3WFBC

Reduced cytochrome c-dependent nitric oxide reductase (cnor) from pseudomonas aeruginosa in complex with antibody fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
FTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAMSAAVVRGKLVWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMKIQPLNVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment light chain
publication title Structures of reduced and ligand-bound nitric oxide reductase provide insights into functional differences in respiratory enzymes
pubmed doi rcsb
molecule tags Immune system/oxidoreductase
total genus 46
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3wfbC00
2C1UA 1DT1A 4L3HA 2CA4B 1H33A 2MHMA 3VNWA 4DY9A 3O1YA 4JCGA 2LIRA 3A9FA 1OCDA 1FI7A 5CIHB 3O5CA 4V2KA 1C6SA 1EB7A 1SQXD 2OZ1A 1CIGA 1NTKD 2ZBOA 1RAQA 1S5LV 1CSXA 1NU1D 5C9MA 1LC2A 3ZOXA 5DJQB 2GC4D 2N3YA 3A0BV 3RN0A 4MU8A 1MG3D 1DW1A 1DW0A 1KB9D 3L75D 5H2FV 4PD4D 1GQ1A 2V08A 1OAEA 1HRCA 4FB1A 3ZBMA 5TISV 1DW3A 2YQBA 4XXLA 2N9JA 1CSWA 3NBTA 451CA 1CYCA 2AXTV 1CRYA 1PPJD 5CICB 4AANA 1DIIC 4WQBA 1MG2D 4GEDB 3SVWA 3H1KD 1M6ZA 2HV4A 3PH2B 1DVVA 1H31A 1AOFA 3RLMA 4GYDA 1E2RA 1L0ND 5KLIB 1CRGA 4Y5RA 1COTA 1NMIA 1YNRA 2N18B 4PJ0V 3MK7C 2BLFB 1DIQC 1C2NA 1FI9A 5KKZB 1KIBA 3M97X 4L3GA 1E8EA 2AIUA 5B5EV 4N0KA 5KAFV 2CE1A 4WQ7A 1NTZD 3KZIV 3PXTA 1PP9D 5GTHV 1QL4A 4PW9B 1YTCA 1HZVA 4EIDA 1KYOW 2ZOOA 3TGUD 3L74D 3HQ9A 1YEAA 1RZ5A 2I8FA 2D0WA 1K3GA 1GIWA 1YFCA 4UB6V 3WC8A 1I6EA 3H1ID 1H9YA 1AOQA 1U75B 1CXAA 4AAOA 2ORLA 2D0SA 1I55A 1CYJA 1F1CA 3L4OA 1I8OA 3HQ7A 3ZOYA 2BCNB 3ORVA 1QKSA 1WEJF 1W5CT 3NWVA 2C1VA 1RAPA 4WQEA 1KYOD 5CIBB 3CX5D 1KX7A 1CTJA 5CYTR 1FI3A 155CA 3HQ6A 1CXCA 3L70D 2BGVX 1CTYA 2PCCB 2BH5X 1SQQD 4WQ9A 5KLVD 5DJQC 4FA1A 2YIUB 3ZIYA 4Q5PA 3ZOOA 4FA9A 1HJ4A 1WVEC 2XTSB 2V07A 1H31B 2MTAC 5KAIV 3SWSA 1DVHA 2C1DA 1SQPD 1J3SA 1H1OA 1IQCA 1LFMA 1GDVA 3L71D 3CWBD 3VRDA 3OA8A 4P4QB 5GTIV 1I54A 2QJYB 5IY51 2QJKB 3TYIA 4FANA 3OCDA 1RZ6A 2GC7D 2YK3A 4LJIA 1CHIA 4H0KA 1L0LD 3ZCFA 1I8PA 4YE1A 1CSVA 1BCCD 2C2CA 3L4MA 3H1LD 2B11B 3L73D 3ZOWA 3CXHW 3MK7B 1KV9A 2N9IA 5CIEB 4UB8V 351CA 1C6OA 1ETPA 1H32B 4XYDB 1CRIA 1I6DA 2BH4X 3DMIA 1A56A 4PWAA 4J20A 1GJQA 5CIFB 3H1HD 1IO3A 3CP5A 4RSZA 5CIGB 3A0HV 4NFGB 3WUIA 1HJ3A 1CNOA 3PXSA 1NTMD 1MZ4A 1CHJA 1QN2A 1BE3D 1DW2A 2EXVA 2DGEA 3O20A 2GB8B 1R0QA 2ZZS1 3BCCD 3CYTI 1H32A 1EZVD 4H0JA 3WFBC 1A2SA 1YCCA 2AI5A 3CXHD 1GU2A 1C52A 1K3HA 5B66V 1HZUA 2PCBB 2YCCA 4O1QA 2GIWA 3C2CA 2BCCD 2FWLA 1HROA 1IZL0 1CIFA 1I5TA 1IRVA 1CIEA 1NMLA 5AURA 1CSUA 1NNOA 2JTIB 3RN1A 3VYMA 1B7VA 4QAOA 1CYIA 1CCHA 1U74B 2DVHA 4AALA 1H9XA 1ZRTD 4EIEA 1HCMA 1YIQA 3SJLA 1L9JC 2VHDA 1N50A 4FA4A 2FYNB 1C75A 1FCDC 1QYZA 1IRWA 2FRCA 1LC1A 4WQDA 1AYGA 3RMZA 2ZXYA 5DF5A 4D6TD 2C1DB 1C7MA 2PACA 5CIDB 2BPBB 1P84D 3SXTA 4WQ8A 3O0RC 3OA8B 4FAVA 2FYUD 1KB0A 1JDLA 1LS9A 1YEBA 3DP5A 2N3BA 1M70A 3OCDB 1CC5A 1CHHA 2ZONG 3JBTB 1CO6A 1E29A 1BGYD 5B6QA 3CU4A 1HH7A 3HQ8A 1N90A 4O1WA 4L1QA 1C2RA 4WQCA 1YICA 4KMGA 5E79V 1FJ0A 2B12B 2B10B 3WFCC 3L72D 2B4ZA 3DR0A 3NBSA 1HJ5A 2C9XB 1L9BC 1KX2A 2B0ZB 1AKKA 1N9CA 2IBZD 1CIHA 1SQBD 3WU2V 1W2LA 1F1FA 1S6VB 2N18C 1CRCA 1QL3A 4WQAA 3WFEC 2LITA 3SLEA 2C8SA 1A8CA 1SQVD 1LMSA 3WFDC 1NIRA 1GKSA 1CRHA 5C0ZA 1ZZHA 5DFSA 1CTZA 1CRJA 1FHBA 2CXBA 2CE0A 1N15A 1C6RA 3PXWA 2QJPB 1CCRA 1H33B 5EXQA 3X39A 4EICA 1CEDA 4AAMA 1M60A 4K3IA 1BL9A 4IL6V 3H1JD 1CORA 4EIFA 4AX3A 3CX5W 2JQRA 2L4DA 1VYDA 2OZ1B 2CA3B 4U3FD 1FOCA 2A06D 4FA5A
chains in the Genus database with same CATH superfamily
2C1UA 1DT1A 4L3HA 2CA4B 1H33A 2MHMA 3VNWA 4DY9A 3O1YA 4JCGA 2LIRA 3A9FA 1OCDA 1FI7A 5CIHB 3O5CA 4V2KA 1C6SA 1EB7A 1SQXD 2OZ1A 1CIGA 1NTKD 2ZBOA 1RAQA 1S5LV 1CSXA 1NU1D 5C9MA 1LC2A 3ZOXA 5DJQB 2GC4D 2N3YA 3A0BV 3RN0A 4MU8A 1MG3D 1DW1A 1DW0A 1KB9D 3L75D 5H2FV 4PD4D 1GQ1A 2V08A 1OAEA 1HRCA 4FB1A 3ZBMA 5TISV 1DW3A 2YQBA 4XXLA 2N9JA 1CSWA 3NBTA 451CA 1CYCA 2AXTV 1CRYA 1PPJD 5CICB 4AANA 1DIIC 4WQBA 1MG2D 4GEDB 3SVWA 3H1KD 1M6ZA 2HV4A 3PH2B 1DVVA 1H31A 1AOFA 3RLMA 4GYDA 1E2RA 1L0ND 5KLIB 1CRGA 4Y5RA 1COTA 1NMIA 1YNRA 2N18B 4PJ0V 3MK7C 2BLFB 1DIQC 1C2NA 1FI9A 5KKZB 1KIBA 3M97X 4L3GA 1E8EA 2AIUA 5B5EV 4N0KA 5KAFV 2CE1A 4WQ7A 1NTZD 3KZIV 3PXTA 1PP9D 5GTHV 1QL4A 4PW9B 1YTCA 1HZVA 4EIDA 1KYOW 2ZOOA 3TGUD 3L74D 3HQ9A 1YEAA 1RZ5A 2I8FA 2D0WA 1K3GA 1GIWA 1YFCA 4UB6V 3WC8A 1I6EA 3H1ID 1H9YA 1AOQA 1U75B 1CXAA 4AAOA 2ORLA 2D0SA 1I55A 1CYJA 1F1CA 3L4OA 1I8OA 3HQ7A 3ZOYA 2BCNB 3ORVA 1QKSA 1WEJF 1W5CT 3NWVA 2C1VA 1RAPA 4WQEA 1KYOD 5CIBB 3CX5D 1KX7A 1CTJA 5CYTR 1FI3A 155CA 3HQ6A 1CXCA 3L70D 2BGVX 1CTYA 2PCCB 2BH5X 1SQQD 4WQ9A 5KLVD 5DJQC 4FA1A 2YIUB 3ZIYA 4Q5PA 3ZOOA 4FA9A 1HJ4A 1WVEC 2XTSB 2V07A 1H31B 2MTAC 5KAIV 3SWSA 1DVHA 2C1DA 1SQPD 1J3SA 1H1OA 1IQCA 1LFMA 1GDVA 3L71D 3CWBD 3VRDA 3OA8A 4P4QB 5GTIV 1I54A 2QJYB 5IY51 2QJKB 3TYIA 4FANA 3OCDA 1RZ6A 2GC7D 2YK3A 4LJIA 1CHIA 4H0KA 1L0LD 3ZCFA 1I8PA 4YE1A 1CSVA 1BCCD 2C2CA 3L4MA 3H1LD 2B11B 3L73D 3ZOWA 3CXHW 3MK7B 1KV9A 2N9IA 5CIEB 4UB8V 351CA 1C6OA 1ETPA 1H32B 4XYDB 1CRIA 1I6DA 2BH4X 3DMIA 1A56A 4PWAA 4J20A 1GJQA 5CIFB 3H1HD 1IO3A 3CP5A 4RSZA 5CIGB 3A0HV 4NFGB 3WUIA 1HJ3A 1CNOA 3PXSA 1NTMD 1MZ4A 1CHJA 1QN2A 1BE3D 1DW2A 2EXVA 2DGEA 3O20A 2GB8B 1R0QA 2ZZS1 3BCCD 3CYTI 1H32A 1EZVD 4H0JA 3WFBC 1A2SA 1YCCA 2AI5A 3CXHD 1GU2A 1C52A 1K3HA 5B66V 1HZUA 2PCBB 2YCCA 4O1QA 2GIWA 3C2CA 2BCCD 2FWLA 1HROA 1IZL0 1CIFA 1I5TA 1IRVA 1CIEA 1NMLA 5AURA 1CSUA 1NNOA 2JTIB 3RN1A 3VYMA 1B7VA 4QAOA 1CYIA 1CCHA 1U74B 2DVHA 4AALA 1H9XA 1ZRTD 4EIEA 1HCMA 1YIQA 3SJLA 1L9JC 3D0WA 2VHDA 1N50A 4FA4A 2FYNB 1C75A 1FCDC 1QYZA 1IRWA 2FRCA 1LC1A 4WQDA 1AYGA 3RMZA 2ZXYA 5DF5A 4D6TD 2C1DB 1C7MA 2PACA 5CIDB 2BPBB 1P84D 3SXTA 4WQ8A 3O0RC 3OA8B 4FAVA 2FYUD 1KB0A 1JDLA 1LS9A 1YEBA 3DP5A 2N3BA 1M70A 3OCDB 1CC5A 1CHHA 2ZONG 3JBTB 1CO6A 1E29A 1BGYD 5B6QA 3CU4A 1HH7A 3HQ8A 1N90A 4O1WA 4L1QA 1C2RA 4WQCA 1YICA 4KMGA 5E79V 1FJ0A 2B12B 2B10B 3WFCC 3L72D 2B4ZA 3DR0A 3NBSA 1HJ5A 2C9XB 1L9BC 1KX2A 2B0ZB 1AKKA 1N9CA 2IBZD 1CIHA 1SQBD 3WU2V 1W2LA 1F1FA 1S6VB 2N18C 1CRCA 1QL3A 4WQAA 3WFEC 2LITA 3SLEA 2C8SA 1A8CA 1SQVD 1LMSA 3WFDC 1NIRA 1GKSA 1CRHA 5C0ZA 1ZZHA 5DFSA 1CTZA 1CRJA 1FHBA 2CXBA 2CE0A 1N15A 1C6RA 3PXWA 2QJPB 1CCRA 1H33B 5EXQA 3X39A 4EICA 1CEDA 4AAMA 1M60A 4K3IA 1BL9A 4IL6V 3H1JD 1CORA 4EIFA 4AX3A 3CX5W 2JQRA 2L4DA 1VYDA 2OZ1B 2CA3B 4U3FD 1FOCA 2A06D 4FA5A
chains in the Genus database with same CATH topology
2C1UA 1DT1A 4L3HA 2CA4B 1H33A 2MHMA 3VNWA 4DY9A 3O1YA 4JCGA 2LIRA 3A9FA 1OCDA 1FI7A 5CIHB 3O5CA 4V2KA 1C6SA 1EB7A 1SQXD 2OZ1A 1CIGA 1NTKD 2ZBOA 1RAQA 1S5LV 1CSXA 1NU1D 5C9MA 1LC2A 3ZOXA 5DJQB 2GC4D 2N3YA 3A0BV 3RN0A 4MU8A 1MG3D 1DW1A 1DW0A 1KB9D 3L75D 5H2FV 4PD4D 1GQ1A 2V08A 1OAEA 1HRCA 4FB1A 3ZBMA 5TISV 1DW3A 2YQBA 4XXLA 2N9JA 1CSWA 3NBTA 451CA 1CYCA 2AXTV 1CRYA 1PPJD 5CICB 4AANA 1DIIC 4WQBA 1MG2D 4GEDB 3SVWA 3H1KD 1M6ZA 2HV4A 3PH2B 1DVVA 1H31A 1AOFA 3RLMA 4GYDA 1E2RA 1L0ND 5KLIB 1CRGA 4Y5RA 1COTA 1NMIA 1YNRA 2N18B 4PJ0V 3MK7C 2BLFB 1DIQC 1C2NA 1FI9A 5KKZB 1KIBA 3M97X 4L3GA 1E8EA 2AIUA 5B5EV 4N0KA 5KAFV 2CE1A 4WQ7A 1NTZD 3KZIV 3PXTA 1PP9D 5GTHV 1QL4A 4PW9B 1YTCA 1HZVA 4EIDA 1KYOW 2ZOOA 3TGUD 3L74D 3HQ9A 1YEAA 1RZ5A 2I8FA 2D0WA 1K3GA 1GIWA 1YFCA 4UB6V 3WC8A 1I6EA 3H1ID 1H9YA 1AOQA 1U75B 1CXAA 4AAOA 2ORLA 2D0SA 1I55A 1CYJA 1F1CA 3L4OA 1I8OA 3HQ7A 3ZOYA 2BCNB 3ORVA 1QKSA 1WEJF 1W5CT 3NWVA 2C1VA 1RAPA 4WQEA 1KYOD 5CIBB 3CX5D 1KX7A 1CTJA 5CYTR 1FI3A 155CA 3HQ6A 1CXCA 3L70D 2BGVX 1CTYA 2PCCB 2BH5X 1SQQD 4WQ9A 5KLVD 5DJQC 4FA1A 2YIUB 3ZIYA 4Q5PA 3ZOOA 4FA9A 1HJ4A 1WVEC 2XTSB 2V07A 1H31B 2MTAC 5KAIV 3SWSA 1DVHA 2C1DA 1SQPD 1J3SA 1H1OA 1IQCA 1LFMA 1GDVA 3L71D 3CWBD 3VRDA 3OA8A 4P4QB 5GTIV 1I54A 2QJYB 5IY51 2QJKB 3TYIA 4FANA 3OCDA 1RZ6A 2GC7D 2YK3A 4LJIA 1CHIA 4H0KA 1L0LD 3ZCFA 1I8PA 4YE1A 1CSVA 1BCCD 2C2CA 3L4MA 3H1LD 2B11B 3L73D 3ZOWA 3CXHW 3MK7B 1KV9A 2N9IA 5CIEB 4UB8V 351CA 1C6OA 1ETPA 1H32B 4XYDB 1CRIA 1I6DA 2BH4X 3DMIA 1A56A 4PWAA 4J20A 1GJQA 5CIFB 3H1HD 1IO3A 3CP5A 4RSZA 5CIGB 3A0HV 4NFGB 3WUIA 1HJ3A 1CNOA 3PXSA 1NTMD 1MZ4A 1CHJA 1QN2A 1BE3D 1DW2A 2EXVA 2DGEA 3O20A 2GB8B 1R0QA 2ZZS1 3BCCD 3CYTI 1H32A 1EZVD 4H0JA 3WFBC 1A2SA 1YCCA 2AI5A 3CXHD 1GU2A 1C52A 1K3HA 5B66V 1HZUA 2PCBB 2YCCA 4O1QA 2GIWA 3C2CA 2BCCD 2FWLA 1HROA 1IZL0 1CIFA 1I5TA 1IRVA 1CIEA 1NMLA 5AURA 1CSUA 1NNOA 2JTIB 3RN1A 3VYMA 1B7VA 4QAOA 1CYIA 1CCHA 1U74B 2DVHA 4AALA 1H9XA 1ZRTD 4EIEA 1HCMA 1YIQA 3SJLA 1L9JC 2VHDA 1N50A 4FA4A 2FYNB 1C75A 1FCDC 1QYZA 1IRWA 2FRCA 1LC1A 4WQDA 1AYGA 3RMZA 2ZXYA 5DF5A 4D6TD 2C1DB 1C7MA 2PACA 5CIDB 2BPBB 1P84D 3SXTA 4WQ8A 3O0RC 3OA8B 4FAVA 2FYUD 1KB0A 1JDLA 1LS9A 1YEBA 3DP5A 2N3BA 1M70A 3OCDB 1CC5A 1CHHA 2ZONG 3JBTB 1CO6A 1E29A 1BGYD 5B6QA 3CU4A 1HH7A 3HQ8A 1N90A 4O1WA 4L1QA 1C2RA 4WQCA 1YICA 4KMGA 5E79V 1FJ0A 2B12B 2B10B 3WFCC 3L72D 2B4ZA 3DR0A 3NBSA 1HJ5A 2C9XB 1L9BC 1KX2A 2B0ZB 1AKKA 1N9CA 2IBZD 1CIHA 1SQBD 3WU2V 1W2LA 1F1FA 1S6VB 2N18C 1CRCA 1QL3A 4WQAA 3WFEC 2LITA 3SLEA 2C8SA 1A8CA 1SQVD 1LMSA 3WFDC 1NIRA 1GKSA 1CRHA 5C0ZA 1ZZHA 5DFSA 1CTZA 1CRJA 1FHBA 2CXBA 2CE0A 1N15A 1C6RA 3PXWA 2QJPB 1CCRA 1H33B 5EXQA 3X39A 4EICA 1CEDA 4AAMA 1M60A 4K3IA 1BL9A 4IL6V 3H1JD 1CORA 4EIFA 4AX3A 3CX5W 2JQRA 2L4DA 1VYDA 2OZ1B 2CA3B 4U3FD 1FOCA 2A06D 4FA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C1U A;  1DT1 A;  4L3H A;  2CA4 B;  1H33 A;  2MHM A;  3VNW A;  4DY9 A;  3O1Y A;  4JCG A;  2LIR A;  3A9F A;  1OCD A;  1FI7 A;  5CIH B;  3O5C A;  4V2K A;  1C6S A;  1EB7 A;  1SQX D;  2OZ1 A;  1CIG A;  1NTK D;  2ZBO A;  1RAQ A;  1S5L V;  1CSX A;  1NU1 D;  5C9M A;  1LC2 A;  3ZOX A;  5DJQ B;  2GC4 D;  2N3Y A;  3A0B V;  3RN0 A;  4MU8 A;  1MG3 D;  1DW1 A;  1DW0 A;  1KB9 D;  3L75 D;  5H2F V;  4PD4 D;  1GQ1 A;  2V08 A;  1OAE A;  1HRC A;  4FB1 A;  3ZBM A;  5TIS V;  1DW3 A;  2YQB A;  4XXL A;  2N9J A;  1CSW A;  3NBT A;  451C A;  1CYC A;  2AXT V;  1CRY A;  1PPJ D;  5CIC B;  4AAN A;  1DII C;  4WQB A;  1MG2 D;  4GED B;  3SVW A;  3H1K D;  1M6Z A;  2HV4 A;  3PH2 B;  1DVV A;  1H31 A;  1AOF A;  3RLM A;  4GYD A;  1E2R A;  1L0N D;  5KLI B;  1CRG A;  4Y5R A;  1COT A;  1NMI A;  1YNR A;  2N18 B;  4PJ0 V;  3MK7 C;  2BLF B;  1DIQ C;  1C2N A;  1FI9 A;  5KKZ B;  1KIB A;  3M97 X;  4L3G A;  1E8E A;  2AIU A;  5B5E V;  4N0K A;  5KAF V;  2CE1 A;  4WQ7 A;  1NTZ D;  3KZI V;  3PXT A;  1PP9 D;  5GTH V;  1QL4 A;  4PW9 B;  1YTC A;  1HZV A;  4EID A;  1KYO W;  2ZOO A;  3TGU D;  3L74 D;  3HQ9 A;  1YEA A;  1RZ5 A;  2I8F A;  2D0W A;  1K3G A;  1GIW A;  1YFC A;  4UB6 V;  3WC8 A;  1I6E A;  3H1I D;  1H9Y A;  1AOQ A;  1U75 B;  1CXA A;  4AAO A;  2ORL A;  2D0S A;  1I55 A;  1CYJ A;  1F1C A;  3L4O A;  1I8O A;  3HQ7 A;  3ZOY A;  2BCN B;  3ORV A;  1QKS A;  1WEJ F;  1W5C T;  3NWV A;  2C1V A;  1RAP A;  4WQE A;  1KYO D;  5CIB B;  3CX5 D;  1KX7 A;  1CTJ A;  5CYT R;  1FI3 A;  155C A;  3HQ6 A;  1CXC A;  3L70 D;  2BGV X;  1CTY A;  2PCC B;  2BH5 X;  1SQQ D;  4WQ9 A;  5KLV D;  5DJQ C;  4FA1 A;  2YIU B;  3ZIY A;  4Q5P A;  3ZOO A;  4FA9 A;  1HJ4 A;  1WVE C;  2XTS B;  2V07 A;  1H31 B;  2MTA C;  5KAI V;  3SWS A;  1DVH A;  2C1D A;  1SQP D;  1J3S A;  1H1O A;  1IQC A;  1LFM A;  1GDV A;  3L71 D;  3CWB D;  3VRD A;  3OA8 A;  4P4Q B;  5GTI V;  1I54 A;  2QJY B;  5IY5 1;  2QJK B;  3TYI A;  4FAN A;  3OCD A;  1RZ6 A;  2GC7 D;  2YK3 A;  4LJI A;  1CHI A;  4H0K A;  1L0L D;  3ZCF A;  1I8P A;  4YE1 A;  1CSV A;  1BCC D;  2C2C A;  3L4M A;  3H1L D;  2B11 B;  3L73 D;  3ZOW A;  3CXH W;  3MK7 B;  1KV9 A;  2N9I A;  5CIE B;  4UB8 V;  351C A;  1C6O A;  1ETP A;  1H32 B;  4XYD B;  1CRI A;  1I6D A;  2BH4 X;  3DMI A;  1A56 A;  4PWA A;  4J20 A;  1GJQ A;  5CIF B;  3H1H D;  1IO3 A;  3CP5 A;  4RSZ A;  5CIG B;  3A0H V;  4NFG B;  3WUI A;  1HJ3 A;  1CNO A;  3PXS A;  1NTM D;  1MZ4 A;  1CHJ A;  1QN2 A;  1BE3 D;  1DW2 A;  2EXV A;  2DGE A;  3O20 A;  2GB8 B;  1R0Q A;  2ZZS 1;  3BCC D;  3CYT I;  1H32 A;  1EZV D;  4H0J A;  3WFB C;  1A2S A;  1YCC A;  2AI5 A;  3CXH D;  1GU2 A;  1C52 A;  1K3H A;  5B66 V;  1HZU A;  2PCB B;  2YCC A;  4O1Q A;  2GIW A;  3C2C A;  2BCC D;  2FWL A;  1HRO A;  1IZL 0;  1CIF A;  1I5T A;  1IRV A;  1CIE A;  1NML A;  5AUR A;  1CSU A;  1NNO A;  2JTI B;  3RN1 A;  3VYM A;  1B7V A;  4QAO A;  1CYI A;  1CCH A;  1U74 B;  2DVH A;  4AAL A;  1H9X A;  1ZRT D;  4EIE A;  1HCM A;  1YIQ A;  3SJL A;  1L9J C;  2VHD A;  1N50 A;  4FA4 A;  2FYN B;  1C75 A;  1FCD C;  1QYZ A;  1IRW A;  2FRC A;  1LC1 A;  4WQD A;  1AYG A;  3RMZ A;  2ZXY A;  5DF5 A;  4D6T D;  2C1D B;  1C7M A;  2PAC A;  5CID B;  2BPB B;  1P84 D;  3SXT A;  4WQ8 A;  3O0R C;  3OA8 B;  4FAV A;  2FYU D;  1KB0 A;  1JDL A;  1LS9 A;  1YEB A;  3DP5 A;  2N3B A;  1M70 A;  3OCD B;  1CC5 A;  1CHH A;  2ZON G;  3JBT B;  1CO6 A;  1E29 A;  1BGY D;  5B6Q A;  3CU4 A;  1HH7 A;  3HQ8 A;  1N90 A;  4O1W A;  4L1Q A;  1C2R A;  4WQC A;  1YIC A;  4KMG A;  5E79 V;  1FJ0 A;  2B12 B;  2B10 B;  3WFC C;  3L72 D;  2B4Z A;  3DR0 A;  3NBS A;  1HJ5 A;  2C9X B;  1L9B C;  1KX2 A;  2B0Z B;  1AKK A;  1N9C A;  2IBZ D;  1CIH A;  1SQB D;  3WU2 V;  1W2L A;  1F1F A;  1S6V B;  2N18 C;  1CRC A;  1QL3 A;  4WQA A;  3WFE C;  2LIT A;  3SLE A;  2C8S A;  1A8C A;  1SQV D;  1LMS A;  3WFD C;  1NIR A;  1GKS A;  1CRH A;  5C0Z A;  1ZZH A;  5DFS A;  1CTZ A;  1CRJ A;  1FHB A;  2CXB A;  2CE0 A;  1N15 A;  1C6R A;  3PXW A;  2QJP B;  1CCR A;  1H33 B;  5EXQ A;  3X39 A;  4EIC A;  1CED A;  4AAM A;  1M60 A;  4K3I A;  1BL9 A;  4IL6 V;  3H1J D;  1COR A;  4EIF A;  4AX3 A;  3CX5 W;  2JQR A;  2L4D A;  1VYD A;  2OZ1 B;  2CA3 B;  4U3F D;  1FOC A;  2A06 D;  4FA5 A; 
#chains in the Genus database with same CATH topology
 2C1U A;  1DT1 A;  4L3H A;  2CA4 B;  1H33 A;  2MHM A;  3VNW A;  4DY9 A;  3O1Y A;  4JCG A;  2LIR A;  3A9F A;  1OCD A;  1FI7 A;  5CIH B;  3O5C A;  4V2K A;  1C6S A;  1EB7 A;  1SQX D;  2OZ1 A;  1CIG A;  1NTK D;  2ZBO A;  1RAQ A;  1S5L V;  1CSX A;  1NU1 D;  5C9M A;  1LC2 A;  3ZOX A;  5DJQ B;  2GC4 D;  2N3Y A;  3A0B V;  3RN0 A;  4MU8 A;  1MG3 D;  1DW1 A;  1DW0 A;  1KB9 D;  3L75 D;  5H2F V;  4PD4 D;  1GQ1 A;  2V08 A;  1OAE A;  1HRC A;  4FB1 A;  3ZBM A;  5TIS V;  1DW3 A;  2YQB A;  4XXL A;  2N9J A;  1CSW A;  3NBT A;  451C A;  1CYC A;  2AXT V;  1CRY A;  1PPJ D;  5CIC B;  4AAN A;  1DII C;  4WQB A;  1MG2 D;  4GED B;  3SVW A;  3H1K D;  1M6Z A;  2HV4 A;  3PH2 B;  1DVV A;  1H31 A;  1AOF A;  3RLM A;  4GYD A;  1E2R A;  1L0N D;  5KLI B;  1CRG A;  4Y5R A;  1COT A;  1NMI A;  1YNR A;  2N18 B;  4PJ0 V;  3MK7 C;  2BLF B;  1DIQ C;  1C2N A;  1FI9 A;  5KKZ B;  1KIB A;  3M97 X;  4L3G A;  1E8E A;  2AIU A;  5B5E V;  4N0K A;  5KAF V;  2CE1 A;  4WQ7 A;  1NTZ D;  3KZI V;  3PXT A;  1PP9 D;  5GTH V;  1QL4 A;  4PW9 B;  1YTC A;  1HZV A;  4EID A;  1KYO W;  2ZOO A;  3TGU D;  3L74 D;  3HQ9 A;  1YEA A;  1RZ5 A;  2I8F A;  2D0W A;  1K3G A;  1GIW A;  1YFC A;  4UB6 V;  3WC8 A;  1I6E A;  3H1I D;  1H9Y A;  1AOQ A;  1U75 B;  1CXA A;  4AAO A;  2ORL A;  2D0S A;  1I55 A;  1CYJ A;  1F1C A;  3L4O A;  1I8O A;  3HQ7 A;  3ZOY A;  2BCN B;  3ORV A;  1QKS A;  1WEJ F;  1W5C T;  3NWV A;  2C1V A;  1RAP A;  4WQE A;  1KYO D;  5CIB B;  3CX5 D;  1KX7 A;  1CTJ A;  5CYT R;  1FI3 A;  155C A;  3HQ6 A;  1CXC A;  3L70 D;  2BGV X;  1CTY A;  2PCC B;  2BH5 X;  1SQQ D;  4WQ9 A;  5KLV D;  5DJQ C;  4FA1 A;  2YIU B;  3ZIY A;  4Q5P A;  3ZOO A;  4FA9 A;  1HJ4 A;  1WVE C;  2XTS B;  2V07 A;  1H31 B;  2MTA C;  5KAI V;  3SWS A;  1DVH A;  2C1D A;  1SQP D;  1J3S A;  1H1O A;  1IQC A;  1LFM A;  1GDV A;  3L71 D;  3CWB D;  3VRD A;  3OA8 A;  4P4Q B;  5GTI V;  1I54 A;  2QJY B;  5IY5 1;  2QJK B;  3TYI A;  4FAN A;  3OCD A;  1RZ6 A;  2GC7 D;  2YK3 A;  4LJI A;  1CHI A;  4H0K A;  1L0L D;  3ZCF A;  1I8P A;  4YE1 A;  1CSV A;  1BCC D;  2C2C A;  3L4M A;  3H1L D;  2B11 B;  3L73 D;  3ZOW A;  3CXH W;  3MK7 B;  1KV9 A;  2N9I A;  5CIE B;  4UB8 V;  351C A;  1C6O A;  1ETP A;  1H32 B;  4XYD B;  1CRI A;  1I6D A;  2BH4 X;  3DMI A;  1A56 A;  4PWA A;  4J20 A;  1GJQ A;  5CIF B;  3H1H D;  1IO3 A;  3CP5 A;  4RSZ A;  5CIG B;  3A0H V;  4NFG B;  3WUI A;  1HJ3 A;  1CNO A;  3PXS A;  1NTM D;  1MZ4 A;  1CHJ A;  1QN2 A;  1BE3 D;  1DW2 A;  2EXV A;  2DGE A;  3O20 A;  2GB8 B;  1R0Q A;  2ZZS 1;  3BCC D;  3CYT I;  1H32 A;  1EZV D;  4H0J A;  3WFB C;  1A2S A;  1YCC A;  2AI5 A;  3CXH D;  1GU2 A;  1C52 A;  1K3H A;  5B66 V;  1HZU A;  2PCB B;  2YCC A;  4O1Q A;  2GIW A;  3C2C A;  2BCC D;  2FWL A;  1HRO A;  1IZL 0;  1CIF A;  1I5T A;  1IRV A;  1CIE A;  1NML A;  5AUR A;  1CSU A;  1NNO A;  2JTI B;  3RN1 A;  3VYM A;  1B7V A;  4QAO A;  1CYI A;  1CCH A;  1U74 B;  2DVH A;  4AAL A;  1H9X A;  1ZRT D;  4EIE A;  1HCM A;  1YIQ A;  3SJL A;  1L9J C;  3D0W A;  2VHD A;  1N50 A;  4FA4 A;  2FYN B;  1C75 A;  1FCD C;  1QYZ A;  1IRW A;  2FRC A;  1LC1 A;  4WQD A;  1AYG A;  3RMZ A;  2ZXY A;  5DF5 A;  4D6T D;  2C1D B;  1C7M A;  2PAC A;  5CID B;  2BPB B;  1P84 D;  3SXT A;  4WQ8 A;  3O0R C;  3OA8 B;  4FAV A;  2FYU D;  1KB0 A;  1JDL A;  1LS9 A;  1YEB A;  3DP5 A;  2N3B A;  1M70 A;  3OCD B;  1CC5 A;  1CHH A;  2ZON G;  3JBT B;  1CO6 A;  1E29 A;  1BGY D;  5B6Q A;  3CU4 A;  1HH7 A;  3HQ8 A;  1N90 A;  4O1W A;  4L1Q A;  1C2R A;  4WQC A;  1YIC A;  4KMG A;  5E79 V;  1FJ0 A;  2B12 B;  2B10 B;  3WFC C;  3L72 D;  2B4Z A;  3DR0 A;  3NBS A;  1HJ5 A;  2C9X B;  1L9B C;  1KX2 A;  2B0Z B;  1AKK A;  1N9C A;  2IBZ D;  1CIH A;  1SQB D;  3WU2 V;  1W2L A;  1F1F A;  1S6V B;  2N18 C;  1CRC A;  1QL3 A;  4WQA A;  3WFE C;  2LIT A;  3SLE A;  2C8S A;  1A8C A;  1SQV D;  1LMS A;  3WFD C;  1NIR A;  1GKS A;  1CRH A;  5C0Z A;  1ZZH A;  5DFS A;  1CTZ A;  1CRJ A;  1FHB A;  2CXB A;  2CE0 A;  1N15 A;  1C6R A;  3PXW A;  2QJP B;  1CCR A;  1H33 B;  5EXQ A;  3X39 A;  4EIC A;  1CED A;  4AAM A;  1M60 A;  4K3I A;  1BL9 A;  4IL6 V;  3H1J D;  1COR A;  4EIF A;  4AX3 A;  3CX5 W;  2JQR A;  2L4D A;  1VYD A;  2OZ1 B;  2CA3 B;  4U3F D;  1FOC A;  2A06 D;  4FA5 A; 
#chains in the Genus database with same CATH homology
 2C1U A;  1DT1 A;  4L3H A;  2CA4 B;  1H33 A;  2MHM A;  3VNW A;  4DY9 A;  3O1Y A;  4JCG A;  2LIR A;  3A9F A;  1OCD A;  1FI7 A;  5CIH B;  3O5C A;  4V2K A;  1C6S A;  1EB7 A;  1SQX D;  2OZ1 A;  1CIG A;  1NTK D;  2ZBO A;  1RAQ A;  1S5L V;  1CSX A;  1NU1 D;  5C9M A;  1LC2 A;  3ZOX A;  5DJQ B;  2GC4 D;  2N3Y A;  3A0B V;  3RN0 A;  4MU8 A;  1MG3 D;  1DW1 A;  1DW0 A;  1KB9 D;  3L75 D;  5H2F V;  4PD4 D;  1GQ1 A;  2V08 A;  1OAE A;  1HRC A;  4FB1 A;  3ZBM A;  5TIS V;  1DW3 A;  2YQB A;  4XXL A;  2N9J A;  1CSW A;  3NBT A;  451C A;  1CYC A;  2AXT V;  1CRY A;  1PPJ D;  5CIC B;  4AAN A;  1DII C;  4WQB A;  1MG2 D;  4GED B;  3SVW A;  3H1K D;  1M6Z A;  2HV4 A;  3PH2 B;  1DVV A;  1H31 A;  1AOF A;  3RLM A;  4GYD A;  1E2R A;  1L0N D;  5KLI B;  1CRG A;  4Y5R A;  1COT A;  1NMI A;  1YNR A;  2N18 B;  4PJ0 V;  3MK7 C;  2BLF B;  1DIQ C;  1C2N A;  1FI9 A;  5KKZ B;  1KIB A;  3M97 X;  4L3G A;  1E8E A;  2AIU A;  5B5E V;  4N0K A;  5KAF V;  2CE1 A;  4WQ7 A;  1NTZ D;  3KZI V;  3PXT A;  1PP9 D;  5GTH V;  1QL4 A;  4PW9 B;  1YTC A;  1HZV A;  4EID A;  1KYO W;  2ZOO A;  3TGU D;  3L74 D;  3HQ9 A;  1YEA A;  1RZ5 A;  2I8F A;  2D0W A;  1K3G A;  1GIW A;  1YFC A;  4UB6 V;  3WC8 A;  1I6E A;  3H1I D;  1H9Y A;  1AOQ A;  1U75 B;  1CXA A;  4AAO A;  2ORL A;  2D0S A;  1I55 A;  1CYJ A;  1F1C A;  3L4O A;  1I8O A;  3HQ7 A;  3ZOY A;  2BCN B;  3ORV A;  1QKS A;  1WEJ F;  1W5C T;  3NWV A;  2C1V A;  1RAP A;  4WQE A;  1KYO D;  5CIB B;  3CX5 D;  1KX7 A;  1CTJ A;  5CYT R;  1FI3 A;  155C A;  3HQ6 A;  1CXC A;  3L70 D;  2BGV X;  1CTY A;  2PCC B;  2BH5 X;  1SQQ D;  4WQ9 A;  5KLV D;  5DJQ C;  4FA1 A;  2YIU B;  3ZIY A;  4Q5P A;  3ZOO A;  4FA9 A;  1HJ4 A;  1WVE C;  2XTS B;  2V07 A;  1H31 B;  2MTA C;  5KAI V;  3SWS A;  1DVH A;  2C1D A;  1SQP D;  1J3S A;  1H1O A;  1IQC A;  1LFM A;  1GDV A;  3L71 D;  3CWB D;  3VRD A;  3OA8 A;  4P4Q B;  5GTI V;  1I54 A;  2QJY B;  5IY5 1;  2QJK B;  3TYI A;  4FAN A;  3OCD A;  1RZ6 A;  2GC7 D;  2YK3 A;  4LJI A;  1CHI A;  4H0K A;  1L0L D;  3ZCF A;  1I8P A;  4YE1 A;  1CSV A;  1BCC D;  2C2C A;  3L4M A;  3H1L D;  2B11 B;  3L73 D;  3ZOW A;  3CXH W;  3MK7 B;  1KV9 A;  2N9I A;  5CIE B;  4UB8 V;  351C A;  1C6O A;  1ETP A;  1H32 B;  4XYD B;  1CRI A;  1I6D A;  2BH4 X;  3DMI A;  1A56 A;  4PWA A;  4J20 A;  1GJQ A;  5CIF B;  3H1H D;  1IO3 A;  3CP5 A;  4RSZ A;  5CIG B;  3A0H V;  4NFG B;  3WUI A;  1HJ3 A;  1CNO A;  3PXS A;  1NTM D;  1MZ4 A;  1CHJ A;  1QN2 A;  1BE3 D;  1DW2 A;  2EXV A;  2DGE A;  3O20 A;  2GB8 B;  1R0Q A;  2ZZS 1;  3BCC D;  3CYT I;  1H32 A;  1EZV D;  4H0J A;  3WFB C;  1A2S A;  1YCC A;  2AI5 A;  3CXH D;  1GU2 A;  1C52 A;  1K3H A;  5B66 V;  1HZU A;  2PCB B;  2YCC A;  4O1Q A;  2GIW A;  3C2C A;  2BCC D;  2FWL A;  1HRO A;  1IZL 0;  1CIF A;  1I5T A;  1IRV A;  1CIE A;  1NML A;  5AUR A;  1CSU A;  1NNO A;  2JTI B;  3RN1 A;  3VYM A;  1B7V A;  4QAO A;  1CYI A;  1CCH A;  1U74 B;  2DVH A;  4AAL A;  1H9X A;  1ZRT D;  4EIE A;  1HCM A;  1YIQ A;  3SJL A;  1L9J C;  2VHD A;  1N50 A;  4FA4 A;  2FYN B;  1C75 A;  1FCD C;  1QYZ A;  1IRW A;  2FRC A;  1LC1 A;  4WQD A;  1AYG A;  3RMZ A;  2ZXY A;  5DF5 A;  4D6T D;  2C1D B;  1C7M A;  2PAC A;  5CID B;  2BPB B;  1P84 D;  3SXT A;  4WQ8 A;  3O0R C;  3OA8 B;  4FAV A;  2FYU D;  1KB0 A;  1JDL A;  1LS9 A;  1YEB A;  3DP5 A;  2N3B A;  1M70 A;  3OCD B;  1CC5 A;  1CHH A;  2ZON G;  3JBT B;  1CO6 A;  1E29 A;  1BGY D;  5B6Q A;  3CU4 A;  1HH7 A;  3HQ8 A;  1N90 A;  4O1W A;  4L1Q A;  1C2R A;  4WQC A;  1YIC A;  4KMG A;  5E79 V;  1FJ0 A;  2B12 B;  2B10 B;  3WFC C;  3L72 D;  2B4Z A;  3DR0 A;  3NBS A;  1HJ5 A;  2C9X B;  1L9B C;  1KX2 A;  2B0Z B;  1AKK A;  1N9C A;  2IBZ D;  1CIH A;  1SQB D;  3WU2 V;  1W2L A;  1F1F A;  1S6V B;  2N18 C;  1CRC A;  1QL3 A;  4WQA A;  3WFE C;  2LIT A;  3SLE A;  2C8S A;  1A8C A;  1SQV D;  1LMS A;  3WFD C;  1NIR A;  1GKS A;  1CRH A;  5C0Z A;  1ZZH A;  5DFS A;  1CTZ A;  1CRJ A;  1FHB A;  2CXB A;  2CE0 A;  1N15 A;  1C6R A;  3PXW A;  2QJP B;  1CCR A;  1H33 B;  5EXQ A;  3X39 A;  4EIC A;  1CED A;  4AAM A;  1M60 A;  4K3I A;  1BL9 A;  4IL6 V;  3H1J D;  1COR A;  4EIF A;  4AX3 A;  3CX5 W;  2JQR A;  2L4D A;  1VYD A;  2OZ1 B;  2CA3 B;  4U3F D;  1FOC A;  2A06 D;  4FA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...