4UB6V

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
137
structure length
137
Chain Sequence
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport, photosynthesis
total genus 48
structure length 137
sequence length 137
chains with identical sequence v
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF14495 Cytochrom_C550 Cytochrome c-550 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4ub6V00
1N15A 1YCCA 1FI7A 1QKSA 3NBSA 4EICA 1DIIC 1DIQC 3JBTB 1ZZHA 2YK3A 1VYDA 3H1ID 1CC5A 2B4ZA 5E79V 3SLEA 1OCDA 1NMIA 4FA9A 1H32A 2D0WA 5B5EV 5CICB 3L71D 1I6DA 3CP5A 5IY51 1QL3A 1BE3D 4PW9B 4AALA 1DW1A 3A0BV 5KKZB 5B66V 3ZIYA 1KX2A 3OA8A 1YFCA 5C0ZA 2GIWA 2HV4A 2BLFB 3OCDA 4FB1A 3O1YA 2V08A 1E8EA 1LC1A 1W5CT 1CIHA 1E29A 2PACA 1IRVA 1CHHA 2ZXYA 1HJ3A 2YIUB 5C9MA 1F1FA 1FCDC 4EIDA 1CRCA 1LFMA 2FYNB 4AAOA 5CIBB 3VYMA 2PCCB 1N90A 1GJQA 3DR0A 1RAQA 2CXBA 1K3HA 1H32B 1DW3A 3HQ9A 2ZBOA 1OAEA 1QN2A 1A2SA 1PP9D 3WUIA 2YQBA 1YIQA 4XXLA 3NWVA 5H2FV 2GC7D 2AI5A 1C6RA 1CIFA 1AKKA 1A8CA 1DW0A 1QL4A 1HJ5A 5GTHV 3A9FA 3OA8B 5KAIV 1YNRA 1FHBA 3OCDB 3WFBC 1AYGA 1C2NA 3HQ6A 3BCCD 4WQEA 2C1DB 1BGYD 1GDVA 1N50A 3HQ8A 1A56A 1ZRTD 1CSXA 1L9BC 1HZVA 1QYZA 4K3IA 1KX7A 1NMLA 3PXWA 3PH2B 3RN1A 4KMGA 4EIFA 1YEAA 5DJQB 4JCGA 1FJ0A 1H33A 5CIFB 1CTZA 1CRGA 5KAFV 1HROA 3KZIV 1C52A 5GTIV 4PWAA 4H0KA 3SVWA 1C75A 4L3HA 3L70D 1CTJA 4L3GA 1C6OA 4UB6V 1E2RA 2XTSB 2MTAC 1CRJA 1SQQD 1CHJA 3VNWA 4PJ0V 2QJKB 1KB9D 1M70A 4AX3A 1LC2A 2BCNB 4N0KA 2BH5X 2N18B 2B11B 1IO3A 1H1OA 5CYTR 5DF5A 1RAPA 1CORA 4WQDA 5DJQC 2BH4X 5AURA 3CYTI 3L74D 1FI3A 2MHMA 1N9CA 1SQVD 1CNOA 1M6ZA 5CIGB 3ZBMA 3ZCFA 1YEBA 1I54A 1EZVD 1CTYA 3RN0A 4FA5A 2DVHA 1KYOW 5EXQA 4D6TD 1CHIA 4O1WA 4Y5RA 4GEDB 1H33B 2BGVX 4FA1A 1F1CA 2N18C 2GC4D 1NNOA 3DP5A 3HQ7A 1R0QA 1GU2A 1CCRA 4MU8A 3SWSA 2DGEA 2ZZS1 2N9IA 1K3GA 1FOCA 1CXCA 1CIEA 1CYJA 1CYCA 2C2CA 1DT1A 2C9XB 3MK7B 4Q5PA 4RSZA 2JQRA 3WFEC 3ZOYA 4LJIA 3WC8A 1KB0A 3SJLA 1L0LD 4GYDA 4WQAA 4NFGB 1AOFA 2C8SA 2N3BA 3WU2V 2D0SA 2IBZD 3O5CA 5CIDB 4WQ8A 1CXAA 3CXHD 2CA4B 1WEJF 3H1KD 5KLIB 3H1LD 3MK7C 1S5LV 3WFDC 3O0RC 2GB8B 4P4QB 1I6EA 4WQ7A 1DVHA 1GQ1A 1BCCD 1U74B 3CU4A 1COTA 1GKSA 2N3YA 1CYIA 1DVVA 1KYOD 1BL9A 4WQBA 2CA3B 3TYIA 1CSWA 4U3FD 1I8PA 1SQBD 2B12B 3A0HV 1RZ6A 1ETPA 3X39A 4DY9A 1RZ5A 2ZONG 1I55A 4H0JA 2FRCA 3RMZA 2B10B 1YTCA 1IRWA 3L4OA 1CCHA 1NTZD 1C6SA 1NTMD 1LS9A 3CXHW 2AIUA 1CRHA 1GIWA 3WFCC 1CSUA 1CRIA 1H31A 3SXTA 3ORVA 2FYUD 2YCCA 4PD4D 1YICA 1FI9A 4EIEA 3ZOXA 5DFSA 3L75D 1S6VB 1C2RA 2CE1A 1IQCA 5CIHB 3CWBD 1PPJD 3M97X 5KLVD 3L4MA 1EB7A 3O20A 2QJPB 1H9XA 1L0ND 2C1VA 451CA 1SQPD 1I5TA 1WVEC 1AOQA 4L1QA 4YE1A 351CA 4WQCA 1KV9A 4FA4A 2OZ1A 3TGUD 4QAOA 1HZUA 2C1DA 3CX5W 3VRDA 2CE0A 2ORLA 3L73D 2V07A 2A06D 2FWLA 3PXTA 1H31B 4XYDB 4AANA 2VHDA 1IZL0 2LITA 3L72D 1U75B 1NIRA 2EXVA 1NTKD 155CA 1CIGA 4WQ9A 1SQXD 2C1UA 1CRYA 1KIBA 1I8OA 2N9JA 4FAVA 1HH7A 1J3SA 4O1QA 5TISV 1CEDA 1MZ4A 1P84D 3PXSA 1CSVA 2L4DA 2PCBB 2ZOOA 1H9YA 2OZ1B 4J20A 2B0ZB 3DMIA 3ZOWA 4AAMA 3RLMA 1HJ4A 1HRCA 2BPBB 1MG2D 5CIEB 2QJYB 1LMSA 2I8FA 3C2CA 1HCMA 3ZOOA 5B6QA 4V2KA 1W2LA 1L9JC 1CO6A 4FANA 1M60A 2AXTV 3NBTA 1B7VA 1NU1D 2LIRA 1C7MA 4UB8V 1JDLA 3H1HD 4IL6V 3H1JD 1MG3D 2BCCD 2JTIB 1DW2A 3CX5D
chains in the Genus database with same CATH superfamily
1N15A 1YCCA 1FI7A 1QKSA 3NBSA 4EICA 1DIIC 1DIQC 3JBTB 1ZZHA 2YK3A 1VYDA 3H1ID 1CC5A 2B4ZA 5E79V 3SLEA 1OCDA 1NMIA 4FA9A 1H32A 2D0WA 5B5EV 5CICB 3L71D 1I6DA 3CP5A 5IY51 1QL3A 1BE3D 4PW9B 4AALA 1DW1A 3A0BV 5KKZB 5B66V 3ZIYA 1KX2A 3OA8A 1YFCA 5C0ZA 2GIWA 2HV4A 2BLFB 3OCDA 4FB1A 3O1YA 2V08A 1E8EA 1LC1A 1W5CT 1CIHA 1E29A 2PACA 1IRVA 1CHHA 2ZXYA 1HJ3A 2YIUB 5C9MA 1F1FA 1FCDC 4EIDA 1CRCA 1LFMA 2FYNB 4AAOA 5CIBB 3VYMA 2PCCB 1N90A 1GJQA 3DR0A 1RAQA 2CXBA 1K3HA 1H32B 1DW3A 3HQ9A 2ZBOA 1OAEA 1QN2A 1A2SA 1PP9D 3WUIA 2YQBA 1YIQA 4XXLA 3NWVA 5H2FV 2GC7D 2AI5A 1C6RA 1CIFA 1AKKA 1A8CA 1DW0A 1QL4A 1HJ5A 5GTHV 3A9FA 3OA8B 5KAIV 1YNRA 1FHBA 3OCDB 3WFBC 1AYGA 1C2NA 3HQ6A 3BCCD 4WQEA 2C1DB 1BGYD 1GDVA 1N50A 3HQ8A 1A56A 1ZRTD 1CSXA 1L9BC 1HZVA 1QYZA 4K3IA 1KX7A 1NMLA 3PXWA 3PH2B 3RN1A 4KMGA 4EIFA 1YEAA 5DJQB 4JCGA 1FJ0A 1H33A 5CIFB 1CTZA 1CRGA 5KAFV 1HROA 3KZIV 1C52A 5GTIV 4PWAA 4H0KA 3SVWA 1C75A 4L3HA 3L70D 1CTJA 4L3GA 1C6OA 4UB6V 1E2RA 2XTSB 2MTAC 1CRJA 1SQQD 1CHJA 3VNWA 4PJ0V 2QJKB 1KB9D 1M70A 4AX3A 1LC2A 2BCNB 4N0KA 2BH5X 2N18B 2B11B 1IO3A 1H1OA 5CYTR 5DF5A 1RAPA 1CORA 4WQDA 5DJQC 2BH4X 5AURA 3CYTI 3L74D 1FI3A 2MHMA 1N9CA 1SQVD 1CNOA 1M6ZA 5CIGB 3ZBMA 3ZCFA 1YEBA 1I54A 1EZVD 1CTYA 3RN0A 4FA5A 2DVHA 1KYOW 5EXQA 4D6TD 1CHIA 4O1WA 4Y5RA 4GEDB 1H33B 3D0WA 2BGVX 4FA1A 1F1CA 2N18C 2GC4D 1NNOA 3DP5A 3HQ7A 1R0QA 1GU2A 1CCRA 4MU8A 3SWSA 2DGEA 2ZZS1 2N9IA 1K3GA 1FOCA 1CXCA 1CIEA 1CYJA 1CYCA 2C2CA 1DT1A 2C9XB 3MK7B 4Q5PA 4RSZA 2JQRA 3WFEC 3ZOYA 4LJIA 3WC8A 1KB0A 3SJLA 1L0LD 4GYDA 4WQAA 4NFGB 1AOFA 2C8SA 2N3BA 3WU2V 2D0SA 2IBZD 3O5CA 5CIDB 4WQ8A 1CXAA 3CXHD 2CA4B 1WEJF 3H1KD 5KLIB 3H1LD 3MK7C 1S5LV 3WFDC 3O0RC 2GB8B 4P4QB 1I6EA 4WQ7A 1DVHA 1GQ1A 1BCCD 1U74B 3CU4A 1COTA 1GKSA 2N3YA 1CYIA 1DVVA 1KYOD 1BL9A 4WQBA 2CA3B 3TYIA 1CSWA 4U3FD 1I8PA 1SQBD 2B12B 3A0HV 1RZ6A 1ETPA 3X39A 4DY9A 1RZ5A 2ZONG 1I55A 4H0JA 2FRCA 3RMZA 2B10B 1YTCA 1IRWA 3L4OA 1CCHA 1NTZD 1C6SA 1NTMD 1LS9A 3CXHW 2AIUA 1CRHA 1GIWA 3WFCC 1CSUA 1CRIA 1H31A 3SXTA 3ORVA 2FYUD 2YCCA 4PD4D 1YICA 1FI9A 4EIEA 3ZOXA 5DFSA 3L75D 1S6VB 1C2RA 2CE1A 1IQCA 5CIHB 3CWBD 1PPJD 3M97X 5KLVD 3L4MA 1EB7A 3O20A 2QJPB 1H9XA 1L0ND 2C1VA 451CA 1SQPD 1I5TA 1WVEC 1AOQA 4L1QA 4YE1A 351CA 4WQCA 1KV9A 4FA4A 2OZ1A 3TGUD 4QAOA 1HZUA 2C1DA 3CX5W 3VRDA 2CE0A 2ORLA 3L73D 2V07A 2A06D 2FWLA 3PXTA 1H31B 4XYDB 4AANA 2VHDA 1IZL0 2LITA 3L72D 1U75B 1NIRA 2EXVA 1NTKD 155CA 1CIGA 4WQ9A 1SQXD 2C1UA 1CRYA 1KIBA 1I8OA 2N9JA 4FAVA 1HH7A 1J3SA 4O1QA 5TISV 1CEDA 1MZ4A 1P84D 3PXSA 1CSVA 2L4DA 2PCBB 2ZOOA 1H9YA 2OZ1B 4J20A 2B0ZB 3DMIA 3ZOWA 4AAMA 3RLMA 1HJ4A 1HRCA 2BPBB 1MG2D 5CIEB 2QJYB 1LMSA 2I8FA 3C2CA 1HCMA 3ZOOA 5B6QA 4V2KA 1W2LA 1L9JC 1CO6A 4FANA 1M60A 2AXTV 3NBTA 1B7VA 1NU1D 2LIRA 1C7MA 4UB8V 1JDLA 3H1HD 4IL6V 3H1JD 1MG3D 2BCCD 2JTIB 1DW2A 3CX5D
chains in the Genus database with same CATH topology
1N15A 1YCCA 1FI7A 1QKSA 3NBSA 4EICA 1DIIC 1DIQC 3JBTB 1ZZHA 2YK3A 1VYDA 3H1ID 1CC5A 2B4ZA 5E79V 3SLEA 1OCDA 1NMIA 4FA9A 1H32A 2D0WA 5B5EV 5CICB 3L71D 1I6DA 3CP5A 5IY51 1QL3A 1BE3D 4PW9B 4AALA 1DW1A 3A0BV 5KKZB 5B66V 3ZIYA 1KX2A 3OA8A 1YFCA 5C0ZA 2GIWA 2HV4A 2BLFB 3OCDA 4FB1A 3O1YA 2V08A 1E8EA 1LC1A 1W5CT 1CIHA 1E29A 2PACA 1IRVA 1CHHA 2ZXYA 1HJ3A 2YIUB 5C9MA 1F1FA 1FCDC 4EIDA 1CRCA 1LFMA 2FYNB 4AAOA 5CIBB 3VYMA 2PCCB 1N90A 1GJQA 3DR0A 1RAQA 2CXBA 1K3HA 1H32B 1DW3A 3HQ9A 2ZBOA 1OAEA 1QN2A 1A2SA 1PP9D 3WUIA 2YQBA 1YIQA 4XXLA 3NWVA 5H2FV 2GC7D 2AI5A 1C6RA 1CIFA 1AKKA 1A8CA 1DW0A 1QL4A 1HJ5A 5GTHV 3A9FA 3OA8B 5KAIV 1YNRA 1FHBA 3OCDB 3WFBC 1AYGA 1C2NA 3HQ6A 3BCCD 4WQEA 2C1DB 1BGYD 1GDVA 1N50A 3HQ8A 1A56A 1ZRTD 1CSXA 1L9BC 1HZVA 1QYZA 4K3IA 1KX7A 1NMLA 3PXWA 3PH2B 3RN1A 4KMGA 4EIFA 1YEAA 5DJQB 4JCGA 1FJ0A 1H33A 5CIFB 1CTZA 1CRGA 5KAFV 1HROA 3KZIV 1C52A 5GTIV 4PWAA 4H0KA 3SVWA 1C75A 4L3HA 3L70D 1CTJA 4L3GA 1C6OA 4UB6V 1E2RA 2XTSB 2MTAC 1CRJA 1SQQD 1CHJA 3VNWA 4PJ0V 2QJKB 1KB9D 1M70A 4AX3A 1LC2A 2BCNB 4N0KA 2BH5X 2N18B 2B11B 1IO3A 1H1OA 5CYTR 5DF5A 1RAPA 1CORA 4WQDA 5DJQC 2BH4X 5AURA 3CYTI 3L74D 1FI3A 2MHMA 1N9CA 1SQVD 1CNOA 1M6ZA 5CIGB 3ZBMA 3ZCFA 1YEBA 1I54A 1EZVD 1CTYA 3RN0A 4FA5A 2DVHA 1KYOW 5EXQA 4D6TD 1CHIA 4O1WA 4Y5RA 4GEDB 1H33B 2BGVX 4FA1A 1F1CA 2N18C 2GC4D 1NNOA 3DP5A 3HQ7A 1R0QA 1GU2A 1CCRA 4MU8A 3SWSA 2DGEA 2ZZS1 2N9IA 1K3GA 1FOCA 1CXCA 1CIEA 1CYJA 1CYCA 2C2CA 1DT1A 2C9XB 3MK7B 4Q5PA 4RSZA 2JQRA 3WFEC 3ZOYA 4LJIA 3WC8A 1KB0A 3SJLA 1L0LD 4GYDA 4WQAA 4NFGB 1AOFA 2C8SA 2N3BA 3WU2V 2D0SA 2IBZD 3O5CA 5CIDB 4WQ8A 1CXAA 3CXHD 2CA4B 1WEJF 3H1KD 5KLIB 3H1LD 3MK7C 1S5LV 3WFDC 3O0RC 2GB8B 4P4QB 1I6EA 4WQ7A 1DVHA 1GQ1A 1BCCD 1U74B 3CU4A 1COTA 1GKSA 2N3YA 1CYIA 1DVVA 1KYOD 1BL9A 4WQBA 2CA3B 3TYIA 1CSWA 4U3FD 1I8PA 1SQBD 2B12B 3A0HV 1RZ6A 1ETPA 3X39A 4DY9A 1RZ5A 2ZONG 1I55A 4H0JA 2FRCA 3RMZA 2B10B 1YTCA 1IRWA 3L4OA 1CCHA 1NTZD 1C6SA 1NTMD 1LS9A 3CXHW 2AIUA 1CRHA 1GIWA 3WFCC 1CSUA 1CRIA 1H31A 3SXTA 3ORVA 2FYUD 2YCCA 4PD4D 1YICA 1FI9A 4EIEA 3ZOXA 5DFSA 3L75D 1S6VB 1C2RA 2CE1A 1IQCA 5CIHB 3CWBD 1PPJD 3M97X 5KLVD 3L4MA 1EB7A 3O20A 2QJPB 1H9XA 1L0ND 2C1VA 451CA 1SQPD 1I5TA 1WVEC 1AOQA 4L1QA 4YE1A 351CA 4WQCA 1KV9A 4FA4A 2OZ1A 3TGUD 4QAOA 1HZUA 2C1DA 3CX5W 3VRDA 2CE0A 2ORLA 3L73D 2V07A 2A06D 2FWLA 3PXTA 1H31B 4XYDB 4AANA 2VHDA 1IZL0 2LITA 3L72D 1U75B 1NIRA 2EXVA 1NTKD 155CA 1CIGA 4WQ9A 1SQXD 2C1UA 1CRYA 1KIBA 1I8OA 2N9JA 4FAVA 1HH7A 1J3SA 4O1QA 5TISV 1CEDA 1MZ4A 1P84D 3PXSA 1CSVA 2L4DA 2PCBB 2ZOOA 1H9YA 2OZ1B 4J20A 2B0ZB 3DMIA 3ZOWA 4AAMA 3RLMA 1HJ4A 1HRCA 2BPBB 1MG2D 5CIEB 2QJYB 1LMSA 2I8FA 3C2CA 1HCMA 3ZOOA 5B6QA 4V2KA 1W2LA 1L9JC 1CO6A 4FANA 1M60A 2AXTV 3NBTA 1B7VA 1NU1D 2LIRA 1C7MA 4UB8V 1JDLA 3H1HD 4IL6V 3H1JD 1MG3D 2BCCD 2JTIB 1DW2A 3CX5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N15 A;  1YCC A;  1FI7 A;  1QKS A;  3NBS A;  4EIC A;  1DII C;  1DIQ C;  3JBT B;  1ZZH A;  2YK3 A;  1VYD A;  3H1I D;  1CC5 A;  2B4Z A;  5E79 V;  3SLE A;  1OCD A;  1NMI A;  4FA9 A;  1H32 A;  2D0W A;  5B5E V;  5CIC B;  3L71 D;  1I6D A;  3CP5 A;  5IY5 1;  1QL3 A;  1BE3 D;  4PW9 B;  4AAL A;  1DW1 A;  3A0B V;  5KKZ B;  5B66 V;  3ZIY A;  1KX2 A;  3OA8 A;  1YFC A;  5C0Z A;  2GIW A;  2HV4 A;  2BLF B;  3OCD A;  4FB1 A;  3O1Y A;  2V08 A;  1E8E A;  1LC1 A;  1W5C T;  1CIH A;  1E29 A;  2PAC A;  1IRV A;  1CHH A;  2ZXY A;  1HJ3 A;  2YIU B;  5C9M A;  1F1F A;  1FCD C;  4EID A;  1CRC A;  1LFM A;  2FYN B;  4AAO A;  5CIB B;  3VYM A;  2PCC B;  1N90 A;  1GJQ A;  3DR0 A;  1RAQ A;  2CXB A;  1K3H A;  1H32 B;  1DW3 A;  3HQ9 A;  2ZBO A;  1OAE A;  1QN2 A;  1A2S A;  1PP9 D;  3WUI A;  2YQB A;  1YIQ A;  4XXL A;  3NWV A;  5H2F V;  2GC7 D;  2AI5 A;  1C6R A;  1CIF A;  1AKK A;  1A8C A;  1DW0 A;  1QL4 A;  1HJ5 A;  5GTH V;  3A9F A;  3OA8 B;  5KAI V;  1YNR A;  1FHB A;  3OCD B;  3WFB C;  1AYG A;  1C2N A;  3HQ6 A;  3BCC D;  4WQE A;  2C1D B;  1BGY D;  1GDV A;  1N50 A;  3HQ8 A;  1A56 A;  1ZRT D;  1CSX A;  1L9B C;  1HZV A;  1QYZ A;  4K3I A;  1KX7 A;  1NML A;  3PXW A;  3PH2 B;  3RN1 A;  4KMG A;  4EIF A;  1YEA A;  5DJQ B;  4JCG A;  1FJ0 A;  1H33 A;  5CIF B;  1CTZ A;  1CRG A;  5KAF V;  1HRO A;  3KZI V;  1C52 A;  5GTI V;  4PWA A;  4H0K A;  3SVW A;  1C75 A;  4L3H A;  3L70 D;  1CTJ A;  4L3G A;  1C6O A;  4UB6 V;  1E2R A;  2XTS B;  2MTA C;  1CRJ A;  1SQQ D;  1CHJ A;  3VNW A;  4PJ0 V;  2QJK B;  1KB9 D;  1M70 A;  4AX3 A;  1LC2 A;  2BCN B;  4N0K A;  2BH5 X;  2N18 B;  2B11 B;  1IO3 A;  1H1O A;  5CYT R;  5DF5 A;  1RAP A;  1COR A;  4WQD A;  5DJQ C;  2BH4 X;  5AUR A;  3CYT I;  3L74 D;  1FI3 A;  2MHM A;  1N9C A;  1SQV D;  1CNO A;  1M6Z A;  5CIG B;  3ZBM A;  3ZCF A;  1YEB A;  1I54 A;  1EZV D;  1CTY A;  3RN0 A;  4FA5 A;  2DVH A;  1KYO W;  5EXQ A;  4D6T D;  1CHI A;  4O1W A;  4Y5R A;  4GED B;  1H33 B;  2BGV X;  4FA1 A;  1F1C A;  2N18 C;  2GC4 D;  1NNO A;  3DP5 A;  3HQ7 A;  1R0Q A;  1GU2 A;  1CCR A;  4MU8 A;  3SWS A;  2DGE A;  2ZZS 1;  2N9I A;  1K3G A;  1FOC A;  1CXC A;  1CIE A;  1CYJ A;  1CYC A;  2C2C A;  1DT1 A;  2C9X B;  3MK7 B;  4Q5P A;  4RSZ A;  2JQR A;  3WFE C;  3ZOY A;  4LJI A;  3WC8 A;  1KB0 A;  3SJL A;  1L0L D;  4GYD A;  4WQA A;  4NFG B;  1AOF A;  2C8S A;  2N3B A;  3WU2 V;  2D0S A;  2IBZ D;  3O5C A;  5CID B;  4WQ8 A;  1CXA A;  3CXH D;  2CA4 B;  1WEJ F;  3H1K D;  5KLI B;  3H1L D;  3MK7 C;  1S5L V;  3WFD C;  3O0R C;  2GB8 B;  4P4Q B;  1I6E A;  4WQ7 A;  1DVH A;  1GQ1 A;  1BCC D;  1U74 B;  3CU4 A;  1COT A;  1GKS A;  2N3Y A;  1CYI A;  1DVV A;  1KYO D;  1BL9 A;  4WQB A;  2CA3 B;  3TYI A;  1CSW A;  4U3F D;  1I8P A;  1SQB D;  2B12 B;  3A0H V;  1RZ6 A;  1ETP A;  3X39 A;  4DY9 A;  1RZ5 A;  2ZON G;  1I55 A;  4H0J A;  2FRC A;  3RMZ A;  2B10 B;  1YTC A;  1IRW A;  3L4O A;  1CCH A;  1NTZ D;  1C6S A;  1NTM D;  1LS9 A;  3CXH W;  2AIU A;  1CRH A;  1GIW A;  3WFC C;  1CSU A;  1CRI A;  1H31 A;  3SXT A;  3ORV A;  2FYU D;  2YCC A;  4PD4 D;  1YIC A;  1FI9 A;  4EIE A;  3ZOX A;  5DFS A;  3L75 D;  1S6V B;  1C2R A;  2CE1 A;  1IQC A;  5CIH B;  3CWB D;  1PPJ D;  3M97 X;  5KLV D;  3L4M A;  1EB7 A;  3O20 A;  2QJP B;  1H9X A;  1L0N D;  2C1V A;  451C A;  1SQP D;  1I5T A;  1WVE C;  1AOQ A;  4L1Q A;  4YE1 A;  351C A;  4WQC A;  1KV9 A;  4FA4 A;  2OZ1 A;  3TGU D;  4QAO A;  1HZU A;  2C1D A;  3CX5 W;  3VRD A;  2CE0 A;  2ORL A;  3L73 D;  2V07 A;  2A06 D;  2FWL A;  3PXT A;  1H31 B;  4XYD B;  4AAN A;  2VHD A;  1IZL 0;  2LIT A;  3L72 D;  1U75 B;  1NIR A;  2EXV A;  1NTK D;  155C A;  1CIG A;  4WQ9 A;  1SQX D;  2C1U A;  1CRY A;  1KIB A;  1I8O A;  2N9J A;  4FAV A;  1HH7 A;  1J3S A;  4O1Q A;  5TIS V;  1CED A;  1MZ4 A;  1P84 D;  3PXS A;  1CSV A;  2L4D A;  2PCB B;  2ZOO A;  1H9Y A;  2OZ1 B;  4J20 A;  2B0Z B;  3DMI A;  3ZOW A;  4AAM A;  3RLM A;  1HJ4 A;  1HRC A;  2BPB B;  1MG2 D;  5CIE B;  2QJY B;  1LMS A;  2I8F A;  3C2C A;  1HCM A;  3ZOO A;  5B6Q A;  4V2K A;  1W2L A;  1L9J C;  1CO6 A;  4FAN A;  1M60 A;  2AXT V;  3NBT A;  1B7V A;  1NU1 D;  2LIR A;  1C7M A;  4UB8 V;  1JDL A;  3H1H D;  4IL6 V;  3H1J D;  1MG3 D;  2BCC D;  2JTI B;  1DW2 A;  3CX5 D; 
#chains in the Genus database with same CATH topology
 1N15 A;  1YCC A;  1FI7 A;  1QKS A;  3NBS A;  4EIC A;  1DII C;  1DIQ C;  3JBT B;  1ZZH A;  2YK3 A;  1VYD A;  3H1I D;  1CC5 A;  2B4Z A;  5E79 V;  3SLE A;  1OCD A;  1NMI A;  4FA9 A;  1H32 A;  2D0W A;  5B5E V;  5CIC B;  3L71 D;  1I6D A;  3CP5 A;  5IY5 1;  1QL3 A;  1BE3 D;  4PW9 B;  4AAL A;  1DW1 A;  3A0B V;  5KKZ B;  5B66 V;  3ZIY A;  1KX2 A;  3OA8 A;  1YFC A;  5C0Z A;  2GIW A;  2HV4 A;  2BLF B;  3OCD A;  4FB1 A;  3O1Y A;  2V08 A;  1E8E A;  1LC1 A;  1W5C T;  1CIH A;  1E29 A;  2PAC A;  1IRV A;  1CHH A;  2ZXY A;  1HJ3 A;  2YIU B;  5C9M A;  1F1F A;  1FCD C;  4EID A;  1CRC A;  1LFM A;  2FYN B;  4AAO A;  5CIB B;  3VYM A;  2PCC B;  1N90 A;  1GJQ A;  3DR0 A;  1RAQ A;  2CXB A;  1K3H A;  1H32 B;  1DW3 A;  3HQ9 A;  2ZBO A;  1OAE A;  1QN2 A;  1A2S A;  1PP9 D;  3WUI A;  2YQB A;  1YIQ A;  4XXL A;  3NWV A;  5H2F V;  2GC7 D;  2AI5 A;  1C6R A;  1CIF A;  1AKK A;  1A8C A;  1DW0 A;  1QL4 A;  1HJ5 A;  5GTH V;  3A9F A;  3OA8 B;  5KAI V;  1YNR A;  1FHB A;  3OCD B;  3WFB C;  1AYG A;  1C2N A;  3HQ6 A;  3BCC D;  4WQE A;  2C1D B;  1BGY D;  1GDV A;  1N50 A;  3HQ8 A;  1A56 A;  1ZRT D;  1CSX A;  1L9B C;  1HZV A;  1QYZ A;  4K3I A;  1KX7 A;  1NML A;  3PXW A;  3PH2 B;  3RN1 A;  4KMG A;  4EIF A;  1YEA A;  5DJQ B;  4JCG A;  1FJ0 A;  1H33 A;  5CIF B;  1CTZ A;  1CRG A;  5KAF V;  1HRO A;  3KZI V;  1C52 A;  5GTI V;  4PWA A;  4H0K A;  3SVW A;  1C75 A;  4L3H A;  3L70 D;  1CTJ A;  4L3G A;  1C6O A;  4UB6 V;  1E2R A;  2XTS B;  2MTA C;  1CRJ A;  1SQQ D;  1CHJ A;  3VNW A;  4PJ0 V;  2QJK B;  1KB9 D;  1M70 A;  4AX3 A;  1LC2 A;  2BCN B;  4N0K A;  2BH5 X;  2N18 B;  2B11 B;  1IO3 A;  1H1O A;  5CYT R;  5DF5 A;  1RAP A;  1COR A;  4WQD A;  5DJQ C;  2BH4 X;  5AUR A;  3CYT I;  3L74 D;  1FI3 A;  2MHM A;  1N9C A;  1SQV D;  1CNO A;  1M6Z A;  5CIG B;  3ZBM A;  3ZCF A;  1YEB A;  1I54 A;  1EZV D;  1CTY A;  3RN0 A;  4FA5 A;  2DVH A;  1KYO W;  5EXQ A;  4D6T D;  1CHI A;  4O1W A;  4Y5R A;  4GED B;  1H33 B;  3D0W A;  2BGV X;  4FA1 A;  1F1C A;  2N18 C;  2GC4 D;  1NNO A;  3DP5 A;  3HQ7 A;  1R0Q A;  1GU2 A;  1CCR A;  4MU8 A;  3SWS A;  2DGE A;  2ZZS 1;  2N9I A;  1K3G A;  1FOC A;  1CXC A;  1CIE A;  1CYJ A;  1CYC A;  2C2C A;  1DT1 A;  2C9X B;  3MK7 B;  4Q5P A;  4RSZ A;  2JQR A;  3WFE C;  3ZOY A;  4LJI A;  3WC8 A;  1KB0 A;  3SJL A;  1L0L D;  4GYD A;  4WQA A;  4NFG B;  1AOF A;  2C8S A;  2N3B A;  3WU2 V;  2D0S A;  2IBZ D;  3O5C A;  5CID B;  4WQ8 A;  1CXA A;  3CXH D;  2CA4 B;  1WEJ F;  3H1K D;  5KLI B;  3H1L D;  3MK7 C;  1S5L V;  3WFD C;  3O0R C;  2GB8 B;  4P4Q B;  1I6E A;  4WQ7 A;  1DVH A;  1GQ1 A;  1BCC D;  1U74 B;  3CU4 A;  1COT A;  1GKS A;  2N3Y A;  1CYI A;  1DVV A;  1KYO D;  1BL9 A;  4WQB A;  2CA3 B;  3TYI A;  1CSW A;  4U3F D;  1I8P A;  1SQB D;  2B12 B;  3A0H V;  1RZ6 A;  1ETP A;  3X39 A;  4DY9 A;  1RZ5 A;  2ZON G;  1I55 A;  4H0J A;  2FRC A;  3RMZ A;  2B10 B;  1YTC A;  1IRW A;  3L4O A;  1CCH A;  1NTZ D;  1C6S A;  1NTM D;  1LS9 A;  3CXH W;  2AIU A;  1CRH A;  1GIW A;  3WFC C;  1CSU A;  1CRI A;  1H31 A;  3SXT A;  3ORV A;  2FYU D;  2YCC A;  4PD4 D;  1YIC A;  1FI9 A;  4EIE A;  3ZOX A;  5DFS A;  3L75 D;  1S6V B;  1C2R A;  2CE1 A;  1IQC A;  5CIH B;  3CWB D;  1PPJ D;  3M97 X;  5KLV D;  3L4M A;  1EB7 A;  3O20 A;  2QJP B;  1H9X A;  1L0N D;  2C1V A;  451C A;  1SQP D;  1I5T A;  1WVE C;  1AOQ A;  4L1Q A;  4YE1 A;  351C A;  4WQC A;  1KV9 A;  4FA4 A;  2OZ1 A;  3TGU D;  4QAO A;  1HZU A;  2C1D A;  3CX5 W;  3VRD A;  2CE0 A;  2ORL A;  3L73 D;  2V07 A;  2A06 D;  2FWL A;  3PXT A;  1H31 B;  4XYD B;  4AAN A;  2VHD A;  1IZL 0;  2LIT A;  3L72 D;  1U75 B;  1NIR A;  2EXV A;  1NTK D;  155C A;  1CIG A;  4WQ9 A;  1SQX D;  2C1U A;  1CRY A;  1KIB A;  1I8O A;  2N9J A;  4FAV A;  1HH7 A;  1J3S A;  4O1Q A;  5TIS V;  1CED A;  1MZ4 A;  1P84 D;  3PXS A;  1CSV A;  2L4D A;  2PCB B;  2ZOO A;  1H9Y A;  2OZ1 B;  4J20 A;  2B0Z B;  3DMI A;  3ZOW A;  4AAM A;  3RLM A;  1HJ4 A;  1HRC A;  2BPB B;  1MG2 D;  5CIE B;  2QJY B;  1LMS A;  2I8F A;  3C2C A;  1HCM A;  3ZOO A;  5B6Q A;  4V2K A;  1W2L A;  1L9J C;  1CO6 A;  4FAN A;  1M60 A;  2AXT V;  3NBT A;  1B7V A;  1NU1 D;  2LIR A;  1C7M A;  4UB8 V;  1JDL A;  3H1H D;  4IL6 V;  3H1J D;  1MG3 D;  2BCC D;  2JTI B;  1DW2 A;  3CX5 D; 
#chains in the Genus database with same CATH homology
 1N15 A;  1YCC A;  1FI7 A;  1QKS A;  3NBS A;  4EIC A;  1DII C;  1DIQ C;  3JBT B;  1ZZH A;  2YK3 A;  1VYD A;  3H1I D;  1CC5 A;  2B4Z A;  5E79 V;  3SLE A;  1OCD A;  1NMI A;  4FA9 A;  1H32 A;  2D0W A;  5B5E V;  5CIC B;  3L71 D;  1I6D A;  3CP5 A;  5IY5 1;  1QL3 A;  1BE3 D;  4PW9 B;  4AAL A;  1DW1 A;  3A0B V;  5KKZ B;  5B66 V;  3ZIY A;  1KX2 A;  3OA8 A;  1YFC A;  5C0Z A;  2GIW A;  2HV4 A;  2BLF B;  3OCD A;  4FB1 A;  3O1Y A;  2V08 A;  1E8E A;  1LC1 A;  1W5C T;  1CIH A;  1E29 A;  2PAC A;  1IRV A;  1CHH A;  2ZXY A;  1HJ3 A;  2YIU B;  5C9M A;  1F1F A;  1FCD C;  4EID A;  1CRC A;  1LFM A;  2FYN B;  4AAO A;  5CIB B;  3VYM A;  2PCC B;  1N90 A;  1GJQ A;  3DR0 A;  1RAQ A;  2CXB A;  1K3H A;  1H32 B;  1DW3 A;  3HQ9 A;  2ZBO A;  1OAE A;  1QN2 A;  1A2S A;  1PP9 D;  3WUI A;  2YQB A;  1YIQ A;  4XXL A;  3NWV A;  5H2F V;  2GC7 D;  2AI5 A;  1C6R A;  1CIF A;  1AKK A;  1A8C A;  1DW0 A;  1QL4 A;  1HJ5 A;  5GTH V;  3A9F A;  3OA8 B;  5KAI V;  1YNR A;  1FHB A;  3OCD B;  3WFB C;  1AYG A;  1C2N A;  3HQ6 A;  3BCC D;  4WQE A;  2C1D B;  1BGY D;  1GDV A;  1N50 A;  3HQ8 A;  1A56 A;  1ZRT D;  1CSX A;  1L9B C;  1HZV A;  1QYZ A;  4K3I A;  1KX7 A;  1NML A;  3PXW A;  3PH2 B;  3RN1 A;  4KMG A;  4EIF A;  1YEA A;  5DJQ B;  4JCG A;  1FJ0 A;  1H33 A;  5CIF B;  1CTZ A;  1CRG A;  5KAF V;  1HRO A;  3KZI V;  1C52 A;  5GTI V;  4PWA A;  4H0K A;  3SVW A;  1C75 A;  4L3H A;  3L70 D;  1CTJ A;  4L3G A;  1C6O A;  4UB6 V;  1E2R A;  2XTS B;  2MTA C;  1CRJ A;  1SQQ D;  1CHJ A;  3VNW A;  4PJ0 V;  2QJK B;  1KB9 D;  1M70 A;  4AX3 A;  1LC2 A;  2BCN B;  4N0K A;  2BH5 X;  2N18 B;  2B11 B;  1IO3 A;  1H1O A;  5CYT R;  5DF5 A;  1RAP A;  1COR A;  4WQD A;  5DJQ C;  2BH4 X;  5AUR A;  3CYT I;  3L74 D;  1FI3 A;  2MHM A;  1N9C A;  1SQV D;  1CNO A;  1M6Z A;  5CIG B;  3ZBM A;  3ZCF A;  1YEB A;  1I54 A;  1EZV D;  1CTY A;  3RN0 A;  4FA5 A;  2DVH A;  1KYO W;  5EXQ A;  4D6T D;  1CHI A;  4O1W A;  4Y5R A;  4GED B;  1H33 B;  2BGV X;  4FA1 A;  1F1C A;  2N18 C;  2GC4 D;  1NNO A;  3DP5 A;  3HQ7 A;  1R0Q A;  1GU2 A;  1CCR A;  4MU8 A;  3SWS A;  2DGE A;  2ZZS 1;  2N9I A;  1K3G A;  1FOC A;  1CXC A;  1CIE A;  1CYJ A;  1CYC A;  2C2C A;  1DT1 A;  2C9X B;  3MK7 B;  4Q5P A;  4RSZ A;  2JQR A;  3WFE C;  3ZOY A;  4LJI A;  3WC8 A;  1KB0 A;  3SJL A;  1L0L D;  4GYD A;  4WQA A;  4NFG B;  1AOF A;  2C8S A;  2N3B A;  3WU2 V;  2D0S A;  2IBZ D;  3O5C A;  5CID B;  4WQ8 A;  1CXA A;  3CXH D;  2CA4 B;  1WEJ F;  3H1K D;  5KLI B;  3H1L D;  3MK7 C;  1S5L V;  3WFD C;  3O0R C;  2GB8 B;  4P4Q B;  1I6E A;  4WQ7 A;  1DVH A;  1GQ1 A;  1BCC D;  1U74 B;  3CU4 A;  1COT A;  1GKS A;  2N3Y A;  1CYI A;  1DVV A;  1KYO D;  1BL9 A;  4WQB A;  2CA3 B;  3TYI A;  1CSW A;  4U3F D;  1I8P A;  1SQB D;  2B12 B;  3A0H V;  1RZ6 A;  1ETP A;  3X39 A;  4DY9 A;  1RZ5 A;  2ZON G;  1I55 A;  4H0J A;  2FRC A;  3RMZ A;  2B10 B;  1YTC A;  1IRW A;  3L4O A;  1CCH A;  1NTZ D;  1C6S A;  1NTM D;  1LS9 A;  3CXH W;  2AIU A;  1CRH A;  1GIW A;  3WFC C;  1CSU A;  1CRI A;  1H31 A;  3SXT A;  3ORV A;  2FYU D;  2YCC A;  4PD4 D;  1YIC A;  1FI9 A;  4EIE A;  3ZOX A;  5DFS A;  3L75 D;  1S6V B;  1C2R A;  2CE1 A;  1IQC A;  5CIH B;  3CWB D;  1PPJ D;  3M97 X;  5KLV D;  3L4M A;  1EB7 A;  3O20 A;  2QJP B;  1H9X A;  1L0N D;  2C1V A;  451C A;  1SQP D;  1I5T A;  1WVE C;  1AOQ A;  4L1Q A;  4YE1 A;  351C A;  4WQC A;  1KV9 A;  4FA4 A;  2OZ1 A;  3TGU D;  4QAO A;  1HZU A;  2C1D A;  3CX5 W;  3VRD A;  2CE0 A;  2ORL A;  3L73 D;  2V07 A;  2A06 D;  2FWL A;  3PXT A;  1H31 B;  4XYD B;  4AAN A;  2VHD A;  1IZL 0;  2LIT A;  3L72 D;  1U75 B;  1NIR A;  2EXV A;  1NTK D;  155C A;  1CIG A;  4WQ9 A;  1SQX D;  2C1U A;  1CRY A;  1KIB A;  1I8O A;  2N9J A;  4FAV A;  1HH7 A;  1J3S A;  4O1Q A;  5TIS V;  1CED A;  1MZ4 A;  1P84 D;  3PXS A;  1CSV A;  2L4D A;  2PCB B;  2ZOO A;  1H9Y A;  2OZ1 B;  4J20 A;  2B0Z B;  3DMI A;  3ZOW A;  4AAM A;  3RLM A;  1HJ4 A;  1HRC A;  2BPB B;  1MG2 D;  5CIE B;  2QJY B;  1LMS A;  2I8F A;  3C2C A;  1HCM A;  3ZOO A;  5B6Q A;  4V2K A;  1W2L A;  1L9J C;  1CO6 A;  4FAN A;  1M60 A;  2AXT V;  3NBT A;  1B7V A;  1NU1 D;  2LIR A;  1C7M A;  4UB8 V;  1JDL A;  3H1H D;  4IL6 V;  3H1J D;  1MG3 D;  2BCC D;  2JTI B;  1DW2 A;  3CX5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...