5GMBA

Methylation at position 32 of trna catalyzed by trmj alters oxidative stress response in pseudomonas aeruiginosa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
Knots found
sequence length
171
structure length
171
Chain Sequence
FQSMMLDRIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARASGATDILDAARVVDTLEEALSGCSVVLGTSARDRRIPWPLLDPRECATTCLEHLEANGEVALVFGREYAGLTNEELQRCQFHVHIPSDPEFGSLNLAAAVQVLTYEVRMAWLAAQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
publication title Methylation at position 32 of tRNA catalyzed by TrmJ alters oxidative stress response in Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 68
structure length 171
sequence length 171
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 5gmbA01
4MCCA 3AI9X 3BBHA 3L8UA 1X7PA 4YQ9A 4E8BA 4YQ2A 1UAKA 3KNUA 1TO0A 3IC6A 3DCMX 3E5YA 4YQBA 1OY5A 4FAKA 5GMCA 2QWVA 4KDZA 4YQDA 4KGNA 3ONPA 4H3YA 4YPYA 4YQ7A 1P9PA 2EGWA 3NK6A 5D9FA 3IEFA 4YPZA 4YPWA 4YQCA 3KTYA 4YQ5A 4YPXA 4L69A 5GM8A 4YQPA 2Z0YA 4MCBA 3QUVA 4YQ8A 4JAKA 1VH0A 4XBOA 1NS5A 4YQSA 2V3JA 4YQ1A 4YQNA 4X3LA 3AXZA 4MCDA 3N4KA 4CNDA 3KW2A 4YQKA 2V3KA 1K3RA 1J85A 4YQ6A 1NXZA 4YVHA 4CNEA 2QMMA 4YQTA 3N4JA 1Z85A 1X7OA 3BBDA 1UAJA 4YVIA 1UALA 2O3AA 1ZJRA 4YQ3A 1VHYA 4YVGA 4H3ZA 4YQIA 4YQAA 1GZ0A 4YQOA 4YVKA 4J3CA 5CO4A 4JALA 3OINA 3OIJA 4YQ4A 3ILKA 3OIIA 1IPAA 3KY7A 4RG1A 4YVJA 4X3MA 3GYQA 4IG6A 5GMBA 4CNGA 1UAMA 1V2XA 2I6DA 3AIAA 4CNFA 4YQJA 1VHKA 5FAIA 1O6DA 3BBEA 4YQLA 2HA8A 2CX8A 4YQRA 1MXIA 1V6ZA 3NK7A 2YY8A 2EGVA 4YQQA 4PZKA 3O7BA 4YQ0A 4YQGA
chains in the Genus database with same CATH superfamily
4MCCA 3AI9X 3BBHA 3L8UA 1X7PA 4YQ9A 4E8BA 4YQ2A 1UAKA 3KNUA 1TO0A 3IC6A 3DCMX 3E5YA 4YQBA 1OY5A 4FAKA 5GMCA 2QWVA 4KDZA 4YQDA 4KGNA 3ONPA 4H3YA 4YPYA 4YQ7A 1P9PA 2EGWA 3NK6A 5D9FA 3IEFA 4YPZA 4YPWA 4YQCA 3KTYA 4YQ5A 4YPXA 4L69A 5GM8A 4YQPA 2Z0YA 4MCBA 3QUVA 4YQ8A 4JAKA 1VH0A 4XBOA 1NS5A 4YQSA 2V3JA 4YQ1A 4YQNA 4X3LA 3AXZA 4MCDA 3N4KA 4CNDA 3KW2A 4YQKA 2V3KA 1K3RA 1J85A 4YQ6A 1NXZA 4YVHA 4CNEA 2QMMA 4YQTA 3N4JA 1Z85A 1X7OA 3BBDA 1UAJA 4YVIA 1UALA 2O3AA 1ZJRA 4JWFA 4YQ3A 1VHYA 4YVGA 4H3ZA 4YQIA 4YQAA 1GZ0A 4YQOA 4YVKA 4J3CA 5CO4A 4JALA 3OINA 3OIJA 4JWJA 4YQ4A 3ILKA 3OIIA 1IPAA 3KY7A 4RG1A 4YVJA 4X3MA 3GYQA 4IG6A 5GMBA 4CNGA 1UAMA 1V2XA 2I6DA 3AIAA 4CNFA 4YQJA 1VHKA 5FAIA 1O6DA 4FMWA 3BBEA 4YQLA 2HA8A 2CX8A 4JWHA 4JWGA 4YQRA 1MXIA 1V6ZA 3NK7A 2YY8A 2EGVA 4YQQA 4PZKA 3O7BA 4YQ0A 4YQGA
chains in the Genus database with same CATH topology
4MCCA 3AI9X 3BBHA 3L8UA 1X7PA 4YQ9A 4E8BA 4YQ2A 1UAKA 3KNUA 1TO0A 3IC6A 3DCMX 3E5YA 4YQBA 1OY5A 4FAKA 5GMCA 2QWVA 4KDZA 4YQDA 4KGNA 3ONPA 4H3YA 4YPYA 4YQ7A 1P9PA 2EGWA 3NK6A 5D9FA 3IEFA 4YPZA 4YPWA 4YQCA 3KTYA 4YQ5A 4YPXA 4L69A 5GM8A 4YQPA 2Z0YA 4MCBA 3QUVA 4YQ8A 4JAKA 1VH0A 4XBOA 1NS5A 4YQSA 2V3JA 4YQ1A 4YQNA 4X3LA 3AXZA 4MCDA 3N4KA 4CNDA 3KW2A 4YQKA 2V3KA 1K3RA 1J85A 4YQ6A 1NXZA 4YVHA 4CNEA 2QMMA 4YQTA 3N4JA 1Z85A 1X7OA 3BBDA 1UAJA 4YVIA 1UALA 2O3AA 1ZJRA 4JWFA 4YQ3A 1VHYA 4YVGA 4H3ZA 4YQIA 4YQAA 1GZ0A 4YQOA 4YVKA 4J3CA 5CO4A 4JALA 3OINA 3OIJA 4JWJA 4YQ4A 3ILKA 3OIIA 1IPAA 3KY7A 4RG1A 4YVJA 4X3MA 3GYQA 4IG6A 5GMBA 4CNGA 1UAMA 1V2XA 2I6DA 3AIAA 4CNFA 4YQJA 1VHKA 5FAIA 1O6DA 4FMWA 3BBEA 4YQLA 2HA8A 2CX8A 4JWHA 4JWGA 4YQRA 1MXIA 1V6ZA 3NK7A 2YY8A 2EGVA 4YQQA 4PZKA 3O7BA 4YQ0A 4YQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCC A;  3AI9 X;  3BBH A;  3L8U A;  1X7P A;  4YQ9 A;  4E8B A;  4YQ2 A;  1UAK A;  3KNU A;  1TO0 A;  3IC6 A;  3DCM X;  3E5Y A;  4YQB A;  1OY5 A;  4FAK A;  5GMC A;  2QWV A;  4KDZ A;  4YQD A;  4KGN A;  3ONP A;  4H3Y A;  4YPY A;  4YQ7 A;  1P9P A;  2EGW A;  3NK6 A;  5D9F A;  3IEF A;  4YPZ A;  4YPW A;  4YQC A;  3KTY A;  4YQ5 A;  4YPX A;  4L69 A;  5GM8 A;  4YQP A;  2Z0Y A;  4MCB A;  3QUV A;  4YQ8 A;  4JAK A;  1VH0 A;  4XBO A;  1NS5 A;  4YQS A;  2V3J A;  4YQ1 A;  4YQN A;  4X3L A;  3AXZ A;  4MCD A;  3N4K A;  4CND A;  3KW2 A;  4YQK A;  2V3K A;  1K3R A;  1J85 A;  4YQ6 A;  1NXZ A;  4YVH A;  4CNE A;  2QMM A;  4YQT A;  3N4J A;  1Z85 A;  1X7O A;  3BBD A;  1UAJ A;  4YVI A;  1UAL A;  2O3A A;  1ZJR A;  4YQ3 A;  1VHY A;  4YVG A;  4H3Z A;  4YQI A;  4YQA A;  1GZ0 A;  4YQO A;  4YVK A;  4J3C A;  5CO4 A;  4JAL A;  3OIN A;  3OIJ A;  4YQ4 A;  3ILK A;  3OII A;  1IPA A;  3KY7 A;  4RG1 A;  4YVJ A;  4X3M A;  3GYQ A;  4IG6 A;  5GMB A;  4CNG A;  1UAM A;  1V2X A;  2I6D A;  3AIA A;  4CNF A;  4YQJ A;  1VHK A;  5FAI A;  1O6D A;  3BBE A;  4YQL A;  2HA8 A;  2CX8 A;  4YQR A;  1MXI A;  1V6Z A;  3NK7 A;  2YY8 A;  2EGV A;  4YQQ A;  4PZK A;  3O7B A;  4YQ0 A;  4YQG A; 
#chains in the Genus database with same CATH topology
 4MCC A;  3AI9 X;  3BBH A;  3L8U A;  1X7P A;  4YQ9 A;  4E8B A;  4YQ2 A;  1UAK A;  3KNU A;  1TO0 A;  3IC6 A;  3DCM X;  3E5Y A;  4YQB A;  1OY5 A;  4FAK A;  5GMC A;  2QWV A;  4KDZ A;  4YQD A;  4KGN A;  3ONP A;  4H3Y A;  4YPY A;  4YQ7 A;  1P9P A;  2EGW A;  3NK6 A;  5D9F A;  3IEF A;  4YPZ A;  4YPW A;  4YQC A;  3KTY A;  4YQ5 A;  4YPX A;  4L69 A;  5GM8 A;  4YQP A;  2Z0Y A;  4MCB A;  3QUV A;  4YQ8 A;  4JAK A;  1VH0 A;  4XBO A;  1NS5 A;  4YQS A;  2V3J A;  4YQ1 A;  4YQN A;  4X3L A;  3AXZ A;  4MCD A;  3N4K A;  4CND A;  3KW2 A;  4YQK A;  2V3K A;  1K3R A;  1J85 A;  4YQ6 A;  1NXZ A;  4YVH A;  4CNE A;  2QMM A;  4YQT A;  3N4J A;  1Z85 A;  1X7O A;  3BBD A;  1UAJ A;  4YVI A;  1UAL A;  2O3A A;  1ZJR A;  4JWF A;  4YQ3 A;  1VHY A;  4YVG A;  4H3Z A;  4YQI A;  4YQA A;  1GZ0 A;  4YQO A;  4YVK A;  4J3C A;  5CO4 A;  4JAL A;  3OIN A;  3OIJ A;  4JWJ A;  4YQ4 A;  3ILK A;  3OII A;  1IPA A;  3KY7 A;  4RG1 A;  4YVJ A;  4X3M A;  3GYQ A;  4IG6 A;  5GMB A;  4CNG A;  1UAM A;  1V2X A;  2I6D A;  3AIA A;  4CNF A;  4YQJ A;  1VHK A;  5FAI A;  1O6D A;  4FMW A;  3BBE A;  4YQL A;  2HA8 A;  2CX8 A;  4JWH A;  4JWG A;  4YQR A;  1MXI A;  1V6Z A;  3NK7 A;  2YY8 A;  2EGV A;  4YQQ A;  4PZK A;  3O7B A;  4YQ0 A;  4YQG A; 
#chains in the Genus database with same CATH homology
 4MCC A;  3AI9 X;  3BBH A;  3L8U A;  1X7P A;  4YQ9 A;  4E8B A;  4YQ2 A;  1UAK A;  3KNU A;  1TO0 A;  3IC6 A;  3DCM X;  3E5Y A;  4YQB A;  1OY5 A;  4FAK A;  5GMC A;  2QWV A;  4KDZ A;  4YQD A;  4KGN A;  3ONP A;  4H3Y A;  4YPY A;  4YQ7 A;  1P9P A;  2EGW A;  3NK6 A;  5D9F A;  3IEF A;  4YPZ A;  4YPW A;  4YQC A;  3KTY A;  4YQ5 A;  4YPX A;  4L69 A;  5GM8 A;  4YQP A;  2Z0Y A;  4MCB A;  3QUV A;  4YQ8 A;  4JAK A;  1VH0 A;  4XBO A;  1NS5 A;  4YQS A;  2V3J A;  4YQ1 A;  4YQN A;  4X3L A;  3AXZ A;  4MCD A;  3N4K A;  4CND A;  3KW2 A;  4YQK A;  2V3K A;  1K3R A;  1J85 A;  4YQ6 A;  1NXZ A;  4YVH A;  4CNE A;  2QMM A;  4YQT A;  3N4J A;  1Z85 A;  1X7O A;  3BBD A;  1UAJ A;  4YVI A;  1UAL A;  2O3A A;  1ZJR A;  4JWF A;  4YQ3 A;  1VHY A;  4YVG A;  4H3Z A;  4YQI A;  4YQA A;  1GZ0 A;  4YQO A;  4YVK A;  4J3C A;  5CO4 A;  4JAL A;  3OIN A;  3OIJ A;  4JWJ A;  4YQ4 A;  3ILK A;  3OII A;  1IPA A;  3KY7 A;  4RG1 A;  4YVJ A;  4X3M A;  3GYQ A;  4IG6 A;  5GMB A;  4CNG A;  1UAM A;  1V2X A;  2I6D A;  3AIA A;  4CNF A;  4YQJ A;  1VHK A;  5FAI A;  1O6D A;  4FMW A;  3BBE A;  4YQL A;  2HA8 A;  2CX8 A;  4JWH A;  4JWG A;  4YQR A;  1MXI A;  1V6Z A;  3NK7 A;  2YY8 A;  2EGV A;  4YQQ A;  4PZK A;  3O7B A;  4YQ0 A;  4YQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...