5B5EV

Crystal structure analysis of photosystem ii complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
137
structure length
137
Chain Sequence
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 47
structure length 137
sequence length 137
chains with identical sequence v
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF14495 Cytochrom_C550 Cytochrome c-550 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5b5eV00
1COTA 1SQBD 1CXCA 2CA3B 5CIHB 1HZVA 1RZ6A 1CTZA 3L70D 4YE1A 1I55A 1C6SA 4XXLA 4WQ8A 1DT1A 1E29A 1F1FA 1A56A 1DIQC 5B5EV 1C7MA 3VRDA 1ZZHA 1FI3A 1W5CT 5GTIV 1FJ0A 1C2NA 3OA8A 1YICA 1AKKA 3H1HD 155CA 1MG3D 1CRCA 1YFCA 5H2FV 2N18B 1QYZA 3CWBD 3H1KD 4IL6V 3L75D 3PXSA 1I6EA 1BCCD 1CXAA 3A0BV 3ZOWA 2FWLA 4AALA 1NNOA 3TYIA 4H0KA 4Q5PA 1DW1A 1RAQA 2V08A 3CXHW 4WQDA 1OAEA 1FI9A 1CTJA 3OCDA 3MK7C 4NFGB 1M6ZA 3A0HV 1DVHA 1HH7A 1E2RA 1IRVA 1A2SA 3HQ9A 1FCDC 1CRHA 3MK7B 1NMIA 2CE0A 1H32B 2JQRA 3CU4A 4H0JA 4PJ0V 1K3HA 2CE1A 3DR0A 1CCHA 3JBTB 1CIEA 2C9XB 2B11B 4EICA 3VYMA 4DY9A 2C1UA 5KKZB 1I54A 3RN0A 1H31A 2AXTV 4UB6V 1YEBA 2BLFB 2MHMA 1A8CA 4FB1A 4PWAA 1C6RA 1AYGA 2C1DB 351CA 5DJQC 1HCMA 4P4QB 3BCCD 2D0WA 3DMIA 1H9XA 2CXBA 1L9JC 1EB7A 1SQPD 1DW2A 1YTCA 1SQVD 2BCCD 1CRGA 1OCDA 4V2KA 1N50A 1CYJA 1I5TA 4PW9B 3ORVA 1KIBA 4PD4D 2ORLA 1JDLA 1GQ1A 1MG2D 2N3BA 1DVVA 2BH4X 3O20A 2ZXYA 2BGVX 1CRJA 2CA4B 2LIRA 2EXVA 3ZOXA 4WQAA 3CX5D 3VNWA 2AI5A 4WQ7A 2GC4D 1PP9D 1F1CA 1GIWA 2QJYB 2N9IA 1CYCA 3O0RC 1S6VB 4FA4A 1NMLA 1CHIA 4FA5A 4AX3A 5CIGB 2PACA 1E8EA 2YK3A 5GTHV 1KYOD 3ZOOA 3WFDC 1CEDA 2ZBOA 1FHBA 3HQ6A 1C52A 1FOCA 1DW0A 1IZL0 2B4ZA 3M97X 3CP5A 1NTKD 1KX2A 2LITA 1N15A 4Y5RA 1GJQA 4WQEA 3RMZA 1H32A 5KLVD 5TISV 1U74B 1KB9D 1CSVA 2YQBA 4D6TD 1NIRA 1GDVA 2B10B 5DF5A 3PXWA 2A06D 3H1ID 1WEJF 1YEAA 2OZ1A 4J20A 1LC1A 1QL3A 1HRCA 4L1QA 4O1WA 4AANA 3ZBMA 3OA8B 2YIUB 1YNRA 2HV4A 4K3IA 3TGUD 4FA1A 1SQQD 1K3GA 4JCGA 1QKSA 1H33B 1CRYA 3WUIA 4N0KA 1CO6A 1B7VA 4FAVA 3WFBC 1LS9A 5B66V 2GC7D 2AIUA 3RN1A 3CXHD 4EIEA 2FRCA 5DFSA 3L73D 2D0SA 3NWVA 3OCDB 3WC8A 2QJKB 3CX5W 3SJLA 2PCBB 5DJQB 1DIIC 1H1OA 3NBTA 1CTYA 3HQ8A 3PH2B 4AAOA 3L4MA 2BH5X 451CA 1M70A 3ZIYA 5CIEB 4KMGA 1QL4A 1KYOW 3SWSA 3H1LD 1H31B 1AOFA 4QAOA 1VYDA 4GYDA 1LMSA 1KX7A 2PCCB 1N90A 1CIFA 4AAMA 5AURA 3L71D 1DW3A 3KZIV 1HJ5A 1MZ4A 1BE3D 2V07A 2JTIB 1I8PA 4L3GA 2FYNB 3C2CA 2YCCA 1QN2A 5CIDB 1GU2A 1EZVD 5CIFB 1BGYD 3O1YA 5KAFV 1HZUA 1N9CA 1CCRA 1CRIA 5IY51 2C2CA 1IO3A 1W2LA 2IBZD 1LC2A 1CC5A 1HROA 2MTAC 3RLMA 1WVEC 1HJ3A 1L0LD 2GIWA 1L9BC 3SLEA 5B6QA 5CYTR 3WU2V 2N18C 3O5CA 2FYUD 1J3SA 1C6OA 2N3YA 1YCCA 3WFEC 2XTSB 3L4OA 5KAIV 1H33A 1CYIA 3ZOYA 2C1VA 2GB8B 1YIQA 3H1JD 1NTMD 2DGEA 4RSZA 4WQBA 1P84D 5CICB 2B12B 1IRWA 1KB0A 5CIBB 3L72D 1FI7A 2C1DA 3X39A 2B0ZB 2I8FA 4FANA 1HJ4A 4EIFA 5KLIB 1CSUA 1I6DA 1IQCA 3CYTI 1CSWA 3SXTA 1C75A 3DP5A 4LJIA 1CSXA 1R0QA 2QJPB 5C9MA 4U3FD 3L74D 2L4DA 2ZOOA 1ZRTD 1GKSA 1C2RA 1KV9A 1CHHA 1CIGA 4GEDB 5EXQA 2BPBB 1LFMA 1ETPA 4L3HA 2ZZS1 4MU8A 1CNOA 4WQ9A 1CHJA 1L0ND 3PXTA 2OZ1B 1PPJD 2C8SA 1H9YA 1RZ5A 2ZONG 4WQCA 5C0ZA 2VHDA 3SVWA 4O1QA 1CIHA 3WFCC 2N9JA 4XYDB 3HQ7A 1U75B 3A9FA 4EIDA 1NTZD 2BCNB 1M60A 3ZCFA 4UB8V 3NBSA 1AOQA 1BL9A 1RAPA 1CORA 1S5LV 5E79V 1SQXD 4FA9A 1NU1D 1I8OA 2DVHA
chains in the Genus database with same CATH superfamily
1COTA 1SQBD 1CXCA 2CA3B 5CIHB 1HZVA 1RZ6A 1CTZA 3L70D 4YE1A 1I55A 1C6SA 4XXLA 4WQ8A 1DT1A 1E29A 1F1FA 1A56A 1DIQC 5B5EV 1C7MA 3VRDA 1ZZHA 1FI3A 1W5CT 5GTIV 1FJ0A 1C2NA 3OA8A 1YICA 1AKKA 3H1HD 155CA 1MG3D 1CRCA 1YFCA 5H2FV 2N18B 1QYZA 3CWBD 3H1KD 4IL6V 3L75D 3PXSA 1I6EA 1BCCD 1CXAA 3A0BV 3ZOWA 2FWLA 4AALA 1NNOA 3TYIA 4H0KA 4Q5PA 1DW1A 1RAQA 2V08A 3CXHW 4WQDA 1OAEA 1FI9A 1CTJA 3OCDA 3MK7C 4NFGB 1M6ZA 3A0HV 1DVHA 1HH7A 1E2RA 1IRVA 1A2SA 3HQ9A 1FCDC 1CRHA 3MK7B 1NMIA 2CE0A 1H32B 2JQRA 3CU4A 4H0JA 4PJ0V 1K3HA 2CE1A 3DR0A 1CCHA 3JBTB 1CIEA 2C9XB 2B11B 4EICA 3VYMA 4DY9A 2C1UA 5KKZB 1I54A 3RN0A 1H31A 2AXTV 4UB6V 1YEBA 2BLFB 2MHMA 1A8CA 4FB1A 4PWAA 1C6RA 1AYGA 2C1DB 351CA 5DJQC 1HCMA 4P4QB 3BCCD 2D0WA 3DMIA 1H9XA 2CXBA 1L9JC 1EB7A 1SQPD 1DW2A 1YTCA 1SQVD 2BCCD 1CRGA 1OCDA 4V2KA 1N50A 1CYJA 1I5TA 4PW9B 3ORVA 1KIBA 4PD4D 2ORLA 1JDLA 1GQ1A 1MG2D 2N3BA 1DVVA 2BH4X 3O20A 2ZXYA 2BGVX 1CRJA 2CA4B 2LIRA 2EXVA 3ZOXA 4WQAA 3CX5D 3VNWA 2AI5A 4WQ7A 2GC4D 1PP9D 1F1CA 1GIWA 2QJYB 2N9IA 1CYCA 3O0RC 1S6VB 4FA4A 1NMLA 1CHIA 4FA5A 4AX3A 5CIGB 2PACA 1E8EA 2YK3A 5GTHV 1KYOD 3ZOOA 3WFDC 1CEDA 2ZBOA 1FHBA 3HQ6A 1C52A 1FOCA 1DW0A 1IZL0 2B4ZA 3M97X 3CP5A 1NTKD 1KX2A 2LITA 1N15A 4Y5RA 1GJQA 4WQEA 3RMZA 1H32A 5KLVD 5TISV 1U74B 1KB9D 1CSVA 2YQBA 4D6TD 1NIRA 1GDVA 2B10B 5DF5A 3PXWA 2A06D 3H1ID 1WEJF 1YEAA 2OZ1A 4J20A 1LC1A 1QL3A 1HRCA 4L1QA 4O1WA 4AANA 3ZBMA 3OA8B 2YIUB 1YNRA 2HV4A 4K3IA 3TGUD 4FA1A 1SQQD 1K3GA 4JCGA 1QKSA 1H33B 1CRYA 3WUIA 4N0KA 1CO6A 1B7VA 3D0WA 4FAVA 3WFBC 1LS9A 5B66V 2GC7D 2AIUA 3RN1A 3CXHD 4EIEA 2FRCA 5DFSA 3L73D 2D0SA 3NWVA 3OCDB 3WC8A 2QJKB 3CX5W 3SJLA 2PCBB 5DJQB 1DIIC 1H1OA 3NBTA 1CTYA 3HQ8A 3PH2B 4AAOA 3L4MA 2BH5X 451CA 1M70A 3ZIYA 5CIEB 4KMGA 1QL4A 1KYOW 3SWSA 3H1LD 1H31B 1AOFA 4QAOA 1VYDA 4GYDA 1LMSA 1KX7A 2PCCB 1N90A 1CIFA 4AAMA 5AURA 3L71D 1DW3A 3KZIV 1HJ5A 1MZ4A 1BE3D 2V07A 2JTIB 1I8PA 4L3GA 2FYNB 3C2CA 2YCCA 1QN2A 5CIDB 1GU2A 1EZVD 5CIFB 1BGYD 3O1YA 5KAFV 1HZUA 1N9CA 1CCRA 1CRIA 5IY51 2C2CA 1IO3A 1W2LA 2IBZD 1LC2A 1CC5A 1HROA 2MTAC 3RLMA 1WVEC 1HJ3A 1L0LD 2GIWA 1L9BC 3SLEA 5B6QA 5CYTR 3WU2V 2N18C 3O5CA 2FYUD 1J3SA 1C6OA 2N3YA 1YCCA 3WFEC 2XTSB 3L4OA 5KAIV 1H33A 1CYIA 3ZOYA 2C1VA 2GB8B 1YIQA 3H1JD 1NTMD 2DGEA 4RSZA 4WQBA 1P84D 5CICB 2B12B 1IRWA 1KB0A 5CIBB 3L72D 1FI7A 2C1DA 3X39A 2B0ZB 2I8FA 4FANA 1HJ4A 4EIFA 5KLIB 1CSUA 1I6DA 1IQCA 3CYTI 1CSWA 3SXTA 1C75A 3DP5A 4LJIA 1CSXA 1R0QA 2QJPB 5C9MA 4U3FD 3L74D 2L4DA 2ZOOA 1ZRTD 1GKSA 1C2RA 1KV9A 1CHHA 1CIGA 4GEDB 5EXQA 2BPBB 1LFMA 1ETPA 4L3HA 2ZZS1 4MU8A 1CNOA 4WQ9A 1CHJA 1L0ND 3PXTA 2OZ1B 1PPJD 2C8SA 1H9YA 1RZ5A 2ZONG 4WQCA 5C0ZA 2VHDA 3SVWA 4O1QA 1CIHA 3WFCC 2N9JA 4XYDB 3HQ7A 1U75B 3A9FA 4EIDA 1NTZD 2BCNB 1M60A 3ZCFA 4UB8V 3NBSA 1AOQA 1BL9A 1RAPA 1CORA 1S5LV 5E79V 1SQXD 4FA9A 1NU1D 1I8OA 2DVHA
chains in the Genus database with same CATH topology
1COTA 1SQBD 1CXCA 2CA3B 5CIHB 1HZVA 1RZ6A 1CTZA 3L70D 4YE1A 1I55A 1C6SA 4XXLA 4WQ8A 1DT1A 1E29A 1F1FA 1A56A 1DIQC 5B5EV 1C7MA 3VRDA 1ZZHA 1FI3A 1W5CT 5GTIV 1FJ0A 1C2NA 3OA8A 1YICA 1AKKA 3H1HD 155CA 1MG3D 1CRCA 1YFCA 5H2FV 2N18B 1QYZA 3CWBD 3H1KD 4IL6V 3L75D 3PXSA 1I6EA 1BCCD 1CXAA 3A0BV 3ZOWA 2FWLA 4AALA 1NNOA 3TYIA 4H0KA 4Q5PA 1DW1A 1RAQA 2V08A 3CXHW 4WQDA 1OAEA 1FI9A 1CTJA 3OCDA 3MK7C 4NFGB 1M6ZA 3A0HV 1DVHA 1HH7A 1E2RA 1IRVA 1A2SA 3HQ9A 1FCDC 1CRHA 3MK7B 1NMIA 2CE0A 1H32B 2JQRA 3CU4A 4H0JA 4PJ0V 1K3HA 2CE1A 3DR0A 1CCHA 3JBTB 1CIEA 2C9XB 2B11B 4EICA 3VYMA 4DY9A 2C1UA 5KKZB 1I54A 3RN0A 1H31A 2AXTV 4UB6V 1YEBA 2BLFB 2MHMA 1A8CA 4FB1A 4PWAA 1C6RA 1AYGA 2C1DB 351CA 5DJQC 1HCMA 4P4QB 3BCCD 2D0WA 3DMIA 1H9XA 2CXBA 1L9JC 1EB7A 1SQPD 1DW2A 1YTCA 1SQVD 2BCCD 1CRGA 1OCDA 4V2KA 1N50A 1CYJA 1I5TA 4PW9B 3ORVA 1KIBA 4PD4D 2ORLA 1JDLA 1GQ1A 1MG2D 2N3BA 1DVVA 2BH4X 3O20A 2ZXYA 2BGVX 1CRJA 2CA4B 2LIRA 2EXVA 3ZOXA 4WQAA 3CX5D 3VNWA 2AI5A 4WQ7A 2GC4D 1PP9D 1F1CA 1GIWA 2QJYB 2N9IA 1CYCA 3O0RC 1S6VB 4FA4A 1NMLA 1CHIA 4FA5A 4AX3A 5CIGB 2PACA 1E8EA 2YK3A 5GTHV 1KYOD 3ZOOA 3WFDC 1CEDA 2ZBOA 1FHBA 3HQ6A 1C52A 1FOCA 1DW0A 1IZL0 2B4ZA 3M97X 3CP5A 1NTKD 1KX2A 2LITA 1N15A 4Y5RA 1GJQA 4WQEA 3RMZA 1H32A 5KLVD 5TISV 1U74B 1KB9D 1CSVA 2YQBA 4D6TD 1NIRA 1GDVA 2B10B 5DF5A 3PXWA 2A06D 3H1ID 1WEJF 1YEAA 2OZ1A 4J20A 1LC1A 1QL3A 1HRCA 4L1QA 4O1WA 4AANA 3ZBMA 3OA8B 2YIUB 1YNRA 2HV4A 4K3IA 3TGUD 4FA1A 1SQQD 1K3GA 4JCGA 1QKSA 1H33B 1CRYA 3WUIA 4N0KA 1CO6A 1B7VA 4FAVA 3WFBC 1LS9A 5B66V 2GC7D 2AIUA 3RN1A 3CXHD 4EIEA 2FRCA 5DFSA 3L73D 2D0SA 3NWVA 3OCDB 3WC8A 2QJKB 3CX5W 3SJLA 2PCBB 5DJQB 1DIIC 1H1OA 3NBTA 1CTYA 3HQ8A 3PH2B 4AAOA 3L4MA 2BH5X 451CA 1M70A 3ZIYA 5CIEB 4KMGA 1QL4A 1KYOW 3SWSA 3H1LD 1H31B 1AOFA 4QAOA 1VYDA 4GYDA 1LMSA 1KX7A 2PCCB 1N90A 1CIFA 4AAMA 5AURA 3L71D 1DW3A 3KZIV 1HJ5A 1MZ4A 1BE3D 2V07A 2JTIB 1I8PA 4L3GA 2FYNB 3C2CA 2YCCA 1QN2A 5CIDB 1GU2A 1EZVD 5CIFB 1BGYD 3O1YA 5KAFV 1HZUA 1N9CA 1CCRA 1CRIA 5IY51 2C2CA 1IO3A 1W2LA 2IBZD 1LC2A 1CC5A 1HROA 2MTAC 3RLMA 1WVEC 1HJ3A 1L0LD 2GIWA 1L9BC 3SLEA 5B6QA 5CYTR 3WU2V 2N18C 3O5CA 2FYUD 1J3SA 1C6OA 2N3YA 1YCCA 3WFEC 2XTSB 3L4OA 5KAIV 1H33A 1CYIA 3ZOYA 2C1VA 2GB8B 1YIQA 3H1JD 1NTMD 2DGEA 4RSZA 4WQBA 1P84D 5CICB 2B12B 1IRWA 1KB0A 5CIBB 3L72D 1FI7A 2C1DA 3X39A 2B0ZB 2I8FA 4FANA 1HJ4A 4EIFA 5KLIB 1CSUA 1I6DA 1IQCA 3CYTI 1CSWA 3SXTA 1C75A 3DP5A 4LJIA 1CSXA 1R0QA 2QJPB 5C9MA 4U3FD 3L74D 2L4DA 2ZOOA 1ZRTD 1GKSA 1C2RA 1KV9A 1CHHA 1CIGA 4GEDB 5EXQA 2BPBB 1LFMA 1ETPA 4L3HA 2ZZS1 4MU8A 1CNOA 4WQ9A 1CHJA 1L0ND 3PXTA 2OZ1B 1PPJD 2C8SA 1H9YA 1RZ5A 2ZONG 4WQCA 5C0ZA 2VHDA 3SVWA 4O1QA 1CIHA 3WFCC 2N9JA 4XYDB 3HQ7A 1U75B 3A9FA 4EIDA 1NTZD 2BCNB 1M60A 3ZCFA 4UB8V 3NBSA 1AOQA 1BL9A 1RAPA 1CORA 1S5LV 5E79V 1SQXD 4FA9A 1NU1D 1I8OA 2DVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COT A;  1SQB D;  1CXC A;  2CA3 B;  5CIH B;  1HZV A;  1RZ6 A;  1CTZ A;  3L70 D;  4YE1 A;  1I55 A;  1C6S A;  4XXL A;  4WQ8 A;  1DT1 A;  1E29 A;  1F1F A;  1A56 A;  1DIQ C;  5B5E V;  1C7M A;  3VRD A;  1ZZH A;  1FI3 A;  1W5C T;  5GTI V;  1FJ0 A;  1C2N A;  3OA8 A;  1YIC A;  1AKK A;  3H1H D;  155C A;  1MG3 D;  1CRC A;  1YFC A;  5H2F V;  2N18 B;  1QYZ A;  3CWB D;  3H1K D;  4IL6 V;  3L75 D;  3PXS A;  1I6E A;  1BCC D;  1CXA A;  3A0B V;  3ZOW A;  2FWL A;  4AAL A;  1NNO A;  3TYI A;  4H0K A;  4Q5P A;  1DW1 A;  1RAQ A;  2V08 A;  3CXH W;  4WQD A;  1OAE A;  1FI9 A;  1CTJ A;  3OCD A;  3MK7 C;  4NFG B;  1M6Z A;  3A0H V;  1DVH A;  1HH7 A;  1E2R A;  1IRV A;  1A2S A;  3HQ9 A;  1FCD C;  1CRH A;  3MK7 B;  1NMI A;  2CE0 A;  1H32 B;  2JQR A;  3CU4 A;  4H0J A;  4PJ0 V;  1K3H A;  2CE1 A;  3DR0 A;  1CCH A;  3JBT B;  1CIE A;  2C9X B;  2B11 B;  4EIC A;  3VYM A;  4DY9 A;  2C1U A;  5KKZ B;  1I54 A;  3RN0 A;  1H31 A;  2AXT V;  4UB6 V;  1YEB A;  2BLF B;  2MHM A;  1A8C A;  4FB1 A;  4PWA A;  1C6R A;  1AYG A;  2C1D B;  351C A;  5DJQ C;  1HCM A;  4P4Q B;  3BCC D;  2D0W A;  3DMI A;  1H9X A;  2CXB A;  1L9J C;  1EB7 A;  1SQP D;  1DW2 A;  1YTC A;  1SQV D;  2BCC D;  1CRG A;  1OCD A;  4V2K A;  1N50 A;  1CYJ A;  1I5T A;  4PW9 B;  3ORV A;  1KIB A;  4PD4 D;  2ORL A;  1JDL A;  1GQ1 A;  1MG2 D;  2N3B A;  1DVV A;  2BH4 X;  3O20 A;  2ZXY A;  2BGV X;  1CRJ A;  2CA4 B;  2LIR A;  2EXV A;  3ZOX A;  4WQA A;  3CX5 D;  3VNW A;  2AI5 A;  4WQ7 A;  2GC4 D;  1PP9 D;  1F1C A;  1GIW A;  2QJY B;  2N9I A;  1CYC A;  3O0R C;  1S6V B;  4FA4 A;  1NML A;  1CHI A;  4FA5 A;  4AX3 A;  5CIG B;  2PAC A;  1E8E A;  2YK3 A;  5GTH V;  1KYO D;  3ZOO A;  3WFD C;  1CED A;  2ZBO A;  1FHB A;  3HQ6 A;  1C52 A;  1FOC A;  1DW0 A;  1IZL 0;  2B4Z A;  3M97 X;  3CP5 A;  1NTK D;  1KX2 A;  2LIT A;  1N15 A;  4Y5R A;  1GJQ A;  4WQE A;  3RMZ A;  1H32 A;  5KLV D;  5TIS V;  1U74 B;  1KB9 D;  1CSV A;  2YQB A;  4D6T D;  1NIR A;  1GDV A;  2B10 B;  5DF5 A;  3PXW A;  2A06 D;  3H1I D;  1WEJ F;  1YEA A;  2OZ1 A;  4J20 A;  1LC1 A;  1QL3 A;  1HRC A;  4L1Q A;  4O1W A;  4AAN A;  3ZBM A;  3OA8 B;  2YIU B;  1YNR A;  2HV4 A;  4K3I A;  3TGU D;  4FA1 A;  1SQQ D;  1K3G A;  4JCG A;  1QKS A;  1H33 B;  1CRY A;  3WUI A;  4N0K A;  1CO6 A;  1B7V A;  4FAV A;  3WFB C;  1LS9 A;  5B66 V;  2GC7 D;  2AIU A;  3RN1 A;  3CXH D;  4EIE A;  2FRC A;  5DFS A;  3L73 D;  2D0S A;  3NWV A;  3OCD B;  3WC8 A;  2QJK B;  3CX5 W;  3SJL A;  2PCB B;  5DJQ B;  1DII C;  1H1O A;  3NBT A;  1CTY A;  3HQ8 A;  3PH2 B;  4AAO A;  3L4M A;  2BH5 X;  451C A;  1M70 A;  3ZIY A;  5CIE B;  4KMG A;  1QL4 A;  1KYO W;  3SWS A;  3H1L D;  1H31 B;  1AOF A;  4QAO A;  1VYD A;  4GYD A;  1LMS A;  1KX7 A;  2PCC B;  1N90 A;  1CIF A;  4AAM A;  5AUR A;  3L71 D;  1DW3 A;  3KZI V;  1HJ5 A;  1MZ4 A;  1BE3 D;  2V07 A;  2JTI B;  1I8P A;  4L3G A;  2FYN B;  3C2C A;  2YCC A;  1QN2 A;  5CID B;  1GU2 A;  1EZV D;  5CIF B;  1BGY D;  3O1Y A;  5KAF V;  1HZU A;  1N9C A;  1CCR A;  1CRI A;  5IY5 1;  2C2C A;  1IO3 A;  1W2L A;  2IBZ D;  1LC2 A;  1CC5 A;  1HRO A;  2MTA C;  3RLM A;  1WVE C;  1HJ3 A;  1L0L D;  2GIW A;  1L9B C;  3SLE A;  5B6Q A;  5CYT R;  3WU2 V;  2N18 C;  3O5C A;  2FYU D;  1J3S A;  1C6O A;  2N3Y A;  1YCC A;  3WFE C;  2XTS B;  3L4O A;  5KAI V;  1H33 A;  1CYI A;  3ZOY A;  2C1V A;  2GB8 B;  1YIQ A;  3H1J D;  1NTM D;  2DGE A;  4RSZ A;  4WQB A;  1P84 D;  5CIC B;  2B12 B;  1IRW A;  1KB0 A;  5CIB B;  3L72 D;  1FI7 A;  2C1D A;  3X39 A;  2B0Z B;  2I8F A;  4FAN A;  1HJ4 A;  4EIF A;  5KLI B;  1CSU A;  1I6D A;  1IQC A;  3CYT I;  1CSW A;  3SXT A;  1C75 A;  3DP5 A;  4LJI A;  1CSX A;  1R0Q A;  2QJP B;  5C9M A;  4U3F D;  3L74 D;  2L4D A;  2ZOO A;  1ZRT D;  1GKS A;  1C2R A;  1KV9 A;  1CHH A;  1CIG A;  4GED B;  5EXQ A;  2BPB B;  1LFM A;  1ETP A;  4L3H A;  2ZZS 1;  4MU8 A;  1CNO A;  4WQ9 A;  1CHJ A;  1L0N D;  3PXT A;  2OZ1 B;  1PPJ D;  2C8S A;  1H9Y A;  1RZ5 A;  2ZON G;  4WQC A;  5C0Z A;  2VHD A;  3SVW A;  4O1Q A;  1CIH A;  3WFC C;  2N9J A;  4XYD B;  3HQ7 A;  1U75 B;  3A9F A;  4EID A;  1NTZ D;  2BCN B;  1M60 A;  3ZCF A;  4UB8 V;  3NBS A;  1AOQ A;  1BL9 A;  1RAP A;  1COR A;  1S5L V;  5E79 V;  1SQX D;  4FA9 A;  1NU1 D;  1I8O A;  2DVH A; 
#chains in the Genus database with same CATH topology
 1COT A;  1SQB D;  1CXC A;  2CA3 B;  5CIH B;  1HZV A;  1RZ6 A;  1CTZ A;  3L70 D;  4YE1 A;  1I55 A;  1C6S A;  4XXL A;  4WQ8 A;  1DT1 A;  1E29 A;  1F1F A;  1A56 A;  1DIQ C;  5B5E V;  1C7M A;  3VRD A;  1ZZH A;  1FI3 A;  1W5C T;  5GTI V;  1FJ0 A;  1C2N A;  3OA8 A;  1YIC A;  1AKK A;  3H1H D;  155C A;  1MG3 D;  1CRC A;  1YFC A;  5H2F V;  2N18 B;  1QYZ A;  3CWB D;  3H1K D;  4IL6 V;  3L75 D;  3PXS A;  1I6E A;  1BCC D;  1CXA A;  3A0B V;  3ZOW A;  2FWL A;  4AAL A;  1NNO A;  3TYI A;  4H0K A;  4Q5P A;  1DW1 A;  1RAQ A;  2V08 A;  3CXH W;  4WQD A;  1OAE A;  1FI9 A;  1CTJ A;  3OCD A;  3MK7 C;  4NFG B;  1M6Z A;  3A0H V;  1DVH A;  1HH7 A;  1E2R A;  1IRV A;  1A2S A;  3HQ9 A;  1FCD C;  1CRH A;  3MK7 B;  1NMI A;  2CE0 A;  1H32 B;  2JQR A;  3CU4 A;  4H0J A;  4PJ0 V;  1K3H A;  2CE1 A;  3DR0 A;  1CCH A;  3JBT B;  1CIE A;  2C9X B;  2B11 B;  4EIC A;  3VYM A;  4DY9 A;  2C1U A;  5KKZ B;  1I54 A;  3RN0 A;  1H31 A;  2AXT V;  4UB6 V;  1YEB A;  2BLF B;  2MHM A;  1A8C A;  4FB1 A;  4PWA A;  1C6R A;  1AYG A;  2C1D B;  351C A;  5DJQ C;  1HCM A;  4P4Q B;  3BCC D;  2D0W A;  3DMI A;  1H9X A;  2CXB A;  1L9J C;  1EB7 A;  1SQP D;  1DW2 A;  1YTC A;  1SQV D;  2BCC D;  1CRG A;  1OCD A;  4V2K A;  1N50 A;  1CYJ A;  1I5T A;  4PW9 B;  3ORV A;  1KIB A;  4PD4 D;  2ORL A;  1JDL A;  1GQ1 A;  1MG2 D;  2N3B A;  1DVV A;  2BH4 X;  3O20 A;  2ZXY A;  2BGV X;  1CRJ A;  2CA4 B;  2LIR A;  2EXV A;  3ZOX A;  4WQA A;  3CX5 D;  3VNW A;  2AI5 A;  4WQ7 A;  2GC4 D;  1PP9 D;  1F1C A;  1GIW A;  2QJY B;  2N9I A;  1CYC A;  3O0R C;  1S6V B;  4FA4 A;  1NML A;  1CHI A;  4FA5 A;  4AX3 A;  5CIG B;  2PAC A;  1E8E A;  2YK3 A;  5GTH V;  1KYO D;  3ZOO A;  3WFD C;  1CED A;  2ZBO A;  1FHB A;  3HQ6 A;  1C52 A;  1FOC A;  1DW0 A;  1IZL 0;  2B4Z A;  3M97 X;  3CP5 A;  1NTK D;  1KX2 A;  2LIT A;  1N15 A;  4Y5R A;  1GJQ A;  4WQE A;  3RMZ A;  1H32 A;  5KLV D;  5TIS V;  1U74 B;  1KB9 D;  1CSV A;  2YQB A;  4D6T D;  1NIR A;  1GDV A;  2B10 B;  5DF5 A;  3PXW A;  2A06 D;  3H1I D;  1WEJ F;  1YEA A;  2OZ1 A;  4J20 A;  1LC1 A;  1QL3 A;  1HRC A;  4L1Q A;  4O1W A;  4AAN A;  3ZBM A;  3OA8 B;  2YIU B;  1YNR A;  2HV4 A;  4K3I A;  3TGU D;  4FA1 A;  1SQQ D;  1K3G A;  4JCG A;  1QKS A;  1H33 B;  1CRY A;  3WUI A;  4N0K A;  1CO6 A;  1B7V A;  3D0W A;  4FAV A;  3WFB C;  1LS9 A;  5B66 V;  2GC7 D;  2AIU A;  3RN1 A;  3CXH D;  4EIE A;  2FRC A;  5DFS A;  3L73 D;  2D0S A;  3NWV A;  3OCD B;  3WC8 A;  2QJK B;  3CX5 W;  3SJL A;  2PCB B;  5DJQ B;  1DII C;  1H1O A;  3NBT A;  1CTY A;  3HQ8 A;  3PH2 B;  4AAO A;  3L4M A;  2BH5 X;  451C A;  1M70 A;  3ZIY A;  5CIE B;  4KMG A;  1QL4 A;  1KYO W;  3SWS A;  3H1L D;  1H31 B;  1AOF A;  4QAO A;  1VYD A;  4GYD A;  1LMS A;  1KX7 A;  2PCC B;  1N90 A;  1CIF A;  4AAM A;  5AUR A;  3L71 D;  1DW3 A;  3KZI V;  1HJ5 A;  1MZ4 A;  1BE3 D;  2V07 A;  2JTI B;  1I8P A;  4L3G A;  2FYN B;  3C2C A;  2YCC A;  1QN2 A;  5CID B;  1GU2 A;  1EZV D;  5CIF B;  1BGY D;  3O1Y A;  5KAF V;  1HZU A;  1N9C A;  1CCR A;  1CRI A;  5IY5 1;  2C2C A;  1IO3 A;  1W2L A;  2IBZ D;  1LC2 A;  1CC5 A;  1HRO A;  2MTA C;  3RLM A;  1WVE C;  1HJ3 A;  1L0L D;  2GIW A;  1L9B C;  3SLE A;  5B6Q A;  5CYT R;  3WU2 V;  2N18 C;  3O5C A;  2FYU D;  1J3S A;  1C6O A;  2N3Y A;  1YCC A;  3WFE C;  2XTS B;  3L4O A;  5KAI V;  1H33 A;  1CYI A;  3ZOY A;  2C1V A;  2GB8 B;  1YIQ A;  3H1J D;  1NTM D;  2DGE A;  4RSZ A;  4WQB A;  1P84 D;  5CIC B;  2B12 B;  1IRW A;  1KB0 A;  5CIB B;  3L72 D;  1FI7 A;  2C1D A;  3X39 A;  2B0Z B;  2I8F A;  4FAN A;  1HJ4 A;  4EIF A;  5KLI B;  1CSU A;  1I6D A;  1IQC A;  3CYT I;  1CSW A;  3SXT A;  1C75 A;  3DP5 A;  4LJI A;  1CSX A;  1R0Q A;  2QJP B;  5C9M A;  4U3F D;  3L74 D;  2L4D A;  2ZOO A;  1ZRT D;  1GKS A;  1C2R A;  1KV9 A;  1CHH A;  1CIG A;  4GED B;  5EXQ A;  2BPB B;  1LFM A;  1ETP A;  4L3H A;  2ZZS 1;  4MU8 A;  1CNO A;  4WQ9 A;  1CHJ A;  1L0N D;  3PXT A;  2OZ1 B;  1PPJ D;  2C8S A;  1H9Y A;  1RZ5 A;  2ZON G;  4WQC A;  5C0Z A;  2VHD A;  3SVW A;  4O1Q A;  1CIH A;  3WFC C;  2N9J A;  4XYD B;  3HQ7 A;  1U75 B;  3A9F A;  4EID A;  1NTZ D;  2BCN B;  1M60 A;  3ZCF A;  4UB8 V;  3NBS A;  1AOQ A;  1BL9 A;  1RAP A;  1COR A;  1S5L V;  5E79 V;  1SQX D;  4FA9 A;  1NU1 D;  1I8O A;  2DVH A; 
#chains in the Genus database with same CATH homology
 1COT A;  1SQB D;  1CXC A;  2CA3 B;  5CIH B;  1HZV A;  1RZ6 A;  1CTZ A;  3L70 D;  4YE1 A;  1I55 A;  1C6S A;  4XXL A;  4WQ8 A;  1DT1 A;  1E29 A;  1F1F A;  1A56 A;  1DIQ C;  5B5E V;  1C7M A;  3VRD A;  1ZZH A;  1FI3 A;  1W5C T;  5GTI V;  1FJ0 A;  1C2N A;  3OA8 A;  1YIC A;  1AKK A;  3H1H D;  155C A;  1MG3 D;  1CRC A;  1YFC A;  5H2F V;  2N18 B;  1QYZ A;  3CWB D;  3H1K D;  4IL6 V;  3L75 D;  3PXS A;  1I6E A;  1BCC D;  1CXA A;  3A0B V;  3ZOW A;  2FWL A;  4AAL A;  1NNO A;  3TYI A;  4H0K A;  4Q5P A;  1DW1 A;  1RAQ A;  2V08 A;  3CXH W;  4WQD A;  1OAE A;  1FI9 A;  1CTJ A;  3OCD A;  3MK7 C;  4NFG B;  1M6Z A;  3A0H V;  1DVH A;  1HH7 A;  1E2R A;  1IRV A;  1A2S A;  3HQ9 A;  1FCD C;  1CRH A;  3MK7 B;  1NMI A;  2CE0 A;  1H32 B;  2JQR A;  3CU4 A;  4H0J A;  4PJ0 V;  1K3H A;  2CE1 A;  3DR0 A;  1CCH A;  3JBT B;  1CIE A;  2C9X B;  2B11 B;  4EIC A;  3VYM A;  4DY9 A;  2C1U A;  5KKZ B;  1I54 A;  3RN0 A;  1H31 A;  2AXT V;  4UB6 V;  1YEB A;  2BLF B;  2MHM A;  1A8C A;  4FB1 A;  4PWA A;  1C6R A;  1AYG A;  2C1D B;  351C A;  5DJQ C;  1HCM A;  4P4Q B;  3BCC D;  2D0W A;  3DMI A;  1H9X A;  2CXB A;  1L9J C;  1EB7 A;  1SQP D;  1DW2 A;  1YTC A;  1SQV D;  2BCC D;  1CRG A;  1OCD A;  4V2K A;  1N50 A;  1CYJ A;  1I5T A;  4PW9 B;  3ORV A;  1KIB A;  4PD4 D;  2ORL A;  1JDL A;  1GQ1 A;  1MG2 D;  2N3B A;  1DVV A;  2BH4 X;  3O20 A;  2ZXY A;  2BGV X;  1CRJ A;  2CA4 B;  2LIR A;  2EXV A;  3ZOX A;  4WQA A;  3CX5 D;  3VNW A;  2AI5 A;  4WQ7 A;  2GC4 D;  1PP9 D;  1F1C A;  1GIW A;  2QJY B;  2N9I A;  1CYC A;  3O0R C;  1S6V B;  4FA4 A;  1NML A;  1CHI A;  4FA5 A;  4AX3 A;  5CIG B;  2PAC A;  1E8E A;  2YK3 A;  5GTH V;  1KYO D;  3ZOO A;  3WFD C;  1CED A;  2ZBO A;  1FHB A;  3HQ6 A;  1C52 A;  1FOC A;  1DW0 A;  1IZL 0;  2B4Z A;  3M97 X;  3CP5 A;  1NTK D;  1KX2 A;  2LIT A;  1N15 A;  4Y5R A;  1GJQ A;  4WQE A;  3RMZ A;  1H32 A;  5KLV D;  5TIS V;  1U74 B;  1KB9 D;  1CSV A;  2YQB A;  4D6T D;  1NIR A;  1GDV A;  2B10 B;  5DF5 A;  3PXW A;  2A06 D;  3H1I D;  1WEJ F;  1YEA A;  2OZ1 A;  4J20 A;  1LC1 A;  1QL3 A;  1HRC A;  4L1Q A;  4O1W A;  4AAN A;  3ZBM A;  3OA8 B;  2YIU B;  1YNR A;  2HV4 A;  4K3I A;  3TGU D;  4FA1 A;  1SQQ D;  1K3G A;  4JCG A;  1QKS A;  1H33 B;  1CRY A;  3WUI A;  4N0K A;  1CO6 A;  1B7V A;  4FAV A;  3WFB C;  1LS9 A;  5B66 V;  2GC7 D;  2AIU A;  3RN1 A;  3CXH D;  4EIE A;  2FRC A;  5DFS A;  3L73 D;  2D0S A;  3NWV A;  3OCD B;  3WC8 A;  2QJK B;  3CX5 W;  3SJL A;  2PCB B;  5DJQ B;  1DII C;  1H1O A;  3NBT A;  1CTY A;  3HQ8 A;  3PH2 B;  4AAO A;  3L4M A;  2BH5 X;  451C A;  1M70 A;  3ZIY A;  5CIE B;  4KMG A;  1QL4 A;  1KYO W;  3SWS A;  3H1L D;  1H31 B;  1AOF A;  4QAO A;  1VYD A;  4GYD A;  1LMS A;  1KX7 A;  2PCC B;  1N90 A;  1CIF A;  4AAM A;  5AUR A;  3L71 D;  1DW3 A;  3KZI V;  1HJ5 A;  1MZ4 A;  1BE3 D;  2V07 A;  2JTI B;  1I8P A;  4L3G A;  2FYN B;  3C2C A;  2YCC A;  1QN2 A;  5CID B;  1GU2 A;  1EZV D;  5CIF B;  1BGY D;  3O1Y A;  5KAF V;  1HZU A;  1N9C A;  1CCR A;  1CRI A;  5IY5 1;  2C2C A;  1IO3 A;  1W2L A;  2IBZ D;  1LC2 A;  1CC5 A;  1HRO A;  2MTA C;  3RLM A;  1WVE C;  1HJ3 A;  1L0L D;  2GIW A;  1L9B C;  3SLE A;  5B6Q A;  5CYT R;  3WU2 V;  2N18 C;  3O5C A;  2FYU D;  1J3S A;  1C6O A;  2N3Y A;  1YCC A;  3WFE C;  2XTS B;  3L4O A;  5KAI V;  1H33 A;  1CYI A;  3ZOY A;  2C1V A;  2GB8 B;  1YIQ A;  3H1J D;  1NTM D;  2DGE A;  4RSZ A;  4WQB A;  1P84 D;  5CIC B;  2B12 B;  1IRW A;  1KB0 A;  5CIB B;  3L72 D;  1FI7 A;  2C1D A;  3X39 A;  2B0Z B;  2I8F A;  4FAN A;  1HJ4 A;  4EIF A;  5KLI B;  1CSU A;  1I6D A;  1IQC A;  3CYT I;  1CSW A;  3SXT A;  1C75 A;  3DP5 A;  4LJI A;  1CSX A;  1R0Q A;  2QJP B;  5C9M A;  4U3F D;  3L74 D;  2L4D A;  2ZOO A;  1ZRT D;  1GKS A;  1C2R A;  1KV9 A;  1CHH A;  1CIG A;  4GED B;  5EXQ A;  2BPB B;  1LFM A;  1ETP A;  4L3H A;  2ZZS 1;  4MU8 A;  1CNO A;  4WQ9 A;  1CHJ A;  1L0N D;  3PXT A;  2OZ1 B;  1PPJ D;  2C8S A;  1H9Y A;  1RZ5 A;  2ZON G;  4WQC A;  5C0Z A;  2VHD A;  3SVW A;  4O1Q A;  1CIH A;  3WFC C;  2N9J A;  4XYD B;  3HQ7 A;  1U75 B;  3A9F A;  4EID A;  1NTZ D;  2BCN B;  1M60 A;  3ZCF A;  4UB8 V;  3NBS A;  1AOQ A;  1BL9 A;  1RAP A;  1COR A;  1S5L V;  5E79 V;  1SQX D;  4FA9 A;  1NU1 D;  1I8O A;  2DVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...