3WU2V

Crystal structure analysis of photosystem ii complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
137
structure length
137
Chain Sequence
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
total genus 47
structure length 137
sequence length 137
chains with identical sequence v
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF14495 Cytochrom_C550 Cytochrome c-550 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3wu2V00
1CYCA 1L9JC 4AAOA 4EIDA 1C52A 2V08A 1AYGA 3L72D 1H1OA 4PWAA 3H1ID 1N15A 3RN0A 3ZOWA 1CEDA 2PCBB 3M97X 3H1HD 1BL9A 5E79V 2ZZS1 5CIFB 3HQ6A 1A8CA 1WEJF 1SQBD 1CRHA 2B11B 3OA8A 3KZIV 1H9XA 4FA1A 1SQQD 4V2KA 5KAFV 1YEAA 1EZVD 1RZ6A 4WQ7A 3WC8A 1K3GA 1YTCA 1HJ4A 3VNWA 5B66V 1I55A 1YFCA 1HJ5A 2N9IA 2MHMA 2FYNB 1I6EA 3CP5A 1LC2A 1NMLA 1NNOA 1QN2A 1CYIA 5DJQB 2N18C 1FI9A 1PPJD 3L4OA 5IY51 1IZL0 5CIBB 4AAMA 1VYDA 3DP5A 1KB9D 4QAOA 2B10B 4FA5A 1BE3D 1JDLA 1KYOW 2CA4B 4Q5PA 4U3FD 1LMSA 3L70D 1F1FA 5CIDB 1HJ3A 2N3BA 3WFCC 1CCRA 1CHJA 1BCCD 1ZZHA 1LFMA 2LIRA 1KB0A 1LS9A 5GTHV 1I5TA 3WFEC 4FAVA 3H1KD 3L74D 1C7MA 3SJLA 4FA9A 2C2CA 1GKSA 3WFDC 2A06D 1CSWA 1FJ0A 4J20A 2GC7D 3CYTI 3O0RC 1E29A 3C2CA 1A2SA 1WVEC 2B0ZB 3DR0A 2FWLA 1C2RA 1M70A 5KKZB 1L0ND 2CA3B 3HQ7A 2C1UA 5CYTR 4PW9B 1CNOA 1MG3D 4EICA 4O1QA 1CHHA 5C9MA 3BCCD 2QJKB 2C1VA 1BGYD 1C6RA 4O1WA 1NMIA 1I8OA 1CRCA 4UB8V 1HZUA 2CE1A 1FHBA 4YE1A 4EIFA 1YEBA 4WQDA 5DFSA 1CIFA 5KAIV 3ZIYA 2C8SA 1EB7A 4WQCA 1AOFA 2GIWA 2ORLA 2PCCB 3RLMA 4JCGA 1MG2D 3CX5D 1DVHA 1AKKA 4KMGA 3L71D 5DF5A 5KLVD 1U75B 1H32B 1IRVA 2C9XB 1E2RA 3CXHD 1CIGA 2DGEA 3CU4A 3VYMA 4RSZA 1CSUA 1HROA 1GDVA 4L3HA 3MK7B 3TYIA 2BCCD 1CORA 1GJQA 3VRDA 1C2NA 4N0KA 4H0JA 3O1YA 3JBTB 1QL4A 1NTKD 2MTAC 3X39A 1YNRA 1CTJA 1S5LV 4FANA 1CRYA 451CA 1C75A 1M60A 4WQBA 1CTZA 3CXHW 5CIGB 3PXTA 4H0KA 1NU1D 1HZVA 1RAQA 1I6DA 4WQ8A 3CWBD 1A56A 4PD4D 4WQ9A 1MZ4A 1YIQA 4L3GA 1KX7A 4K3IA 1J3SA 1DVVA 1I8PA 2YIUB 3SVWA 3H1JD 2QJYB 2B4ZA 5B6QA 1DIIC 2ZXYA 3L4MA 1NTZD 3SLEA 1IQCA 3O20A 3ZOXA 1H32A 3PH2B 5CICB 1AOQA 4EIEA 3TGUD 4GYDA 1NIRA 1QYZA 1SQVD 3A9FA 4WQAA 2IBZD 4MU8A 2VHDA 2YQBA 1LC1A 5DJQC 1F1CA 1CSXA 1N50A 2JTIB 3L73D 1W5CT 4DY9A 4LJIA 4GEDB 155CA 2JQRA 3ORVA 1CC5A 1OAEA 3SXTA 1ETPA 1M6ZA 2LITA 1FOCA 1DW3A 2BGVX 3DMIA 1SQPD 3WU2V 2N18B 1S6VB 1DW1A 3O5CA 2I8FA 4NFGB 3NWVA 1CO6A 3HQ9A 4P4QB 1HH7A 1DT1A 1YICA 1CRIA 1R0QA 1KIBA 1GU2A 3L75D 2YCCA 1HCMA 1E8EA 1N90A 3SWSA 1C6OA 3ZOOA 3PXSA 1COTA 2BPBB 3ZCFA 3PXWA 1B7VA 1H33B 2CE0A 4L1QA 3WFBC 4FB1A 1SQXD 4XYDB 1QKSA 1C6SA 1L0LD 1K3HA 1DW0A 4AX3A 1N9CA 1CXCA 2OZ1B 1KYOD 5GTIV 2ZBOA 2CXBA 2L4DA 1NTMD 3CX5W 1OCDA 5CIEB 3NBSA 1PP9D 5AURA 4AANA 1HRCA 1QL3A 1H31B 3OCDB 1RZ5A 1CTYA 1CYJA 5KLIB 2D0WA 3WUIA 2C1DB 5TISV 3RMZA 2GB8B 1W2LA 1CRGA 1H9YA 4UB6V 1CCHA 2AXTV 1CIEA 1I54A 1DW2A 1FI3A 3ZOYA 2PACA 1IRWA 2BCNB 5EXQA 2QJPB 4IL6V 2AI5A 1FCDC 351CA 4D6TD 1GIWA 2XTSB 2FRCA 3RN1A 2N9JA 2GC4D 1CIHA 1L9BC 3OA8B 1CRJA 2BH5X 3A0BV 3A0HV 2ZONG 3HQ8A 4Y5RA 3NBTA 1H33A 1KV9A 4FA4A 1RAPA 4WQEA 2HV4A 1YCCA 2BLFB 3MK7C 2EXVA 2V07A 1U74B 2BH4X 5C0ZA 5B5EV 2OZ1A 3ZBMA 1P84D 2AIUA 2FYUD 5CIHB 1IO3A 1CXAA 1FI7A 1KX2A 1GQ1A 4XXLA 5H2FV 2YK3A 2N3YA 1H31A 1DIQC 3OCDA 2D0SA 2B12B 2ZOOA 4AALA 1ZRTD 2C1DA 2DVHA 1CSVA 3H1LD 1CHIA 4PJ0V
chains in the Genus database with same CATH superfamily
1CYCA 1L9JC 4AAOA 4EIDA 1C52A 2V08A 1AYGA 3L72D 1H1OA 4PWAA 3H1ID 1N15A 3RN0A 3ZOWA 1CEDA 2PCBB 3M97X 3H1HD 1BL9A 5E79V 2ZZS1 5CIFB 3HQ6A 1A8CA 1WEJF 1SQBD 1CRHA 2B11B 3OA8A 3KZIV 1H9XA 4FA1A 1SQQD 4V2KA 5KAFV 1YEAA 1EZVD 1RZ6A 4WQ7A 3WC8A 1K3GA 1YTCA 1HJ4A 3VNWA 5B66V 1I55A 1YFCA 1HJ5A 2N9IA 2MHMA 2FYNB 1I6EA 3CP5A 1LC2A 1NMLA 1NNOA 1QN2A 1CYIA 5DJQB 2N18C 1FI9A 1PPJD 3L4OA 3D0WA 5IY51 1IZL0 5CIBB 4AAMA 1VYDA 3DP5A 1KB9D 4QAOA 2B10B 4FA5A 1BE3D 1JDLA 1KYOW 2CA4B 4Q5PA 4U3FD 1LMSA 3L70D 1F1FA 5CIDB 1HJ3A 2N3BA 3WFCC 1CCRA 1CHJA 1BCCD 1ZZHA 1LFMA 2LIRA 1KB0A 1LS9A 5GTHV 1I5TA 3WFEC 4FAVA 3H1KD 3L74D 1C7MA 3SJLA 4FA9A 2C2CA 1GKSA 3WFDC 2A06D 1CSWA 1FJ0A 4J20A 2GC7D 3CYTI 3O0RC 1E29A 3C2CA 1A2SA 1WVEC 2B0ZB 3DR0A 2FWLA 1C2RA 1M70A 5KKZB 1L0ND 2CA3B 3HQ7A 2C1UA 5CYTR 4PW9B 1CNOA 1MG3D 4EICA 4O1QA 1CHHA 5C9MA 3BCCD 2QJKB 2C1VA 1BGYD 1C6RA 4O1WA 1NMIA 1I8OA 1CRCA 4UB8V 1HZUA 2CE1A 1FHBA 4YE1A 4EIFA 1YEBA 4WQDA 5DFSA 1CIFA 5KAIV 3ZIYA 2C8SA 1EB7A 4WQCA 1AOFA 2GIWA 2ORLA 2PCCB 3RLMA 4JCGA 1MG2D 3CX5D 1DVHA 1AKKA 4KMGA 3L71D 5DF5A 5KLVD 1U75B 1H32B 1IRVA 2C9XB 1E2RA 3CXHD 1CIGA 2DGEA 3CU4A 3VYMA 4RSZA 1CSUA 1HROA 1GDVA 4L3HA 3MK7B 3TYIA 2BCCD 1CORA 1GJQA 3VRDA 1C2NA 4N0KA 4H0JA 3O1YA 3JBTB 1QL4A 1NTKD 2MTAC 3X39A 1YNRA 1CTJA 1S5LV 4FANA 1CRYA 451CA 1C75A 1M60A 4WQBA 1CTZA 3CXHW 5CIGB 3PXTA 4H0KA 1NU1D 1HZVA 1RAQA 1I6DA 4WQ8A 3CWBD 1A56A 4PD4D 4WQ9A 1MZ4A 1YIQA 4L3GA 1KX7A 4K3IA 1J3SA 1DVVA 1I8PA 2YIUB 3SVWA 3H1JD 2QJYB 2B4ZA 5B6QA 1DIIC 2ZXYA 3L4MA 1NTZD 3SLEA 1IQCA 3O20A 3ZOXA 1H32A 3PH2B 5CICB 1AOQA 4EIEA 3TGUD 4GYDA 1NIRA 1QYZA 1SQVD 3A9FA 4WQAA 2IBZD 4MU8A 2VHDA 2YQBA 1LC1A 5DJQC 1F1CA 1CSXA 1N50A 2JTIB 3L73D 1W5CT 4DY9A 4LJIA 4GEDB 155CA 2JQRA 3ORVA 1CC5A 1OAEA 3SXTA 1ETPA 1M6ZA 2LITA 1FOCA 1DW3A 2BGVX 3DMIA 1SQPD 3WU2V 2N18B 1S6VB 1DW1A 3O5CA 2I8FA 4NFGB 3NWVA 1CO6A 3HQ9A 4P4QB 1HH7A 1DT1A 1YICA 1CRIA 1R0QA 1KIBA 1GU2A 3L75D 2YCCA 1HCMA 1E8EA 1N90A 3SWSA 1C6OA 3ZOOA 3PXSA 1COTA 2BPBB 3ZCFA 3PXWA 1B7VA 1H33B 2CE0A 4L1QA 3WFBC 4FB1A 1SQXD 4XYDB 1QKSA 1C6SA 1L0LD 1K3HA 1DW0A 4AX3A 1N9CA 1CXCA 2OZ1B 1KYOD 5GTIV 2ZBOA 2CXBA 2L4DA 1NTMD 3CX5W 1OCDA 5CIEB 3NBSA 1PP9D 5AURA 4AANA 1HRCA 1QL3A 1H31B 3OCDB 1RZ5A 1CTYA 1CYJA 5KLIB 2D0WA 3WUIA 2C1DB 5TISV 3RMZA 2GB8B 1W2LA 1CRGA 1H9YA 4UB6V 1CCHA 2AXTV 1CIEA 1I54A 1DW2A 1FI3A 3ZOYA 2PACA 1IRWA 2BCNB 5EXQA 2QJPB 4IL6V 2AI5A 1FCDC 351CA 4D6TD 1GIWA 2XTSB 2FRCA 3RN1A 2N9JA 2GC4D 1CIHA 1L9BC 3OA8B 1CRJA 2BH5X 3A0BV 3A0HV 2ZONG 3HQ8A 4Y5RA 3NBTA 1H33A 1KV9A 4FA4A 1RAPA 4WQEA 2HV4A 1YCCA 2BLFB 3MK7C 2EXVA 2V07A 1U74B 2BH4X 5C0ZA 5B5EV 2OZ1A 3ZBMA 1P84D 2AIUA 2FYUD 5CIHB 1IO3A 1CXAA 1FI7A 1KX2A 1GQ1A 4XXLA 5H2FV 2YK3A 2N3YA 1H31A 1DIQC 3OCDA 2D0SA 2B12B 2ZOOA 4AALA 1ZRTD 2C1DA 2DVHA 1CSVA 3H1LD 1CHIA 4PJ0V
chains in the Genus database with same CATH topology
1CYCA 1L9JC 4AAOA 4EIDA 1C52A 2V08A 1AYGA 3L72D 1H1OA 4PWAA 3H1ID 1N15A 3RN0A 3ZOWA 1CEDA 2PCBB 3M97X 3H1HD 1BL9A 5E79V 2ZZS1 5CIFB 3HQ6A 1A8CA 1WEJF 1SQBD 1CRHA 2B11B 3OA8A 3KZIV 1H9XA 4FA1A 1SQQD 4V2KA 5KAFV 1YEAA 1EZVD 1RZ6A 4WQ7A 3WC8A 1K3GA 1YTCA 1HJ4A 3VNWA 5B66V 1I55A 1YFCA 1HJ5A 2N9IA 2MHMA 2FYNB 1I6EA 3CP5A 1LC2A 1NMLA 1NNOA 1QN2A 1CYIA 5DJQB 2N18C 1FI9A 1PPJD 3L4OA 5IY51 1IZL0 5CIBB 4AAMA 1VYDA 3DP5A 1KB9D 4QAOA 2B10B 4FA5A 1BE3D 1JDLA 1KYOW 2CA4B 4Q5PA 4U3FD 1LMSA 3L70D 1F1FA 5CIDB 1HJ3A 2N3BA 3WFCC 1CCRA 1CHJA 1BCCD 1ZZHA 1LFMA 2LIRA 1KB0A 1LS9A 5GTHV 1I5TA 3WFEC 4FAVA 3H1KD 3L74D 1C7MA 3SJLA 4FA9A 2C2CA 1GKSA 3WFDC 2A06D 1CSWA 1FJ0A 4J20A 2GC7D 3CYTI 3O0RC 1E29A 3C2CA 1A2SA 1WVEC 2B0ZB 3DR0A 2FWLA 1C2RA 1M70A 5KKZB 1L0ND 2CA3B 3HQ7A 2C1UA 5CYTR 4PW9B 1CNOA 1MG3D 4EICA 4O1QA 1CHHA 5C9MA 3BCCD 2QJKB 2C1VA 1BGYD 1C6RA 4O1WA 1NMIA 1I8OA 1CRCA 4UB8V 1HZUA 2CE1A 1FHBA 4YE1A 4EIFA 1YEBA 4WQDA 5DFSA 1CIFA 5KAIV 3ZIYA 2C8SA 1EB7A 4WQCA 1AOFA 2GIWA 2ORLA 2PCCB 3RLMA 4JCGA 1MG2D 3CX5D 1DVHA 1AKKA 4KMGA 3L71D 5DF5A 5KLVD 1U75B 1H32B 1IRVA 2C9XB 1E2RA 3CXHD 1CIGA 2DGEA 3CU4A 3VYMA 4RSZA 1CSUA 1HROA 1GDVA 4L3HA 3MK7B 3TYIA 2BCCD 1CORA 1GJQA 3VRDA 1C2NA 4N0KA 4H0JA 3O1YA 3JBTB 1QL4A 1NTKD 2MTAC 3X39A 1YNRA 1CTJA 1S5LV 4FANA 1CRYA 451CA 1C75A 1M60A 4WQBA 1CTZA 3CXHW 5CIGB 3PXTA 4H0KA 1NU1D 1HZVA 1RAQA 1I6DA 4WQ8A 3CWBD 1A56A 4PD4D 4WQ9A 1MZ4A 1YIQA 4L3GA 1KX7A 4K3IA 1J3SA 1DVVA 1I8PA 2YIUB 3SVWA 3H1JD 2QJYB 2B4ZA 5B6QA 1DIIC 2ZXYA 3L4MA 1NTZD 3SLEA 1IQCA 3O20A 3ZOXA 1H32A 3PH2B 5CICB 1AOQA 4EIEA 3TGUD 4GYDA 1NIRA 1QYZA 1SQVD 3A9FA 4WQAA 2IBZD 4MU8A 2VHDA 2YQBA 1LC1A 5DJQC 1F1CA 1CSXA 1N50A 2JTIB 3L73D 1W5CT 4DY9A 4LJIA 4GEDB 155CA 2JQRA 3ORVA 1CC5A 1OAEA 3SXTA 1ETPA 1M6ZA 2LITA 1FOCA 1DW3A 2BGVX 3DMIA 1SQPD 3WU2V 2N18B 1S6VB 1DW1A 3O5CA 2I8FA 4NFGB 3NWVA 1CO6A 3HQ9A 4P4QB 1HH7A 1DT1A 1YICA 1CRIA 1R0QA 1KIBA 1GU2A 3L75D 2YCCA 1HCMA 1E8EA 1N90A 3SWSA 1C6OA 3ZOOA 3PXSA 1COTA 2BPBB 3ZCFA 3PXWA 1B7VA 1H33B 2CE0A 4L1QA 3WFBC 4FB1A 1SQXD 4XYDB 1QKSA 1C6SA 1L0LD 1K3HA 1DW0A 4AX3A 1N9CA 1CXCA 2OZ1B 1KYOD 5GTIV 2ZBOA 2CXBA 2L4DA 1NTMD 3CX5W 1OCDA 5CIEB 3NBSA 1PP9D 5AURA 4AANA 1HRCA 1QL3A 1H31B 3OCDB 1RZ5A 1CTYA 1CYJA 5KLIB 2D0WA 3WUIA 2C1DB 5TISV 3RMZA 2GB8B 1W2LA 1CRGA 1H9YA 4UB6V 1CCHA 2AXTV 1CIEA 1I54A 1DW2A 1FI3A 3ZOYA 2PACA 1IRWA 2BCNB 5EXQA 2QJPB 4IL6V 2AI5A 1FCDC 351CA 4D6TD 1GIWA 2XTSB 2FRCA 3RN1A 2N9JA 2GC4D 1CIHA 1L9BC 3OA8B 1CRJA 2BH5X 3A0BV 3A0HV 2ZONG 3HQ8A 4Y5RA 3NBTA 1H33A 1KV9A 4FA4A 1RAPA 4WQEA 2HV4A 1YCCA 2BLFB 3MK7C 2EXVA 2V07A 1U74B 2BH4X 5C0ZA 5B5EV 2OZ1A 3ZBMA 1P84D 2AIUA 2FYUD 5CIHB 1IO3A 1CXAA 1FI7A 1KX2A 1GQ1A 4XXLA 5H2FV 2YK3A 2N3YA 1H31A 1DIQC 3OCDA 2D0SA 2B12B 2ZOOA 4AALA 1ZRTD 2C1DA 2DVHA 1CSVA 3H1LD 1CHIA 4PJ0V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CYC A;  1L9J C;  4AAO A;  4EID A;  1C52 A;  2V08 A;  1AYG A;  3L72 D;  1H1O A;  4PWA A;  3H1I D;  1N15 A;  3RN0 A;  3ZOW A;  1CED A;  2PCB B;  3M97 X;  3H1H D;  1BL9 A;  5E79 V;  2ZZS 1;  5CIF B;  3HQ6 A;  1A8C A;  1WEJ F;  1SQB D;  1CRH A;  2B11 B;  3OA8 A;  3KZI V;  1H9X A;  4FA1 A;  1SQQ D;  4V2K A;  5KAF V;  1YEA A;  1EZV D;  1RZ6 A;  4WQ7 A;  3WC8 A;  1K3G A;  1YTC A;  1HJ4 A;  3VNW A;  5B66 V;  1I55 A;  1YFC A;  1HJ5 A;  2N9I A;  2MHM A;  2FYN B;  1I6E A;  3CP5 A;  1LC2 A;  1NML A;  1NNO A;  1QN2 A;  1CYI A;  5DJQ B;  2N18 C;  1FI9 A;  1PPJ D;  3L4O A;  5IY5 1;  1IZL 0;  5CIB B;  4AAM A;  1VYD A;  3DP5 A;  1KB9 D;  4QAO A;  2B10 B;  4FA5 A;  1BE3 D;  1JDL A;  1KYO W;  2CA4 B;  4Q5P A;  4U3F D;  1LMS A;  3L70 D;  1F1F A;  5CID B;  1HJ3 A;  2N3B A;  3WFC C;  1CCR A;  1CHJ A;  1BCC D;  1ZZH A;  1LFM A;  2LIR A;  1KB0 A;  1LS9 A;  5GTH V;  1I5T A;  3WFE C;  4FAV A;  3H1K D;  3L74 D;  1C7M A;  3SJL A;  4FA9 A;  2C2C A;  1GKS A;  3WFD C;  2A06 D;  1CSW A;  1FJ0 A;  4J20 A;  2GC7 D;  3CYT I;  3O0R C;  1E29 A;  3C2C A;  1A2S A;  1WVE C;  2B0Z B;  3DR0 A;  2FWL A;  1C2R A;  1M70 A;  5KKZ B;  1L0N D;  2CA3 B;  3HQ7 A;  2C1U A;  5CYT R;  4PW9 B;  1CNO A;  1MG3 D;  4EIC A;  4O1Q A;  1CHH A;  5C9M A;  3BCC D;  2QJK B;  2C1V A;  1BGY D;  1C6R A;  4O1W A;  1NMI A;  1I8O A;  1CRC A;  4UB8 V;  1HZU A;  2CE1 A;  1FHB A;  4YE1 A;  4EIF A;  1YEB A;  4WQD A;  5DFS A;  1CIF A;  5KAI V;  3ZIY A;  2C8S A;  1EB7 A;  4WQC A;  1AOF A;  2GIW A;  2ORL A;  2PCC B;  3RLM A;  4JCG A;  1MG2 D;  3CX5 D;  1DVH A;  1AKK A;  4KMG A;  3L71 D;  5DF5 A;  5KLV D;  1U75 B;  1H32 B;  1IRV A;  2C9X B;  1E2R A;  3CXH D;  1CIG A;  2DGE A;  3CU4 A;  3VYM A;  4RSZ A;  1CSU A;  1HRO A;  1GDV A;  4L3H A;  3MK7 B;  3TYI A;  2BCC D;  1COR A;  1GJQ A;  3VRD A;  1C2N A;  4N0K A;  4H0J A;  3O1Y A;  3JBT B;  1QL4 A;  1NTK D;  2MTA C;  3X39 A;  1YNR A;  1CTJ A;  1S5L V;  4FAN A;  1CRY A;  451C A;  1C75 A;  1M60 A;  4WQB A;  1CTZ A;  3CXH W;  5CIG B;  3PXT A;  4H0K A;  1NU1 D;  1HZV A;  1RAQ A;  1I6D A;  4WQ8 A;  3CWB D;  1A56 A;  4PD4 D;  4WQ9 A;  1MZ4 A;  1YIQ A;  4L3G A;  1KX7 A;  4K3I A;  1J3S A;  1DVV A;  1I8P A;  2YIU B;  3SVW A;  3H1J D;  2QJY B;  2B4Z A;  5B6Q A;  1DII C;  2ZXY A;  3L4M A;  1NTZ D;  3SLE A;  1IQC A;  3O20 A;  3ZOX A;  1H32 A;  3PH2 B;  5CIC B;  1AOQ A;  4EIE A;  3TGU D;  4GYD A;  1NIR A;  1QYZ A;  1SQV D;  3A9F A;  4WQA A;  2IBZ D;  4MU8 A;  2VHD A;  2YQB A;  1LC1 A;  5DJQ C;  1F1C A;  1CSX A;  1N50 A;  2JTI B;  3L73 D;  1W5C T;  4DY9 A;  4LJI A;  4GED B;  155C A;  2JQR A;  3ORV A;  1CC5 A;  1OAE A;  3SXT A;  1ETP A;  1M6Z A;  2LIT A;  1FOC A;  1DW3 A;  2BGV X;  3DMI A;  1SQP D;  3WU2 V;  2N18 B;  1S6V B;  1DW1 A;  3O5C A;  2I8F A;  4NFG B;  3NWV A;  1CO6 A;  3HQ9 A;  4P4Q B;  1HH7 A;  1DT1 A;  1YIC A;  1CRI A;  1R0Q A;  1KIB A;  1GU2 A;  3L75 D;  2YCC A;  1HCM A;  1E8E A;  1N90 A;  3SWS A;  1C6O A;  3ZOO A;  3PXS A;  1COT A;  2BPB B;  3ZCF A;  3PXW A;  1B7V A;  1H33 B;  2CE0 A;  4L1Q A;  3WFB C;  4FB1 A;  1SQX D;  4XYD B;  1QKS A;  1C6S A;  1L0L D;  1K3H A;  1DW0 A;  4AX3 A;  1N9C A;  1CXC A;  2OZ1 B;  1KYO D;  5GTI V;  2ZBO A;  2CXB A;  2L4D A;  1NTM D;  3CX5 W;  1OCD A;  5CIE B;  3NBS A;  1PP9 D;  5AUR A;  4AAN A;  1HRC A;  1QL3 A;  1H31 B;  3OCD B;  1RZ5 A;  1CTY A;  1CYJ A;  5KLI B;  2D0W A;  3WUI A;  2C1D B;  5TIS V;  3RMZ A;  2GB8 B;  1W2L A;  1CRG A;  1H9Y A;  4UB6 V;  1CCH A;  2AXT V;  1CIE A;  1I54 A;  1DW2 A;  1FI3 A;  3ZOY A;  2PAC A;  1IRW A;  2BCN B;  5EXQ A;  2QJP B;  4IL6 V;  2AI5 A;  1FCD C;  351C A;  4D6T D;  1GIW A;  2XTS B;  2FRC A;  3RN1 A;  2N9J A;  2GC4 D;  1CIH A;  1L9B C;  3OA8 B;  1CRJ A;  2BH5 X;  3A0B V;  3A0H V;  2ZON G;  3HQ8 A;  4Y5R A;  3NBT A;  1H33 A;  1KV9 A;  4FA4 A;  1RAP A;  4WQE A;  2HV4 A;  1YCC A;  2BLF B;  3MK7 C;  2EXV A;  2V07 A;  1U74 B;  2BH4 X;  5C0Z A;  5B5E V;  2OZ1 A;  3ZBM A;  1P84 D;  2AIU A;  2FYU D;  5CIH B;  1IO3 A;  1CXA A;  1FI7 A;  1KX2 A;  1GQ1 A;  4XXL A;  5H2F V;  2YK3 A;  2N3Y A;  1H31 A;  1DIQ C;  3OCD A;  2D0S A;  2B12 B;  2ZOO A;  4AAL A;  1ZRT D;  2C1D A;  2DVH A;  1CSV A;  3H1L D;  1CHI A;  4PJ0 V; 
#chains in the Genus database with same CATH topology
 1CYC A;  1L9J C;  4AAO A;  4EID A;  1C52 A;  2V08 A;  1AYG A;  3L72 D;  1H1O A;  4PWA A;  3H1I D;  1N15 A;  3RN0 A;  3ZOW A;  1CED A;  2PCB B;  3M97 X;  3H1H D;  1BL9 A;  5E79 V;  2ZZS 1;  5CIF B;  3HQ6 A;  1A8C A;  1WEJ F;  1SQB D;  1CRH A;  2B11 B;  3OA8 A;  3KZI V;  1H9X A;  4FA1 A;  1SQQ D;  4V2K A;  5KAF V;  1YEA A;  1EZV D;  1RZ6 A;  4WQ7 A;  3WC8 A;  1K3G A;  1YTC A;  1HJ4 A;  3VNW A;  5B66 V;  1I55 A;  1YFC A;  1HJ5 A;  2N9I A;  2MHM A;  2FYN B;  1I6E A;  3CP5 A;  1LC2 A;  1NML A;  1NNO A;  1QN2 A;  1CYI A;  5DJQ B;  2N18 C;  1FI9 A;  1PPJ D;  3L4O A;  3D0W A;  5IY5 1;  1IZL 0;  5CIB B;  4AAM A;  1VYD A;  3DP5 A;  1KB9 D;  4QAO A;  2B10 B;  4FA5 A;  1BE3 D;  1JDL A;  1KYO W;  2CA4 B;  4Q5P A;  4U3F D;  1LMS A;  3L70 D;  1F1F A;  5CID B;  1HJ3 A;  2N3B A;  3WFC C;  1CCR A;  1CHJ A;  1BCC D;  1ZZH A;  1LFM A;  2LIR A;  1KB0 A;  1LS9 A;  5GTH V;  1I5T A;  3WFE C;  4FAV A;  3H1K D;  3L74 D;  1C7M A;  3SJL A;  4FA9 A;  2C2C A;  1GKS A;  3WFD C;  2A06 D;  1CSW A;  1FJ0 A;  4J20 A;  2GC7 D;  3CYT I;  3O0R C;  1E29 A;  3C2C A;  1A2S A;  1WVE C;  2B0Z B;  3DR0 A;  2FWL A;  1C2R A;  1M70 A;  5KKZ B;  1L0N D;  2CA3 B;  3HQ7 A;  2C1U A;  5CYT R;  4PW9 B;  1CNO A;  1MG3 D;  4EIC A;  4O1Q A;  1CHH A;  5C9M A;  3BCC D;  2QJK B;  2C1V A;  1BGY D;  1C6R A;  4O1W A;  1NMI A;  1I8O A;  1CRC A;  4UB8 V;  1HZU A;  2CE1 A;  1FHB A;  4YE1 A;  4EIF A;  1YEB A;  4WQD A;  5DFS A;  1CIF A;  5KAI V;  3ZIY A;  2C8S A;  1EB7 A;  4WQC A;  1AOF A;  2GIW A;  2ORL A;  2PCC B;  3RLM A;  4JCG A;  1MG2 D;  3CX5 D;  1DVH A;  1AKK A;  4KMG A;  3L71 D;  5DF5 A;  5KLV D;  1U75 B;  1H32 B;  1IRV A;  2C9X B;  1E2R A;  3CXH D;  1CIG A;  2DGE A;  3CU4 A;  3VYM A;  4RSZ A;  1CSU A;  1HRO A;  1GDV A;  4L3H A;  3MK7 B;  3TYI A;  2BCC D;  1COR A;  1GJQ A;  3VRD A;  1C2N A;  4N0K A;  4H0J A;  3O1Y A;  3JBT B;  1QL4 A;  1NTK D;  2MTA C;  3X39 A;  1YNR A;  1CTJ A;  1S5L V;  4FAN A;  1CRY A;  451C A;  1C75 A;  1M60 A;  4WQB A;  1CTZ A;  3CXH W;  5CIG B;  3PXT A;  4H0K A;  1NU1 D;  1HZV A;  1RAQ A;  1I6D A;  4WQ8 A;  3CWB D;  1A56 A;  4PD4 D;  4WQ9 A;  1MZ4 A;  1YIQ A;  4L3G A;  1KX7 A;  4K3I A;  1J3S A;  1DVV A;  1I8P A;  2YIU B;  3SVW A;  3H1J D;  2QJY B;  2B4Z A;  5B6Q A;  1DII C;  2ZXY A;  3L4M A;  1NTZ D;  3SLE A;  1IQC A;  3O20 A;  3ZOX A;  1H32 A;  3PH2 B;  5CIC B;  1AOQ A;  4EIE A;  3TGU D;  4GYD A;  1NIR A;  1QYZ A;  1SQV D;  3A9F A;  4WQA A;  2IBZ D;  4MU8 A;  2VHD A;  2YQB A;  1LC1 A;  5DJQ C;  1F1C A;  1CSX A;  1N50 A;  2JTI B;  3L73 D;  1W5C T;  4DY9 A;  4LJI A;  4GED B;  155C A;  2JQR A;  3ORV A;  1CC5 A;  1OAE A;  3SXT A;  1ETP A;  1M6Z A;  2LIT A;  1FOC A;  1DW3 A;  2BGV X;  3DMI A;  1SQP D;  3WU2 V;  2N18 B;  1S6V B;  1DW1 A;  3O5C A;  2I8F A;  4NFG B;  3NWV A;  1CO6 A;  3HQ9 A;  4P4Q B;  1HH7 A;  1DT1 A;  1YIC A;  1CRI A;  1R0Q A;  1KIB A;  1GU2 A;  3L75 D;  2YCC A;  1HCM A;  1E8E A;  1N90 A;  3SWS A;  1C6O A;  3ZOO A;  3PXS A;  1COT A;  2BPB B;  3ZCF A;  3PXW A;  1B7V A;  1H33 B;  2CE0 A;  4L1Q A;  3WFB C;  4FB1 A;  1SQX D;  4XYD B;  1QKS A;  1C6S A;  1L0L D;  1K3H A;  1DW0 A;  4AX3 A;  1N9C A;  1CXC A;  2OZ1 B;  1KYO D;  5GTI V;  2ZBO A;  2CXB A;  2L4D A;  1NTM D;  3CX5 W;  1OCD A;  5CIE B;  3NBS A;  1PP9 D;  5AUR A;  4AAN A;  1HRC A;  1QL3 A;  1H31 B;  3OCD B;  1RZ5 A;  1CTY A;  1CYJ A;  5KLI B;  2D0W A;  3WUI A;  2C1D B;  5TIS V;  3RMZ A;  2GB8 B;  1W2L A;  1CRG A;  1H9Y A;  4UB6 V;  1CCH A;  2AXT V;  1CIE A;  1I54 A;  1DW2 A;  1FI3 A;  3ZOY A;  2PAC A;  1IRW A;  2BCN B;  5EXQ A;  2QJP B;  4IL6 V;  2AI5 A;  1FCD C;  351C A;  4D6T D;  1GIW A;  2XTS B;  2FRC A;  3RN1 A;  2N9J A;  2GC4 D;  1CIH A;  1L9B C;  3OA8 B;  1CRJ A;  2BH5 X;  3A0B V;  3A0H V;  2ZON G;  3HQ8 A;  4Y5R A;  3NBT A;  1H33 A;  1KV9 A;  4FA4 A;  1RAP A;  4WQE A;  2HV4 A;  1YCC A;  2BLF B;  3MK7 C;  2EXV A;  2V07 A;  1U74 B;  2BH4 X;  5C0Z A;  5B5E V;  2OZ1 A;  3ZBM A;  1P84 D;  2AIU A;  2FYU D;  5CIH B;  1IO3 A;  1CXA A;  1FI7 A;  1KX2 A;  1GQ1 A;  4XXL A;  5H2F V;  2YK3 A;  2N3Y A;  1H31 A;  1DIQ C;  3OCD A;  2D0S A;  2B12 B;  2ZOO A;  4AAL A;  1ZRT D;  2C1D A;  2DVH A;  1CSV A;  3H1L D;  1CHI A;  4PJ0 V; 
#chains in the Genus database with same CATH homology
 1CYC A;  1L9J C;  4AAO A;  4EID A;  1C52 A;  2V08 A;  1AYG A;  3L72 D;  1H1O A;  4PWA A;  3H1I D;  1N15 A;  3RN0 A;  3ZOW A;  1CED A;  2PCB B;  3M97 X;  3H1H D;  1BL9 A;  5E79 V;  2ZZS 1;  5CIF B;  3HQ6 A;  1A8C A;  1WEJ F;  1SQB D;  1CRH A;  2B11 B;  3OA8 A;  3KZI V;  1H9X A;  4FA1 A;  1SQQ D;  4V2K A;  5KAF V;  1YEA A;  1EZV D;  1RZ6 A;  4WQ7 A;  3WC8 A;  1K3G A;  1YTC A;  1HJ4 A;  3VNW A;  5B66 V;  1I55 A;  1YFC A;  1HJ5 A;  2N9I A;  2MHM A;  2FYN B;  1I6E A;  3CP5 A;  1LC2 A;  1NML A;  1NNO A;  1QN2 A;  1CYI A;  5DJQ B;  2N18 C;  1FI9 A;  1PPJ D;  3L4O A;  5IY5 1;  1IZL 0;  5CIB B;  4AAM A;  1VYD A;  3DP5 A;  1KB9 D;  4QAO A;  2B10 B;  4FA5 A;  1BE3 D;  1JDL A;  1KYO W;  2CA4 B;  4Q5P A;  4U3F D;  1LMS A;  3L70 D;  1F1F A;  5CID B;  1HJ3 A;  2N3B A;  3WFC C;  1CCR A;  1CHJ A;  1BCC D;  1ZZH A;  1LFM A;  2LIR A;  1KB0 A;  1LS9 A;  5GTH V;  1I5T A;  3WFE C;  4FAV A;  3H1K D;  3L74 D;  1C7M A;  3SJL A;  4FA9 A;  2C2C A;  1GKS A;  3WFD C;  2A06 D;  1CSW A;  1FJ0 A;  4J20 A;  2GC7 D;  3CYT I;  3O0R C;  1E29 A;  3C2C A;  1A2S A;  1WVE C;  2B0Z B;  3DR0 A;  2FWL A;  1C2R A;  1M70 A;  5KKZ B;  1L0N D;  2CA3 B;  3HQ7 A;  2C1U A;  5CYT R;  4PW9 B;  1CNO A;  1MG3 D;  4EIC A;  4O1Q A;  1CHH A;  5C9M A;  3BCC D;  2QJK B;  2C1V A;  1BGY D;  1C6R A;  4O1W A;  1NMI A;  1I8O A;  1CRC A;  4UB8 V;  1HZU A;  2CE1 A;  1FHB A;  4YE1 A;  4EIF A;  1YEB A;  4WQD A;  5DFS A;  1CIF A;  5KAI V;  3ZIY A;  2C8S A;  1EB7 A;  4WQC A;  1AOF A;  2GIW A;  2ORL A;  2PCC B;  3RLM A;  4JCG A;  1MG2 D;  3CX5 D;  1DVH A;  1AKK A;  4KMG A;  3L71 D;  5DF5 A;  5KLV D;  1U75 B;  1H32 B;  1IRV A;  2C9X B;  1E2R A;  3CXH D;  1CIG A;  2DGE A;  3CU4 A;  3VYM A;  4RSZ A;  1CSU A;  1HRO A;  1GDV A;  4L3H A;  3MK7 B;  3TYI A;  2BCC D;  1COR A;  1GJQ A;  3VRD A;  1C2N A;  4N0K A;  4H0J A;  3O1Y A;  3JBT B;  1QL4 A;  1NTK D;  2MTA C;  3X39 A;  1YNR A;  1CTJ A;  1S5L V;  4FAN A;  1CRY A;  451C A;  1C75 A;  1M60 A;  4WQB A;  1CTZ A;  3CXH W;  5CIG B;  3PXT A;  4H0K A;  1NU1 D;  1HZV A;  1RAQ A;  1I6D A;  4WQ8 A;  3CWB D;  1A56 A;  4PD4 D;  4WQ9 A;  1MZ4 A;  1YIQ A;  4L3G A;  1KX7 A;  4K3I A;  1J3S A;  1DVV A;  1I8P A;  2YIU B;  3SVW A;  3H1J D;  2QJY B;  2B4Z A;  5B6Q A;  1DII C;  2ZXY A;  3L4M A;  1NTZ D;  3SLE A;  1IQC A;  3O20 A;  3ZOX A;  1H32 A;  3PH2 B;  5CIC B;  1AOQ A;  4EIE A;  3TGU D;  4GYD A;  1NIR A;  1QYZ A;  1SQV D;  3A9F A;  4WQA A;  2IBZ D;  4MU8 A;  2VHD A;  2YQB A;  1LC1 A;  5DJQ C;  1F1C A;  1CSX A;  1N50 A;  2JTI B;  3L73 D;  1W5C T;  4DY9 A;  4LJI A;  4GED B;  155C A;  2JQR A;  3ORV A;  1CC5 A;  1OAE A;  3SXT A;  1ETP A;  1M6Z A;  2LIT A;  1FOC A;  1DW3 A;  2BGV X;  3DMI A;  1SQP D;  3WU2 V;  2N18 B;  1S6V B;  1DW1 A;  3O5C A;  2I8F A;  4NFG B;  3NWV A;  1CO6 A;  3HQ9 A;  4P4Q B;  1HH7 A;  1DT1 A;  1YIC A;  1CRI A;  1R0Q A;  1KIB A;  1GU2 A;  3L75 D;  2YCC A;  1HCM A;  1E8E A;  1N90 A;  3SWS A;  1C6O A;  3ZOO A;  3PXS A;  1COT A;  2BPB B;  3ZCF A;  3PXW A;  1B7V A;  1H33 B;  2CE0 A;  4L1Q A;  3WFB C;  4FB1 A;  1SQX D;  4XYD B;  1QKS A;  1C6S A;  1L0L D;  1K3H A;  1DW0 A;  4AX3 A;  1N9C A;  1CXC A;  2OZ1 B;  1KYO D;  5GTI V;  2ZBO A;  2CXB A;  2L4D A;  1NTM D;  3CX5 W;  1OCD A;  5CIE B;  3NBS A;  1PP9 D;  5AUR A;  4AAN A;  1HRC A;  1QL3 A;  1H31 B;  3OCD B;  1RZ5 A;  1CTY A;  1CYJ A;  5KLI B;  2D0W A;  3WUI A;  2C1D B;  5TIS V;  3RMZ A;  2GB8 B;  1W2L A;  1CRG A;  1H9Y A;  4UB6 V;  1CCH A;  2AXT V;  1CIE A;  1I54 A;  1DW2 A;  1FI3 A;  3ZOY A;  2PAC A;  1IRW A;  2BCN B;  5EXQ A;  2QJP B;  4IL6 V;  2AI5 A;  1FCD C;  351C A;  4D6T D;  1GIW A;  2XTS B;  2FRC A;  3RN1 A;  2N9J A;  2GC4 D;  1CIH A;  1L9B C;  3OA8 B;  1CRJ A;  2BH5 X;  3A0B V;  3A0H V;  2ZON G;  3HQ8 A;  4Y5R A;  3NBT A;  1H33 A;  1KV9 A;  4FA4 A;  1RAP A;  4WQE A;  2HV4 A;  1YCC A;  2BLF B;  3MK7 C;  2EXV A;  2V07 A;  1U74 B;  2BH4 X;  5C0Z A;  5B5E V;  2OZ1 A;  3ZBM A;  1P84 D;  2AIU A;  2FYU D;  5CIH B;  1IO3 A;  1CXA A;  1FI7 A;  1KX2 A;  1GQ1 A;  4XXL A;  5H2F V;  2YK3 A;  2N3Y A;  1H31 A;  1DIQ C;  3OCD A;  2D0S A;  2B12 B;  2ZOO A;  4AAL A;  1ZRT D;  2C1D A;  2DVH A;  1CSV A;  3H1L D;  1CHI A;  4PJ0 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...