4JWGA

Crystal structure of sptrm10(74)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
Knots found
sequence length
187
structure length
187
Chain Sequence
b'RIRLGKVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVELFATNFGGRLKTRQDFVLKGQQNNWKRYNPTTKSYLEEFESQKEKLVYLSADSDNTITELDEDKIYIIGAIVDKNRYKNLCQNKASEQGIKTAKLPIDEYIKITDRKILTVNQVFEILSLWLEYRDWEKAFMEVIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine(9)-N1)-methyltransferase
publication title Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 67
structure length 187
sequence length 187
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.30 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jwgA00
4JWHA 4FMWA 4JWGA 4JWFA 4JWJA
chains in the Genus database with same CATH superfamily
1ZJRA 1GZ0A 3AI9X 3E5YA 1VHYA 1X7PA 4YQIA 4YQ4A 4YVIA 3BBDA 4YQ0A 4JWHA 3KNUA 3N4JA 4XBOA 4FMWA 4JWGA 1MXIA 4YPZA 2I6DA 4YQAA 2QWVA 2YY8A 4YVKA 1NXZA 1UAJA 4YQ3A 4J3CA 4KDZA 4IG6A 5FAIA 4YQ1A 2V3KA 4JALA 5CO4A 4YQLA 4KGNA 3KTYA 5GMCA 4YQ2A 2QMMA 1OY5A 3NK6A 3BBHA 4YVGA 4CNDA 3GYQA 1TO0A 2O3AA 1Z85A 3KW2A 4MCBA 4PZKA 2CX8A 2HA8A 5GMBA 3IEFA 4JWJA 1UALA 4YQ8A 4YQNA 3O7BA 4YQ6A 1X7OA 4RG1A 3L8UA 5D9FA 4YQGA 1V2XA 4YQ9A 3N4KA 3OINA 1P9PA 4CNFA 3QUVA 4YQQA 3IC6A 1K3RA 4CNEA 4YQCA 1VHKA 2EGWA 4YVJA 4H3YA 4YQOA 4YQTA 3AIAA 1VH0A 2V3JA 1UAKA 4YPWA 4YQKA 3NK7A 1NS5A 3OIJA 4YQRA 4L69A 4JWFA 4YQBA 1IPAA 4E8BA 4H3ZA 4YPXA 1J85A 4YQJA 3AXZA 4YVHA 2EGVA 4YQ7A 3KY7A 1UAMA 3DCMX 4YQDA 4CNGA 4X3LA 3BBEA 4FAKA 4YQSA 4YQ5A 1O6DA 4YPYA 2Z0YA 5GM8A 4YQPA 4JAKA 1V6ZA 3ONPA 4MCDA 3OIIA 4MCCA 4X3MA 3ILKA
chains in the Genus database with same CATH topology
1ZJRA 1GZ0A 3AI9X 3E5YA 1VHYA 1X7PA 4YQIA 4YQ4A 4YVIA 3BBDA 4YQ0A 4JWHA 3KNUA 3N4JA 4XBOA 4FMWA 4JWGA 1MXIA 4YPZA 2I6DA 4YQAA 2QWVA 2YY8A 4YVKA 1NXZA 1UAJA 4YQ3A 4J3CA 4KDZA 4IG6A 5FAIA 4YQ1A 2V3KA 4JALA 5CO4A 4YQLA 4KGNA 3KTYA 5GMCA 4YQ2A 2QMMA 1OY5A 3NK6A 3BBHA 4YVGA 4CNDA 3GYQA 1TO0A 2O3AA 1Z85A 3KW2A 4MCBA 4PZKA 2CX8A 2HA8A 5GMBA 3IEFA 4JWJA 1UALA 4YQ8A 4YQNA 3O7BA 4YQ6A 1X7OA 4RG1A 3L8UA 5D9FA 4YQGA 1V2XA 4YQ9A 3N4KA 3OINA 1P9PA 4CNFA 3QUVA 4YQQA 3IC6A 1K3RA 4CNEA 4YQCA 1VHKA 2EGWA 4YVJA 4H3YA 4YQOA 4YQTA 3AIAA 1VH0A 2V3JA 1UAKA 4YPWA 4YQKA 3NK7A 1NS5A 3OIJA 4YQRA 4L69A 4JWFA 4YQBA 1IPAA 4E8BA 4H3ZA 4YPXA 1J85A 4YQJA 3AXZA 4YVHA 2EGVA 4YQ7A 3KY7A 1UAMA 3DCMX 4YQDA 4CNGA 4X3LA 3BBEA 4FAKA 4YQSA 4YQ5A 1O6DA 4YPYA 2Z0YA 5GM8A 4YQPA 4JAKA 1V6ZA 3ONPA 4MCDA 3OIIA 4MCCA 4X3MA 3ILKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWH A;  4FMW A;  4JWG A;  4JWF A;  4JWJ A; 
#chains in the Genus database with same CATH topology
 1ZJR A;  1GZ0 A;  3AI9 X;  3E5Y A;  1VHY A;  1X7P A;  4YQI A;  4YQ4 A;  4YVI A;  3BBD A;  4YQ0 A;  4JWH A;  3KNU A;  3N4J A;  4XBO A;  4FMW A;  4JWG A;  1MXI A;  4YPZ A;  2I6D A;  4YQA A;  2QWV A;  2YY8 A;  4YVK A;  1NXZ A;  1UAJ A;  4YQ3 A;  4J3C A;  4KDZ A;  4IG6 A;  5FAI A;  4YQ1 A;  2V3K A;  4JAL A;  5CO4 A;  4YQL A;  4KGN A;  3KTY A;  5GMC A;  4YQ2 A;  2QMM A;  1OY5 A;  3NK6 A;  3BBH A;  4YVG A;  4CND A;  3GYQ A;  1TO0 A;  2O3A A;  1Z85 A;  3KW2 A;  4MCB A;  4PZK A;  2CX8 A;  2HA8 A;  5GMB A;  3IEF A;  4JWJ A;  1UAL A;  4YQ8 A;  4YQN A;  3O7B A;  4YQ6 A;  1X7O A;  4RG1 A;  3L8U A;  5D9F A;  4YQG A;  1V2X A;  4YQ9 A;  3N4K A;  3OIN A;  1P9P A;  4CNF A;  3QUV A;  4YQQ A;  3IC6 A;  1K3R A;  4CNE A;  4YQC A;  1VHK A;  2EGW A;  4YVJ A;  4H3Y A;  4YQO A;  4YQT A;  3AIA A;  1VH0 A;  2V3J A;  1UAK A;  4YPW A;  4YQK A;  3NK7 A;  1NS5 A;  3OIJ A;  4YQR A;  4L69 A;  4JWF A;  4YQB A;  1IPA A;  4E8B A;  4H3Z A;  4YPX A;  1J85 A;  4YQJ A;  3AXZ A;  4YVH A;  2EGV A;  4YQ7 A;  3KY7 A;  1UAM A;  3DCM X;  4YQD A;  4CNG A;  4X3L A;  3BBE A;  4FAK A;  4YQS A;  4YQ5 A;  1O6D A;  4YPY A;  2Z0Y A;  5GM8 A;  4YQP A;  4JAK A;  1V6Z A;  3ONP A;  4MCD A;  3OII A;  4MCC A;  4X3M A;  3ILK A; 
#chains in the Genus database with same CATH homology
 1ZJR A;  1GZ0 A;  3AI9 X;  3E5Y A;  1VHY A;  1X7P A;  4YQI A;  4YQ4 A;  4YVI A;  3BBD A;  4YQ0 A;  4JWH A;  3KNU A;  3N4J A;  4XBO A;  4FMW A;  4JWG A;  1MXI A;  4YPZ A;  2I6D A;  4YQA A;  2QWV A;  2YY8 A;  4YVK A;  1NXZ A;  1UAJ A;  4YQ3 A;  4J3C A;  4KDZ A;  4IG6 A;  5FAI A;  4YQ1 A;  2V3K A;  4JAL A;  5CO4 A;  4YQL A;  4KGN A;  3KTY A;  5GMC A;  4YQ2 A;  2QMM A;  1OY5 A;  3NK6 A;  3BBH A;  4YVG A;  4CND A;  3GYQ A;  1TO0 A;  2O3A A;  1Z85 A;  3KW2 A;  4MCB A;  4PZK A;  2CX8 A;  2HA8 A;  5GMB A;  3IEF A;  4JWJ A;  1UAL A;  4YQ8 A;  4YQN A;  3O7B A;  4YQ6 A;  1X7O A;  4RG1 A;  3L8U A;  5D9F A;  4YQG A;  1V2X A;  4YQ9 A;  3N4K A;  3OIN A;  1P9P A;  4CNF A;  3QUV A;  4YQQ A;  3IC6 A;  1K3R A;  4CNE A;  4YQC A;  1VHK A;  2EGW A;  4YVJ A;  4H3Y A;  4YQO A;  4YQT A;  3AIA A;  1VH0 A;  2V3J A;  1UAK A;  4YPW A;  4YQK A;  3NK7 A;  1NS5 A;  3OIJ A;  4YQR A;  4L69 A;  4JWF A;  4YQB A;  1IPA A;  4E8B A;  4H3Z A;  4YPX A;  1J85 A;  4YQJ A;  3AXZ A;  4YVH A;  2EGV A;  4YQ7 A;  3KY7 A;  1UAM A;  3DCM X;  4YQD A;  4CNG A;  4X3L A;  3BBE A;  4FAK A;  4YQS A;  4YQ5 A;  1O6D A;  4YPY A;  2Z0Y A;  5GM8 A;  4YQP A;  4JAK A;  1V6Z A;  3ONP A;  4MCD A;  3OII A;  4MCC A;  4X3M A;  3ILK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...