4RG1A

Methyltransferase domain of c9orf114
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
Knots found
sequence length
306
structure length
285
Chain Sequence
RGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQACVQLARILQYLECPQYLRKAFFPKHLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLTQAGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C9orf114
publication title The Crystal Structure of Human C9orf114 in complex with S-adenosyl-homocysteine
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 285
sequence length 306
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02598 Methyltrn_RNA_3 Putative RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4rg1A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4rg1A01
1C7YA 3S1NH 4YQPA 1X3EA 2UXDQ 5GAGC 4OWWB 1X3FA 4JI6L 3KYHC 5GAEC 1N8RC 4QL5A 4AYBE 2Q2UA 1X3GA 2B29A 4DR4Q 3Q8DA 4R4TA 1IBML 2I0QA 2NN6I 5LMUL 4JBMA 3KTYA 4R4CA 5BR8L 5C3EH 4TQUS 4LF5L 2HT1A 4IFDJ 3PUYA 4JI8L 3CC7A 1PHJA 1FGUA 4JI4Q 2UXCL 3HOUH 4PZ8A 1N32L 1KD1C 5FLMG 3W1BA 4OX9Q 3AXZA 4GN3B 2N3SA 1VQHA 4O0AA 5C4XH 4YQBA 4YQQA 1SRUA 2A19A 4WJ4A 1BBWA 4ME3A 3UDXA 1HZ9A 1Y14B 1HJPA 3CMAA 3PUVA 2NZOA 2IX1A 2ATWA 4P75A 1Q7YC 5IYCH 4OO1G 5C4XG 2WAQE 3E9IA 3J81i 4APVA 2EQSA 3L2PA 1NE3A 4DR6L 1VQDA 3HOWH 4DR7L 1JJ2A 1D7QA 1V6ZA 2IT1A 3RN5A 5LMNW 3U58A 2PQAB 2K5HA 5K36G 2VL6A 2RF4A 4JOIA 4KI0A 4Y52H 1IL2A 4IJHA 2VQEQ 3O7BA 4LFBL 1QVFA 2E2JH 4MCBA 2UU9Q 4YQGA 1OXTA 2N78A 1VQPA 4A3EH 2JE6I 1Q82C 4JI2Q 3L0OA 3HOYG 4UP9A 1UE1A 2FXQA 5AJ3Q 3KNUA 5IP7H 3HOWG 2ID0A 1EUJA 2KCTA 2D0OA 4QIWE 1DGSA 3B6YA 3H0GH 4YCVA 3RLOA 1VS0A 1GVPA 1Q12A 2PNHA 1N9WA 1A8VA 2YTVA 4X62L 4X64Q 4ALPA 3CCLA 2JA7H 2BH8A 4HIDA 4YPXA 1B7YB 1XNQQ 1A62A 1PYBA 4IPDA 4B3ML 4AYBG 4NXML 4JI5Q 1JJGA 4IFDI 1PFSA 3FKIG 4X66L 4TVAB 1YJWA 4YQLA 2AKWB 3CW2C 4XIGS 4LFAL 3AFQA 4L5QA 4XBOA 4JBJA 3AFPA 3M9BA 2KHJA 2IY5B 3SGIA 4BBRH 2ZJRA 4DNIA 4LF4L 3GTJH 2JA5H 1FVIA 2PMZE 1R9TH 4DK3C 3CF5A 1HZBA 1D8LA 2XGTA 4IPGA 4DR3L 3VDYA 4UPAA 1XMQQ 3AI9X 1PH3A 3I4MG 2AHOB 5LMNQ 3ER0A 2E5LQ 2JA6H 2R6GA 1YZ6A 2PQAA 4DUZL 1XTDA 3NBHB 2AWNA 2HA8A 2YTYA 4MTNA 5IT9c 1WCMG 2CKZB 4L5SA 4A93G 1A63A 1FJGL 1JE5A 4DUYQ 1GZ0A 2R7FA 5GMCA 1HZCA 2PI2E 3A0JA 3J7A5 2K14A 1X9NA 2WAQG 3I4NG 3I4OA 5M3FG 2UUCL 1WJJA 2OTJA 4KHZA 2D0PA 2VUMH 3KDFA 1SLJA 2MO0A 4O2DA 1VQAA 2UUAL 2O3AA 4C3JH 3GTPH 3PCOB 1KRTA 3S17H 2CWPA 2RHQB 4DR1Q 1YI2A 4A3GH 2K52A 2K5NA 3HFZB 3PUZA 3OW2A 1RIPA 4NXNQ 3AYHB 5IYDG 4HJ9A 3KJPA 4YCWA 4DR2L 3T1YL 3GTGH 1AH9A 2A1AA 1N34L 4UP7A 1HZAA 2R92G 2JEAI 1VQJA 4LF6L 4LUVA 3EN2A 1S72A 1EWIA 4LW1A 5JEAG 3FHWA 2ZM6Q 1K8AC 3LGJA 1GD7A 4R4IA 2EGVA 4QY7A 3RLNA 3J81c 4YVKA 1L1OA 1Z47A 4R4OA 5IYBH 4DV0L 5M5XH 5M3MH 2MFIA 2NZHA 4GN5A 1NTGA 1VQBA 3T1HL 1HNZL 5DLQE 2QA4A 2CCZA 1UAKA 5FAIA 1X7PA 3ZJYC 4XTCS 5FJ8H 4LF7L 4A75A 1YJ9A 3CP0A 3IC6A 1Y1VG 4YQ0A 5GM8A 4UP8A 3HOZH 5C0XJ 4LF8Q 4GOPA 1L0WA 4DV6Q 4GKJQ 2JA8G 1WFQA 5C44G 5IP9G 4JI7L 5GROA 4IFDG 2I5MX 4A4IA 4PZ7A 1Q1BA 4JI1L 2JJQA 4GLAC 4JI6Q 4LUZA 3CCMA 4DV1L 5GADC 3PO3G 4A3MH 3G6EA 4YY3L 4POFA 4X65Q 4CNEA 1XNRL 1VH0A 1M90C 2YTXA 5LMUQ 2Q2TA 4YQJA 3CCUA 4A3CG 1N33L 4JBWA 2N8NA 4LNQA 3F2CA 1NY4A 1GO3E 4AH6A 4YQ9A 2CFMA 1V9PA 2L15A 4KLKA 4A3MG 4LF5Q 1YVCA 3GTQH 2DGYA 4GN4B 2UXCQ 1CSPA 2Q2IA 1U5KA 3CCJA 1MKHA 4LF9Q 4DV4Q 1I94L 2BH2A 1UAJA 1OXSC 1K8GA 1ZJRA 5C3EG 4YQCA 5J3BA 1PH7A 1G6PA 2A8VA 4HIKA 4KHPQ 4MCDA 4GNXB 4RG1A 4K0KL 2QWVA 3QUVA 1BVSA 1XJVA 3BBEA 2Z6KA 3F2DA 3HOUG 2UXDL 1MXIA 1B8AA 1X6OA 3F1ZA 4QJFA 2BA1A 3J80i 3U4VA 1VQNA 2C35B 1UALA 2OQKA 3HOVH 4JOIC 3PF5A 4MNOA 3KF6B 4B3RQ 1IPAA 3KLWA 4H3YA 2MO1A 3J81j 4A76A 1J5EL 2EGWA 2EXDA 2WP8J 2K50A 4IPCA 1EIFA 4LWCA 5IYCG 4GNXC 1Y1WH 1EYGA 4JI4L 1E7ZA 5JJKA 1EQRA 4YQ3A 1QUQB 3CC4A 1K83H 4DV3Q 4A3LH 4DK6C 1SMXA 2CWAA 4DKAC 3J7ZC 1OXUA 4OX9L 4YQDA 3N4KA 3L7ZC 1YBYA 1XMOQ 4YVJA 5IY0A 3UDGA 3GTOH 2Z0YA 4HIOA 4DV7Q 5C0XI 1S40A 4DAYB 3IEFA 1FJGQ 4X3MA 4CNDA 4IPHA 1VQLA 4BY1H 1K0RA 1VQIA 3GTLH 1E1OA 2Q2HA 2KHIA 3UDFA 4HJ8A 4JI0Q 1Q1EA 1PH9A 4L5RC 2V3JA 4JAKA 3K8AA 3A5UA 1TXYA 1NJIC 1QVGA 1H95A 2OQ0A 3M85A 4A3EG 2VS1A 2V3KA 1YIJA 2E2HH 5GQOA 1UE5A 4JI3L 5ELNA 4YWMA 2ALYB 2ES2A 2VQFQ 2R93H 4X62Q 4JYAL 5M5WH 5IP7G 4A3CH 1VQEA 4PZKA 3H0GG 4DV2L 4B3MQ 2IHEA 3ICEA 2K5VA 4NXMQ 2GVBA 4HJ5A 3CPFA 1TWFH 4A3FH 4BXXH 2GN5A 3W5OA 4LFCQ 3EIVA 4HIMA 4GLXA 2B63H 2NN6G 3ULJA 1HR0W 2JA7G 2CQOA 4LFAQ 4BA1I 1PA6A 3KJOA 4YQOA 4DAMA 1PH5A 4AIMA 3G48A 4A3KH 4LF4Q 3WWVA 2UXBQ 1O6DA 4BBSH 4DR3Q 4HJ7A 2H5XA 3GDEA 4A3DH 3S24A 1IXRA 3KW2A 4YQIA 4L69A 4IOCA 5HY6A 3I2ZA 4EQ5A 3CCQA 4AQYL 4B3SL 1AE3A 4H02A 1BBUA 4BBRG 1K73C 2OTLA 5EAYA 4X64L 2JA5G 1YNXA 3K81C 4DV5L 1SROA 1XNQL 3PIOA 1TWAH 4GS3A 2IX0A 1VHYA 4JI5L 1T9HA 3GD7A 1IBKQ 1TWHH 2UUCQ 1G291 2JA6G 1I6HH 2XTIA 2VY3A 2JQOA 4YQ1A 3GTMH 1WOCA 4PMWA 3DCMX 1CKNB 2VNUD 3MXNB 4YQ5A 1QZGA 3CC2A 1SFOH 1Z85A 2F4VL 2LXKA 1V43A 1QZHA 2JK8A 3PF4A 2K75A 3TEHB 3RNUA 1XMQL 2VUMG 4DR2Q 2N49A 1EOVA 4YWLA 4YPWA 1KHIA 1N34Q 3I7FA 5GMBA 3ONPA 1UEBA 3S1QH 4LF6Q 3E5YA 3IRBA 4GKKQ 4YQ2A 4A3GG 3TQYA 1K9MC 3TS2A 5C0XG 3H3VI 2KCMA 5JJIA 4YWKA 3L8UA 3J80c 4DUYL 1HNXQ 4YQKA 3ERSX 5IWAL 1P16A 4YHHQ 4A3IH 3HOXH 3PUWA 1HR0Q 3BU2A 3NELA 3CMEA 1HNZQ 1N36Q 4YQTA 1PV4A 2HHHQ 3OTOL 4LF7Q 2YU9H 4OO1I 1KIXA 1LUZA 4A3IG 2I5HA 3UE1A 1HNWQ 3CCVA 5JJLA 1CUKA 1OXVA 5IYBG 1GM5A 5M3MG 2LSSA 4YVIA 3AQQA 4NXNL 2NVTH 3CQZH 1EFWA 3PO2H 3W1GA 3G71A 3M4PA 3CCEA 4JI7Q 1YEZA 1OTCA 3S14H 5FJ8G 4J3CA 2V1CC 4IOAA 4YQAA 1W3SA 4C3IH 4E8BA 4X3LA 2IHFA 3GYQA 1NMFA 1WYDA 1Z9FA 1KAWA 1YHQA 4DV1Q 2UUBL 3HOZG 1O7IA 2DUDA 2R7ZH 4JALA 4PZ6A 4J15A 1KXLA 3S16H 1SE8A 5HGQA 1X55A 1IBMQ 3KOJA 3I55A 2HQLA 3D0FA 4NB3A 1N33Q 1Q8KA 1W2BA 4A3JH 1PH8A 4JV5L 5BR8Q 2NVXH 2LXJA 4A3BH 3K0XA 2MNAA 1I5FA 1PH6A 4JI8Q 4DR5L 4JG2A 1PH1A 1VHKA 1MJEA 3M4QA 1ASZA 1N32Q 1I94Q 4DV6L 4GKJL 3RZOH 3A74A 3EBEA 1PVOA 4B3TL 1X56A 4OONA 4OWXB 1IBLL 3HKSA 4K0KQ 1OY5A 3AIAA 3KFUA 2HIXA 1VQOA 3NENA 2Z0SA 4WJ3M 3OYYA 4IG6A 1PH2A 2EIFA 2ASBA 1M1KC 1S3OA 4QQBX 2GVAA 2E8GA 4EX5A 4X65L 1ASYA 1VQ6A 4DR4L 3UE0A 1YITA 4DR6Q 4DR7Q 3H3VH 4FDBA 5FLMH 3DM3A 1J5EQ 5D9FA 3NK6A 3RLFA 4OXPA 2AMCB 1VQKA 1SR3A 2RHSB 3HOVG 1IYJB 4JCVE 3D31A 3S2DH 1YHAA 3N4JA 1P8LA 4YCUA 4KGNA 4LF9L 3BZCA 1SN8A 2Y0SE 3CCSA 4C3HH 4DV4L 4LFBQ 4H3ZA 3U50C 4IO9A 3ULLA 2VZAA 1Y1WG 4KHPL 3E0EA 1EIYB 1X7OA 1CSQA 1E3PA 3BBHA 1Q86C 5E7NA 3BBDA 3KF8B 4YQNA 4A3LG 3ILKA 2R7DA 3HKZE 1JB7A 3DLLA 1UE6A 4B3RL 3M3YH 1JJCB 1WI5A 1XPRA 4BY1G 4JI3Q 2KENA 4CNGA 3JAMi 3PIPA 4JYAQ 2JEBI 2K4KA 2ZTEA 1VCIA 1VQ9A 1V2XA 4DV2Q 2QGQA 4DV3L 3HOYH 3S1RH 1VQ7A 4HJAA 2VQEL 3NEMA 3PV0A 5CO4A 2WB1E 4X66Q 3BZKA 3RZDH 1XMOL 1X54A 2UU9L 3PGZA 4GNXA 1VQCA 1Q81C 2R93G 2QMMA 2NVQH 4DV7L 3CD6A 4R1JA 3KDFB 5H1SE 1OXXK 2QEXA 1HR0L 4YPZA 4JI2L 1FL0A 3OINA 4JI0L 5AJ3L 1YHBA 3K80C 3KF6A 4A3FG 1PH4A 3S1MH 4BXXG 4R4QA 2B63G 1NXZA 1UAMA 1TWGH 4P73A 4QGUA 3I56A 4B3SQ 4AQYQ 4X6AH 3FKIH 4GLVB 4DUZQ 2VQFL 4A3KG 3S15H 4UY8C 1LTLA 1V1QA 4DV5Q 4BBSG 4YQ4A 1X65A 1QUQA 3PUXA 2I5LX 3PSIA 1HH2P 4L5TA 4DPGA 1KC8C 2B3GA 1JMCA 4A3DG 4P72A 2YYZA 4C2MH 1VQGA 2CX8A 4OWTB 3TREA 5GAHC 1L1OB 4IJLA 4LFCL 5FLXc 2KBNA 1G51A 3I4MH 2PI2A 4JC0A 1BKBA 2UUAQ 3KY7A 4P71A 4YPYA 1UE7A 3M7NA 4YQ6A 2F4VQ 2UXBL 4NPSA 1XPUA 1WCMH 3MEFA 1XPOA 4A93H 2BA0A 1GKHA 4BA2I 1KRSA 4KDZA 1U0LA 2D62A 4GOPB 4YQSA 1TWCH 2Y0SG 1Q46A 1MIUA 3T1YQ 4JBKA 2I6DA 4YQ7A 2AWOA 4Y7NH 1L1OC 5LMNL 3I4NH 3OIIA 5M3FH 1E22A 1NMGA 2E5LL 1K3RA 4MCCA 2E2IH 2RCNA 1CKOA 1L2FA 2MQHA 1VQ4A 3GTKH 5IWAQ 1VQ8A 1NS5A 3NK7A 3G4SA 4RMFA 4FAKA 1IBKL 3HKZG 3UDIA 4DV0Q 3TS0A 4GOPC 4PG3A 3T1HQ 3STBD 1MJCA 3OTOQ 5IYDH 1VQFA 5M5YH 3AEVA 1B70B 4YVHA 3S2HH 2YY8A 3BJUA 3F8TA 1LM0A 1EQQA 2R92H 1IZ6A 1JT8A 2F3IA 3CAMA 3HOXG 3F2BA 2ZTCA 4DR1L 2OWOA 3CXCA 4YVGA 3RR5A 1I50H 1PYSB 1J6QA 1RL2A 1CKMA 3RN2A 3FP9A 3STBC 4POGA 2WB1G 4YQ8A 3E9HA 1LYLA 3JC66 4MZ9A 1E24A 2ZJQA 1AE2A 2VW9A 4JI1Q 1KQSA 2UUBQ 4GKKL 1QVCA 1UWVA 3TRZA 3OIJA 4YQRA 2HIVA 3K7AH 1YJNA 2YV5A 3PO2G 2JA9A 2OCEA 4YY3Q 2ZM6L 3ULPA 4BY7H 4YHHL 1XNRQ 1Y1VH 2ZTDA 1I3QH 1HNXL 5C4JH 3CPWA 1N36L 4JV5Q 1C0AA 1E1TA 2HHHL 2JA8H 3JAMc 1C9OA 5IP9H 1KL9A 1CKNA 5C44H 2F52A 2WFWA 3U4ZA 5IE8A 1A0IA 4DR5Q 1VQMA 2R7ZG 4BY7G 2NVYH 4CNFA 1NBWA 1HNWL 2Z6KC 3K7UC 4P74A 1P9PA 3A5ZB 4LF8L 1VQ5A 4A3JG 4LUOA 3PO3H 1TO0A 5JEAJ 4B3TQ 3M4OH 3H15A 2ZJPA 5ELOA 1IBLQ 4A3BG 3GO5A 1J85A 3CCRA
chains in the Genus database with same CATH superfamily
3S1NH 2UXDQ 4OWWB 1X3FA 3KYHC 2GA4B 2Q2UA 1X3GA 5LMUL 3KTYA 3OHXC 3U9OA 3HOZB 2BCOA 4JK1C 4TQUS 5EBCA 4CDDC 2O2LD 2UXCL 4ZLTF 3MTSA 3AXZA 1HQMC 4O0AA 4YQQA 1EY8A 2PCFB 1TKWB 2HCIA 1HZ9A 1CHQD 3LX0A 4WORA 1EQVA 4P75A 4RHRA 1GXDC 4OO1G 3E9IA 2F4IA 1NAPA 4APVA 3DM1A 3J81i 3L2PA 1D7QA 2RBMA 3VR5A 1K8MA 1HRJA 1FYCA 2K5HA 5K36G 2E2DC 1G2SA 4IJHA 1PRTB 2VQEQ 1MSGA 3NPPA 1QVFA 2UU9Q 1OXTA 3ZYYX 2N78A 4A3EH 1U9RA 3HOYG 4CJ2C 1UE1A 2MP1A 2JP1A 5IP7H 1EYDA 2ID0A 2IJ0A 2KCTA 2LMCB 2G5DA 2PNHA 4X62L 4HN7A 2NN6H 1BCPC 4HIDA 1XNQQ 1MI2A 1PYBA 4CJ0B 3GTLB 4X66L 1YJWA 4YQLA 3M3YB 4XBOA 3AFQA 3AFPA 3M9BA 2KHJA 3KBXA 3MHBA 3VA5A 1BF4A 1R9TH 4DK3C 1D8LA 4DR3L 1O80A 3I73A 2H4OA 4UPAA 3S1RB 1EIGA 2AHOB 2JA6H 3M7GA 1YZ6A 2PQAA 5IGGA 2AWNA 4A3FB 4MTNA 1WCMG 4IURA 1Z7TA 1FJGL 1JE5A 1GZ0A 4ZAIA 2LY7A 3A0JA 3I4NG 2WAQG 2UUCL 3I3CA 1PFMA 4KHZA 1ILPA 1GUOA 5DEHA 4C3JH 3S17H 3RUZA 5C6AA 4RCOA 1MSHA 3PUZA 3OW2A 5LHY1 4YCWA 1BXTA 2R92G 2JEAI 2K03A 3EN2A 2Y0SB 1EWIA 5JEAG 3FHWA 3LGJA 4QY7A 4YVKA 5M3MH 2MFIA 2F0WA 3A56A 3HKZB 4YQ0A 1E2VA 5E4XA 2F0TA 5EJWA 2KQ3A 1SE3A 2NWGA 3NBHA 1GOZA 4DV1L 2HD3A 4DXGA 1AZPA 4YY3L 4CNEA 2YTXA 4YQJA 1D1KA 2EY2A 4A3CG 1GO3E 4LF5Q 4KLKA 1YVCA 1MGSA 2Q2IA 3LWEA 4ZRZA 3VYSA 4LF9Q 1LTAD 3NTIA 1OXSC 4K2KA 4BY7B 2A8VA 4GNXB 4K0KL 1WTHA 2B2YC 2UXDL 3G6JB 4A3JB 1Z6HA 5EPJA 5FO7B 2OQKA 3KF6B 5E1FA 3ERQA 2DJGC 5C5LA 1D2BA 4LWCA 5ISRA 4GNXC 2PMZB 1DOMA 4YQ3A 4E6IA 1K83H 5DAUA 4EQOA 4DV3Q 1EY6A 4L8JA 1YNJC 1SMXA 1B2TA 4YQDA 1XMOQ 2Z0YA 2RKSA 4CNDA 2QDLA 1HQRD 2KHIA 4NDXA 2QKIC 4L5RC 1STGA 1H95A 3S2DB 1PFNA 5CV6A 1J9OA 1PZJD 1YIJA 2E2HH 2ES2A 2ALYB 2Z9HA 5M5WH 1YNND 5C5MA 2EY5A 2K5VA 4NXMQ 2O5JC 3BVGA 4HJ5A 1JOQA 1DJRD 4OEMB 5CORA 2GN5A 3EIVA 4KHVA 4EGVA 4F7XA 4WJ4A 1HR0W 2CQOA 1PA6A 4DAMA 1TS3A 1PH5A 4AIMA 1U4PA 4A3KH 2E75C 4HJ7A 4A3DH 4L69A 5HY6A 3I2ZA 4B3SL 4I65A 2JA5G 1YNXA 3K81C 1QNKA 4A3EB 1XNQL 3PIOA 1TWAH 2QEJC 1DM0B 4KD3A 2IX0A 5CV7A 1I6HH 1TWHH 4DAYA 3SK6A 2SEBD 1HFGA 4IUTA 3VYTA 4EQPA 4PMWA 4KV6A 2HDMA 2FHTA 1V43A 1QZHA 2K75A 1IW7C 2D5DA 4DR2Q 3TP5A 1EOVA 1KHIA 2A6HD 2K7VA 1UEBA 4YQ2A 1S5ED 5C0XG 4YWKA 2H1EA 1R4PB 5IWAL 3HOXH 3PUWA 2NUCA 1WCMB 2MJ8A 3MVVA 2KECA 2HHHQ 5D65A 4LF7Q 1X32A 4CDCC 4Y7NB 1KIXA 2JA6B 3I4NB 2I5HA 2HQEA 4ZKBB 3BS1A 1OXVA 2NVTH 2FMMA 3PO2H 3W1GA 3M4PA 1ET9A 1YEZA 4J3CA 1X3PA 2B2VA 4C3IH 1SNOA 3GYQA 1U4RA 2J7ZA 3L9AX 5EPKA 1SYGA 1SE8A 5HGQA 3S16H 2R92B 4MIUA 1IBMQ 1W2BA 4JV5L 2NVXH 1PH6A 1D1IA 4JI8Q 1EQTA 4DR5L 1PH1A 1ENCA 2MHVA 3C1EA 1MJEA 1HTLD 3WOFA 1VMCA 1I94Q 3K7AB 1U4MA 3MFGA 4B3TL 3L3OC 4QUFA 5IODA 1IBLL 3BVMA 3KUPA 1VQOA 5C4JB 1S4ZA 3QG1A 1TS2A 1JWMD 1M1KC 4QQBX 3K0YA 2EJMA 4EX5A 3QOLA 4FDBA 3DM3A 2F0OA 4KTAA 1PTOD 1SDFA 1SEBD 1RTOA 3HOVG 1IYJB 4YCUA 1A2UA 4LF9L 4FF1A 4C3HH 4IO9A 1EY4A 2VZAA 5G3LF 1Y1WG 4DGZA 1EIYB 4OHJA 3BBDA 1O78A 4A3LG 1K3BC 3ILKA 1KNEA 3ND9A 2K32A 1TY2A 3JAMi 1IHZA 4G7HC 4JYAQ 2ZTEA 1XYIA 4RKLA 1B50A 3DHQA 4DV2Q 4DV3L 3PV0A 2J0TD 4K8JA 1PRTD 2WB1E 4KJNA 1XMOL 5CO4A 1VQCA 1Q81C 1LTBD 2QMMA 2NVQH 3EVQA 5H1SE 2QEXA 1SJED 4DF7A 4JI2L 1SJHD 4OGQC 3E0JA 1ET6A 1KABA 3K80C 4B9XA 2NBFA 2B63G 1NXZA 1K83B 1FD7D 2CW0C 3VR6A 3FKIH 1WVLA 2IW3A 1JC7A 4DV5Q 3OPOA 4BBSG 1X65A 2I5LX 3PSIA 1KC8C 1JMCA 4P72A 5ELCA 1NCVA 1JR0D 2CX8A 4RHSA 3TREA 5FO8B 5FLXc 1EOTA 3C3LA 1F2ZA 4P71A 2A73B 3M7NA 4YQ6A 4N8FA 1XPOA 2BA0A 2D62A 1TWCH 4JBKA 2AWOA 5M3FH 1E22A 1NMGA 2E5LL 1K3RA 2VB3X 4MCCA 4R8IA 4WFN3 1CKOA 2LS01 3NK7A 3OSOA 3GTJB 4DV0Q 2JA5B 3QIAA 1I4QA 2F3WA 3OTOQ 2Z6BA 5IYDH 3AEVA 2F0PA 2YY8A 3BJUA 1T5XD 1JQYD 3R8BA 1EWCA 3D4WA 2B39A 3DWAA 2KOLA 3RN2A 1RL2A 2F0NA 5HGTA 5A2QL 3JC66 1PTOF 1UUPA 1KQSA 4JI1Q 2UUBQ 3TRZA 2JA9A 2K5WA 2DNCA 1XNRQ 4LAAA 1LLRD 1QB5D 3CPWA 3NE5B 5JVG3 2HHHL 5C44H 5IP9H 2F52A 2WFWA 3U4ZA 4IFDH 2F0FA 2NVYH 1RODA 1P9PA 5FO9B 4LUOA 2RVLA 5JEAJ 3M4OH 2ZXOA 4KKSA 2ZJPA 2KHSA 3CHBD 2Z4IA 1F77A 4RGMA 4YQPA 4FXGC 3FEWX 2DNEA 4PMCA 5GAEC 5L37A 4QL5A 4AYBE 4DR4Q 1HTPA 2B29A 5CBAE 4FNFA 4R4TA 1IBML 2NN6I 1PRTF 4LJZC 2NVTB 3PO2B 5C3EH 2HT1A 1EFID 3IKJA 4JI8L 3WOEA 3A8JE 4C3IB 1FGBD 1TS4A 4PZ8A 1B3AA 1KD1C 5FLMG 1EU4A 4GN3B 5C4XH 1SRUA 2ICEC 2MGSA 4ME3A 3UDXA 1SYFA 3PUVA 2NVXB 2ATWA 1RTNA 1Q7YC 5JAVA 5C4XG 1QOHA 3Q23A 4DK1A 1ESRA 1NE3A 1VQDA 2F0KA 4HR7B 3TN2A 3P7JA 4G4KA 5FOBB 3RN5A 1WTQA 1PXUA 2JYOA 2VL6A 1IKMA 2RF4A 3H6MA 4DA2A 1F2YA 4KI0A 3J80E 4HTHA 3O7BA 1F9RA 2E2JH 4YQGA 1B9MA 1Q82C 1G6ZA 5KGUA 1Y1WB 1EL0A 3HOWG 3TSSA 1S5FD 1QILA 2QF7A 4QIWE 3B6YA 4YCVA 1VS0A 5EPLA 1GVPA 1A8VA 4H0LC 4X64Q 2JA7H 4ALPA 2PPBC 2BH8A 1B7YB 4MHEA 1A62A 1CA6A 4B3ML 4QCLA 1JJGA 1PFSA 2VB2X 3IFDA 1I4PA 1CFMA 1OO9B 2A68D 4UAIA 1HPCA 4XIGS 1SYCA 1YNNC 4UHVA 2IY5B 4BBRH 4LF4L 2XGTA 2XNAC 4F88A 5LMNQ 1L0YB 3FRPB 1B53A 5E3FA 4XQQA 4KY5A 1C48A 5IT9c 1A63A 4L5SA 2D9UA 2R7FA 1DZ1A 1ML0D 2PI2E 1EU3A 5J1ZA 1WTPA 2E76C 1X9NA 3VR3A 3I4OA 1V1PB 4BBSB 2VUMH 1EZ8A 2A69D 3KDFA 2B2VC 3GTPH 3FKIB 3PCOB 1KRTA 2RDHA 1NSNS 4A3GH 3HFZB 1RIPA 2EZVA 4F87A 3AYHB 1AH9A 5C3WA 5D14A 4XT3B 1VQJA 1QWYA 4LF6L 5BN5A 4LUVA 2EGVA 4R4IA 1GD7A 3NTHA 3RLNA 1L1OA 5K5PA 1Z47A 2A6HC 5IYBH 4DV0L 5M5XH 1HR0L 2NZHA 4KJOA 5FLXL 1VQBA 1UAKA 1TWCB 1X7PA 2WV6D 4K8IA 4FO2A 5FJ8H 4DXFA 1YJ9A 1BUVT 3IC6A 4UP8A 1D5MC 5C0XJ 3HRZC 4L6TB 2Q8RE 5C3XA 1WFQA 4JI7L 4PZ7A 1Q1BA 4JI1L 1Q8IA 2A74C 2XSCA 1UEAB 4JI6Q 5T1IA 4A3MH 4X65Q 1XNRL 1TR5A 1N33L 4LNQA 4K5WA 1NY4A 2L15A 3FPUB 4A3MG 4H44C 3S14B 5JOBA 1U4LA 4GZYC 4GN4B 5AFWA 1MKHA 4DV4Q 1ILQA 5J3BA 2EY6A 4FF4A 4KHPQ 1WTXA 3V96A 1MXIA 3F1ZA 4QJFA 3W2DA 5C44B 3U4VA 2SDFA 1FR3A 2TSSA 2NTTA 1K8OA 1BO0A 2NVYB 4JOIC 4X3TA 3R3OA 3A8KE 2WP8J 3DMUA 3DEPA 1E7ZA 4IALA 3W3AA 4DKAC 5ELBA 3D4DA 3UDGA 1R4QB 4R9WA 4H13C 5C0XI 4IPHA 1VQLA 4BY1H 1K0RA 1BCPB 1WTOA 1VQIA 2X69A 3UDFA 4HJ8A 4JI0Q 3A5UA 1QVGA 2OQ0A 1E2WA 3BDCA 4A3EG 2V3KA 4JI3L 2VQFQ 2R93H 5C4XB 5IP7G 4IN3A 3E6ZX 2L0CA 4PZKA 2GVBA 2XWBB 5E4WC 1TWFH 1AP0A 4GLXA 2NN6G 4LFAQ 4YQOA 5J22A 2UXBQ 4QUCA 2H5XA 3GDEA 1BQQT 1IYUA 3KW2A 4IOCA 4EQ5A 1IL8A 3HS0C 4OELB 4H02A 1BBUA 2E2JB 3HOWB 3RZDB 5EAYA 4X64L 2L55A 1SROA 3TZDA 3WDNA 4GS3A 1VHYA 2JA6G 4UDUC 3A7LA 2JQOA 4YQ1A 1RD9D 3GTMH 2ZT9C 1HCZA 3CC2A 3S15B 2F4VL 2A6ED 2JK8A 3PF4A 1LV9A 3RNUA 5COYA 2F1MA 5HURA 1N34Q 4C2MB 4C3JG 2SNSA 5GMBA 1ZYRD 4L63B 3TQYA 1K9MC 3TS2A 5JJIA 4MTKA 1A6XA 3ERSX 3D6CA 4YHHQ 3PIP3 1WD1A 4F8MA 3NQTA 4C56C 3BU2A 1HNZQ 2PW5A 3NBIA 1N36Q 4YQTA 1PV4A 2EE1A 2PNRC 1GJXA 2YU9H 1T5EA 1VDZA 2PZWA 3CCVA 1TQOA 5JJLA 2E2IB 5M3MG 3QJYA 4YVIA 1CM9A 3CQZH 3RD4A 4XXEA 1ONLA 3G71A 3GTKB 4J1MA 1W3SA 4X3LA 2IHFA 5IT9L 1Z9FA 1YHQA 2F3VA 2VUMB 1XXGA 2K05A 1O7IA 2R7ZH 4JALA 2N88A 4PZ6A 4CKEA 3GTPB 4TSSA 3I72A 3H09A 5CBEE 1SNPA 3KOJA 4X3KA 3I55A 4A3GB 4NB3A 3D6WA 4JWHA 1Q8KA 1PH8A 2K28A 5BR8Q 2EJGC 3K0XA 2MNAA 4S3SA 5EBDA 3O13A 3CU7A 2L5TA 3RZOH 3EROA 4JWFA 3MFYA 1FNUA 2NTSA 3AIAA 5M5XB 3NENA 2Z0SA 2SNMA 1PH2A 2EIFA 2ASBA 4DAVA 4X65L 1SSOA 3UE0A 1YITA 3UI2A 4DR7Q 1J5EQ 2LFNA 5D9FA 1SNCA 1SR3A 3S1NB 1RJTA 4KGNA 5C4ZA 2Y0SE 4DV4L 1DCZA 4A3MB 4LFBQ 3U50C 3I90A 4KHPL 1X7OA 1CSQA 3BBHA 1Q86C 1A3UA 4YQNA 4DNTB 3HKZE 3V05A 3DLLA 3BYYB 4DAPA 1JJCB 4FVMA 1RKNA 4CNGA 2Q8TA 3V2TA 4EVOA 4RH6A 4CDFC 4ZUJA 4HAEA 4CDEC 3FVQA 4HJAA 2VQEL 3NEMA 2K04A 1F2LA 5D3DA 3Q24A 3U9SA 1X54A 2UU9L 3J81E 3GQBA 1B9NA 3CD6A 3KDFB 5JJZA 3VR4A 1ZXTA 4OL7A 2A5HA 4JI0L 4RA8A 1YHBA 1NNXA 3F2UA 1TWGH 4P73A 3NWSA 3GV3A 1AN8A 3MC0B 4AQYQ 4X6AH 2BDNA 5G3LD 4DUZQ 2VQFL 4A3KG 4UY8C 1LTLA 1QUQA 1JE4A 3PUXA 4A3DG 1HH2P 4L5TA 4BY1B 1J85A 2ZXPA 4ILWA 2OEOA 2YYZA 2FJ2A 5CYUA 1VQGA 4OWTB 1L1OB 4IJLA 4BWGB 2M9VA 1O7LA 4RGOS 1G51A 3TP7A 5IGCA 2PI2A 4JC0A 2UUAQ 3I4MH 4WJWA 2CH4A 1UE7A 3Q6SA 1G8ZD 3IAYA 2UXBL 2B8GA 2K6AA 4NPSA 3HEJA 3MEFA 4M8AA 1XPUA 4BA2I 4A93H 1KRSA 4G57A 3T1YQ 1MIUA 3ITPA 4YQ7A 1B1ZA 2EXZA 1L1OC 1FNVA 1NS5A 4RMFA 4FAKA 1TVXA 3TS0A 1R9TB 3M4YA 2KVMA 2EDGA 1B70B 5M5YH 4YVHA 1BOSA 1LM0A 2KCCA 2BE5C 3CAMA 5EKIA 3HOXG 3RR5A 1CKMA 3FP9A 2Z8LA 1STYA 2LKVA 3STBC 4YQ8A 3E9HA 1LYLA 5LL6X 1B3QA 4MZ9A 1H9MA 2ZJQA 2VW9A 3OIJA 5I9OA 3N6RA 5LL6S 4YQRA 3NQIA 2TMPA 3IL8A 3AB9A 3PO2G 2OCEA 4RGTA 4C3JB 3ULPA 4YHHL 3S17B 1Y1VH 4C3IG 1I3QH 1N36L 1EEID 2JA8H 1D5ZC 1C9OA 1ZEQX 3CRKC 1CKNA 4YQBA 3PQIA 1NBWA 3A5ZB 2NYZD 1VQ5A 3PO3H 1TO0A 1X3EA 4NW2A 5M3MB 4RAUC 3I70A 4RKBA 2WB1B 1SYDA 1N8RC 2YU9B 3KLRA 5T1GA 3Q8DA 5I9PA 4R4CA 1DONA 5BR8L 4LF5L 3PUYA 1PHJA 3DWPA 3CC7A 3HOUH 1TT2A 1AZQA 3OOCA 2QCPX 3FPPA 4OX9Q 1NR4A 2N3SA 1VQHA 2B2TA 1BBWA 4N9PA 5CV5A 2IX1A 2Z1CA 1JOKA 5IYCH 4ME5A 4C3HG 2WAQE 1CK1A 5ELDA 2EQSA 4DR7L 1ESFA 1SNDA 1JJ2A 1AW7A 3NXWA 4XQJA 2WINB 1EY9A 3RZOB 5JPMC 2L9HA 1VF7A 4N8X1 3K58A 5LMNW 2PQAB 3U58A 3OIPA 1E2ZA 2K5QA 3DWQA 4JOIA 4Y52H 1CQFA 4LFBL 4MCBA 1CTMA 3NUCA 1SE2A 1SYBA 2JE6I 1C8CA 4JW0A 4FYDA 3E3XA 1BCPD 5AJ3Q 4V0BA 1Y8OB 3KNUA 1EUJA 3RLOA 4FF3A 3H0GH 1N9WA 1EIHA 4YPXA 1MBYA 3OWEB 4NXML 2XN9C 4JI5Q 1XWEA 3FKIG 1V8QA 4TVAB 2AKWB 4L5QA 1H9KA 3KF8A 2E2HB 3SGIA 2ZJRA 4DNIA 1FVIA 5M5WB 3CF5A 1HZBA 4H7BA 3AI9X 1PH3A 3ER0A 4DUZL 5DNFA 1XTDA 3NBHB 1CQVA 2CKZB 2R61A 3KLSA 4DUYQ 1HZCA 1LT3D 4A3KB 1W6KA 4HMJA 5M3FG 1WJJA 4O42A 3TZUA 2D0PA 1SLJA 4A3DB 2DY8A 3TP8A 4O2DA 2UUAL 4DR1Q 4B08A 2K52A 2K5NA 3G7LA 3NHHA 1LTID 1HXYD 2B2UA 5IYDG 1TWAB 4HJ9A 4DR2L 3T1YL 3GTGH 2A1AA 1WD0A 1LTTD 4UP7A 1HZAA 1I6HB 1TWHB 3I4MB 4LMQD 4LW1A 2ZM6Q 4WRDA 1HNXQ 4A93B 2F0IA 3SVMA 1VQKA 5FAIA 4XTCS 2BDOA 4LF7L 1PDQA 2F0HA 1Q3LA 1Y8PB 3HOZH 1PTOH 3K5OA 4LF8Q 5C44G 5IP9G 1B4OA 4IFDG 3HOXB 1GHJA 5TSSA 2JJQA 4GLAC 1GUSA 3SEBA 1II3A 5KIXA 5GADC 1A15A 1I4RA 3G6EA 1STAA 4KD4A 1I4XA 4ABNA 1M90C 2CH4W 2WKCA 2L11A 5LMUQ 3CCUA 5JVH3 4JBWA 2PZTA 3PIO3 3F2CA 1PFBA 3I4LA 3FMCA 1V9PA 5I2YA 1LT5D 5EGTA 1Y8NB 3GTQH 2DGYA 2UXCQ 1BDOA 1BCPF 1CSPA 1U5KA 3CCJA 2BH2A 1I94L 4YQCA 3IFTA 5C3EG 1PH7A 3S16B 4HIKA 1Y1VB 4MCDA 4RG1A 2QWVA 3QUVA 4U68A 5FKAC 3BBEA 2JA8B 2BA1A 3MXPA 1F9QA 1UALA 3T16A 3PF5A 1IPAA 3KLWA 1YNJD 2MO1A 2P5ZX 4A76A 4IG6A 4IPCA 2EYLA 1QUQB 3MA2B 4J6HA 3K6OA 3CC4A 2CWAA 2Q8IB 5BN3A 4OX9L 1OXUA 3L7ZC 2F0SA 4HIOA 4DV7Q 1S40A 3IEFA 4DAYB 4PMBA 4RCNA 3DUZA 1C4QA 3GTLH 4KN4C 1ENFA 4LK1C 3K8AA 2G9HD 3HOUB 3M85A 3BYTB 5ELNA 4YWMA 4HEDA 2KA7A 4C3HB 2DJFC 4X62Q 4JYAL 1QNUA 4KK7A 2PW7A 1VQEA 4DV2L 4U673 5C4HA 4A3FH 4BXXH 3W5OA 1STHA 2JA7G 4ODGA 1SMYD 4N9TA 2K01A 1TU2B 2M00A 3G48A 3JAME 1KDCA 2F0EA 2PYKA 3A8IE 4DR3Q 4XQNA 5EKKA 3CCQA 4PQXA 2FINB 4BBRG 1TIID 1K73C 2OT2A 1XX8A 4DV5L 1DOKA 4IUVA 2NVQB 3EFXD 1DOLA 4JI5L 2UUCQ 1IBKQ 1IW7D 1G291 2VY3A 3Q0AA 2I07B 1NR2A 3DCMX 2B8FA 1CKNB 2VNUD 4YQ5A 1QZGA 1SFOH 2LXKA 4K5XA 3TEHB 2VUMG 4YWLA 4YPWA 3I7FA 2ICIA 3ONPA 3S1QH 3E5YA 3IRBA 4GKKQ 4A3GG 4ZYSA 3L8UA 2MUYA 3J80c 4DUYL 1S5CD 2EJFC 3D8GA 1P16A 4C1NI 2F0JA 1S5DD 5IGBA 1NUCA 4C1NK 3CMEA 1JWUD 4DU9A 3OTOL 3T13A 3I8ZA 1LUZA 3UE1A 5M3FB 4X3UA 5IYBG 2LSSA 1EFWA 1J8IA 3CCEA 1OTCA 4YQAA 5FJ8G 2V1CC 4IOAA 1NMFA 1WYDA 2UUBL 4DV1Q 2DUDA 4QB4A 4XYQA 4J15A 1KXLA 1X55A 3MZ5A 3QR8A 2KEDA 3D0FA 3FDTA 4A3JH 5EKLA 4CGYB 2LXJA 2IX3A 4A3BH 2B2TC 1I5FA 5F2DA 4G7OC 4JG2A 3BG3A 2G9DA 1G2TA 1ASZA 1N32Q 2EYFA 3EBEA 1PVOA 1X56A 4K0KQ 3DXJC 3HP3A 5CV8A 3KFUA 2HIXA 3EJIA 4ZK9B 5DM63 1S3OA 4XT1B 3K5MA 3SK5A 1JB3A 2E8GA 4DR4L 4DR6Q 1BBXC 1PTOB 3H3VH 1ZKOA 3QWNA 2V4DA 5IIFA 3NK6A 3M4OB 2AMCB 2JN4A 4JCVE 4K5VA 3S2DH 5IGFA 1YHAA 3N4JA 1P8LA 4M1UB 4H3ZA 3BZCA 1SN8A 3CCSA 2EYMA 1EY0A 4OO1H 3ULLA 1PTOC 3K5NA 3KF8B 5C3EB 3GTQB 2OF1A 2ZXRA 2R7DA 4IUPA 5K36H 4K14A 1JB7A 1GHKA 2EYHA 2K33A 5M9OA 1WI5A 3QB3A 4BY1G 4G7ZC 1I4HA 1Q90A 2JEBI 2K4KA 2F0UA 2IWHA 4CKCA 1VCIA 1H9SA 1VQ9A 3KBGA 1V2XA 2QGQA 3HOYH 1VQ7A 5BN4A 1HA6A 1KDAA 2R93G 2HDLA 4DV7L 4YPZA 4R1JA 2CW0D 1OXXK 3URYA 1QCBD 1JOOA 1FL0A 3OINA 1KLGD 3OMCA 1UAPA 3S1MH 1PRTC 1UAMA 4IUNA 4B3SQ 2K1BA 4YQ4A 4DFAA 2B3GA 3OMGA 5CMDA 2QILA 3AMUA 3ND8A 3S9WA 2B2UC 1BKBA 1WCMH 2JA7B 1HUMA 1GKHA 3P75A 5IOCA 1SXTA 2AQ2B 2I6DA 2RCFA 4Y7NH 5LMNL 3I4NH 4FMWA 3VYRA 2RCNA 1L2FA 2MQHA 1EYCA 3HZXA 5IWAQ 3VR2A 2JXMB 1HA5A 4BBRB 4QF4A 1IBKL 1PLFA 3UDIA 1CZWA 3T1HQ 2X6LA 3S2HH 3F8TA 2R92H 1IZ6A 1EY5A 3F2BA 2ZTCA 2J4XA 4OIJA 1VF5C 5ELEA 3H91A 1I50H 1E0BA 3C46A 1QE6A 5JEAH 2N55A 1PZKD 3VYUA 2WB1G 5IGEA 1AE2A 4GKKL 1QVCA 1TY0A 3K7AH 1YJNA 2YV5A 1GUGA 5I6WA 5ELFA 2ZTDA 1SFOB 4HCSA 5C4JH 4JV5Q 3T4AC 1SYEA 3CKIB 2R7ZG 3MXNA 4CNFA 4DR5Q 4YQ9A 5KNDA 1HHVA 3K7UC 3S1QB 1D6EC 4P74A 2AUJD 1KNAA 3OW7A 4B3TQ 2AQ1B 5ELOA 1IBLQ 4A3CH 1C7YA 3T56B 5GAGC 4JI6L 3J80L 4IUQA 2PZUA 1WTVA 2I0QA 4JBMA 3DEOA 2I46A 2KCNA 4JI4Q 4IFDJ 5A2QE 1FGUA 4DK0A 1EZ6A 5I6YA 1AEXA 1L0XB 5CC4A 1N32L 2O4XA 3W1BA 1BNZA 2X6GA 2R3ZA 2A19A 1Y14B 1HJPA 2F0MA 4RGNA 3CMAA 2NZOA 4A3BB 2L4NA 1WTWA 4DR6L 1V6ZA 3JAML 2C5CA 2IT1A 1ENAA 4JPBW 1IL2A 2F0DA 3PMFA 2EPBA 1VQPA 4JI2Q 3C1FA 3L0OA 3QO2A 4UP9A 2FXQA 1EY7A 1LACA 5IGDA 2D0OA 1DGSA 4R8NA 2EVBA 1Q12A 4ZCKA 4O1NA 2YTVA 3CCLA 3H3VC 4FF2A 4IPDA 4AYBG 1HFNA 4IFDI 5J39A 1GUNA 1TS5A 1K0SA 1F9PA 2WKDA 2B2WC 3CW2C 1CT1D 4LFAL 4JBJA 2PO4A 3GTJH 2JA5H 2R93B 1CHPD 2PMZE 4I7ZC 4IPGA 3VDYA 1XMQQ 1A3TA 3HOYB 1SMYC 1EEFD 2A68C 3I4MG 2E5LQ 2R6GA 2YTYA 1TWFB 3OWFA 4A93G 1LTRD 5GMCA 2KJXA 3J7A5 4DNRB 2K14A 2OTJA 1SE4A 3S1MB 5CGKA 2MO0A 1RF2D 4MN3A 1VQAA 2O3AA 1MD2D 3T53B 5KEEA 1GUTA 2CWPA 2RHQB 1YI2A 1B44D 4QMGA 3K57A 5C0XH 2K5DA 3EQLC 4TRDA 4PV1C 4NXNQ 4X3SA 3KJPA 2VXWA 5D3IB 2A69C 4B9WA 3A55A 1N34L 4JWJA 3GTMB 1S72A 1LO5D 5KYIA 1K8AC 2HA8A 2WACA 1ICFB 2XIWA 3J81c 4R4OA 2HCCA 3T1HL 1HNZL 4GN5A 4V190 1NTGA 2CCZA 5DLQE 2QA4A 3ZJYC 1H9RA 2WAQB 3T51B 4A75A 2AUKA 3CP0A 1Y1VG 2IPKD 2AQ3B 5GM8A 4GOPA 2FMCA 1L0WA 4DV6Q 4GKJQ 2JA8G 1CZGA 5GROA 3J7AF 4KKUA 2I5MX 4FP5D 4A4IA 1LTGD 4LUZA 5A35A 3CCMA 3SR1A 1IYVA 4CKBA 3PO3G 3S2HB 4POFA 1DD2A 1V1PA 1VH0A 5CR3A 2Q2TA 2FFKB 3MEHA 2N8NA 1I50B 2RSOA 4YIJA 1GUWA 2D2CC 3CQZB 5KRUA 4AH6A 1LTSD 2CFMA 1H9SB 4RFBA 1M8AA 2SOBA 2R7ZB 4KMUC 1ZJRA 1UAJA 3QOJA 1K8GA 1G6PA 4KN7C 1BVSA 1XJVA 2Z6KA 5FLXE 1QJOA 3F2DA 2F03A 1B8AA 4FXKC 3HOUG 1X6OA 4P2CB 3J80i 2EYJA 3TP6A 1VQNA 2IL8A 1RHPA 2C35B 3MXGA 3HOVH 5JPNC 1STEA 4MNOA 4B3RQ 4H3YA 1DXMA 1DYQA 4IZ8A 3J81j 1J5EL 3Q22A 2M2LA 2EXDA 1I4GA 2K50A 4PNYA 1EIFA 1SNQA 5IYCG 2EGWA 1Y1WH 1EYGA 4JI4L 5JJKA 3VA7A 1EQRA 3SE0A 5NUCA 4DK6C 4A3LH 4HSPA 1PMRA 3J7ZC 4YVJA 3N4KA 1YBYA 3HG9A 5IY0A 1JICA 3GTOH 4ID6A 1VMPA 1KDBA 4X3MA 4FXDA 1E1OA 2Q2HA 1CI3M 1Q1EA 1PH9A 2V3JA 4JAKA 3NP8A 1TXYA 1NJIC 4KY7A 2VS1A 5GQOA 1UE5A 2EYPA 1F9SA 1X3QA 4RWSC 4HMIA 3H0GG 3ICEA 4B3MQ 2IHEA 1SBBB 3CPFA 3LWUA 4NKLA 3J7YW 4LFCQ 4HIMA 2B63H 4XDXA 3ULJA 4CJ1B 4BA1I 3D3RA 3KJOA 2XRSD 4Q0FA 2OXPA 4LF4Q 3SK8A 3WWVA 1O6DA 4BBSH 5I2XA 4NP5A 2DN8A 2DY7A 3S24A 3A54A 1IXRA 4YQIA 4AQYL 1AE3A 3I91A 4K6DA 2OTLA 2CVRA 3P20A 1I6VC 4JWGA 1T9HA 3GD7A 2BOSA 2XTIA 3TMEA 1A3VA 1WOCA 4K6LA 1TWGB 2XVSA 2PQEA 4AYBB 3MXNB 1Z85A 1HUNA 1STNA 1XMQL 2N49A 1PZID 4NMZA 3P1HA 4LF6Q 2C9OA 4YQKA 3H3VI 2KCMA 2A6EC 1PYWD 1A2TA 3EA6A 5KNBA 4A3IH 1LT6D 1HR0Q 3NELA 4IUUA 3GP7A 1SNMA 1ZYRC 3KLSX 1MHWC 1Y69U 4OO1I 1BR9A 3NK9A 4A3IG 2F0VA 1HNWQ 3AU7A 2EYOA 1CUKA 2QW7A 1GM5A 3SHLA 3AQQA 4NXNL 3X3NA 3BDLA 4JI7Q 3S14H 1LABA 5CV4A 1KLUD 2CHBD 2RSNA 4E8BA 1EWHA 5FK9C 1KAWA 3HOZG 5M5YB 1FNWA 2HQLA 1N33Q 1AFPA 3GV6A 4KY6A 2RDGA 4EQNA 1VHKA 2RDFA 2RQXA 4QIWB 3M4QA 1WTRA 4DV6L 4GKJL 3A74A 4TKOB 4OONA 1F2MA 4OWXB 1S5BD 3HKSA 1OY5A 3D4RA 1I3QB 4WJ3M 2F0GA 3OYYA 2NB0A 2XRQD 2L1BA 1KTKA 3R93A 2GVAA 1ASYA 1VQ6A 2L12A 4J8QA 3J81L 1IKLA 5FLMH 3PO3B 2CQAA 3RLFA 4OXPA 4JVZA 3N52A 2RHSB 1EYAA 1QG7A 1RDPD 1JORA 3D31A 5IT9E 5I4DA 4OIKA 2MPMA 1JCKB 3ONAB 2ENBA 4IQZA 3MAQA 2XWJB 3KK7A 3E0EA 3MXUA 1E3PA 5E7NA 3NWTA 1O7ZA 2HUGA 4B3RL 1UE6A 4KKTA 3M3YH 2EY1A 4ZUIA 1XPRA 2B2YA 3LNNA 4JI3Q 4CHTB 2KENA 5KYLA 3PIPA 2KEEA 2NZ1D 3CRLC 1K28A 3S1RH 3NSWA 4HSVA 4X66Q 3BZKA 2RA4A 3RZDH 1V1OA 3HOWH 3PGZA 4GNXA 3HOVB 3TDQA 3K59A 3R2TA 5AJ3L 1PH4A 3KF6A 1RCVD 4A3FG 4Q5VA 4BXXG 4R4QA 1UNSA 2QDBA 3E5SA 3NTKA 4QGUA 3I56A 3BVZA 3C2PA 2Z4HA 4GLVB 1SAPA 3S15H 3GTOB 1V1QA 4DPGA 1FJGQ 1G91A 3BZDB 4XYOA 4C2MH 4CBVA 5GAHC 2O5IC 4LFCL 4DN4M 2KBNA 3H0GB 3KY7A 1W6JA 4YPYA 3SXHA 2F4VQ 4KDZA 1JWSD 3K5LA 3X3MA 1U0LA 4GOPB 1M4VA 4YQSA 1Q46A 2Y0SG 2B2WA 3OIIA 2KUMA 5CV9A 1D5XC 2E2IH 2B63B 1VQ4A 2BE5D 3GTKH 5KNCA 4I7AA 1O7YA 1VQ8A 3G4SA 2JSOA 1H9JA 3HKZG 4ZKCB 4GOPC 4PG3A 4BS9A 3STBD 1MJCA 1VQFA 3A7AB 1EQQA 2F0QA 4HCEA 1KAAA 1JT8A 2F3IA 4ULLA 2OWOA 4DR1L 3CXCA 3BDOA 3J7AV 4YVGA 1PYSB 1J6QA 5DM73 3RMHA 4K2LA 1LT4D 3SK4A 4POGA 3R2IA 1E24A 2E74C 1CA5A 1UWVA 4ZQ3A 2HIVA 4YY3Q 4BY7H 2F0LA 3H94A 2ZM6L 3MWYW 1XTCD 1HNXL 1C0AA 1E1TA 3JAMc 3GTGB 1KL9A 5IE8A 3TBIB 3HGBA 1A0IA 1VQMA 4BY7G 1HNWL 2Z6KC 2EOTA 4LF8L 1ICWA 4A3JG 2WIIB 4Z9CB 5EQ0A 3H15A 1STBA 3SDZA 4A3IB 4A3BG 3OIQA 3GO5A 3CCRA
chains in the Genus database with same CATH topology
1C7YA 3S1NH 4YQPA 1X3EA 2UXDQ 5GAGC 4OWWB 1X3FA 4JI6L 3KYHC 5GAEC 1N8RC 4QL5A 4AYBE 2Q2UA 1X3GA 2B29A 4DR4Q 3Q8DA 4R4TA 1IBML 2I0QA 2NN6I 5LMUL 4JBMA 3KTYA 4R4CA 5BR8L 5C3EH 4TQUS 4LF5L 2HT1A 4IFDJ 3PUYA 4JI8L 3CC7A 1PHJA 1FGUA 4JI4Q 2UXCL 3HOUH 4PZ8A 1N32L 1KD1C 5FLMG 3W1BA 4OX9Q 3AXZA 4GN3B 2N3SA 1VQHA 4O0AA 5C4XH 4YQBA 4YQQA 1SRUA 2A19A 4WJ4A 1BBWA 4ME3A 3UDXA 1HZ9A 1Y14B 1HJPA 3CMAA 3PUVA 2NZOA 2IX1A 2ATWA 4P75A 1Q7YC 5IYCH 4OO1G 5C4XG 2WAQE 3E9IA 3J81i 4APVA 2EQSA 3L2PA 1NE3A 4DR6L 1VQDA 3HOWH 4DR7L 1JJ2A 1D7QA 1V6ZA 2IT1A 3RN5A 5LMNW 3U58A 2PQAB 2K5HA 5K36G 2VL6A 2RF4A 4JOIA 4KI0A 4Y52H 1IL2A 4IJHA 2VQEQ 3O7BA 4LFBL 1QVFA 2E2JH 4MCBA 2UU9Q 4YQGA 1OXTA 2N78A 1VQPA 4A3EH 2JE6I 1Q82C 4JI2Q 3L0OA 3HOYG 4UP9A 1UE1A 2FXQA 5AJ3Q 3KNUA 5IP7H 3HOWG 2ID0A 1EUJA 2KCTA 2D0OA 4QIWE 1DGSA 3B6YA 3H0GH 4YCVA 3RLOA 1VS0A 1GVPA 1Q12A 2PNHA 1N9WA 1A8VA 2YTVA 4X62L 4X64Q 4ALPA 3CCLA 2JA7H 2BH8A 4HIDA 4YPXA 1B7YB 1XNQQ 1A62A 1PYBA 4IPDA 4B3ML 4AYBG 4NXML 4JI5Q 1JJGA 4IFDI 1PFSA 3FKIG 4X66L 4TVAB 1YJWA 4YQLA 2AKWB 3CW2C 4XIGS 4LFAL 3AFQA 4L5QA 4XBOA 4JBJA 3AFPA 3M9BA 2KHJA 2IY5B 3SGIA 4BBRH 2ZJRA 4DNIA 4LF4L 3GTJH 2JA5H 1FVIA 2PMZE 1R9TH 4DK3C 3CF5A 1HZBA 1D8LA 2XGTA 4IPGA 4DR3L 3VDYA 4UPAA 1XMQQ 3AI9X 1PH3A 3I4MG 2AHOB 5LMNQ 3ER0A 2E5LQ 2JA6H 2R6GA 1YZ6A 2PQAA 4DUZL 1XTDA 3NBHB 2AWNA 2HA8A 2YTYA 4MTNA 5IT9c 1WCMG 2CKZB 4L5SA 4A93G 1A63A 1FJGL 1JE5A 4DUYQ 1GZ0A 2R7FA 5GMCA 1HZCA 2PI2E 3A0JA 3J7A5 2K14A 1X9NA 2WAQG 3I4NG 3I4OA 5M3FG 2UUCL 1WJJA 2OTJA 4KHZA 2D0PA 2VUMH 3KDFA 1SLJA 2MO0A 4O2DA 1VQAA 2UUAL 2O3AA 4C3JH 3GTPH 3PCOB 1KRTA 3S17H 2CWPA 2RHQB 4DR1Q 1YI2A 4A3GH 2K52A 2K5NA 3HFZB 3PUZA 3OW2A 1RIPA 4NXNQ 3AYHB 5IYDG 4HJ9A 3KJPA 4YCWA 4DR2L 3T1YL 3GTGH 1AH9A 2A1AA 1N34L 4UP7A 1HZAA 2R92G 2JEAI 1VQJA 4LF6L 4LUVA 4JWJA 3EN2A 1S72A 1EWIA 4LW1A 5JEAG 3FHWA 2ZM6Q 1K8AC 3LGJA 1GD7A 4R4IA 2EGVA 4QY7A 3RLNA 3J81c 4YVKA 1L1OA 1Z47A 4R4OA 5IYBH 4DV0L 5M5XH 5M3MH 2MFIA 2NZHA 4GN5A 1NTGA 1VQBA 3T1HL 1HNZL 5DLQE 2QA4A 2CCZA 1UAKA 5FAIA 1X7PA 3ZJYC 4XTCS 5FJ8H 4LF7L 4A75A 1YJ9A 3CP0A 3IC6A 1Y1VG 4YQ0A 5GM8A 4UP8A 3HOZH 5C0XJ 4LF8Q 4GOPA 1L0WA 4DV6Q 4GKJQ 2JA8G 1WFQA 5C44G 5IP9G 4JI7L 5GROA 4IFDG 2I5MX 4A4IA 4PZ7A 1Q1BA 4JI1L 2JJQA 4GLAC 4JI6Q 4LUZA 3CCMA 4DV1L 5GADC 3PO3G 4A3MH 3G6EA 4YY3L 4POFA 4X65Q 4CNEA 1XNRL 1VH0A 1M90C 2YTXA 5LMUQ 2Q2TA 4YQJA 3CCUA 4A3CG 1N33L 4JBWA 2N8NA 4LNQA 3F2CA 1NY4A 1GO3E 4AH6A 4YQ9A 2CFMA 1V9PA 2L15A 4KLKA 4A3MG 4LF5Q 1YVCA 3GTQH 2DGYA 4GN4B 2UXCQ 1CSPA 2Q2IA 1U5KA 3CCJA 1MKHA 4LF9Q 4DV4Q 1I94L 2BH2A 1UAJA 1OXSC 1K8GA 1ZJRA 5C3EG 4YQCA 5J3BA 1PH7A 1G6PA 2A8VA 4HIKA 4KHPQ 4MCDA 4GNXB 4RG1A 4K0KL 2QWVA 3QUVA 1BVSA 1XJVA 3BBEA 2Z6KA 3F2DA 3HOUG 2UXDL 1MXIA 1B8AA 1X6OA 3F1ZA 4QJFA 2BA1A 3J80i 3U4VA 1VQNA 2C35B 1UALA 2OQKA 3HOVH 4JOIC 3PF5A 4MNOA 3KF6B 4B3RQ 1IPAA 3KLWA 4H3YA 2MO1A 3J81j 4A76A 1J5EL 2EGWA 2EXDA 2WP8J 2K50A 4IPCA 1EIFA 4LWCA 5IYCG 4GNXC 1Y1WH 1EYGA 4JI4L 1E7ZA 5JJKA 1EQRA 4YQ3A 1QUQB 3CC4A 1K83H 4DV3Q 4A3LH 4DK6C 1SMXA 2CWAA 4DKAC 3J7ZC 1OXUA 4OX9L 4YQDA 3N4KA 3L7ZC 1YBYA 1XMOQ 4YVJA 5IY0A 3UDGA 3GTOH 2Z0YA 4HIOA 4DV7Q 5C0XI 1S40A 4DAYB 3IEFA 1FJGQ 4X3MA 4CNDA 4IPHA 1VQLA 4BY1H 1K0RA 1VQIA 3GTLH 1E1OA 2Q2HA 2KHIA 3UDFA 4HJ8A 4JI0Q 1Q1EA 1PH9A 4L5RC 2V3JA 4JAKA 3K8AA 3A5UA 1TXYA 1NJIC 1QVGA 1H95A 2OQ0A 3M85A 4A3EG 2VS1A 2V3KA 1YIJA 2E2HH 5GQOA 1UE5A 4JI3L 5ELNA 4YWMA 2ALYB 2ES2A 2VQFQ 2R93H 4X62Q 4JYAL 5M5WH 5IP7G 4A3CH 1VQEA 4PZKA 3H0GG 4DV2L 4B3MQ 2IHEA 3ICEA 2K5VA 4NXMQ 2GVBA 4HJ5A 3CPFA 1TWFH 4A3FH 4BXXH 2GN5A 3W5OA 4LFCQ 3EIVA 4HIMA 4GLXA 2B63H 2NN6G 3ULJA 1HR0W 2JA7G 2CQOA 4LFAQ 4BA1I 1PA6A 3KJOA 4YQOA 4DAMA 1PH5A 4AIMA 3G48A 4A3KH 4LF4Q 3WWVA 2UXBQ 1O6DA 4BBSH 4DR3Q 4HJ7A 2H5XA 3GDEA 4A3DH 3S24A 1IXRA 3KW2A 4YQIA 4L69A 4IOCA 5HY6A 3I2ZA 4EQ5A 3CCQA 4AQYL 4B3SL 1AE3A 4H02A 1BBUA 4BBRG 1K73C 2OTLA 5EAYA 4X64L 2JA5G 1YNXA 3K81C 4DV5L 1SROA 1XNQL 3PIOA 4JWGA 1TWAH 4GS3A 2IX0A 1VHYA 4JI5L 1T9HA 3GD7A 1IBKQ 1TWHH 2UUCQ 1G291 2JA6G 1I6HH 2XTIA 2VY3A 2JQOA 4YQ1A 3GTMH 1WOCA 4PMWA 3DCMX 1CKNB 2VNUD 3MXNB 4YQ5A 1QZGA 3CC2A 1SFOH 1Z85A 2F4VL 2LXKA 1V43A 1QZHA 2JK8A 3PF4A 2K75A 3TEHB 3RNUA 1XMQL 2VUMG 4DR2Q 2N49A 1EOVA 4YWLA 4YPWA 1KHIA 1N34Q 3I7FA 5GMBA 3ONPA 1UEBA 3S1QH 4LF6Q 3E5YA 3IRBA 4GKKQ 4YQ2A 4A3GG 3TQYA 1K9MC 3TS2A 5C0XG 3H3VI 2KCMA 5JJIA 4YWKA 3L8UA 3J80c 4DUYL 1HNXQ 4YQKA 3ERSX 5IWAL 1P16A 4YHHQ 4A3IH 3HOXH 3PUWA 1HR0Q 3BU2A 3NELA 3CMEA 1HNZQ 1N36Q 4YQTA 1PV4A 2HHHQ 3OTOL 4LF7Q 2YU9H 4OO1I 1KIXA 1LUZA 4A3IG 2I5HA 3UE1A 1HNWQ 3CCVA 5JJLA 1CUKA 1OXVA 5IYBG 1GM5A 5M3MG 2LSSA 4YVIA 3AQQA 4NXNL 2NVTH 3CQZH 1EFWA 3PO2H 3W1GA 3G71A 3M4PA 3CCEA 4JI7Q 1YEZA 1OTCA 3S14H 5FJ8G 4J3CA 2V1CC 4IOAA 4YQAA 1W3SA 4C3IH 4E8BA 4X3LA 2IHFA 3GYQA 1NMFA 1WYDA 1Z9FA 1KAWA 1YHQA 4DV1Q 2UUBL 3HOZG 1O7IA 2DUDA 2R7ZH 4JALA 4PZ6A 4J15A 1KXLA 3S16H 1SE8A 5HGQA 1X55A 1IBMQ 3KOJA 3I55A 2HQLA 3D0FA 4NB3A 1N33Q 4JWHA 1Q8KA 1W2BA 4A3JH 1PH8A 4JV5L 5BR8Q 2NVXH 2LXJA 4A3BH 3K0XA 2MNAA 1I5FA 1PH6A 4JI8Q 4DR5L 4JG2A 1PH1A 1VHKA 1MJEA 3M4QA 1ASZA 1N32Q 1I94Q 4DV6L 4GKJL 3RZOH 3A74A 3EBEA 1PVOA 4B3TL 4JWFA 1X56A 4OONA 4OWXB 1IBLL 3HKSA 4K0KQ 1OY5A 3AIAA 3KFUA 2HIXA 1VQOA 3NENA 2Z0SA 4WJ3M 3OYYA 4IG6A 1PH2A 2EIFA 2ASBA 1M1KC 1S3OA 4QQBX 2GVAA 2E8GA 4EX5A 4X65L 1ASYA 1VQ6A 4DR4L 3UE0A 1YITA 4DR6Q 4DR7Q 3H3VH 4FDBA 5FLMH 3DM3A 1J5EQ 5D9FA 3NK6A 3RLFA 4OXPA 2AMCB 1VQKA 1SR3A 2RHSB 3HOVG 1IYJB 4JCVE 3D31A 3S2DH 1YHAA 3N4JA 1P8LA 4YCUA 4KGNA 4LF9L 3BZCA 1SN8A 2Y0SE 3CCSA 4C3HH 4DV4L 4LFBQ 4H3ZA 3U50C 4IO9A 3ULLA 2VZAA 1Y1WG 4KHPL 3E0EA 1EIYB 1X7OA 1CSQA 1E3PA 3BBHA 1Q86C 5E7NA 3BBDA 3KF8B 4YQNA 4A3LG 3ILKA 2R7DA 3HKZE 1JB7A 3DLLA 1UE6A 4B3RL 3M3YH 1JJCB 1WI5A 1XPRA 4BY1G 4JI3Q 2KENA 4CNGA 3JAMi 3PIPA 4JYAQ 2JEBI 2K4KA 2ZTEA 1VCIA 1VQ9A 1V2XA 4DV2Q 2QGQA 4DV3L 3HOYH 3S1RH 1VQ7A 4HJAA 2VQEL 3NEMA 3PV0A 5CO4A 2WB1E 4X66Q 3BZKA 3RZDH 1XMOL 1X54A 2UU9L 3PGZA 4GNXA 1VQCA 1Q81C 2R93G 2QMMA 2NVQH 4DV7L 3CD6A 4R1JA 3KDFB 5H1SE 1OXXK 2QEXA 1HR0L 4YPZA 4JI2L 1FL0A 3OINA 4JI0L 5AJ3L 1YHBA 3K80C 3KF6A 4A3FG 1PH4A 3S1MH 4BXXG 4R4QA 2B63G 1NXZA 1UAMA 1TWGH 4P73A 4QGUA 3I56A 4B3SQ 4AQYQ 4X6AH 3FKIH 4GLVB 4DUZQ 2VQFL 4A3KG 3S15H 4UY8C 1LTLA 1V1QA 4DV5Q 4BBSG 4YQ4A 1X65A 1QUQA 3PUXA 2I5LX 3PSIA 1HH2P 4L5TA 4DPGA 1KC8C 2B3GA 1JMCA 4A3DG 4P72A 2YYZA 4C2MH 1VQGA 2CX8A 4OWTB 3TREA 5GAHC 1L1OB 4IJLA 4LFCL 5FLXc 2KBNA 1G51A 3I4MH 2PI2A 4JC0A 1BKBA 2UUAQ 3KY7A 4P71A 4YPYA 1UE7A 3M7NA 4YQ6A 2F4VQ 2UXBL 4NPSA 1XPUA 1WCMH 3MEFA 1XPOA 4A93H 2BA0A 1GKHA 4BA2I 1KRSA 4KDZA 1U0LA 2D62A 4GOPB 4YQSA 1TWCH 2Y0SG 1Q46A 1MIUA 3T1YQ 4JBKA 2I6DA 4YQ7A 2AWOA 4Y7NH 1L1OC 5LMNL 3I4NH 3OIIA 5M3FH 1E22A 1NMGA 2E5LL 4FMWA 1K3RA 4MCCA 2E2IH 2RCNA 1CKOA 1L2FA 2MQHA 1VQ4A 3GTKH 5IWAQ 1VQ8A 1NS5A 3NK7A 3G4SA 4RMFA 4FAKA 1IBKL 3HKZG 3UDIA 4DV0Q 3TS0A 4GOPC 4PG3A 3T1HQ 3STBD 1MJCA 3OTOQ 5IYDH 1VQFA 5M5YH 3AEVA 1B70B 4YVHA 3S2HH 2YY8A 3BJUA 3F8TA 1LM0A 1EQQA 2R92H 1IZ6A 1JT8A 2F3IA 3CAMA 3HOXG 3F2BA 2ZTCA 4DR1L 2OWOA 3CXCA 4YVGA 3RR5A 1I50H 1PYSB 1J6QA 1RL2A 1CKMA 3RN2A 3FP9A 3STBC 4POGA 2WB1G 4YQ8A 3E9HA 1LYLA 3JC66 4MZ9A 1E24A 2ZJQA 1AE2A 2VW9A 4JI1Q 1KQSA 2UUBQ 4GKKL 1QVCA 1UWVA 3TRZA 3OIJA 4YQRA 2HIVA 3K7AH 1YJNA 2YV5A 3PO2G 2JA9A 2OCEA 4YY3Q 2ZM6L 3ULPA 4BY7H 4YHHL 1XNRQ 1Y1VH 2ZTDA 1I3QH 1HNXL 5C4JH 3CPWA 1N36L 4JV5Q 1C0AA 1E1TA 2HHHL 2JA8H 3JAMc 1C9OA 5IP9H 1KL9A 1CKNA 5C44H 2F52A 2WFWA 3U4ZA 5IE8A 1A0IA 4DR5Q 1VQMA 2R7ZG 4BY7G 2NVYH 4CNFA 1NBWA 1HNWL 2Z6KC 3K7UC 4P74A 1P9PA 3A5ZB 4LF8L 1VQ5A 4A3JG 4LUOA 3PO3H 1TO0A 5JEAJ 4B3TQ 3M4OH 3H15A 2ZJPA 5ELOA 1IBLQ 4A3BG 3GO5A 1J85A 3CCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7Y A;  3S1N H;  4YQP A;  1X3E A;  2UXD Q;  5GAG C;  4OWW B;  1X3F A;  4JI6 L;  3KYH C;  5GAE C;  1N8R C;  4QL5 A;  4AYB E;  2Q2U A;  1X3G A;  2B29 A;  4DR4 Q;  3Q8D A;  4R4T A;  1IBM L;  2I0Q A;  2NN6 I;  5LMU L;  4JBM A;  3KTY A;  4R4C A;  5BR8 L;  5C3E H;  4TQU S;  4LF5 L;  2HT1 A;  4IFD J;  3PUY A;  4JI8 L;  3CC7 A;  1PHJ A;  1FGU A;  4JI4 Q;  2UXC L;  3HOU H;  4PZ8 A;  1N32 L;  1KD1 C;  5FLM G;  3W1B A;  4OX9 Q;  3AXZ A;  4GN3 B;  2N3S A;  1VQH A;  4O0A A;  5C4X H;  4YQB A;  4YQQ A;  1SRU A;  2A19 A;  4WJ4 A;  1BBW A;  4ME3 A;  3UDX A;  1HZ9 A;  1Y14 B;  1HJP A;  3CMA A;  3PUV A;  2NZO A;  2IX1 A;  2ATW A;  4P75 A;  1Q7Y C;  5IYC H;  4OO1 G;  5C4X G;  2WAQ E;  3E9I A;  3J81 i;  4APV A;  2EQS A;  3L2P A;  1NE3 A;  4DR6 L;  1VQD A;  3HOW H;  4DR7 L;  1JJ2 A;  1D7Q A;  1V6Z A;  2IT1 A;  3RN5 A;  5LMN W;  3U58 A;  2PQA B;  2K5H A;  5K36 G;  2VL6 A;  2RF4 A;  4JOI A;  4KI0 A;  4Y52 H;  1IL2 A;  4IJH A;  2VQE Q;  3O7B A;  4LFB L;  1QVF A;  2E2J H;  4MCB A;  2UU9 Q;  4YQG A;  1OXT A;  2N78 A;  1VQP A;  4A3E H;  2JE6 I;  1Q82 C;  4JI2 Q;  3L0O A;  3HOY G;  4UP9 A;  1UE1 A;  2FXQ A;  5AJ3 Q;  3KNU A;  5IP7 H;  3HOW G;  2ID0 A;  1EUJ A;  2KCT A;  2D0O A;  4QIW E;  1DGS A;  3B6Y A;  3H0G H;  4YCV A;  3RLO A;  1VS0 A;  1GVP A;  1Q12 A;  2PNH A;  1N9W A;  1A8V A;  2YTV A;  4X62 L;  4X64 Q;  4ALP A;  3CCL A;  2JA7 H;  2BH8 A;  4HID A;  4YPX A;  1B7Y B;  1XNQ Q;  1A62 A;  1PYB A;  4IPD A;  4B3M L;  4AYB G;  4NXM L;  4JI5 Q;  1JJG A;  4IFD I;  1PFS A;  3FKI G;  4X66 L;  4TVA B;  1YJW A;  4YQL A;  2AKW B;  3CW2 C;  4XIG S;  4LFA L;  3AFQ A;  4L5Q A;  4XBO A;  4JBJ A;  3AFP A;  3M9B A;  2KHJ A;  2IY5 B;  3SGI A;  4BBR H;  2ZJR A;  4DNI A;  4LF4 L;  3GTJ H;  2JA5 H;  1FVI A;  2PMZ E;  1R9T H;  4DK3 C;  3CF5 A;  1HZB A;  1D8L A;  2XGT A;  4IPG A;  4DR3 L;  3VDY A;  4UPA A;  1XMQ Q;  3AI9 X;  1PH3 A;  3I4M G;  2AHO B;  5LMN Q;  3ER0 A;  2E5L Q;  2JA6 H;  2R6G A;  1YZ6 A;  2PQA A;  4DUZ L;  1XTD A;  3NBH B;  2AWN A;  2HA8 A;  2YTY A;  4MTN A;  5IT9 c;  1WCM G;  2CKZ B;  4L5S A;  4A93 G;  1A63 A;  1FJG L;  1JE5 A;  4DUY Q;  1GZ0 A;  2R7F A;  5GMC A;  1HZC A;  2PI2 E;  3A0J A;  3J7A 5;  2K14 A;  1X9N A;  2WAQ G;  3I4N G;  3I4O A;  5M3F G;  2UUC L;  1WJJ A;  2OTJ A;  4KHZ A;  2D0P A;  2VUM H;  3KDF A;  1SLJ A;  2MO0 A;  4O2D A;  1VQA A;  2UUA L;  2O3A A;  4C3J H;  3GTP H;  3PCO B;  1KRT A;  3S17 H;  2CWP A;  2RHQ B;  4DR1 Q;  1YI2 A;  4A3G H;  2K52 A;  2K5N A;  3HFZ B;  3PUZ A;  3OW2 A;  1RIP A;  4NXN Q;  3AYH B;  5IYD G;  4HJ9 A;  3KJP A;  4YCW A;  4DR2 L;  3T1Y L;  3GTG H;  1AH9 A;  2A1A A;  1N34 L;  4UP7 A;  1HZA A;  2R92 G;  2JEA I;  1VQJ A;  4LF6 L;  4LUV A;  3EN2 A;  1S72 A;  1EWI A;  4LW1 A;  5JEA G;  3FHW A;  2ZM6 Q;  1K8A C;  3LGJ A;  1GD7 A;  4R4I A;  2EGV A;  4QY7 A;  3RLN A;  3J81 c;  4YVK A;  1L1O A;  1Z47 A;  4R4O A;  5IYB H;  4DV0 L;  5M5X H;  5M3M H;  2MFI A;  2NZH A;  4GN5 A;  1NTG A;  1VQB A;  3T1H L;  1HNZ L;  5DLQ E;  2QA4 A;  2CCZ A;  1UAK A;  5FAI A;  1X7P A;  3ZJY C;  4XTC S;  5FJ8 H;  4LF7 L;  4A75 A;  1YJ9 A;  3CP0 A;  3IC6 A;  1Y1V G;  4YQ0 A;  5GM8 A;  4UP8 A;  3HOZ H;  5C0X J;  4LF8 Q;  4GOP A;  1L0W A;  4DV6 Q;  4GKJ Q;  2JA8 G;  1WFQ A;  5C44 G;  5IP9 G;  4JI7 L;  5GRO A;  4IFD G;  2I5M X;  4A4I A;  4PZ7 A;  1Q1B A;  4JI1 L;  2JJQ A;  4GLA C;  4JI6 Q;  4LUZ A;  3CCM A;  4DV1 L;  5GAD C;  3PO3 G;  4A3M H;  3G6E A;  4YY3 L;  4POF A;  4X65 Q;  4CNE A;  1XNR L;  1VH0 A;  1M90 C;  2YTX A;  5LMU Q;  2Q2T A;  4YQJ A;  3CCU A;  4A3C G;  1N33 L;  4JBW A;  2N8N A;  4LNQ A;  3F2C A;  1NY4 A;  1GO3 E;  4AH6 A;  4YQ9 A;  2CFM A;  1V9P A;  2L15 A;  4KLK A;  4A3M G;  4LF5 Q;  1YVC A;  3GTQ H;  2DGY A;  4GN4 B;  2UXC Q;  1CSP A;  2Q2I A;  1U5K A;  3CCJ A;  1MKH A;  4LF9 Q;  4DV4 Q;  1I94 L;  2BH2 A;  1UAJ A;  1OXS C;  1K8G A;  1ZJR A;  5C3E G;  4YQC A;  5J3B A;  1PH7 A;  1G6P A;  2A8V A;  4HIK A;  4KHP Q;  4MCD A;  4GNX B;  4RG1 A;  4K0K L;  2QWV A;  3QUV A;  1BVS A;  1XJV A;  3BBE A;  2Z6K A;  3F2D A;  3HOU G;  2UXD L;  1MXI A;  1B8A A;  1X6O A;  3F1Z A;  4QJF A;  2BA1 A;  3J80 i;  3U4V A;  1VQN A;  2C35 B;  1UAL A;  2OQK A;  3HOV H;  4JOI C;  3PF5 A;  4MNO A;  3KF6 B;  4B3R Q;  1IPA A;  3KLW A;  4H3Y A;  2MO1 A;  3J81 j;  4A76 A;  1J5E L;  2EGW A;  2EXD A;  2WP8 J;  2K50 A;  4IPC A;  1EIF A;  4LWC A;  5IYC G;  4GNX C;  1Y1W H;  1EYG A;  4JI4 L;  1E7Z A;  5JJK A;  1EQR A;  4YQ3 A;  1QUQ B;  3CC4 A;  1K83 H;  4DV3 Q;  4A3L H;  4DK6 C;  1SMX A;  2CWA A;  4DKA C;  3J7Z C;  1OXU A;  4OX9 L;  4YQD A;  3N4K A;  3L7Z C;  1YBY A;  1XMO Q;  4YVJ A;  5IY0 A;  3UDG A;  3GTO H;  2Z0Y A;  4HIO A;  4DV7 Q;  5C0X I;  1S40 A;  4DAY B;  3IEF A;  1FJG Q;  4X3M A;  4CND A;  4IPH A;  1VQL A;  4BY1 H;  1K0R A;  1VQI A;  3GTL H;  1E1O A;  2Q2H A;  2KHI A;  3UDF A;  4HJ8 A;  4JI0 Q;  1Q1E A;  1PH9 A;  4L5R C;  2V3J A;  4JAK A;  3K8A A;  3A5U A;  1TXY A;  1NJI C;  1QVG A;  1H95 A;  2OQ0 A;  3M85 A;  4A3E G;  2VS1 A;  2V3K A;  1YIJ A;  2E2H H;  5GQO A;  1UE5 A;  4JI3 L;  5ELN A;  4YWM A;  2ALY B;  2ES2 A;  2VQF Q;  2R93 H;  4X62 Q;  4JYA L;  5M5W H;  5IP7 G;  4A3C H;  1VQE A;  4PZK A;  3H0G G;  4DV2 L;  4B3M Q;  2IHE A;  3ICE A;  2K5V A;  4NXM Q;  2GVB A;  4HJ5 A;  3CPF A;  1TWF H;  4A3F H;  4BXX H;  2GN5 A;  3W5O A;  4LFC Q;  3EIV A;  4HIM A;  4GLX A;  2B63 H;  2NN6 G;  3ULJ A;  1HR0 W;  2JA7 G;  2CQO A;  4LFA Q;  4BA1 I;  1PA6 A;  3KJO A;  4YQO A;  4DAM A;  1PH5 A;  4AIM A;  3G48 A;  4A3K H;  4LF4 Q;  3WWV A;  2UXB Q;  1O6D A;  4BBS H;  4DR3 Q;  4HJ7 A;  2H5X A;  3GDE A;  4A3D H;  3S24 A;  1IXR A;  3KW2 A;  4YQI A;  4L69 A;  4IOC A;  5HY6 A;  3I2Z A;  4EQ5 A;  3CCQ A;  4AQY L;  4B3S L;  1AE3 A;  4H02 A;  1BBU A;  4BBR G;  1K73 C;  2OTL A;  5EAY A;  4X64 L;  2JA5 G;  1YNX A;  3K81 C;  4DV5 L;  1SRO A;  1XNQ L;  3PIO A;  1TWA H;  4GS3 A;  2IX0 A;  1VHY A;  4JI5 L;  1T9H A;  3GD7 A;  1IBK Q;  1TWH H;  2UUC Q;  1G29 1;  2JA6 G;  1I6H H;  2XTI A;  2VY3 A;  2JQO A;  4YQ1 A;  3GTM H;  1WOC A;  4PMW A;  3DCM X;  1CKN B;  2VNU D;  3MXN B;  4YQ5 A;  1QZG A;  3CC2 A;  1SFO H;  1Z85 A;  2F4V L;  2LXK A;  1V43 A;  1QZH A;  2JK8 A;  3PF4 A;  2K75 A;  3TEH B;  3RNU A;  1XMQ L;  2VUM G;  4DR2 Q;  2N49 A;  1EOV A;  4YWL A;  4YPW A;  1KHI A;  1N34 Q;  3I7F A;  5GMB A;  3ONP A;  1UEB A;  3S1Q H;  4LF6 Q;  3E5Y A;  3IRB A;  4GKK Q;  4YQ2 A;  4A3G G;  3TQY A;  1K9M C;  3TS2 A;  5C0X G;  3H3V I;  2KCM A;  5JJI A;  4YWK A;  3L8U A;  3J80 c;  4DUY L;  1HNX Q;  4YQK A;  3ERS X;  5IWA L;  1P16 A;  4YHH Q;  4A3I H;  3HOX H;  3PUW A;  1HR0 Q;  3BU2 A;  3NEL A;  3CME A;  1HNZ Q;  1N36 Q;  4YQT A;  1PV4 A;  2HHH Q;  3OTO L;  4LF7 Q;  2YU9 H;  4OO1 I;  1KIX A;  1LUZ A;  4A3I G;  2I5H A;  3UE1 A;  1HNW Q;  3CCV A;  5JJL A;  1CUK A;  1OXV A;  5IYB G;  1GM5 A;  5M3M G;  2LSS A;  4YVI A;  3AQQ A;  4NXN L;  2NVT H;  3CQZ H;  1EFW A;  3PO2 H;  3W1G A;  3G71 A;  3M4P A;  3CCE A;  4JI7 Q;  1YEZ A;  1OTC A;  3S14 H;  5FJ8 G;  4J3C A;  2V1C C;  4IOA A;  4YQA A;  1W3S A;  4C3I H;  4E8B A;  4X3L A;  2IHF A;  3GYQ A;  1NMF A;  1WYD A;  1Z9F A;  1KAW A;  1YHQ A;  4DV1 Q;  2UUB L;  3HOZ G;  1O7I A;  2DUD A;  2R7Z H;  4JAL A;  4PZ6 A;  4J15 A;  1KXL A;  3S16 H;  1SE8 A;  5HGQ A;  1X55 A;  1IBM Q;  3KOJ A;  3I55 A;  2HQL A;  3D0F A;  4NB3 A;  1N33 Q;  1Q8K A;  1W2B A;  4A3J H;  1PH8 A;  4JV5 L;  5BR8 Q;  2NVX H;  2LXJ A;  4A3B H;  3K0X A;  2MNA A;  1I5F A;  1PH6 A;  4JI8 Q;  4DR5 L;  4JG2 A;  1PH1 A;  1VHK A;  1MJE A;  3M4Q A;  1ASZ A;  1N32 Q;  1I94 Q;  4DV6 L;  4GKJ L;  3RZO H;  3A74 A;  3EBE A;  1PVO A;  4B3T L;  1X56 A;  4OON A;  4OWX B;  1IBL L;  3HKS A;  4K0K Q;  1OY5 A;  3AIA A;  3KFU A;  2HIX A;  1VQO A;  3NEN A;  2Z0S A;  4WJ3 M;  3OYY A;  4IG6 A;  1PH2 A;  2EIF A;  2ASB A;  1M1K C;  1S3O A;  4QQB X;  2GVA A;  2E8G A;  4EX5 A;  4X65 L;  1ASY A;  1VQ6 A;  4DR4 L;  3UE0 A;  1YIT A;  4DR6 Q;  4DR7 Q;  3H3V H;  4FDB A;  5FLM H;  3DM3 A;  1J5E Q;  5D9F A;  3NK6 A;  3RLF A;  4OXP A;  2AMC B;  1VQK A;  1SR3 A;  2RHS B;  3HOV G;  1IYJ B;  4JCV E;  3D31 A;  3S2D H;  1YHA A;  3N4J A;  1P8L A;  4YCU A;  4KGN A;  4LF9 L;  3BZC A;  1SN8 A;  2Y0S E;  3CCS A;  4C3H H;  4DV4 L;  4LFB Q;  4H3Z A;  3U50 C;  4IO9 A;  3ULL A;  2VZA A;  1Y1W G;  4KHP L;  3E0E A;  1EIY B;  1X7O A;  1CSQ A;  1E3P A;  3BBH A;  1Q86 C;  5E7N A;  3BBD A;  3KF8 B;  4YQN A;  4A3L G;  3ILK A;  2R7D A;  3HKZ E;  1JB7 A;  3DLL A;  1UE6 A;  4B3R L;  3M3Y H;  1JJC B;  1WI5 A;  1XPR A;  4BY1 G;  4JI3 Q;  2KEN A;  4CNG A;  3JAM i;  3PIP A;  4JYA Q;  2JEB I;  2K4K A;  2ZTE A;  1VCI A;  1VQ9 A;  1V2X A;  4DV2 Q;  2QGQ A;  4DV3 L;  3HOY H;  3S1R H;  1VQ7 A;  4HJA A;  2VQE L;  3NEM A;  3PV0 A;  5CO4 A;  2WB1 E;  4X66 Q;  3BZK A;  3RZD H;  1XMO L;  1X54 A;  2UU9 L;  3PGZ A;  4GNX A;  1VQC A;  1Q81 C;  2R93 G;  2QMM A;  2NVQ H;  4DV7 L;  3CD6 A;  4R1J A;  3KDF B;  5H1S E;  1OXX K;  2QEX A;  1HR0 L;  4YPZ A;  4JI2 L;  1FL0 A;  3OIN A;  4JI0 L;  5AJ3 L;  1YHB A;  3K80 C;  3KF6 A;  4A3F G;  1PH4 A;  3S1M H;  4BXX G;  4R4Q A;  2B63 G;  1NXZ A;  1UAM A;  1TWG H;  4P73 A;  4QGU A;  3I56 A;  4B3S Q;  4AQY Q;  4X6A H;  3FKI H;  4GLV B;  4DUZ Q;  2VQF L;  4A3K G;  3S15 H;  4UY8 C;  1LTL A;  1V1Q A;  4DV5 Q;  4BBS G;  4YQ4 A;  1X65 A;  1QUQ A;  3PUX A;  2I5L X;  3PSI A;  1HH2 P;  4L5T A;  4DPG A;  1KC8 C;  2B3G A;  1JMC A;  4A3D G;  4P72 A;  2YYZ A;  4C2M H;  1VQG A;  2CX8 A;  4OWT B;  3TRE A;  5GAH C;  1L1O B;  4IJL A;  4LFC L;  5FLX c;  2KBN A;  1G51 A;  3I4M H;  2PI2 A;  4JC0 A;  1BKB A;  2UUA Q;  3KY7 A;  4P71 A;  4YPY A;  1UE7 A;  3M7N A;  4YQ6 A;  2F4V Q;  2UXB L;  4NPS A;  1XPU A;  1WCM H;  3MEF A;  1XPO A;  4A93 H;  2BA0 A;  1GKH A;  4BA2 I;  1KRS A;  4KDZ A;  1U0L A;  2D62 A;  4GOP B;  4YQS A;  1TWC H;  2Y0S G;  1Q46 A;  1MIU A;  3T1Y Q;  4JBK A;  2I6D A;  4YQ7 A;  2AWO A;  4Y7N H;  1L1O C;  5LMN L;  3I4N H;  3OII A;  5M3F H;  1E22 A;  1NMG A;  2E5L L;  1K3R A;  4MCC A;  2E2I H;  2RCN A;  1CKO A;  1L2F A;  2MQH A;  1VQ4 A;  3GTK H;  5IWA Q;  1VQ8 A;  1NS5 A;  3NK7 A;  3G4S A;  4RMF A;  4FAK A;  1IBK L;  3HKZ G;  3UDI A;  4DV0 Q;  3TS0 A;  4GOP C;  4PG3 A;  3T1H Q;  3STB D;  1MJC A;  3OTO Q;  5IYD H;  1VQF A;  5M5Y H;  3AEV A;  1B70 B;  4YVH A;  3S2H H;  2YY8 A;  3BJU A;  3F8T A;  1LM0 A;  1EQQ A;  2R92 H;  1IZ6 A;  1JT8 A;  2F3I A;  3CAM A;  3HOX G;  3F2B A;  2ZTC A;  4DR1 L;  2OWO A;  3CXC A;  4YVG A;  3RR5 A;  1I50 H;  1PYS B;  1J6Q A;  1RL2 A;  1CKM A;  3RN2 A;  3FP9 A;  3STB C;  4POG A;  2WB1 G;  4YQ8 A;  3E9H A;  1LYL A;  3JC6 6;  4MZ9 A;  1E24 A;  2ZJQ A;  1AE2 A;  2VW9 A;  4JI1 Q;  1KQS A;  2UUB Q;  4GKK L;  1QVC A;  1UWV A;  3TRZ A;  3OIJ A;  4YQR A;  2HIV A;  3K7A H;  1YJN A;  2YV5 A;  3PO2 G;  2JA9 A;  2OCE A;  4YY3 Q;  2ZM6 L;  3ULP A;  4BY7 H;  4YHH L;  1XNR Q;  1Y1V H;  2ZTD A;  1I3Q H;  1HNX L;  5C4J H;  3CPW A;  1N36 L;  4JV5 Q;  1C0A A;  1E1T A;  2HHH L;  2JA8 H;  3JAM c;  1C9O A;  5IP9 H;  1KL9 A;  1CKN A;  5C44 H;  2F52 A;  2WFW A;  3U4Z A;  5IE8 A;  1A0I A;  4DR5 Q;  1VQM A;  2R7Z G;  4BY7 G;  2NVY H;  4CNF A;  1NBW A;  1HNW L;  2Z6K C;  3K7U C;  4P74 A;  1P9P A;  3A5Z B;  4LF8 L;  1VQ5 A;  4A3J G;  4LUO A;  3PO3 H;  1TO0 A;  5JEA J;  4B3T Q;  3M4O H;  3H15 A;  2ZJP A;  5ELO A;  1IBL Q;  4A3B G;  3GO5 A;  1J85 A;  3CCR A; 
#chains in the Genus database with same CATH topology
 3S1N H;  2UXD Q;  4OWW B;  1X3F A;  3KYH C;  2GA4 B;  2Q2U A;  1X3G A;  5LMU L;  3KTY A;  3OHX C;  3U9O A;  3HOZ B;  2BCO A;  4JK1 C;  4TQU S;  5EBC A;  4CDD C;  2O2L D;  2UXC L;  4ZLT F;  3MTS A;  3AXZ A;  1HQM C;  4O0A A;  4YQQ A;  1EY8 A;  2PCF B;  1TKW B;  2HCI A;  1HZ9 A;  1CHQ D;  3LX0 A;  4WOR A;  1EQV A;  4P75 A;  4RHR A;  1GXD C;  4OO1 G;  3E9I A;  2F4I A;  1NAP A;  4APV A;  3DM1 A;  3J81 i;  3L2P A;  1D7Q A;  2RBM A;  3VR5 A;  1K8M A;  1HRJ A;  1FYC A;  2K5H A;  5K36 G;  2E2D C;  1G2S A;  4IJH A;  1PRT B;  2VQE Q;  1MSG A;  3NPP A;  1QVF A;  2UU9 Q;  1OXT A;  3ZYY X;  2N78 A;  4A3E H;  1U9R A;  3HOY G;  4CJ2 C;  1UE1 A;  2MP1 A;  2JP1 A;  5IP7 H;  1EYD A;  2ID0 A;  2IJ0 A;  2KCT A;  2LMC B;  2G5D A;  2PNH A;  4X62 L;  4HN7 A;  2NN6 H;  1BCP C;  4HID A;  1XNQ Q;  1MI2 A;  1PYB A;  4CJ0 B;  3GTL B;  4X66 L;  1YJW A;  4YQL A;  3M3Y B;  4XBO A;  3AFQ A;  3AFP A;  3M9B A;  2KHJ A;  3KBX A;  3MHB A;  3VA5 A;  1BF4 A;  1R9T H;  4DK3 C;  1D8L A;  4DR3 L;  1O80 A;  3I73 A;  2H4O A;  4UPA A;  3S1R B;  1EIG A;  2AHO B;  2JA6 H;  3M7G A;  1YZ6 A;  2PQA A;  5IGG A;  2AWN A;  4A3F B;  4MTN A;  1WCM G;  4IUR A;  1Z7T A;  1FJG L;  1JE5 A;  1GZ0 A;  4ZAI A;  2LY7 A;  3A0J A;  3I4N G;  2WAQ G;  2UUC L;  3I3C A;  1PFM A;  4KHZ A;  1ILP A;  1GUO A;  5DEH A;  4C3J H;  3S17 H;  3RUZ A;  5C6A A;  4RCO A;  1MSH A;  3PUZ A;  3OW2 A;  5LHY 1;  4YCW A;  1BXT A;  2R92 G;  2JEA I;  2K03 A;  3EN2 A;  2Y0S B;  1EWI A;  5JEA G;  3FHW A;  3LGJ A;  4QY7 A;  4YVK A;  5M3M H;  2MFI A;  2F0W A;  3A56 A;  3HKZ B;  4YQ0 A;  1E2V A;  5E4X A;  2F0T A;  5EJW A;  2KQ3 A;  1SE3 A;  2NWG A;  3NBH A;  1GOZ A;  4DV1 L;  2HD3 A;  4DXG A;  1AZP A;  4YY3 L;  4CNE A;  2YTX A;  4YQJ A;  1D1K A;  2EY2 A;  4A3C G;  1GO3 E;  4LF5 Q;  4KLK A;  1YVC A;  1MGS A;  2Q2I A;  3LWE A;  4ZRZ A;  3VYS A;  4LF9 Q;  1LTA D;  3NTI A;  1OXS C;  4K2K A;  4BY7 B;  2A8V A;  4GNX B;  4K0K L;  1WTH A;  2B2Y C;  2UXD L;  3G6J B;  4A3J B;  1Z6H A;  5EPJ A;  5FO7 B;  2OQK A;  3KF6 B;  5E1F A;  3ERQ A;  2DJG C;  5C5L A;  1D2B A;  4LWC A;  5ISR A;  4GNX C;  2PMZ B;  1DOM A;  4YQ3 A;  4E6I A;  1K83 H;  5DAU A;  4EQO A;  4DV3 Q;  1EY6 A;  4L8J A;  1YNJ C;  1SMX A;  1B2T A;  4YQD A;  1XMO Q;  2Z0Y A;  2RKS A;  4CND A;  2QDL A;  1HQR D;  2KHI A;  4NDX A;  2QKI C;  4L5R C;  1STG A;  1H95 A;  3S2D B;  1PFN A;  5CV6 A;  1J9O A;  1PZJ D;  1YIJ A;  2E2H H;  2ES2 A;  2ALY B;  2Z9H A;  5M5W H;  1YNN D;  5C5M A;  2EY5 A;  2K5V A;  4NXM Q;  2O5J C;  3BVG A;  4HJ5 A;  1JOQ A;  1DJR D;  4OEM B;  5COR A;  2GN5 A;  3EIV A;  4KHV A;  4EGV A;  4F7X A;  4WJ4 A;  1HR0 W;  2CQO A;  1PA6 A;  4DAM A;  1TS3 A;  1PH5 A;  4AIM A;  1U4P A;  4A3K H;  2E75 C;  4HJ7 A;  4A3D H;  4L69 A;  5HY6 A;  3I2Z A;  4B3S L;  4I65 A;  2JA5 G;  1YNX A;  3K81 C;  1QNK A;  4A3E B;  1XNQ L;  3PIO A;  1TWA H;  2QEJ C;  1DM0 B;  4KD3 A;  2IX0 A;  5CV7 A;  1I6H H;  1TWH H;  4DAY A;  3SK6 A;  2SEB D;  1HFG A;  4IUT A;  3VYT A;  4EQP A;  4PMW A;  4KV6 A;  2HDM A;  2FHT A;  1V43 A;  1QZH A;  2K75 A;  1IW7 C;  2D5D A;  4DR2 Q;  3TP5 A;  1EOV A;  1KHI A;  2A6H D;  2K7V A;  1UEB A;  4YQ2 A;  1S5E D;  5C0X G;  4YWK A;  2H1E A;  1R4P B;  5IWA L;  3HOX H;  3PUW A;  2NUC A;  1WCM B;  2MJ8 A;  3MVV A;  2KEC A;  2HHH Q;  5D65 A;  4LF7 Q;  1X32 A;  4CDC C;  4Y7N B;  1KIX A;  2JA6 B;  3I4N B;  2I5H A;  2HQE A;  4ZKB B;  3BS1 A;  1OXV A;  2NVT H;  2FMM A;  3PO2 H;  3W1G A;  3M4P A;  1ET9 A;  1YEZ A;  4J3C A;  1X3P A;  2B2V A;  4C3I H;  1SNO A;  3GYQ A;  1U4R A;  2J7Z A;  3L9A X;  5EPK A;  1SYG A;  1SE8 A;  5HGQ A;  3S16 H;  2R92 B;  4MIU A;  1IBM Q;  1W2B A;  4JV5 L;  2NVX H;  1PH6 A;  1D1I A;  4JI8 Q;  1EQT A;  4DR5 L;  1PH1 A;  1ENC A;  2MHV A;  3C1E A;  1MJE A;  1HTL D;  3WOF A;  1VMC A;  1I94 Q;  3K7A B;  1U4M A;  3MFG A;  4B3T L;  3L3O C;  4QUF A;  5IOD A;  1IBL L;  3BVM A;  3KUP A;  1VQO A;  5C4J B;  1S4Z A;  3QG1 A;  1TS2 A;  1JWM D;  1M1K C;  4QQB X;  3K0Y A;  2EJM A;  4EX5 A;  3QOL A;  4FDB A;  3DM3 A;  2F0O A;  4KTA A;  1PTO D;  1SDF A;  1SEB D;  1RTO A;  3HOV G;  1IYJ B;  4YCU A;  1A2U A;  4LF9 L;  4FF1 A;  4C3H H;  4IO9 A;  1EY4 A;  2VZA A;  5G3L F;  1Y1W G;  4DGZ A;  1EIY B;  4OHJ A;  3BBD A;  1O78 A;  4A3L G;  1K3B C;  3ILK A;  1KNE A;  3ND9 A;  2K32 A;  1TY2 A;  3JAM i;  1IHZ A;  4G7H C;  4JYA Q;  2ZTE A;  1XYI A;  4RKL A;  1B50 A;  3DHQ A;  4DV2 Q;  4DV3 L;  3PV0 A;  2J0T D;  4K8J A;  1PRT D;  2WB1 E;  4KJN A;  1XMO L;  5CO4 A;  1VQC A;  1Q81 C;  1LTB D;  2QMM A;  2NVQ H;  3EVQ A;  5H1S E;  2QEX A;  1SJE D;  4DF7 A;  4JI2 L;  1SJH D;  4OGQ C;  3E0J A;  1ET6 A;  1KAB A;  3K80 C;  4B9X A;  2NBF A;  2B63 G;  1NXZ A;  1K83 B;  1FD7 D;  2CW0 C;  3VR6 A;  3FKI H;  1WVL A;  2IW3 A;  1JC7 A;  4DV5 Q;  3OPO A;  4BBS G;  1X65 A;  2I5L X;  3PSI A;  1KC8 C;  1JMC A;  4P72 A;  5ELC A;  1NCV A;  1JR0 D;  2CX8 A;  4RHS A;  3TRE A;  5FO8 B;  5FLX c;  1EOT A;  3C3L A;  1F2Z A;  4P71 A;  2A73 B;  3M7N A;  4YQ6 A;  4N8F A;  1XPO A;  2BA0 A;  2D62 A;  1TWC H;  4JBK A;  2AWO A;  5M3F H;  1E22 A;  1NMG A;  2E5L L;  1K3R A;  2VB3 X;  4MCC A;  4R8I A;  4WFN 3;  1CKO A;  2LS0 1;  3NK7 A;  3OSO A;  3GTJ B;  4DV0 Q;  2JA5 B;  3QIA A;  1I4Q A;  2F3W A;  3OTO Q;  2Z6B A;  5IYD H;  3AEV A;  2F0P A;  2YY8 A;  3BJU A;  1T5X D;  1JQY D;  3R8B A;  1EWC A;  3D4W A;  2B39 A;  3DWA A;  2KOL A;  3RN2 A;  1RL2 A;  2F0N A;  5HGT A;  5A2Q L;  3JC6 6;  1PTO F;  1UUP A;  1KQS A;  4JI1 Q;  2UUB Q;  3TRZ A;  2JA9 A;  2K5W A;  2DNC A;  1XNR Q;  4LAA A;  1LLR D;  1QB5 D;  3CPW A;  3NE5 B;  5JVG 3;  2HHH L;  5C44 H;  5IP9 H;  2F52 A;  2WFW A;  3U4Z A;  4IFD H;  2F0F A;  2NVY H;  1ROD A;  1P9P A;  5FO9 B;  4LUO A;  2RVL A;  5JEA J;  3M4O H;  2ZXO A;  4KKS A;  2ZJP A;  2KHS A;  3CHB D;  2Z4I A;  1F77 A;  4RGM A;  4YQP A;  4FXG C;  3FEW X;  2DNE A;  4PMC A;  5GAE C;  5L37 A;  4QL5 A;  4AYB E;  4DR4 Q;  1HTP A;  2B29 A;  5CBA E;  4FNF A;  4R4T A;  1IBM L;  2NN6 I;  1PRT F;  4LJZ C;  2NVT B;  3PO2 B;  5C3E H;  2HT1 A;  1EFI D;  3IKJ A;  4JI8 L;  3WOE A;  3A8J E;  4C3I B;  1FGB D;  1TS4 A;  4PZ8 A;  1B3A A;  1KD1 C;  5FLM G;  1EU4 A;  4GN3 B;  5C4X H;  1SRU A;  2ICE C;  2MGS A;  4ME3 A;  3UDX A;  1SYF A;  3PUV A;  2NVX B;  2ATW A;  1RTN A;  1Q7Y C;  5JAV A;  5C4X G;  1QOH A;  3Q23 A;  4DK1 A;  1ESR A;  1NE3 A;  1VQD A;  2F0K A;  4HR7 B;  3TN2 A;  3P7J A;  4G4K A;  5FOB B;  3RN5 A;  1WTQ A;  1PXU A;  2JYO A;  2VL6 A;  1IKM A;  2RF4 A;  3H6M A;  4DA2 A;  1F2Y A;  4KI0 A;  3J80 E;  4HTH A;  3O7B A;  1F9R A;  2E2J H;  4YQG A;  1B9M A;  1Q82 C;  1G6Z A;  5KGU A;  1Y1W B;  1EL0 A;  3HOW G;  3TSS A;  1S5F D;  1QIL A;  2QF7 A;  4QIW E;  3B6Y A;  4YCV A;  1VS0 A;  5EPL A;  1GVP A;  1A8V A;  4H0L C;  4X64 Q;  2JA7 H;  4ALP A;  2PPB C;  2BH8 A;  1B7Y B;  4MHE A;  1A62 A;  1CA6 A;  4B3M L;  4QCL A;  1JJG A;  1PFS A;  2VB2 X;  3IFD A;  1I4P A;  1CFM A;  1OO9 B;  2A68 D;  4UAI A;  1HPC A;  4XIG S;  1SYC A;  1YNN C;  4UHV A;  2IY5 B;  4BBR H;  4LF4 L;  2XGT A;  2XNA C;  4F88 A;  5LMN Q;  1L0Y B;  3FRP B;  1B53 A;  5E3F A;  4XQQ A;  4KY5 A;  1C48 A;  5IT9 c;  1A63 A;  4L5S A;  2D9U A;  2R7F A;  1DZ1 A;  1ML0 D;  2PI2 E;  1EU3 A;  5J1Z A;  1WTP A;  2E76 C;  1X9N A;  3VR3 A;  3I4O A;  1V1P B;  4BBS B;  2VUM H;  1EZ8 A;  2A69 D;  3KDF A;  2B2V C;  3GTP H;  3FKI B;  3PCO B;  1KRT A;  2RDH A;  1NSN S;  4A3G H;  3HFZ B;  1RIP A;  2EZV A;  4F87 A;  3AYH B;  1AH9 A;  5C3W A;  5D14 A;  4XT3 B;  1VQJ A;  1QWY A;  4LF6 L;  5BN5 A;  4LUV A;  2EGV A;  4R4I A;  1GD7 A;  3NTH A;  3RLN A;  1L1O A;  5K5P A;  1Z47 A;  2A6H C;  5IYB H;  4DV0 L;  5M5X H;  1HR0 L;  2NZH A;  4KJO A;  5FLX L;  1VQB A;  1UAK A;  1TWC B;  1X7P A;  2WV6 D;  4K8I A;  4FO2 A;  5FJ8 H;  4DXF A;  1YJ9 A;  1BUV T;  3IC6 A;  4UP8 A;  1D5M C;  5C0X J;  3HRZ C;  4L6T B;  2Q8R E;  5C3X A;  1WFQ A;  4JI7 L;  4PZ7 A;  1Q1B A;  4JI1 L;  1Q8I A;  2A74 C;  2XSC A;  1UEA B;  4JI6 Q;  5T1I A;  4A3M H;  4X65 Q;  1XNR L;  1TR5 A;  1N33 L;  4LNQ A;  4K5W A;  1NY4 A;  2L15 A;  3FPU B;  4A3M G;  4H44 C;  3S14 B;  5JOB A;  1U4L A;  4GZY C;  4GN4 B;  5AFW A;  1MKH A;  4DV4 Q;  1ILQ A;  5J3B A;  2EY6 A;  4FF4 A;  4KHP Q;  1WTX A;  3V96 A;  1MXI A;  3F1Z A;  4QJF A;  3W2D A;  5C44 B;  3U4V A;  2SDF A;  1FR3 A;  2TSS A;  2NTT A;  1K8O A;  1BO0 A;  2NVY B;  4JOI C;  4X3T A;  3R3O A;  3A8K E;  2WP8 J;  3DMU A;  3DEP A;  1E7Z A;  4IAL A;  3W3A A;  4DKA C;  5ELB A;  3D4D A;  3UDG A;  1R4Q B;  4R9W A;  4H13 C;  5C0X I;  4IPH A;  1VQL A;  4BY1 H;  1K0R A;  1BCP B;  1WTO A;  1VQI A;  2X69 A;  3UDF A;  4HJ8 A;  4JI0 Q;  3A5U A;  1QVG A;  2OQ0 A;  1E2W A;  3BDC A;  4A3E G;  2V3K A;  4JI3 L;  2VQF Q;  2R93 H;  5C4X B;  5IP7 G;  4IN3 A;  3E6Z X;  2L0C A;  4PZK A;  2GVB A;  2XWB B;  5E4W C;  1TWF H;  1AP0 A;  4GLX A;  2NN6 G;  4LFA Q;  4YQO A;  5J22 A;  2UXB Q;  4QUC A;  2H5X A;  3GDE A;  1BQQ T;  1IYU A;  3KW2 A;  4IOC A;  4EQ5 A;  1IL8 A;  3HS0 C;  4OEL B;  4H02 A;  1BBU A;  2E2J B;  3HOW B;  3RZD B;  5EAY A;  4X64 L;  2L55 A;  1SRO A;  3TZD A;  3WDN A;  4GS3 A;  1VHY A;  2JA6 G;  4UDU C;  3A7L A;  2JQO A;  4YQ1 A;  1RD9 D;  3GTM H;  2ZT9 C;  1HCZ A;  3CC2 A;  3S15 B;  2F4V L;  2A6E D;  2JK8 A;  3PF4 A;  1LV9 A;  3RNU A;  5COY A;  2F1M A;  5HUR A;  1N34 Q;  4C2M B;  4C3J G;  2SNS A;  5GMB A;  1ZYR D;  4L63 B;  3TQY A;  1K9M C;  3TS2 A;  5JJI A;  4MTK A;  1A6X A;  3ERS X;  3D6C A;  4YHH Q;  3PIP 3;  1WD1 A;  4F8M A;  3NQT A;  4C56 C;  3BU2 A;  1HNZ Q;  2PW5 A;  3NBI A;  1N36 Q;  4YQT A;  1PV4 A;  2EE1 A;  2PNR C;  1GJX A;  2YU9 H;  1T5E A;  1VDZ A;  2PZW A;  3CCV A;  1TQO A;  5JJL A;  2E2I B;  5M3M G;  3QJY A;  4YVI A;  1CM9 A;  3CQZ H;  3RD4 A;  4XXE A;  1ONL A;  3G71 A;  3GTK B;  4J1M A;  1W3S A;  4X3L A;  2IHF A;  5IT9 L;  1Z9F A;  1YHQ A;  2F3V A;  2VUM B;  1XXG A;  2K05 A;  1O7I A;  2R7Z H;  4JAL A;  2N88 A;  4PZ6 A;  4CKE A;  3GTP B;  4TSS A;  3I72 A;  3H09 A;  5CBE E;  1SNP A;  3KOJ A;  4X3K A;  3I55 A;  4A3G B;  4NB3 A;  3D6W A;  4JWH A;  1Q8K A;  1PH8 A;  2K28 A;  5BR8 Q;  2EJG C;  3K0X A;  2MNA A;  4S3S A;  5EBD A;  3O13 A;  3CU7 A;  2L5T A;  3RZO H;  3ERO A;  4JWF A;  3MFY A;  1FNU A;  2NTS A;  3AIA A;  5M5X B;  3NEN A;  2Z0S A;  2SNM A;  1PH2 A;  2EIF A;  2ASB A;  4DAV A;  4X65 L;  1SSO A;  3UE0 A;  1YIT A;  3UI2 A;  4DR7 Q;  1J5E Q;  2LFN A;  5D9F A;  1SNC A;  1SR3 A;  3S1N B;  1RJT A;  4KGN A;  5C4Z A;  2Y0S E;  4DV4 L;  1DCZ A;  4A3M B;  4LFB Q;  3U50 C;  3I90 A;  4KHP L;  1X7O A;  1CSQ A;  3BBH A;  1Q86 C;  1A3U A;  4YQN A;  4DNT B;  3HKZ E;  3V05 A;  3DLL A;  3BYY B;  4DAP A;  1JJC B;  4FVM A;  1RKN A;  4CNG A;  2Q8T A;  3V2T A;  4EVO A;  4RH6 A;  4CDF C;  4ZUJ A;  4HAE A;  4CDE C;  3FVQ A;  4HJA A;  2VQE L;  3NEM A;  2K04 A;  1F2L A;  5D3D A;  3Q24 A;  3U9S A;  1X54 A;  2UU9 L;  3J81 E;  3GQB A;  1B9N A;  3CD6 A;  3KDF B;  5JJZ A;  3VR4 A;  1ZXT A;  4OL7 A;  2A5H A;  4JI0 L;  4RA8 A;  1YHB A;  1NNX A;  3F2U A;  1TWG H;  4P73 A;  3NWS A;  3GV3 A;  1AN8 A;  3MC0 B;  4AQY Q;  4X6A H;  2BDN A;  5G3L D;  4DUZ Q;  2VQF L;  4A3K G;  4UY8 C;  1LTL A;  1QUQ A;  1JE4 A;  3PUX A;  4A3D G;  1HH2 P;  4L5T A;  4BY1 B;  1J85 A;  2ZXP A;  4ILW A;  2OEO A;  2YYZ A;  2FJ2 A;  5CYU A;  1VQG A;  4OWT B;  1L1O B;  4IJL A;  4BWG B;  2M9V A;  1O7L A;  4RGO S;  1G51 A;  3TP7 A;  5IGC A;  2PI2 A;  4JC0 A;  2UUA Q;  3I4M H;  4WJW A;  2CH4 A;  1UE7 A;  3Q6S A;  1G8Z D;  3IAY A;  2UXB L;  2B8G A;  2K6A A;  4NPS A;  3HEJ A;  3MEF A;  4M8A A;  1XPU A;  4BA2 I;  4A93 H;  1KRS A;  4G57 A;  3T1Y Q;  1MIU A;  3ITP A;  4YQ7 A;  1B1Z A;  2EXZ A;  1L1O C;  1FNV A;  1NS5 A;  4RMF A;  4FAK A;  1TVX A;  3TS0 A;  1R9T B;  3M4Y A;  2KVM A;  2EDG A;  1B70 B;  5M5Y H;  4YVH A;  1BOS A;  1LM0 A;  2KCC A;  2BE5 C;  3CAM A;  5EKI A;  3HOX G;  3RR5 A;  1CKM A;  3FP9 A;  2Z8L A;  1STY A;  2LKV A;  3STB C;  4YQ8 A;  3E9H A;  1LYL A;  5LL6 X;  1B3Q A;  4MZ9 A;  1H9M A;  2ZJQ A;  2VW9 A;  3OIJ A;  5I9O A;  3N6R A;  5LL6 S;  4YQR A;  3NQI A;  2TMP A;  3IL8 A;  3AB9 A;  3PO2 G;  2OCE A;  4RGT A;  4C3J B;  3ULP A;  4YHH L;  3S17 B;  1Y1V H;  4C3I G;  1I3Q H;  1N36 L;  1EEI D;  2JA8 H;  1D5Z C;  1C9O A;  1ZEQ X;  3CRK C;  1CKN A;  4YQB A;  3PQI A;  1NBW A;  3A5Z B;  2NYZ D;  1VQ5 A;  3PO3 H;  1TO0 A;  1X3E A;  4NW2 A;  5M3M B;  4RAU C;  3I70 A;  4RKB A;  2WB1 B;  1SYD A;  1N8R C;  2YU9 B;  3KLR A;  5T1G A;  3Q8D A;  5I9P A;  4R4C A;  1DON A;  5BR8 L;  4LF5 L;  3PUY A;  1PHJ A;  3DWP A;  3CC7 A;  3HOU H;  1TT2 A;  1AZQ A;  3OOC A;  2QCP X;  3FPP A;  4OX9 Q;  1NR4 A;  2N3S A;  1VQH A;  2B2T A;  1BBW A;  4N9P A;  5CV5 A;  2IX1 A;  2Z1C A;  1JOK A;  5IYC H;  4ME5 A;  4C3H G;  2WAQ E;  1CK1 A;  5ELD A;  2EQS A;  4DR7 L;  1ESF A;  1SND A;  1JJ2 A;  1AW7 A;  3NXW A;  4XQJ A;  2WIN B;  1EY9 A;  3RZO B;  5JPM C;  2L9H A;  1VF7 A;  4N8X 1;  3K58 A;  5LMN W;  2PQA B;  3U58 A;  3OIP A;  1E2Z A;  2K5Q A;  3DWQ A;  4JOI A;  4Y52 H;  1CQF A;  4LFB L;  4MCB A;  1CTM A;  3NUC A;  1SE2 A;  1SYB A;  2JE6 I;  1C8C A;  4JW0 A;  4FYD A;  3E3X A;  1BCP D;  5AJ3 Q;  4V0B A;  1Y8O B;  3KNU A;  1EUJ A;  3RLO A;  4FF3 A;  3H0G H;  1N9W A;  1EIH A;  4YPX A;  1MBY A;  3OWE B;  4NXM L;  2XN9 C;  4JI5 Q;  1XWE A;  3FKI G;  1V8Q A;  4TVA B;  2AKW B;  4L5Q A;  1H9K A;  3KF8 A;  2E2H B;  3SGI A;  2ZJR A;  4DNI A;  1FVI A;  5M5W B;  3CF5 A;  1HZB A;  4H7B A;  3AI9 X;  1PH3 A;  3ER0 A;  4DUZ L;  5DNF A;  1XTD A;  3NBH B;  1CQV A;  2CKZ B;  2R61 A;  3KLS A;  4DUY Q;  1HZC A;  1LT3 D;  4A3K B;  1W6K A;  4HMJ A;  5M3F G;  1WJJ A;  4O42 A;  3TZU A;  2D0P A;  1SLJ A;  4A3D B;  2DY8 A;  3TP8 A;  4O2D A;  2UUA L;  4DR1 Q;  4B08 A;  2K52 A;  2K5N A;  3G7L A;  3NHH A;  1LTI D;  1HXY D;  2B2U A;  5IYD G;  1TWA B;  4HJ9 A;  4DR2 L;  3T1Y L;  3GTG H;  2A1A A;  1WD0 A;  1LTT D;  4UP7 A;  1HZA A;  1I6H B;  1TWH B;  3I4M B;  4LMQ D;  4LW1 A;  2ZM6 Q;  4WRD A;  1HNX Q;  4A93 B;  2F0I A;  3SVM A;  1VQK A;  5FAI A;  4XTC S;  2BDO A;  4LF7 L;  1PDQ A;  2F0H A;  1Q3L A;  1Y8P B;  3HOZ H;  1PTO H;  3K5O A;  4LF8 Q;  5C44 G;  5IP9 G;  1B4O A;  4IFD G;  3HOX B;  1GHJ A;  5TSS A;  2JJQ A;  4GLA C;  1GUS A;  3SEB A;  1II3 A;  5KIX A;  5GAD C;  1A15 A;  1I4R A;  3G6E A;  1STA A;  4KD4 A;  1I4X A;  4ABN A;  1M90 C;  2CH4 W;  2WKC A;  2L11 A;  5LMU Q;  3CCU A;  5JVH 3;  4JBW A;  2PZT A;  3PIO 3;  3F2C A;  1PFB A;  3I4L A;  3FMC A;  1V9P A;  5I2Y A;  1LT5 D;  5EGT A;  1Y8N B;  3GTQ H;  2DGY A;  2UXC Q;  1BDO A;  1BCP F;  1CSP A;  1U5K A;  3CCJ A;  2BH2 A;  1I94 L;  4YQC A;  3IFT A;  5C3E G;  1PH7 A;  3S16 B;  4HIK A;  1Y1V B;  4MCD A;  4RG1 A;  2QWV A;  3QUV A;  4U68 A;  5FKA C;  3BBE A;  2JA8 B;  2BA1 A;  3MXP A;  1F9Q A;  1UAL A;  3T16 A;  3PF5 A;  1IPA A;  3KLW A;  1YNJ D;  2MO1 A;  2P5Z X;  4A76 A;  4IG6 A;  4IPC A;  2EYL A;  1QUQ B;  3MA2 B;  4J6H A;  3K6O A;  3CC4 A;  2CWA A;  2Q8I B;  5BN3 A;  4OX9 L;  1OXU A;  3L7Z C;  2F0S A;  4HIO A;  4DV7 Q;  1S40 A;  3IEF A;  4DAY B;  4PMB A;  4RCN A;  3DUZ A;  1C4Q A;  3GTL H;  4KN4 C;  1ENF A;  4LK1 C;  3K8A A;  2G9H D;  3HOU B;  3M85 A;  3BYT B;  5ELN A;  4YWM A;  4HED A;  2KA7 A;  4C3H B;  2DJF C;  4X62 Q;  4JYA L;  1QNU A;  4KK7 A;  2PW7 A;  1VQE A;  4DV2 L;  4U67 3;  5C4H A;  4A3F H;  4BXX H;  3W5O A;  1STH A;  2JA7 G;  4ODG A;  1SMY D;  4N9T A;  2K01 A;  1TU2 B;  2M00 A;  3G48 A;  3JAM E;  1KDC A;  2F0E A;  2PYK A;  3A8I E;  4DR3 Q;  4XQN A;  5EKK A;  3CCQ A;  4PQX A;  2FIN B;  4BBR G;  1TII D;  1K73 C;  2OT2 A;  1XX8 A;  4DV5 L;  1DOK A;  4IUV A;  2NVQ B;  3EFX D;  1DOL A;  4JI5 L;  2UUC Q;  1IBK Q;  1IW7 D;  1G29 1;  2VY3 A;  3Q0A A;  2I07 B;  1NR2 A;  3DCM X;  2B8F A;  1CKN B;  2VNU D;  4YQ5 A;  1QZG A;  1SFO H;  2LXK A;  4K5X A;  3TEH B;  2VUM G;  4YWL A;  4YPW A;  3I7F A;  2ICI A;  3ONP A;  3S1Q H;  3E5Y A;  3IRB A;  4GKK Q;  4A3G G;  4ZYS A;  3L8U A;  2MUY A;  3J80 c;  4DUY L;  1S5C D;  2EJF C;  3D8G A;  1P16 A;  4C1N I;  2F0J A;  1S5D D;  5IGB A;  1NUC A;  4C1N K;  3CME A;  1JWU D;  4DU9 A;  3OTO L;  3T13 A;  3I8Z A;  1LUZ A;  3UE1 A;  5M3F B;  4X3U A;  5IYB G;  2LSS A;  1EFW A;  1J8I A;  3CCE A;  1OTC A;  4YQA A;  5FJ8 G;  2V1C C;  4IOA A;  1NMF A;  1WYD A;  2UUB L;  4DV1 Q;  2DUD A;  4QB4 A;  4XYQ A;  4J15 A;  1KXL A;  1X55 A;  3MZ5 A;  3QR8 A;  2KED A;  3D0F A;  3FDT A;  4A3J H;  5EKL A;  4CGY B;  2LXJ A;  2IX3 A;  4A3B H;  2B2T C;  1I5F A;  5F2D A;  4G7O C;  4JG2 A;  3BG3 A;  2G9D A;  1G2T A;  1ASZ A;  1N32 Q;  2EYF A;  3EBE A;  1PVO A;  1X56 A;  4K0K Q;  3DXJ C;  3HP3 A;  5CV8 A;  3KFU A;  2HIX A;  3EJI A;  4ZK9 B;  5DM6 3;  1S3O A;  4XT1 B;  3K5M A;  3SK5 A;  1JB3 A;  2E8G A;  4DR4 L;  4DR6 Q;  1BBX C;  1PTO B;  3H3V H;  1ZKO A;  3QWN A;  2V4D A;  5IIF A;  3NK6 A;  3M4O B;  2AMC B;  2JN4 A;  4JCV E;  4K5V A;  3S2D H;  5IGF A;  1YHA A;  3N4J A;  1P8L A;  4M1U B;  4H3Z A;  3BZC A;  1SN8 A;  3CCS A;  2EYM A;  1EY0 A;  4OO1 H;  3ULL A;  1PTO C;  3K5N A;  3KF8 B;  5C3E B;  3GTQ B;  2OF1 A;  2ZXR A;  2R7D A;  4IUP A;  5K36 H;  4K14 A;  1JB7 A;  1GHK A;  2EYH A;  2K33 A;  5M9O A;  1WI5 A;  3QB3 A;  4BY1 G;  4G7Z C;  1I4H A;  1Q90 A;  2JEB I;  2K4K A;  2F0U A;  2IWH A;  4CKC A;  1VCI A;  1H9S A;  1VQ9 A;  3KBG A;  1V2X A;  2QGQ A;  3HOY H;  1VQ7 A;  5BN4 A;  1HA6 A;  1KDA A;  2R93 G;  2HDL A;  4DV7 L;  4YPZ A;  4R1J A;  2CW0 D;  1OXX K;  3URY A;  1QCB D;  1JOO A;  1FL0 A;  3OIN A;  1KLG D;  3OMC A;  1UAP A;  3S1M H;  1PRT C;  1UAM A;  4IUN A;  4B3S Q;  2K1B A;  4YQ4 A;  4DFA A;  2B3G A;  3OMG A;  5CMD A;  2QIL A;  3AMU A;  3ND8 A;  3S9W A;  2B2U C;  1BKB A;  1WCM H;  2JA7 B;  1HUM A;  1GKH A;  3P75 A;  5IOC A;  1SXT A;  2AQ2 B;  2I6D A;  2RCF A;  4Y7N H;  5LMN L;  3I4N H;  4FMW A;  3VYR A;  2RCN A;  1L2F A;  2MQH A;  1EYC A;  3HZX A;  5IWA Q;  3VR2 A;  2JXM B;  1HA5 A;  4BBR B;  4QF4 A;  1IBK L;  1PLF A;  3UDI A;  1CZW A;  3T1H Q;  2X6L A;  3S2H H;  3F8T A;  2R92 H;  1IZ6 A;  1EY5 A;  3F2B A;  2ZTC A;  2J4X A;  4OIJ A;  1VF5 C;  5ELE A;  3H91 A;  1I50 H;  1E0B A;  3C46 A;  1QE6 A;  5JEA H;  2N55 A;  1PZK D;  3VYU A;  2WB1 G;  5IGE A;  1AE2 A;  4GKK L;  1QVC A;  1TY0 A;  3K7A H;  1YJN A;  2YV5 A;  1GUG A;  5I6W A;  5ELF A;  2ZTD A;  1SFO B;  4HCS A;  5C4J H;  4JV5 Q;  3T4A C;  1SYE A;  3CKI B;  2R7Z G;  3MXN A;  4CNF A;  4DR5 Q;  4YQ9 A;  5KND A;  1HHV A;  3K7U C;  3S1Q B;  1D6E C;  4P74 A;  2AUJ D;  1KNA A;  3OW7 A;  4B3T Q;  2AQ1 B;  5ELO A;  1IBL Q;  4A3C H;  1C7Y A;  3T56 B;  5GAG C;  4JI6 L;  3J80 L;  4IUQ A;  2PZU A;  1WTV A;  2I0Q A;  4JBM A;  3DEO A;  2I46 A;  2KCN A;  4JI4 Q;  4IFD J;  5A2Q E;  1FGU A;  4DK0 A;  1EZ6 A;  5I6Y A;  1AEX A;  1L0X B;  5CC4 A;  1N32 L;  2O4X A;  3W1B A;  1BNZ A;  2X6G A;  2R3Z A;  2A19 A;  1Y14 B;  1HJP A;  2F0M A;  4RGN A;  3CMA A;  2NZO A;  4A3B B;  2L4N A;  1WTW A;  4DR6 L;  1V6Z A;  3JAM L;  2C5C A;  2IT1 A;  1ENA A;  4JPB W;  1IL2 A;  2F0D A;  3PMF A;  2EPB A;  1VQP A;  4JI2 Q;  3C1F A;  3L0O A;  3QO2 A;  4UP9 A;  2FXQ A;  1EY7 A;  1LAC A;  5IGD A;  2D0O A;  1DGS A;  4R8N A;  2EVB A;  1Q12 A;  4ZCK A;  4O1N A;  2YTV A;  3CCL A;  3H3V C;  4FF2 A;  4IPD A;  4AYB G;  1HFN A;  4IFD I;  5J39 A;  1GUN A;  1TS5 A;  1K0S A;  1F9P A;  2WKD A;  2B2W C;  3CW2 C;  1CT1 D;  4LFA L;  4JBJ A;  2PO4 A;  3GTJ H;  2JA5 H;  2R93 B;  1CHP D;  2PMZ E;  4I7Z C;  4IPG A;  3VDY A;  1XMQ Q;  1A3T A;  3HOY B;  1SMY C;  1EEF D;  2A68 C;  3I4M G;  2E5L Q;  2R6G A;  2YTY A;  1TWF B;  3OWF A;  4A93 G;  1LTR D;  5GMC A;  2KJX A;  3J7A 5;  4DNR B;  2K14 A;  2OTJ A;  1SE4 A;  3S1M B;  5CGK A;  2MO0 A;  1RF2 D;  4MN3 A;  1VQA A;  2O3A A;  1MD2 D;  3T53 B;  5KEE A;  1GUT A;  2CWP A;  2RHQ B;  1YI2 A;  1B44 D;  4QMG A;  3K57 A;  5C0X H;  2K5D A;  3EQL C;  4TRD A;  4PV1 C;  4NXN Q;  4X3S A;  3KJP A;  2VXW A;  5D3I B;  2A69 C;  4B9W A;  3A55 A;  1N34 L;  4JWJ A;  3GTM B;  1S72 A;  1LO5 D;  5KYI A;  1K8A C;  2HA8 A;  2WAC A;  1ICF B;  2XIW A;  3J81 c;  4R4O A;  2HCC A;  3T1H L;  1HNZ L;  4GN5 A;  4V19 0;  1NTG A;  2CCZ A;  5DLQ E;  2QA4 A;  3ZJY C;  1H9R A;  2WAQ B;  3T51 B;  4A75 A;  2AUK A;  3CP0 A;  1Y1V G;  2IPK D;  2AQ3 B;  5GM8 A;  4GOP A;  2FMC A;  1L0W A;  4DV6 Q;  4GKJ Q;  2JA8 G;  1CZG A;  5GRO A;  3J7A F;  4KKU A;  2I5M X;  4FP5 D;  4A4I A;  1LTG D;  4LUZ A;  5A35 A;  3CCM A;  3SR1 A;  1IYV A;  4CKB A;  3PO3 G;  3S2H B;  4POF A;  1DD2 A;  1V1P A;  1VH0 A;  5CR3 A;  2Q2T A;  2FFK B;  3MEH A;  2N8N A;  1I50 B;  2RSO A;  4YIJ A;  1GUW A;  2D2C C;  3CQZ B;  5KRU A;  4AH6 A;  1LTS D;  2CFM A;  1H9S B;  4RFB A;  1M8A A;  2SOB A;  2R7Z B;  4KMU C;  1ZJR A;  1UAJ A;  3QOJ A;  1K8G A;  1G6P A;  4KN7 C;  1BVS A;  1XJV A;  2Z6K A;  5FLX E;  1QJO A;  3F2D A;  2F03 A;  1B8A A;  4FXK C;  3HOU G;  1X6O A;  4P2C B;  3J80 i;  2EYJ A;  3TP6 A;  1VQN A;  2IL8 A;  1RHP A;  2C35 B;  3MXG A;  3HOV H;  5JPN C;  1STE A;  4MNO A;  4B3R Q;  4H3Y A;  1DXM A;  1DYQ A;  4IZ8 A;  3J81 j;  1J5E L;  3Q22 A;  2M2L A;  2EXD A;  1I4G A;  2K50 A;  4PNY A;  1EIF A;  1SNQ A;  5IYC G;  2EGW A;  1Y1W H;  1EYG A;  4JI4 L;  5JJK A;  3VA7 A;  1EQR A;  3SE0 A;  5NUC A;  4DK6 C;  4A3L H;  4HSP A;  1PMR A;  3J7Z C;  4YVJ A;  3N4K A;  1YBY A;  3HG9 A;  5IY0 A;  1JIC A;  3GTO H;  4ID6 A;  1VMP A;  1KDB A;  4X3M A;  4FXD A;  1E1O A;  2Q2H A;  1CI3 M;  1Q1E A;  1PH9 A;  2V3J A;  4JAK A;  3NP8 A;  1TXY A;  1NJI C;  4KY7 A;  2VS1 A;  5GQO A;  1UE5 A;  2EYP A;  1F9S A;  1X3Q A;  4RWS C;  4HMI A;  3H0G G;  3ICE A;  4B3M Q;  2IHE A;  1SBB B;  3CPF A;  3LWU A;  4NKL A;  3J7Y W;  4LFC Q;  4HIM A;  2B63 H;  4XDX A;  3ULJ A;  4CJ1 B;  4BA1 I;  3D3R A;  3KJO A;  2XRS D;  4Q0F A;  2OXP A;  4LF4 Q;  3SK8 A;  3WWV A;  1O6D A;  4BBS H;  5I2X A;  4NP5 A;  2DN8 A;  2DY7 A;  3S24 A;  3A54 A;  1IXR A;  4YQI A;  4AQY L;  1AE3 A;  3I91 A;  4K6D A;  2OTL A;  2CVR A;  3P20 A;  1I6V C;  4JWG A;  1T9H A;  3GD7 A;  2BOS A;  2XTI A;  3TME A;  1A3V A;  1WOC A;  4K6L A;  1TWG B;  2XVS A;  2PQE A;  4AYB B;  3MXN B;  1Z85 A;  1HUN A;  1STN A;  1XMQ L;  2N49 A;  1PZI D;  4NMZ A;  3P1H A;  4LF6 Q;  2C9O A;  4YQK A;  3H3V I;  2KCM A;  2A6E C;  1PYW D;  1A2T A;  3EA6 A;  5KNB A;  4A3I H;  1LT6 D;  1HR0 Q;  3NEL A;  4IUU A;  3GP7 A;  1SNM A;  1ZYR C;  3KLS X;  1MHW C;  1Y69 U;  4OO1 I;  1BR9 A;  3NK9 A;  4A3I G;  2F0V A;  1HNW Q;  3AU7 A;  2EYO A;  1CUK A;  2QW7 A;  1GM5 A;  3SHL A;  3AQQ A;  4NXN L;  3X3N A;  3BDL A;  4JI7 Q;  3S14 H;  1LAB A;  5CV4 A;  1KLU D;  2CHB D;  2RSN A;  4E8B A;  1EWH A;  5FK9 C;  1KAW A;  3HOZ G;  5M5Y B;  1FNW A;  2HQL A;  1N33 Q;  1AFP A;  3GV6 A;  4KY6 A;  2RDG A;  4EQN A;  1VHK A;  2RDF A;  2RQX A;  4QIW B;  3M4Q A;  1WTR A;  4DV6 L;  4GKJ L;  3A74 A;  4TKO B;  4OON A;  1F2M A;  4OWX B;  1S5B D;  3HKS A;  1OY5 A;  3D4R A;  1I3Q B;  4WJ3 M;  2F0G A;  3OYY A;  2NB0 A;  2XRQ D;  2L1B A;  1KTK A;  3R93 A;  2GVA A;  1ASY A;  1VQ6 A;  2L12 A;  4J8Q A;  3J81 L;  1IKL A;  5FLM H;  3PO3 B;  2CQA A;  3RLF A;  4OXP A;  4JVZ A;  3N52 A;  2RHS B;  1EYA A;  1QG7 A;  1RDP D;  1JOR A;  3D31 A;  5IT9 E;  5I4D A;  4OIK A;  2MPM A;  1JCK B;  3ONA B;  2ENB A;  4IQZ A;  3MAQ A;  2XWJ B;  3KK7 A;  3E0E A;  3MXU A;  1E3P A;  5E7N A;  3NWT A;  1O7Z A;  2HUG A;  4B3R L;  1UE6 A;  4KKT A;  3M3Y H;  2EY1 A;  4ZUI A;  1XPR A;  2B2Y A;  3LNN A;  4JI3 Q;  4CHT B;  2KEN A;  5KYL A;  3PIP A;  2KEE A;  2NZ1 D;  3CRL C;  1K28 A;  3S1R H;  3NSW A;  4HSV A;  4X66 Q;  3BZK A;  2RA4 A;  3RZD H;  1V1O A;  3HOW H;  3PGZ A;  4GNX A;  3HOV B;  3TDQ A;  3K59 A;  3R2T A;  5AJ3 L;  1PH4 A;  3KF6 A;  1RCV D;  4A3F G;  4Q5V A;  4BXX G;  4R4Q A;  1UNS A;  2QDB A;  3E5S A;  3NTK A;  4QGU A;  3I56 A;  3BVZ A;  3C2P A;  2Z4H A;  4GLV B;  1SAP A;  3S15 H;  3GTO B;  1V1Q A;  4DPG A;  1FJG Q;  1G91 A;  3BZD B;  4XYO A;  4C2M H;  4CBV A;  5GAH C;  2O5I C;  4LFC L;  4DN4 M;  2KBN A;  3H0G B;  3KY7 A;  1W6J A;  4YPY A;  3SXH A;  2F4V Q;  4KDZ A;  1JWS D;  3K5L A;  3X3M A;  1U0L A;  4GOP B;  1M4V A;  4YQS A;  1Q46 A;  2Y0S G;  2B2W A;  3OII A;  2KUM A;  5CV9 A;  1D5X C;  2E2I H;  2B63 B;  1VQ4 A;  2BE5 D;  3GTK H;  5KNC A;  4I7A A;  1O7Y A;  1VQ8 A;  3G4S A;  2JSO A;  1H9J A;  3HKZ G;  4ZKC B;  4GOP C;  4PG3 A;  4BS9 A;  3STB D;  1MJC A;  1VQF A;  3A7A B;  1EQQ A;  2F0Q A;  4HCE A;  1KAA A;  1JT8 A;  2F3I A;  4ULL A;  2OWO A;  4DR1 L;  3CXC A;  3BDO A;  3J7A V;  4YVG A;  1PYS B;  1J6Q A;  5DM7 3;  3RMH A;  4K2L A;  1LT4 D;  3SK4 A;  4POG A;  3R2I A;  1E24 A;  2E74 C;  1CA5 A;  1UWV A;  4ZQ3 A;  2HIV A;  4YY3 Q;  4BY7 H;  2F0L A;  3H94 A;  2ZM6 L;  3MWY W;  1XTC D;  1HNX L;  1C0A A;  1E1T A;  3JAM c;  3GTG B;  1KL9 A;  5IE8 A;  3TBI B;  3HGB A;  1A0I A;  1VQM A;  4BY7 G;  1HNW L;  2Z6K C;  2EOT A;  4LF8 L;  1ICW A;  4A3J G;  2WII B;  4Z9C B;  5EQ0 A;  3H15 A;  1STB A;  3SDZ A;  4A3I B;  4A3B G;  3OIQ A;  3GO5 A;  3CCR A; 
#chains in the Genus database with same CATH homology
 1C7Y A;  3S1N H;  4YQP A;  1X3E A;  2UXD Q;  5GAG C;  4OWW B;  1X3F A;  4JI6 L;  3KYH C;  5GAE C;  1N8R C;  4QL5 A;  4AYB E;  2Q2U A;  1X3G A;  2B29 A;  4DR4 Q;  3Q8D A;  4R4T A;  1IBM L;  2I0Q A;  2NN6 I;  5LMU L;  4JBM A;  3KTY A;  4R4C A;  5BR8 L;  5C3E H;  4TQU S;  4LF5 L;  2HT1 A;  4IFD J;  3PUY A;  4JI8 L;  3CC7 A;  1PHJ A;  1FGU A;  4JI4 Q;  2UXC L;  3HOU H;  4PZ8 A;  1N32 L;  1KD1 C;  5FLM G;  3W1B A;  4OX9 Q;  3AXZ A;  4GN3 B;  2N3S A;  1VQH A;  4O0A A;  5C4X H;  4YQB A;  4YQQ A;  1SRU A;  2A19 A;  4WJ4 A;  1BBW A;  4ME3 A;  3UDX A;  1HZ9 A;  1Y14 B;  1HJP A;  3CMA A;  3PUV A;  2NZO A;  2IX1 A;  2ATW A;  4P75 A;  1Q7Y C;  5IYC H;  4OO1 G;  5C4X G;  2WAQ E;  3E9I A;  3J81 i;  4APV A;  2EQS A;  3L2P A;  1NE3 A;  4DR6 L;  1VQD A;  3HOW H;  4DR7 L;  1JJ2 A;  1D7Q A;  1V6Z A;  2IT1 A;  3RN5 A;  5LMN W;  3U58 A;  2PQA B;  2K5H A;  5K36 G;  2VL6 A;  2RF4 A;  4JOI A;  4KI0 A;  4Y52 H;  1IL2 A;  4IJH A;  2VQE Q;  3O7B A;  4LFB L;  1QVF A;  2E2J H;  4MCB A;  2UU9 Q;  4YQG A;  1OXT A;  2N78 A;  1VQP A;  4A3E H;  2JE6 I;  1Q82 C;  4JI2 Q;  3L0O A;  3HOY G;  4UP9 A;  1UE1 A;  2FXQ A;  5AJ3 Q;  3KNU A;  5IP7 H;  3HOW G;  2ID0 A;  1EUJ A;  2KCT A;  2D0O A;  4QIW E;  1DGS A;  3B6Y A;  3H0G H;  4YCV A;  3RLO A;  1VS0 A;  1GVP A;  1Q12 A;  2PNH A;  1N9W A;  1A8V A;  2YTV A;  4X62 L;  4X64 Q;  4ALP A;  3CCL A;  2JA7 H;  2BH8 A;  4HID A;  4YPX A;  1B7Y B;  1XNQ Q;  1A62 A;  1PYB A;  4IPD A;  4B3M L;  4AYB G;  4NXM L;  4JI5 Q;  1JJG A;  4IFD I;  1PFS A;  3FKI G;  4X66 L;  4TVA B;  1YJW A;  4YQL A;  2AKW B;  3CW2 C;  4XIG S;  4LFA L;  3AFQ A;  4L5Q A;  4XBO A;  4JBJ A;  3AFP A;  3M9B A;  2KHJ A;  2IY5 B;  3SGI A;  4BBR H;  2ZJR A;  4DNI A;  4LF4 L;  3GTJ H;  2JA5 H;  1FVI A;  2PMZ E;  1R9T H;  4DK3 C;  3CF5 A;  1HZB A;  1D8L A;  2XGT A;  4IPG A;  4DR3 L;  3VDY A;  4UPA A;  1XMQ Q;  3AI9 X;  1PH3 A;  3I4M G;  2AHO B;  5LMN Q;  3ER0 A;  2E5L Q;  2JA6 H;  2R6G A;  1YZ6 A;  2PQA A;  4DUZ L;  1XTD A;  3NBH B;  2AWN A;  2HA8 A;  2YTY A;  4MTN A;  5IT9 c;  1WCM G;  2CKZ B;  4L5S A;  4A93 G;  1A63 A;  1FJG L;  1JE5 A;  4DUY Q;  1GZ0 A;  2R7F A;  5GMC A;  1HZC A;  2PI2 E;  3A0J A;  3J7A 5;  2K14 A;  1X9N A;  2WAQ G;  3I4N G;  3I4O A;  5M3F G;  2UUC L;  1WJJ A;  2OTJ A;  4KHZ A;  2D0P A;  2VUM H;  3KDF A;  1SLJ A;  2MO0 A;  4O2D A;  1VQA A;  2UUA L;  2O3A A;  4C3J H;  3GTP H;  3PCO B;  1KRT A;  3S17 H;  2CWP A;  2RHQ B;  4DR1 Q;  1YI2 A;  4A3G H;  2K52 A;  2K5N A;  3HFZ B;  3PUZ A;  3OW2 A;  1RIP A;  4NXN Q;  3AYH B;  5IYD G;  4HJ9 A;  3KJP A;  4YCW A;  4DR2 L;  3T1Y L;  3GTG H;  1AH9 A;  2A1A A;  1N34 L;  4UP7 A;  1HZA A;  2R92 G;  2JEA I;  1VQJ A;  4LF6 L;  4LUV A;  4JWJ A;  3EN2 A;  1S72 A;  1EWI A;  4LW1 A;  5JEA G;  3FHW A;  2ZM6 Q;  1K8A C;  3LGJ A;  1GD7 A;  4R4I A;  2EGV A;  4QY7 A;  3RLN A;  3J81 c;  4YVK A;  1L1O A;  1Z47 A;  4R4O A;  5IYB H;  4DV0 L;  5M5X H;  5M3M H;  2MFI A;  2NZH A;  4GN5 A;  1NTG A;  1VQB A;  3T1H L;  1HNZ L;  5DLQ E;  2QA4 A;  2CCZ A;  1UAK A;  5FAI A;  1X7P A;  3ZJY C;  4XTC S;  5FJ8 H;  4LF7 L;  4A75 A;  1YJ9 A;  3CP0 A;  3IC6 A;  1Y1V G;  4YQ0 A;  5GM8 A;  4UP8 A;  3HOZ H;  5C0X J;  4LF8 Q;  4GOP A;  1L0W A;  4DV6 Q;  4GKJ Q;  2JA8 G;  1WFQ A;  5C44 G;  5IP9 G;  4JI7 L;  5GRO A;  4IFD G;  2I5M X;  4A4I A;  4PZ7 A;  1Q1B A;  4JI1 L;  2JJQ A;  4GLA C;  4JI6 Q;  4LUZ A;  3CCM A;  4DV1 L;  5GAD C;  3PO3 G;  4A3M H;  3G6E A;  4YY3 L;  4POF A;  4X65 Q;  4CNE A;  1XNR L;  1VH0 A;  1M90 C;  2YTX A;  5LMU Q;  2Q2T A;  4YQJ A;  3CCU A;  4A3C G;  1N33 L;  4JBW A;  2N8N A;  4LNQ A;  3F2C A;  1NY4 A;  1GO3 E;  4AH6 A;  4YQ9 A;  2CFM A;  1V9P A;  2L15 A;  4KLK A;  4A3M G;  4LF5 Q;  1YVC A;  3GTQ H;  2DGY A;  4GN4 B;  2UXC Q;  1CSP A;  2Q2I A;  1U5K A;  3CCJ A;  1MKH A;  4LF9 Q;  4DV4 Q;  1I94 L;  2BH2 A;  1UAJ A;  1OXS C;  1K8G A;  1ZJR A;  5C3E G;  4YQC A;  5J3B A;  1PH7 A;  1G6P A;  2A8V A;  4HIK A;  4KHP Q;  4MCD A;  4GNX B;  4RG1 A;  4K0K L;  2QWV A;  3QUV A;  1BVS A;  1XJV A;  3BBE A;  2Z6K A;  3F2D A;  3HOU G;  2UXD L;  1MXI A;  1B8A A;  1X6O A;  3F1Z A;  4QJF A;  2BA1 A;  3J80 i;  3U4V A;  1VQN A;  2C35 B;  1UAL A;  2OQK A;  3HOV H;  4JOI C;  3PF5 A;  4MNO A;  3KF6 B;  4B3R Q;  1IPA A;  3KLW A;  4H3Y A;  2MO1 A;  3J81 j;  4A76 A;  1J5E L;  2EGW A;  2EXD A;  2WP8 J;  2K50 A;  4IPC A;  1EIF A;  4LWC A;  5IYC G;  4GNX C;  1Y1W H;  1EYG A;  4JI4 L;  1E7Z A;  5JJK A;  1EQR A;  4YQ3 A;  1QUQ B;  3CC4 A;  1K83 H;  4DV3 Q;  4A3L H;  4DK6 C;  1SMX A;  2CWA A;  4DKA C;  3J7Z C;  1OXU A;  4OX9 L;  4YQD A;  3N4K A;  3L7Z C;  1YBY A;  1XMO Q;  4YVJ A;  5IY0 A;  3UDG A;  3GTO H;  2Z0Y A;  4HIO A;  4DV7 Q;  5C0X I;  1S40 A;  4DAY B;  3IEF A;  1FJG Q;  4X3M A;  4CND A;  4IPH A;  1VQL A;  4BY1 H;  1K0R A;  1VQI A;  3GTL H;  1E1O A;  2Q2H A;  2KHI A;  3UDF A;  4HJ8 A;  4JI0 Q;  1Q1E A;  1PH9 A;  4L5R C;  2V3J A;  4JAK A;  3K8A A;  3A5U A;  1TXY A;  1NJI C;  1QVG A;  1H95 A;  2OQ0 A;  3M85 A;  4A3E G;  2VS1 A;  2V3K A;  1YIJ A;  2E2H H;  5GQO A;  1UE5 A;  4JI3 L;  5ELN A;  4YWM A;  2ALY B;  2ES2 A;  2VQF Q;  2R93 H;  4X62 Q;  4JYA L;  5M5W H;  5IP7 G;  4A3C H;  1VQE A;  4PZK A;  3H0G G;  4DV2 L;  4B3M Q;  2IHE A;  3ICE A;  2K5V A;  4NXM Q;  2GVB A;  4HJ5 A;  3CPF A;  1TWF H;  4A3F H;  4BXX H;  2GN5 A;  3W5O A;  4LFC Q;  3EIV A;  4HIM A;  4GLX A;  2B63 H;  2NN6 G;  3ULJ A;  1HR0 W;  2JA7 G;  2CQO A;  4LFA Q;  4BA1 I;  1PA6 A;  3KJO A;  4YQO A;  4DAM A;  1PH5 A;  4AIM A;  3G48 A;  4A3K H;  4LF4 Q;  3WWV A;  2UXB Q;  1O6D A;  4BBS H;  4DR3 Q;  4HJ7 A;  2H5X A;  3GDE A;  4A3D H;  3S24 A;  1IXR A;  3KW2 A;  4YQI A;  4L69 A;  4IOC A;  5HY6 A;  3I2Z A;  4EQ5 A;  3CCQ A;  4AQY L;  4B3S L;  1AE3 A;  4H02 A;  1BBU A;  4BBR G;  1K73 C;  2OTL A;  5EAY A;  4X64 L;  2JA5 G;  1YNX A;  3K81 C;  4DV5 L;  1SRO A;  1XNQ L;  3PIO A;  4JWG A;  1TWA H;  4GS3 A;  2IX0 A;  1VHY A;  4JI5 L;  1T9H A;  3GD7 A;  1IBK Q;  1TWH H;  2UUC Q;  1G29 1;  2JA6 G;  1I6H H;  2XTI A;  2VY3 A;  2JQO A;  4YQ1 A;  3GTM H;  1WOC A;  4PMW A;  3DCM X;  1CKN B;  2VNU D;  3MXN B;  4YQ5 A;  1QZG A;  3CC2 A;  1SFO H;  1Z85 A;  2F4V L;  2LXK A;  1V43 A;  1QZH A;  2JK8 A;  3PF4 A;  2K75 A;  3TEH B;  3RNU A;  1XMQ L;  2VUM G;  4DR2 Q;  2N49 A;  1EOV A;  4YWL A;  4YPW A;  1KHI A;  1N34 Q;  3I7F A;  5GMB A;  3ONP A;  1UEB A;  3S1Q H;  4LF6 Q;  3E5Y A;  3IRB A;  4GKK Q;  4YQ2 A;  4A3G G;  3TQY A;  1K9M C;  3TS2 A;  5C0X G;  3H3V I;  2KCM A;  5JJI A;  4YWK A;  3L8U A;  3J80 c;  4DUY L;  1HNX Q;  4YQK A;  3ERS X;  5IWA L;  1P16 A;  4YHH Q;  4A3I H;  3HOX H;  3PUW A;  1HR0 Q;  3BU2 A;  3NEL A;  3CME A;  1HNZ Q;  1N36 Q;  4YQT A;  1PV4 A;  2HHH Q;  3OTO L;  4LF7 Q;  2YU9 H;  4OO1 I;  1KIX A;  1LUZ A;  4A3I G;  2I5H A;  3UE1 A;  1HNW Q;  3CCV A;  5JJL A;  1CUK A;  1OXV A;  5IYB G;  1GM5 A;  5M3M G;  2LSS A;  4YVI A;  3AQQ A;  4NXN L;  2NVT H;  3CQZ H;  1EFW A;  3PO2 H;  3W1G A;  3G71 A;  3M4P A;  3CCE A;  4JI7 Q;  1YEZ A;  1OTC A;  3S14 H;  5FJ8 G;  4J3C A;  2V1C C;  4IOA A;  4YQA A;  1W3S A;  4C3I H;  4E8B A;  4X3L A;  2IHF A;  3GYQ A;  1NMF A;  1WYD A;  1Z9F A;  1KAW A;  1YHQ A;  4DV1 Q;  2UUB L;  3HOZ G;  1O7I A;  2DUD A;  2R7Z H;  4JAL A;  4PZ6 A;  4J15 A;  1KXL A;  3S16 H;  1SE8 A;  5HGQ A;  1X55 A;  1IBM Q;  3KOJ A;  3I55 A;  2HQL A;  3D0F A;  4NB3 A;  1N33 Q;  4JWH A;  1Q8K A;  1W2B A;  4A3J H;  1PH8 A;  4JV5 L;  5BR8 Q;  2NVX H;  2LXJ A;  4A3B H;  3K0X A;  2MNA A;  1I5F A;  1PH6 A;  4JI8 Q;  4DR5 L;  4JG2 A;  1PH1 A;  1VHK A;  1MJE A;  3M4Q A;  1ASZ A;  1N32 Q;  1I94 Q;  4DV6 L;  4GKJ L;  3RZO H;  3A74 A;  3EBE A;  1PVO A;  4B3T L;  4JWF A;  1X56 A;  4OON A;  4OWX B;  1IBL L;  3HKS A;  4K0K Q;  1OY5 A;  3AIA A;  3KFU A;  2HIX A;  1VQO A;  3NEN A;  2Z0S A;  4WJ3 M;  3OYY A;  4IG6 A;  1PH2 A;  2EIF A;  2ASB A;  1M1K C;  1S3O A;  4QQB X;  2GVA A;  2E8G A;  4EX5 A;  4X65 L;  1ASY A;  1VQ6 A;  4DR4 L;  3UE0 A;  1YIT A;  4DR6 Q;  4DR7 Q;  3H3V H;  4FDB A;  5FLM H;  3DM3 A;  1J5E Q;  5D9F A;  3NK6 A;  3RLF A;  4OXP A;  2AMC B;  1VQK A;  1SR3 A;  2RHS B;  3HOV G;  1IYJ B;  4JCV E;  3D31 A;  3S2D H;  1YHA A;  3N4J A;  1P8L A;  4YCU A;  4KGN A;  4LF9 L;  3BZC A;  1SN8 A;  2Y0S E;  3CCS A;  4C3H H;  4DV4 L;  4LFB Q;  4H3Z A;  3U50 C;  4IO9 A;  3ULL A;  2VZA A;  1Y1W G;  4KHP L;  3E0E A;  1EIY B;  1X7O A;  1CSQ A;  1E3P A;  3BBH A;  1Q86 C;  5E7N A;  3BBD A;  3KF8 B;  4YQN A;  4A3L G;  3ILK A;  2R7D A;  3HKZ E;  1JB7 A;  3DLL A;  1UE6 A;  4B3R L;  3M3Y H;  1JJC B;  1WI5 A;  1XPR A;  4BY1 G;  4JI3 Q;  2KEN A;  4CNG A;  3JAM i;  3PIP A;  4JYA Q;  2JEB I;  2K4K A;  2ZTE A;  1VCI A;  1VQ9 A;  1V2X A;  4DV2 Q;  2QGQ A;  4DV3 L;  3HOY H;  3S1R H;  1VQ7 A;  4HJA A;  2VQE L;  3NEM A;  3PV0 A;  5CO4 A;  2WB1 E;  4X66 Q;  3BZK A;  3RZD H;  1XMO L;  1X54 A;  2UU9 L;  3PGZ A;  4GNX A;  1VQC A;  1Q81 C;  2R93 G;  2QMM A;  2NVQ H;  4DV7 L;  3CD6 A;  4R1J A;  3KDF B;  5H1S E;  1OXX K;  2QEX A;  1HR0 L;  4YPZ A;  4JI2 L;  1FL0 A;  3OIN A;  4JI0 L;  5AJ3 L;  1YHB A;  3K80 C;  3KF6 A;  4A3F G;  1PH4 A;  3S1M H;  4BXX G;  4R4Q A;  2B63 G;  1NXZ A;  1UAM A;  1TWG H;  4P73 A;  4QGU A;  3I56 A;  4B3S Q;  4AQY Q;  4X6A H;  3FKI H;  4GLV B;  4DUZ Q;  2VQF L;  4A3K G;  3S15 H;  4UY8 C;  1LTL A;  1V1Q A;  4DV5 Q;  4BBS G;  4YQ4 A;  1X65 A;  1QUQ A;  3PUX A;  2I5L X;  3PSI A;  1HH2 P;  4L5T A;  4DPG A;  1KC8 C;  2B3G A;  1JMC A;  4A3D G;  4P72 A;  2YYZ A;  4C2M H;  1VQG A;  2CX8 A;  4OWT B;  3TRE A;  5GAH C;  1L1O B;  4IJL A;  4LFC L;  5FLX c;  2KBN A;  1G51 A;  3I4M H;  2PI2 A;  4JC0 A;  1BKB A;  2UUA Q;  3KY7 A;  4P71 A;  4YPY A;  1UE7 A;  3M7N A;  4YQ6 A;  2F4V Q;  2UXB L;  4NPS A;  1XPU A;  1WCM H;  3MEF A;  1XPO A;  4A93 H;  2BA0 A;  1GKH A;  4BA2 I;  1KRS A;  4KDZ A;  1U0L A;  2D62 A;  4GOP B;  4YQS A;  1TWC H;  2Y0S G;  1Q46 A;  1MIU A;  3T1Y Q;  4JBK A;  2I6D A;  4YQ7 A;  2AWO A;  4Y7N H;  1L1O C;  5LMN L;  3I4N H;  3OII A;  5M3F H;  1E22 A;  1NMG A;  2E5L L;  4FMW A;  1K3R A;  4MCC A;  2E2I H;  2RCN A;  1CKO A;  1L2F A;  2MQH A;  1VQ4 A;  3GTK H;  5IWA Q;  1VQ8 A;  1NS5 A;  3NK7 A;  3G4S A;  4RMF A;  4FAK A;  1IBK L;  3HKZ G;  3UDI A;  4DV0 Q;  3TS0 A;  4GOP C;  4PG3 A;  3T1H Q;  3STB D;  1MJC A;  3OTO Q;  5IYD H;  1VQF A;  5M5Y H;  3AEV A;  1B70 B;  4YVH A;  3S2H H;  2YY8 A;  3BJU A;  3F8T A;  1LM0 A;  1EQQ A;  2R92 H;  1IZ6 A;  1JT8 A;  2F3I A;  3CAM A;  3HOX G;  3F2B A;  2ZTC A;  4DR1 L;  2OWO A;  3CXC A;  4YVG A;  3RR5 A;  1I50 H;  1PYS B;  1J6Q A;  1RL2 A;  1CKM A;  3RN2 A;  3FP9 A;  3STB C;  4POG A;  2WB1 G;  4YQ8 A;  3E9H A;  1LYL A;  3JC6 6;  4MZ9 A;  1E24 A;  2ZJQ A;  1AE2 A;  2VW9 A;  4JI1 Q;  1KQS A;  2UUB Q;  4GKK L;  1QVC A;  1UWV A;  3TRZ A;  3OIJ A;  4YQR A;  2HIV A;  3K7A H;  1YJN A;  2YV5 A;  3PO2 G;  2JA9 A;  2OCE A;  4YY3 Q;  2ZM6 L;  3ULP A;  4BY7 H;  4YHH L;  1XNR Q;  1Y1V H;  2ZTD A;  1I3Q H;  1HNX L;  5C4J H;  3CPW A;  1N36 L;  4JV5 Q;  1C0A A;  1E1T A;  2HHH L;  2JA8 H;  3JAM c;  1C9O A;  5IP9 H;  1KL9 A;  1CKN A;  5C44 H;  2F52 A;  2WFW A;  3U4Z A;  5IE8 A;  1A0I A;  4DR5 Q;  1VQM A;  2R7Z G;  4BY7 G;  2NVY H;  4CNF A;  1NBW A;  1HNW L;  2Z6K C;  3K7U C;  4P74 A;  1P9P A;  3A5Z B;  4LF8 L;  1VQ5 A;  4A3J G;  4LUO A;  3PO3 H;  1TO0 A;  5JEA J;  4B3T Q;  3M4O H;  3H15 A;  2ZJP A;  5ELO A;  1IBL Q;  4A3B G;  3GO5 A;  1J85 A;  3CCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...