4RG1A

Methyltransferase domain of c9orf114
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
Knots found
sequence length
306
structure length
285
Chain Sequence
RGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQACVQLARILQYLECPQYLRKAFFPKHLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLTQAGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human C9orf114 in complex with S-adenosyl-homocysteine
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords C9orf114
total genus 89
structure length 285
sequence length 306
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02598 Methyltrn_RNA_3 Putative RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4rg1A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4rg1A01
5C0XI 4YQAA 1CKOA 4JI6Q 4IOAA 2NZOA 1QUQB 4LF7Q 1X54A 5C0XG 4A3FG 1VQEA 2VZAA 1QUQA 2CQOA 1X3EA 1KL9A 2I5HA 4DR3L 1TWGH 3S2HH 2E8GA 3N4JA 2ZJQA 4A3LH 4LFCL 1VQ9A 4GKKL 1EQRA 1EOVA 1X9NA 1I94Q 1LUZA 3CW2C 4BBRG 3CCJA 2I6DA 3CCLA 2B63G 1Y1WG 1SMXA 2NVTH 1H95A 3JAMi 1Q81C 1PFSA 5GAGC 1VQ5A 1E7ZA 4GN5A 2YV5A 1KRTA 4LFAL 4NXML 4DR7Q 1HNXQ 1KAWA 2CKZB 4GNXB 5IWAL 3H3VI 4H3ZA 2MO0A 2UXDL 2R93H 4DAYB 4DV0Q 1KD1C 2KCTA 3CMEA 1VHKA 2R7FA 4QQBX 5FLMH 2E2IH 5K36G 4IJLA 3VDYA 1IBKL 1WFQA 1R9TH 1K8GA 4WJ3M 4YQTA 4DR1L 1Y1VH 2UU9L 3K0XA 5GM8A 3HOYH 4UPAA 4YY3Q 4A76A 2ES2A 2OQKA 1SR3A 3HKSA 2UUAL 2EGWA 4K0KL 3CC4A 4YQQA 2N49A 4BY7H 4DV7L 3KNUA 4AYBE 1PH8A 4X62Q 3AXZA 4MTNA 2R7ZG 5AJ3Q 3L7ZC 1X56A 1IPAA 1UAMA 3IC6A 2NVXH 4YCVA 4DV6Q 2ASBA 1YNXA 3Q8DA 3CC7A 2HIXA 3NENA 3JC66 2QEXA 2UXBL 3ILKA 5M5YH 4GOPC 1FVIA 3E9HA 2EXDA 4DR5Q 1HNZQ 1UEBA 3EN2A 2XGTA 1E1OA 4JI2Q 4DUZQ 4JI0L 3KFUA 1W3SA 2YYZA 2F4VL 1Q7YC 3I4NG 2L15A 2VQEL 4A75A 1BKBA 2CFMA 4DV2L 1VQCA 3S17H 1E1TA 1FJGL 3FP9A 2AKWB 1TWCH 4JI7Q 3I4MG 1WI5A 2PMZE 4BBSG 1IYJB 4NXNL 4L69A 5LMUL 4YQLA 4L5TA 3CCSA 3DCMX 5IYBH 3PGZA 4RMFA 3F2DA 3ULLA 4GNXA 3HOVH 5D9FA 1VQFA 1FJGQ 3OYYA 2HT1A 5JJIA 1Z85A 4C3JH 2CX8A 4KHPL 2CWAA 2RF4A 4KLKA 5C44G 3CPWA 2UXCQ 3NK6A 5FJ8H 4POFA 4CNGA 4HIMA 1PH6A 4DR1Q 1NJIC 2UU9Q 4LF4L 4GLAC 1SE8A 5IP7G 1YI2A 4A93G 5JJLA 1HZBA 3MEFA 4DR5L 2K50A 3PUWA 4UP9A 1IZ6A 3ZJYC 1N36Q 5BR8Q 4O2DA 4IPHA 4A4IA 1O7IA 4B3ML 1Z9FA 4DV4Q 2C35B 4LF5L 5GQOA 1PVOA 2CCZA 1MJEA 1HR0L 4P75A 1XJVA 4DR7L 1AE2A 4PG3A 4JBMA 4YQCA 2AWOA 1J85A 4ME3A 1K83H 1VHYA 1V1QA 3I55A 4B3MQ 1VQAA 1G6PA 3M4PA 2CWPA 1PH9A 3OIIA 1L1OC 2NVYH 3KJOA 2NN6G 4A3IG 2QA4A 1PYBA 4BY1H 3IRBA 4UP8A 4L5RC 4A93H 4YQRA 4JOIC 4EQ5A 3KTYA 1NS5A 1E24A 3RZDH 4YQ4A 4A3CG 1E22A 4DR3Q 1YJNA 1OXXK 1HH2P 4A3JH 4YQIA 4A3GG 2GVAA 4LFAQ 4A3KG 4OX9Q 4LWCA 1WCMH 4DV1L 2E5LQ 3OINA 4YWLA 4DR2L 3S1RH 4A3DG 4DV4L 1Q1EA 1D7QA 3OW2A 3PO3G 4DV5Q 4PZ8A 4X64L 4A3EG 4KHPQ 2UXCL 1I6HH 1CSQA 4LF9L 5CO4A 1SN8A 4GOPA 1B7YB 4YQ2A 2DGYA 2K4KA 2H5XA 3W1GA 1K73C 1X7OA 1C9OA 3RR5A 2PI2E 5C4XG 1PV4A 4MCDA 3PIOA 4K0KQ 3KYHC 3J81j 1HNZL 2JA6G 1BVSA 4A3JG 1Q1BA 1YZ6A 2PQAB 5JEAG 3KLWA 3E5YA 4JI6L 2YTVA 2IX0A 3UE1A 3BBHA 4HJ5A 5FAIA 3ERSX 4YCUA 4JI5L 4DV6L 5IY0A 3CP0A 2KCMA 2B63H 2R7ZH 1X3GA 2WB1E 5GAHC 1CKMA 2UUCL 4OONA 2OQ0A 1C0AA 3KF6B 4YPYA 4A3EH 5HGQA 4HIKA 1JB7A 2E2JH 3K8AA 5M3MG 4YY3L 1GZ0A 4YWMA 3AI9X 4YVGA 3H0GG 2N3SA 3GTKH 2F4VQ 2BA0A 4DV1Q 4FDBA 4DV7Q 3DM3A 1N32Q 2LXJA 1KIXA 1Q86C 4LF5Q 1P9PA 4YQ1A 4AQYQ 5JJKA 2R7DA 3UE0A 1SLJA 3KDFA 1N8RC 1WJJA 4JOIA 1VQPA 2VQFL 1T9HA 4CNFA 2V1CC 3HKZG 1A62A 4GKKQ 2IY5B 3STBD 4OO1I 4YQDA 3G4SA 4R4IA 4DV0L 3BZKA 1QVGA 4A3DH 3RLNA 4JBJA 3OIJA 1NTGA 1MKHA 1V6ZA 4CNEA 2Z0SA 4JAKA 3CCQA 1IL2A 2IHEA 3S2DH 3GTMH 4DV3L 3QUVA 4OWXB 4UP7A 2IT1A 3CD6A 3HOZH 1A8VA 2A19A 1YJWA 1K3RA 1VH0A 2HIVA 4IFDG 2BH2A 2JA8H 4ALPA 2RCNA 4X66L 4JV5L 4TQUS 3U4ZA 5IYDG 1EIFA 1V9PA 2K5VA 5C3EG 1X7PA 1NY4A 2VQFQ 1G51A 5IYCG 4X66Q 4PZ7A 2BA1A 1NE3A 1N33Q 4JV5Q 4JI3L 2FXQA 1BBWA 3J7ZC 4J15A 4DK3C 1N34L 2ZJPA 1B70B 3PUXA 3OTOL 2LSSA 2HHHL 4HIDA 2WP8J 1X6OA 1YHBA 2AMCB 1YVCA 3BU2A 4JI4Q 4NXNQ 4JI1Q 3LGJA 4DR6L 4A3CH 4IG6A 1RL2A 3U4VA 3CCMA 1S72A 1VQNA 2ID0A 3A5ZB 4GKJQ 3H15A 4YQPA 2D0PA 4XIGS 2VUMG 3HOXH 2VY3A 3PSIA 4JBKA 1PHJA 3PUZA 4JI8L 2JEAI 5IYDH 4MCCA 1UE1A 2EQSA 3BBEA 4YQ0A 4B3TL 2Y0SG 1FL0A 1IBLL 1X65A 2R6GA 3FKIG 3JAMc 3I2ZA 5IE8A 1HZCA 1FGUA 3RLOA 3CCVA 1XNQQ 1G291 4QL5A 1N33L 2AWNA 4GKJL 4KI0A 2UXDQ 3IEFA 3BBDA 2Q2HA 2R93G 1HNXL 4OWTB 5M5WH 1VQLA 3GTOH 3W5OA 4JI8Q 1EFWA 3HOWG 3S1QH 3J80i 3OTOQ 1YHQA 3I4NH 3SGIA 2A8VA 3I7FA 4JI1L 2OCEA 4YQNA 4YHHQ 3PO2G 3T1HL 4A3BG 1QZHA 4YQJA 4GN4B 4QIWE 3HOYG 1KHIA 2IX1A 4R4CA 2E5LL 4LNQA 2OTJA 1PH1A 1MJCA 3PF5A 3GTGH 4YPWA 4GLVB 4YVJA 4APVA 3L8UA 4A3LG 2V3JA 2VNUD 3O7BA 1KRSA 1X55A 2LXKA 3UDFA 3T1YQ 1HJPA 1PH7A 2K5NA 3A74A 2UUBL 4JI4L 3PV0A 1O6DA 4NXMQ 5GADC 3BZCA 3HKZE 2I0QA 1HNWL 4X6AH 4MNOA 1TWHH 4R1JA 4BA2I 4BXXH 2ZM6Q 1CKNA 4HJ8A 3AEVA 1VQGA 4DV5L 5C4JH 1GD7A 2GVBA 2VS1A 1VQIA 1Y1WH 3TREA 3PO2H 2ZJRA 2EIFA 2EGVA 4LUOA 2VUMH 3CMAA 1N9WA 5HY6A 3CCEA 4KHZA 3B6YA 2R92H 1Q12A 4NB3A 4HJ9A 4UY8C 2K14A 4YQBA 4YQ9A 3NEMA 1XNQL 3K81C 2K75A 5BR8L 4QGUA 1OXSC 2MQHA 2OWOA 5C0XJ 1J5EQ 4XTCS 1CUKA 3F1ZA 1QVCA 2YTYA 4YQ6A 2YTXA 4A3IH 1HZAA 1L1OB 1I94L 3TQYA 1MXIA 1E3PA 3T1HQ 1PA6A 5EAYA 3D31A 5IP7H 1A63A 1XTDA 1WCMG 1VQ6A 3F2BA 4J3CA 4C2MH 2JA7H 3CC2A 3K7UC 2NZHA 4DR4Q 3RNUA 2K52A 2MNAA 2ZTDA 4JC0A 2V3KA 4C3IH 4BY7G 4EX5A 1KQSA 1U0LA 1YJ9A 1SFOH 1P16A 4P73A 1N34Q 1HR0W 1I3QH 4IJHA 3U58A 2A1AA 1PYSB 2UUCQ 1XNRQ 1IXRA 3S24A 1VQDA 4BBRH 1XPRA 4Y7NH 3DLLA 4JI5Q 4WJ4A 2YY8A 4YVKA 1LM0A 2KENA 3M4OH 1UE6A 3S15H 1ASYA 1YEZA 1XPOA 1XMQQ 4QJFA 1VQMA 4P74A 3D0FA 1K0RA 1L2FA 2WB1G 1VQHA 4YVIA 2E2HH 3S1MH 4JYAQ 2MFIA 5GAEC 1AE3A 5FLXc 4LUZA 4GLXA 5M3MH 1AH9A 4A3FH 4A3KH 4B3SL 5IYBG 3H0GH 3U50C 4YQ5A 1VQ8A 3ULPA 1I5FA 2GN5A 3G48A 1OY5A 2JJQA 5IYCH 5IP9G 3CCUA 3HOUH 2JE6I 4H02A 5E7NA 3GTJH 4YVHA 1BBUA 4DPGA 4LF8Q 4IFDJ 1HR0Q 4LF6Q 1CKNB 1YBYA 3EBEA 1NMFA 1XNRL 4AIMA 1J5EL 3TS2A 1U5KA 4H3YA 1S3OA 3PF4A 5LMNL 3UDXA 2VL6A 5ELOA 1UWVA 3L2PA 3CXCA 4IO9A 4KDZA 4PZKA 1KC8C 3A0JA 4XBOA 5DLQE 3M9BA 2NVQH 4DV3Q 2KHIA 1V43A 3I4OA 2D62A 3RZOH 1Q46A 1TWAH 2ZTEA 4R4TA 4IOCA 2UUAQ 3K7AH 3KF6A 2RHQB 4P71A 3KF8B 3KOJA 3PUYA 3AIAA 5LMNW 1HZ9A 4JBWA 4YCWA 4IPDA 4FAKA 1WYDA 1C7YA 2Y0SE 3S16H 1HNWQ 1L1OA 3F8TA 4JYAL 1Y1VG 3F2CA 2WFWA 4BXXG 1VQ7A 1JMCA 1YIJA 4A3GH 1IBML 1B8AA 4JI7L 4HJ7A 2IHFA 2Q2TA 4YQSA 2BH8A 4RG1A 1N36L 4YQGA 5M5XH 1Q8KA 3CQZH 2JA8G 3AYHB 3GDEA 1VQOA 2HQLA 4B3SQ 4DAMA 3N4KA 4LF8L 5GMBA 2AHOB 4LF4Q 4A3MH 4E8BA 4GOPB 2R92G 1MIUA 2JA5H 1X3FA 4QY7A 1QZGA 2QGQA 2Z6KA 3MXNB 2KBNA 3G6EA 4DV2Q 1JJ2A 2B3GA 3L0OA 3CF5A 3M3YH 2ALYB 4LF6L 3AFPA 2F3IA 3KDFB 5AJ3L 5LMUQ 4DR2Q 1K9MC 4POGA 2MO1A 1TXYA 3PCOB 1D8LA 1JT8A 1UAJA 4CNDA 4KGNA 3BJUA 3CPFA 4GNXC 3RN2A 2RHSB 1S40A 3GYQA 1LYLA 5GMCA 1PH3A 2I5LX 3FKIH 1IBMQ 4OO1G 2WAQE 3STBC 4DUZL 2I5MX 1OXVA 1RIPA 4LF9Q 2Q2UA 3GD7A 2JEBI 1TWFH 2Z6KC 4AYBG 1Q82C 3W1BA 4OWWB 3GTQH 1OXTA 2HA8A 1L0WA 4BY1G 5C3EH 3UDIA 5FLMG 5IT9c 4DUYL 1K8AC 3NK7A 3HOVG 1A0IA 2VQEQ 3HOWH 3ONPA 1WOCA 5C44H 4NPSA 3EIVA 3WWVA 5ELNA 4AH6A 3UDGA 1YITA 1EQQA 1PH4A 4OX9L 1I50H 4YWKA 1VQJA 4DKAC 1KXLA 2Q2IA 3M85A 1GM5A 3TS0A 1Z47A 3RLFA 3TRZA 2PI2A 4YPZA 3HFZB 3RN5A 5LMNQ 1TO0A 2JA9A 4X65Q 1M1KC 1IBKQ 1VQBA 3E0EA 3CAMA 4TVAB 2JA7G 3G71A 2F52A 3KW2A 1ZJRA 1CSPA 4P72A 4X62L 4LFCQ 3NELA 4YQKA 2B29A 4YQOA 1P8LA 4O0AA 3I56A 3CCRA 2JA5G 1UAKA 3J81i 5IP9H 1QVFA 3GTLH 1GO3E 1LTLA 3HOUG 2ZM6L 2JA6H 1EIYB 1VQKA 1VCIA 1YHAA 4LUVA 3S14H 1UE5A 3GO5A 3ER0A 1OXUA 2K5HA 2PNHA 4GN3B 4HIOA 4JG2A 2YU9H 1JE5A 5GROA 4YQ7A 1XMQL 4L5SA 3J81c 2QWVA 1EUJA 1NMGA 4LF7L 4IFDI 2QMMA 2Z0YA 4YQ8A 4DK6C 3J80c 3TEHB 4HJAA 2WAQG 3T1YL 2UUBQ 3PIPA 4LW1A 2NN6I 4JI0Q 4X65L 4L5QA 4OXPA 5FJ8G 4BA1I 1JJCB 2DUDA 4MZ9A 3KJPA 3J7A5 4YHHL 1J6QA 1DGSA 3AQQA 1OTCA 4AQYL 3H3VH 4B3RQ 4IPGA 1XPUA 5M3FH 1IBLQ 1VS0A 2UXBQ 2PQAA 3K80C 1PH5A 1N32L 5C4XH 1NXZA 3ICEA 4LFBL 1SRUA 4JALA 3NBHB 5H1SE 1EYGA 1UALA 1W2BA 2N78A 4JCVE 1VQ4A 2O3AA 3I4MH 4BBSH 4Y52H 1SROA 2D0OA 1M90C 1UE7A 2N8NA 3AFQA 5J3BA 2ZTCA 4R4QA 4LFBQ 1GVPA 3E9IA 3HOXG 4PZ6A 4B3TQ 4R4OA 4JI2L 4DNIA 4A3MG 1Y14B 3FHWA 1PH2A 2JQOA 2OTLA 4X3LA 1XMOQ 3M4QA 1NBWA 3KY7A 3PUVA 1ASZA 3GTPH 4YQ3A 5JEAJ 4GS3A 1XMOL 5M3FG 3HOZG 4C3HH 2JK8A 2ATWA 5IWAQ 4X3MA 1EWIA 3PO3H 1JJGA 4PMWA 3S1NH 4DR4L 2HHHQ 4YPXA 3M7NA 4IPCA 4MCBA 4DUYQ 1GKHA 4A3BH 2XTIA 3ULJA 4X64Q 4DR6Q 4B3RL 3A5UA 4JI3Q 2VW9A 1V2XA 2KHJA
chains in the Genus database with same CATH superfamily
4ZUJA 5C0XI 1ZKOA 4FXGC 4JI6Q 4IOAA 4A3FG 2NB0A 1VQEA 2ZJQA 3EQLC 4A3LH 4GKKL 3I90A 4PMCA 1SE4A 4G4KA 5D3IB 4BBRG 2R92B 3SHLA 2WKDA 1Y8NB 1SMXA 2F0MA 1Q81C 3PO2B 4DR7Q 4NXML 3U9SA 2YV5A 4LFAL 5C4JB 1HNXQ 4P2CB 1STYA 2LS01 1KD1C 1VHKA 1MSGA 4X3UA 1PZKD 1HPCA 1IBKL 1WFQA 4WJ3M 5IT9L 1SJED 4K8JA 5GM8A 4UPAA 4A76A 3HKSA 2IL8A 1A6XA 2VB3X 4G7OC 3KNUA 5CORA 4AYBE 1JORA 3AXZA 4MTNA 2R7ZG 3L7ZC 4DFAA 2ASBA 3N52A 3Q8DA 4RWSC 2HIXA 1HCZA 2UXBL 3ILKA 1QG7A 1EEID 4CGYB 2EXDA 5M9OA 5C4XB 5BN3A 1GHJA 4C3JB 4JI0L 1D1IA 1W3SA 1JWSD 2F4VL 3L3OC 1BKBA 2CFMA 4DV2L 1VQCA 1E1TA 3FP9A 4JI7Q 4ZK9B 4BBSG 1I4QA 4YQLA 3S17B 1SE3A 1QJOA 3DCMX 4RMFA 3C46A 1MHWC 3HOVH 1FJGQ 1TS2A 2F0NA 3ITPA 2CWAA 4POFA 4LMQD 1QNKA 1UEAB 4KN7C 2TMPA 4ZQ3A 4LF4L 4GLAC 1HUNA 2F0WA 4DGZA 4O2DA 4IPHA 1VF7A 1BQQT 4C3IG 3D6CA 1PTOB 2QW7A 1MJEA 4DR7L 5HURA 1AE2A 1Y1VB 2JA8B 2AWOA 1ENFA 1J85A 1K83H 2AQ1B 1VHYA 1V1QA 1U4PA 3I55A 1G6PA 3M4PA 3KLRA 1HFGA 1L1OC 5E4XA 1EQVA 1A3VA 1E24A 1QILA 4YQ4A 4A3CG 4ZYSA 1F2LA 1HH2P 2QCPX 1SMYD 3K5OA 2GVAA 1EWCA 4UHVA 1ESRA 1JR0D 4OX9Q 1WCMH 2E5LQ 1LTID 1E2VA 4DV4L 2V4DA 1D7QA 3OW2A 1B44D 2UXCL 1I6HH 2KECA 3F2UA 1K73C 1X7OA 3RR5A 2PI2E 1JQYD 5E4WC 4MCDA 4Q0FA 1I4GA 5FOBB 1BVSA 1Q1BA 1B3AA 1YZ6A 2RCFA 3KLWA 4C1NK 4C1NI 4JI6L 1HXYD 2YTVA 3HOXB 5KGUA 3ERSX 4JI5L 4DV6L 2Z9HA 5IY0A 2WB1E 5GAHC 3NUCA 4OONA 2OQ0A 1VDZA 1C0AA 4K5VA 3M7GA 3H3VC 4HIKA 2E2JH 3K8AA 4YWMA 1BCPB 2N3SA 2JXMB 3DM3A 1Q86C 4WFN3 4YQ1A 5JJKA 2R7DA 5TSSA 1PDQA 1I4RA 1WJJA 1SBBB 2VQFL 1LTBD 4GKKQ 1D5MC 1NR4A 2HQEA 3G4SA 3BZKA 5IOCA 1XWEA 3RLNA 1LT5D 1MKHA 1V6ZA 4V190 1H9KA 1IL2A 4OO1H 3S2DH 1L0XB 3QUVA 2L5TA 4UP7A 3CD6A 2BE5D 4ALPA 2M9VA 5C3EG 1X7PA 2KEEA 4M8AA 5IYCG 4PZ7A 1TS4A 2FXQA 1BBWA 2DNEA 1N34L 1B70B 2PYKA 2B2UA 2EYPA 2WP8J 1CT1D 1U4LA 4JI1Q 1GUNA 1RL2A 4DA2A 5HGTA 2ID0A 3OOCA 2JEAI 3IAYA 1LACA 3IFTA 2EXZA 2NYZD 4B9XA 3FKIG 2CH4W 3VYTA 2J4XA 2UXDQ 3BBDA 4IZ8A 4O1NA 4OWTB 2F0IA 3GTOH 4JVZA 1TWFB 3A55A 3GTQB 4MHEA 1EFWA 4JWJA 3S1QH 3J80i 2EYHA 3FKIB 3K0YA 3OMCA 2A8VA 4YQNA 3LWEA 3PO2G 5I9PA 4YQJA 3HOYG 4QIWE 5L37A 3C1FA 2Z4HA 1SYFA 3PF5A 4GLVB 3O7BA 3SK4A 2B2UC 2LXKA 2UUBL 2K5NA 4XT1B 1O6DA 3BZCA 3Q6SA 4DV5L 1R4PB 1VQIA 2PPBC 3TREA 3HGBA 2EIFA 2KHSA 4LUOA 3CMAA 4KHZA 2EPBA 1WTPA 1PTOC 3J80E 1B50A 1UUPA 2K28A 5J39A 2RDHA 2OWOA 3FPUB 1CZGA 4XTCS 2FMCA 3OWEB 2NN6H 1HZAA 4U68A 3D8GA 5ELEA 1JOQA 4R8IA 2P5ZX 3D31A 4IFDH 1RKNA 3NQTA 5J22A 3F2BA 4C2MH 5EKLA 2NZHA 4ZUIA 2N88A 2V3KA 1B53A 1VF5C 4FYDA 1KQSA 1II3A 1SFOH 1P16A 3GTJB 4C3HG 1PYSB 2UUCQ 1CK1A 4JI5Q 2YY8A 1BXTA 1LM0A 2KENA 2PQEA 5T1GA 1XMQQ 4YVIA 1VQHA 3NBIA 1AE3A 5FLXc 1VMCA 4LUZA 4GLXA 1AH9A 4A3FH 4A3KH 2L55A 3H0GH 1ILQA 1IHZA 3K59A 1I5FA 3HEJA 2SOBA 2JJQA 3CCUA 3HOUH 2EYFA 1PRTF 4LF8Q 4IFDJ 4MTKA 1GUOA 5LMNL 1MSHA 4KDZA 1UWVA 1ZYRC 1KC8C 4XBOA 2K5WA 2F0FA 3CKIB 1WTRA 3RZOH 2A69C 4IOCA 1TWAH 3A54A 3I4LA 4P71A 3KF8B 4YCWA 1SAPA 4IPDA 3S2HB 3S16H 4RHSA 1HNWQ 2PW5A 1A3UA 3F2CA 2WFWA 4IALA 2PCFB 1VQ7A 4BXXG 4A3GH 1IBML 2Q2TA 2BH8A 1Q8KA 3CQZH 3MWYW 4DAMA 1F2ZA 2F0JA 4LF4Q 4A3MH 4GOPB 3SVMA 2NBFA 1T5XD 4ABNA 1I50B 3MAQA 2QGQA 2Z6KA 1SYCA 2B8GA 4PMBA 5AJ3L 1FYCA 3HZXA 4DR2Q 2L11A 4POGA 3GTGB 5EKKA 1JT8A 1UAJA 3BJUA 3GYQA 3S1RB 5GMCA 2A69D 1AW7A 1S4ZA 4G7ZC 1B2TA 4KD4A 2JEBI 1TWFH 4EQPA 3GTQH 3GTOB 2I46A 2HA8A 4DUYL 5IT9c 2OT2A 1K8AC 1HUMA 4V0BA 2VQEQ 3ONPA 2NVYB 5C44H 5FK9C 3UDGA 1I94Q 2C5CA 4AH6A 4OX9L 1A15A 1WTHA 1Z6HA 3TRZA 1Z47A 1LT6D 3PIP3 3EJIA 1Y8PB 1M1KC 3E0EA 2K01A 3CQZB 2JA7G 3G71A 1D1KA 4LFCQ 3NELA 1FD7D 2F0DA 5IGFA 4O0AA 2A6HC 3P20A 5C5LA 4HEDA 4X3KA 3E3XA 5IP9H 1QVFA 3I70A 1LTLA 3FDTA 1VCIA 4ZAIA 3BDCA 1WTWA 4NW2A 3K7AB 3ER0A 5CBAE 5JVH3 4HIOA 2Z1CA 4F88A 3J81c 4QB4A 4KY6A 1NMGA 2QMMA 2F0PA 4YQ8A 3T1YL 1KLUD 2KA7A 4X65L 4OXPA 4JI0Q 3L9AX 5D65A 4YHHL 1J6QA 3E6ZX 1VS0A 3K80C 3HOUB 4KK7A 1KTKA 1K28A 4KY7A 5A2QL 3TDQA 3NBHB 5H1SE 4A3KB 1EYGA 2O3AA 2F0KA 2KOLA 2IJ0A 4IUVA 2MP1A 3AFQA 5CV4A 1U9RA 4DK0A 4JI2L 2OTLA 1SYBA 4C3JG 4CDEC 4IUPA 1IYVA 3SEBA 3KY7A 3ND8A 3M3YB 2F0QA 1TY0A 2ATWA 5I6WA 4X3MA 1EWIA 2QF7A 4HR7B 4YPXA 2HHHQ 2B2YA 2R7ZB 4MCBA 4DUYQ 1GKHA 1WD1A 4LF9L 3TZUA 2PW7A 4NMZA 3OPOA 2NZOA 4LF7Q 1X54A 1DYQA 1QUQA 3A7AB 1X3EA 1KL9A 3N4JA 2E8GA 4LFCL 1VQ9A 3J7AF 3NWSA 1X9NA 3RZOB 1LUZA 3CW2C 3KBXA 2I6DA 1Q3LA 3CCLA 2B63G 4UAIA 1KLGD 1CQVA 1PFSA 1U4MA 1KRTA 1BCPC 4GNXB 1EY9A 3Q23A 3H3VI 4H3ZA 2MO0A 2R93H 4DAYB 1R4QB 3S1NB 4DV0Q 5K36G 4IJLA 3QJYA 4L63B 1K8GA 2CH4A 1Y1VH 3K0XA 4YY3Q 2UUAL 4BY7H 4J6HA 3SK6A 5AJ3Q 1SNPA 1YNXA 2O2LD 3JC66 2BDNA 4GOPC 1FVIA 3J7YW 1HNZQ 4JI2Q 1E1OA 1HRJA 3KFUA 2AQ3B 5A2QE 3P7JA 5FKAC 1SNOA 1TWCH 1YNND 2AKWB 1WI5A 1CQFA 3MXUA 3I4MG 4L69A 3PQIA 2J7ZA 3H91A 4JK1C 2F4IA 2OEOA 2L12A 4GNXA 5D9FA 1VQFA 1JICA 4A3IB 5JJIA 2UXCQ 2RF4A 3NK6A 1G91A 1TVXA 3MFGA 5IODA 5FJ8H 3X3MA 2NTSA 5KNDA 4HIMA 4JWHA 1NJIC 1HFNA 4MIUA 1SE8A 1YI2A 3GQBA 1EIHA 4DR5L 2K50A 2KVMA 5JEAH 3BDLA 4B3ML 1Z9FA 1CI3M 4DV4Q 1Y1WB 4JBMA 3VYRA 4IN3A 4ME3A 1S5BD 3NTHA 1VQAA 2XWJB 2CWPA 1PH9A 5C44B 1O7YA 2L0CA 3KJOA 2NN6G 1C48A 4YQRA 1TIID 3IRBA 5JPMC 3TN2A 3RZDH 4DR3Q 1OXXK 3DWQA 3BVGA 4CDFC 4YQIA 4A3GG 3J81L 2F0VA 4KV6A 4LWCA 2L1BA 2B2VA 4YWLA 1NR2A 2WINB 1Q1EA 2H1EA 2MJ8A 4ULLA 4JWGA 3PO3G 2F1MA 4A3EG 3EFXD 3P75A 3D3RA 1CSQA 1SN8A 1RCVD 4IUUA 1B7YB 1V1PA 2DGYA 2K4KA 2H5XA 2EJMA 1C9OA 2WAQB 1X3PA 2K33A 4K0KQ 3KYHC 3J81j 1HNZL 5JEAG 4A3MB 2B63B 3GV3A 1YNJC 4YCUA 3I72A 4K6DA 3FEWX 4YPYA 5HGQA 5M3MG 3AI9X 5A35A 4YVGA 1H9SB 2F4VQ 2BA0A 1N32Q 1KIXA 4LF5Q 1IL8A 1QOHA 1WCMB 1N8RC 4AYBB 2NVQB 2I07B 2NTTA 2XNAC 4LAAA 1KABA 3NP8A 1T9HA 3HKZG 4ILWA 2IY5B 5IGEA 4OO1I 4TKOB 3ONAB 2E2DC 4DV0L 1D5XC 1QVGA 4H44C 5J1ZA 1NTGA 2NUCA 4L6TB 5E1FA 3HOZH 1A8VA 1K83B 1YJWA 1K3RA 2HIVA 1HA6A 4A3FB 4JV5L 3U4ZA 1RTNA 5IYDG 5D14A 1EIFA 1STEA 1V9PA 4K2LA 3ND9A 2VQFQ 4X66Q 2BA1A 2JA6B 1RJTA 2C9OA 4J15A 5DM73 4KD3A 2ZJPA 2RQXA 3C2PA 2LSSA 2HHHL 4HIDA 1X6OA 1YVCA 4QUFA 1SFOB 1HTLD 1VQNA 3QWNA 2X6GA 4BWGB 3H15A 4C3IB 1DOLA 4MCCA 1JB3A 4DK1A 1DD2A 1WTQA 2NZ1D 1FL0A 4DAPA 5IE8A 3RLOA 1O78A 1G291 2AWNA 3E5SA 4KJNA 5EBDA 1VQLA 3W5OA 1X32A 3HOWG 1W6JA 3OTOQ 4J8QA 3ZYYX 4TSSA 4RCOA 2K32A 4JI1L 2OCEA 4YHHQ 4RGOS 2F0SA 2EY1A 3SR1A 1KHIA 2F03A 2IX1A 2E5LL 4LNQA 1G2TA 1MJCA 4H0LC 3KK7A 1EIGA 1CFMA 2SDFA 1X55A 3T1YQ 2KCCA 1HJPA 3PV0A 4X6AH 1G2SA 4BA2I 2XVSA 5C4JH 2LKVA 1AZQA 3PO2H 2ZJRA 1O7LA 2NVTB 5HY6A 2F0LA 4KKUA 3KLSA 3IL8A 2O5IC 4OIKA 1ZEQX 2EE1A 4UY8C 2KQ3A 3S1QB 1ESFA 1RDPD 3NEMA 1FNVA 2K75A 5F2DA 5BR8L 1OXSC 3QR8A 3AU7A 5KNBA 2A68D 4HAEA 5FLXE 1I94L 1MXIA 3T1HQ 1SSOA 5IP7H 2GA4B 4G7HC 1EQTA 1H9JA 4H7BA 4BY7G 1YJ9A 1N34Q 1I3QH 1PZID 2A1AA 1WTOA 1PFNA 1VQDA 4BBRH 3FRPB 4WJ4A 5CGKA 4QIWB 5KYIA 1B9NA 3M4OH 1EYCA 3S15H 1ASYA 1KDCA 1PFBA 4QJFA 4P74A 2WB1G 3S15B 1EY5A 1SYDA 2M2LA 2Q8TA 4R8NA 2PZTA 4DAVA 4BBRB 4ZKBB 1VQ8A 3K5NA 2GN5A 5IYCH 1VMPA 2KCNA 4H02A 1O80A 5CV8A 3S2DB 3A8KE 1HR0Q 1YBYA 3EBEA 4F7XA 4AIMA 3TS2A 2CHBD 2E75C 4H3YA 1AEXA 1EY7A 1SDFA 2VXWA 2B2VC 5I2XA 5ELDA 3OW7A 3NSWA 2KHIA 2AQ2B 1V43A 2K6AA 3I4OA 1ILPA 4ME5A 1Q46A 4R4TA 2UUAQ 5KNCA 3NE5B 2F0HA 3S14B 3KF6A 3PUYA 1UNSA 1V1OA 1IW7C 1STHA 3KOJA 4JBWA 1DXMA 2Q8RE 5K36H 2ZT9C 1Y1VG 3DUZA 3KBGA 2R3ZA 4A3EB 1JMCA 1B8AA 1E0BA 4PNYA 4RG1A 5CR3A 1N36L 1SNCA 2G9DA 3GDEA 3TSSA 1VQOA 2K7VA 3T51B 4B3SQ 4LF8L 1CHQD 4FP5D 4KHVA 2PZWA 1TWHB 3BVMA 2R92G 1X3FA 2WIIB 1QZGA 4IUTA 3MXNB 3AMUA 4IUQA 3TMEA 2B3GA 3L0OA 3CF5A 3AFPA 1X3QA 4X3TA 5LMUQ 2MO1A 3BG3A 4RGTA 2B8FA 3PCOB 1KDBA 1PZJD 2HUGA 4GNXC 2RHSB 5LL6S 1H9SA 3J81E 4OO1G 1OXVA 1IKMA 2MHVA 1ZYRD 2Q2UA 3V2TA 1Q82C 4OWWB 3W1BA 1OXTA 1L0WA 3CU7A 4H13C 3UDIA 5FLMG 3GP7A 4RAUC 2E74C 2RA4A 5M3FB 3HOVG 1A0IA 1ICWA 4RCNA 4ZCKA 1PH4A 3WWVA 1EQQA 5ELNA 1YITA 2EOTA 2H4OA 3VYUA 1KXLA 3R2TA 3TS0A 2PI2A 5I6YA 3DMUA 3HFZB 1EU4A 4K14A 1B9MA 1V1PB 4X65Q 5T1IA 3CAMA 2MPMA 4ZLTF 3DWPA 2F52A 2BCOA 3NK9A 1CSPA 4P72A 1ZJRA 4YQKA 2B29A 4XQJA 2EYJA 4K5WA 3CCRA 5I9OA 1GUSA 3GTLH 1HQMC 2ZM6L 2F0TA 3S14H 1UE5A 1OXUA 2DNCA 2K5HA 1RODA 4GN3B 4JG2A 2YU9H 1JE5A 5GROA 4YQ7A 1XMQL 1EUJA 3V05A 1Y69U 2Z0YA 3SXHA 3H6MA 4CKBA 3J80c 3TEHB 3PIPA 3BYYB 4HTHA 3PO3H 4L5QA 3J80L 3SK5A 1AP0A 2DUDA 3KJPA 2AUKA 1DGSA 1KDAA 3HOWB 1XPUA 5M3FH 2UXBQ 3A56A 4DNTB 3I8ZA 4MN3A 4CBVA 1W2BA 1VQ4A 4IURA 4BBSH 1PYWD 1SROA 2E2HB 3MTSA 1UE7A 4LFBQ 1GVPA 5C5MA 4DNIA 3FHWA 3M4OB 1HTPA 1XMOQ 3PUVA 4YQ3A 1XMOL 2NWGA 2JK8A 3MFYA 1TR5A 1STNA 4RKBA 3D4DA 5COYA 3M7NA 4IPCA 4XXEA 4ZRZA 4A3BH 1KNEA 1S5DD 4DR6Q 1Q8IA 1V2XA 4L8JA 4YQAA 1CKOA 1IW7D 2HCIA 5EPKA 4DR3L 5KIXA 2DJFC 2FINB 4HSVA 2EYOA 4PQXA 3T56B 5FO9B 3LNNA 2QEJC 4RGNA 1EOVA 2D5DA 3J7AV 1YNJD 1NNXA 3CCJA 5EPJA 1DJRD 2ZXRA 1Z7TA 2NVTH 1H95A 3JAMi 1VQ5A 5GAGC 1JWUD 1E7ZA 2CW0D 1KAWA 1XX8A 2CKZB 3FMCA 1MBYA 3CMEA 4I65A 2R7FA 4QQBX 3W2DA 4RFBA 1F2MA 1R9TH 3T53B 2N55A 4EQNA 3HOYH 2ES2A 4X3SA 2OQKA 4YQQA 3SDZA 3CC4A 2N49A 5K5PA 4DV7L 1PH8A 4X62Q 1X56A 1IPAA 1UAMA 1E2WA 4BBSB 4YCVA 1GJXA 3CC7A 2QEXA 4KN4C 3T16A 5CBEE 4DR5Q 1UEBA 2SNMA 3EN2A 4FF3A 1O7ZA 2EZVA 2YYZA 3H09A 1EEFD 3PO3B 1FJGL 2PMZE 1CM9A 2ENBA 1DCZA 3FPPA 5EKIA 4L5TA 5IYBH 3PGZA 3F2DA 1PRTD 1UAPA 3VR4A 1V8QA 3OYYA 2HT1A 2CX8A 2EYLA 1MGSA 4RHRA 4IQZA 4CNGA 3SK8A 4ZKCB 2KJXA 2AUJD 4DR1Q 2UU9Q 3CRLC 2PO4A 3K6OA 4QCLA 5M5YB 3R2IA 2EJGC 4A93G 1ET6A 3PUWA 1ET9A 4UP9A 1IZ6A 1N36Q 5BR8Q 2BDOA 3DM1A 2VUMB 2B2WA 1CTMA 3KLSX 3O13A 1PVOA 2CCZA 4FF1A 1MI2A 1XJVA 3NTKA 4YQCA 1RF2D 4F87A 1SNQA 3HOZB 1EZ8A 1E2ZA 2XSCA 2R93B 1TS3A 4BY1H 4XDXA 4EQ5A 1NS5A 5JVG3 1LT3D 4A3JH 2F3WA 1EL0A 2O4XA 5I4DA 4LFAQ 4A3KG 1ML0D 4DV1L 3G6JB 2JSOA 3MXNA 4KHPQ 4DV5Q 4XQNA 4X64L 5CO4A 3VA5A 4YQ2A 2WACA 1GHKA 1CA5A 3HKZB 1PV4A 3WOFA 2JA6G 1GUTA 3E5YA 2PZUA 1NCVA 3TP8A 4HJ5A 2B63H 2L9HA 2R7ZH 1X3GA 1CKMA 2UUCL 3BYTB 3KF6B 2K05A 4A3EH 3X3NA 1SYGA 1C8CA 1I4PA 4YY3L 1GZ0A 3H0GG 3GTKH 4FDBA 2LXJA 3WDNA 2G5DA 4AQYQ 3UE0A 1C4QA 4UDUC 1VQPA 1SYEA 1ENCA 3LWUA 3K5LA 4CNFA 4YQDA 3STBD 4R4IA 4JBJA 1F9PA 3OIJA 1STAA 4A93B 4CNEA 2X69A 4DV3L 4OWXB 4A3DB 3SE0A 4IFDG 3H94A 2RCNA 2XRQD 4Z9CB 3UI2A 2XN9C 4IUNA 2DY8A 1NY4A 2EY6A 3NHHA 1N33Q 3MC0B 2JN4A 1FNUA 4N9PA 1PRTB 1FGBD 5FLXL 3J7ZC 5NUCA 4DK3C 3OTOL 1PXUA 1YHBA 1LLRD 3LGJA 4DR6L 1PFMA 4A3CH 4YVJA 3U4VA 3T13A 4YQPA 2CQAA 3A5ZB 4XIGS 2VY3A 1SNDA 5IYDH 1PHJA 1UE1A 2EQSA 3BBEA 1TWCB 2X6LA 4YQ0A 3A8IE 3OSOA 1I4HA 4EQOA 3OHXC 4B9WA 3JAMc 4CDDC 3CCVA 5AFWA 5KRUA 2EDGA 4KJOA 3IEFA 2A6HD 4KI0A 4CJ1B 2Q2HA 3DWAA 5M5WH 4O42A 1F77A 2Y0SB 4NKLA 2ICEC 4EVOA 3TBIB 1YHQA 3I4NH 4HCSA 3LX0A 3T1HL 4A3BG 4GZYC 1QZHA 1RTOA 2A6ED 2D9UA 4GN4B 4XT3B 4R4CA 2HDMA 3RZDB 5DM63 3GTGH 1YNNC 2IW3A 1KRSA 2HDLA 4JI4L 3UDFA 1PH7A 3A74A 4OHJA 4NXMQ 5GADC 4MNOA 4BXXH 1CKNA 4HJ8A 3K57A 3AEVA 1Y1WH 2GVBA 2VS1A 2K03A 3MXPA 2EGVA 1N9WA 1BNZA 1OO9B 3CCEA 4A3GB 2G9HD 2R61A 3B6YA 4QF4A 1GXDC 4NB3A 3QG1A 4HJ9A 3S16B 1XNQL 4QGUA 2MQHA 1J5EQ 2O5JC 1Y8OB 4YQ6A 1TWAB 1WVLA 2YTXA 4A3IH 1HA5A 1L1OB 3TQYA 4G57A 1E3PA 5DNFA 1PA6A 1BBXC 5EAYA 1WCMG 4CJ2C 1VQ6A 3QB3A 3K7UC 3RNUA 2ZTDA 4C3IH 4EX5A 1B1ZA 1U0LA 3M4YA 4IJHA 4RH6A 3K58A 1XNRQ 1IXRA 1JOKA 2QDLA 1TU2B 3S1MB 3RD4A 1YEZA 1H9RA 4BY7B 2F0GA 1EFID 1L2FA 3D0FA 5IGGA 1SXTA 3S1MH 4JYAQ 2MFIA 5GAEC 3V96A 5IYBG 4B3SL 4M1UB 3U50C 3ULPA 3I91A 2Z6BA 5IP9G 3GTMB 2JE6I 5E7NA 1DZ1A 2CW0C 3GTJH 3PIO3 4YVHA 1BBUA 4DPGA 4CJ0B 2SNSA 3MA2B 1J8IA 1U5KA 1TY2A 5ELOA 5CC4A 1W6KA 4R9WA 2BOSA 2NVQH 4DV3Q 1CHPD 2EJFC 3D4RA 3R3OA 3U9OA 3K7AH 3E0JA 1G6ZA 3AIAA 4FAKA 2KEDA 5LMNW 5ELFA 1WYDA 1C7YA 1K3BC 3DEPA 1L1OA 3F8TA 2HD3A 1YIJA 4JI7L 2IHFA 4K8IA 3HG9A 4YQSA 5M5XH 3HS0C 2JA8G 3AYHB 1IYUA 2IX3A 3RMHA 4QUCA 2QKIC 5GMBA 2B2WC 2AHOB 1XYIA 4E8BA 1SMYC 1MIUA 2JA5H 5CV7A 4QY7A 1F2YA 4FF2A 1IKLA 1TQOA 4DV2Q 3M3YH 4J1MA 2ALYB 5JOBA 4LF6L 2F3IA 2PMZB 1K9MC 5C3EB 1TXYA 4CNDA 1D8LA 4FXKC 3GV6A 3RN2A 1S40A 3MHBA 1LTGD 1NAPA 3FKIH 3STBC 4DUZL 1RIPA 4PV1C 4LF9Q 1HHVA 1TS5A 3GD7A 4AYBG 5CV6A 2PNRC 3JAML 5C3EH 1G8ZD 5IGDA 3NK7A 4JPBW 2IPKD 4C56C 2QDBA 4NPSA 3EIVA 1I50H 4YWKA 4DKAC 4OEMB 2JA5B 2MGSA 3RN5A 5LMNQ 1TO0A 2JA9A 1IBKQ 1H9MA 5M5XB 4X62L 1F9QA 1EY4A 1P8LA 3QOJA 1JE4A 3C1EA 1PMRA 2JA5G 1I6VC 3HOUG 1GO3E 4YIJA 4FO2A 1VQKA 1SE2A 1YHAA 3TZDA 2K5QA 3GO5A 3D6WA 4HCEA 2Z8LA 5DAUA 3N6RA 5C3WA 4IFDI 2WB1B 5IGBA 4OGQC 2L4NA 4FNFA 4LW1A 2NN6I 3J7A5 4BA1I 3AQQA 5FO8B 4B3RQ 4AQYL 3H3VH 4IPGA 2PQAA 3VR6A 1LTRD 4DXGA 1PH5A 2A68C 1NXZA 3ICEA 4CKEA 5EJWA 1SRUA 4JALA 1B4OA 2N78A 4JCVE 1T5EA 3I4MH 3I3CA 2NVXB 4Y52H 1M90C 3HRZC 2N8NA 5J3BA 4RGMA 4B3TQ 4R4OA 5LHY1 4A3MG 1PH2A 4DAYA 3GTKB 1ASZA 3GTPH 5JEAJ 4GS3A 2F0UA 5M3FG 3HOZG 2E2IB 5D3DA 5G3LF 3EA6A 1JJGA 3QOLA 4PMWA 3S1NH 1KAAA 4DR4L 5E3FA 5CV9A 4K5XA 2XTIA 1JWMD 3ULJA 3A5UA 2KHJA 3TP6A 3QIAA 2DN8A 3G7LA 1RD9D 2A74C 4XQQA 4FMWA 1QUQB 5C0XG 2VZAA 2CQOA 2I5HA 3S2HH 1TWGH 5EGTA 5BN4A 1DOKA 1TWGB 1EQRA 3ERQA 1STBA 2QILA 2SEBD 2B2TC 4A3JB 4KKTA 1Y1WG 3CHBD 4GN5A 5ELCA 1Q90A 5IWAL 2UXDL 2K04A 2KCTA 5FLMH 2E2IH 2FFKB 4TRDA 4CKCA 3VDYA 3H0GB 4YQTA 1MD2D 4DR1L 2UU9L 3GTPB 3NTIA 1PTOH 3NBHA 1SR3A 1NUCA 1AFPA 2EGWA 4K0KL 5CYUA 4DXFA 1EYAA 1DONA 3IC6A 2NVXH 3I4MB 4LK1C 4RA8A 4DV6Q 2DJGC 3NENA 1EOTA 5M5YH 5M5WB 3E9HA 1QB5D 2XGTA 4DUZQ 5LL6X 3HOVB 4DU9A 1Q7YC 3I4NG 2L15A 2EY5A 3WOEA 2VQEL 4A75A 1FR3A 4HMJA 4XYQA 3S17H 1IYJB 4NXNL 1AZPA 5LMUL 3NWTA 4C2MB 3CCSA 3ULLA 1D5ZC 1Z85A 4C3JH 4KHPL 5C44G 4KLKA 3CPWA 2RBMA 2B39A 4OL7A 1PH6A 2OXPA 1A2UA 5IP7G 5JJLA 1HZBA 3MEFA 1WTVA 2WKCA 5IIFA 3ZJYC 3RUZA 4A4IA 2KUMA 4NP5A 4I7AA 5KEEA 1J9OA 1O7IA 3VR3A 2C35B 4LF5L 5GQOA 1HR0L 3IKJA 4P75A 4PG3A 2E76C 5C4HA 4B3MQ 3OIPA 1FNWA 2LY7A 3HP3A 3OIIA 4ID6A 4JWFA 2NVYH 4A3IG 1A2TA 1PYBA 2QA4A 4L5RC 4UP8A 4A93H 3JAME 4JOIC 3KTYA 1PLFA 1E22A 3MXGA 1YJNA 3D4WA 3P1HA 3OINA 2RDFA 3BDOA 2LFNA 4DR2L 3S1RH 3I4NB 4A3DG 1K8OA 4PZ8A 4GOPA 5EQ0A 1WTXA 3W1GA 4QMGA 1JOOA 4CHTB 1RHPA 5C4XG 3PIOA 5ELBA 5EPLA 4A3JG 4RKLA 1XTCD 2PQAB 1L0YB 4ODGA 1LTTD 2IWHA 2IX0A 4S3SA 3UE1A 4NDXA 3BBHA 5FAIA 2A73B 3CP0A 2KCMA 3KF8A 1JB7A 1ZXTA 1PTOD 1SJHD 4DV1Q 4B08A 4DV7Q 1I6HB 1QE6A 1P9PA 2A5HA 3Q24A 1SLJA 3KDFA 4JW0A 4JOIA 1QCBD 3K5MA 1F9SA 2V1CC 1A62A 2Z4IA 4FXDA 3BS1A 5C6AA 3DEOA 4A3DH 5CV5A 5BN5A 4BY1B 2Z0SA 4JAKA 5EBCA 3CCQA 2EY2A 2IHEA 3GTMH 2F0EA 2IT1A 2A19A 1VH0A 1TT2A 2BH2A 4CDCC 2JA8H 1K8MA 4X66L 3NPPA 4TQUS 2YU9B 2K5VA 4WJWA 2B2YC 5I2YA 4HN7A 3KUPA 3BVZA 1G51A 4JV5Q 2FJ2A 1NE3A 4JI3L 3GTLB 3DXJC 2J0TD 3PUXA 1GUGA 1WD0A 1HQRD 4K2KA 2AMCB 3BU2A 1DOMA 4JI4Q 4NXNQ 5IT9E 3EVQA 4IG6A 3CCMA 1S72A 4GKJQ 3W3AA 2D0PA 2VUMG 1GUWA 3HOXH 4JBKA 3PSIA 3PUZA 4JI8L 1M4VA 5G3LD 1CZWA 2Y0SG 4B3TL 2A6EC 1PTOF 1IBLL 1X65A 2R6GA 4XYOA 4F8MA 5KYLA 3I73A 1B3QA 3I2ZA 1HZCA 1FGUA 1XNQQ 4N8X1 4QL5A 1N33L 3R93A 1EYDA 5FO7B 4GKJL 1LTAD 2R93G 2TSSA 4N9TA 1HNXL 2ZXPA 1A3TA 4JI8Q 4KMUC 1BF4A 3SGIA 3I7FA 1BR9A 1BO0A 2OTJA 1PH1A 1ENAA 2RSNA 1I4XA 3CRKC 4APVA 3L8UA 4A3LG 1EY6A 1QNUA 2V3JA 2VNUD 2K1BA 3T4AC 3VR2A 1GOZA 3HKZE 5C3XA 2I0QA 1HNWL 4R1JA 1TWHH 1BOSA 1BDOA 2ZM6Q 1VQGA 1GD7A 4K6LA 3MZ5A 2VUMH 3VR5A 1KNAA 2WV6D 1S5CD 2R92H 1Q12A 3C3LA 4YQBA 2K14A 4YQ9A 1K0SA 3K81C 4HSPA 2BE5C 3Q0AA 5C0XJ 2K5DA 5JJZA 1STGA 1CUKA 3F1ZA 1QVCA 2YTYA 5IGCA 2VB2X 5C4ZA 2DY7A 2EVBA 1A63A 1XTDA 1S5FD 4J3CA 2JA7H 3CC2A 1SNMA 4DR4Q 1EZ6A 2K52A 2MNAA 4JC0A 4P73A 1HR0W 2FMMA 3U58A 2RDGA 3S24A 1XPRA 1SEBD 4Y7NH 3DLLA 4YVKA 5M3MB 3DHQA 4WRDA 1UE6A 1XPOA 3OMGA 5JPNC 1VQMA 1K0RA 2E2HH 3HOYB 5M3MH 5C0XH 4YQ5A 1D6EC 3G48A 1OY5A 4OIJA 1LV9A 4LF6Q 1PRTC 1CKNB 1XNRL 1NMFA 2MUYA 1J5EL 1S3OA 3PF4A 3UDXA 2VL6A 3CXCA 3L2PA 4IO9A 2JA7B 4E6IA 4Q5VA 4PZKA 1XXGA 3A0JA 5DLQE 2EYMA 3FVQA 3M9BA 4U673 2D62A 2F3VA 2ZTEA 3TP7A 2B2TA 2RHQB 1HZ9A 2Y0SE 4JYAL 3AB9A 2E2JB 3VA7A 4HJ7A 1EY8A 3MEHA 2FHTA 4YQGA 2HQLA 3N4KA 2XRSD 4A3BB 4KY5A 2OF1A 1TKWB 4DNRB 2KBNA 1ICFB 3G6EA 4KTAA 4C3HB 1JJ2A 1JCKB 4BS9A 2RSOA 3KDFB 3Q22A 1S5ED 4KGNA 2JP1A 3CPFA 2Q8IB 1U4RA 1NSNS 5DEHA 1LYLA 1AN8A 1EY0A 1PH3A 2HCCA 2I5LX 3VYSA 1IBMQ 2WAQE 2I5MX 2D2CC 2LMCB 2JYOA 2Z6KC 5JAVA 2M00A 1BCPF 1LT4D 4BY1G 2CVRA 3HOWH 2ICIA 4DN4M 1WOCA 3NXWA 1LTSD 4YPWA 1VQJA 1DM0B 2Q2IA 3M85A 1GM5A 4YPZA 3RLFA 3MVVA 4N8FA 1VQBA 4TVAB 4KKSA 1JC7A 3A8JE 3KW2A 1QWYA 1LO5D 3PMFA 4YQOA 3OIQA 4EGVA 3I56A 2RKSA 1UAKA 1EU3A 3J81i 4DF7A 2JA6H 1EIYB 1D2BA 4LUVA 3R8BA 3EROA 2RVLA 2PNHA 1M8AA 3TP5A 4L5SA 2QWVA 1ONLA 4LF7L 4DK6C 4HJAA 2WAQG 2UUBQ 3OWFA 4I7ZC 4OELB 3QO2A 5FJ8G 1JJCB 4MZ9A 3BZDB 4HMIA 4LJZC 1OTCA 1IBLQ 1BUVT 2XWBB 1N32L 5C4XH 4LFBL 4WORA 2ZXOA 1F9RA 1UALA 2F0OA 1BCPD 2D0OA 4FF4A 2ZTCA 4R4QA 1LABA 3E9IA 3HOXG 4PZ6A 3IFDA 3NQIA 4X3LA 1Y14B 2JQOA 3M4QA 5CMDA 1NBWA 5ISRA 4Y7NB 1R9TB 1CA6A 4C3HH 1EWHA 5IWAQ 3S9WA 4FVMA 1I3QB 2XIWA 4X64Q 4B3RL 3A7LA 4JI3Q 3URYA 2VW9A
chains in the Genus database with same CATH topology
5C0XI 4YQAA 1CKOA 4JI6Q 4IOAA 2NZOA 4FMWA 1QUQB 4LF7Q 1X54A 5C0XG 4A3FG 1VQEA 2VZAA 1QUQA 2CQOA 1X3EA 1KL9A 2I5HA 4DR3L 1TWGH 3S2HH 2E8GA 3N4JA 2ZJQA 4A3LH 4LFCL 1VQ9A 4GKKL 1EQRA 1EOVA 1X9NA 1I94Q 1LUZA 3CW2C 4BBRG 3CCJA 2I6DA 3CCLA 2B63G 1Y1WG 1SMXA 2NVTH 1H95A 3JAMi 1Q81C 1PFSA 5GAGC 1VQ5A 1E7ZA 4GN5A 2YV5A 1KRTA 4LFAL 4NXML 4DR7Q 1HNXQ 1KAWA 2CKZB 4GNXB 5IWAL 3H3VI 4H3ZA 2MO0A 2UXDL 2R93H 4DAYB 4DV0Q 1KD1C 2KCTA 3CMEA 1VHKA 2R7FA 4QQBX 5FLMH 2E2IH 5K36G 4IJLA 3VDYA 1IBKL 1WFQA 1R9TH 1K8GA 4WJ3M 4YQTA 4DR1L 1Y1VH 2UU9L 3K0XA 5GM8A 3HOYH 4UPAA 4YY3Q 4A76A 2ES2A 2OQKA 1SR3A 3HKSA 2UUAL 2EGWA 4K0KL 3CC4A 4YQQA 2N49A 4BY7H 4DV7L 3KNUA 4AYBE 1PH8A 4X62Q 3AXZA 4MTNA 2R7ZG 5AJ3Q 3L7ZC 1X56A 1IPAA 1UAMA 3IC6A 2NVXH 4YCVA 4DV6Q 2ASBA 1YNXA 3Q8DA 3CC7A 2HIXA 3NENA 3JC66 2QEXA 2UXBL 3ILKA 5M5YH 4GOPC 1FVIA 3E9HA 2EXDA 4DR5Q 1HNZQ 1UEBA 3EN2A 2XGTA 1E1OA 4JI2Q 4DUZQ 4JI0L 3KFUA 1W3SA 2YYZA 2F4VL 1Q7YC 3I4NG 2L15A 2VQEL 4A75A 1BKBA 2CFMA 4DV2L 1VQCA 3S17H 1E1TA 1FJGL 3FP9A 2AKWB 1TWCH 4JI7Q 3I4MG 1WI5A 2PMZE 4BBSG 1IYJB 4NXNL 4L69A 5LMUL 4YQLA 4L5TA 3CCSA 3DCMX 5IYBH 3PGZA 4RMFA 3F2DA 3ULLA 4GNXA 3HOVH 5D9FA 1VQFA 1FJGQ 3OYYA 2HT1A 5JJIA 1Z85A 4C3JH 2CX8A 4KHPL 2CWAA 2RF4A 4KLKA 5C44G 3CPWA 2UXCQ 3NK6A 5FJ8H 4POFA 4CNGA 4HIMA 1PH6A 4JWHA 4DR1Q 1NJIC 2UU9Q 4LF4L 4GLAC 1SE8A 5IP7G 1YI2A 4A93G 5JJLA 1HZBA 3MEFA 4DR5L 2K50A 3PUWA 4UP9A 1IZ6A 3ZJYC 1N36Q 5BR8Q 4O2DA 4IPHA 4A4IA 1O7IA 4B3ML 1Z9FA 4DV4Q 2C35B 4LF5L 5GQOA 1PVOA 2CCZA 1MJEA 1HR0L 4P75A 1XJVA 4DR7L 1AE2A 4PG3A 4JBMA 4YQCA 2AWOA 1J85A 4ME3A 1K83H 1VHYA 1V1QA 3I55A 4B3MQ 1VQAA 1G6PA 3M4PA 2CWPA 1PH9A 3OIIA 1L1OC 4JWFA 2NVYH 3KJOA 2NN6G 4A3IG 2QA4A 1PYBA 4BY1H 3IRBA 4UP8A 4L5RC 4A93H 4YQRA 4JOIC 4EQ5A 3KTYA 1NS5A 1E24A 3RZDH 4YQ4A 4A3CG 1E22A 4DR3Q 1YJNA 1OXXK 1HH2P 4A3JH 4YQIA 4A3GG 2GVAA 4LFAQ 4A3KG 4OX9Q 4LWCA 1WCMH 4DV1L 2E5LQ 3OINA 4YWLA 4DR2L 3S1RH 4A3DG 4DV4L 1Q1EA 1D7QA 4JWGA 3OW2A 3PO3G 4DV5Q 4PZ8A 4X64L 4A3EG 4KHPQ 2UXCL 1I6HH 1CSQA 4LF9L 5CO4A 1SN8A 4GOPA 1B7YB 4YQ2A 2DGYA 2K4KA 2H5XA 3W1GA 1K73C 1X7OA 1C9OA 3RR5A 2PI2E 5C4XG 1PV4A 4MCDA 3PIOA 4K0KQ 3KYHC 3J81j 1HNZL 2JA6G 1BVSA 4A3JG 1Q1BA 1YZ6A 2PQAB 5JEAG 3KLWA 3E5YA 4JI6L 2YTVA 2IX0A 3UE1A 3BBHA 4HJ5A 5FAIA 3ERSX 4YCUA 4JI5L 4DV6L 5IY0A 3CP0A 2KCMA 2B63H 2R7ZH 1X3GA 2WB1E 5GAHC 1CKMA 2UUCL 4OONA 2OQ0A 1C0AA 3KF6B 4YPYA 4A3EH 5HGQA 4HIKA 1JB7A 2E2JH 3K8AA 5M3MG 4YY3L 1GZ0A 4YWMA 3AI9X 4YVGA 3H0GG 2N3SA 3GTKH 2F4VQ 2BA0A 4DV1Q 4FDBA 4DV7Q 3DM3A 1N32Q 2LXJA 1KIXA 1Q86C 4LF5Q 1P9PA 4YQ1A 4AQYQ 5JJKA 2R7DA 3UE0A 1SLJA 3KDFA 1N8RC 1WJJA 4JOIA 1VQPA 2VQFL 1T9HA 4CNFA 2V1CC 3HKZG 1A62A 4GKKQ 2IY5B 3STBD 4OO1I 4YQDA 3G4SA 4R4IA 4DV0L 3BZKA 1QVGA 4A3DH 3RLNA 4JBJA 3OIJA 1NTGA 1MKHA 1V6ZA 4CNEA 2Z0SA 4JAKA 3CCQA 1IL2A 2IHEA 3S2DH 3GTMH 4DV3L 3QUVA 4OWXB 4UP7A 2IT1A 3CD6A 3HOZH 1A8VA 2A19A 1YJWA 1K3RA 1VH0A 2HIVA 4IFDG 2BH2A 2JA8H 4ALPA 2RCNA 4X66L 4JV5L 4TQUS 3U4ZA 5IYDG 1EIFA 1V9PA 2K5VA 5C3EG 1X7PA 1NY4A 2VQFQ 1G51A 5IYCG 4X66Q 4PZ7A 2BA1A 1NE3A 1N33Q 4JV5Q 4JI3L 2FXQA 1BBWA 3J7ZC 4J15A 4DK3C 1N34L 2ZJPA 1B70B 3PUXA 3OTOL 2LSSA 2HHHL 4HIDA 2WP8J 1X6OA 1YHBA 2AMCB 1YVCA 3BU2A 4JI4Q 4NXNQ 4JI1Q 3LGJA 4DR6L 4A3CH 4IG6A 1RL2A 3U4VA 3CCMA 1S72A 1VQNA 2ID0A 3A5ZB 4GKJQ 3H15A 4YQPA 2D0PA 4XIGS 2VUMG 3HOXH 2VY3A 3PSIA 4JBKA 1PHJA 3PUZA 4JI8L 2JEAI 5IYDH 4MCCA 1UE1A 2EQSA 3BBEA 4YQ0A 4B3TL 2Y0SG 1FL0A 1IBLL 1X65A 2R6GA 3FKIG 3JAMc 3I2ZA 5IE8A 1HZCA 1FGUA 3RLOA 3CCVA 1XNQQ 1G291 4QL5A 1N33L 2AWNA 4GKJL 4KI0A 2UXDQ 3IEFA 3BBDA 2Q2HA 2R93G 1HNXL 4OWTB 5M5WH 1VQLA 3GTOH 3W5OA 4JI8Q 1EFWA 3HOWG 4JWJA 3S1QH 3J80i 3OTOQ 1YHQA 3I4NH 3SGIA 2A8VA 3I7FA 4JI1L 2OCEA 4YQNA 4YHHQ 3PO2G 3T1HL 4A3BG 1QZHA 4YQJA 4GN4B 4QIWE 3HOYG 1KHIA 2IX1A 4R4CA 2E5LL 4LNQA 2OTJA 1PH1A 1MJCA 3PF5A 3GTGH 4YPWA 4GLVB 4YVJA 4APVA 3L8UA 4A3LG 2V3JA 2VNUD 3O7BA 1KRSA 1X55A 2LXKA 3UDFA 3T1YQ 1HJPA 1PH7A 2K5NA 3A74A 2UUBL 4JI4L 3PV0A 1O6DA 4NXMQ 5GADC 3BZCA 3HKZE 2I0QA 1HNWL 4X6AH 4MNOA 1TWHH 4R1JA 4BA2I 4BXXH 2ZM6Q 1CKNA 4HJ8A 3AEVA 1VQGA 4DV5L 5C4JH 1GD7A 2GVBA 2VS1A 1VQIA 1Y1WH 3TREA 3PO2H 2ZJRA 2EIFA 2EGVA 4LUOA 2VUMH 3CMAA 1N9WA 5HY6A 3CCEA 4KHZA 3B6YA 2R92H 1Q12A 4NB3A 4HJ9A 4UY8C 2K14A 4YQBA 4YQ9A 3NEMA 1XNQL 3K81C 2K75A 5BR8L 4QGUA 1OXSC 2MQHA 2OWOA 5C0XJ 1J5EQ 4XTCS 1CUKA 3F1ZA 1QVCA 2YTYA 4YQ6A 2YTXA 4A3IH 1HZAA 1L1OB 1I94L 3TQYA 1MXIA 1E3PA 3T1HQ 1PA6A 5EAYA 3D31A 5IP7H 1A63A 1XTDA 1WCMG 1VQ6A 3F2BA 4J3CA 4C2MH 2JA7H 3CC2A 3K7UC 2NZHA 4DR4Q 3RNUA 2K52A 2MNAA 2ZTDA 4JC0A 2V3KA 4C3IH 4BY7G 4EX5A 1KQSA 1U0LA 1YJ9A 1SFOH 1P16A 4P73A 1N34Q 1HR0W 1I3QH 4IJHA 3U58A 2A1AA 1PYSB 2UUCQ 1XNRQ 1IXRA 3S24A 1VQDA 4BBRH 1XPRA 4Y7NH 3DLLA 4JI5Q 4WJ4A 2YY8A 4YVKA 1LM0A 2KENA 3M4OH 1UE6A 3S15H 1ASYA 1YEZA 1XPOA 1XMQQ 4QJFA 1VQMA 4P74A 3D0FA 1K0RA 1L2FA 2WB1G 1VQHA 4YVIA 2E2HH 3S1MH 4JYAQ 2MFIA 5GAEC 1AE3A 5FLXc 4LUZA 4GLXA 5M3MH 1AH9A 4A3FH 4A3KH 4B3SL 5IYBG 3H0GH 3U50C 4YQ5A 1VQ8A 3ULPA 1I5FA 2GN5A 3G48A 1OY5A 2JJQA 5IYCH 5IP9G 3CCUA 3HOUH 2JE6I 4H02A 5E7NA 3GTJH 4YVHA 1BBUA 4DPGA 4LF8Q 4IFDJ 1HR0Q 4LF6Q 1CKNB 1YBYA 3EBEA 1NMFA 1XNRL 4AIMA 1J5EL 3TS2A 1U5KA 4H3YA 1S3OA 3PF4A 5LMNL 3UDXA 2VL6A 5ELOA 1UWVA 3L2PA 3CXCA 4IO9A 4KDZA 4PZKA 1KC8C 3A0JA 4XBOA 5DLQE 3M9BA 2NVQH 4DV3Q 2KHIA 1V43A 3I4OA 2D62A 3RZOH 1Q46A 1TWAH 2ZTEA 4R4TA 4IOCA 2UUAQ 3K7AH 3KF6A 2RHQB 4P71A 3KF8B 3KOJA 3PUYA 3AIAA 5LMNW 1HZ9A 4JBWA 4YCWA 4IPDA 4FAKA 1WYDA 1C7YA 2Y0SE 3S16H 1HNWQ 1L1OA 3F8TA 4JYAL 1Y1VG 3F2CA 2WFWA 4BXXG 1VQ7A 1JMCA 1YIJA 4A3GH 1IBML 1B8AA 4JI7L 4HJ7A 2IHFA 2Q2TA 4YQSA 2BH8A 4RG1A 1N36L 4YQGA 5M5XH 1Q8KA 3CQZH 2JA8G 3AYHB 3GDEA 1VQOA 2HQLA 4B3SQ 4DAMA 3N4KA 4LF8L 5GMBA 2AHOB 4LF4Q 4A3MH 4E8BA 4GOPB 2R92G 1MIUA 2JA5H 1X3FA 4QY7A 1QZGA 2QGQA 2Z6KA 3MXNB 2KBNA 3G6EA 4DV2Q 1JJ2A 2B3GA 3L0OA 3CF5A 3M3YH 2ALYB 4LF6L 3AFPA 2F3IA 3KDFB 5AJ3L 5LMUQ 4DR2Q 1K9MC 4POGA 2MO1A 1TXYA 3PCOB 1D8LA 1JT8A 1UAJA 4CNDA 4KGNA 3BJUA 3CPFA 4GNXC 3RN2A 2RHSB 1S40A 3GYQA 1LYLA 5GMCA 1PH3A 2I5LX 3FKIH 1IBMQ 4OO1G 2WAQE 3STBC 4DUZL 2I5MX 1OXVA 1RIPA 4LF9Q 2Q2UA 3GD7A 2JEBI 1TWFH 2Z6KC 4AYBG 1Q82C 3W1BA 4OWWB 3GTQH 1OXTA 2HA8A 1L0WA 4BY1G 5C3EH 3UDIA 5FLMG 5IT9c 4DUYL 1K8AC 3NK7A 3HOVG 1A0IA 2VQEQ 3HOWH 3ONPA 1WOCA 5C44H 4NPSA 3EIVA 3WWVA 5ELNA 4AH6A 3UDGA 1YITA 1EQQA 1PH4A 4OX9L 1I50H 4YWKA 1VQJA 4DKAC 1KXLA 2Q2IA 3M85A 1GM5A 3TS0A 1Z47A 3RLFA 3TRZA 2PI2A 4YPZA 3HFZB 3RN5A 5LMNQ 1TO0A 2JA9A 4X65Q 1M1KC 1IBKQ 1VQBA 3E0EA 3CAMA 4TVAB 2JA7G 3G71A 2F52A 3KW2A 1ZJRA 1CSPA 4P72A 4X62L 4LFCQ 3NELA 4YQKA 2B29A 4YQOA 1P8LA 4O0AA 3I56A 3CCRA 2JA5G 1UAKA 3J81i 5IP9H 1QVFA 3GTLH 1GO3E 1LTLA 3HOUG 2ZM6L 2JA6H 1EIYB 1VQKA 1VCIA 1YHAA 4LUVA 3S14H 1UE5A 3GO5A 3ER0A 1OXUA 2K5HA 2PNHA 4GN3B 4HIOA 4JG2A 2YU9H 1JE5A 5GROA 4YQ7A 1XMQL 4L5SA 3J81c 2QWVA 1EUJA 1NMGA 4LF7L 4IFDI 2QMMA 2Z0YA 4YQ8A 4DK6C 3J80c 3TEHB 4HJAA 2WAQG 3T1YL 2UUBQ 3PIPA 4LW1A 2NN6I 4JI0Q 4X65L 4L5QA 4OXPA 5FJ8G 4BA1I 1JJCB 2DUDA 4MZ9A 3KJPA 3J7A5 4YHHL 1J6QA 1DGSA 3AQQA 1OTCA 4AQYL 3H3VH 4B3RQ 4IPGA 1XPUA 5M3FH 1IBLQ 1VS0A 2UXBQ 2PQAA 3K80C 1PH5A 1N32L 5C4XH 1NXZA 3ICEA 4LFBL 1SRUA 4JALA 3NBHB 5H1SE 1EYGA 1UALA 1W2BA 2N78A 4JCVE 1VQ4A 2O3AA 3I4MH 4BBSH 4Y52H 1SROA 2D0OA 1M90C 1UE7A 2N8NA 3AFQA 5J3BA 2ZTCA 4R4QA 4LFBQ 1GVPA 3E9IA 3HOXG 4PZ6A 4B3TQ 4R4OA 4JI2L 4DNIA 4A3MG 1Y14B 3FHWA 1PH2A 2JQOA 2OTLA 4X3LA 1XMOQ 3M4QA 1NBWA 3KY7A 3PUVA 1ASZA 3GTPH 4YQ3A 5JEAJ 4GS3A 1XMOL 5M3FG 3HOZG 4C3HH 2JK8A 2ATWA 5IWAQ 4X3MA 1EWIA 3PO3H 1JJGA 4PMWA 3S1NH 4DR4L 2HHHQ 4YPXA 3M7NA 4IPCA 4MCBA 4DUYQ 1GKHA 4A3BH 2XTIA 3ULJA 4X64Q 4DR6Q 4B3RL 3A5UA 4JI3Q 2VW9A 1V2XA 2KHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X I;  4YQA A;  1CKO A;  4JI6 Q;  4IOA A;  2NZO A;  1QUQ B;  4LF7 Q;  1X54 A;  5C0X G;  4A3F G;  1VQE A;  2VZA A;  1QUQ A;  2CQO A;  1X3E A;  1KL9 A;  2I5H A;  4DR3 L;  1TWG H;  3S2H H;  2E8G A;  3N4J A;  2ZJQ A;  4A3L H;  4LFC L;  1VQ9 A;  4GKK L;  1EQR A;  1EOV A;  1X9N A;  1I94 Q;  1LUZ A;  3CW2 C;  4BBR G;  3CCJ A;  2I6D A;  3CCL A;  2B63 G;  1Y1W G;  1SMX A;  2NVT H;  1H95 A;  3JAM i;  1Q81 C;  1PFS A;  5GAG C;  1VQ5 A;  1E7Z A;  4GN5 A;  2YV5 A;  1KRT A;  4LFA L;  4NXM L;  4DR7 Q;  1HNX Q;  1KAW A;  2CKZ B;  4GNX B;  5IWA L;  3H3V I;  4H3Z A;  2MO0 A;  2UXD L;  2R93 H;  4DAY B;  4DV0 Q;  1KD1 C;  2KCT A;  3CME A;  1VHK A;  2R7F A;  4QQB X;  5FLM H;  2E2I H;  5K36 G;  4IJL A;  3VDY A;  1IBK L;  1WFQ A;  1R9T H;  1K8G A;  4WJ3 M;  4YQT A;  4DR1 L;  1Y1V H;  2UU9 L;  3K0X A;  5GM8 A;  3HOY H;  4UPA A;  4YY3 Q;  4A76 A;  2ES2 A;  2OQK A;  1SR3 A;  3HKS A;  2UUA L;  2EGW A;  4K0K L;  3CC4 A;  4YQQ A;  2N49 A;  4BY7 H;  4DV7 L;  3KNU A;  4AYB E;  1PH8 A;  4X62 Q;  3AXZ A;  4MTN A;  2R7Z G;  5AJ3 Q;  3L7Z C;  1X56 A;  1IPA A;  1UAM A;  3IC6 A;  2NVX H;  4YCV A;  4DV6 Q;  2ASB A;  1YNX A;  3Q8D A;  3CC7 A;  2HIX A;  3NEN A;  3JC6 6;  2QEX A;  2UXB L;  3ILK A;  5M5Y H;  4GOP C;  1FVI A;  3E9H A;  2EXD A;  4DR5 Q;  1HNZ Q;  1UEB A;  3EN2 A;  2XGT A;  1E1O A;  4JI2 Q;  4DUZ Q;  4JI0 L;  3KFU A;  1W3S A;  2YYZ A;  2F4V L;  1Q7Y C;  3I4N G;  2L15 A;  2VQE L;  4A75 A;  1BKB A;  2CFM A;  4DV2 L;  1VQC A;  3S17 H;  1E1T A;  1FJG L;  3FP9 A;  2AKW B;  1TWC H;  4JI7 Q;  3I4M G;  1WI5 A;  2PMZ E;  4BBS G;  1IYJ B;  4NXN L;  4L69 A;  5LMU L;  4YQL A;  4L5T A;  3CCS A;  3DCM X;  5IYB H;  3PGZ A;  4RMF A;  3F2D A;  3ULL A;  4GNX A;  3HOV H;  5D9F A;  1VQF A;  1FJG Q;  3OYY A;  2HT1 A;  5JJI A;  1Z85 A;  4C3J H;  2CX8 A;  4KHP L;  2CWA A;  2RF4 A;  4KLK A;  5C44 G;  3CPW A;  2UXC Q;  3NK6 A;  5FJ8 H;  4POF A;  4CNG A;  4HIM A;  1PH6 A;  4DR1 Q;  1NJI C;  2UU9 Q;  4LF4 L;  4GLA C;  1SE8 A;  5IP7 G;  1YI2 A;  4A93 G;  5JJL A;  1HZB A;  3MEF A;  4DR5 L;  2K50 A;  3PUW A;  4UP9 A;  1IZ6 A;  3ZJY C;  1N36 Q;  5BR8 Q;  4O2D A;  4IPH A;  4A4I A;  1O7I A;  4B3M L;  1Z9F A;  4DV4 Q;  2C35 B;  4LF5 L;  5GQO A;  1PVO A;  2CCZ A;  1MJE A;  1HR0 L;  4P75 A;  1XJV A;  4DR7 L;  1AE2 A;  4PG3 A;  4JBM A;  4YQC A;  2AWO A;  1J85 A;  4ME3 A;  1K83 H;  1VHY A;  1V1Q A;  3I55 A;  4B3M Q;  1VQA A;  1G6P A;  3M4P A;  2CWP A;  1PH9 A;  3OII A;  1L1O C;  2NVY H;  3KJO A;  2NN6 G;  4A3I G;  2QA4 A;  1PYB A;  4BY1 H;  3IRB A;  4UP8 A;  4L5R C;  4A93 H;  4YQR A;  4JOI C;  4EQ5 A;  3KTY A;  1NS5 A;  1E24 A;  3RZD H;  4YQ4 A;  4A3C G;  1E22 A;  4DR3 Q;  1YJN A;  1OXX K;  1HH2 P;  4A3J H;  4YQI A;  4A3G G;  2GVA A;  4LFA Q;  4A3K G;  4OX9 Q;  4LWC A;  1WCM H;  4DV1 L;  2E5L Q;  3OIN A;  4YWL A;  4DR2 L;  3S1R H;  4A3D G;  4DV4 L;  1Q1E A;  1D7Q A;  3OW2 A;  3PO3 G;  4DV5 Q;  4PZ8 A;  4X64 L;  4A3E G;  4KHP Q;  2UXC L;  1I6H H;  1CSQ A;  4LF9 L;  5CO4 A;  1SN8 A;  4GOP A;  1B7Y B;  4YQ2 A;  2DGY A;  2K4K A;  2H5X A;  3W1G A;  1K73 C;  1X7O A;  1C9O A;  3RR5 A;  2PI2 E;  5C4X G;  1PV4 A;  4MCD A;  3PIO A;  4K0K Q;  3KYH C;  3J81 j;  1HNZ L;  2JA6 G;  1BVS A;  4A3J G;  1Q1B A;  1YZ6 A;  2PQA B;  5JEA G;  3KLW A;  3E5Y A;  4JI6 L;  2YTV A;  2IX0 A;  3UE1 A;  3BBH A;  4HJ5 A;  5FAI A;  3ERS X;  4YCU A;  4JI5 L;  4DV6 L;  5IY0 A;  3CP0 A;  2KCM A;  2B63 H;  2R7Z H;  1X3G A;  2WB1 E;  5GAH C;  1CKM A;  2UUC L;  4OON A;  2OQ0 A;  1C0A A;  3KF6 B;  4YPY A;  4A3E H;  5HGQ A;  4HIK A;  1JB7 A;  2E2J H;  3K8A A;  5M3M G;  4YY3 L;  1GZ0 A;  4YWM A;  3AI9 X;  4YVG A;  3H0G G;  2N3S A;  3GTK H;  2F4V Q;  2BA0 A;  4DV1 Q;  4FDB A;  4DV7 Q;  3DM3 A;  1N32 Q;  2LXJ A;  1KIX A;  1Q86 C;  4LF5 Q;  1P9P A;  4YQ1 A;  4AQY Q;  5JJK A;  2R7D A;  3UE0 A;  1SLJ A;  3KDF A;  1N8R C;  1WJJ A;  4JOI A;  1VQP A;  2VQF L;  1T9H A;  4CNF A;  2V1C C;  3HKZ G;  1A62 A;  4GKK Q;  2IY5 B;  3STB D;  4OO1 I;  4YQD A;  3G4S A;  4R4I A;  4DV0 L;  3BZK A;  1QVG A;  4A3D H;  3RLN A;  4JBJ A;  3OIJ A;  1NTG A;  1MKH A;  1V6Z A;  4CNE A;  2Z0S A;  4JAK A;  3CCQ A;  1IL2 A;  2IHE A;  3S2D H;  3GTM H;  4DV3 L;  3QUV A;  4OWX B;  4UP7 A;  2IT1 A;  3CD6 A;  3HOZ H;  1A8V A;  2A19 A;  1YJW A;  1K3R A;  1VH0 A;  2HIV A;  4IFD G;  2BH2 A;  2JA8 H;  4ALP A;  2RCN A;  4X66 L;  4JV5 L;  4TQU S;  3U4Z A;  5IYD G;  1EIF A;  1V9P A;  2K5V A;  5C3E G;  1X7P A;  1NY4 A;  2VQF Q;  1G51 A;  5IYC G;  4X66 Q;  4PZ7 A;  2BA1 A;  1NE3 A;  1N33 Q;  4JV5 Q;  4JI3 L;  2FXQ A;  1BBW A;  3J7Z C;  4J15 A;  4DK3 C;  1N34 L;  2ZJP A;  1B70 B;  3PUX A;  3OTO L;  2LSS A;  2HHH L;  4HID A;  2WP8 J;  1X6O A;  1YHB A;  2AMC B;  1YVC A;  3BU2 A;  4JI4 Q;  4NXN Q;  4JI1 Q;  3LGJ A;  4DR6 L;  4A3C H;  4IG6 A;  1RL2 A;  3U4V A;  3CCM A;  1S72 A;  1VQN A;  2ID0 A;  3A5Z B;  4GKJ Q;  3H15 A;  4YQP A;  2D0P A;  4XIG S;  2VUM G;  3HOX H;  2VY3 A;  3PSI A;  4JBK A;  1PHJ A;  3PUZ A;  4JI8 L;  2JEA I;  5IYD H;  4MCC A;  1UE1 A;  2EQS A;  3BBE A;  4YQ0 A;  4B3T L;  2Y0S G;  1FL0 A;  1IBL L;  1X65 A;  2R6G A;  3FKI G;  3JAM c;  3I2Z A;  5IE8 A;  1HZC A;  1FGU A;  3RLO A;  3CCV A;  1XNQ Q;  1G29 1;  4QL5 A;  1N33 L;  2AWN A;  4GKJ L;  4KI0 A;  2UXD Q;  3IEF A;  3BBD A;  2Q2H A;  2R93 G;  1HNX L;  4OWT B;  5M5W H;  1VQL A;  3GTO H;  3W5O A;  4JI8 Q;  1EFW A;  3HOW G;  3S1Q H;  3J80 i;  3OTO Q;  1YHQ A;  3I4N H;  3SGI A;  2A8V A;  3I7F A;  4JI1 L;  2OCE A;  4YQN A;  4YHH Q;  3PO2 G;  3T1H L;  4A3B G;  1QZH A;  4YQJ A;  4GN4 B;  4QIW E;  3HOY G;  1KHI A;  2IX1 A;  4R4C A;  2E5L L;  4LNQ A;  2OTJ A;  1PH1 A;  1MJC A;  3PF5 A;  3GTG H;  4YPW A;  4GLV B;  4YVJ A;  4APV A;  3L8U A;  4A3L G;  2V3J A;  2VNU D;  3O7B A;  1KRS A;  1X55 A;  2LXK A;  3UDF A;  3T1Y Q;  1HJP A;  1PH7 A;  2K5N A;  3A74 A;  2UUB L;  4JI4 L;  3PV0 A;  1O6D A;  4NXM Q;  5GAD C;  3BZC A;  3HKZ E;  2I0Q A;  1HNW L;  4X6A H;  4MNO A;  1TWH H;  4R1J A;  4BA2 I;  4BXX H;  2ZM6 Q;  1CKN A;  4HJ8 A;  3AEV A;  1VQG A;  4DV5 L;  5C4J H;  1GD7 A;  2GVB A;  2VS1 A;  1VQI A;  1Y1W H;  3TRE A;  3PO2 H;  2ZJR A;  2EIF A;  2EGV A;  4LUO A;  2VUM H;  3CMA A;  1N9W A;  5HY6 A;  3CCE A;  4KHZ A;  3B6Y A;  2R92 H;  1Q12 A;  4NB3 A;  4HJ9 A;  4UY8 C;  2K14 A;  4YQB A;  4YQ9 A;  3NEM A;  1XNQ L;  3K81 C;  2K75 A;  5BR8 L;  4QGU A;  1OXS C;  2MQH A;  2OWO A;  5C0X J;  1J5E Q;  4XTC S;  1CUK A;  3F1Z A;  1QVC A;  2YTY A;  4YQ6 A;  2YTX A;  4A3I H;  1HZA A;  1L1O B;  1I94 L;  3TQY A;  1MXI A;  1E3P A;  3T1H Q;  1PA6 A;  5EAY A;  3D31 A;  5IP7 H;  1A63 A;  1XTD A;  1WCM G;  1VQ6 A;  3F2B A;  4J3C A;  4C2M H;  2JA7 H;  3CC2 A;  3K7U C;  2NZH A;  4DR4 Q;  3RNU A;  2K52 A;  2MNA A;  2ZTD A;  4JC0 A;  2V3K A;  4C3I H;  4BY7 G;  4EX5 A;  1KQS A;  1U0L A;  1YJ9 A;  1SFO H;  1P16 A;  4P73 A;  1N34 Q;  1HR0 W;  1I3Q H;  4IJH A;  3U58 A;  2A1A A;  1PYS B;  2UUC Q;  1XNR Q;  1IXR A;  3S24 A;  1VQD A;  4BBR H;  1XPR A;  4Y7N H;  3DLL A;  4JI5 Q;  4WJ4 A;  2YY8 A;  4YVK A;  1LM0 A;  2KEN A;  3M4O H;  1UE6 A;  3S15 H;  1ASY A;  1YEZ A;  1XPO A;  1XMQ Q;  4QJF A;  1VQM A;  4P74 A;  3D0F A;  1K0R A;  1L2F A;  2WB1 G;  1VQH A;  4YVI A;  2E2H H;  3S1M H;  4JYA Q;  2MFI A;  5GAE C;  1AE3 A;  5FLX c;  4LUZ A;  4GLX A;  5M3M H;  1AH9 A;  4A3F H;  4A3K H;  4B3S L;  5IYB G;  3H0G H;  3U50 C;  4YQ5 A;  1VQ8 A;  3ULP A;  1I5F A;  2GN5 A;  3G48 A;  1OY5 A;  2JJQ A;  5IYC H;  5IP9 G;  3CCU A;  3HOU H;  2JE6 I;  4H02 A;  5E7N A;  3GTJ H;  4YVH A;  1BBU A;  4DPG A;  4LF8 Q;  4IFD J;  1HR0 Q;  4LF6 Q;  1CKN B;  1YBY A;  3EBE A;  1NMF A;  1XNR L;  4AIM A;  1J5E L;  3TS2 A;  1U5K A;  4H3Y A;  1S3O A;  3PF4 A;  5LMN L;  3UDX A;  2VL6 A;  5ELO A;  1UWV A;  3L2P A;  3CXC A;  4IO9 A;  4KDZ A;  4PZK A;  1KC8 C;  3A0J A;  4XBO A;  5DLQ E;  3M9B A;  2NVQ H;  4DV3 Q;  2KHI A;  1V43 A;  3I4O A;  2D62 A;  3RZO H;  1Q46 A;  1TWA H;  2ZTE A;  4R4T A;  4IOC A;  2UUA Q;  3K7A H;  3KF6 A;  2RHQ B;  4P71 A;  3KF8 B;  3KOJ A;  3PUY A;  3AIA A;  5LMN W;  1HZ9 A;  4JBW A;  4YCW A;  4IPD A;  4FAK A;  1WYD A;  1C7Y A;  2Y0S E;  3S16 H;  1HNW Q;  1L1O A;  3F8T A;  4JYA L;  1Y1V G;  3F2C A;  2WFW A;  4BXX G;  1VQ7 A;  1JMC A;  1YIJ A;  4A3G H;  1IBM L;  1B8A A;  4JI7 L;  4HJ7 A;  2IHF A;  2Q2T A;  4YQS A;  2BH8 A;  4RG1 A;  1N36 L;  4YQG A;  5M5X H;  1Q8K A;  3CQZ H;  2JA8 G;  3AYH B;  3GDE A;  1VQO A;  2HQL A;  4B3S Q;  4DAM A;  3N4K A;  4LF8 L;  5GMB A;  2AHO B;  4LF4 Q;  4A3M H;  4E8B A;  4GOP B;  2R92 G;  1MIU A;  2JA5 H;  1X3F A;  4QY7 A;  1QZG A;  2QGQ A;  2Z6K A;  3MXN B;  2KBN A;  3G6E A;  4DV2 Q;  1JJ2 A;  2B3G A;  3L0O A;  3CF5 A;  3M3Y H;  2ALY B;  4LF6 L;  3AFP A;  2F3I A;  3KDF B;  5AJ3 L;  5LMU Q;  4DR2 Q;  1K9M C;  4POG A;  2MO1 A;  1TXY A;  3PCO B;  1D8L A;  1JT8 A;  1UAJ A;  4CND A;  4KGN A;  3BJU A;  3CPF A;  4GNX C;  3RN2 A;  2RHS B;  1S40 A;  3GYQ A;  1LYL A;  5GMC A;  1PH3 A;  2I5L X;  3FKI H;  1IBM Q;  4OO1 G;  2WAQ E;  3STB C;  4DUZ L;  2I5M X;  1OXV A;  1RIP A;  4LF9 Q;  2Q2U A;  3GD7 A;  2JEB I;  1TWF H;  2Z6K C;  4AYB G;  1Q82 C;  3W1B A;  4OWW B;  3GTQ H;  1OXT A;  2HA8 A;  1L0W A;  4BY1 G;  5C3E H;  3UDI A;  5FLM G;  5IT9 c;  4DUY L;  1K8A C;  3NK7 A;  3HOV G;  1A0I A;  2VQE Q;  3HOW H;  3ONP A;  1WOC A;  5C44 H;  4NPS A;  3EIV A;  3WWV A;  5ELN A;  4AH6 A;  3UDG A;  1YIT A;  1EQQ A;  1PH4 A;  4OX9 L;  1I50 H;  4YWK A;  1VQJ A;  4DKA C;  1KXL A;  2Q2I A;  3M85 A;  1GM5 A;  3TS0 A;  1Z47 A;  3RLF A;  3TRZ A;  2PI2 A;  4YPZ A;  3HFZ B;  3RN5 A;  5LMN Q;  1TO0 A;  2JA9 A;  4X65 Q;  1M1K C;  1IBK Q;  1VQB A;  3E0E A;  3CAM A;  4TVA B;  2JA7 G;  3G71 A;  2F52 A;  3KW2 A;  1ZJR A;  1CSP A;  4P72 A;  4X62 L;  4LFC Q;  3NEL A;  4YQK A;  2B29 A;  4YQO A;  1P8L A;  4O0A A;  3I56 A;  3CCR A;  2JA5 G;  1UAK A;  3J81 i;  5IP9 H;  1QVF A;  3GTL H;  1GO3 E;  1LTL A;  3HOU G;  2ZM6 L;  2JA6 H;  1EIY B;  1VQK A;  1VCI A;  1YHA A;  4LUV A;  3S14 H;  1UE5 A;  3GO5 A;  3ER0 A;  1OXU A;  2K5H A;  2PNH A;  4GN3 B;  4HIO A;  4JG2 A;  2YU9 H;  1JE5 A;  5GRO A;  4YQ7 A;  1XMQ L;  4L5S A;  3J81 c;  2QWV A;  1EUJ A;  1NMG A;  4LF7 L;  4IFD I;  2QMM A;  2Z0Y A;  4YQ8 A;  4DK6 C;  3J80 c;  3TEH B;  4HJA A;  2WAQ G;  3T1Y L;  2UUB Q;  3PIP A;  4LW1 A;  2NN6 I;  4JI0 Q;  4X65 L;  4L5Q A;  4OXP A;  5FJ8 G;  4BA1 I;  1JJC B;  2DUD A;  4MZ9 A;  3KJP A;  3J7A 5;  4YHH L;  1J6Q A;  1DGS A;  3AQQ A;  1OTC A;  4AQY L;  3H3V H;  4B3R Q;  4IPG A;  1XPU A;  5M3F H;  1IBL Q;  1VS0 A;  2UXB Q;  2PQA A;  3K80 C;  1PH5 A;  1N32 L;  5C4X H;  1NXZ A;  3ICE A;  4LFB L;  1SRU A;  4JAL A;  3NBH B;  5H1S E;  1EYG A;  1UAL A;  1W2B A;  2N78 A;  4JCV E;  1VQ4 A;  2O3A A;  3I4M H;  4BBS H;  4Y52 H;  1SRO A;  2D0O A;  1M90 C;  1UE7 A;  2N8N A;  3AFQ A;  5J3B A;  2ZTC A;  4R4Q A;  4LFB Q;  1GVP A;  3E9I A;  3HOX G;  4PZ6 A;  4B3T Q;  4R4O A;  4JI2 L;  4DNI A;  4A3M G;  1Y14 B;  3FHW A;  1PH2 A;  2JQO A;  2OTL A;  4X3L A;  1XMO Q;  3M4Q A;  1NBW A;  3KY7 A;  3PUV A;  1ASZ A;  3GTP H;  4YQ3 A;  5JEA J;  4GS3 A;  1XMO L;  5M3F G;  3HOZ G;  4C3H H;  2JK8 A;  2ATW A;  5IWA Q;  4X3M A;  1EWI A;  3PO3 H;  1JJG A;  4PMW A;  3S1N H;  4DR4 L;  2HHH Q;  4YPX A;  3M7N A;  4IPC A;  4MCB A;  4DUY Q;  1GKH A;  4A3B H;  2XTI A;  3ULJ A;  4X64 Q;  4DR6 Q;  4B3R L;  3A5U A;  4JI3 Q;  2VW9 A;  1V2X A;  2KHJ A; 
#chains in the Genus database with same CATH topology
 4ZUJ A;  5C0X I;  1ZKO A;  4FXG C;  4JI6 Q;  4IOA A;  4A3F G;  2NB0 A;  1VQE A;  2ZJQ A;  3EQL C;  4A3L H;  4GKK L;  3I90 A;  4PMC A;  1SE4 A;  4G4K A;  5D3I B;  4BBR G;  2R92 B;  3SHL A;  2WKD A;  1Y8N B;  1SMX A;  2F0M A;  1Q81 C;  3PO2 B;  4DR7 Q;  4NXM L;  3U9S A;  2YV5 A;  4LFA L;  5C4J B;  1HNX Q;  4P2C B;  1STY A;  2LS0 1;  1KD1 C;  1VHK A;  1MSG A;  4X3U A;  1PZK D;  1HPC A;  1IBK L;  1WFQ A;  4WJ3 M;  5IT9 L;  1SJE D;  4K8J A;  5GM8 A;  4UPA A;  4A76 A;  3HKS A;  2IL8 A;  1A6X A;  2VB3 X;  4G7O C;  3KNU A;  5COR A;  4AYB E;  1JOR A;  3AXZ A;  4MTN A;  2R7Z G;  3L7Z C;  4DFA A;  2ASB A;  3N52 A;  3Q8D A;  4RWS C;  2HIX A;  1HCZ A;  2UXB L;  3ILK A;  1QG7 A;  1EEI D;  4CGY B;  2EXD A;  5M9O A;  5C4X B;  5BN3 A;  1GHJ A;  4C3J B;  4JI0 L;  1D1I A;  1W3S A;  1JWS D;  2F4V L;  3L3O C;  1BKB A;  2CFM A;  4DV2 L;  1VQC A;  1E1T A;  3FP9 A;  4JI7 Q;  4ZK9 B;  4BBS G;  1I4Q A;  4YQL A;  3S17 B;  1SE3 A;  1QJO A;  3DCM X;  4RMF A;  3C46 A;  1MHW C;  3HOV H;  1FJG Q;  1TS2 A;  2F0N A;  3ITP A;  2CWA A;  4POF A;  4LMQ D;  1QNK A;  1UEA B;  4KN7 C;  2TMP A;  4ZQ3 A;  4LF4 L;  4GLA C;  1HUN A;  2F0W A;  4DGZ A;  4O2D A;  4IPH A;  1VF7 A;  1BQQ T;  4C3I G;  3D6C A;  1PTO B;  2QW7 A;  1MJE A;  4DR7 L;  5HUR A;  1AE2 A;  1Y1V B;  2JA8 B;  2AWO A;  1ENF A;  1J85 A;  1K83 H;  2AQ1 B;  1VHY A;  1V1Q A;  1U4P A;  3I55 A;  1G6P A;  3M4P A;  3KLR A;  1HFG A;  1L1O C;  5E4X A;  1EQV A;  1A3V A;  1E24 A;  1QIL A;  4YQ4 A;  4A3C G;  4ZYS A;  1F2L A;  1HH2 P;  2QCP X;  1SMY D;  3K5O A;  2GVA A;  1EWC A;  4UHV A;  1ESR A;  1JR0 D;  4OX9 Q;  1WCM H;  2E5L Q;  1LTI D;  1E2V A;  4DV4 L;  2V4D A;  1D7Q A;  3OW2 A;  1B44 D;  2UXC L;  1I6H H;  2KEC A;  3F2U A;  1K73 C;  1X7O A;  3RR5 A;  2PI2 E;  1JQY D;  5E4W C;  4MCD A;  4Q0F A;  1I4G A;  5FOB B;  1BVS A;  1Q1B A;  1B3A A;  1YZ6 A;  2RCF A;  3KLW A;  4C1N K;  4C1N I;  4JI6 L;  1HXY D;  2YTV A;  3HOX B;  5KGU A;  3ERS X;  4JI5 L;  4DV6 L;  2Z9H A;  5IY0 A;  2WB1 E;  5GAH C;  3NUC A;  4OON A;  2OQ0 A;  1VDZ A;  1C0A A;  4K5V A;  3M7G A;  3H3V C;  4HIK A;  2E2J H;  3K8A A;  4YWM A;  1BCP B;  2N3S A;  2JXM B;  3DM3 A;  1Q86 C;  4WFN 3;  4YQ1 A;  5JJK A;  2R7D A;  5TSS A;  1PDQ A;  1I4R A;  1WJJ A;  1SBB B;  2VQF L;  1LTB D;  4GKK Q;  1D5M C;  1NR4 A;  2HQE A;  3G4S A;  3BZK A;  5IOC A;  1XWE A;  3RLN A;  1LT5 D;  1MKH A;  1V6Z A;  4V19 0;  1H9K A;  1IL2 A;  4OO1 H;  3S2D H;  1L0X B;  3QUV A;  2L5T A;  4UP7 A;  3CD6 A;  2BE5 D;  4ALP A;  2M9V A;  5C3E G;  1X7P A;  2KEE A;  4M8A A;  5IYC G;  4PZ7 A;  1TS4 A;  2FXQ A;  1BBW A;  2DNE A;  1N34 L;  1B70 B;  2PYK A;  2B2U A;  2EYP A;  2WP8 J;  1CT1 D;  1U4L A;  4JI1 Q;  1GUN A;  1RL2 A;  4DA2 A;  5HGT A;  2ID0 A;  3OOC A;  2JEA I;  3IAY A;  1LAC A;  3IFT A;  2EXZ A;  2NYZ D;  4B9X A;  3FKI G;  2CH4 W;  3VYT A;  2J4X A;  2UXD Q;  3BBD A;  4IZ8 A;  4O1N A;  4OWT B;  2F0I A;  3GTO H;  4JVZ A;  1TWF B;  3A55 A;  3GTQ B;  4MHE A;  1EFW A;  4JWJ A;  3S1Q H;  3J80 i;  2EYH A;  3FKI B;  3K0Y A;  3OMC A;  2A8V A;  4YQN A;  3LWE A;  3PO2 G;  5I9P A;  4YQJ A;  3HOY G;  4QIW E;  5L37 A;  3C1F A;  2Z4H A;  1SYF A;  3PF5 A;  4GLV B;  3O7B A;  3SK4 A;  2B2U C;  2LXK A;  2UUB L;  2K5N A;  4XT1 B;  1O6D A;  3BZC A;  3Q6S A;  4DV5 L;  1R4P B;  1VQI A;  2PPB C;  3TRE A;  3HGB A;  2EIF A;  2KHS A;  4LUO A;  3CMA A;  4KHZ A;  2EPB A;  1WTP A;  1PTO C;  3J80 E;  1B50 A;  1UUP A;  2K28 A;  5J39 A;  2RDH A;  2OWO A;  3FPU B;  1CZG A;  4XTC S;  2FMC A;  3OWE B;  2NN6 H;  1HZA A;  4U68 A;  3D8G A;  5ELE A;  1JOQ A;  4R8I A;  2P5Z X;  3D31 A;  4IFD H;  1RKN A;  3NQT A;  5J22 A;  3F2B A;  4C2M H;  5EKL A;  2NZH A;  4ZUI A;  2N88 A;  2V3K A;  1B53 A;  1VF5 C;  4FYD A;  1KQS A;  1II3 A;  1SFO H;  1P16 A;  3GTJ B;  4C3H G;  1PYS B;  2UUC Q;  1CK1 A;  4JI5 Q;  2YY8 A;  1BXT A;  1LM0 A;  2KEN A;  2PQE A;  5T1G A;  1XMQ Q;  4YVI A;  1VQH A;  3NBI A;  1AE3 A;  5FLX c;  1VMC A;  4LUZ A;  4GLX A;  1AH9 A;  4A3F H;  4A3K H;  2L55 A;  3H0G H;  1ILQ A;  1IHZ A;  3K59 A;  1I5F A;  3HEJ A;  2SOB A;  2JJQ A;  3CCU A;  3HOU H;  2EYF A;  1PRT F;  4LF8 Q;  4IFD J;  4MTK A;  1GUO A;  5LMN L;  1MSH A;  4KDZ A;  1UWV A;  1ZYR C;  1KC8 C;  4XBO A;  2K5W A;  2F0F A;  3CKI B;  1WTR A;  3RZO H;  2A69 C;  4IOC A;  1TWA H;  3A54 A;  3I4L A;  4P71 A;  3KF8 B;  4YCW A;  1SAP A;  4IPD A;  3S2H B;  3S16 H;  4RHS A;  1HNW Q;  2PW5 A;  1A3U A;  3F2C A;  2WFW A;  4IAL A;  2PCF B;  1VQ7 A;  4BXX G;  4A3G H;  1IBM L;  2Q2T A;  2BH8 A;  1Q8K A;  3CQZ H;  3MWY W;  4DAM A;  1F2Z A;  2F0J A;  4LF4 Q;  4A3M H;  4GOP B;  3SVM A;  2NBF A;  1T5X D;  4ABN A;  1I50 B;  3MAQ A;  2QGQ A;  2Z6K A;  1SYC A;  2B8G A;  4PMB A;  5AJ3 L;  1FYC A;  3HZX A;  4DR2 Q;  2L11 A;  4POG A;  3GTG B;  5EKK A;  1JT8 A;  1UAJ A;  3BJU A;  3GYQ A;  3S1R B;  5GMC A;  2A69 D;  1AW7 A;  1S4Z A;  4G7Z C;  1B2T A;  4KD4 A;  2JEB I;  1TWF H;  4EQP A;  3GTQ H;  3GTO B;  2I46 A;  2HA8 A;  4DUY L;  5IT9 c;  2OT2 A;  1K8A C;  1HUM A;  4V0B A;  2VQE Q;  3ONP A;  2NVY B;  5C44 H;  5FK9 C;  3UDG A;  1I94 Q;  2C5C A;  4AH6 A;  4OX9 L;  1A15 A;  1WTH A;  1Z6H A;  3TRZ A;  1Z47 A;  1LT6 D;  3PIP 3;  3EJI A;  1Y8P B;  1M1K C;  3E0E A;  2K01 A;  3CQZ B;  2JA7 G;  3G71 A;  1D1K A;  4LFC Q;  3NEL A;  1FD7 D;  2F0D A;  5IGF A;  4O0A A;  2A6H C;  3P20 A;  5C5L A;  4HED A;  4X3K A;  3E3X A;  5IP9 H;  1QVF A;  3I70 A;  1LTL A;  3FDT A;  1VCI A;  4ZAI A;  3BDC A;  1WTW A;  4NW2 A;  3K7A B;  3ER0 A;  5CBA E;  5JVH 3;  4HIO A;  2Z1C A;  4F88 A;  3J81 c;  4QB4 A;  4KY6 A;  1NMG A;  2QMM A;  2F0P A;  4YQ8 A;  3T1Y L;  1KLU D;  2KA7 A;  4X65 L;  4OXP A;  4JI0 Q;  3L9A X;  5D65 A;  4YHH L;  1J6Q A;  3E6Z X;  1VS0 A;  3K80 C;  3HOU B;  4KK7 A;  1KTK A;  1K28 A;  4KY7 A;  5A2Q L;  3TDQ A;  3NBH B;  5H1S E;  4A3K B;  1EYG A;  2O3A A;  2F0K A;  2KOL A;  2IJ0 A;  4IUV A;  2MP1 A;  3AFQ A;  5CV4 A;  1U9R A;  4DK0 A;  4JI2 L;  2OTL A;  1SYB A;  4C3J G;  4CDE C;  4IUP A;  1IYV A;  3SEB A;  3KY7 A;  3ND8 A;  3M3Y B;  2F0Q A;  1TY0 A;  2ATW A;  5I6W A;  4X3M A;  1EWI A;  2QF7 A;  4HR7 B;  4YPX A;  2HHH Q;  2B2Y A;  2R7Z B;  4MCB A;  4DUY Q;  1GKH A;  1WD1 A;  4LF9 L;  3TZU A;  2PW7 A;  4NMZ A;  3OPO A;  2NZO A;  4LF7 Q;  1X54 A;  1DYQ A;  1QUQ A;  3A7A B;  1X3E A;  1KL9 A;  3N4J A;  2E8G A;  4LFC L;  1VQ9 A;  3J7A F;  3NWS A;  1X9N A;  3RZO B;  1LUZ A;  3CW2 C;  3KBX A;  2I6D A;  1Q3L A;  3CCL A;  2B63 G;  4UAI A;  1KLG D;  1CQV A;  1PFS A;  1U4M A;  1KRT A;  1BCP C;  4GNX B;  1EY9 A;  3Q23 A;  3H3V I;  4H3Z A;  2MO0 A;  2R93 H;  4DAY B;  1R4Q B;  3S1N B;  4DV0 Q;  5K36 G;  4IJL A;  3QJY A;  4L63 B;  1K8G A;  2CH4 A;  1Y1V H;  3K0X A;  4YY3 Q;  2UUA L;  4BY7 H;  4J6H A;  3SK6 A;  5AJ3 Q;  1SNP A;  1YNX A;  2O2L D;  3JC6 6;  2BDN A;  4GOP C;  1FVI A;  3J7Y W;  1HNZ Q;  4JI2 Q;  1E1O A;  1HRJ A;  3KFU A;  2AQ3 B;  5A2Q E;  3P7J A;  5FKA C;  1SNO A;  1TWC H;  1YNN D;  2AKW B;  1WI5 A;  1CQF A;  3MXU A;  3I4M G;  4L69 A;  3PQI A;  2J7Z A;  3H91 A;  4JK1 C;  2F4I A;  2OEO A;  2L12 A;  4GNX A;  5D9F A;  1VQF A;  1JIC A;  4A3I B;  5JJI A;  2UXC Q;  2RF4 A;  3NK6 A;  1G91 A;  1TVX A;  3MFG A;  5IOD A;  5FJ8 H;  3X3M A;  2NTS A;  5KND A;  4HIM A;  4JWH A;  1NJI C;  1HFN A;  4MIU A;  1SE8 A;  1YI2 A;  3GQB A;  1EIH A;  4DR5 L;  2K50 A;  2KVM A;  5JEA H;  3BDL A;  4B3M L;  1Z9F A;  1CI3 M;  4DV4 Q;  1Y1W B;  4JBM A;  3VYR A;  4IN3 A;  4ME3 A;  1S5B D;  3NTH A;  1VQA A;  2XWJ B;  2CWP A;  1PH9 A;  5C44 B;  1O7Y A;  2L0C A;  3KJO A;  2NN6 G;  1C48 A;  4YQR A;  1TII D;  3IRB A;  5JPM C;  3TN2 A;  3RZD H;  4DR3 Q;  1OXX K;  3DWQ A;  3BVG A;  4CDF C;  4YQI A;  4A3G G;  3J81 L;  2F0V A;  4KV6 A;  4LWC A;  2L1B A;  2B2V A;  4YWL A;  1NR2 A;  2WIN B;  1Q1E A;  2H1E A;  2MJ8 A;  4ULL A;  4JWG A;  3PO3 G;  2F1M A;  4A3E G;  3EFX D;  3P75 A;  3D3R A;  1CSQ A;  1SN8 A;  1RCV D;  4IUU A;  1B7Y B;  1V1P A;  2DGY A;  2K4K A;  2H5X A;  2EJM A;  1C9O A;  2WAQ B;  1X3P A;  2K33 A;  4K0K Q;  3KYH C;  3J81 j;  1HNZ L;  5JEA G;  4A3M B;  2B63 B;  3GV3 A;  1YNJ C;  4YCU A;  3I72 A;  4K6D A;  3FEW X;  4YPY A;  5HGQ A;  5M3M G;  3AI9 X;  5A35 A;  4YVG A;  1H9S B;  2F4V Q;  2BA0 A;  1N32 Q;  1KIX A;  4LF5 Q;  1IL8 A;  1QOH A;  1WCM B;  1N8R C;  4AYB B;  2NVQ B;  2I07 B;  2NTT A;  2XNA C;  4LAA A;  1KAB A;  3NP8 A;  1T9H A;  3HKZ G;  4ILW A;  2IY5 B;  5IGE A;  4OO1 I;  4TKO B;  3ONA B;  2E2D C;  4DV0 L;  1D5X C;  1QVG A;  4H44 C;  5J1Z A;  1NTG A;  2NUC A;  4L6T B;  5E1F A;  3HOZ H;  1A8V A;  1K83 B;  1YJW A;  1K3R A;  2HIV A;  1HA6 A;  4A3F B;  4JV5 L;  3U4Z A;  1RTN A;  5IYD G;  5D14 A;  1EIF A;  1STE A;  1V9P A;  4K2L A;  3ND9 A;  2VQF Q;  4X66 Q;  2BA1 A;  2JA6 B;  1RJT A;  2C9O A;  4J15 A;  5DM7 3;  4KD3 A;  2ZJP A;  2RQX A;  3C2P A;  2LSS A;  2HHH L;  4HID A;  1X6O A;  1YVC A;  4QUF A;  1SFO B;  1HTL D;  1VQN A;  3QWN A;  2X6G A;  4BWG B;  3H15 A;  4C3I B;  1DOL A;  4MCC A;  1JB3 A;  4DK1 A;  1DD2 A;  1WTQ A;  2NZ1 D;  1FL0 A;  4DAP A;  5IE8 A;  3RLO A;  1O78 A;  1G29 1;  2AWN A;  3E5S A;  4KJN A;  5EBD A;  1VQL A;  3W5O A;  1X32 A;  3HOW G;  1W6J A;  3OTO Q;  4J8Q A;  3ZYY X;  4TSS A;  4RCO A;  2K32 A;  4JI1 L;  2OCE A;  4YHH Q;  4RGO S;  2F0S A;  2EY1 A;  3SR1 A;  1KHI A;  2F03 A;  2IX1 A;  2E5L L;  4LNQ A;  1G2T A;  1MJC A;  4H0L C;  3KK7 A;  1EIG A;  1CFM A;  2SDF A;  1X55 A;  3T1Y Q;  2KCC A;  1HJP A;  3PV0 A;  4X6A H;  1G2S A;  4BA2 I;  2XVS A;  5C4J H;  2LKV A;  1AZQ A;  3PO2 H;  2ZJR A;  1O7L A;  2NVT B;  5HY6 A;  2F0L A;  4KKU A;  3KLS A;  3IL8 A;  2O5I C;  4OIK A;  1ZEQ X;  2EE1 A;  4UY8 C;  2KQ3 A;  3S1Q B;  1ESF A;  1RDP D;  3NEM A;  1FNV A;  2K75 A;  5F2D A;  5BR8 L;  1OXS C;  3QR8 A;  3AU7 A;  5KNB A;  2A68 D;  4HAE A;  5FLX E;  1I94 L;  1MXI A;  3T1H Q;  1SSO A;  5IP7 H;  2GA4 B;  4G7H C;  1EQT A;  1H9J A;  4H7B A;  4BY7 G;  1YJ9 A;  1N34 Q;  1I3Q H;  1PZI D;  2A1A A;  1WTO A;  1PFN A;  1VQD A;  4BBR H;  3FRP B;  4WJ4 A;  5CGK A;  4QIW B;  5KYI A;  1B9N A;  3M4O H;  1EYC A;  3S15 H;  1ASY A;  1KDC A;  1PFB A;  4QJF A;  4P74 A;  2WB1 G;  3S15 B;  1EY5 A;  1SYD A;  2M2L A;  2Q8T A;  4R8N A;  2PZT A;  4DAV A;  4BBR B;  4ZKB B;  1VQ8 A;  3K5N A;  2GN5 A;  5IYC H;  1VMP A;  2KCN A;  4H02 A;  1O80 A;  5CV8 A;  3S2D B;  3A8K E;  1HR0 Q;  1YBY A;  3EBE A;  4F7X A;  4AIM A;  3TS2 A;  2CHB D;  2E75 C;  4H3Y A;  1AEX A;  1EY7 A;  1SDF A;  2VXW A;  2B2V C;  5I2X A;  5ELD A;  3OW7 A;  3NSW A;  2KHI A;  2AQ2 B;  1V43 A;  2K6A A;  3I4O A;  1ILP A;  4ME5 A;  1Q46 A;  4R4T A;  2UUA Q;  5KNC A;  3NE5 B;  2F0H A;  3S14 B;  3KF6 A;  3PUY A;  1UNS A;  1V1O A;  1IW7 C;  1STH A;  3KOJ A;  4JBW A;  1DXM A;  2Q8R E;  5K36 H;  2ZT9 C;  1Y1V G;  3DUZ A;  3KBG A;  2R3Z A;  4A3E B;  1JMC A;  1B8A A;  1E0B A;  4PNY A;  4RG1 A;  5CR3 A;  1N36 L;  1SNC A;  2G9D A;  3GDE A;  3TSS A;  1VQO A;  2K7V A;  3T51 B;  4B3S Q;  4LF8 L;  1CHQ D;  4FP5 D;  4KHV A;  2PZW A;  1TWH B;  3BVM A;  2R92 G;  1X3F A;  2WII B;  1QZG A;  4IUT A;  3MXN B;  3AMU A;  4IUQ A;  3TME A;  2B3G A;  3L0O A;  3CF5 A;  3AFP A;  1X3Q A;  4X3T A;  5LMU Q;  2MO1 A;  3BG3 A;  4RGT A;  2B8F A;  3PCO B;  1KDB A;  1PZJ D;  2HUG A;  4GNX C;  2RHS B;  5LL6 S;  1H9S A;  3J81 E;  4OO1 G;  1OXV A;  1IKM A;  2MHV A;  1ZYR D;  2Q2U A;  3V2T A;  1Q82 C;  4OWW B;  3W1B A;  1OXT A;  1L0W A;  3CU7 A;  4H13 C;  3UDI A;  5FLM G;  3GP7 A;  4RAU C;  2E74 C;  2RA4 A;  5M3F B;  3HOV G;  1A0I A;  1ICW A;  4RCN A;  4ZCK A;  1PH4 A;  3WWV A;  1EQQ A;  5ELN A;  1YIT A;  2EOT A;  2H4O A;  3VYU A;  1KXL A;  3R2T A;  3TS0 A;  2PI2 A;  5I6Y A;  3DMU A;  3HFZ B;  1EU4 A;  4K14 A;  1B9M A;  1V1P B;  4X65 Q;  5T1I A;  3CAM A;  2MPM A;  4ZLT F;  3DWP A;  2F52 A;  2BCO A;  3NK9 A;  1CSP A;  4P72 A;  1ZJR A;  4YQK A;  2B29 A;  4XQJ A;  2EYJ A;  4K5W A;  3CCR A;  5I9O A;  1GUS A;  3GTL H;  1HQM C;  2ZM6 L;  2F0T A;  3S14 H;  1UE5 A;  1OXU A;  2DNC A;  2K5H A;  1ROD A;  4GN3 B;  4JG2 A;  2YU9 H;  1JE5 A;  5GRO A;  4YQ7 A;  1XMQ L;  1EUJ A;  3V05 A;  1Y69 U;  2Z0Y A;  3SXH A;  3H6M A;  4CKB A;  3J80 c;  3TEH B;  3PIP A;  3BYY B;  4HTH A;  3PO3 H;  4L5Q A;  3J80 L;  3SK5 A;  1AP0 A;  2DUD A;  3KJP A;  2AUK A;  1DGS A;  1KDA A;  3HOW B;  1XPU A;  5M3F H;  2UXB Q;  3A56 A;  4DNT B;  3I8Z A;  4MN3 A;  4CBV A;  1W2B A;  1VQ4 A;  4IUR A;  4BBS H;  1PYW D;  1SRO A;  2E2H B;  3MTS A;  1UE7 A;  4LFB Q;  1GVP A;  5C5M A;  4DNI A;  3FHW A;  3M4O B;  1HTP A;  1XMO Q;  3PUV A;  4YQ3 A;  1XMO L;  2NWG A;  2JK8 A;  3MFY A;  1TR5 A;  1STN A;  4RKB A;  3D4D A;  5COY A;  3M7N A;  4IPC A;  4XXE A;  4ZRZ A;  4A3B H;  1KNE A;  1S5D D;  4DR6 Q;  1Q8I A;  1V2X A;  4L8J A;  4YQA A;  1CKO A;  1IW7 D;  2HCI A;  5EPK A;  4DR3 L;  5KIX A;  2DJF C;  2FIN B;  4HSV A;  2EYO A;  4PQX A;  3T56 B;  5FO9 B;  3LNN A;  2QEJ C;  4RGN A;  1EOV A;  2D5D A;  3J7A V;  1YNJ D;  1NNX A;  3CCJ A;  5EPJ A;  1DJR D;  2ZXR A;  1Z7T A;  2NVT H;  1H95 A;  3JAM i;  1VQ5 A;  5GAG C;  1JWU D;  1E7Z A;  2CW0 D;  1KAW A;  1XX8 A;  2CKZ B;  3FMC A;  1MBY A;  3CME A;  4I65 A;  2R7F A;  4QQB X;  3W2D A;  4RFB A;  1F2M A;  1R9T H;  3T53 B;  2N55 A;  4EQN A;  3HOY H;  2ES2 A;  4X3S A;  2OQK A;  4YQQ A;  3SDZ A;  3CC4 A;  2N49 A;  5K5P A;  4DV7 L;  1PH8 A;  4X62 Q;  1X56 A;  1IPA A;  1UAM A;  1E2W A;  4BBS B;  4YCV A;  1GJX A;  3CC7 A;  2QEX A;  4KN4 C;  3T16 A;  5CBE E;  4DR5 Q;  1UEB A;  2SNM A;  3EN2 A;  4FF3 A;  1O7Z A;  2EZV A;  2YYZ A;  3H09 A;  1EEF D;  3PO3 B;  1FJG L;  2PMZ E;  1CM9 A;  2ENB A;  1DCZ A;  3FPP A;  5EKI A;  4L5T A;  5IYB H;  3PGZ A;  3F2D A;  1PRT D;  1UAP A;  3VR4 A;  1V8Q A;  3OYY A;  2HT1 A;  2CX8 A;  2EYL A;  1MGS A;  4RHR A;  4IQZ A;  4CNG A;  3SK8 A;  4ZKC B;  2KJX A;  2AUJ D;  4DR1 Q;  2UU9 Q;  3CRL C;  2PO4 A;  3K6O A;  4QCL A;  5M5Y B;  3R2I A;  2EJG C;  4A93 G;  1ET6 A;  3PUW A;  1ET9 A;  4UP9 A;  1IZ6 A;  1N36 Q;  5BR8 Q;  2BDO A;  3DM1 A;  2VUM B;  2B2W A;  1CTM A;  3KLS X;  3O13 A;  1PVO A;  2CCZ A;  4FF1 A;  1MI2 A;  1XJV A;  3NTK A;  4YQC A;  1RF2 D;  4F87 A;  1SNQ A;  3HOZ B;  1EZ8 A;  1E2Z A;  2XSC A;  2R93 B;  1TS3 A;  4BY1 H;  4XDX A;  4EQ5 A;  1NS5 A;  5JVG 3;  1LT3 D;  4A3J H;  2F3W A;  1EL0 A;  2O4X A;  5I4D A;  4LFA Q;  4A3K G;  1ML0 D;  4DV1 L;  3G6J B;  2JSO A;  3MXN A;  4KHP Q;  4DV5 Q;  4XQN A;  4X64 L;  5CO4 A;  3VA5 A;  4YQ2 A;  2WAC A;  1GHK A;  1CA5 A;  3HKZ B;  1PV4 A;  3WOF A;  2JA6 G;  1GUT A;  3E5Y A;  2PZU A;  1NCV A;  3TP8 A;  4HJ5 A;  2B63 H;  2L9H A;  2R7Z H;  1X3G A;  1CKM A;  2UUC L;  3BYT B;  3KF6 B;  2K05 A;  4A3E H;  3X3N A;  1SYG A;  1C8C A;  1I4P A;  4YY3 L;  1GZ0 A;  3H0G G;  3GTK H;  4FDB A;  2LXJ A;  3WDN A;  2G5D A;  4AQY Q;  3UE0 A;  1C4Q A;  4UDU C;  1VQP A;  1SYE A;  1ENC A;  3LWU A;  3K5L A;  4CNF A;  4YQD A;  3STB D;  4R4I A;  4JBJ A;  1F9P A;  3OIJ A;  1STA A;  4A93 B;  4CNE A;  2X69 A;  4DV3 L;  4OWX B;  4A3D B;  3SE0 A;  4IFD G;  3H94 A;  2RCN A;  2XRQ D;  4Z9C B;  3UI2 A;  2XN9 C;  4IUN A;  2DY8 A;  1NY4 A;  2EY6 A;  3NHH A;  1N33 Q;  3MC0 B;  2JN4 A;  1FNU A;  4N9P A;  1PRT B;  1FGB D;  5FLX L;  3J7Z C;  5NUC A;  4DK3 C;  3OTO L;  1PXU A;  1YHB A;  1LLR D;  3LGJ A;  4DR6 L;  1PFM A;  4A3C H;  4YVJ A;  3U4V A;  3T13 A;  4YQP A;  2CQA A;  3A5Z B;  4XIG S;  2VY3 A;  1SND A;  5IYD H;  1PHJ A;  1UE1 A;  2EQS A;  3BBE A;  1TWC B;  2X6L A;  4YQ0 A;  3A8I E;  3OSO A;  1I4H A;  4EQO A;  3OHX C;  4B9W A;  3JAM c;  4CDD C;  3CCV A;  5AFW A;  5KRU A;  2EDG A;  4KJO A;  3IEF A;  2A6H D;  4KI0 A;  4CJ1 B;  2Q2H A;  3DWA A;  5M5W H;  4O42 A;  1F77 A;  2Y0S B;  4NKL A;  2ICE C;  4EVO A;  3TBI B;  1YHQ A;  3I4N H;  4HCS A;  3LX0 A;  3T1H L;  4A3B G;  4GZY C;  1QZH A;  1RTO A;  2A6E D;  2D9U A;  4GN4 B;  4XT3 B;  4R4C A;  2HDM A;  3RZD B;  5DM6 3;  3GTG H;  1YNN C;  2IW3 A;  1KRS A;  2HDL A;  4JI4 L;  3UDF A;  1PH7 A;  3A74 A;  4OHJ A;  4NXM Q;  5GAD C;  4MNO A;  4BXX H;  1CKN A;  4HJ8 A;  3K57 A;  3AEV A;  1Y1W H;  2GVB A;  2VS1 A;  2K03 A;  3MXP A;  2EGV A;  1N9W A;  1BNZ A;  1OO9 B;  3CCE A;  4A3G B;  2G9H D;  2R61 A;  3B6Y A;  4QF4 A;  1GXD C;  4NB3 A;  3QG1 A;  4HJ9 A;  3S16 B;  1XNQ L;  4QGU A;  2MQH A;  1J5E Q;  2O5J C;  1Y8O B;  4YQ6 A;  1TWA B;  1WVL A;  2YTX A;  4A3I H;  1HA5 A;  1L1O B;  3TQY A;  4G57 A;  1E3P A;  5DNF A;  1PA6 A;  1BBX C;  5EAY A;  1WCM G;  4CJ2 C;  1VQ6 A;  3QB3 A;  3K7U C;  3RNU A;  2ZTD A;  4C3I H;  4EX5 A;  1B1Z A;  1U0L A;  3M4Y A;  4IJH A;  4RH6 A;  3K58 A;  1XNR Q;  1IXR A;  1JOK A;  2QDL A;  1TU2 B;  3S1M B;  3RD4 A;  1YEZ A;  1H9R A;  4BY7 B;  2F0G A;  1EFI D;  1L2F A;  3D0F A;  5IGG A;  1SXT A;  3S1M H;  4JYA Q;  2MFI A;  5GAE C;  3V96 A;  5IYB G;  4B3S L;  4M1U B;  3U50 C;  3ULP A;  3I91 A;  2Z6B A;  5IP9 G;  3GTM B;  2JE6 I;  5E7N A;  1DZ1 A;  2CW0 C;  3GTJ H;  3PIO 3;  4YVH A;  1BBU A;  4DPG A;  4CJ0 B;  2SNS A;  3MA2 B;  1J8I A;  1U5K A;  1TY2 A;  5ELO A;  5CC4 A;  1W6K A;  4R9W A;  2BOS A;  2NVQ H;  4DV3 Q;  1CHP D;  2EJF C;  3D4R A;  3R3O A;  3U9O A;  3K7A H;  3E0J A;  1G6Z A;  3AIA A;  4FAK A;  2KED A;  5LMN W;  5ELF A;  1WYD A;  1C7Y A;  1K3B C;  3DEP A;  1L1O A;  3F8T A;  2HD3 A;  1YIJ A;  4JI7 L;  2IHF A;  4K8I A;  3HG9 A;  4YQS A;  5M5X H;  3HS0 C;  2JA8 G;  3AYH B;  1IYU A;  2IX3 A;  3RMH A;  4QUC A;  2QKI C;  5GMB A;  2B2W C;  2AHO B;  1XYI A;  4E8B A;  1SMY C;  1MIU A;  2JA5 H;  5CV7 A;  4QY7 A;  1F2Y A;  4FF2 A;  1IKL A;  1TQO A;  4DV2 Q;  3M3Y H;  4J1M A;  2ALY B;  5JOB A;  4LF6 L;  2F3I A;  2PMZ B;  1K9M C;  5C3E B;  1TXY A;  4CND A;  1D8L A;  4FXK C;  3GV6 A;  3RN2 A;  1S40 A;  3MHB A;  1LTG D;  1NAP A;  3FKI H;  3STB C;  4DUZ L;  1RIP A;  4PV1 C;  4LF9 Q;  1HHV A;  1TS5 A;  3GD7 A;  4AYB G;  5CV6 A;  2PNR C;  3JAM L;  5C3E H;  1G8Z D;  5IGD A;  3NK7 A;  4JPB W;  2IPK D;  4C56 C;  2QDB A;  4NPS A;  3EIV A;  1I50 H;  4YWK A;  4DKA C;  4OEM B;  2JA5 B;  2MGS A;  3RN5 A;  5LMN Q;  1TO0 A;  2JA9 A;  1IBK Q;  1H9M A;  5M5X B;  4X62 L;  1F9Q A;  1EY4 A;  1P8L A;  3QOJ A;  1JE4 A;  3C1E A;  1PMR A;  2JA5 G;  1I6V C;  3HOU G;  1GO3 E;  4YIJ A;  4FO2 A;  1VQK A;  1SE2 A;  1YHA A;  3TZD A;  2K5Q A;  3GO5 A;  3D6W A;  4HCE A;  2Z8L A;  5DAU A;  3N6R A;  5C3W A;  4IFD I;  2WB1 B;  5IGB A;  4OGQ C;  2L4N A;  4FNF A;  4LW1 A;  2NN6 I;  3J7A 5;  4BA1 I;  3AQQ A;  5FO8 B;  4B3R Q;  4AQY L;  3H3V H;  4IPG A;  2PQA A;  3VR6 A;  1LTR D;  4DXG A;  1PH5 A;  2A68 C;  1NXZ A;  3ICE A;  4CKE A;  5EJW A;  1SRU A;  4JAL A;  1B4O A;  2N78 A;  4JCV E;  1T5E A;  3I4M H;  3I3C A;  2NVX B;  4Y52 H;  1M90 C;  3HRZ C;  2N8N A;  5J3B A;  4RGM A;  4B3T Q;  4R4O A;  5LHY 1;  4A3M G;  1PH2 A;  4DAY A;  3GTK B;  1ASZ A;  3GTP H;  5JEA J;  4GS3 A;  2F0U A;  5M3F G;  3HOZ G;  2E2I B;  5D3D A;  5G3L F;  3EA6 A;  1JJG A;  3QOL A;  4PMW A;  3S1N H;  1KAA A;  4DR4 L;  5E3F A;  5CV9 A;  4K5X A;  2XTI A;  1JWM D;  3ULJ A;  3A5U A;  2KHJ A;  3TP6 A;  3QIA A;  2DN8 A;  3G7L A;  1RD9 D;  2A74 C;  4XQQ A;  4FMW A;  1QUQ B;  5C0X G;  2VZA A;  2CQO A;  2I5H A;  3S2H H;  1TWG H;  5EGT A;  5BN4 A;  1DOK A;  1TWG B;  1EQR A;  3ERQ A;  1STB A;  2QIL A;  2SEB D;  2B2T C;  4A3J B;  4KKT A;  1Y1W G;  3CHB D;  4GN5 A;  5ELC A;  1Q90 A;  5IWA L;  2UXD L;  2K04 A;  2KCT A;  5FLM H;  2E2I H;  2FFK B;  4TRD A;  4CKC A;  3VDY A;  3H0G B;  4YQT A;  1MD2 D;  4DR1 L;  2UU9 L;  3GTP B;  3NTI A;  1PTO H;  3NBH A;  1SR3 A;  1NUC A;  1AFP A;  2EGW A;  4K0K L;  5CYU A;  4DXF A;  1EYA A;  1DON A;  3IC6 A;  2NVX H;  3I4M B;  4LK1 C;  4RA8 A;  4DV6 Q;  2DJG C;  3NEN A;  1EOT A;  5M5Y H;  5M5W B;  3E9H A;  1QB5 D;  2XGT A;  4DUZ Q;  5LL6 X;  3HOV B;  4DU9 A;  1Q7Y C;  3I4N G;  2L15 A;  2EY5 A;  3WOE A;  2VQE L;  4A75 A;  1FR3 A;  4HMJ A;  4XYQ A;  3S17 H;  1IYJ B;  4NXN L;  1AZP A;  5LMU L;  3NWT A;  4C2M B;  3CCS A;  3ULL A;  1D5Z C;  1Z85 A;  4C3J H;  4KHP L;  5C44 G;  4KLK A;  3CPW A;  2RBM A;  2B39 A;  4OL7 A;  1PH6 A;  2OXP A;  1A2U A;  5IP7 G;  5JJL A;  1HZB A;  3MEF A;  1WTV A;  2WKC A;  5IIF A;  3ZJY C;  3RUZ A;  4A4I A;  2KUM A;  4NP5 A;  4I7A A;  5KEE A;  1J9O A;  1O7I A;  3VR3 A;  2C35 B;  4LF5 L;  5GQO A;  1HR0 L;  3IKJ A;  4P75 A;  4PG3 A;  2E76 C;  5C4H A;  4B3M Q;  3OIP A;  1FNW A;  2LY7 A;  3HP3 A;  3OII A;  4ID6 A;  4JWF A;  2NVY H;  4A3I G;  1A2T A;  1PYB A;  2QA4 A;  4L5R C;  4UP8 A;  4A93 H;  3JAM E;  4JOI C;  3KTY A;  1PLF A;  1E22 A;  3MXG A;  1YJN A;  3D4W A;  3P1H A;  3OIN A;  2RDF A;  3BDO A;  2LFN A;  4DR2 L;  3S1R H;  3I4N B;  4A3D G;  1K8O A;  4PZ8 A;  4GOP A;  5EQ0 A;  1WTX A;  3W1G A;  4QMG A;  1JOO A;  4CHT B;  1RHP A;  5C4X G;  3PIO A;  5ELB A;  5EPL A;  4A3J G;  4RKL A;  1XTC D;  2PQA B;  1L0Y B;  4ODG A;  1LTT D;  2IWH A;  2IX0 A;  4S3S A;  3UE1 A;  4NDX A;  3BBH A;  5FAI A;  2A73 B;  3CP0 A;  2KCM A;  3KF8 A;  1JB7 A;  1ZXT A;  1PTO D;  1SJH D;  4DV1 Q;  4B08 A;  4DV7 Q;  1I6H B;  1QE6 A;  1P9P A;  2A5H A;  3Q24 A;  1SLJ A;  3KDF A;  4JW0 A;  4JOI A;  1QCB D;  3K5M A;  1F9S A;  2V1C C;  1A62 A;  2Z4I A;  4FXD A;  3BS1 A;  5C6A A;  3DEO A;  4A3D H;  5CV5 A;  5BN5 A;  4BY1 B;  2Z0S A;  4JAK A;  5EBC A;  3CCQ A;  2EY2 A;  2IHE A;  3GTM H;  2F0E A;  2IT1 A;  2A19 A;  1VH0 A;  1TT2 A;  2BH2 A;  4CDC C;  2JA8 H;  1K8M A;  4X66 L;  3NPP A;  4TQU S;  2YU9 B;  2K5V A;  4WJW A;  2B2Y C;  5I2Y A;  4HN7 A;  3KUP A;  3BVZ A;  1G51 A;  4JV5 Q;  2FJ2 A;  1NE3 A;  4JI3 L;  3GTL B;  3DXJ C;  2J0T D;  3PUX A;  1GUG A;  1WD0 A;  1HQR D;  4K2K A;  2AMC B;  3BU2 A;  1DOM A;  4JI4 Q;  4NXN Q;  5IT9 E;  3EVQ A;  4IG6 A;  3CCM A;  1S72 A;  4GKJ Q;  3W3A A;  2D0P A;  2VUM G;  1GUW A;  3HOX H;  4JBK A;  3PSI A;  3PUZ A;  4JI8 L;  1M4V A;  5G3L D;  1CZW A;  2Y0S G;  4B3T L;  2A6E C;  1PTO F;  1IBL L;  1X65 A;  2R6G A;  4XYO A;  4F8M A;  5KYL A;  3I73 A;  1B3Q A;  3I2Z A;  1HZC A;  1FGU A;  1XNQ Q;  4N8X 1;  4QL5 A;  1N33 L;  3R93 A;  1EYD A;  5FO7 B;  4GKJ L;  1LTA D;  2R93 G;  2TSS A;  4N9T A;  1HNX L;  2ZXP A;  1A3T A;  4JI8 Q;  4KMU C;  1BF4 A;  3SGI A;  3I7F A;  1BR9 A;  1BO0 A;  2OTJ A;  1PH1 A;  1ENA A;  2RSN A;  1I4X A;  3CRK C;  4APV A;  3L8U A;  4A3L G;  1EY6 A;  1QNU A;  2V3J A;  2VNU D;  2K1B A;  3T4A C;  3VR2 A;  1GOZ A;  3HKZ E;  5C3X A;  2I0Q A;  1HNW L;  4R1J A;  1TWH H;  1BOS A;  1BDO A;  2ZM6 Q;  1VQG A;  1GD7 A;  4K6L A;  3MZ5 A;  2VUM H;  3VR5 A;  1KNA A;  2WV6 D;  1S5C D;  2R92 H;  1Q12 A;  3C3L A;  4YQB A;  2K14 A;  4YQ9 A;  1K0S A;  3K81 C;  4HSP A;  2BE5 C;  3Q0A A;  5C0X J;  2K5D A;  5JJZ A;  1STG A;  1CUK A;  3F1Z A;  1QVC A;  2YTY A;  5IGC A;  2VB2 X;  5C4Z A;  2DY7 A;  2EVB A;  1A63 A;  1XTD A;  1S5F D;  4J3C A;  2JA7 H;  3CC2 A;  1SNM A;  4DR4 Q;  1EZ6 A;  2K52 A;  2MNA A;  4JC0 A;  4P73 A;  1HR0 W;  2FMM A;  3U58 A;  2RDG A;  3S24 A;  1XPR A;  1SEB D;  4Y7N H;  3DLL A;  4YVK A;  5M3M B;  3DHQ A;  4WRD A;  1UE6 A;  1XPO A;  3OMG A;  5JPN C;  1VQM A;  1K0R A;  2E2H H;  3HOY B;  5M3M H;  5C0X H;  4YQ5 A;  1D6E C;  3G48 A;  1OY5 A;  4OIJ A;  1LV9 A;  4LF6 Q;  1PRT C;  1CKN B;  1XNR L;  1NMF A;  2MUY A;  1J5E L;  1S3O A;  3PF4 A;  3UDX A;  2VL6 A;  3CXC A;  3L2P A;  4IO9 A;  2JA7 B;  4E6I A;  4Q5V A;  4PZK A;  1XXG A;  3A0J A;  5DLQ E;  2EYM A;  3FVQ A;  3M9B A;  4U67 3;  2D62 A;  2F3V A;  2ZTE A;  3TP7 A;  2B2T A;  2RHQ B;  1HZ9 A;  2Y0S E;  4JYA L;  3AB9 A;  2E2J B;  3VA7 A;  4HJ7 A;  1EY8 A;  3MEH A;  2FHT A;  4YQG A;  2HQL A;  3N4K A;  2XRS D;  4A3B B;  4KY5 A;  2OF1 A;  1TKW B;  4DNR B;  2KBN A;  1ICF B;  3G6E A;  4KTA A;  4C3H B;  1JJ2 A;  1JCK B;  4BS9 A;  2RSO A;  3KDF B;  3Q22 A;  1S5E D;  4KGN A;  2JP1 A;  3CPF A;  2Q8I B;  1U4R A;  1NSN S;  5DEH A;  1LYL A;  1AN8 A;  1EY0 A;  1PH3 A;  2HCC A;  2I5L X;  3VYS A;  1IBM Q;  2WAQ E;  2I5M X;  2D2C C;  2LMC B;  2JYO A;  2Z6K C;  5JAV A;  2M00 A;  1BCP F;  1LT4 D;  4BY1 G;  2CVR A;  3HOW H;  2ICI A;  4DN4 M;  1WOC A;  3NXW A;  1LTS D;  4YPW A;  1VQJ A;  1DM0 B;  2Q2I A;  3M85 A;  1GM5 A;  4YPZ A;  3RLF A;  3MVV A;  4N8F A;  1VQB A;  4TVA B;  4KKS A;  1JC7 A;  3A8J E;  3KW2 A;  1QWY A;  1LO5 D;  3PMF A;  4YQO A;  3OIQ A;  4EGV A;  3I56 A;  2RKS A;  1UAK A;  1EU3 A;  3J81 i;  4DF7 A;  2JA6 H;  1EIY B;  1D2B A;  4LUV A;  3R8B A;  3ERO A;  2RVL A;  2PNH A;  1M8A A;  3TP5 A;  4L5S A;  2QWV A;  1ONL A;  4LF7 L;  4DK6 C;  4HJA A;  2WAQ G;  2UUB Q;  3OWF A;  4I7Z C;  4OEL B;  3QO2 A;  5FJ8 G;  1JJC B;  4MZ9 A;  3BZD B;  4HMI A;  4LJZ C;  1OTC A;  1IBL Q;  1BUV T;  2XWB B;  1N32 L;  5C4X H;  4LFB L;  4WOR A;  2ZXO A;  1F9R A;  1UAL A;  2F0O A;  1BCP D;  2D0O A;  4FF4 A;  2ZTC A;  4R4Q A;  1LAB A;  3E9I A;  3HOX G;  4PZ6 A;  3IFD A;  3NQI A;  4X3L A;  1Y14 B;  2JQO A;  3M4Q A;  5CMD A;  1NBW A;  5ISR A;  4Y7N B;  1R9T B;  1CA6 A;  4C3H H;  1EWH A;  5IWA Q;  3S9W A;  4FVM A;  1I3Q B;  2XIW A;  4X64 Q;  4B3R L;  3A7L A;  4JI3 Q;  3URY A;  2VW9 A; 
#chains in the Genus database with same CATH homology
 5C0X I;  4YQA A;  1CKO A;  4JI6 Q;  4IOA A;  2NZO A;  4FMW A;  1QUQ B;  4LF7 Q;  1X54 A;  5C0X G;  4A3F G;  1VQE A;  2VZA A;  1QUQ A;  2CQO A;  1X3E A;  1KL9 A;  2I5H A;  4DR3 L;  1TWG H;  3S2H H;  2E8G A;  3N4J A;  2ZJQ A;  4A3L H;  4LFC L;  1VQ9 A;  4GKK L;  1EQR A;  1EOV A;  1X9N A;  1I94 Q;  1LUZ A;  3CW2 C;  4BBR G;  3CCJ A;  2I6D A;  3CCL A;  2B63 G;  1Y1W G;  1SMX A;  2NVT H;  1H95 A;  3JAM i;  1Q81 C;  1PFS A;  5GAG C;  1VQ5 A;  1E7Z A;  4GN5 A;  2YV5 A;  1KRT A;  4LFA L;  4NXM L;  4DR7 Q;  1HNX Q;  1KAW A;  2CKZ B;  4GNX B;  5IWA L;  3H3V I;  4H3Z A;  2MO0 A;  2UXD L;  2R93 H;  4DAY B;  4DV0 Q;  1KD1 C;  2KCT A;  3CME A;  1VHK A;  2R7F A;  4QQB X;  5FLM H;  2E2I H;  5K36 G;  4IJL A;  3VDY A;  1IBK L;  1WFQ A;  1R9T H;  1K8G A;  4WJ3 M;  4YQT A;  4DR1 L;  1Y1V H;  2UU9 L;  3K0X A;  5GM8 A;  3HOY H;  4UPA A;  4YY3 Q;  4A76 A;  2ES2 A;  2OQK A;  1SR3 A;  3HKS A;  2UUA L;  2EGW A;  4K0K L;  3CC4 A;  4YQQ A;  2N49 A;  4BY7 H;  4DV7 L;  3KNU A;  4AYB E;  1PH8 A;  4X62 Q;  3AXZ A;  4MTN A;  2R7Z G;  5AJ3 Q;  3L7Z C;  1X56 A;  1IPA A;  1UAM A;  3IC6 A;  2NVX H;  4YCV A;  4DV6 Q;  2ASB A;  1YNX A;  3Q8D A;  3CC7 A;  2HIX A;  3NEN A;  3JC6 6;  2QEX A;  2UXB L;  3ILK A;  5M5Y H;  4GOP C;  1FVI A;  3E9H A;  2EXD A;  4DR5 Q;  1HNZ Q;  1UEB A;  3EN2 A;  2XGT A;  1E1O A;  4JI2 Q;  4DUZ Q;  4JI0 L;  3KFU A;  1W3S A;  2YYZ A;  2F4V L;  1Q7Y C;  3I4N G;  2L15 A;  2VQE L;  4A75 A;  1BKB A;  2CFM A;  4DV2 L;  1VQC A;  3S17 H;  1E1T A;  1FJG L;  3FP9 A;  2AKW B;  1TWC H;  4JI7 Q;  3I4M G;  1WI5 A;  2PMZ E;  4BBS G;  1IYJ B;  4NXN L;  4L69 A;  5LMU L;  4YQL A;  4L5T A;  3CCS A;  3DCM X;  5IYB H;  3PGZ A;  4RMF A;  3F2D A;  3ULL A;  4GNX A;  3HOV H;  5D9F A;  1VQF A;  1FJG Q;  3OYY A;  2HT1 A;  5JJI A;  1Z85 A;  4C3J H;  2CX8 A;  4KHP L;  2CWA A;  2RF4 A;  4KLK A;  5C44 G;  3CPW A;  2UXC Q;  3NK6 A;  5FJ8 H;  4POF A;  4CNG A;  4HIM A;  1PH6 A;  4JWH A;  4DR1 Q;  1NJI C;  2UU9 Q;  4LF4 L;  4GLA C;  1SE8 A;  5IP7 G;  1YI2 A;  4A93 G;  5JJL A;  1HZB A;  3MEF A;  4DR5 L;  2K50 A;  3PUW A;  4UP9 A;  1IZ6 A;  3ZJY C;  1N36 Q;  5BR8 Q;  4O2D A;  4IPH A;  4A4I A;  1O7I A;  4B3M L;  1Z9F A;  4DV4 Q;  2C35 B;  4LF5 L;  5GQO A;  1PVO A;  2CCZ A;  1MJE A;  1HR0 L;  4P75 A;  1XJV A;  4DR7 L;  1AE2 A;  4PG3 A;  4JBM A;  4YQC A;  2AWO A;  1J85 A;  4ME3 A;  1K83 H;  1VHY A;  1V1Q A;  3I55 A;  4B3M Q;  1VQA A;  1G6P A;  3M4P A;  2CWP A;  1PH9 A;  3OII A;  1L1O C;  4JWF A;  2NVY H;  3KJO A;  2NN6 G;  4A3I G;  2QA4 A;  1PYB A;  4BY1 H;  3IRB A;  4UP8 A;  4L5R C;  4A93 H;  4YQR A;  4JOI C;  4EQ5 A;  3KTY A;  1NS5 A;  1E24 A;  3RZD H;  4YQ4 A;  4A3C G;  1E22 A;  4DR3 Q;  1YJN A;  1OXX K;  1HH2 P;  4A3J H;  4YQI A;  4A3G G;  2GVA A;  4LFA Q;  4A3K G;  4OX9 Q;  4LWC A;  1WCM H;  4DV1 L;  2E5L Q;  3OIN A;  4YWL A;  4DR2 L;  3S1R H;  4A3D G;  4DV4 L;  1Q1E A;  1D7Q A;  4JWG A;  3OW2 A;  3PO3 G;  4DV5 Q;  4PZ8 A;  4X64 L;  4A3E G;  4KHP Q;  2UXC L;  1I6H H;  1CSQ A;  4LF9 L;  5CO4 A;  1SN8 A;  4GOP A;  1B7Y B;  4YQ2 A;  2DGY A;  2K4K A;  2H5X A;  3W1G A;  1K73 C;  1X7O A;  1C9O A;  3RR5 A;  2PI2 E;  5C4X G;  1PV4 A;  4MCD A;  3PIO A;  4K0K Q;  3KYH C;  3J81 j;  1HNZ L;  2JA6 G;  1BVS A;  4A3J G;  1Q1B A;  1YZ6 A;  2PQA B;  5JEA G;  3KLW A;  3E5Y A;  4JI6 L;  2YTV A;  2IX0 A;  3UE1 A;  3BBH A;  4HJ5 A;  5FAI A;  3ERS X;  4YCU A;  4JI5 L;  4DV6 L;  5IY0 A;  3CP0 A;  2KCM A;  2B63 H;  2R7Z H;  1X3G A;  2WB1 E;  5GAH C;  1CKM A;  2UUC L;  4OON A;  2OQ0 A;  1C0A A;  3KF6 B;  4YPY A;  4A3E H;  5HGQ A;  4HIK A;  1JB7 A;  2E2J H;  3K8A A;  5M3M G;  4YY3 L;  1GZ0 A;  4YWM A;  3AI9 X;  4YVG A;  3H0G G;  2N3S A;  3GTK H;  2F4V Q;  2BA0 A;  4DV1 Q;  4FDB A;  4DV7 Q;  3DM3 A;  1N32 Q;  2LXJ A;  1KIX A;  1Q86 C;  4LF5 Q;  1P9P A;  4YQ1 A;  4AQY Q;  5JJK A;  2R7D A;  3UE0 A;  1SLJ A;  3KDF A;  1N8R C;  1WJJ A;  4JOI A;  1VQP A;  2VQF L;  1T9H A;  4CNF A;  2V1C C;  3HKZ G;  1A62 A;  4GKK Q;  2IY5 B;  3STB D;  4OO1 I;  4YQD A;  3G4S A;  4R4I A;  4DV0 L;  3BZK A;  1QVG A;  4A3D H;  3RLN A;  4JBJ A;  3OIJ A;  1NTG A;  1MKH A;  1V6Z A;  4CNE A;  2Z0S A;  4JAK A;  3CCQ A;  1IL2 A;  2IHE A;  3S2D H;  3GTM H;  4DV3 L;  3QUV A;  4OWX B;  4UP7 A;  2IT1 A;  3CD6 A;  3HOZ H;  1A8V A;  2A19 A;  1YJW A;  1K3R A;  1VH0 A;  2HIV A;  4IFD G;  2BH2 A;  2JA8 H;  4ALP A;  2RCN A;  4X66 L;  4JV5 L;  4TQU S;  3U4Z A;  5IYD G;  1EIF A;  1V9P A;  2K5V A;  5C3E G;  1X7P A;  1NY4 A;  2VQF Q;  1G51 A;  5IYC G;  4X66 Q;  4PZ7 A;  2BA1 A;  1NE3 A;  1N33 Q;  4JV5 Q;  4JI3 L;  2FXQ A;  1BBW A;  3J7Z C;  4J15 A;  4DK3 C;  1N34 L;  2ZJP A;  1B70 B;  3PUX A;  3OTO L;  2LSS A;  2HHH L;  4HID A;  2WP8 J;  1X6O A;  1YHB A;  2AMC B;  1YVC A;  3BU2 A;  4JI4 Q;  4NXN Q;  4JI1 Q;  3LGJ A;  4DR6 L;  4A3C H;  4IG6 A;  1RL2 A;  3U4V A;  3CCM A;  1S72 A;  1VQN A;  2ID0 A;  3A5Z B;  4GKJ Q;  3H15 A;  4YQP A;  2D0P A;  4XIG S;  2VUM G;  3HOX H;  2VY3 A;  3PSI A;  4JBK A;  1PHJ A;  3PUZ A;  4JI8 L;  2JEA I;  5IYD H;  4MCC A;  1UE1 A;  2EQS A;  3BBE A;  4YQ0 A;  4B3T L;  2Y0S G;  1FL0 A;  1IBL L;  1X65 A;  2R6G A;  3FKI G;  3JAM c;  3I2Z A;  5IE8 A;  1HZC A;  1FGU A;  3RLO A;  3CCV A;  1XNQ Q;  1G29 1;  4QL5 A;  1N33 L;  2AWN A;  4GKJ L;  4KI0 A;  2UXD Q;  3IEF A;  3BBD A;  2Q2H A;  2R93 G;  1HNX L;  4OWT B;  5M5W H;  1VQL A;  3GTO H;  3W5O A;  4JI8 Q;  1EFW A;  3HOW G;  4JWJ A;  3S1Q H;  3J80 i;  3OTO Q;  1YHQ A;  3I4N H;  3SGI A;  2A8V A;  3I7F A;  4JI1 L;  2OCE A;  4YQN A;  4YHH Q;  3PO2 G;  3T1H L;  4A3B G;  1QZH A;  4YQJ A;  4GN4 B;  4QIW E;  3HOY G;  1KHI A;  2IX1 A;  4R4C A;  2E5L L;  4LNQ A;  2OTJ A;  1PH1 A;  1MJC A;  3PF5 A;  3GTG H;  4YPW A;  4GLV B;  4YVJ A;  4APV A;  3L8U A;  4A3L G;  2V3J A;  2VNU D;  3O7B A;  1KRS A;  1X55 A;  2LXK A;  3UDF A;  3T1Y Q;  1HJP A;  1PH7 A;  2K5N A;  3A74 A;  2UUB L;  4JI4 L;  3PV0 A;  1O6D A;  4NXM Q;  5GAD C;  3BZC A;  3HKZ E;  2I0Q A;  1HNW L;  4X6A H;  4MNO A;  1TWH H;  4R1J A;  4BA2 I;  4BXX H;  2ZM6 Q;  1CKN A;  4HJ8 A;  3AEV A;  1VQG A;  4DV5 L;  5C4J H;  1GD7 A;  2GVB A;  2VS1 A;  1VQI A;  1Y1W H;  3TRE A;  3PO2 H;  2ZJR A;  2EIF A;  2EGV A;  4LUO A;  2VUM H;  3CMA A;  1N9W A;  5HY6 A;  3CCE A;  4KHZ A;  3B6Y A;  2R92 H;  1Q12 A;  4NB3 A;  4HJ9 A;  4UY8 C;  2K14 A;  4YQB A;  4YQ9 A;  3NEM A;  1XNQ L;  3K81 C;  2K75 A;  5BR8 L;  4QGU A;  1OXS C;  2MQH A;  2OWO A;  5C0X J;  1J5E Q;  4XTC S;  1CUK A;  3F1Z A;  1QVC A;  2YTY A;  4YQ6 A;  2YTX A;  4A3I H;  1HZA A;  1L1O B;  1I94 L;  3TQY A;  1MXI A;  1E3P A;  3T1H Q;  1PA6 A;  5EAY A;  3D31 A;  5IP7 H;  1A63 A;  1XTD A;  1WCM G;  1VQ6 A;  3F2B A;  4J3C A;  4C2M H;  2JA7 H;  3CC2 A;  3K7U C;  2NZH A;  4DR4 Q;  3RNU A;  2K52 A;  2MNA A;  2ZTD A;  4JC0 A;  2V3K A;  4C3I H;  4BY7 G;  4EX5 A;  1KQS A;  1U0L A;  1YJ9 A;  1SFO H;  1P16 A;  4P73 A;  1N34 Q;  1HR0 W;  1I3Q H;  4IJH A;  3U58 A;  2A1A A;  1PYS B;  2UUC Q;  1XNR Q;  1IXR A;  3S24 A;  1VQD A;  4BBR H;  1XPR A;  4Y7N H;  3DLL A;  4JI5 Q;  4WJ4 A;  2YY8 A;  4YVK A;  1LM0 A;  2KEN A;  3M4O H;  1UE6 A;  3S15 H;  1ASY A;  1YEZ A;  1XPO A;  1XMQ Q;  4QJF A;  1VQM A;  4P74 A;  3D0F A;  1K0R A;  1L2F A;  2WB1 G;  1VQH A;  4YVI A;  2E2H H;  3S1M H;  4JYA Q;  2MFI A;  5GAE C;  1AE3 A;  5FLX c;  4LUZ A;  4GLX A;  5M3M H;  1AH9 A;  4A3F H;  4A3K H;  4B3S L;  5IYB G;  3H0G H;  3U50 C;  4YQ5 A;  1VQ8 A;  3ULP A;  1I5F A;  2GN5 A;  3G48 A;  1OY5 A;  2JJQ A;  5IYC H;  5IP9 G;  3CCU A;  3HOU H;  2JE6 I;  4H02 A;  5E7N A;  3GTJ H;  4YVH A;  1BBU A;  4DPG A;  4LF8 Q;  4IFD J;  1HR0 Q;  4LF6 Q;  1CKN B;  1YBY A;  3EBE A;  1NMF A;  1XNR L;  4AIM A;  1J5E L;  3TS2 A;  1U5K A;  4H3Y A;  1S3O A;  3PF4 A;  5LMN L;  3UDX A;  2VL6 A;  5ELO A;  1UWV A;  3L2P A;  3CXC A;  4IO9 A;  4KDZ A;  4PZK A;  1KC8 C;  3A0J A;  4XBO A;  5DLQ E;  3M9B A;  2NVQ H;  4DV3 Q;  2KHI A;  1V43 A;  3I4O A;  2D62 A;  3RZO H;  1Q46 A;  1TWA H;  2ZTE A;  4R4T A;  4IOC A;  2UUA Q;  3K7A H;  3KF6 A;  2RHQ B;  4P71 A;  3KF8 B;  3KOJ A;  3PUY A;  3AIA A;  5LMN W;  1HZ9 A;  4JBW A;  4YCW A;  4IPD A;  4FAK A;  1WYD A;  1C7Y A;  2Y0S E;  3S16 H;  1HNW Q;  1L1O A;  3F8T A;  4JYA L;  1Y1V G;  3F2C A;  2WFW A;  4BXX G;  1VQ7 A;  1JMC A;  1YIJ A;  4A3G H;  1IBM L;  1B8A A;  4JI7 L;  4HJ7 A;  2IHF A;  2Q2T A;  4YQS A;  2BH8 A;  4RG1 A;  1N36 L;  4YQG A;  5M5X H;  1Q8K A;  3CQZ H;  2JA8 G;  3AYH B;  3GDE A;  1VQO A;  2HQL A;  4B3S Q;  4DAM A;  3N4K A;  4LF8 L;  5GMB A;  2AHO B;  4LF4 Q;  4A3M H;  4E8B A;  4GOP B;  2R92 G;  1MIU A;  2JA5 H;  1X3F A;  4QY7 A;  1QZG A;  2QGQ A;  2Z6K A;  3MXN B;  2KBN A;  3G6E A;  4DV2 Q;  1JJ2 A;  2B3G A;  3L0O A;  3CF5 A;  3M3Y H;  2ALY B;  4LF6 L;  3AFP A;  2F3I A;  3KDF B;  5AJ3 L;  5LMU Q;  4DR2 Q;  1K9M C;  4POG A;  2MO1 A;  1TXY A;  3PCO B;  1D8L A;  1JT8 A;  1UAJ A;  4CND A;  4KGN A;  3BJU A;  3CPF A;  4GNX C;  3RN2 A;  2RHS B;  1S40 A;  3GYQ A;  1LYL A;  5GMC A;  1PH3 A;  2I5L X;  3FKI H;  1IBM Q;  4OO1 G;  2WAQ E;  3STB C;  4DUZ L;  2I5M X;  1OXV A;  1RIP A;  4LF9 Q;  2Q2U A;  3GD7 A;  2JEB I;  1TWF H;  2Z6K C;  4AYB G;  1Q82 C;  3W1B A;  4OWW B;  3GTQ H;  1OXT A;  2HA8 A;  1L0W A;  4BY1 G;  5C3E H;  3UDI A;  5FLM G;  5IT9 c;  4DUY L;  1K8A C;  3NK7 A;  3HOV G;  1A0I A;  2VQE Q;  3HOW H;  3ONP A;  1WOC A;  5C44 H;  4NPS A;  3EIV A;  3WWV A;  5ELN A;  4AH6 A;  3UDG A;  1YIT A;  1EQQ A;  1PH4 A;  4OX9 L;  1I50 H;  4YWK A;  1VQJ A;  4DKA C;  1KXL A;  2Q2I A;  3M85 A;  1GM5 A;  3TS0 A;  1Z47 A;  3RLF A;  3TRZ A;  2PI2 A;  4YPZ A;  3HFZ B;  3RN5 A;  5LMN Q;  1TO0 A;  2JA9 A;  4X65 Q;  1M1K C;  1IBK Q;  1VQB A;  3E0E A;  3CAM A;  4TVA B;  2JA7 G;  3G71 A;  2F52 A;  3KW2 A;  1ZJR A;  1CSP A;  4P72 A;  4X62 L;  4LFC Q;  3NEL A;  4YQK A;  2B29 A;  4YQO A;  1P8L A;  4O0A A;  3I56 A;  3CCR A;  2JA5 G;  1UAK A;  3J81 i;  5IP9 H;  1QVF A;  3GTL H;  1GO3 E;  1LTL A;  3HOU G;  2ZM6 L;  2JA6 H;  1EIY B;  1VQK A;  1VCI A;  1YHA A;  4LUV A;  3S14 H;  1UE5 A;  3GO5 A;  3ER0 A;  1OXU A;  2K5H A;  2PNH A;  4GN3 B;  4HIO A;  4JG2 A;  2YU9 H;  1JE5 A;  5GRO A;  4YQ7 A;  1XMQ L;  4L5S A;  3J81 c;  2QWV A;  1EUJ A;  1NMG A;  4LF7 L;  4IFD I;  2QMM A;  2Z0Y A;  4YQ8 A;  4DK6 C;  3J80 c;  3TEH B;  4HJA A;  2WAQ G;  3T1Y L;  2UUB Q;  3PIP A;  4LW1 A;  2NN6 I;  4JI0 Q;  4X65 L;  4L5Q A;  4OXP A;  5FJ8 G;  4BA1 I;  1JJC B;  2DUD A;  4MZ9 A;  3KJP A;  3J7A 5;  4YHH L;  1J6Q A;  1DGS A;  3AQQ A;  1OTC A;  4AQY L;  3H3V H;  4B3R Q;  4IPG A;  1XPU A;  5M3F H;  1IBL Q;  1VS0 A;  2UXB Q;  2PQA A;  3K80 C;  1PH5 A;  1N32 L;  5C4X H;  1NXZ A;  3ICE A;  4LFB L;  1SRU A;  4JAL A;  3NBH B;  5H1S E;  1EYG A;  1UAL A;  1W2B A;  2N78 A;  4JCV E;  1VQ4 A;  2O3A A;  3I4M H;  4BBS H;  4Y52 H;  1SRO A;  2D0O A;  1M90 C;  1UE7 A;  2N8N A;  3AFQ A;  5J3B A;  2ZTC A;  4R4Q A;  4LFB Q;  1GVP A;  3E9I A;  3HOX G;  4PZ6 A;  4B3T Q;  4R4O A;  4JI2 L;  4DNI A;  4A3M G;  1Y14 B;  3FHW A;  1PH2 A;  2JQO A;  2OTL A;  4X3L A;  1XMO Q;  3M4Q A;  1NBW A;  3KY7 A;  3PUV A;  1ASZ A;  3GTP H;  4YQ3 A;  5JEA J;  4GS3 A;  1XMO L;  5M3F G;  3HOZ G;  4C3H H;  2JK8 A;  2ATW A;  5IWA Q;  4X3M A;  1EWI A;  3PO3 H;  1JJG A;  4PMW A;  3S1N H;  4DR4 L;  2HHH Q;  4YPX A;  3M7N A;  4IPC A;  4MCB A;  4DUY Q;  1GKH A;  4A3B H;  2XTI A;  3ULJ A;  4X64 Q;  4DR6 Q;  4B3R L;  3A5U A;  4JI3 Q;  2VW9 A;  1V2X A;  2KHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...