5B66V

Crystal structure analysis of photosystem ii complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
137
structure length
137
Chain Sequence
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 47
structure length 137
sequence length 137
chains with identical sequence v
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF14495 Cytochrom_C550 Cytochrome c-550 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5b66V00
5CIFB 1HCMA 1MG3D 1M70A 3ZBMA 2L4DA 4J20A 1CCHA 1M60A 1CXCA 2ZOOA 351CA 4LJIA 3JBTB 1FJ0A 4WQAA 4DY9A 4GYDA 4AAMA 2QJYB 4IL6V 2N3BA 1CRGA 4XXLA 3RMZA 5GTIV 1CXAA 4FA9A 3CXHD 5CICB 1LFMA 2DGEA 1GIWA 1H9YA 1E29A 1OAEA 1CSVA 2MTAC 4EIEA 1C2RA 5CIGB 1F1CA 1L0LD 3L4MA 1HH7A 1CSWA 3L71D 1CRYA 1DVHA 1QN2A 1IRWA 1CO6A 1H32A 4PJ0V 1YIQA 4L1QA 2BPBB 1KYOD 1CIHA 1C6SA 1CYJA 3PXSA 4P4QB 5TISV 1LC2A 1FHBA 1CYCA 2B0ZB 2N9IA 4XYDB 2ZONG 1A8CA 3PH2B 3DR0A 3SJLA 2GC4D 1CSXA 5B5EV 2B10B 3VNWA 3OCDA 1QYZA 1KB9D 2CA4B 4WQ7A 1IRVA 3WFBC 2JTIB 3L73D 3H1ID 4FAVA 5GTHV 1HJ4A 3SXTA 2FRCA 2JQRA 1H31A 2FYUD 2V08A 3MK7B 4Y5RA 1OCDA 1LS9A 2PCCB 2CXBA 4L3GA 5CIDB 1CYIA 1BL9A 4PW9B 1C75A 1CTJA 2N9JA 1BE3D 1M6ZA 2CE1A 1W5CT 3C2CA 3ZIYA 1KYOW 4EIFA 3MK7C 1W2LA 2YQBA 5DJQB 2C8SA 1YFCA 1RZ5A 1PPJD 1DW0A 3DMIA 3CYTI 2FWLA 1FI3A 4O1QA 4GEDB 2LITA 3WU2V 2C1UA 1FCDC 1I54A 1CHJA 3PXTA 3VYMA 451CA 1L0ND 5H2FV 5DJQC 5E79V 5KAFV 1N90A 2B4ZA 4K3IA 2BGVX 3L72D 2PACA 3L74D 1JDLA 1E8EA 1YNRA 3X39A 3VRDA 5DF5A 1S6VB 2IBZD 2BH5X 3WFCC 1CRIA 1CRHA 1CIFA 4UB8V 1MG2D 4L3HA 1C6OA 5CIEB 1DIQC 1DW3A 1DIIC 1KX7A 1NNOA 4WQ9A 1H32B 4H0JA 1RAQA 1CSUA 1ZZHA 1P84D 2A06D 1C2NA 2BLFB 3H1KD 4N0KA 2B12B 1DW1A 1ZRTD 1PP9D 1BGYD 1U75B 5C0ZA 1SQBD 1C52A 5DFSA 3CX5W 1H1OA 2PCBB 2CA3B 3OCDB 1I5TA 1IO3A 1EB7A 1A2SA 1FOCA 3WUIA 5EXQA 1IZL0 1QL3A 2B11B 2FYNB 1SQPD 3SWSA 1NU1D 3ORVA 2BCNB 2C1DB 1HZUA 1AYGA 3L4OA 2HV4A 1NMIA 2VHDA 2DVHA 2ZXYA 1CRJA 2XTSB 5AURA 3M97X 3ZOXA 4YE1A 1RAPA 1FI9A 3O0RC 4H0KA 3HQ7A 1SQVD 2EXVA 1LMSA 3WFDC 4FB1A 1KIBA 2BH4X 1GKSA 4EICA 2LIRA 1CC5A 1I55A 1KB0A 2AI5A 1ETPA 3HQ8A 1H33A 4FA4A 1HROA 3L70D 1CTZA 1B7VA 1CNOA 1L9BC 3NWVA 1H9XA 5KLVD 5KLIB 1BCCD 1VYDA 1HJ5A 1NTKD 3OA8A 3CX5D 1GJQA 1WVEC 5C9MA 1CCRA 2C2CA 4KMGA 1SQQD 3H1JD 1DW2A 2YCCA 3WC8A 1COTA 5B66V 2YK3A 2D0WA 1LC1A 4FA1A 3KZIV 4FA5A 3HQ9A 1YICA 4AX3A 3CWBD 4WQEA 5CYTR 1RZ6A 1CORA 1GQ1A 2GIWA 3ZOOA 1N9CA 155CA 2GB8B 3HQ6A 4RSZA 1YCCA 1U74B 2GC7D 3SVWA 2OZ1A 1QKSA 2ZZS1 3L75D 1HRCA 4V2KA 1AOFA 1GU2A 1CIEA 1K3GA 1HJ3A 4PD4D 3O5CA 2ORLA 4AALA 1HZVA 2BCCD 2N18B 4NFGB 3CP5A 3TGUD 5B6QA 1KV9A 1YTCA 4WQBA 1GDVA 2MHMA 1R0QA 1NTZD 4AAOA 2C9XB 1DT1A 1H31B 4WQDA 2N18C 3A0BV 1K3HA 1YEAA 1E2RA 1NIRA 1I8PA 1N50A 3WFEC 1DVVA 2YIUB 3H1HD 4WQ8A 3NBSA 3TYIA 3A9FA 3DP5A 1H33B 2I8FA 5CIBB 3ZOYA 4EIDA 1J3SA 1AKKA 4UB6V 5KAIV 2C1DA 2D0SA 3SLEA 3RN0A 5KKZB 3O1YA 3O20A 4FANA 1CHHA 1CTYA 1EZVD 3CXHW 1F1FA 1CRCA 3OA8B 3BCCD 3PXWA 3NBTA 3ZOWA 5IY51 4D6TD 1SQXD 1YEBA 4MU8A 1CHIA 1KX2A 1I6EA 4QAOA 1S5LV 1NMLA 3RN1A 1QL4A 4JCGA 2QJPB 2V07A 3CU4A 1N15A 1NTMD 1FI7A 1IQCA 1CIGA 3ZCFA 1L9JC 2ZBOA 2AXTV 2QJKB 4AANA 1MZ4A 1WEJF 3A0HV 2C1VA 3H1LD 5CIHB 1I6DA 4U3FD 3RLMA 4O1WA 2CE0A 1I8OA 2N3YA 2OZ1B 1C7MA 4PWAA 1A56A 4WQCA 1AOQA 2AIUA 4Q5PA 1CEDA 1C6RA
chains in the Genus database with same CATH superfamily
5CIFB 1HCMA 1MG3D 1M70A 3ZBMA 2L4DA 4J20A 1CCHA 1M60A 1CXCA 2ZOOA 351CA 4LJIA 3JBTB 1FJ0A 4WQAA 4DY9A 4GYDA 4AAMA 2QJYB 4IL6V 2N3BA 1CRGA 4XXLA 3RMZA 5GTIV 1CXAA 4FA9A 3CXHD 5CICB 1LFMA 2DGEA 1GIWA 1H9YA 1E29A 1OAEA 1CSVA 2MTAC 4EIEA 1C2RA 5CIGB 1F1CA 1L0LD 3L4MA 1HH7A 1CSWA 3L71D 1CRYA 1DVHA 1QN2A 1IRWA 1CO6A 1H32A 4PJ0V 1YIQA 4L1QA 2BPBB 1KYOD 1CIHA 1C6SA 1CYJA 3PXSA 4P4QB 5TISV 1LC2A 1FHBA 1CYCA 2B0ZB 2N9IA 4XYDB 2ZONG 1A8CA 3PH2B 3DR0A 3SJLA 2GC4D 1CSXA 5B5EV 2B10B 3VNWA 3OCDA 1QYZA 1KB9D 2CA4B 4WQ7A 1IRVA 3WFBC 2JTIB 3L73D 3H1ID 4FAVA 5GTHV 1HJ4A 3SXTA 2FRCA 2JQRA 1H31A 2FYUD 2V08A 3MK7B 4Y5RA 1OCDA 3D0WA 1LS9A 2PCCB 2CXBA 4L3GA 5CIDB 1CYIA 1BL9A 4PW9B 1C75A 1CTJA 2N9JA 1BE3D 1M6ZA 2CE1A 1W5CT 3C2CA 3ZIYA 1KYOW 4EIFA 3MK7C 1W2LA 2YQBA 5DJQB 2C8SA 1YFCA 1RZ5A 1PPJD 1DW0A 3DMIA 3CYTI 2FWLA 1FI3A 4O1QA 4GEDB 2LITA 3WU2V 2C1UA 1FCDC 1I54A 1CHJA 3PXTA 3VYMA 451CA 1L0ND 5H2FV 5DJQC 5E79V 5KAFV 1N90A 2B4ZA 4K3IA 2BGVX 3L72D 2PACA 3L74D 1JDLA 1E8EA 1YNRA 3X39A 3VRDA 5DF5A 1S6VB 2IBZD 2BH5X 3WFCC 1CRIA 1CRHA 1CIFA 4UB8V 1MG2D 4L3HA 1C6OA 5CIEB 1DIQC 1DW3A 1DIIC 1KX7A 1NNOA 4WQ9A 1H32B 4H0JA 1RAQA 1CSUA 1ZZHA 1P84D 2A06D 1C2NA 2BLFB 3H1KD 4N0KA 2B12B 1DW1A 1ZRTD 1PP9D 1BGYD 1U75B 5C0ZA 1SQBD 1C52A 5DFSA 3CX5W 1H1OA 2PCBB 2CA3B 3OCDB 1I5TA 1IO3A 1EB7A 1A2SA 1FOCA 3WUIA 5EXQA 1IZL0 1QL3A 2B11B 2FYNB 1SQPD 3SWSA 1NU1D 3ORVA 2BCNB 2C1DB 1HZUA 1AYGA 3L4OA 2HV4A 1NMIA 2VHDA 2DVHA 2ZXYA 1CRJA 2XTSB 5AURA 3M97X 3ZOXA 4YE1A 1RAPA 1FI9A 3O0RC 4H0KA 3HQ7A 1SQVD 2EXVA 1LMSA 3WFDC 4FB1A 1KIBA 2BH4X 1GKSA 4EICA 2LIRA 1CC5A 1I55A 1KB0A 2AI5A 1ETPA 3HQ8A 1H33A 4FA4A 1HROA 3L70D 1CTZA 1B7VA 1CNOA 1L9BC 3NWVA 1H9XA 5KLVD 5KLIB 1BCCD 1VYDA 1HJ5A 1NTKD 3OA8A 3CX5D 1GJQA 1WVEC 5C9MA 1CCRA 2C2CA 4KMGA 1SQQD 3H1JD 1DW2A 2YCCA 3WC8A 1COTA 5B66V 2YK3A 2D0WA 1LC1A 4FA1A 3KZIV 4FA5A 3HQ9A 1YICA 4AX3A 3CWBD 4WQEA 5CYTR 1RZ6A 1CORA 1GQ1A 2GIWA 3ZOOA 1N9CA 155CA 2GB8B 3HQ6A 4RSZA 1YCCA 1U74B 2GC7D 3SVWA 2OZ1A 1QKSA 2ZZS1 3L75D 1HRCA 4V2KA 1AOFA 1GU2A 1CIEA 1K3GA 1HJ3A 4PD4D 3O5CA 2ORLA 4AALA 1HZVA 2BCCD 2N18B 4NFGB 3CP5A 3TGUD 5B6QA 1KV9A 1YTCA 4WQBA 1GDVA 2MHMA 1R0QA 1NTZD 4AAOA 2C9XB 1DT1A 1H31B 4WQDA 2N18C 3A0BV 1K3HA 1YEAA 1E2RA 1NIRA 1I8PA 1N50A 3WFEC 1DVVA 2YIUB 3H1HD 4WQ8A 3NBSA 3TYIA 3A9FA 3DP5A 1H33B 2I8FA 5CIBB 3ZOYA 4EIDA 1J3SA 1AKKA 4UB6V 5KAIV 2C1DA 2D0SA 3SLEA 3RN0A 5KKZB 3O1YA 3O20A 4FANA 1CHHA 1CTYA 1EZVD 3CXHW 1F1FA 1CRCA 3OA8B 3BCCD 3PXWA 3NBTA 3ZOWA 5IY51 4D6TD 1SQXD 1YEBA 4MU8A 1CHIA 1KX2A 1I6EA 4QAOA 1S5LV 1NMLA 3RN1A 1QL4A 4JCGA 2QJPB 2V07A 3CU4A 1N15A 1NTMD 1FI7A 1IQCA 1CIGA 3ZCFA 1L9JC 2ZBOA 2AXTV 2QJKB 4AANA 1MZ4A 1WEJF 3A0HV 2C1VA 3H1LD 5CIHB 1I6DA 4U3FD 3RLMA 4O1WA 2CE0A 1I8OA 2N3YA 2OZ1B 1C7MA 4PWAA 1A56A 4WQCA 1AOQA 2AIUA 4Q5PA 1CEDA 1C6RA
chains in the Genus database with same CATH topology
5CIFB 1HCMA 1MG3D 1M70A 3ZBMA 2L4DA 4J20A 1CCHA 1M60A 1CXCA 2ZOOA 351CA 4LJIA 3JBTB 1FJ0A 4WQAA 4DY9A 4GYDA 4AAMA 2QJYB 4IL6V 2N3BA 1CRGA 4XXLA 3RMZA 5GTIV 1CXAA 4FA9A 3CXHD 5CICB 1LFMA 2DGEA 1GIWA 1H9YA 1E29A 1OAEA 1CSVA 2MTAC 4EIEA 1C2RA 5CIGB 1F1CA 1L0LD 3L4MA 1HH7A 1CSWA 3L71D 1CRYA 1DVHA 1QN2A 1IRWA 1CO6A 1H32A 4PJ0V 1YIQA 4L1QA 2BPBB 1KYOD 1CIHA 1C6SA 1CYJA 3PXSA 4P4QB 5TISV 1LC2A 1FHBA 1CYCA 2B0ZB 2N9IA 4XYDB 2ZONG 1A8CA 3PH2B 3DR0A 3SJLA 2GC4D 1CSXA 5B5EV 2B10B 3VNWA 3OCDA 1QYZA 1KB9D 2CA4B 4WQ7A 1IRVA 3WFBC 2JTIB 3L73D 3H1ID 4FAVA 5GTHV 1HJ4A 3SXTA 2FRCA 2JQRA 1H31A 2FYUD 2V08A 3MK7B 4Y5RA 1OCDA 1LS9A 2PCCB 2CXBA 4L3GA 5CIDB 1CYIA 1BL9A 4PW9B 1C75A 1CTJA 2N9JA 1BE3D 1M6ZA 2CE1A 1W5CT 3C2CA 3ZIYA 1KYOW 4EIFA 3MK7C 1W2LA 2YQBA 5DJQB 2C8SA 1YFCA 1RZ5A 1PPJD 1DW0A 3DMIA 3CYTI 2FWLA 1FI3A 4O1QA 4GEDB 2LITA 3WU2V 2C1UA 1FCDC 1I54A 1CHJA 3PXTA 3VYMA 451CA 1L0ND 5H2FV 5DJQC 5E79V 5KAFV 1N90A 2B4ZA 4K3IA 2BGVX 3L72D 2PACA 3L74D 1JDLA 1E8EA 1YNRA 3X39A 3VRDA 5DF5A 1S6VB 2IBZD 2BH5X 3WFCC 1CRIA 1CRHA 1CIFA 4UB8V 1MG2D 4L3HA 1C6OA 5CIEB 1DIQC 1DW3A 1DIIC 1KX7A 1NNOA 4WQ9A 1H32B 4H0JA 1RAQA 1CSUA 1ZZHA 1P84D 2A06D 1C2NA 2BLFB 3H1KD 4N0KA 2B12B 1DW1A 1ZRTD 1PP9D 1BGYD 1U75B 5C0ZA 1SQBD 1C52A 5DFSA 3CX5W 1H1OA 2PCBB 2CA3B 3OCDB 1I5TA 1IO3A 1EB7A 1A2SA 1FOCA 3WUIA 5EXQA 1IZL0 1QL3A 2B11B 2FYNB 1SQPD 3SWSA 1NU1D 3ORVA 2BCNB 2C1DB 1HZUA 1AYGA 3L4OA 2HV4A 1NMIA 2VHDA 2DVHA 2ZXYA 1CRJA 2XTSB 5AURA 3M97X 3ZOXA 4YE1A 1RAPA 1FI9A 3O0RC 4H0KA 3HQ7A 1SQVD 2EXVA 1LMSA 3WFDC 4FB1A 1KIBA 2BH4X 1GKSA 4EICA 2LIRA 1CC5A 1I55A 1KB0A 2AI5A 1ETPA 3HQ8A 1H33A 4FA4A 1HROA 3L70D 1CTZA 1B7VA 1CNOA 1L9BC 3NWVA 1H9XA 5KLVD 5KLIB 1BCCD 1VYDA 1HJ5A 1NTKD 3OA8A 3CX5D 1GJQA 1WVEC 5C9MA 1CCRA 2C2CA 4KMGA 1SQQD 3H1JD 1DW2A 2YCCA 3WC8A 1COTA 5B66V 2YK3A 2D0WA 1LC1A 4FA1A 3KZIV 4FA5A 3HQ9A 1YICA 4AX3A 3CWBD 4WQEA 5CYTR 1RZ6A 1CORA 1GQ1A 2GIWA 3ZOOA 1N9CA 155CA 2GB8B 3HQ6A 4RSZA 1YCCA 1U74B 2GC7D 3SVWA 2OZ1A 1QKSA 2ZZS1 3L75D 1HRCA 4V2KA 1AOFA 1GU2A 1CIEA 1K3GA 1HJ3A 4PD4D 3O5CA 2ORLA 4AALA 1HZVA 2BCCD 2N18B 4NFGB 3CP5A 3TGUD 5B6QA 1KV9A 1YTCA 4WQBA 1GDVA 2MHMA 1R0QA 1NTZD 4AAOA 2C9XB 1DT1A 1H31B 4WQDA 2N18C 3A0BV 1K3HA 1YEAA 1E2RA 1NIRA 1I8PA 1N50A 3WFEC 1DVVA 2YIUB 3H1HD 4WQ8A 3NBSA 3TYIA 3A9FA 3DP5A 1H33B 2I8FA 5CIBB 3ZOYA 4EIDA 1J3SA 1AKKA 4UB6V 5KAIV 2C1DA 2D0SA 3SLEA 3RN0A 5KKZB 3O1YA 3O20A 4FANA 1CHHA 1CTYA 1EZVD 3CXHW 1F1FA 1CRCA 3OA8B 3BCCD 3PXWA 3NBTA 3ZOWA 5IY51 4D6TD 1SQXD 1YEBA 4MU8A 1CHIA 1KX2A 1I6EA 4QAOA 1S5LV 1NMLA 3RN1A 1QL4A 4JCGA 2QJPB 2V07A 3CU4A 1N15A 1NTMD 1FI7A 1IQCA 1CIGA 3ZCFA 1L9JC 2ZBOA 2AXTV 2QJKB 4AANA 1MZ4A 1WEJF 3A0HV 2C1VA 3H1LD 5CIHB 1I6DA 4U3FD 3RLMA 4O1WA 2CE0A 1I8OA 2N3YA 2OZ1B 1C7MA 4PWAA 1A56A 4WQCA 1AOQA 2AIUA 4Q5PA 1CEDA 1C6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CIF B;  1HCM A;  1MG3 D;  1M70 A;  3ZBM A;  2L4D A;  4J20 A;  1CCH A;  1M60 A;  1CXC A;  2ZOO A;  351C A;  4LJI A;  3JBT B;  1FJ0 A;  4WQA A;  4DY9 A;  4GYD A;  4AAM A;  2QJY B;  4IL6 V;  2N3B A;  1CRG A;  4XXL A;  3RMZ A;  5GTI V;  1CXA A;  4FA9 A;  3CXH D;  5CIC B;  1LFM A;  2DGE A;  1GIW A;  1H9Y A;  1E29 A;  1OAE A;  1CSV A;  2MTA C;  4EIE A;  1C2R A;  5CIG B;  1F1C A;  1L0L D;  3L4M A;  1HH7 A;  1CSW A;  3L71 D;  1CRY A;  1DVH A;  1QN2 A;  1IRW A;  1CO6 A;  1H32 A;  4PJ0 V;  1YIQ A;  4L1Q A;  2BPB B;  1KYO D;  1CIH A;  1C6S A;  1CYJ A;  3PXS A;  4P4Q B;  5TIS V;  1LC2 A;  1FHB A;  1CYC A;  2B0Z B;  2N9I A;  4XYD B;  2ZON G;  1A8C A;  3PH2 B;  3DR0 A;  3SJL A;  2GC4 D;  1CSX A;  5B5E V;  2B10 B;  3VNW A;  3OCD A;  1QYZ A;  1KB9 D;  2CA4 B;  4WQ7 A;  1IRV A;  3WFB C;  2JTI B;  3L73 D;  3H1I D;  4FAV A;  5GTH V;  1HJ4 A;  3SXT A;  2FRC A;  2JQR A;  1H31 A;  2FYU D;  2V08 A;  3MK7 B;  4Y5R A;  1OCD A;  1LS9 A;  2PCC B;  2CXB A;  4L3G A;  5CID B;  1CYI A;  1BL9 A;  4PW9 B;  1C75 A;  1CTJ A;  2N9J A;  1BE3 D;  1M6Z A;  2CE1 A;  1W5C T;  3C2C A;  3ZIY A;  1KYO W;  4EIF A;  3MK7 C;  1W2L A;  2YQB A;  5DJQ B;  2C8S A;  1YFC A;  1RZ5 A;  1PPJ D;  1DW0 A;  3DMI A;  3CYT I;  2FWL A;  1FI3 A;  4O1Q A;  4GED B;  2LIT A;  3WU2 V;  2C1U A;  1FCD C;  1I54 A;  1CHJ A;  3PXT A;  3VYM A;  451C A;  1L0N D;  5H2F V;  5DJQ C;  5E79 V;  5KAF V;  1N90 A;  2B4Z A;  4K3I A;  2BGV X;  3L72 D;  2PAC A;  3L74 D;  1JDL A;  1E8E A;  1YNR A;  3X39 A;  3VRD A;  5DF5 A;  1S6V B;  2IBZ D;  2BH5 X;  3WFC C;  1CRI A;  1CRH A;  1CIF A;  4UB8 V;  1MG2 D;  4L3H A;  1C6O A;  5CIE B;  1DIQ C;  1DW3 A;  1DII C;  1KX7 A;  1NNO A;  4WQ9 A;  1H32 B;  4H0J A;  1RAQ A;  1CSU A;  1ZZH A;  1P84 D;  2A06 D;  1C2N A;  2BLF B;  3H1K D;  4N0K A;  2B12 B;  1DW1 A;  1ZRT D;  1PP9 D;  1BGY D;  1U75 B;  5C0Z A;  1SQB D;  1C52 A;  5DFS A;  3CX5 W;  1H1O A;  2PCB B;  2CA3 B;  3OCD B;  1I5T A;  1IO3 A;  1EB7 A;  1A2S A;  1FOC A;  3WUI A;  5EXQ A;  1IZL 0;  1QL3 A;  2B11 B;  2FYN B;  1SQP D;  3SWS A;  1NU1 D;  3ORV A;  2BCN B;  2C1D B;  1HZU A;  1AYG A;  3L4O A;  2HV4 A;  1NMI A;  2VHD A;  2DVH A;  2ZXY A;  1CRJ A;  2XTS B;  5AUR A;  3M97 X;  3ZOX A;  4YE1 A;  1RAP A;  1FI9 A;  3O0R C;  4H0K A;  3HQ7 A;  1SQV D;  2EXV A;  1LMS A;  3WFD C;  4FB1 A;  1KIB A;  2BH4 X;  1GKS A;  4EIC A;  2LIR A;  1CC5 A;  1I55 A;  1KB0 A;  2AI5 A;  1ETP A;  3HQ8 A;  1H33 A;  4FA4 A;  1HRO A;  3L70 D;  1CTZ A;  1B7V A;  1CNO A;  1L9B C;  3NWV A;  1H9X A;  5KLV D;  5KLI B;  1BCC D;  1VYD A;  1HJ5 A;  1NTK D;  3OA8 A;  3CX5 D;  1GJQ A;  1WVE C;  5C9M A;  1CCR A;  2C2C A;  4KMG A;  1SQQ D;  3H1J D;  1DW2 A;  2YCC A;  3WC8 A;  1COT A;  5B66 V;  2YK3 A;  2D0W A;  1LC1 A;  4FA1 A;  3KZI V;  4FA5 A;  3HQ9 A;  1YIC A;  4AX3 A;  3CWB D;  4WQE A;  5CYT R;  1RZ6 A;  1COR A;  1GQ1 A;  2GIW A;  3ZOO A;  1N9C A;  155C A;  2GB8 B;  3HQ6 A;  4RSZ A;  1YCC A;  1U74 B;  2GC7 D;  3SVW A;  2OZ1 A;  1QKS A;  2ZZS 1;  3L75 D;  1HRC A;  4V2K A;  1AOF A;  1GU2 A;  1CIE A;  1K3G A;  1HJ3 A;  4PD4 D;  3O5C A;  2ORL A;  4AAL A;  1HZV A;  2BCC D;  2N18 B;  4NFG B;  3CP5 A;  3TGU D;  5B6Q A;  1KV9 A;  1YTC A;  4WQB A;  1GDV A;  2MHM A;  1R0Q A;  1NTZ D;  4AAO A;  2C9X B;  1DT1 A;  1H31 B;  4WQD A;  2N18 C;  3A0B V;  1K3H A;  1YEA A;  1E2R A;  1NIR A;  1I8P A;  1N50 A;  3WFE C;  1DVV A;  2YIU B;  3H1H D;  4WQ8 A;  3NBS A;  3TYI A;  3A9F A;  3DP5 A;  1H33 B;  2I8F A;  5CIB B;  3ZOY A;  4EID A;  1J3S A;  1AKK A;  4UB6 V;  5KAI V;  2C1D A;  2D0S A;  3SLE A;  3RN0 A;  5KKZ B;  3O1Y A;  3O20 A;  4FAN A;  1CHH A;  1CTY A;  1EZV D;  3CXH W;  1F1F A;  1CRC A;  3OA8 B;  3BCC D;  3PXW A;  3NBT A;  3ZOW A;  5IY5 1;  4D6T D;  1SQX D;  1YEB A;  4MU8 A;  1CHI A;  1KX2 A;  1I6E A;  4QAO A;  1S5L V;  1NML A;  3RN1 A;  1QL4 A;  4JCG A;  2QJP B;  2V07 A;  3CU4 A;  1N15 A;  1NTM D;  1FI7 A;  1IQC A;  1CIG A;  3ZCF A;  1L9J C;  2ZBO A;  2AXT V;  2QJK B;  4AAN A;  1MZ4 A;  1WEJ F;  3A0H V;  2C1V A;  3H1L D;  5CIH B;  1I6D A;  4U3F D;  3RLM A;  4O1W A;  2CE0 A;  1I8O A;  2N3Y A;  2OZ1 B;  1C7M A;  4PWA A;  1A56 A;  4WQC A;  1AOQ A;  2AIU A;  4Q5P A;  1CED A;  1C6R A; 
#chains in the Genus database with same CATH topology
 5CIF B;  1HCM A;  1MG3 D;  1M70 A;  3ZBM A;  2L4D A;  4J20 A;  1CCH A;  1M60 A;  1CXC A;  2ZOO A;  351C A;  4LJI A;  3JBT B;  1FJ0 A;  4WQA A;  4DY9 A;  4GYD A;  4AAM A;  2QJY B;  4IL6 V;  2N3B A;  1CRG A;  4XXL A;  3RMZ A;  5GTI V;  1CXA A;  4FA9 A;  3CXH D;  5CIC B;  1LFM A;  2DGE A;  1GIW A;  1H9Y A;  1E29 A;  1OAE A;  1CSV A;  2MTA C;  4EIE A;  1C2R A;  5CIG B;  1F1C A;  1L0L D;  3L4M A;  1HH7 A;  1CSW A;  3L71 D;  1CRY A;  1DVH A;  1QN2 A;  1IRW A;  1CO6 A;  1H32 A;  4PJ0 V;  1YIQ A;  4L1Q A;  2BPB B;  1KYO D;  1CIH A;  1C6S A;  1CYJ A;  3PXS A;  4P4Q B;  5TIS V;  1LC2 A;  1FHB A;  1CYC A;  2B0Z B;  2N9I A;  4XYD B;  2ZON G;  1A8C A;  3PH2 B;  3DR0 A;  3SJL A;  2GC4 D;  1CSX A;  5B5E V;  2B10 B;  3VNW A;  3OCD A;  1QYZ A;  1KB9 D;  2CA4 B;  4WQ7 A;  1IRV A;  3WFB C;  2JTI B;  3L73 D;  3H1I D;  4FAV A;  5GTH V;  1HJ4 A;  3SXT A;  2FRC A;  2JQR A;  1H31 A;  2FYU D;  2V08 A;  3MK7 B;  4Y5R A;  1OCD A;  3D0W A;  1LS9 A;  2PCC B;  2CXB A;  4L3G A;  5CID B;  1CYI A;  1BL9 A;  4PW9 B;  1C75 A;  1CTJ A;  2N9J A;  1BE3 D;  1M6Z A;  2CE1 A;  1W5C T;  3C2C A;  3ZIY A;  1KYO W;  4EIF A;  3MK7 C;  1W2L A;  2YQB A;  5DJQ B;  2C8S A;  1YFC A;  1RZ5 A;  1PPJ D;  1DW0 A;  3DMI A;  3CYT I;  2FWL A;  1FI3 A;  4O1Q A;  4GED B;  2LIT A;  3WU2 V;  2C1U A;  1FCD C;  1I54 A;  1CHJ A;  3PXT A;  3VYM A;  451C A;  1L0N D;  5H2F V;  5DJQ C;  5E79 V;  5KAF V;  1N90 A;  2B4Z A;  4K3I A;  2BGV X;  3L72 D;  2PAC A;  3L74 D;  1JDL A;  1E8E A;  1YNR A;  3X39 A;  3VRD A;  5DF5 A;  1S6V B;  2IBZ D;  2BH5 X;  3WFC C;  1CRI A;  1CRH A;  1CIF A;  4UB8 V;  1MG2 D;  4L3H A;  1C6O A;  5CIE B;  1DIQ C;  1DW3 A;  1DII C;  1KX7 A;  1NNO A;  4WQ9 A;  1H32 B;  4H0J A;  1RAQ A;  1CSU A;  1ZZH A;  1P84 D;  2A06 D;  1C2N A;  2BLF B;  3H1K D;  4N0K A;  2B12 B;  1DW1 A;  1ZRT D;  1PP9 D;  1BGY D;  1U75 B;  5C0Z A;  1SQB D;  1C52 A;  5DFS A;  3CX5 W;  1H1O A;  2PCB B;  2CA3 B;  3OCD B;  1I5T A;  1IO3 A;  1EB7 A;  1A2S A;  1FOC A;  3WUI A;  5EXQ A;  1IZL 0;  1QL3 A;  2B11 B;  2FYN B;  1SQP D;  3SWS A;  1NU1 D;  3ORV A;  2BCN B;  2C1D B;  1HZU A;  1AYG A;  3L4O A;  2HV4 A;  1NMI A;  2VHD A;  2DVH A;  2ZXY A;  1CRJ A;  2XTS B;  5AUR A;  3M97 X;  3ZOX A;  4YE1 A;  1RAP A;  1FI9 A;  3O0R C;  4H0K A;  3HQ7 A;  1SQV D;  2EXV A;  1LMS A;  3WFD C;  4FB1 A;  1KIB A;  2BH4 X;  1GKS A;  4EIC A;  2LIR A;  1CC5 A;  1I55 A;  1KB0 A;  2AI5 A;  1ETP A;  3HQ8 A;  1H33 A;  4FA4 A;  1HRO A;  3L70 D;  1CTZ A;  1B7V A;  1CNO A;  1L9B C;  3NWV A;  1H9X A;  5KLV D;  5KLI B;  1BCC D;  1VYD A;  1HJ5 A;  1NTK D;  3OA8 A;  3CX5 D;  1GJQ A;  1WVE C;  5C9M A;  1CCR A;  2C2C A;  4KMG A;  1SQQ D;  3H1J D;  1DW2 A;  2YCC A;  3WC8 A;  1COT A;  5B66 V;  2YK3 A;  2D0W A;  1LC1 A;  4FA1 A;  3KZI V;  4FA5 A;  3HQ9 A;  1YIC A;  4AX3 A;  3CWB D;  4WQE A;  5CYT R;  1RZ6 A;  1COR A;  1GQ1 A;  2GIW A;  3ZOO A;  1N9C A;  155C A;  2GB8 B;  3HQ6 A;  4RSZ A;  1YCC A;  1U74 B;  2GC7 D;  3SVW A;  2OZ1 A;  1QKS A;  2ZZS 1;  3L75 D;  1HRC A;  4V2K A;  1AOF A;  1GU2 A;  1CIE A;  1K3G A;  1HJ3 A;  4PD4 D;  3O5C A;  2ORL A;  4AAL A;  1HZV A;  2BCC D;  2N18 B;  4NFG B;  3CP5 A;  3TGU D;  5B6Q A;  1KV9 A;  1YTC A;  4WQB A;  1GDV A;  2MHM A;  1R0Q A;  1NTZ D;  4AAO A;  2C9X B;  1DT1 A;  1H31 B;  4WQD A;  2N18 C;  3A0B V;  1K3H A;  1YEA A;  1E2R A;  1NIR A;  1I8P A;  1N50 A;  3WFE C;  1DVV A;  2YIU B;  3H1H D;  4WQ8 A;  3NBS A;  3TYI A;  3A9F A;  3DP5 A;  1H33 B;  2I8F A;  5CIB B;  3ZOY A;  4EID A;  1J3S A;  1AKK A;  4UB6 V;  5KAI V;  2C1D A;  2D0S A;  3SLE A;  3RN0 A;  5KKZ B;  3O1Y A;  3O20 A;  4FAN A;  1CHH A;  1CTY A;  1EZV D;  3CXH W;  1F1F A;  1CRC A;  3OA8 B;  3BCC D;  3PXW A;  3NBT A;  3ZOW A;  5IY5 1;  4D6T D;  1SQX D;  1YEB A;  4MU8 A;  1CHI A;  1KX2 A;  1I6E A;  4QAO A;  1S5L V;  1NML A;  3RN1 A;  1QL4 A;  4JCG A;  2QJP B;  2V07 A;  3CU4 A;  1N15 A;  1NTM D;  1FI7 A;  1IQC A;  1CIG A;  3ZCF A;  1L9J C;  2ZBO A;  2AXT V;  2QJK B;  4AAN A;  1MZ4 A;  1WEJ F;  3A0H V;  2C1V A;  3H1L D;  5CIH B;  1I6D A;  4U3F D;  3RLM A;  4O1W A;  2CE0 A;  1I8O A;  2N3Y A;  2OZ1 B;  1C7M A;  4PWA A;  1A56 A;  4WQC A;  1AOQ A;  2AIU A;  4Q5P A;  1CED A;  1C6R A; 
#chains in the Genus database with same CATH homology
 5CIF B;  1HCM A;  1MG3 D;  1M70 A;  3ZBM A;  2L4D A;  4J20 A;  1CCH A;  1M60 A;  1CXC A;  2ZOO A;  351C A;  4LJI A;  3JBT B;  1FJ0 A;  4WQA A;  4DY9 A;  4GYD A;  4AAM A;  2QJY B;  4IL6 V;  2N3B A;  1CRG A;  4XXL A;  3RMZ A;  5GTI V;  1CXA A;  4FA9 A;  3CXH D;  5CIC B;  1LFM A;  2DGE A;  1GIW A;  1H9Y A;  1E29 A;  1OAE A;  1CSV A;  2MTA C;  4EIE A;  1C2R A;  5CIG B;  1F1C A;  1L0L D;  3L4M A;  1HH7 A;  1CSW A;  3L71 D;  1CRY A;  1DVH A;  1QN2 A;  1IRW A;  1CO6 A;  1H32 A;  4PJ0 V;  1YIQ A;  4L1Q A;  2BPB B;  1KYO D;  1CIH A;  1C6S A;  1CYJ A;  3PXS A;  4P4Q B;  5TIS V;  1LC2 A;  1FHB A;  1CYC A;  2B0Z B;  2N9I A;  4XYD B;  2ZON G;  1A8C A;  3PH2 B;  3DR0 A;  3SJL A;  2GC4 D;  1CSX A;  5B5E V;  2B10 B;  3VNW A;  3OCD A;  1QYZ A;  1KB9 D;  2CA4 B;  4WQ7 A;  1IRV A;  3WFB C;  2JTI B;  3L73 D;  3H1I D;  4FAV A;  5GTH V;  1HJ4 A;  3SXT A;  2FRC A;  2JQR A;  1H31 A;  2FYU D;  2V08 A;  3MK7 B;  4Y5R A;  1OCD A;  1LS9 A;  2PCC B;  2CXB A;  4L3G A;  5CID B;  1CYI A;  1BL9 A;  4PW9 B;  1C75 A;  1CTJ A;  2N9J A;  1BE3 D;  1M6Z A;  2CE1 A;  1W5C T;  3C2C A;  3ZIY A;  1KYO W;  4EIF A;  3MK7 C;  1W2L A;  2YQB A;  5DJQ B;  2C8S A;  1YFC A;  1RZ5 A;  1PPJ D;  1DW0 A;  3DMI A;  3CYT I;  2FWL A;  1FI3 A;  4O1Q A;  4GED B;  2LIT A;  3WU2 V;  2C1U A;  1FCD C;  1I54 A;  1CHJ A;  3PXT A;  3VYM A;  451C A;  1L0N D;  5H2F V;  5DJQ C;  5E79 V;  5KAF V;  1N90 A;  2B4Z A;  4K3I A;  2BGV X;  3L72 D;  2PAC A;  3L74 D;  1JDL A;  1E8E A;  1YNR A;  3X39 A;  3VRD A;  5DF5 A;  1S6V B;  2IBZ D;  2BH5 X;  3WFC C;  1CRI A;  1CRH A;  1CIF A;  4UB8 V;  1MG2 D;  4L3H A;  1C6O A;  5CIE B;  1DIQ C;  1DW3 A;  1DII C;  1KX7 A;  1NNO A;  4WQ9 A;  1H32 B;  4H0J A;  1RAQ A;  1CSU A;  1ZZH A;  1P84 D;  2A06 D;  1C2N A;  2BLF B;  3H1K D;  4N0K A;  2B12 B;  1DW1 A;  1ZRT D;  1PP9 D;  1BGY D;  1U75 B;  5C0Z A;  1SQB D;  1C52 A;  5DFS A;  3CX5 W;  1H1O A;  2PCB B;  2CA3 B;  3OCD B;  1I5T A;  1IO3 A;  1EB7 A;  1A2S A;  1FOC A;  3WUI A;  5EXQ A;  1IZL 0;  1QL3 A;  2B11 B;  2FYN B;  1SQP D;  3SWS A;  1NU1 D;  3ORV A;  2BCN B;  2C1D B;  1HZU A;  1AYG A;  3L4O A;  2HV4 A;  1NMI A;  2VHD A;  2DVH A;  2ZXY A;  1CRJ A;  2XTS B;  5AUR A;  3M97 X;  3ZOX A;  4YE1 A;  1RAP A;  1FI9 A;  3O0R C;  4H0K A;  3HQ7 A;  1SQV D;  2EXV A;  1LMS A;  3WFD C;  4FB1 A;  1KIB A;  2BH4 X;  1GKS A;  4EIC A;  2LIR A;  1CC5 A;  1I55 A;  1KB0 A;  2AI5 A;  1ETP A;  3HQ8 A;  1H33 A;  4FA4 A;  1HRO A;  3L70 D;  1CTZ A;  1B7V A;  1CNO A;  1L9B C;  3NWV A;  1H9X A;  5KLV D;  5KLI B;  1BCC D;  1VYD A;  1HJ5 A;  1NTK D;  3OA8 A;  3CX5 D;  1GJQ A;  1WVE C;  5C9M A;  1CCR A;  2C2C A;  4KMG A;  1SQQ D;  3H1J D;  1DW2 A;  2YCC A;  3WC8 A;  1COT A;  5B66 V;  2YK3 A;  2D0W A;  1LC1 A;  4FA1 A;  3KZI V;  4FA5 A;  3HQ9 A;  1YIC A;  4AX3 A;  3CWB D;  4WQE A;  5CYT R;  1RZ6 A;  1COR A;  1GQ1 A;  2GIW A;  3ZOO A;  1N9C A;  155C A;  2GB8 B;  3HQ6 A;  4RSZ A;  1YCC A;  1U74 B;  2GC7 D;  3SVW A;  2OZ1 A;  1QKS A;  2ZZS 1;  3L75 D;  1HRC A;  4V2K A;  1AOF A;  1GU2 A;  1CIE A;  1K3G A;  1HJ3 A;  4PD4 D;  3O5C A;  2ORL A;  4AAL A;  1HZV A;  2BCC D;  2N18 B;  4NFG B;  3CP5 A;  3TGU D;  5B6Q A;  1KV9 A;  1YTC A;  4WQB A;  1GDV A;  2MHM A;  1R0Q A;  1NTZ D;  4AAO A;  2C9X B;  1DT1 A;  1H31 B;  4WQD A;  2N18 C;  3A0B V;  1K3H A;  1YEA A;  1E2R A;  1NIR A;  1I8P A;  1N50 A;  3WFE C;  1DVV A;  2YIU B;  3H1H D;  4WQ8 A;  3NBS A;  3TYI A;  3A9F A;  3DP5 A;  1H33 B;  2I8F A;  5CIB B;  3ZOY A;  4EID A;  1J3S A;  1AKK A;  4UB6 V;  5KAI V;  2C1D A;  2D0S A;  3SLE A;  3RN0 A;  5KKZ B;  3O1Y A;  3O20 A;  4FAN A;  1CHH A;  1CTY A;  1EZV D;  3CXH W;  1F1F A;  1CRC A;  3OA8 B;  3BCC D;  3PXW A;  3NBT A;  3ZOW A;  5IY5 1;  4D6T D;  1SQX D;  1YEB A;  4MU8 A;  1CHI A;  1KX2 A;  1I6E A;  4QAO A;  1S5L V;  1NML A;  3RN1 A;  1QL4 A;  4JCG A;  2QJP B;  2V07 A;  3CU4 A;  1N15 A;  1NTM D;  1FI7 A;  1IQC A;  1CIG A;  3ZCF A;  1L9J C;  2ZBO A;  2AXT V;  2QJK B;  4AAN A;  1MZ4 A;  1WEJ F;  3A0H V;  2C1V A;  3H1L D;  5CIH B;  1I6D A;  4U3F D;  3RLM A;  4O1W A;  2CE0 A;  1I8O A;  2N3Y A;  2OZ1 B;  1C7M A;  4PWA A;  1A56 A;  4WQC A;  1AOQ A;  2AIU A;  4Q5P A;  1CED A;  1C6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...