4JWGA

Crystal structure of sptrm10(74)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
Knots found
sequence length
187
structure length
187
Chain Sequence
RIRLGKVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVELFATNFGGRLKTRQDFVLKGQQNNWKRYNPTTKSYLEEFESQKEKLVYLSADSDNTITELDEDKIYIIGAIVDKNRYKNLCQNKASEQGIKTAKLPIDEYIKITDRKILTVNQVFEILSLWLEYRDWEKAFMEVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (guanine(9)-N1)-methyltransferase
publication title Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 67
structure length 187
sequence length 187
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.30 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jwgA00
4FMWA 4JWGA 4JWFA 4JWJA 4JWHA
chains in the Genus database with same CATH superfamily
1TO0A 3AXZA 4YPYA 3OIIA 3N4KA 4KGNA 4YVKA 4YQ5A 4YQ7A 3KW2A 5FAIA 5D9FA 3BBDA 4RG1A 4YQAA 1K3RA 3OINA 4YQGA 4YQCA 4YQQA 2QMMA 3NK6A 4H3ZA 4FMWA 4YPWA 3DCMX 4YQLA 4E8BA 3QUVA 4YVHA 3L8UA 4X3LA 4CNEA 4CNGA 1UALA 1VHYA 5GMBA 4CNFA 3OIJA 4YQKA 2EGVA 4YPXA 3BBEA 3AIAA 4YQPA 4YQSA 1UAJA 1X7PA 3E5YA 4YQ0A 3AI9X 2CX8A 4YQ9A 1UAMA 1ZJRA 4YQJA 4MCCA 4YVIA 1OY5A 5CO4A 1GZ0A 4J3CA 1NXZA 4YQ6A 2V3JA 1IPAA 3IEFA 3BBHA 4YQ8A 2Z0YA 4PZKA 4MCBA 1P9PA 2I6DA 2QWVA 3NK7A 4JWFA 3IC6A 4JWHA 2HA8A 1VH0A 4JALA 4MCDA 4YPZA 2O3AA 3O7BA 4CNDA 4YQBA 1V2XA 2V3KA 1VHKA 4YQ1A 3KNUA 1O6DA 4YQ3A 1X7OA 1MXIA 4JWJA 1V6ZA 2EGWA 4XBOA 4YQRA 4YQ4A 4JAKA 4YQ2A 4YVJA 1UAKA 3ONPA 1J85A 4YQTA 3KTYA 4H3YA 4YQDA 4FAKA 1Z85A 3GYQA 4JWGA 5GMCA 3ILKA 3KY7A 4L69A 1NS5A 4YQIA 4IG6A 4X3MA 2YY8A 3N4JA 4KDZA 4YQOA 5GM8A 4YQNA 4YVGA
chains in the Genus database with same CATH topology
1TO0A 3AXZA 4YPYA 3OIIA 3N4KA 4KGNA 4YVKA 4YQ5A 4YQ7A 3KW2A 5FAIA 5D9FA 3BBDA 4RG1A 4YQAA 1K3RA 3OINA 4YQGA 4YQCA 4YQQA 2QMMA 3NK6A 4H3ZA 4FMWA 4YPWA 3DCMX 4YQLA 4E8BA 3QUVA 4YVHA 3L8UA 4X3LA 4CNEA 4CNGA 1UALA 1VHYA 5GMBA 4CNFA 3OIJA 4YQKA 2EGVA 4YPXA 3BBEA 3AIAA 4YQPA 4YQSA 1UAJA 1X7PA 3E5YA 4YQ0A 3AI9X 2CX8A 4YQ9A 1UAMA 1ZJRA 4YQJA 4MCCA 4YVIA 1OY5A 5CO4A 1GZ0A 4J3CA 1NXZA 4YQ6A 2V3JA 1IPAA 3IEFA 3BBHA 4YQ8A 2Z0YA 4PZKA 4MCBA 1P9PA 2I6DA 2QWVA 3NK7A 4JWFA 3IC6A 4JWHA 2HA8A 1VH0A 4JALA 4MCDA 4YPZA 2O3AA 3O7BA 4CNDA 4YQBA 1V2XA 2V3KA 1VHKA 4YQ1A 3KNUA 1O6DA 4YQ3A 1X7OA 1MXIA 4JWJA 1V6ZA 2EGWA 4XBOA 4YQRA 4YQ4A 4JAKA 4YQ2A 4YVJA 1UAKA 3ONPA 1J85A 4YQTA 3KTYA 4H3YA 4YQDA 4FAKA 1Z85A 3GYQA 4JWGA 5GMCA 3ILKA 3KY7A 4L69A 1NS5A 4YQIA 4IG6A 4X3MA 2YY8A 3N4JA 4KDZA 4YQOA 5GM8A 4YQNA 4YVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMW A;  4JWG A;  4JWF A;  4JWJ A;  4JWH A; 
#chains in the Genus database with same CATH topology
 1TO0 A;  3AXZ A;  4YPY A;  3OII A;  3N4K A;  4KGN A;  4YVK A;  4YQ5 A;  4YQ7 A;  3KW2 A;  5FAI A;  5D9F A;  3BBD A;  4RG1 A;  4YQA A;  1K3R A;  3OIN A;  4YQG A;  4YQC A;  4YQQ A;  2QMM A;  3NK6 A;  4H3Z A;  4FMW A;  4YPW A;  3DCM X;  4YQL A;  4E8B A;  3QUV A;  4YVH A;  3L8U A;  4X3L A;  4CNE A;  4CNG A;  1UAL A;  1VHY A;  5GMB A;  4CNF A;  3OIJ A;  4YQK A;  2EGV A;  4YPX A;  3BBE A;  3AIA A;  4YQP A;  4YQS A;  1UAJ A;  1X7P A;  3E5Y A;  4YQ0 A;  3AI9 X;  2CX8 A;  4YQ9 A;  1UAM A;  1ZJR A;  4YQJ A;  4MCC A;  4YVI A;  1OY5 A;  5CO4 A;  1GZ0 A;  4J3C A;  1NXZ A;  4YQ6 A;  2V3J A;  1IPA A;  3IEF A;  3BBH A;  4YQ8 A;  2Z0Y A;  4PZK A;  4MCB A;  1P9P A;  2I6D A;  2QWV A;  3NK7 A;  4JWF A;  3IC6 A;  4JWH A;  2HA8 A;  1VH0 A;  4JAL A;  4MCD A;  4YPZ A;  2O3A A;  3O7B A;  4CND A;  4YQB A;  1V2X A;  2V3K A;  1VHK A;  4YQ1 A;  3KNU A;  1O6D A;  4YQ3 A;  1X7O A;  1MXI A;  4JWJ A;  1V6Z A;  2EGW A;  4XBO A;  4YQR A;  4YQ4 A;  4JAK A;  4YQ2 A;  4YVJ A;  1UAK A;  3ONP A;  1J85 A;  4YQT A;  3KTY A;  4H3Y A;  4YQD A;  4FAK A;  1Z85 A;  3GYQ A;  4JWG A;  5GMC A;  3ILK A;  3KY7 A;  4L69 A;  1NS5 A;  4YQI A;  4IG6 A;  4X3M A;  2YY8 A;  3N4J A;  4KDZ A;  4YQO A;  5GM8 A;  4YQN A;  4YVG A; 
#chains in the Genus database with same CATH homology
 1TO0 A;  3AXZ A;  4YPY A;  3OII A;  3N4K A;  4KGN A;  4YVK A;  4YQ5 A;  4YQ7 A;  3KW2 A;  5FAI A;  5D9F A;  3BBD A;  4RG1 A;  4YQA A;  1K3R A;  3OIN A;  4YQG A;  4YQC A;  4YQQ A;  2QMM A;  3NK6 A;  4H3Z A;  4FMW A;  4YPW A;  3DCM X;  4YQL A;  4E8B A;  3QUV A;  4YVH A;  3L8U A;  4X3L A;  4CNE A;  4CNG A;  1UAL A;  1VHY A;  5GMB A;  4CNF A;  3OIJ A;  4YQK A;  2EGV A;  4YPX A;  3BBE A;  3AIA A;  4YQP A;  4YQS A;  1UAJ A;  1X7P A;  3E5Y A;  4YQ0 A;  3AI9 X;  2CX8 A;  4YQ9 A;  1UAM A;  1ZJR A;  4YQJ A;  4MCC A;  4YVI A;  1OY5 A;  5CO4 A;  1GZ0 A;  4J3C A;  1NXZ A;  4YQ6 A;  2V3J A;  1IPA A;  3IEF A;  3BBH A;  4YQ8 A;  2Z0Y A;  4PZK A;  4MCB A;  1P9P A;  2I6D A;  2QWV A;  3NK7 A;  4JWF A;  3IC6 A;  4JWH A;  2HA8 A;  1VH0 A;  4JAL A;  4MCD A;  4YPZ A;  2O3A A;  3O7B A;  4CND A;  4YQB A;  1V2X A;  2V3K A;  1VHK A;  4YQ1 A;  3KNU A;  1O6D A;  4YQ3 A;  1X7O A;  1MXI A;  4JWJ A;  1V6Z A;  2EGW A;  4XBO A;  4YQR A;  4YQ4 A;  4JAK A;  4YQ2 A;  4YVJ A;  1UAK A;  3ONP A;  1J85 A;  4YQT A;  3KTY A;  4H3Y A;  4YQD A;  4FAK A;  1Z85 A;  3GYQ A;  4JWG A;  5GMC A;  3ILK A;  3KY7 A;  4L69 A;  1NS5 A;  4YQI A;  4IG6 A;  4X3M A;  2YY8 A;  3N4J A;  4KDZ A;  4YQO A;  5GM8 A;  4YQN A;  4YVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...