3FQRA 1TYEB 4OD2B 2HX9A 3BT2H 3F58L 3QXWA 2CO7A 3TVMC 5FFLA 4ETQA 1ZEAL 5A2IH 1JZDC 4MYWB 1Z5LB 2ITFA 1CNOA 4L3CB 1MF2H 1A1MA 3GLEA 1WFOA 4RGNE 4TL4A 2WQVA 3I6GA 1T1XA 2FQDA 4HXAH 2OFQA 3QPKA 4AM0Q 4FQ1L 2OMVA 1PZ3A 4JBSA 3LHPH 3QUYD 4FC3E 1JI1A 1ZANL 2XN0A 3EJUA 3BVXA 4NC2B 4R90H 2J8UA 4YUEL 5CJXA 1YY8B 4KGLA 3GZQA 3RNQA 3CSTA 3NCBB 1EA9C 1FFPA 3VD4A 3RWDB 3QBTB 1QVOB 2XKNB 4OCYH 2X3CA 2QGDA 2JCCB 3DX3A 3ISYA 1OAZL 1NZRA 2BNUA 2Z93B 1S3KL 3DP5A 4Z78B 451CA 1SOSA 4FFWD 2QPFA 3IBEA 5A2AA 1W2KT 1R5IA 2EECA 5JPNC 3I2CL 1S78D 5LQBL 1BX2B 1YEHL 3H9YA 3MRRB 4BQ9A 4WY7H 1XGRB 1XSKA 4N4YB 5L9DL 1FORH 1EHXA 4WGVB 3HAEB 2VO5A 4XHQA 4Z5RA 3JV0A 3II3A 2C9XB 4ANKA 4NSKB 3QR0A 5I1GH 2M2DA 4G3YL 1NPJA 3HNTH 3MRHA 4JZOA 5LNEA 3VWJA 3VXUA 4E5XG 3W2DL 1UACL 2R29A 2XWTB 1R9FA 4U1MA 5C7XL 3G5VA 3VWKC 1UM4L 3N43F 3ZX1A 3WY2A 4HJ0D 4W6YB 3MV7A 4LLVB 3T0EC 4HWZB 1NC2D 3PWUB 2R8SH 3QEQD 1LILA 3WFZA 4IRZH 1B6UA 1CFSA 3AU1B 5EA0H 5BRPA 1S9VB 3MA9L 2BM3A 1Y7VA 2AKRB 1IAOB 4LJIA 1JUFB 1SXAA 2HTKC 4UMGA 2VDMH 4Z3JA 3NTCL 4PRNA 3MAWA 3Q5YA 3LIZL 1IC4L 1M70A 1F1AA 3R0NA 2VC2H 2R4SL 2VAAA 5B38G 4I18C 1E4HA 3C5JA 2EH8L 2WP3T 4TNVF 2ZWZA 5IK3A 1UM5L 1XR8B 4TNFA 3T6ZA 2DTMH 2JQMA 4MSWB 4QO1B 4BH8A 2EEAA 3W39B 2GIXA 4PP2B 4U1LA 4MXQC 1OD7A 4N8VG 4HBQA 4LESA 3PQYE 5LAXB 3NZ8B 1XFPA 3UCRA 2PABA 4F8LA 1TJHH 1QEWB 1NIRA 3N85H 2CDEB 3PRZA 4K3DH 1KELH 4NM8L 3U9PL 3CX2A 1DVHA 2ZXBA 3GSOB 4K3JL 4GH7B 3TURA 2GSGB 1AR1D 1B3JA 1KFAL 4EUPG 1WFUA 1WZ1L 4H5SA 1SY6A 1R3LB 4L1TA 4IBZA 4XMTA 2GC4C 4HUUB 1T2JA 4IRSB 1QUPA 4QCIA 3S2AA 1RIHH 1C7MA 1N26A 2XN2A 1IBZA 4JRYD 2J5WA 3LPPA 4W93A 1A2SA 4AJVA 3FT4A 3RJOA 2JB5H 5K33A 2YQ3A 4L1QA 3TBSB 2FUTA 4H0KA 2AJZA 4KH2A 5MERA 1KCVH 1M56B 1HOCB 3DPDA 1ZTMA 4O9HL 1DANT 3ELQA 4KTDH 1BFSA 1E67A 4W4NA 5AOZA 4U1HA 1SJHB 1AQMA 4D3CL 1VADB 3B6SB 1HIMH 1L9JC 2XC8A 1UGNA 3VI3F 1AO7E 2AJYL 1YEGH 3H55A 4W9FC 2KLTA 3BCDA 4LARH 4N5UA 4IOIB 1KPRA 1S7XA 1JL8A 4Y2DC 2FWUA 4JZJC 4HOWA 4UDUB 5BZXA 5ETUA 5I30L 4HPYH 5KS9A 2VN6A 2D31B 3IDMA 2LE9A 1K4DB 4JB9L 3QGVA 1XR9B 5AZEH 4XE0A 2QKIC 3UTTA 2FWOB 1YQVL 2B11B 4DGYH 2R4RH 1R24A 1H8NA 4WEEA 4QI3A 3PXTA 4N2OA 1KLGB 2ZKYA 1CE6A 3LQZA 4H8PA 2HVJA 1FI3A 3NT0A 2OTWA 1UCBL 3TONA 3ZL4L 5C2UB 4PJHB 5TFSL 3OKDA 4LSPH 4Y88A 4CJ0A 3EGSB 2VKWA 4MFHA 1ZVYA 3F8UB 5FKAB 1URIA 3FUHA 4NQXA 4ZNEA 1KCRH 4G8GD 4NUGL 5H2FV 3L2LA 3TT1H 5I24A 5CCJA 3B2PA 4XBGB 2QSVA 4Q5PA 1ACYH 5DC9B 1CGSH 2QVIA 1JGEA 5IBTH 3GKWH 7TAAA 5C0EB 1QHQA 2NY6D 5DYOB 4ZOBA 2OTUB 1VGKB 1DQLL 4ZMXA 3D9AH 3VNYA 4MAYD 3TGUD 3K72B 4L4TD 2V37A 2B16A 1OAUH 4M9PA 2LHAA 4J3WA 2EUXA 4F7TA 3RUGE 1F6AA 4MMXC 4LPCA 4XMPH 5B39G 5MENA 1CDGA 3TESA 1M2VA 2Z8SA 3WSQH 1TTRA 1QFWH 1NGPH 5I0ZA 1EEYB 1ZS8A 2OBGA 5IHLB 3NJIA 3ZHFA 3ZSSA 2WGNB 4MB4A 2M8XA 2GB8B 4HALA 5C8JA 5CICB 2GJPA 1XDTT 3WMSA 5GRVK 3ULVD 4W6WB 5E8NA 3B83A 4G80B 5AUMA 1CR9L 4JO1H 5EPMA 1HI6A 3UPCA 2BPBB 3QC5X 4CBZA 4EE2A 2OZ1A 5L2KE 3BPLC 4YDLC 3IETB 1KJMA 2XNAA 4JVPA 3WIFB 5FWQA 3DOIA 3V6OC 1JPST 4J6RL 3GNML 3EOBA 1LEGA 2PUQT 3MCYA 5GS1A 3VH8B 1NCBL 2YMTA 3SJVD 5D7KD 1B4JH 4XCYA 2C4FU 5JHLH 5IJVB 2GSIB 2JJWA 3PAVA 4PGEA 2A9BA 3KPTA 1T21B 1C6OA 1X5GA 3IFNH 3WENA 5AYUH 1FZMB 1P4BL 3FTZA 4FABL 1CQYA 5FHAH 2DDQH 1G6VK 2GW5A 4N8CL 5AVVB 3L45A 1YN6A 3OQRA 3P30H 1FZJA 4ADJA 5I19H 1CHHA 1U3ZA 5J56B 1OPGH 1EZUA 2NSQA 2X1WL 4Y5XA 2PPEA 4WVRA 2HX7A 4UT9L 2XTJE 4JM4H 4OFKA 1CCRA 3KBPA 5D4HA 3WNIA 3NIFE 4M7KL 3QIWB 4RVBA 1U8KB 1MDTA 4KTEL 4PUBL 4FQXA 1PCXA 1HSAB 1K3IA 2XSKA 4ZMZA 4JHAH 1NUDA 2D3LA 2GFBB 4Q9BA 4YX2L 1UH2A 4I0PC 4F80A 4NO0A 1S9WA 2IDQA 2H26A 3F7LA 1QTYT 2FH6A 1SYVA 3Q9QA 5IESH 1I7UB 3MJ8A 1AIFB 3L73D 1OM3H 1LQBC 4ABUA 5E4AA 5FYJD 3IAPA 1B2YA 5I18L 5IMMA 2JB6A 2X4QA 3IDNB 5DZVA 4P8QA 3L08A 4X6DF 4L2YA 3QJHB 1FL3B 2YGVA 1L5GB 1BQRA 1E5UI 3QDJD 3RGVA 1JGVH 2UXGA 4WWKC 1KB9D 2ICEC 5K1JA 5DUBB 3S5LB 3OAZH 4DUWA 4LIQL 3MJWA 4J8QA 1YY9C 2R83A 5DDHA 5IEHA 3TJEH 4PGCB 1JYWA 1OB1B 3FCTB 4QKTA 2QPDB 2HG5A 2DLTA 1D5RA 3QO0A 1ZK5A 3O4OC 4NCDA 1QFUL 1IAIL 4FQQA 3H9SD 1VDGA 4ZBJA 1EAPB 2VABB 4Q2ZA 4L29A 3U0WH 3H85A 2OZ4L 3VCLB 2FQGA 2A6JA 4PRDA 3U9UB 3GO1H 4P4RA 3RA7H 4A2FA 3DXAA 3FO9B 1G1KA 4N0KA 4WUUE 5ITBH 4ZUUB 1NDGA 1A9BA 2CHXA 2FX7L 2Y2YA 4LOFA 3RWCB 3MGAA 4R96B 3MGOA 1R4XA 4QRPA 4KK8D 2VDPH 1AKKA 5IUSA 3ME0B 5HYJA 3WTSA 3B2DC 4KROC 1TZHB 4K9EL 1SNRA 1OSPL 1S7TA 1BLNB 3KPSE 4Z7IA 1ZZHA 4G83A 5KSAA 1AGFB 3S3PA 2IXQB 2K70A 1XXDC 3BUDA 1GMEA 2NQDA 1NU1D 2BMKA 3OLGA 5FA3A 4NPYA 2PCBB 1NA8A 5AW3B 2K4AA 4YR6A 4PWAA 1WFJA 3OWRA 4X6FA 5ITFB 3PGFL 4I1RA 3MRNA 5C71A 4YHIB 2B59B 4JN1L 4UAOB 1G7IB 3P2BA 1I3UA 2OAAA 3QJXA 1ITBB 2VISA 3D08A 3O11B 3TVMA 4XAKD 4XN9A 1L9TA 1VFBB 4P5MB 5ICZB 1U8MA 3MJ9A 1QHOA 4JL1A 1LL1A 2BCKA 3WUZA 1EVTC 3UJIH 3L1EA 4L1SA 3WLWD 5CYTR 3MROA 1M7IB 3C5XA 1ICTA 4FN0A 4DEPB 4Y8DC 5C07A 3TH4T 1MCPH 3QJUB 1HHIA 2H1XA 5AW2B 3ULUC 3A24A 4KTGA 1CS6A 3HPJB 2CBOA 2YA2A 3FYIB 2A73B 3QQDA 1BXVA 1WWCA 2BRRL 1OT4A 1IEBA 1L3NA 5B21A 4LB8A 4F8QA 2NTFB 3KPNA 1CYIA 4A63A 4F15C 1OARL 2VHDA 2IPUK 2E86A 2K6WA 3FQRB 3DC0A 3MLRL 3BVWA 2CO7B 5E2TL 3GK8L 2HRPH 2VW7A 5JPNA 4ETQB 2Q86A 5BZWA 5IROD 1A1MB 2WJ5A 3VVWA 1D5XA 4ZMPA 2NXYB 7FABH 1MI5A 4PJCF 1T1XB 2LTQB 1K72A 4ZXBD 3QEQE 4XNAA 2YRPA 5CR1A 1XIWC 1KXHA 2W1NA 4HJSA 4XN2A 3GSWA 1J05A 2OMVB 3P2TA 1UH3A 4R4FL 1RV6X 3ZSTA 1B9KA 2QVFB 2HT2D 3G6DL 4LSTH 4GRLC 5TDOA 2FD6H 1KYDA 5D70H 2J8UB 5FA4A 2XG5A 1FFPB 3VWKA 1N68A 4OCNC 3QQXA 1F11A 1ZT1B 3S37L 3T0EA 2BNUB 5JIHA 2WXMA 3CN2A 3STBA 2PWHA 3FUNA 3M17A 4QRBA 1RKRA 4TMPA 5GRUL 1R5IB 4J4PC 2GBTA 2EJ1A 2YQBA 4G6KH 1CE1L 1FO0L 2YK1H 5CR8A 5LJYH 3QE5A 4KAQL 2Y0SA 4R4ND 3T8XA 4Z5RB 5I66A 5BPPA 3GXUB 4BSVA 1ZCRA 1CDUA 4HWEH 4I18A 1JZ6A 1N59A 3FB5A 4M1DL 1GXEA 1IBGL 2PF6A 1Z9PA 3MRHB 3O2WL 2I9LA 2IOMA 4JZOB 5HHOE 3VXUB 1J87A 1FFQA 2MNUA 1PTZA 1FI9A 4U1MB 4OLUL 4HWUA 3G5VB 1EUUA 3ZO9A 3HR5A 4JRYE 2CO1A 3FCBA 3MV7B 4WUKL 3BWUC 1X5MA 1MIEH 5EF2A 1OPOA 3HNSL 3T3MF 4FG4A 3QUXC 3NRQA 1J8RA 1CFSB 3Q2VA 4TQHA 2X7LA 4JCMA 2FX9L 4BCZA 5D7JD 3LEYL 5ABAA 3KCPA 4PRNB 3LRGA 15C8H 4LF3A 3NIGB 4WGKA 2VAAB 5LGYA 1K5WA 3C5JB 2Y72A 4OD1L 4BZYA 2R15A 1AG0A 3LIUA 4JFYA 5IK3B 1FDLL 5HVHB 2EDWA 2HG0A 3Q7JA 4BH8B 1JZGA 4ICXA 4OZFA 4U1LB 2Y23A 5FO8B 3NJHA 4XVTL 2H3XC 2ZCKL 5DZOA 4XCFL 1PLCA 4HS8L 1CRJA 2J73A 2QFPA 2X41A 1U4FA 1L0YA 2ODIA 1EDQA 4HSQA 4LL1A 4PTTB 4AVIA 1VPOH 1MFAL 2EE6A 3B5TA 1QTPA 4JO4H 5B7MA 1RZIA 1MEXL 3RKDC 4QTIH 5GS0D 4LHUD 2J12B 3K6IA 4JDEA 5FECA 4U49A 4JK0D 2X4SB 2JI1A 1Q0YL 2LIRA 4KXBA 2VQ1A 4H5SB 3LKQA 4MYPA 2B39A 4Y2DA 4JZJA 3V5DA 4KJPC 1XD0A 4HT1L 4QCIB 3UL4A 1L0LD 1MCBA 4WKZA 4F5CA 1DQDH 4KZ0A 4FNLL 1Z3GL 3SDXB 4P2OD 3FT4B 3NFNA 5EUOF 2QKIA 3QXTA 5JOPD 4FA5A 1NANH 2AJZB 3VD0A 1O6VA 5MERB 1X5FA 5HGGS 2GHZA 3BZ4A 5CU9A 2BY1A 3ULVH 1I53A 2EE0A 3GMOA 4PJEE 5INDB 3INUL 4U1HB 2ZXYA 1E3XA 1X5YA 1GZHC 4L4TE 1CXLA 4X6CF 4DP0X 4DKEL 2FB4H 1TZGH 4OVUA 1ZTXH 3IGFA 1OTSC 2V5TA 4M62L 3O9WD 4K71B 3ZR5A 3OPZH 2WWOA 1S7XB 4CN1A 1DVYA 3BKCH 5ETUB 5JIIA 1EJ6A 5KS9B 2E6PA 3IDMB 3L13A 5CS7A 5TE7L 3ULVE 5F7NC 1C8QA 1K5NA 3UTTB 3U2SA 3PHAA 1WH0A 2ENJA 4OIIH 4Q0XL 1H6FA 1R24B 5C0ZA 1EJOH 2YD7A 3VW3L 1SMAA 3LS5H 1OSZA 1ZTXE 4HKJA 1CE6B 4MMXA 4J12A 3LQZB 3BP4A 4R4BA 2HVJB 5LCVA 2OTWB 5E8DL 4KY2A 1OP3H 4IOFC