4JWGA

Crystal structure of sptrm10(74)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
Knots found
sequence length
187
structure length
187
Chain Sequence
RIRLGKVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVELFATNFGGRLKTRQDFVLKGQQNNWKRYNPTTKSYLEEFESQKEKLVYLSADSDNTITELDEDKIYIIGAIVDKNRYKNLCQNKASEQGIKTAKLPIDEYIKITDRKILTVNQVFEILSLWLEYRDWEKAFMEVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine(9)-N1)-methyltransferase
publication title Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 67
structure length 187
sequence length 187
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.30 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jwgA00
4FMWA 4JWFA 4JWHA 4JWJA 4JWGA
chains in the Genus database with same CATH superfamily
4YQ5A 4L69A 4YQ8A 1V2XA 4YPXA 4JWFA 1NS5A 3ONPA 4YQ7A 4YQ1A 1Z85A 3AIAA 5GMCA 4YQ2A 4CNEA 1X7PA 3KNUA 3BBEA 5CO4A 4JWGA 4CNDA 1VHKA 4YQTA 1ZJRA 5D9FA 4YPYA 4YQAA 4YQSA 4YVJA 1MXIA 4CNFA 4YQ3A 3BBDA 3GYQA 3OIIA 4RG1A 5FAIA 1NXZA 4YVKA 2EGWA 1OY5A 2HA8A 3AXZA 4JALA 4YPWA 2I6DA 4YQNA 4YPZA 4FAKA 4JAKA 3KTYA 3IC6A 3E5YA 1VHYA 4YQOA 3QUVA 4J3CA 4YQRA 4YQDA 3OINA 4H3YA 3ILKA 4JWJA 1K3RA 4KGNA 1UAJA 3NK6A 4CNGA 4YQKA 4E8BA 5GMBA 4YQJA 3BBHA 4H3ZA 3N4JA 3NK7A 4X3LA 4X3MA 4XBOA 3OIJA 1VH0A 1V6ZA 4YQ6A 2YY8A 1P9PA 4IG6A 3AI9X 2EGVA 4YQ4A 3IEFA 4PZKA 4YQBA 3O7BA 4YQLA 4YQQA 3L8UA 3KY7A 2QMMA 4YQ0A 4YQGA 2V3JA 1UAMA 4MCCA 4FMWA 3N4KA 1TO0A 4YQIA 2Z0YA 1GZ0A 4MCBA 4YVGA 1J85A 1IPAA 4KDZA 5GM8A 4YQ9A 4YQPA 4YVHA 3KW2A 1UALA 2CX8A 4JWHA 4MCDA 1UAKA 2V3KA 2QWVA 4YQCA 4YVIA 2O3AA 1O6DA 1X7OA 3DCMX
chains in the Genus database with same CATH topology
4YQ5A 4L69A 4YQ8A 1V2XA 4YPXA 4JWFA 1NS5A 3ONPA 4YQ7A 4YQ1A 1Z85A 3AIAA 5GMCA 4YQ2A 4CNEA 1X7PA 3KNUA 3BBEA 5CO4A 4JWGA 4CNDA 1VHKA 4YQTA 1ZJRA 5D9FA 4YPYA 4YQAA 4YQSA 4YVJA 1MXIA 4CNFA 4YQ3A 3BBDA 3GYQA 3OIIA 4RG1A 5FAIA 1NXZA 4YVKA 2EGWA 1OY5A 2HA8A 3AXZA 4JALA 4YPWA 2I6DA 4YQNA 4YPZA 4FAKA 4JAKA 3KTYA 3IC6A 3E5YA 1VHYA 4YQOA 3QUVA 4J3CA 4YQRA 4YQDA 3OINA 4H3YA 3ILKA 4JWJA 1K3RA 4KGNA 1UAJA 3NK6A 4CNGA 4YQKA 4E8BA 5GMBA 4YQJA 3BBHA 4H3ZA 3N4JA 3NK7A 4X3LA 4X3MA 4XBOA 3OIJA 1VH0A 1V6ZA 4YQ6A 2YY8A 1P9PA 4IG6A 3AI9X 2EGVA 4YQ4A 3IEFA 4PZKA 4YQBA 3O7BA 4YQLA 4YQQA 3L8UA 3KY7A 2QMMA 4YQ0A 4YQGA 2V3JA 1UAMA 4MCCA 4FMWA 3N4KA 1TO0A 4YQIA 2Z0YA 1GZ0A 4MCBA 4YVGA 1J85A 1IPAA 4KDZA 5GM8A 4YQ9A 4YQPA 4YVHA 3KW2A 1UALA 2CX8A 4JWHA 4MCDA 1UAKA 2V3KA 2QWVA 4YQCA 4YVIA 2O3AA 1O6DA 1X7OA 3DCMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMW A;  4JWF A;  4JWH A;  4JWJ A;  4JWG A; 
#chains in the Genus database with same CATH topology
 4YQ5 A;  4L69 A;  4YQ8 A;  1V2X A;  4YPX A;  4JWF A;  1NS5 A;  3ONP A;  4YQ7 A;  4YQ1 A;  1Z85 A;  3AIA A;  5GMC A;  4YQ2 A;  4CNE A;  1X7P A;  3KNU A;  3BBE A;  5CO4 A;  4JWG A;  4CND A;  1VHK A;  4YQT A;  1ZJR A;  5D9F A;  4YPY A;  4YQA A;  4YQS A;  4YVJ A;  1MXI A;  4CNF A;  4YQ3 A;  3BBD A;  3GYQ A;  3OII A;  4RG1 A;  5FAI A;  1NXZ A;  4YVK A;  2EGW A;  1OY5 A;  2HA8 A;  3AXZ A;  4JAL A;  4YPW A;  2I6D A;  4YQN A;  4YPZ A;  4FAK A;  4JAK A;  3KTY A;  3IC6 A;  3E5Y A;  1VHY A;  4YQO A;  3QUV A;  4J3C A;  4YQR A;  4YQD A;  3OIN A;  4H3Y A;  3ILK A;  4JWJ A;  1K3R A;  4KGN A;  1UAJ A;  3NK6 A;  4CNG A;  4YQK A;  4E8B A;  5GMB A;  4YQJ A;  3BBH A;  4H3Z A;  3N4J A;  3NK7 A;  4X3L A;  4X3M A;  4XBO A;  3OIJ A;  1VH0 A;  1V6Z A;  4YQ6 A;  2YY8 A;  1P9P A;  4IG6 A;  3AI9 X;  2EGV A;  4YQ4 A;  3IEF A;  4PZK A;  4YQB A;  3O7B A;  4YQL A;  4YQQ A;  3L8U A;  3KY7 A;  2QMM A;  4YQ0 A;  4YQG A;  2V3J A;  1UAM A;  4MCC A;  4FMW A;  3N4K A;  1TO0 A;  4YQI A;  2Z0Y A;  1GZ0 A;  4MCB A;  4YVG A;  1J85 A;  1IPA A;  4KDZ A;  5GM8 A;  4YQ9 A;  4YQP A;  4YVH A;  3KW2 A;  1UAL A;  2CX8 A;  4JWH A;  4MCD A;  1UAK A;  2V3K A;  2QWV A;  4YQC A;  4YVI A;  2O3A A;  1O6D A;  1X7O A;  3DCM X; 
#chains in the Genus database with same CATH homology
 4YQ5 A;  4L69 A;  4YQ8 A;  1V2X A;  4YPX A;  4JWF A;  1NS5 A;  3ONP A;  4YQ7 A;  4YQ1 A;  1Z85 A;  3AIA A;  5GMC A;  4YQ2 A;  4CNE A;  1X7P A;  3KNU A;  3BBE A;  5CO4 A;  4JWG A;  4CND A;  1VHK A;  4YQT A;  1ZJR A;  5D9F A;  4YPY A;  4YQA A;  4YQS A;  4YVJ A;  1MXI A;  4CNF A;  4YQ3 A;  3BBD A;  3GYQ A;  3OII A;  4RG1 A;  5FAI A;  1NXZ A;  4YVK A;  2EGW A;  1OY5 A;  2HA8 A;  3AXZ A;  4JAL A;  4YPW A;  2I6D A;  4YQN A;  4YPZ A;  4FAK A;  4JAK A;  3KTY A;  3IC6 A;  3E5Y A;  1VHY A;  4YQO A;  3QUV A;  4J3C A;  4YQR A;  4YQD A;  3OIN A;  4H3Y A;  3ILK A;  4JWJ A;  1K3R A;  4KGN A;  1UAJ A;  3NK6 A;  4CNG A;  4YQK A;  4E8B A;  5GMB A;  4YQJ A;  3BBH A;  4H3Z A;  3N4J A;  3NK7 A;  4X3L A;  4X3M A;  4XBO A;  3OIJ A;  1VH0 A;  1V6Z A;  4YQ6 A;  2YY8 A;  1P9P A;  4IG6 A;  3AI9 X;  2EGV A;  4YQ4 A;  3IEF A;  4PZK A;  4YQB A;  3O7B A;  4YQL A;  4YQQ A;  3L8U A;  3KY7 A;  2QMM A;  4YQ0 A;  4YQG A;  2V3J A;  1UAM A;  4MCC A;  4FMW A;  3N4K A;  1TO0 A;  4YQI A;  2Z0Y A;  1GZ0 A;  4MCB A;  4YVG A;  1J85 A;  1IPA A;  4KDZ A;  5GM8 A;  4YQ9 A;  4YQP A;  4YVH A;  3KW2 A;  1UAL A;  2CX8 A;  4JWH A;  4MCD A;  1UAK A;  2V3K A;  2QWV A;  4YQC A;  4YVI A;  2O3A A;  1O6D A;  1X7O A;  3DCM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...