4UB8V

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
137
structure length
137
Chain Sequence
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport, photosynthesis
total genus 48
structure length 137
sequence length 137
chains with identical sequence v
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF14495 Cytochrom_C550 Cytochrome c-550 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4ub8V00
1LC1A 2BLFB 1IQCA 1H9XA 4AANA 2YQBA 1C7MA 3OCDB 1NTMD 1DW1A 1RAPA 4WQ8A 4PW9B 1CO6A 1E2RA 3SWSA 2B12B 5B66V 1IRVA 1HCMA 4O1WA 2PCCB 2DGEA 3VNWA 1I8OA 1EZVD 1E8EA 1MZ4A 1J3SA 1U75B 1YTCA 5CIFB 3RMZA 1H32A 1YCCA 1L9BC 2IBZD 4H0JA 5H2FV 1SQXD 1IRWA 1BCCD 2PCBB 4YE1A 1QKSA 4WQBA 1H32B 1YEBA 3SLEA 3CXHD 1EB7A 1GDVA 1BE3D 3O5CA 4V2KA 3MK7B 1CIHA 1ZRTD 1C6RA 351CA 3O0RC 2OZ1A 1I8PA 5KAFV 4WQ7A 2FWLA 1CYIA 4FB1A 3ZCFA 1RZ5A 3H1ID 2D0SA 3DMIA 4AX3A 1H33B 3RLMA 1AOFA 3SXTA 3PXWA 3WFBC 2FYUD 3L4OA 4WQDA 3H1HD 1BGYD 5AURA 2FYNB 2V08A 2I8FA 3L71D 2ZOOA 4L3GA 3A0HV 3CX5D 2ORLA 1N9CA 4FA1A 2DVHA 3DR0A 1CIEA 1GQ1A 3WUIA 1AOQA 1W2LA 1CSUA 2N18C 1H1OA 1CSXA 2B10B 1CEDA 3JBTB 1C6SA 1KYOD 2N3YA 1CRJA 3BCCD 1QL4A 3CU4A 3TYIA 3WFCC 2CE0A 1BL9A 2BCCD 2FRCA 1HJ3A 451CA 2L4DA 2YIUB 1M6ZA 4L1QA 4LJIA 2ZXYA 5GTHV 1NNOA 3HQ7A 4UB8V 1C6OA 2AI5A 3PXSA 4D6TD 3ZBMA 2CE1A 3HQ9A 5CIDB 2GB8B 1YEAA 1ZZHA 1CC5A 2PACA 3CX5W 1I6DA 1KB0A 2D0WA 4WQAA 3ZOYA 4O1QA 1DW2A 1CSVA 1LC2A 5E79V 1NMIA 3C2CA 1N50A 1CRIA 4PD4D 1CHIA 3OA8A 1CIFA 1KYOW 4EIDA 4PWAA 2LITA 4FA5A 2JTIB 2JQRA 1MG2D 5CIEB 1CYCA 1QYZA 1A2SA 3OA8B 1YIQA 1FI7A 2QJYB 3HQ6A 1CCHA 1NTKD 1NMLA 1I54A 3ZOWA 3H1KD 1FI9A 1KX7A 1PP9D 1RZ6A 4Q5PA 1QL3A 3RN1A 1DVVA 1OCDA 1S6VB 3TGUD 1FHBA 4WQCA 3WC8A 3NBTA 2OZ1B 3ZOXA 2GC4D 4AAMA 5KKZB 1M70A 4AALA 1E29A 3CYTI 3A9FA 5KLVD 1IZL0 2HV4A 1L9JC 1HROA 4UB6V 1DVHA 1CRYA 4Y5RA 2GC7D 2CA3B 1WVEC 2VHDA 2N18B 1AYGA 1GKSA 3MK7C 1CIGA 1CNOA 3ORVA 1CXCA 1HZUA 3A0BV 4FANA 2CA4B 4QAOA 5DJQC 3L4MA 1U74B 2N9IA 1WEJF 3PXTA 3L74D 2BCNB 1VYDA 4XYDB 3WFEC 1H31A 4EICA 2B0ZB 4FA4A 2C2CA 1CXAA 1I6EA 1MG3D 2B4ZA 2ZBOA 1C2RA 1H31B 1F1FA 1LS9A 1HRCA 1F1CA 1HJ5A 4GEDB 2BPBB 4H0KA 1C75A 2N3BA 3DP5A 3RN0A 1CTJA 2MTAC 1CORA 4U3FD 1A56A 1DIQC 1KB9D 5CICB 2QJKB 3VRDA 2ZONG 1SQVD 1YFCA 1A8CA 1KV9A 2LIRA 2YCCA 1B7VA 4RSZA 1IO3A 3HQ8A 4N0KA 4MU8A 1QN2A 155CA 2C1DA 2EXVA 4J20A 1HZVA 1CRHA 1CCRA 5CYTR 3VYMA 4KMGA 5C0ZA 1CTYA 1DW3A 1FI3A 2C1DB 5CIHB 5KAIV 1H9YA 1CSWA 3L75D 1KX2A 1S5LV 4IL6V 1DIIC 1L0ND 1OAEA 4GYDA 4XXLA 1SQPD 3KZIV 4FAVA 5DF5A 3WFDC 1C2NA 4WQ9A 1FOCA 5B6QA 1HJ4A 2A06D 4FA9A 3H1LD 4JCGA 3NWVA 2MHMA 5KLIB 3CWBD 1GJQA 4EIFA 1HH7A 5CIGB 3L73D 3O20A 1R0QA 1GIWA 1COTA 1W5CT 4AAOA 2BH5X 2BGVX 1LMSA 1CTZA 1JDLA 3L70D 1FCDC 4PJ0V 1NIRA 1I55A 1H33A 3L72D 4EIEA 2YK3A 3WU2V 5DJQB 3SJLA 1C52A 1RAQA 5EXQA 3M97X 2C9XB 1CRGA 2GIWA 1SQQD 2V07A 5CIBB 1DW0A 1CHHA 1DT1A 4NFGB 1M60A 2N9JA 5B5EV 5C9MA 1N15A 1SQBD 2C1UA 3X39A 1P84D 2QJPB 1GU2A 2CXBA 1CRCA 2AIUA 4DY9A 3NBSA 4WQEA 1K3HA 3CXHW 4L3HA 1NU1D 1YICA 3H1JD 4P4QB 3CP5A 3ZOOA 3O1YA 2BH4X 1KIBA 1YNRA 2B11B 3PH2B 1ETPA 3ZIYA 2AXTV 1N90A 1L0LD 1PPJD 1FJ0A 2C8SA 2C1VA 5TISV 1CYJA 5IY51 1NTZD 5DFSA 1CHJA 1AKKA 3SVWA 4K3IA 1K3GA 1I5TA 1LFMA 3OCDA 2ZZS1 2XTSB 5GTIV
chains in the Genus database with same CATH superfamily
1LC1A 2BLFB 1IQCA 1H9XA 4AANA 2YQBA 1C7MA 3OCDB 1NTMD 1DW1A 1RAPA 4WQ8A 4PW9B 1CO6A 1E2RA 3SWSA 2B12B 5B66V 1IRVA 1HCMA 4O1WA 2PCCB 2DGEA 3VNWA 1I8OA 1EZVD 1E8EA 1MZ4A 1J3SA 1U75B 1YTCA 5CIFB 3RMZA 1H32A 1YCCA 1L9BC 2IBZD 4H0JA 5H2FV 1SQXD 1IRWA 1BCCD 2PCBB 4YE1A 1QKSA 4WQBA 1H32B 1YEBA 3SLEA 3CXHD 1EB7A 1GDVA 1BE3D 3O5CA 4V2KA 3MK7B 1CIHA 1ZRTD 1C6RA 351CA 3O0RC 2OZ1A 1I8PA 5KAFV 4WQ7A 2FWLA 1CYIA 4FB1A 3ZCFA 1RZ5A 3H1ID 2D0SA 3DMIA 4AX3A 1H33B 3RLMA 1AOFA 3SXTA 3PXWA 3WFBC 2FYUD 3L4OA 4WQDA 3H1HD 1BGYD 5AURA 2FYNB 2V08A 2I8FA 3L71D 2ZOOA 4L3GA 3A0HV 3CX5D 2ORLA 1N9CA 4FA1A 2DVHA 3DR0A 1CIEA 1GQ1A 3WUIA 1AOQA 1W2LA 1CSUA 2N18C 1H1OA 1CSXA 2B10B 1CEDA 3JBTB 1C6SA 1KYOD 2N3YA 1CRJA 3BCCD 1QL4A 3CU4A 3TYIA 3WFCC 2CE0A 1BL9A 2BCCD 2FRCA 1HJ3A 451CA 2L4DA 2YIUB 1M6ZA 4L1QA 4LJIA 2ZXYA 5GTHV 1NNOA 3HQ7A 4UB8V 1C6OA 2AI5A 3PXSA 4D6TD 3ZBMA 2CE1A 3HQ9A 5CIDB 2GB8B 1YEAA 1ZZHA 1CC5A 2PACA 3CX5W 1I6DA 1KB0A 2D0WA 4WQAA 3ZOYA 4O1QA 1DW2A 1CSVA 1LC2A 5E79V 1NMIA 3C2CA 1N50A 1CRIA 4PD4D 1CHIA 3OA8A 1CIFA 1KYOW 4EIDA 4PWAA 2LITA 4FA5A 2JTIB 2JQRA 1MG2D 5CIEB 1CYCA 1QYZA 1A2SA 3OA8B 1YIQA 1FI7A 2QJYB 3HQ6A 1CCHA 1NTKD 1NMLA 1I54A 3ZOWA 3H1KD 1FI9A 1KX7A 1PP9D 1RZ6A 4Q5PA 3D0WA 1QL3A 3RN1A 1DVVA 1OCDA 1S6VB 3TGUD 1FHBA 4WQCA 3WC8A 3NBTA 2OZ1B 3ZOXA 2GC4D 4AAMA 5KKZB 1M70A 4AALA 1E29A 3CYTI 3A9FA 5KLVD 1IZL0 2HV4A 1L9JC 1HROA 4UB6V 1DVHA 1CRYA 4Y5RA 2GC7D 2CA3B 1WVEC 2VHDA 2N18B 1AYGA 1GKSA 3MK7C 1CIGA 1CNOA 3ORVA 1CXCA 1HZUA 3A0BV 4FANA 2CA4B 4QAOA 5DJQC 3L4MA 1U74B 2N9IA 1WEJF 3PXTA 3L74D 2BCNB 1VYDA 4XYDB 3WFEC 1H31A 4EICA 2B0ZB 4FA4A 2C2CA 1CXAA 1I6EA 1MG3D 2B4ZA 2ZBOA 1C2RA 1H31B 1F1FA 1LS9A 1HRCA 1F1CA 1HJ5A 4GEDB 2BPBB 4H0KA 1C75A 2N3BA 3DP5A 3RN0A 1CTJA 2MTAC 1CORA 4U3FD 1A56A 1DIQC 1KB9D 5CICB 2QJKB 3VRDA 2ZONG 1SQVD 1YFCA 1A8CA 1KV9A 2LIRA 2YCCA 1B7VA 4RSZA 1IO3A 3HQ8A 4N0KA 4MU8A 1QN2A 155CA 2C1DA 2EXVA 4J20A 1HZVA 1CRHA 1CCRA 5CYTR 3VYMA 4KMGA 5C0ZA 1CTYA 1DW3A 1FI3A 2C1DB 5CIHB 5KAIV 1H9YA 1CSWA 3L75D 1KX2A 1S5LV 4IL6V 1DIIC 1L0ND 1OAEA 4GYDA 4XXLA 1SQPD 3KZIV 4FAVA 5DF5A 3WFDC 1C2NA 4WQ9A 1FOCA 5B6QA 1HJ4A 2A06D 4FA9A 3H1LD 4JCGA 3NWVA 2MHMA 5KLIB 3CWBD 1GJQA 4EIFA 1HH7A 5CIGB 3L73D 3O20A 1R0QA 1GIWA 1COTA 1W5CT 4AAOA 2BH5X 2BGVX 1LMSA 1CTZA 1JDLA 3L70D 1FCDC 4PJ0V 1NIRA 1I55A 1H33A 3L72D 4EIEA 2YK3A 3WU2V 5DJQB 3SJLA 1C52A 1RAQA 5EXQA 3M97X 2C9XB 1CRGA 2GIWA 1SQQD 2V07A 5CIBB 1DW0A 1CHHA 1DT1A 4NFGB 1M60A 2N9JA 5B5EV 5C9MA 1N15A 1SQBD 2C1UA 3X39A 1P84D 2QJPB 1GU2A 2CXBA 1CRCA 2AIUA 4DY9A 3NBSA 4WQEA 1K3HA 3CXHW 4L3HA 1NU1D 1YICA 3H1JD 4P4QB 3CP5A 3ZOOA 3O1YA 2BH4X 1KIBA 1YNRA 2B11B 3PH2B 1ETPA 3ZIYA 2AXTV 1N90A 1L0LD 1PPJD 1FJ0A 2C8SA 2C1VA 5TISV 1CYJA 5IY51 1NTZD 5DFSA 1CHJA 1AKKA 3SVWA 4K3IA 1K3GA 1I5TA 1LFMA 3OCDA 2ZZS1 2XTSB 5GTIV
chains in the Genus database with same CATH topology
1LC1A 2BLFB 1IQCA 1H9XA 4AANA 2YQBA 1C7MA 3OCDB 1NTMD 1DW1A 1RAPA 4WQ8A 4PW9B 1CO6A 1E2RA 3SWSA 2B12B 5B66V 1IRVA 1HCMA 4O1WA 2PCCB 2DGEA 3VNWA 1I8OA 1EZVD 1E8EA 1MZ4A 1J3SA 1U75B 1YTCA 5CIFB 3RMZA 1H32A 1YCCA 1L9BC 2IBZD 4H0JA 5H2FV 1SQXD 1IRWA 1BCCD 2PCBB 4YE1A 1QKSA 4WQBA 1H32B 1YEBA 3SLEA 3CXHD 1EB7A 1GDVA 1BE3D 3O5CA 4V2KA 3MK7B 1CIHA 1ZRTD 1C6RA 351CA 3O0RC 2OZ1A 1I8PA 5KAFV 4WQ7A 2FWLA 1CYIA 4FB1A 3ZCFA 1RZ5A 3H1ID 2D0SA 3DMIA 4AX3A 1H33B 3RLMA 1AOFA 3SXTA 3PXWA 3WFBC 2FYUD 3L4OA 4WQDA 3H1HD 1BGYD 5AURA 2FYNB 2V08A 2I8FA 3L71D 2ZOOA 4L3GA 3A0HV 3CX5D 2ORLA 1N9CA 4FA1A 2DVHA 3DR0A 1CIEA 1GQ1A 3WUIA 1AOQA 1W2LA 1CSUA 2N18C 1H1OA 1CSXA 2B10B 1CEDA 3JBTB 1C6SA 1KYOD 2N3YA 1CRJA 3BCCD 1QL4A 3CU4A 3TYIA 3WFCC 2CE0A 1BL9A 2BCCD 2FRCA 1HJ3A 451CA 2L4DA 2YIUB 1M6ZA 4L1QA 4LJIA 2ZXYA 5GTHV 1NNOA 3HQ7A 4UB8V 1C6OA 2AI5A 3PXSA 4D6TD 3ZBMA 2CE1A 3HQ9A 5CIDB 2GB8B 1YEAA 1ZZHA 1CC5A 2PACA 3CX5W 1I6DA 1KB0A 2D0WA 4WQAA 3ZOYA 4O1QA 1DW2A 1CSVA 1LC2A 5E79V 1NMIA 3C2CA 1N50A 1CRIA 4PD4D 1CHIA 3OA8A 1CIFA 1KYOW 4EIDA 4PWAA 2LITA 4FA5A 2JTIB 2JQRA 1MG2D 5CIEB 1CYCA 1QYZA 1A2SA 3OA8B 1YIQA 1FI7A 2QJYB 3HQ6A 1CCHA 1NTKD 1NMLA 1I54A 3ZOWA 3H1KD 1FI9A 1KX7A 1PP9D 1RZ6A 4Q5PA 1QL3A 3RN1A 1DVVA 1OCDA 1S6VB 3TGUD 1FHBA 4WQCA 3WC8A 3NBTA 2OZ1B 3ZOXA 2GC4D 4AAMA 5KKZB 1M70A 4AALA 1E29A 3CYTI 3A9FA 5KLVD 1IZL0 2HV4A 1L9JC 1HROA 4UB6V 1DVHA 1CRYA 4Y5RA 2GC7D 2CA3B 1WVEC 2VHDA 2N18B 1AYGA 1GKSA 3MK7C 1CIGA 1CNOA 3ORVA 1CXCA 1HZUA 3A0BV 4FANA 2CA4B 4QAOA 5DJQC 3L4MA 1U74B 2N9IA 1WEJF 3PXTA 3L74D 2BCNB 1VYDA 4XYDB 3WFEC 1H31A 4EICA 2B0ZB 4FA4A 2C2CA 1CXAA 1I6EA 1MG3D 2B4ZA 2ZBOA 1C2RA 1H31B 1F1FA 1LS9A 1HRCA 1F1CA 1HJ5A 4GEDB 2BPBB 4H0KA 1C75A 2N3BA 3DP5A 3RN0A 1CTJA 2MTAC 1CORA 4U3FD 1A56A 1DIQC 1KB9D 5CICB 2QJKB 3VRDA 2ZONG 1SQVD 1YFCA 1A8CA 1KV9A 2LIRA 2YCCA 1B7VA 4RSZA 1IO3A 3HQ8A 4N0KA 4MU8A 1QN2A 155CA 2C1DA 2EXVA 4J20A 1HZVA 1CRHA 1CCRA 5CYTR 3VYMA 4KMGA 5C0ZA 1CTYA 1DW3A 1FI3A 2C1DB 5CIHB 5KAIV 1H9YA 1CSWA 3L75D 1KX2A 1S5LV 4IL6V 1DIIC 1L0ND 1OAEA 4GYDA 4XXLA 1SQPD 3KZIV 4FAVA 5DF5A 3WFDC 1C2NA 4WQ9A 1FOCA 5B6QA 1HJ4A 2A06D 4FA9A 3H1LD 4JCGA 3NWVA 2MHMA 5KLIB 3CWBD 1GJQA 4EIFA 1HH7A 5CIGB 3L73D 3O20A 1R0QA 1GIWA 1COTA 1W5CT 4AAOA 2BH5X 2BGVX 1LMSA 1CTZA 1JDLA 3L70D 1FCDC 4PJ0V 1NIRA 1I55A 1H33A 3L72D 4EIEA 2YK3A 3WU2V 5DJQB 3SJLA 1C52A 1RAQA 5EXQA 3M97X 2C9XB 1CRGA 2GIWA 1SQQD 2V07A 5CIBB 1DW0A 1CHHA 1DT1A 4NFGB 1M60A 2N9JA 5B5EV 5C9MA 1N15A 1SQBD 2C1UA 3X39A 1P84D 2QJPB 1GU2A 2CXBA 1CRCA 2AIUA 4DY9A 3NBSA 4WQEA 1K3HA 3CXHW 4L3HA 1NU1D 1YICA 3H1JD 4P4QB 3CP5A 3ZOOA 3O1YA 2BH4X 1KIBA 1YNRA 2B11B 3PH2B 1ETPA 3ZIYA 2AXTV 1N90A 1L0LD 1PPJD 1FJ0A 2C8SA 2C1VA 5TISV 1CYJA 5IY51 1NTZD 5DFSA 1CHJA 1AKKA 3SVWA 4K3IA 1K3GA 1I5TA 1LFMA 3OCDA 2ZZS1 2XTSB 5GTIV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LC1 A;  2BLF B;  1IQC A;  1H9X A;  4AAN A;  2YQB A;  1C7M A;  3OCD B;  1NTM D;  1DW1 A;  1RAP A;  4WQ8 A;  4PW9 B;  1CO6 A;  1E2R A;  3SWS A;  2B12 B;  5B66 V;  1IRV A;  1HCM A;  4O1W A;  2PCC B;  2DGE A;  3VNW A;  1I8O A;  1EZV D;  1E8E A;  1MZ4 A;  1J3S A;  1U75 B;  1YTC A;  5CIF B;  3RMZ A;  1H32 A;  1YCC A;  1L9B C;  2IBZ D;  4H0J A;  5H2F V;  1SQX D;  1IRW A;  1BCC D;  2PCB B;  4YE1 A;  1QKS A;  4WQB A;  1H32 B;  1YEB A;  3SLE A;  3CXH D;  1EB7 A;  1GDV A;  1BE3 D;  3O5C A;  4V2K A;  3MK7 B;  1CIH A;  1ZRT D;  1C6R A;  351C A;  3O0R C;  2OZ1 A;  1I8P A;  5KAF V;  4WQ7 A;  2FWL A;  1CYI A;  4FB1 A;  3ZCF A;  1RZ5 A;  3H1I D;  2D0S A;  3DMI A;  4AX3 A;  1H33 B;  3RLM A;  1AOF A;  3SXT A;  3PXW A;  3WFB C;  2FYU D;  3L4O A;  4WQD A;  3H1H D;  1BGY D;  5AUR A;  2FYN B;  2V08 A;  2I8F A;  3L71 D;  2ZOO A;  4L3G A;  3A0H V;  3CX5 D;  2ORL A;  1N9C A;  4FA1 A;  2DVH A;  3DR0 A;  1CIE A;  1GQ1 A;  3WUI A;  1AOQ A;  1W2L A;  1CSU A;  2N18 C;  1H1O A;  1CSX A;  2B10 B;  1CED A;  3JBT B;  1C6S A;  1KYO D;  2N3Y A;  1CRJ A;  3BCC D;  1QL4 A;  3CU4 A;  3TYI A;  3WFC C;  2CE0 A;  1BL9 A;  2BCC D;  2FRC A;  1HJ3 A;  451C A;  2L4D A;  2YIU B;  1M6Z A;  4L1Q A;  4LJI A;  2ZXY A;  5GTH V;  1NNO A;  3HQ7 A;  4UB8 V;  1C6O A;  2AI5 A;  3PXS A;  4D6T D;  3ZBM A;  2CE1 A;  3HQ9 A;  5CID B;  2GB8 B;  1YEA A;  1ZZH A;  1CC5 A;  2PAC A;  3CX5 W;  1I6D A;  1KB0 A;  2D0W A;  4WQA A;  3ZOY A;  4O1Q A;  1DW2 A;  1CSV A;  1LC2 A;  5E79 V;  1NMI A;  3C2C A;  1N50 A;  1CRI A;  4PD4 D;  1CHI A;  3OA8 A;  1CIF A;  1KYO W;  4EID A;  4PWA A;  2LIT A;  4FA5 A;  2JTI B;  2JQR A;  1MG2 D;  5CIE B;  1CYC A;  1QYZ A;  1A2S A;  3OA8 B;  1YIQ A;  1FI7 A;  2QJY B;  3HQ6 A;  1CCH A;  1NTK D;  1NML A;  1I54 A;  3ZOW A;  3H1K D;  1FI9 A;  1KX7 A;  1PP9 D;  1RZ6 A;  4Q5P A;  1QL3 A;  3RN1 A;  1DVV A;  1OCD A;  1S6V B;  3TGU D;  1FHB A;  4WQC A;  3WC8 A;  3NBT A;  2OZ1 B;  3ZOX A;  2GC4 D;  4AAM A;  5KKZ B;  1M70 A;  4AAL A;  1E29 A;  3CYT I;  3A9F A;  5KLV D;  1IZL 0;  2HV4 A;  1L9J C;  1HRO A;  4UB6 V;  1DVH A;  1CRY A;  4Y5R A;  2GC7 D;  2CA3 B;  1WVE C;  2VHD A;  2N18 B;  1AYG A;  1GKS A;  3MK7 C;  1CIG A;  1CNO A;  3ORV A;  1CXC A;  1HZU A;  3A0B V;  4FAN A;  2CA4 B;  4QAO A;  5DJQ C;  3L4M A;  1U74 B;  2N9I A;  1WEJ F;  3PXT A;  3L74 D;  2BCN B;  1VYD A;  4XYD B;  3WFE C;  1H31 A;  4EIC A;  2B0Z B;  4FA4 A;  2C2C A;  1CXA A;  1I6E A;  1MG3 D;  2B4Z A;  2ZBO A;  1C2R A;  1H31 B;  1F1F A;  1LS9 A;  1HRC A;  1F1C A;  1HJ5 A;  4GED B;  2BPB B;  4H0K A;  1C75 A;  2N3B A;  3DP5 A;  3RN0 A;  1CTJ A;  2MTA C;  1COR A;  4U3F D;  1A56 A;  1DIQ C;  1KB9 D;  5CIC B;  2QJK B;  3VRD A;  2ZON G;  1SQV D;  1YFC A;  1A8C A;  1KV9 A;  2LIR A;  2YCC A;  1B7V A;  4RSZ A;  1IO3 A;  3HQ8 A;  4N0K A;  4MU8 A;  1QN2 A;  155C A;  2C1D A;  2EXV A;  4J20 A;  1HZV A;  1CRH A;  1CCR A;  5CYT R;  3VYM A;  4KMG A;  5C0Z A;  1CTY A;  1DW3 A;  1FI3 A;  2C1D B;  5CIH B;  5KAI V;  1H9Y A;  1CSW A;  3L75 D;  1KX2 A;  1S5L V;  4IL6 V;  1DII C;  1L0N D;  1OAE A;  4GYD A;  4XXL A;  1SQP D;  3KZI V;  4FAV A;  5DF5 A;  3WFD C;  1C2N A;  4WQ9 A;  1FOC A;  5B6Q A;  1HJ4 A;  2A06 D;  4FA9 A;  3H1L D;  4JCG A;  3NWV A;  2MHM A;  5KLI B;  3CWB D;  1GJQ A;  4EIF A;  1HH7 A;  5CIG B;  3L73 D;  3O20 A;  1R0Q A;  1GIW A;  1COT A;  1W5C T;  4AAO A;  2BH5 X;  2BGV X;  1LMS A;  1CTZ A;  1JDL A;  3L70 D;  1FCD C;  4PJ0 V;  1NIR A;  1I55 A;  1H33 A;  3L72 D;  4EIE A;  2YK3 A;  3WU2 V;  5DJQ B;  3SJL A;  1C52 A;  1RAQ A;  5EXQ A;  3M97 X;  2C9X B;  1CRG A;  2GIW A;  1SQQ D;  2V07 A;  5CIB B;  1DW0 A;  1CHH A;  1DT1 A;  4NFG B;  1M60 A;  2N9J A;  5B5E V;  5C9M A;  1N15 A;  1SQB D;  2C1U A;  3X39 A;  1P84 D;  2QJP B;  1GU2 A;  2CXB A;  1CRC A;  2AIU A;  4DY9 A;  3NBS A;  4WQE A;  1K3H A;  3CXH W;  4L3H A;  1NU1 D;  1YIC A;  3H1J D;  4P4Q B;  3CP5 A;  3ZOO A;  3O1Y A;  2BH4 X;  1KIB A;  1YNR A;  2B11 B;  3PH2 B;  1ETP A;  3ZIY A;  2AXT V;  1N90 A;  1L0L D;  1PPJ D;  1FJ0 A;  2C8S A;  2C1V A;  5TIS V;  1CYJ A;  5IY5 1;  1NTZ D;  5DFS A;  1CHJ A;  1AKK A;  3SVW A;  4K3I A;  1K3G A;  1I5T A;  1LFM A;  3OCD A;  2ZZS 1;  2XTS B;  5GTI V; 
#chains in the Genus database with same CATH topology
 1LC1 A;  2BLF B;  1IQC A;  1H9X A;  4AAN A;  2YQB A;  1C7M A;  3OCD B;  1NTM D;  1DW1 A;  1RAP A;  4WQ8 A;  4PW9 B;  1CO6 A;  1E2R A;  3SWS A;  2B12 B;  5B66 V;  1IRV A;  1HCM A;  4O1W A;  2PCC B;  2DGE A;  3VNW A;  1I8O A;  1EZV D;  1E8E A;  1MZ4 A;  1J3S A;  1U75 B;  1YTC A;  5CIF B;  3RMZ A;  1H32 A;  1YCC A;  1L9B C;  2IBZ D;  4H0J A;  5H2F V;  1SQX D;  1IRW A;  1BCC D;  2PCB B;  4YE1 A;  1QKS A;  4WQB A;  1H32 B;  1YEB A;  3SLE A;  3CXH D;  1EB7 A;  1GDV A;  1BE3 D;  3O5C A;  4V2K A;  3MK7 B;  1CIH A;  1ZRT D;  1C6R A;  351C A;  3O0R C;  2OZ1 A;  1I8P A;  5KAF V;  4WQ7 A;  2FWL A;  1CYI A;  4FB1 A;  3ZCF A;  1RZ5 A;  3H1I D;  2D0S A;  3DMI A;  4AX3 A;  1H33 B;  3RLM A;  1AOF A;  3SXT A;  3PXW A;  3WFB C;  2FYU D;  3L4O A;  4WQD A;  3H1H D;  1BGY D;  5AUR A;  2FYN B;  2V08 A;  2I8F A;  3L71 D;  2ZOO A;  4L3G A;  3A0H V;  3CX5 D;  2ORL A;  1N9C A;  4FA1 A;  2DVH A;  3DR0 A;  1CIE A;  1GQ1 A;  3WUI A;  1AOQ A;  1W2L A;  1CSU A;  2N18 C;  1H1O A;  1CSX A;  2B10 B;  1CED A;  3JBT B;  1C6S A;  1KYO D;  2N3Y A;  1CRJ A;  3BCC D;  1QL4 A;  3CU4 A;  3TYI A;  3WFC C;  2CE0 A;  1BL9 A;  2BCC D;  2FRC A;  1HJ3 A;  451C A;  2L4D A;  2YIU B;  1M6Z A;  4L1Q A;  4LJI A;  2ZXY A;  5GTH V;  1NNO A;  3HQ7 A;  4UB8 V;  1C6O A;  2AI5 A;  3PXS A;  4D6T D;  3ZBM A;  2CE1 A;  3HQ9 A;  5CID B;  2GB8 B;  1YEA A;  1ZZH A;  1CC5 A;  2PAC A;  3CX5 W;  1I6D A;  1KB0 A;  2D0W A;  4WQA A;  3ZOY A;  4O1Q A;  1DW2 A;  1CSV A;  1LC2 A;  5E79 V;  1NMI A;  3C2C A;  1N50 A;  1CRI A;  4PD4 D;  1CHI A;  3OA8 A;  1CIF A;  1KYO W;  4EID A;  4PWA A;  2LIT A;  4FA5 A;  2JTI B;  2JQR A;  1MG2 D;  5CIE B;  1CYC A;  1QYZ A;  1A2S A;  3OA8 B;  1YIQ A;  1FI7 A;  2QJY B;  3HQ6 A;  1CCH A;  1NTK D;  1NML A;  1I54 A;  3ZOW A;  3H1K D;  1FI9 A;  1KX7 A;  1PP9 D;  1RZ6 A;  4Q5P A;  3D0W A;  1QL3 A;  3RN1 A;  1DVV A;  1OCD A;  1S6V B;  3TGU D;  1FHB A;  4WQC A;  3WC8 A;  3NBT A;  2OZ1 B;  3ZOX A;  2GC4 D;  4AAM A;  5KKZ B;  1M70 A;  4AAL A;  1E29 A;  3CYT I;  3A9F A;  5KLV D;  1IZL 0;  2HV4 A;  1L9J C;  1HRO A;  4UB6 V;  1DVH A;  1CRY A;  4Y5R A;  2GC7 D;  2CA3 B;  1WVE C;  2VHD A;  2N18 B;  1AYG A;  1GKS A;  3MK7 C;  1CIG A;  1CNO A;  3ORV A;  1CXC A;  1HZU A;  3A0B V;  4FAN A;  2CA4 B;  4QAO A;  5DJQ C;  3L4M A;  1U74 B;  2N9I A;  1WEJ F;  3PXT A;  3L74 D;  2BCN B;  1VYD A;  4XYD B;  3WFE C;  1H31 A;  4EIC A;  2B0Z B;  4FA4 A;  2C2C A;  1CXA A;  1I6E A;  1MG3 D;  2B4Z A;  2ZBO A;  1C2R A;  1H31 B;  1F1F A;  1LS9 A;  1HRC A;  1F1C A;  1HJ5 A;  4GED B;  2BPB B;  4H0K A;  1C75 A;  2N3B A;  3DP5 A;  3RN0 A;  1CTJ A;  2MTA C;  1COR A;  4U3F D;  1A56 A;  1DIQ C;  1KB9 D;  5CIC B;  2QJK B;  3VRD A;  2ZON G;  1SQV D;  1YFC A;  1A8C A;  1KV9 A;  2LIR A;  2YCC A;  1B7V A;  4RSZ A;  1IO3 A;  3HQ8 A;  4N0K A;  4MU8 A;  1QN2 A;  155C A;  2C1D A;  2EXV A;  4J20 A;  1HZV A;  1CRH A;  1CCR A;  5CYT R;  3VYM A;  4KMG A;  5C0Z A;  1CTY A;  1DW3 A;  1FI3 A;  2C1D B;  5CIH B;  5KAI V;  1H9Y A;  1CSW A;  3L75 D;  1KX2 A;  1S5L V;  4IL6 V;  1DII C;  1L0N D;  1OAE A;  4GYD A;  4XXL A;  1SQP D;  3KZI V;  4FAV A;  5DF5 A;  3WFD C;  1C2N A;  4WQ9 A;  1FOC A;  5B6Q A;  1HJ4 A;  2A06 D;  4FA9 A;  3H1L D;  4JCG A;  3NWV A;  2MHM A;  5KLI B;  3CWB D;  1GJQ A;  4EIF A;  1HH7 A;  5CIG B;  3L73 D;  3O20 A;  1R0Q A;  1GIW A;  1COT A;  1W5C T;  4AAO A;  2BH5 X;  2BGV X;  1LMS A;  1CTZ A;  1JDL A;  3L70 D;  1FCD C;  4PJ0 V;  1NIR A;  1I55 A;  1H33 A;  3L72 D;  4EIE A;  2YK3 A;  3WU2 V;  5DJQ B;  3SJL A;  1C52 A;  1RAQ A;  5EXQ A;  3M97 X;  2C9X B;  1CRG A;  2GIW A;  1SQQ D;  2V07 A;  5CIB B;  1DW0 A;  1CHH A;  1DT1 A;  4NFG B;  1M60 A;  2N9J A;  5B5E V;  5C9M A;  1N15 A;  1SQB D;  2C1U A;  3X39 A;  1P84 D;  2QJP B;  1GU2 A;  2CXB A;  1CRC A;  2AIU A;  4DY9 A;  3NBS A;  4WQE A;  1K3H A;  3CXH W;  4L3H A;  1NU1 D;  1YIC A;  3H1J D;  4P4Q B;  3CP5 A;  3ZOO A;  3O1Y A;  2BH4 X;  1KIB A;  1YNR A;  2B11 B;  3PH2 B;  1ETP A;  3ZIY A;  2AXT V;  1N90 A;  1L0L D;  1PPJ D;  1FJ0 A;  2C8S A;  2C1V A;  5TIS V;  1CYJ A;  5IY5 1;  1NTZ D;  5DFS A;  1CHJ A;  1AKK A;  3SVW A;  4K3I A;  1K3G A;  1I5T A;  1LFM A;  3OCD A;  2ZZS 1;  2XTS B;  5GTI V; 
#chains in the Genus database with same CATH homology
 1LC1 A;  2BLF B;  1IQC A;  1H9X A;  4AAN A;  2YQB A;  1C7M A;  3OCD B;  1NTM D;  1DW1 A;  1RAP A;  4WQ8 A;  4PW9 B;  1CO6 A;  1E2R A;  3SWS A;  2B12 B;  5B66 V;  1IRV A;  1HCM A;  4O1W A;  2PCC B;  2DGE A;  3VNW A;  1I8O A;  1EZV D;  1E8E A;  1MZ4 A;  1J3S A;  1U75 B;  1YTC A;  5CIF B;  3RMZ A;  1H32 A;  1YCC A;  1L9B C;  2IBZ D;  4H0J A;  5H2F V;  1SQX D;  1IRW A;  1BCC D;  2PCB B;  4YE1 A;  1QKS A;  4WQB A;  1H32 B;  1YEB A;  3SLE A;  3CXH D;  1EB7 A;  1GDV A;  1BE3 D;  3O5C A;  4V2K A;  3MK7 B;  1CIH A;  1ZRT D;  1C6R A;  351C A;  3O0R C;  2OZ1 A;  1I8P A;  5KAF V;  4WQ7 A;  2FWL A;  1CYI A;  4FB1 A;  3ZCF A;  1RZ5 A;  3H1I D;  2D0S A;  3DMI A;  4AX3 A;  1H33 B;  3RLM A;  1AOF A;  3SXT A;  3PXW A;  3WFB C;  2FYU D;  3L4O A;  4WQD A;  3H1H D;  1BGY D;  5AUR A;  2FYN B;  2V08 A;  2I8F A;  3L71 D;  2ZOO A;  4L3G A;  3A0H V;  3CX5 D;  2ORL A;  1N9C A;  4FA1 A;  2DVH A;  3DR0 A;  1CIE A;  1GQ1 A;  3WUI A;  1AOQ A;  1W2L A;  1CSU A;  2N18 C;  1H1O A;  1CSX A;  2B10 B;  1CED A;  3JBT B;  1C6S A;  1KYO D;  2N3Y A;  1CRJ A;  3BCC D;  1QL4 A;  3CU4 A;  3TYI A;  3WFC C;  2CE0 A;  1BL9 A;  2BCC D;  2FRC A;  1HJ3 A;  451C A;  2L4D A;  2YIU B;  1M6Z A;  4L1Q A;  4LJI A;  2ZXY A;  5GTH V;  1NNO A;  3HQ7 A;  4UB8 V;  1C6O A;  2AI5 A;  3PXS A;  4D6T D;  3ZBM A;  2CE1 A;  3HQ9 A;  5CID B;  2GB8 B;  1YEA A;  1ZZH A;  1CC5 A;  2PAC A;  3CX5 W;  1I6D A;  1KB0 A;  2D0W A;  4WQA A;  3ZOY A;  4O1Q A;  1DW2 A;  1CSV A;  1LC2 A;  5E79 V;  1NMI A;  3C2C A;  1N50 A;  1CRI A;  4PD4 D;  1CHI A;  3OA8 A;  1CIF A;  1KYO W;  4EID A;  4PWA A;  2LIT A;  4FA5 A;  2JTI B;  2JQR A;  1MG2 D;  5CIE B;  1CYC A;  1QYZ A;  1A2S A;  3OA8 B;  1YIQ A;  1FI7 A;  2QJY B;  3HQ6 A;  1CCH A;  1NTK D;  1NML A;  1I54 A;  3ZOW A;  3H1K D;  1FI9 A;  1KX7 A;  1PP9 D;  1RZ6 A;  4Q5P A;  1QL3 A;  3RN1 A;  1DVV A;  1OCD A;  1S6V B;  3TGU D;  1FHB A;  4WQC A;  3WC8 A;  3NBT A;  2OZ1 B;  3ZOX A;  2GC4 D;  4AAM A;  5KKZ B;  1M70 A;  4AAL A;  1E29 A;  3CYT I;  3A9F A;  5KLV D;  1IZL 0;  2HV4 A;  1L9J C;  1HRO A;  4UB6 V;  1DVH A;  1CRY A;  4Y5R A;  2GC7 D;  2CA3 B;  1WVE C;  2VHD A;  2N18 B;  1AYG A;  1GKS A;  3MK7 C;  1CIG A;  1CNO A;  3ORV A;  1CXC A;  1HZU A;  3A0B V;  4FAN A;  2CA4 B;  4QAO A;  5DJQ C;  3L4M A;  1U74 B;  2N9I A;  1WEJ F;  3PXT A;  3L74 D;  2BCN B;  1VYD A;  4XYD B;  3WFE C;  1H31 A;  4EIC A;  2B0Z B;  4FA4 A;  2C2C A;  1CXA A;  1I6E A;  1MG3 D;  2B4Z A;  2ZBO A;  1C2R A;  1H31 B;  1F1F A;  1LS9 A;  1HRC A;  1F1C A;  1HJ5 A;  4GED B;  2BPB B;  4H0K A;  1C75 A;  2N3B A;  3DP5 A;  3RN0 A;  1CTJ A;  2MTA C;  1COR A;  4U3F D;  1A56 A;  1DIQ C;  1KB9 D;  5CIC B;  2QJK B;  3VRD A;  2ZON G;  1SQV D;  1YFC A;  1A8C A;  1KV9 A;  2LIR A;  2YCC A;  1B7V A;  4RSZ A;  1IO3 A;  3HQ8 A;  4N0K A;  4MU8 A;  1QN2 A;  155C A;  2C1D A;  2EXV A;  4J20 A;  1HZV A;  1CRH A;  1CCR A;  5CYT R;  3VYM A;  4KMG A;  5C0Z A;  1CTY A;  1DW3 A;  1FI3 A;  2C1D B;  5CIH B;  5KAI V;  1H9Y A;  1CSW A;  3L75 D;  1KX2 A;  1S5L V;  4IL6 V;  1DII C;  1L0N D;  1OAE A;  4GYD A;  4XXL A;  1SQP D;  3KZI V;  4FAV A;  5DF5 A;  3WFD C;  1C2N A;  4WQ9 A;  1FOC A;  5B6Q A;  1HJ4 A;  2A06 D;  4FA9 A;  3H1L D;  4JCG A;  3NWV A;  2MHM A;  5KLI B;  3CWB D;  1GJQ A;  4EIF A;  1HH7 A;  5CIG B;  3L73 D;  3O20 A;  1R0Q A;  1GIW A;  1COT A;  1W5C T;  4AAO A;  2BH5 X;  2BGV X;  1LMS A;  1CTZ A;  1JDL A;  3L70 D;  1FCD C;  4PJ0 V;  1NIR A;  1I55 A;  1H33 A;  3L72 D;  4EIE A;  2YK3 A;  3WU2 V;  5DJQ B;  3SJL A;  1C52 A;  1RAQ A;  5EXQ A;  3M97 X;  2C9X B;  1CRG A;  2GIW A;  1SQQ D;  2V07 A;  5CIB B;  1DW0 A;  1CHH A;  1DT1 A;  4NFG B;  1M60 A;  2N9J A;  5B5E V;  5C9M A;  1N15 A;  1SQB D;  2C1U A;  3X39 A;  1P84 D;  2QJP B;  1GU2 A;  2CXB A;  1CRC A;  2AIU A;  4DY9 A;  3NBS A;  4WQE A;  1K3H A;  3CXH W;  4L3H A;  1NU1 D;  1YIC A;  3H1J D;  4P4Q B;  3CP5 A;  3ZOO A;  3O1Y A;  2BH4 X;  1KIB A;  1YNR A;  2B11 B;  3PH2 B;  1ETP A;  3ZIY A;  2AXT V;  1N90 A;  1L0L D;  1PPJ D;  1FJ0 A;  2C8S A;  2C1V A;  5TIS V;  1CYJ A;  5IY5 1;  1NTZ D;  5DFS A;  1CHJ A;  1AKK A;  3SVW A;  4K3I A;  1K3G A;  1I5T A;  1LFM A;  3OCD A;  2ZZS 1;  2XTS B;  5GTI V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...