1NS5A

X-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
Knots found
sequence length
153
structure length
153
Chain Sequence
MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGKNADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ybeA
publication title Structure of YBEA from E. coli
rcsb
source organism Escherichia coli
total genus 50
structure length 153
sequence length 153
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.177: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02590 SPOUT_MTase Predicted SPOUT methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1ns5A00
4MCBA 1O6DA 4YQ8A 4YVIA 3L8UA 4YQPA 1NS5A 5CO4A 4H3ZA 2HA8A 3BBHA 4YQ3A 4CNFA 4PZKA 2QMMA 5GMCA 4YQ2A 3N4KA 4YQSA 5FAIA 5GM8A 4YPXA 3KY7A 4YQRA 2YY8A 3GYQA 1UAKA 3ONPA 3NK7A 4YQ1A 4YQTA 3E5YA 1Z85A 1NXZA 4YQCA 1X7OA 3O7BA 2O3AA 3IC6A 4MCDA 4X3MA 4YPYA 1VHYA 4YQDA 4YQNA 2EGVA 5GMBA 5D9FA 3KNUA 3AI9X 4YQAA 4IG6A 4YVHA 4CNGA 2QWVA 4FAKA 4YQOA 4H3YA 4E8BA 4MCCA 3KTYA 3QUVA 1ZJRA 3NK6A 4XBOA 1UALA 4CNEA 4YQBA 3IEFA 1K3RA 2Z0YA 3KW2A 4YVGA 4CNDA 3OIJA 2EGWA 4J3CA 4YQGA 4RG1A 1UAJA 4YQ7A 4YVJA 3DCMX 4L69A 4YPWA 2V3JA 4YQJA 2CX8A 4YQ6A 1P9PA 4JALA 1V6ZA 4KDZA 3N4JA 4YQIA 4YQLA 3AIAA 4JAKA 1GZ0A 3OINA 1VH0A 1TO0A 4YVKA 4YQ0A 4X3LA 4YQKA 4KGNA 1IPAA 3ILKA 1V2XA 4YQ4A 3BBEA 1OY5A 4YQ5A 4YQQA 3BBDA 1J85A 4YQ9A 2I6DA 1VHKA 3OIIA 1UAMA 4YPZA 2V3KA 1X7PA 1MXIA 3AXZA
chains in the Genus database with same CATH superfamily
4MCBA 1O6DA 4YQ8A 4YVIA 3L8UA 4YQPA 1NS5A 5CO4A 4H3ZA 2HA8A 3BBHA 4JWHA 4YQ3A 4JWFA 4PZKA 2QMMA 5GMCA 4YQ2A 4CNFA 3N4KA 4YQSA 5FAIA 5GM8A 4YPXA 3KY7A 4YQRA 2YY8A 3GYQA 1UAKA 3ONPA 3NK7A 4YQ1A 4JWGA 4YQTA 3E5YA 1Z85A 1NXZA 4YQCA 1X7OA 3O7BA 2O3AA 3IC6A 4MCDA 4X3MA 4YPYA 1VHYA 4YQDA 4YQNA 2EGVA 5GMBA 5D9FA 3KNUA 3AI9X 4YQAA 4IG6A 4YVHA 4CNGA 2QWVA 4FAKA 4YQOA 4H3YA 4E8BA 4MCCA 3KTYA 3QUVA 1ZJRA 3NK6A 4XBOA 1UALA 4CNEA 4YQBA 3IEFA 1K3RA 2Z0YA 3KW2A 4YVGA 4CNDA 3OIJA 2EGWA 4J3CA 4YQGA 4RG1A 1UAJA 4YQ7A 4YVJA 3DCMX 4L69A 4YPWA 2V3JA 4YQJA 2CX8A 4YQ6A 1P9PA 4JALA 1V6ZA 4KDZA 4JWJA 3N4JA 4YQIA 3AIAA 4JAKA 4YQLA 1GZ0A 3OINA 1VH0A 1TO0A 4YVKA 4YQ0A 4X3LA 4YQKA 4KGNA 1IPAA 4FMWA 3ILKA 1V2XA 4YQ4A 3BBEA 1OY5A 4YQ5A 4YQQA 3BBDA 1J85A 4YQ9A 2I6DA 1VHKA 3OIIA 1UAMA 4YPZA 2V3KA 1X7PA 1MXIA 3AXZA
chains in the Genus database with same CATH topology
4MCBA 1O6DA 4YQ8A 4YVIA 3L8UA 4YQPA 1NS5A 5CO4A 4H3ZA 2HA8A 3BBHA 4JWHA 4YQ3A 4JWFA 4PZKA 2QMMA 5GMCA 4YQ2A 4CNFA 3N4KA 4YQSA 5FAIA 5GM8A 4YPXA 3KY7A 4YQRA 2YY8A 3GYQA 1UAKA 3ONPA 3NK7A 4YQ1A 4JWGA 4YQTA 3E5YA 1Z85A 1NXZA 4YQCA 1X7OA 3O7BA 2O3AA 3IC6A 4MCDA 4X3MA 4YPYA 1VHYA 4YQDA 4YQNA 2EGVA 5GMBA 5D9FA 3KNUA 3AI9X 4YQAA 4IG6A 4YVHA 4CNGA 2QWVA 4FAKA 4YQOA 4H3YA 4E8BA 4MCCA 3KTYA 3QUVA 1ZJRA 3NK6A 4XBOA 1UALA 4CNEA 4YQBA 3IEFA 1K3RA 2Z0YA 3KW2A 4YVGA 4CNDA 3OIJA 2EGWA 4J3CA 4YQGA 4RG1A 1UAJA 4YQ7A 4YVJA 3DCMX 4L69A 4YPWA 2V3JA 4YQJA 2CX8A 4YQ6A 1P9PA 4JALA 1V6ZA 4KDZA 4JWJA 3N4JA 4YQIA 3AIAA 4JAKA 4YQLA 1GZ0A 3OINA 1VH0A 1TO0A 4YVKA 4YQ0A 4X3LA 4YQKA 4KGNA 1IPAA 4FMWA 3ILKA 1V2XA 4YQ4A 3BBEA 1OY5A 4YQ5A 4YQQA 3BBDA 1J85A 4YQ9A 2I6DA 1VHKA 3OIIA 1UAMA 4YPZA 2V3KA 1X7PA 1MXIA 3AXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCB A;  1O6D A;  4YQ8 A;  4YVI A;  3L8U A;  4YQP A;  1NS5 A;  5CO4 A;  4H3Z A;  2HA8 A;  3BBH A;  4YQ3 A;  4CNF A;  4PZK A;  2QMM A;  5GMC A;  4YQ2 A;  3N4K A;  4YQS A;  5FAI A;  5GM8 A;  4YPX A;  3KY7 A;  4YQR A;  2YY8 A;  3GYQ A;  1UAK A;  3ONP A;  3NK7 A;  4YQ1 A;  4YQT A;  3E5Y A;  1Z85 A;  1NXZ A;  4YQC A;  1X7O A;  3O7B A;  2O3A A;  3IC6 A;  4MCD A;  4X3M A;  4YPY A;  1VHY A;  4YQD A;  4YQN A;  2EGV A;  5GMB A;  5D9F A;  3KNU A;  3AI9 X;  4YQA A;  4IG6 A;  4YVH A;  4CNG A;  2QWV A;  4FAK A;  4YQO A;  4H3Y A;  4E8B A;  4MCC A;  3KTY A;  3QUV A;  1ZJR A;  3NK6 A;  4XBO A;  1UAL A;  4CNE A;  4YQB A;  3IEF A;  1K3R A;  2Z0Y A;  3KW2 A;  4YVG A;  4CND A;  3OIJ A;  2EGW A;  4J3C A;  4YQG A;  4RG1 A;  1UAJ A;  4YQ7 A;  4YVJ A;  3DCM X;  4L69 A;  4YPW A;  2V3J A;  4YQJ A;  2CX8 A;  4YQ6 A;  1P9P A;  4JAL A;  1V6Z A;  4KDZ A;  3N4J A;  4YQI A;  4YQL A;  3AIA A;  4JAK A;  1GZ0 A;  3OIN A;  1VH0 A;  1TO0 A;  4YVK A;  4YQ0 A;  4X3L A;  4YQK A;  4KGN A;  1IPA A;  3ILK A;  1V2X A;  4YQ4 A;  3BBE A;  1OY5 A;  4YQ5 A;  4YQQ A;  3BBD A;  1J85 A;  4YQ9 A;  2I6D A;  1VHK A;  3OII A;  1UAM A;  4YPZ A;  2V3K A;  1X7P A;  1MXI A;  3AXZ A; 
#chains in the Genus database with same CATH topology
 4MCB A;  1O6D A;  4YQ8 A;  4YVI A;  3L8U A;  4YQP A;  1NS5 A;  5CO4 A;  4H3Z A;  2HA8 A;  3BBH A;  4JWH A;  4YQ3 A;  4JWF A;  4PZK A;  2QMM A;  5GMC A;  4YQ2 A;  4CNF A;  3N4K A;  4YQS A;  5FAI A;  5GM8 A;  4YPX A;  3KY7 A;  4YQR A;  2YY8 A;  3GYQ A;  1UAK A;  3ONP A;  3NK7 A;  4YQ1 A;  4JWG A;  4YQT A;  3E5Y A;  1Z85 A;  1NXZ A;  4YQC A;  1X7O A;  3O7B A;  2O3A A;  3IC6 A;  4MCD A;  4X3M A;  4YPY A;  1VHY A;  4YQD A;  4YQN A;  2EGV A;  5GMB A;  5D9F A;  3KNU A;  3AI9 X;  4YQA A;  4IG6 A;  4YVH A;  4CNG A;  2QWV A;  4FAK A;  4YQO A;  4H3Y A;  4E8B A;  4MCC A;  3KTY A;  3QUV A;  1ZJR A;  3NK6 A;  4XBO A;  1UAL A;  4CNE A;  4YQB A;  3IEF A;  1K3R A;  2Z0Y A;  3KW2 A;  4YVG A;  4CND A;  3OIJ A;  2EGW A;  4J3C A;  4YQG A;  4RG1 A;  1UAJ A;  4YQ7 A;  4YVJ A;  3DCM X;  4L69 A;  4YPW A;  2V3J A;  4YQJ A;  2CX8 A;  4YQ6 A;  1P9P A;  4JAL A;  1V6Z A;  4KDZ A;  4JWJ A;  3N4J A;  4YQI A;  3AIA A;  4JAK A;  4YQL A;  1GZ0 A;  3OIN A;  1VH0 A;  1TO0 A;  4YVK A;  4YQ0 A;  4X3L A;  4YQK A;  4KGN A;  1IPA A;  4FMW A;  3ILK A;  1V2X A;  4YQ4 A;  3BBE A;  1OY5 A;  4YQ5 A;  4YQQ A;  3BBD A;  1J85 A;  4YQ9 A;  2I6D A;  1VHK A;  3OII A;  1UAM A;  4YPZ A;  2V3K A;  1X7P A;  1MXI A;  3AXZ A; 
#chains in the Genus database with same CATH homology
 4MCB A;  1O6D A;  4YQ8 A;  4YVI A;  3L8U A;  4YQP A;  1NS5 A;  5CO4 A;  4H3Z A;  2HA8 A;  3BBH A;  4JWH A;  4YQ3 A;  4JWF A;  4PZK A;  2QMM A;  5GMC A;  4YQ2 A;  4CNF A;  3N4K A;  4YQS A;  5FAI A;  5GM8 A;  4YPX A;  3KY7 A;  4YQR A;  2YY8 A;  3GYQ A;  1UAK A;  3ONP A;  3NK7 A;  4YQ1 A;  4JWG A;  4YQT A;  3E5Y A;  1Z85 A;  1NXZ A;  4YQC A;  1X7O A;  3O7B A;  2O3A A;  3IC6 A;  4MCD A;  4X3M A;  4YPY A;  1VHY A;  4YQD A;  4YQN A;  2EGV A;  5GMB A;  5D9F A;  3KNU A;  3AI9 X;  4YQA A;  4IG6 A;  4YVH A;  4CNG A;  2QWV A;  4FAK A;  4YQO A;  4H3Y A;  4E8B A;  4MCC A;  3KTY A;  3QUV A;  1ZJR A;  3NK6 A;  4XBO A;  1UAL A;  4CNE A;  4YQB A;  3IEF A;  1K3R A;  2Z0Y A;  3KW2 A;  4YVG A;  4CND A;  3OIJ A;  2EGW A;  4J3C A;  4YQG A;  4RG1 A;  1UAJ A;  4YQ7 A;  4YVJ A;  3DCM X;  4L69 A;  4YPW A;  2V3J A;  4YQJ A;  2CX8 A;  4YQ6 A;  1P9P A;  4JAL A;  1V6Z A;  4KDZ A;  4JWJ A;  3N4J A;  4YQI A;  3AIA A;  4JAK A;  4YQL A;  1GZ0 A;  3OIN A;  1VH0 A;  1TO0 A;  4YVK A;  4YQ0 A;  4X3L A;  4YQK A;  4KGN A;  1IPA A;  4FMW A;  3ILK A;  1V2X A;  4YQ4 A;  3BBE A;  1OY5 A;  4YQ5 A;  4YQQ A;  3BBD A;  1J85 A;  4YQ9 A;  2I6D A;  1VHK A;  3OII A;  1UAM A;  4YPZ A;  2V3K A;  1X7P A;  1MXI A;  3AXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...