4RG1A

Methyltransferase domain of c9orf114
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
Knots found
sequence length
306
structure length
285
Chain Sequence
RGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQACVQLARILQYLECPQYLRKAFFPKHLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLTQAGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords C9orf114
publication title The Crystal Structure of Human C9orf114 in complex with S-adenosyl-homocysteine
rcsb
source organism Homo sapiens
total genus 89
structure length 285
sequence length 306
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02598 Methyltrn_RNA_3 Putative RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4rg1A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4rg1A01
1JMCA 2CFMA 1J5EL 5IWAQ 1OXSC 4O0AA 3ULPA 1N33L 3HOVG 4DR5L 1YJNA 4X6AH 1X7PA 5C0XG 3M3YH 4DKAC 4YWLA 4A3CH 1HNZL 4DV2L 3CC7A 5JJLA 2N49A 5LMUQ 1KHIA 1W2BA 2JA6G 3HOUH 5FLMH 4LFAQ 4POGA 4YCWA 3PUXA 1HNWQ 2A1AA 2WB1E 4OONA 1V1QA 4A4IA 1VQHA 1WCMG 1EYGA 4YQJA 1X65A 3HKZE 4QL5A 3H3VH 2F3IA 4LUVA 2QMMA 4X3MA 4YQ8A 4DV6L 1PFSA 1QZGA 4JI7L 5C0XI 2JQOA 3PV0A 1PH5A 5AJ3Q 4DR2Q 5LMNQ 1BVSA 2VNUD 3UDFA 2UXBQ 1RL2A 2VY3A 3GTMH 4BY1G 1P9PA 3BBDA 3HOZG 1K83H 4LUZA 1TXYA 4L5QA 3G71A 1VS0A 2UXDL 1X3GA 3BJUA 1VQPA 1WYDA 1K8GA 2JA7H 2AWNA 3PO2H 5IYBG 1PYSB 4TVAB 1VHKA 1H95A 4CNDA 2LXKA 1A63A 2ALYB 2Q2TA 4A3MH 3MEFA 4A3KG 2UUBL 3CP0A 1IXRA 4FDBA 4IPGA 3F2DA 1YHAA 4HIDA 1YHQA 4NXML 2NVQH 2R93G 3UDGA 1QVGA 4A76A 1SR3A 3PGZA 1XNRQ 4X64Q 2HA8A 5IP7H 4RG1A 2MNAA 3J80c 1IYJB 1V43A 2BA0A 1Q12A 3JAMi 2VUMH 4YVGA 1X3FA 1RIPA 1E22A 4HJ9A 1Y1WG 1UE6A 1VQ4A 1Q46A 2ZJQA 3TS2A 4YPWA 1VQMA 2IT1A 1AH9A 4A3EG 3PUWA 4YQ5A 4HJ8A 1NE3A 2CWAA 4JYAL 2GVBA 4DR3L 4AQYQ 4DUYQ 4UP8A 3M85A 2MO1A 2KHIA 3S2HH 1PYBA 2R7ZG 1OXXK 1P16A 4JI1Q 3HOVH 4POFA 1X55A 4A93G 3HOWG 3STBD 5HY6A 1FJGQ 1LYLA 4DUZQ 3RZDH 3K81C 4DV3L 3CC2A 5C3EG 2R92H 3QUVA 1Z9FA 1B7YB 3OINA 5C44H 1TWGH 4A93H 1Q81C 1L1OA 1XNQL 2PI2E 4A3FH 4LFBQ 4JI3L 4OO1G 3CD6A 1LM0A 1YJ9A 3S16H 1HZAA 1E24A 5ELNA 2VL6A 3I2ZA 5HGQA 4LF7L 1I94Q 1FGUA 1WJJA 2HQLA 4B3SQ 3S1RH 3M9BA 4JG2A 2YTYA 4P73A 2F4VL 4MCDA 2NN6G 1Z47A 4NB3A 3U4ZA 4A3LG 4YQ3A 4BBSG 1KC8C 1UAKA 3UDIA 2Z6KA 1XMOQ 5M5YH 2UUCL 2L15A 3DM3A 4DK3C 5IYBH 4C3IH 5C4JH 2ES2A 2QWVA 4JBJA 1PH3A 1Q1BA 3NELA 3CCQA 1VQLA 3ICEA 4X3LA 1A62A 1YHBA 1HZ9A 3HOYH 1UE1A 3FHWA 3ULJA 4A3KH 1XPOA 2OTJA 3CCJA 4A3IH 3CC4A 4IOAA 3KF8B 4PZ6A 1C7YA 2R93H 2YYZA 2JEAI 3BBEA 2NN6I 1PVOA 1PH4A 3BZKA 5GM8A 3E9IA 4GKJQ 3GTJH 2OWOA 2YU9H 4YQOA 1A0IA 5IP9G 4X65Q 3J7ZC 3CXCA 4GOPC 4GOPA 3OIJA 2VZAA 2Q2HA 1VQOA 3AEVA 1X56A 4GLXA 4A3EH 1CKMA 3W1GA 1IBLL 1ASYA 3CCMA 4GN4B 2VW9A 1Q1EA 2IX0A 1PH6A 5GMCA 1VQCA 1QUQA 1K0RA 3K8AA 3CCUA 4DV0L 4YVJA 2JJQA 1XTDA 1KL9A 1B70B 1WFQA 4P74A 5GAGC 3NBHB 1XMQL 4DV1L 3T1HL 1OXTA 4UP9A 2IHFA 4LW1A 1N34L 4A3BG 3K7AH 1O6DA 1CSPA 3S14H 4KHPL 4PZ7A 5C3EH 3U50C 1L2FA 2DUDA 1SRUA 4IJHA 5GAEC 5M3FH 1OY5A 2V3JA 1X7OA 1OXUA 3KNUA 2CQOA 1VQGA 2JA9A 1LTLA 2R6GA 1XJVA 5IWAL 4OO1I 3W1BA 1IPAA 1L1OB 2WFWA 3GD7A 4LUOA 5JJKA 4C3JH 1EWIA 4PG3A 4A3DG 3JC66 2XGTA 2IY5B 3K80C 4AIMA 3T1YQ 4YQ0A 1CKNB 1VQJA 5GMBA 1HNXQ 2BH8A 5FLXc 1P8LA 5LMUL 4B3TL 4PZKA 3TQYA 4LF5Q 4LFAL 2PMZE 3N4KA 1VQAA 4L5SA 3W5OA 1HNWL 3O7BA 1VQ8A 2OTLA 1D8LA 4A3GG 1YVCA 1Z85A 1VQ5A 2JA8H 3KTYA 3CCRA 4YY3Q 1NTGA 2MFIA 4AH6A 4B3MQ 2EGVA 4APVA 3OTOQ 1MJCA 1QVCA 1S3OA 4JCVE 2I5LX 3A74A 1X54A 5AJ3L 2GVAA 5C0XJ 5LMNL 4DR2L 1PA6A 4MCCA 3J81i 4YQAA 2JA5G 1O7IA 1PH8A 3GTPH 4K0KQ 4A75A 3RZOH 4MNOA 4JI2Q 5E7NA 2UXCQ 4L69A 1UAMA 3EBEA 3M4QA 3PSIA 3A5ZB 4DV5Q 3K0XA 2I0QA 1Q8KA 1YIJA 4HJ7A 1Y1VH 2KCTA 3GTOH 4KDZA 4YPYA 3I55A 1VQFA 4X62Q 2B63H 3HKSA 2CX8A 3L0OA 4GOPB 3M7NA 4R4IA 5DLQE 3I4NG 4JV5Q 4JBKA 3NEMA 1NJIC 5FAIA 4YQNA 1J6QA 1XNRL 2A19A 3LGJA 2OQKA 4X64L 2D0OA 4P71A 4DV4L 1KQSA 1KAWA 3S1QH 4BY7H 1QUQB 4BXXG 3HOXH 1CUKA 4C3HH 4YQKA 3I4MG 1I5FA 5JEAG 1YNXA 1XPRA 1SE8A 4R4OA 1B8AA 3G48A 4XTCS 1NMGA 4DUYL 4UP7A 3VDYA 1NY4A 3F2CA 4LF4Q 3D31A 3F8TA 4Y7NH 4X66Q 4GKKQ 4H3ZA 4JI1L 1AE3A 1BKBA 4JAKA 4DV6Q 1M1KC 3RLOA 4A3DH 2CKZB 1KRSA 3U4VA 2QA4A 2Z0SA 4GNXC 4GNXA 4DUZL 4AYBG 4L5RC 1IZ6A 4YCVA 3KDFA 1R9TH 1KXLA 1VQBA 3PCOB 3N4JA 5J3BA 4CNFA 4DPGA 1PH2A 2UXDQ 3PUYA 5GAHC 2DGYA 1M90C 4A3GH 2GN5A 1HZBA 4OWTB 4R4CA 1EQQA 2E5LQ 3ZJYC 4DR7Q 2JA6H 4YQ1A 1KIXA 4WJ4A 2MQHA 3L8UA 4JI5Q 1EQRA 1I94L 3S15H 4LF6Q 1NXZA 1TO0A 1U5KA 4YHHQ 4B3SL 4MTNA 2UUBQ 1WCMH 4MCBA 2HIVA 2F52A 4NXMQ 1K9MC 3NK6A 2JA5H 1G51A 4DR1Q 4OX9L 2EGWA 1CKNA 2UU9Q 4YVKA 2UUAQ 1VQ7A 4YQDA 4WJ3M 1VCIA 2ZJRA 1XMOL 4OWWB 3H0GG 1DGSA 4KLKA 4DR6Q 1VQEA 1IBMQ 4O2DA 3Q8DA 1J85A 4J15A 4JI8Q 3JAMc 4BY1H 2VQFQ 3HOZH 2NZOA 2PQAA 4BA1I 4HJ5A 1L0WA 5M3MG 3I4NH 3DLLA 2OCEA 3PIPA 1IBKQ 2HHHQ 3EN2A 3MXNB 5FJ8G 5BR8Q 4DR4Q 2ZM6Q 3GYQA 3K7UC 1S40A 4LFCQ 4BXXH 4GKJL 3CMAA 1G291 4X65L 3I4MH 1A8VA 1N36L 4DV3Q 4IG6A 2VS1A 3PF5A 1TWHH 1K8AC 1TWFH 3B6YA 1SFOH 4NXNQ 2H5XA 2NVTH 4UPAA 1K3RA 4YWMA 2A8VA 4JI6Q 3A0JA 3FKIG 4JOIC 4H02A 1Y1WH 4DV7Q 3GDEA 4MZ9A 3S17H 3ONPA 4QQBX 3TREA 1Q86C 4LF8Q 4J3CA 2RHSB 4IOCA 3DCMX 5ELOA 4YPXA 2RF4A 4JI4Q 1W3SA 4DAMA 5LMNW 4IPDA 4A3CG 1YEZA 3CPWA 3AFQA 2R7ZH 1EIYB 4YQLA 3U58A 1N32Q 2B3GA 1VQIA 1GM5A 2ATWA 3HOWH 1GVPA 3L7ZC 4A3JG 2I5HA 2WAQG 4HIMA 4GNXB 3NENA 2AWOA 3D0FA 1CSQA 3A5UA 3GTLH 3TEHB 4XBOA 3KDFB 2KHJA 5M5XH 2XTIA 4YQCA 4IFDG 4P75A 4BBRG 3PUVA 1WOCA 4LNQA 2N8NA 3PO3G 3KF6B 1HH2P 2K5VA 3T1YL 1Y14B 2K14A 2K50A 1HNXL 4C2MH 1X9NA 4LF5L 2OQ0A 1X3EA 1KRTA 1XPUA 4LF9Q 3H0GH 3OYYA 1KD1C 3HFZB 3E5YA 3F1ZA 4GN3B 3PO2G 2CWPA 1JB7A 4TQUS 3GTQH 3OIIA 4JI0Q 3KFUA 4A3LH 4E8BA 3CCVA 4YY3L 2VQEQ 4BBSH 3H3VI 5M3MH 3OTOL 3H15A 3F2BA 4YVHA 3IC6A 2LSSA 2Q2IA 4GLAC 4AYBE 5FJ8H 5D9FA 2YTXA 1GD7A 2YTVA 1BBUA 1JJCB 3BU2A 3KOJA 4DK6C 5M5WH 2PQAB 4DV1Q 4QJFA 1XMQQ 4K0KL 4JI2L 4DAYB 1N34Q 3CW2C 1V6ZA 2E2HH 4DV5L 1GO3E 3AI9X 1Q82C 3AYHB 2NVYH 1X6OA 1EFWA 1JJGA 4X62L 4B3RQ 2UXBL 1HR0Q 3RR5A 5IP9H 3FKIH 1MJEA 3S2DH 2WP8J 1HZCA 4JV5L 2ZJPA 1LUZA 2KCMA 2JEBI 1JT8A 4R4QA 3KW2A 1YJWA 2EIFA 2ZTDA 2C35B 3KJPA 2R7DA 1UALA 4XIGS 2K4KA 3J80i 4GS3A 3J7A5 1U0LA 4YQPA 4B3TQ 1J5EQ 4JC0A 1C0AA 2AHOB 5EAYA 2R92G 2FXQA 4KHZA 5C44G 1CKOA 1NMFA 4YWKA 3UDXA 3CCSA 4DR5Q 4A3JH 1N33Q 4A3BH 5C4XG 3GO5A 4IPCA 4A3FG 4LF4L 4L5TA 2NVXH 1HNZQ 1MIUA 4DV2Q 1PH1A 1QVFA 3S1MH 4OXPA 4X66L 2EXDA 4HIKA 2YV5A 3KJOA 2E2JH 4GKKL 3CF5A 3KLWA 2RCNA 4BBRH 2CCZA 4AQYL 2N78A 3PO3H 2YY8A 2Y0SE 3CMEA 1JE5A 3AIAA 1MXIA 5GROA 2I5MX 2V1CC 3RN5A 1GZ0A 2BH2A 3CCEA 2HIXA 5JEAJ 1VQ9A 2V3KA 1ASZA 2QGQA 4GLVB 4KGNA 1C9OA 5IYCG 1N9WA 4JI7Q 3J81c 2ID0A 3BZCA 1FJGL 5JJIA 2NZHA 3ULLA 4DR7L 1GKHA 2E5LL 4GN5A 4JI5L 3G6EA 4LF6L 4YQIA 1VH0A 2JE6I 1I50H 4QIWE 4IJLA 4YHHL 3HOYG 4LFBL 2Q2UA 4A3IG 2AMCB 3KF6A 3KY7A 4QGUA 4YQSA 4PZ8A 2EQSA 4DR1L 1NS5A 3E0EA 2UU9L 1IL2A 1FL0A 2UUAL 4DV4Q 1V2XA 2WAQE 4FAKA 3S24A 2ASBA 4DR6L 1D7QA 1IBML 1G6PA 4CNGA 4JI8L 3ILKA 2B29A 1OTCA 2VQFL 1I6HH 3PF4A 2QEXA 4YQTA 3M4OH 2AKWB 1VQ6A 2K5NA 3FP9A 3PIOA 1IBKL 2HHHL 3S1NH 3IRBA 1UAJA 3AXZA 1BBWA 5BR8L 3L2PA 2ZM6L 4DR4L 2ZTEA 4LFCL 4JYAQ 4RMFA 4DR3Q 3I56A 4BA2I 2WB1G 1EOVA 3AFPA 1UE5A 1K73C 2D62A 3CPFA 1E3PA 3HKZG 3M4PA 5GQOA 2E2IH 1VQKA 3NK7A 1V9PA 4NXNL 1YITA 1E7ZA 5C4XH 1L1OC 1SROA 5M3FG 1TWCH 4JI6L 2Y0SG 4EX5A 4EQ5A 1ZJRA 4OWXB 1E1OA 4DV7L 4UY8C 3GTGH 4ALPA 3CCLA 4YQ7A 1PV4A 4LF8L 5IYDG 5K36G 1FVIA 3OW2A 1Q7YC 1VQNA 1SMXA 4YQ2A 1XNQQ 4LWCA 2BA1A 1YZ6A 4JI4L 2ZTCA 4YCUA 4JI3Q 4JOIA 4YQ9A 3CAMA 4OX9Q 1N32L 4LF7Q 1HR0W 1T9HA 2Z6KC 4YQRA 3ERSX 5IYCH 3RLNA 1VHYA 2IX1A 2Z0YA 3SGIA 5IT9c 2F4VQ 2JA8G 4YQBA 5IY0A 4YQ4A 5IE8A 1PH7A 3HOUG 5H1SE 5FLMG 1N8RC 3E9HA 4YPZA 3J81j 2PI2A 3G4SA 2UUCQ 1VQDA 1PH9A 1EIFA 3TS0A 2I6DA 2D0PA 3IEFA 3CQZH 3PUZA 1MKHA 2HT1A 1NBWA 3STBC 4LF9L 4ME3A 1E1TA 4P72A 1N36Q 4YVIA 2IHEA 2JK8A 4DNIA 4Y52H 5CO4A 5GADC 4IO9A 4JI0L 4H3YA 2RHQB 4YQQA 1Y1VG 1UE7A 1UEBA 2KBNA 2VQEL 4CNEA 2B63G 3I7FA 1AE2A 4JALA 4R4TA 2LXJA 3ER0A 1UWVA 2JA7G 3KYHC 2PNHA 3TRZA 1S72A 4IFDJ 1TWAH 4NPSA 1IBLQ 4B3ML 3RLFA 4IPHA 4YQGA 1I3QH 3GTKH 4BY7G 1PHJA 4IFDI 1HJPA 3HOXG 4A3MG 2KENA 4DV0Q 3UE0A 2N3SA 1OXVA 2R7FA 4R1JA 1SN8A 2K5HA 3UE1A 2K75A 3WWVA 4HJAA 1JJ2A 4B3RL 3T1HQ 1YBYA 5IP7G 1HR0L 1QZHA 3AQQA 2UXCL 2VUMG 4KHPQ 4KI0A 4HIOA 4PMWA 1YI2A 4JBWA 1WI5A 5IYDH 3I4OA 4JBMA 4QY7A 1SLJA 2O3AA 3BBHA 1EUJA 2E8GA 3EIVA 2MO0A 3RNUA 3RN2A 2K52A 4YQ6A
chains in the Genus database with same CATH superfamily
2QILA 1J5EL 3R2TA 3HOVG 5C0XG 3M3YH 4A3CH 4RGTA 4DV2L 3CC7A 1WTQA 3OSOA 5LMUQ 2JA6G 1EZ6A 4LFAQ 2KA7A 1HNWQ 1RTNA 2JXMB 4OIJA 1V1QA 1EYGA 4YQJA 1PRTB 3HKZE 1SJED 3OMCA 4LUVA 2QMMA 1R4PB 3S1QB 4IFDH 5C6AA 5C0XI 3NPPA 5IGFA 3J80L 1PH5A 4KKUA 5CBAE 1EY0A 3UDFA 3GTMH 4BY1G 1K83H 4L5QA 3TSSA 1HPCA 1LTRD 1VQPA 1CK1A 4Y7NB 5IYBG 1PYSB 1BDOA 4TVAB 4ZCKA 4CNDA 4A3DB 5C5LA 1A63A 1LT3D 3MEFA 1FNWA 4FDBA 2NVQH 1YNNC 3UDGA 1QVGA 5IP7H 3JAMi 1KLGD 1EEFD 3VR3A 1T5EA 1ZKOA 1VQMA 4YQ5A 1NR4A 2CWAA 2GVBA 2QEJC 4RGMA 4RWSC 2BCOA 1PZKD 1X55A 2F0NA 4L6TB 3TZDA 1ZEQX 2F1MA 3I90A 2R92H 3V05A 4OIKA 3VA5A 1PFMA 5ELEA 1SMYD 2VL6A 4PNYA 4PV1C 4LF7L 1I94Q 1WJJA 1G6ZA 3EFXD 3I8ZA 3M9BA 1EYAA 2YTYA 5T1IA 4MCDA 2NN6G 1Z47A 2NUCA 4NB3A 4RA8A 4A3LG 1D6EC 1SNQA 1KC8C 1LTID 2Z6KA 3KLSX 4QCLA 4DK3C 3S17B 2QWVA 1LO5D 4IUNA 5C3XA 1PH3A 1Q1BA 3CCQA 4N8X1 3ICEA 3DWQA 1XPOA 3CC4A 2R93H 3KF8B 4PZ6A 1C7YA 4JWJA 2NN6I 1PVOA 1PH4A 1IW7D 4GKJQ 2OWOA 2YU9H 4XT1B 2PW7A 1S5ED 2AQ2B 2A69D 2RSOA 4X65Q 3VYTA 4F7XA 1ASYA 4RHSA 1VQCA 2K5WA 1K0RA 4NMZA 3VYUA 5DM73 4C2MB 3NBHB 3T1HL 2CHBD 4EQOA 5FLXL 4A3BG 1N34L 3L3OC 3GTQB 4KHPL 1B3AA 1AW7A 1EY8A 5CV4A 2RQXA 2DUDA 1SRUA 4CBVA 3DEOA 5GAEC 1H9SB 1S5BD 1X7OA 4RGOS 2CQOA 5BN3A 4LK1C 3KNUA 3Q23A 2JA9A 2PO4A 1XJVA 3W1BA 5JJKA 4LUOA 4C3JH 4PG3A 1F77A 3JC66 2XGTA 1F9RA 1V1PB 3T1YQ 5GMBA 5JVH3 4B3TL 3LNNA 3N4KA 4FYDA 3SXHA 1AEXA 3FKIB 1B1ZA 1K3BC 4X3UA 1D8LA 5IODA 4B3MQ 2MFIA 1LACA 1LTBD 1QVCA 3R2IA 1ET6A 1KNEA 1D5MC 2GVAA 5C0XJ 1UUPA 4I7ZC 3GTPH 1WTPA 2D5DA 3RZOH 4RCOA 3AB9A 2WINB 1UAMA 2I0QA 1Q8KA 1YIJA 1STEA 3MXNA 2CX8A 3L0OA 2A74C 5CORA 4GOPB 4R4IA 5DLQE 5JVG3 3FPUB 1NJIC 5FAIA 1QE6A 3MXUA 2A19A 4ABNA 4P71A 4BY7H 1CZWA 2A6EC 4UP7A 1NY4A 3D31A 1PMRA 1M1KC 3U4VA 3WOFA 5J39A 2Z0SA 4YIJA 4GNXA 2HDMA 1IZ6A 5C0XH 1M90C 4A3GH 1HZBA 5A2QE 1EYDA 2JA6H 3L8UA 2G9HD 1EQRA 3S15H 1TO0A 4B3SL 1K9MC 3NK6A 4OX9L 1G51A 3PMFA 2K04A 2NBFA 4YVKA 1VQ7A 2EYPA 4OWWB 2K32A 3A54A 2Q8TA 4CKCA 1LT4D 2CVRA 2F0WA 4BY1H 3SDZA 1A2UA 3KBGA 2PQAA 4BA1I 4HJ5A 1L0WA 5FJ8G 2EE1A 2ZXOA 3K7UC 1S40A 4LFCQ 5LL6X 1G291 1A8VA 1N36L 4IG6A 2VS1A 1EL0A 2F0SA 1SFOH 4E6IA 2IPKD 2O5IC 4LMQD 3A0JA 3BZDB 4H02A 1ML0D 2AQ1B 3CQZB 4MZ9A 3SHLA 1FYCA 1WTVA 4LF8Q 5JPMC 5I2XA 2RCFA 4DAPA 2XWJB 5LMNW 4N9PA 4WORA 3U58A 2B3GA 4K8JA 3L7ZC 2AWOA 1EOTA 3A5UA 1TWAB 4XBOA 5M5XH 4OELB 5J22A 2B2WC 2Z6BA 2XTIA 3QOLA 1EU4A 1XYIA 1I3QB 4YQCA 4LNQA 3PO3G 1HH2P 1MSGA 3MEHA 3DMUA 4LF5L 1X3EA 1XPUA 4RGNA 5CV8A 3F1ZA 3PO2G 1JB7A 1D1KA 2L0CA 3KFUA 2NN6H 5I6WA 4A3LH 4YY3L 2VQEQ 3H3VI 1F9QA 2L9HA 3F2BA 1A15A 2XWBB 5IGGA 3KOJA 1JJCB 4G57A 2E74C 3EQLC 3TP6A 4QJFA 1EIGA 2A68D 3D6WA 1N34Q 1JORA 2E2HH 1GO3E 2E2DC 1X6OA 1EFWA 1JJGA 4B3RQ 2UXBL 4CKEA 2KVMA 2ZJPA 1BO0A 1CZGA 2LFNA 3KW2A 3K6OA 4NKLA 1DYQA 2FFKB 3BVGA 3HZXA 4B3TQ 3J81L 5EAYA 1EY5A 4KTAA 3R93A 5CMDA 4A3JH 5C4XG 4A3BH 1TS4A 3GO5A 1HNZQ 1U4RA 2EXDA 4HIKA 3I4LA 4FF1A 2Y0SE 1MXIA 3PQIA 1EWHA 3RN5A 2QKIC 3D4WA 1ASZA 4GLVB 4KGNA 1C9OA 5IYCG 1N9WA 1FJGL 4FVMA 2ZXPA 3ULLA 4C3IG 2E5LL 3VA7A 2F0KA 2D2CC 4QIWE 5CGKA 4YHHL 2Q2UA 3KY7A 1HCZA 4PZ8A 2UU9L 1Z7TA 1ZYRD 4B9XA 2ASBA 2K6AA 1G6PA 4CNGA 1IHZA 1STAA 2ENBA 5C44B 3D6CA 1RKNA 3PF4A 1ICFB 2L4NA 4EQPA 2F03A 4YQTA 1A3UA 1KDAA 1VQ6A 2KCCA 3FP9A 3PIOA 2HHHL 4K8IA 5KNBA 4DR4L 1KNAA 2SOBA 4BA2I 1KTKA 1UE5A 5KYLA 1K73C 3M4PA 5GQOA 2CQAA 3NK7A 1C48A 5IT9L 4UDUC 5M5YB 1F2ZA 4B9WA 2EOTA 4OWXB 4UY8C 3GTGH 4ALPA 1WTRA 1PV4A 1FVIA 3OW2A 3HOYB 4JWGA 5A35A 1XNQQ 1RDPD 1SYBA 2BA1A 4LWCA 4JI4L 1STNA 2ZTCA 3K58A 4A3IB 1EY6A 3DWAA 4OX9Q 1N32L 1T9HA 2Z6KC 3GTJB 1HXYD 5CR3A 1HHVA 1CM9A 2OEOA 5H1SE 1QWYA 2PI2A 3G4SA 3BVMA 2UUCQ 3J7AV 3EVQA 3IEFA 2XNAC 2HT1A 2WB1B 3STBC 3K7AB 4RH6A 1N36Q 1VF5C 2IHEA 4Y52H 5C3EB 4JI0L 4H3YA 1LV9A 1YNJC 1UEBA 2LY7A 5M9OA 1BXTA 3D4DA 2FINB 5K5PA 4CDDC 2LXJA 3Q22A 1B3QA 2OXPA 3T51B 2EVBA 3RLFA 1HUMA 1SDFA 4I7AA 4OGQC 4IFDI 1HJPA 2KENA 1OXVA 2R7FA 4R1JA 4YQ7A 4HJAA 5HURA 1YBYA 5IP7G 3SEBA 2TSSA 3AQQA 3QOJA 4MN3A 2JA8B 4HIOA 1YI2A 4JBWA 1H9MA 2B2TA 2A73B 2K52A 4MIUA 1YNND 1JMCA 2CFMA 1OXSC 4O0AA 5COYA 3ULPA 3SK8A 1JQYD 3DXJC 1TS3A 3OMGA 4QF4A 3R8BA 5JJLA 2F3WA 3GTOB 4CDCC 4CKBA 3HEJA 5FLMH 4YCWA 1R4QB 3QWNA 1TR5A 1X65A 4ZKBB 4FXKC 3H3VH 4DV6L 4ZQ3A 1PFSA 2K05A 4C3HB 3PV0A 5AJ3Q 1AN8A 5LMNQ 4DR2Q 2UXBQ 2NB0A 1NNXA 4LUZA 3G71A 5ELBA 2UXDL 2F0IA 1K8GA 3PO2H 3KF8A 1VHKA 2LXKA 2DY7A 2ALYB 2Q2TA 1L0XB 1GUWA 5GM8A 3CP0A 1IXRA 4IPGA 4G4KA 3F2DA 1YHAA 3VR5A 4HIDA 1YHQA 2R93G 1SYEA 1SR3A 3PGZA 1R9TB 4X64Q 2I6DA 4RG1A 1IYJB 1V43A 2BA0A 5JAVA 2VUMH 4K14A 5CV7A 2PZWA 1X3FA 1RIPA 1E22A 2QCPX 1UE6A 1QJOA 4CHTB 3TS2A 3FPPA 1AH9A 4HJ8A 1NE3A 4DR3L 4DUYQ 4UP8A 2KHIA 1LABA 4FXGC 2JA5B 1P16A 2LMCB 4HCSA 5BN4A 4POFA 3SK5A 5HY6A 1H9SA 1FJGQ 2K5DA 1LYLA 4DUZQ 3C46A 3K81C 3NWSA 4OEMB 1C8CA 1PFBA 3C1FA 1Z9FA 1B7YB 1HQMC 3DHQA 3HOZB 2B2VA 4CDEC 2PI2E 2CW0C 3I4NB 1SJHD 2B2YA 4DGZA 3J80E 1E24A 5ELNA 1S5DD 3I2ZA 1FGUA 1CT1D 3I4MB 4K5WA 2FMMA 4ZAIA 1TWHB 1TWFB 4FF4A 1X32A 5C3WA 1UAKA 2FJ2A 1XMOQ 4ID6A 1Y1WB 5IGCA 2ZXRA 4C3IH 5C4JH 4CJ0B 3C2PA 1A62A 1VMCA 1B9MA 3H91A 4A3KH 2Z9HA 4IOAA 2YYZA 3H3VC 3BBEA 3HOWB 4YQOA 4G7HC 5IP9G 4GOPA 3GTLB 2VZAA 2Q2HA 1SYGA 4A3EH 4MHEA 3W1GA 1IBLL 2IX3A 5KGUA 2K28A 4EGVA 2KCNA 1H9RA 3H6MA 4YVJA 2JJQA 1XTDA 1KL9A 1B70B 2EYFA 2PCFB 4P74A 4DV1L 3H0GB 2IHFA 1LLRD 3HGBA 4BBSB 1L2FA 4X3KA 2Z4HA 1OY5A 5EBDA 2V3JA 5CYUA 1TU2B 5M5WB 2R6GA 5IWAL 1IPAA 1L1OB 5G3LD 1EWIA 3VR4A 1QG7A 1CKNB 1VQJA 2NVYB 1G2SA 3E3XA 5CV6A 1HNXQ 1M4VA 2PMZE 4L5SA 3S2DB 1VQ8A 3K5OA 5NUCA 1PTOC 4A3GG 1YVCA 1EWCA 3J7YW 1NTGA 2PW5A 4JK1C 5EQ0A 4JWFA 4JCVE 2J0TD 4HTHA 3A74A 3RMHA 1X54A 1PA6A 1B2TA 1O7IA 1PH8A 4K0KQ 5E7NA 2M2LA 3EBEA 3PSIA 2NVXB 2E2JB 2KCTA 4YPYA 4X62Q 2PQEA 3OWFA 1A2TA 1NSNS 2X6GA 5FLXE 1EU3A 1PZID 5ELCA 5DEHA 4JBKA 4JV5Q 4YQNA 3OIPA 1XNRL 3LGJA 1EYCA 3S1QH 1QUQB 4YQKA 4RKBA 2KUMA 4ZKCB 1YNXA 4KD4A 1XPRA 5EBCA 3VDYA 1GXDC 1I50B 4LF4Q 1DZ1A 3IL8A 4Y7NH 4X66Q 2SDFA 4JI1L 2PZTA 4DV6Q 2F0DA 3RLOA 4A3DH 1KRSA 3A8IE 1KAAA 1RD9D 3H94A 1F9PA 1PZJD 1JR0D 4YCVA 4CNFA 2UXDQ 4CJ1B 5GAHC 4XYQA 2GN5A 3FEWX 4DR7Q 1EQQA 4YQ1A 3BG3A 2MQHA 4TSSA 3H09A 1NXZA 4MTNA 4DR1Q 3WDNA 3TP8A 4FO2A 3NTKA 4YQDA 1TWCB 3Q6SA 4KLKA 1DGSA 4DR6Q 4JI8Q 3JAMc 4HAEA 2AUKA 2OCEA 1IBKQ 3C1EA 4IUPA 5BR8Q 2ZM6Q 3GYQA 2PMZB 4BXXH 4AYBB 4DU9A 1K8AC 3B6YA 4UPAA 4NW2A 1X3QA 1K3RA 4K5XA 1U4MA 1UAPA 1DCZA 4IZ8A 2BDOA 2MJ8A 3S17H 3TREA 1CA6A 1Q86C 4F87A 4NP5A 3URYA 1UNSA 2I07B 1D5ZC 3MVVA 4IPDA 1PRTC 3AFQA 1EIYB 4PMCA 4KY7A 5IIFA 1VQIA 1GM5A 4A3JG 2I5HA 1Q8IA 4PQXA 3KDFB 1HFNA 4RFBA 3K0YA 4Z9CB 5M3MB 4XT3B 5KIXA 2N8NA 1SNOA 1U9RA 2K50A 2IWHA 4C2MH 3NBIA 1X9NA 3KUPA 3C3LA 4LF9Q 2P5ZX 1K8MA 2CWPA 4XXEA 4TQUS 3GTQH 1Y8PB 1EY4A 1STHA 5M3MH 3OTOL 4N8FA 2Q2IA 1DOLA 2YTXA 1GD7A 4DV1Q 4JI2L 4DAYB 2EY2A 4DV5L 1D2BA 1BUVT 3E6ZX 1Q82C 2B2TC 3HOUB 2DNCA 1I4HA 1B9NA 3FKIH 5IP9H 1MJEA 2WP8J 1QCBD 2F0EA 3FDTA 1LUZA 2KCMA 2B8GA 4R4QA 1JT8A 3I3CA 1WTHA 1YJWA 2RBMA 2ZTDA 2C35B 4ZUIA 2A6HC 1I4RA 4XIGS 2K4KA 3J80i 4GS3A 1U0LA 1J5EQ 1SYDA 4KHZA 3NUCA 1NUCA 4YWKA 5C44G 4YPWA 2JA7B 2HDLA 4L5TA 1MIUA 2BE5D 4DV2Q 2EYMA 1PH1A 4GKKL 2YV5A 3KJOA 3CF5A 2RCNA 2CCZA 1IKMA 5FO8B 3AIAA 2I5MX 3DWPA 2O5JC 2BH2A 3CCEA 2HIXA 3OOCA 1EFID 2KOLA 2ID0A 2NZHA 2K03A 4GN5A 4JI5L 4FMWA 4LF6L 4YQIA 3HOYG 5D3DA 1QOHA 4A3IG 3KF6A 1IYUA 3E0EA 1IL2A 1FL0A 2UUAL 3HOVB 1GUGA 3RZDB 1IBML 2C9OA 1D1IA 2B29A 1TWGB 4A93B 2VQFL 2QDBA 4A3FB 3AXZA 3S16B 4EVOA 1WVLA 1H9JA 2ZTEA 3J81E 2WB1G 4OHJA 2RDHA 3WOEA 1E3PA 1V9PA 2PNRC 4NXNL 1Q3LA 4ODGA 2B2VC 4JI6L 2Y0SG 1ZJRA 4DV7L 1ENAA 3CCLA 2EDGA 2PPBC 5K36G 1Q7YC 1VQNA 1CI3M 2EZVA 1YZ6A 4YCUA 4JOIA 3EROA 1Q90A 1WTWA 4QB4A 4LF7Q 4HMIA 5EGTA 1HR0W 3IFDA 1GHKA 4YQRA 4DXGA 3RLNA 3T16A 1BBXC 1EY9A 2JA8G 4DNRB 3NSWA 2NWGA 5IE8A 3PIO3 4YQ4A 5FLMG 4M1UB 2F0UA 3J81j 1SAPA 4DK1A 1VQDA 1PH9A 3TS0A 3CQZH 3PUZA 2G9DA 2L55A 3K5LA 1KLUD 1E1TA 4DNIA 3S14B 4B08A 1PLFA 2E75C 5M3FB 2I46A 4JALA 1MBYA 3KYHC 2PNHA 1QILA 1TWAH 1SMYC 3LWEA 5E3FA 1I3QH 5IT9E 1PHJA 5E4XA 2N3SA 1SN8A 2K5HA 3MHBA 2K75A 4JVZA 3I70A 3T1HQ 1HR0L 5JJZA 2VUMG 2WIIB 4KHPQ 2FHTA 3P20A 5IYDH 4QY7A 2PYKA 1EUJA 3GQBA 2MO0A 3RNUA 2ICIA 3NE5B 3RN2A 2BOSA 4J8QA 4JPBW 1J8IA 1XWEA 1N33L 4DR5L 1YJNA 1X7PA 2A69C 4DKAC 1HA6A 4QUCA 1HFGA 4YWLA 1IKLA 1SE2A 2C5CA 3ITPA 1Y1VB 2B63B 1F2YA 3PUXA 2WB1E 4OONA 1VQHA 5E4WC 2F3IA 4YQ8A 3HOXB 4JI7L 1BVSA 1AZPA 1BF4A 1PFNA 3BBDA 3HOZG 3HG9A 1TXYA 1VS0A 1X3GA 3BJUA 4L8JA 5DNFA 5D3IB 3G7LA 2EY1A 4A3KG 2UUBL 3S2HB 3MC0B 1KDCA 4A76A 1ENCA 1NAPA 2HA8A 3K57A 1Q12A 3LX0A 5C5MA 2ZJQA 4HJ9A 1FNUA 1Y1WG 3SK4A 5C4ZA 1Q46A 1VQ4A 2IT1A 4XQNA 4A3EG 3PUWA 1BCPD 2N88A 1FR3A 4JYAL 1BR9A 2EYJA 4IN3A 2MO1A 1WCMB 3V2TA 4C1NK 3M85A 3S2HH 2SEBD 4KD3A 2J7ZA 3HOWG 1EY7A 4FF2A 1BCPF 4KK7A 3QUVA 5C44H 1Q81C 1L1OA 4JI3L 4ULLA 3CD6A 1LM0A 3NTHA 4KKTA 1YJ9A 1HZAA 3R3OA 2KQ3A 3RUZA 1E2WA 1B4OA 1PXUA 2HQLA 4B3SQ 3OIQA 1D5XC 5ELFA 2F4VL 1CFMA 4RKLA 5KYIA 2NVTB 4BBSG 5T1GA 4YQ3A 3CHBD 3UDIA 5M5YH 2F0TA 2L15A 3DM3A 5HGTA 5IOCA 3ONAB 1JWSD 2XRQD 1YHBA 3HOYH 1UE1A 3FHWA 1TIID 2OTJA 3CCJA 4A3IH 2R7ZB 1G91A 1SEBD 2MP1A 1KDBA 2J4XA 3E9IA 1E0BA 3GTJH 1PTOD 1VQOA 3AEVA 4GLXA 1NR2A 3CCMA 1F2LA 4GN4B 1WD1A 1Q1EA 4CGYB 5GMCA 2X69A 1QUQA 3K8AA 4J6HA 3HS0C 3MZ5A 4DV0L 1A3TA 2MHVA 3M7GA 1OXTA 4UP9A 1LTAD 3K7AH 1CSPA 4R8IA 4XQJA 4PZ7A 5C3EH 3U50C 4G7ZC 3PIP3 4IJHA 1DOMA 4FP5D 1I6VC 1OXUA 1K28A 1GJXA 1SYFA 1LTLA 2O4XA 5K36H 3GD7A 4KV6A 4A3DG 1L0YB 3K80C 4AIMA 3NWTA 2HQEA 5LMUL 1P8LA 4DA2A 4LF5Q 4LFAL 1VQAA 2B2UA 3W5OA 1HNWL 3O7BA 4U673 5ISRA 2OTLA 3CRKC 2KECA 1SNCA 4K5VA 1VQ5A 2JA8H 3CCRA 5E1FA 4YY3Q 3IKJA 4IUUA 1DONA 2EGVA 4APVA 2G5DA 1TS5A 1S3OA 1BNZA 3J81i 1BCPB 4A75A 4MNOA 2Q8RE 2NTTA 4L63B 3A5ZB 3S1MB 4HJ7A 3GTOH 5DAUA 4KDZA 3I55A 1VQFA 2B8FA 3HKSA 4U68A 3PO3B 1RCVD 3M7NA 4HCEA 5D65A 4MTKA 4OO1H 2EY5A 1ONLA 2L5TA 4DV4L 1LTSD 1KAWA 3D8GA 1KQSA 4BXXG 1HTPA 4C3HH 4DN4M 1I5FA 2NYZD 4KJNA 2DY8A 1G8ZD 1SE8A 2MPMA 1EZ8A 1B8AA 2OT2A 4ME5A 3F2CA 1AE3A 1BKBA 2Z4IA 3NBHA 4GNXC 2N55A 4AYBG 4L5RC 3KDFA 1R9TH 1I6HB 1KXLA 3N4JA 5J3BA 1DXMA 3JAML 1PH2A 3M4OB 3PUYA 3S1NB 4R4CA 4OWTB 2E5LQ 1U4PA 1VF7A 4F88A 1AP0A 4WJ4A 1SNMA 3EJIA 1B53A 1I94L 4Q0FA 1U5KA 4YHHQ 1I4XA 2UUBQ 2E2IB 1PTOB 4MCBA 2F52A 1F9SA 2JA5H 1V1PA 2UU9Q 5C4XB 3NQIA 2K01A 4WJ3M 1K8OA 3GV3A 3O13A 1W6KA 4K2KA 3Q8DA 1J85A 4J15A 1UEAB 1S4ZA 3HOZH 2KJXA 2NZOA 4UAIA 5M3MG 1JB3A 4DAYA 3I4NH 2JYOA 3DLLA 3PIPA 2HHHQ 3VYSA 3EN2A 4DR4Q 4K6DA 1JICA 4GKJL 1DJRD 1XX8A 4X65L 3I4MH 1EQTA 2XN9C 5JEAH 2F0QA 1TWHH 1TWFH 4KN7C 2H5XA 5KRUA 3BYTB 1VDZA 5L37A 2A8VA 4JOIC 3FKIG 1Y1WH 4XYOA 3ONPA 4QQBX 3W2DA 4JW0A 3X3NA 5ELOA 5I9OA 4P2CB 4JI4Q 1W3SA 1YEZA 1N32Q 2XVSA 2ATWA 3HOWH 4HIMA 3NENA 5IGDA 1ILQA 1CSQA 4V0BA 1AZQA 3GTLH 4V190 4HSVA 2KHJA 2B2WA 2A6HD 2QW7A 3M4YA 3GTKB 2EXZA 2L12A 3PUVA 2HCCA 4CJ2C 3T1YL 1Y14B 2K14A 1KRTA 1W6JA 3H0GH 3HFZB 4TKOB 4GN3B 3DUZA 2MGSA 4JI0Q 5EPLA 3CCVA 4BBSH 1TVXA 2A6ED 4H13C 1NCVA 3ND8A 2IL8A 4YVHA 3IC6A 4BS9A 2LSSA 2NTSA 4AYBE 5G3LF 5M5WH 4DK6C 2BDNA 4LJZC 3CW2C 3CU7A 3NK9A 5KNCA 1V6ZA 1GOZA 2NVYH 2WAQB 1VMPA 3S2DH 3SVMA 1HZCA 1Y8OB 4HN7A 2JEBI 4BBRB 1GUTA 2R7DA 1UALA 1RODA 4BWGB 4YQPA 1T5XD 1GUOA 1C0AA 2AHOB 3OWEB 4O42A 3GTMB 4A93G 1CKOA 1NMFA 3UDXA 1K83B 2AUJD 4A3FG 3BS1A 2NVXH 4J3CA 1QVFA 1SYCA 3T4AC 2E2JH 4BBRH 2YY8A 4AQYL 5IGEA 1JE5A 4UHVA 2NVQB 4WRDA 5GROA 2V1CC 3TDQA 1GZ0A 3TMEA 2VXWA 5JJIA 1O7ZA 3I72A 1GKHA 1PYWD 3G6EA 1B50A 2F0MA 2K1BA 3OPOA 1VH0A 1I50H 4LFBL 4YQSA 4QGUA 4C1NI 1JOQA 4DV4Q 1SSOA 1V2XA 3BVZA 4O1NA 3S24A 3LWUA 1JCKB 3FRPB 2R92B 1TT2A 3ILKA 1OTCA 2Z8LA 2AQ3B 3NHHA 5J1ZA 2AKWB 4WJWA 5JPNC 5AFWA 3L2PA 3D4RA 4LFCL 1J9OA 4RMFA 4DR3Q 4KHVA 1EOVA 3U9OA 1WTOA 3CPFA 4KMUC 4FF3A 2WKDA 1YITA 1SNDA 1L1OC 5FKAC 1SROA 5M3FG 1GUSA 1TWCH 2HUGA 2RKSA 4EX5A 2GA4B 3MA2B 4LF8L 3T53B 5I6YA 5IYDG 4DFAA 4YQ2A 4ILWA 3BDCA 4IUTA 4YQ9A 2R93B 4DF7A 2EJFC 2YU9B 3AU7A 1VHYA 2F3VA 3D3RA 2Z0YA 2RVLA 1SXTA 3SGIA 4YQBA 1PH7A 1N8RC 3E9HA 4YPZA 1EEID 3NXWA 5KNDA 2OF1A 2XSCA 3GP7A 2A5HA 2PZUA 3ZYYX 4ME3A 4KN4C 4I65A 1HUNA 2JSOA 5CO4A 3HKZB 5GADC 4XQQA 1EIHA 1Y1VG 1DOKA 2VQEL 1Y69U 2B63G 1AE2A 3ER0A 1UWVA 2EJMA 2E76C 4NPSA 4RCNA 3BYYB 1IBLQ 4RAUC 4YQGA 4C3JB 2FMCA 3HOXG 3UE0A 3IAYA 2M00A 3WWVA 4B3RL 5CC4A 1QZHA 1CA5A 2UXCL 3MTSA 3A56A 4KI0A 3TP5A 4PMWA 3K5MA 2IJ0A 3I4OA 3VR2A 4JBMA 1SLJA 1STYA 2O3AA 4YQ6A 2ZT9C 1S5CD 5IWAQ 3BDOA 3GTPB 2B2UC 3RZOB 4X6AH 1ENFA 1HNZL 1LTGD 1LT5D 3DEPA 2N49A 1W2BA 1KHIA 3HOUH 4POGA 2VB3X 2A1AA 3ND9A 4A4IA 1WCMG 3Q0AA 1HTLD 3T56B 4QL5A 3SK6A 4X3MA 4IUQA 2F0HA 1SE3A 3T13A 4BY7B 4A3MB 1QZGA 3K5NA 2QDLA 2JQOA 4H0LC 2VNUD 1RL2A 2VY3A 1P9PA 2HCIA 3SE0A 2JA7H 1WYDA 2F0JA 2AWNA 2RDGA 1O80A 1H95A 1KABA 4A3MH 1LT6D 3CKIB 1A3VA 3A7LA 4NXML 1XNRQ 3NTIA 2MNAA 3J80c 2VB2X 4YVGA 4A3GB 1FD7D 5I9PA 2JA6B 3FVQA 1GUNA 5IGBA 3S15B 3A8KE 4AQYQ 4TRDA 4ZUJA 2KEEA 5DM63 5EKIA 1PYBA 2R7ZG 3QO2A 1OXXK 4JI1Q 3HOVH 3STBD 1ESFA 3S1RB 1CHQD 3TBIB 4DV3L 3RZDH 3CC2A 3P7JA 5C3EG 1YNJD 1K0SA 3OINA 3QB3A 4BY1B 4A93H 1TWGH 2QF7A 1XNQL 4A3FH 4LFBQ 2B2YC 2F0LA 3S16H 3MAQA 4DXFA 4XDXA 5CBEE 4K6LA 5HGQA 2EYHA 3S1RH 4JG2A 4P73A 1SNPA 3MXPA 3S9WA 1SFOB 3U4ZA 4PMBA 3A7AB 1HA5A 3CRLC 4ZLTF 2UUCL 5IYBH 2ES2A 2ICEC 4JBJA 1VQLA 3NELA 4LAAA 4X3LA 1CQVA 1HZ9A 2LKVA 3ULJA 2WACA 2R61A 2JEAI 2HD3A 4R8NA 3BZKA 5FO9B 1A0IA 3CXCA 3J7ZC 4GOPC 3OIJA 1X56A 5M5XB 1CKMA 4KY6A 2VW9A 2IX0A 1PH6A 1TY2A 1TS2A 5TSSA 4IALA 3CCUA 3AMUA 4OO1G 1WFQA 2CH4A 5GAGC 1XMQL 2EYLA 4LW1A 1O6DA 1RF2D 4C3HG 3S14H 1AFPA 1O7YA 2JN4A 3L9AX 3Q24A 5M3FH 1GHJA 1VQGA 4OO1I 2WFWA 3MFGA 1LTTD 2IY5B 5FOBB 2E2HB 5EJWA 4YQ0A 1SBBB 3HP3A 1PDQA 2BH8A 1V1OA 3UI2A 5FLXc 4PZKA 3TQYA 2L1BA 1IW7C 4HEDA 3KTYA 1Z85A 2RDFA 2DNEA 1TKWB 1I4QA 2DJGC 2R3ZA 4AH6A 2F4IA 3OTOQ 1MJCA 5A2QL 2F0FA 1I4PA 1JOOA 2I5LX 5AJ3L 4DR2L 5LMNL 1DM0B 4MCCA 4YQAA 2JA5G 4A3JB 4A3BB 4JI2Q 2UXCQ 4L69A 1MHWC 2XRSD 3M4QA 4DV5Q 3K0XA 1G2TA 2F0OA 1Y1VH 2B63H 1ICWA 2CW0D 3I4NG 3NEMA 5I4DA 3GV6A 1J6QA 2OQKA 4X64L 2D0OA 3HOXH 1CUKA 3RD4A 3I4MG 1QNUA 5JEAG 1C4QA 5I2YA 4H44C 1ET9A 4R4OA 3G48A 4XTCS 1NMGA 1RJTA 4DUYL 3KLRA 4KJOA 3F8TA 4GKKQ 4H3ZA 4JAKA 2CKZB 2QA4A 2XIWA 1CHPD 4DUZL 1ZXTA 1IYVA 1VQBA 3PCOB 1CTMA 4DPGA 2NZ1D 1E2ZA 2DGYA 3ZJYC 1KIXA 4JI5Q 4IQZA 4LF6Q 2B39A 1STGA 1WCMH 4OL7A 2HIVA 2D9UA 4NXMQ 3QJYA 1X3PA 2EGWA 1CKNA 3J7AF 2UUAQ 4H7BA 3NQTA 1VCIA 2WKCA 2ZJRA 1XMOL 3A8JE 3H0GG 3K59A 3GTGB 1VQEA 3P1HA 1IBMQ 2BE5C 4O2DA 5D14A 4HR7B 2VQFQ 5LHY1 1MD2D 3X3MA 1EQVA 1FNVA 2KEDA 3SR1A 3FMCA 1QB5D 5LL6S 5JOBA 3MXNB 3EA6A 3CMAA 2F0VA 4DV3Q 5FO7B 1F2MA 1HQRD 3PF5A 4NXNQ 1FGBD 2NVTH 4YWMA 4JI6Q 3V96A 2RSNA 4DV7Q 3GDEA 1RTOA 2RHSB 4IOCA 3DCMX 3KLSA 4YPXA 2RF4A 4DAMA 3JAME 4A3CG 3CPWA 1U4LA 2R7ZH 4YQLA 1JWMD 4IUVA 1WD0A 2K5QA 4ZK9B 1GVPA 2WAQG 1PTOF 4GNXB 3D0FA 2DN8A 3ERQA 3TEHB 2TMPA 4KY5A 4DNTB 1JOKA 4IFDG 4P75A 5FK9C 4BBRG 1WOCA 3KK7A 3KF6B 3VYRA 2K5VA 1QNKA 1HNXL 5EKKA 2OQ0A 5BN5A 2Y0SB 4HSPA 3OYYA 1KD1C 3E5YA 2CH4W 3OIIA 4E8BA 1Z6HA 1TY0A 3QG1A 5ELDA 4EQNA 3H15A 3QR8A 3P75A 5FJ8H 4GLAC 1XXGA 3E0JA 4QMGA 5D9FA 1BBUA 2YTVA 3BU2A 2Q8IB 1WTXA 1XMQQ 2RA4A 2PQAB 3BDLA 1JC7A 2H4OA 4QIWB 4K0KL 1V8QA 3AI9X 1STBA 3AYHB 4QUFA 2F0PA 4X62L 1E2VA 1HR0Q 3RR5A 3MFYA 4JV5L 3TZUA 2EIFA 3KJPA 3J7A5 2EYOA 4DK0A 4X3TA 1I4GA 3N52A 4JC0A 2R92G 2WV6D 2FXQA 1N33Q 3CCSA 4DR5Q 4CDFC 4IPCA 4LF4L 3PO2B 1JE4A 2SNSA 2Z1CA 1RHPA 4DAVA 3S1MH 4OXPA 4X66L 5C4HA 3KLWA 2N78A 3PO3H 4NDXA 3VR6A 3CMEA 1BQQT 2M9VA 1TQOA 2MUYA 1S5FD 2SNMA 5JEAJ 2O2LD 1VQ9A 1CQFA 2VUMB 2V3KA 2QGQA 2A68C 4JI7Q 3J81c 3BZCA 4DR7L 2EY6A 3MWYW 2JE6I 2LS01 4IJLA 2AMCB 3N6RA 1M8AA 5EPJA 2EQSA 5F2DA 4DR1L 1NS5A 1Y8NB 3QIAA 1H9KA 2WAQE 5KEEA 4FAKA 4WFN3 4DR6L 1D7QA 3KBXA 1IL8A 1PRTD 1OO9B 4JWHA 4JI8L 3OW7A 1MGSA 1I6HH 4IURA 2QEXA 3I91A 3M4OH 2K5NA 1IBKL 1A6XA 1UAJA 3S1NH 3IRBA 2X6LA 1BBWA 5BR8L 1MSHA 2ZM6L 4JYAQ 4HMJA 3I56A 3W3AA 1PRTF 2JP1A 3AFPA 3IFTA 4ZYSA 1PTOH 2D62A 2E2IH 1VQKA 3HKZG 3I73A 2EJGC 3MXGA 1ILPA 1E7ZA 4G7OC 2KHSA 4R9WA 5C4XH 4C56C 4EQ5A 1E1OA 1XTCD 4C3IB 5C4JB 5CV9A 4RHRA 4KKSA 3NP8A 1SMXA 1MI2A 4C3JG 4A3KB 4JI3Q 4S3SA 1SE4A 4N9TA 3CAMA 4X3SA 5CV5A 1B44D 3E5SA 1ZYRC 3ERSX 5IYCH 2V4DA 2IX1A 5IT9c 2F4VQ 4A3EB 5EKLA 2K7VA 5IY0A 3HOUG 1BCPC 2F0GA 3U9SA 2EPBA 2K33A 3DM1A 2H1EA 1EIFA 2D0PA 1MKHA 1NBWA 4LF9L 4P72A 1HRJA 1II3A 4YVIA 2JK8A 5EPKA 4IO9A 2RHQB 4YQQA 1UE7A 2KBNA 2IW3A 4CNEA 3I7FA 4M8AA 4R4TA 3F2UA 3OHXC 2JA7G 3A55A 1BOSA 1S72A 3TRZA 4IFDJ 4GZYC 4B3ML 4IPHA 1DD2A 4Q5VA 3GTKH 4J1MA 4BY7G 4ZRZA 4A3MG 3HRZC 3TP7A 4DV0Q 1JWUD 1ESRA 1O78A 4K2LA 3UE1A 4F8MA 1JJ2A 3M3YB 3G6JB 4FXDA 1WI5A 2DJFC 3TN2A 3BBHA 2L11A 2E8GA 3EIVA 1O7LA 4FNFA
chains in the Genus database with same CATH topology
1JMCA 2CFMA 1J5EL 5IWAQ 1OXSC 4O0AA 3ULPA 1N33L 3HOVG 4DR5L 1YJNA 4X6AH 1X7PA 5C0XG 3M3YH 4DKAC 4YWLA 4A3CH 1HNZL 4DV2L 3CC7A 5JJLA 2N49A 5LMUQ 1KHIA 1W2BA 2JA6G 3HOUH 5FLMH 4LFAQ 4POGA 4YCWA 3PUXA 1HNWQ 2A1AA 2WB1E 4OONA 1V1QA 4A4IA 1VQHA 1WCMG 1EYGA 4YQJA 1X65A 3HKZE 4QL5A 3H3VH 2F3IA 4LUVA 2QMMA 4X3MA 4YQ8A 4DV6L 1PFSA 1QZGA 4JI7L 5C0XI 2JQOA 3PV0A 1PH5A 5AJ3Q 4DR2Q 5LMNQ 1BVSA 2VNUD 3UDFA 2UXBQ 1RL2A 2VY3A 3GTMH 4BY1G 1P9PA 3BBDA 3HOZG 1K83H 4LUZA 1TXYA 4L5QA 3G71A 1VS0A 2UXDL 1X3GA 3BJUA 1VQPA 1WYDA 1K8GA 2JA7H 2AWNA 3PO2H 5IYBG 1PYSB 4TVAB 1VHKA 1H95A 4CNDA 2LXKA 1A63A 2ALYB 2Q2TA 4A3MH 3MEFA 4A3KG 2UUBL 3CP0A 1IXRA 4FDBA 4IPGA 3F2DA 1YHAA 4HIDA 1YHQA 4NXML 2NVQH 2R93G 3UDGA 1QVGA 4A76A 1SR3A 3PGZA 1XNRQ 4X64Q 2HA8A 5IP7H 4RG1A 2MNAA 3J80c 1IYJB 1V43A 2BA0A 1Q12A 3JAMi 2VUMH 4YVGA 1X3FA 1RIPA 1E22A 4HJ9A 1Y1WG 1UE6A 1VQ4A 1Q46A 2ZJQA 3TS2A 4YPWA 1VQMA 2IT1A 1AH9A 4A3EG 3PUWA 4YQ5A 4HJ8A 1NE3A 2CWAA 4JYAL 2GVBA 4DR3L 4AQYQ 4DUYQ 4UP8A 3M85A 2MO1A 2KHIA 3S2HH 1PYBA 2R7ZG 1OXXK 1P16A 4JI1Q 3HOVH 4POFA 1X55A 4A93G 3HOWG 3STBD 5HY6A 1FJGQ 1LYLA 4DUZQ 3RZDH 3K81C 4DV3L 3CC2A 5C3EG 2R92H 3QUVA 1Z9FA 1B7YB 3OINA 5C44H 1TWGH 4A93H 1Q81C 1L1OA 1XNQL 2PI2E 4A3FH 4LFBQ 4JI3L 4OO1G 3CD6A 1LM0A 1YJ9A 3S16H 1HZAA 1E24A 5ELNA 2VL6A 3I2ZA 5HGQA 4LF7L 1I94Q 1FGUA 1WJJA 2HQLA 4B3SQ 3S1RH 3M9BA 4JG2A 2YTYA 4P73A 2F4VL 4MCDA 2NN6G 1Z47A 4NB3A 3U4ZA 4A3LG 4YQ3A 4BBSG 1KC8C 1UAKA 3UDIA 2Z6KA 1XMOQ 5M5YH 2UUCL 2L15A 3DM3A 4DK3C 5IYBH 4C3IH 5C4JH 2ES2A 2QWVA 4JBJA 1PH3A 1Q1BA 3NELA 3CCQA 1VQLA 3ICEA 4X3LA 1A62A 1YHBA 1HZ9A 3HOYH 1UE1A 3FHWA 3ULJA 4A3KH 1XPOA 2OTJA 3CCJA 4A3IH 3CC4A 4IOAA 3KF8B 4PZ6A 1C7YA 2R93H 2YYZA 2JEAI 4JWJA 3BBEA 2NN6I 1PVOA 1PH4A 3BZKA 5GM8A 3E9IA 4GKJQ 3GTJH 2OWOA 2YU9H 4YQOA 1A0IA 5IP9G 4X65Q 3J7ZC 3CXCA 4GOPC 4GOPA 3OIJA 2VZAA 2Q2HA 1VQOA 3AEVA 1X56A 4GLXA 4A3EH 1CKMA 3W1GA 1IBLL 1ASYA 3CCMA 4GN4B 2VW9A 1Q1EA 2IX0A 1PH6A 5GMCA 1VQCA 1QUQA 1K0RA 3K8AA 3CCUA 4DV0L 4YVJA 2JJQA 1XTDA 1KL9A 1B70B 1WFQA 4P74A 5GAGC 3NBHB 1XMQL 4DV1L 3T1HL 1OXTA 4UP9A 2IHFA 4LW1A 1N34L 4A3BG 3K7AH 1O6DA 1CSPA 3S14H 4KHPL 4PZ7A 5C3EH 3U50C 1L2FA 2DUDA 1SRUA 4IJHA 5GAEC 5M3FH 1OY5A 2V3JA 1X7OA 1OXUA 3KNUA 2CQOA 1VQGA 2JA9A 1LTLA 2R6GA 1XJVA 5IWAL 4OO1I 3W1BA 1IPAA 1L1OB 2WFWA 3GD7A 4LUOA 5JJKA 4C3JH 1EWIA 4PG3A 4A3DG 3JC66 2XGTA 2IY5B 3K80C 4AIMA 3T1YQ 4YQ0A 1CKNB 1VQJA 5GMBA 1HNXQ 2BH8A 5FLXc 1P8LA 5LMUL 4B3TL 4PZKA 3TQYA 4LF5Q 4LFAL 2PMZE 3N4KA 1VQAA 4L5SA 3W5OA 1HNWL 3O7BA 1VQ8A 2OTLA 1D8LA 4A3GG 1YVCA 1Z85A 1VQ5A 2JA8H 3KTYA 3CCRA 4YY3Q 1NTGA 2MFIA 4AH6A 4B3MQ 2EGVA 4JWFA 4APVA 3OTOQ 1MJCA 1QVCA 1S3OA 4JCVE 2I5LX 3A74A 1X54A 5AJ3L 2GVAA 5C0XJ 5LMNL 4DR2L 1PA6A 4MCCA 3J81i 4YQAA 2JA5G 1O7IA 1PH8A 3GTPH 4K0KQ 4A75A 3RZOH 4MNOA 4JI2Q 5E7NA 2UXCQ 4L69A 1UAMA 3EBEA 3M4QA 3PSIA 3A5ZB 4DV5Q 3K0XA 2I0QA 1Q8KA 1YIJA 4HJ7A 1Y1VH 2KCTA 3GTOH 4KDZA 4YPYA 3I55A 1VQFA 4X62Q 2B63H 3HKSA 2CX8A 3L0OA 4GOPB 3M7NA 4R4IA 5DLQE 3I4NG 4JV5Q 4JBKA 3NEMA 1NJIC 5FAIA 4YQNA 1J6QA 1XNRL 2A19A 3LGJA 2OQKA 4X64L 2D0OA 4P71A 4DV4L 1KQSA 1KAWA 3S1QH 4BY7H 1QUQB 4BXXG 3HOXH 1CUKA 4C3HH 4YQKA 3I4MG 1I5FA 5JEAG 1YNXA 1XPRA 1SE8A 4R4OA 1B8AA 3G48A 4XTCS 1NMGA 4DUYL 4UP7A 3VDYA 1NY4A 3F2CA 4LF4Q 3D31A 3F8TA 4Y7NH 4X66Q 4GKKQ 4H3ZA 4JI1L 1AE3A 1BKBA 4JAKA 4DV6Q 1M1KC 3RLOA 4A3DH 2CKZB 1KRSA 3U4VA 2QA4A 2Z0SA 4GNXC 4GNXA 4DUZL 4AYBG 4L5RC 1IZ6A 4YCVA 3KDFA 1R9TH 1KXLA 1VQBA 3PCOB 3N4JA 5J3BA 4CNFA 4DPGA 1PH2A 2UXDQ 3PUYA 5GAHC 2DGYA 1M90C 4A3GH 2GN5A 1HZBA 4OWTB 4R4CA 1EQQA 2E5LQ 3ZJYC 4DR7Q 2JA6H 4YQ1A 1KIXA 4WJ4A 2MQHA 3L8UA 4JI5Q 1EQRA 1I94L 3S15H 4LF6Q 1NXZA 1TO0A 1U5KA 4YHHQ 4B3SL 4MTNA 2UUBQ 1WCMH 4MCBA 2HIVA 2F52A 4NXMQ 1K9MC 3NK6A 2JA5H 1G51A 4DR1Q 4OX9L 2EGWA 1CKNA 2UU9Q 4YVKA 2UUAQ 1VQ7A 4YQDA 4WJ3M 1VCIA 2ZJRA 1XMOL 4OWWB 3H0GG 1DGSA 4KLKA 4DR6Q 1VQEA 1IBMQ 4O2DA 3Q8DA 1J85A 4J15A 4JI8Q 3JAMc 4BY1H 2VQFQ 3HOZH 2NZOA 2PQAA 4BA1I 4HJ5A 1L0WA 5M3MG 3I4NH 3DLLA 2OCEA 3PIPA 1IBKQ 2HHHQ 3EN2A 3MXNB 5FJ8G 5BR8Q 4DR4Q 2ZM6Q 3GYQA 3K7UC 1S40A 4LFCQ 4BXXH 4GKJL 3CMAA 1G291 4X65L 3I4MH 1A8VA 1N36L 4DV3Q 4IG6A 2VS1A 3PF5A 1TWHH 1K8AC 1TWFH 3B6YA 1SFOH 4NXNQ 2H5XA 2NVTH 4UPAA 1K3RA 4YWMA 2A8VA 4JI6Q 3A0JA 3FKIG 4JOIC 4H02A 1Y1WH 4DV7Q 3GDEA 4MZ9A 3S17H 3ONPA 4QQBX 3TREA 1Q86C 4LF8Q 4J3CA 2RHSB 4IOCA 3DCMX 5ELOA 4YPXA 2RF4A 4JI4Q 1W3SA 4DAMA 5LMNW 4IPDA 4A3CG 1YEZA 3CPWA 3AFQA 2R7ZH 1EIYB 4YQLA 3U58A 1N32Q 2B3GA 1VQIA 1GM5A 2ATWA 3HOWH 1GVPA 3L7ZC 4A3JG 2I5HA 2WAQG 4HIMA 4GNXB 3NENA 2AWOA 3D0FA 1CSQA 3A5UA 3GTLH 3TEHB 4XBOA 3KDFB 2KHJA 5M5XH 2XTIA 4YQCA 4IFDG 4P75A 4BBRG 3PUVA 1WOCA 4LNQA 2N8NA 3PO3G 3KF6B 1HH2P 2K5VA 3T1YL 1Y14B 2K14A 2K50A 1HNXL 4C2MH 1X9NA 4LF5L 2OQ0A 1X3EA 1KRTA 1XPUA 4LF9Q 3H0GH 3OYYA 1KD1C 3HFZB 3E5YA 3F1ZA 4GN3B 3PO2G 2CWPA 1JB7A 4TQUS 3GTQH 3OIIA 4JI0Q 3KFUA 4A3LH 4E8BA 3CCVA 4YY3L 2VQEQ 4BBSH 3H3VI 5M3MH 3OTOL 3H15A 3F2BA 4YVHA 3IC6A 2LSSA 2Q2IA 4GLAC 4AYBE 5FJ8H 5D9FA 2YTXA 1GD7A 2YTVA 1BBUA 1JJCB 3BU2A 3KOJA 4DK6C 5M5WH 2PQAB 4DV1Q 4QJFA 1XMQQ 4K0KL 4JI2L 4DAYB 1N34Q 3CW2C 1V6ZA 2E2HH 4DV5L 1GO3E 3AI9X 1Q82C 3AYHB 2NVYH 1X6OA 1EFWA 1JJGA 4X62L 4B3RQ 2UXBL 1HR0Q 3RR5A 5IP9H 3FKIH 1MJEA 3S2DH 2WP8J 1HZCA 4JV5L 2ZJPA 1LUZA 2KCMA 2JEBI 1JT8A 4R4QA 3KW2A 1YJWA 2EIFA 2ZTDA 2C35B 3KJPA 2R7DA 1UALA 4XIGS 2K4KA 3J80i 4GS3A 3J7A5 1U0LA 4YQPA 4B3TQ 1J5EQ 4JC0A 1C0AA 2AHOB 5EAYA 2R92G 2FXQA 4KHZA 5C44G 1CKOA 1NMFA 4YWKA 3UDXA 3CCSA 4DR5Q 4A3JH 1N33Q 4A3BH 5C4XG 3GO5A 4IPCA 4A3FG 4LF4L 4L5TA 2NVXH 1HNZQ 1MIUA 4DV2Q 1PH1A 1QVFA 3S1MH 4OXPA 4X66L 2EXDA 4HIKA 2YV5A 3KJOA 2E2JH 4GKKL 3CF5A 3KLWA 2RCNA 4BBRH 2CCZA 4AQYL 2N78A 3PO3H 2YY8A 2Y0SE 3CMEA 1JE5A 3AIAA 1MXIA 5GROA 2I5MX 2V1CC 3RN5A 1GZ0A 2BH2A 3CCEA 2HIXA 5JEAJ 1VQ9A 2V3KA 1ASZA 2QGQA 4GLVB 4KGNA 1C9OA 5IYCG 1N9WA 4JI7Q 3J81c 2ID0A 3BZCA 1FJGL 5JJIA 2NZHA 3ULLA 4DR7L 1GKHA 2E5LL 4GN5A 4JI5L 3G6EA 4FMWA 4LF6L 4YQIA 1VH0A 2JE6I 1I50H 4QIWE 4IJLA 4YHHL 3HOYG 4LFBL 2Q2UA 4A3IG 2AMCB 3KF6A 3KY7A 4QGUA 4YQSA 4PZ8A 2EQSA 4DR1L 1NS5A 3E0EA 2UU9L 1IL2A 1FL0A 2UUAL 4DV4Q 1V2XA 2WAQE 4FAKA 3S24A 2ASBA 4DR6L 1D7QA 1IBML 1G6PA 4CNGA 4JWHA 4JI8L 3ILKA 2B29A 1OTCA 2VQFL 1I6HH 3PF4A 2QEXA 4YQTA 3M4OH 2AKWB 1VQ6A 2K5NA 3FP9A 3PIOA 1IBKL 2HHHL 3S1NH 3IRBA 1UAJA 3AXZA 1BBWA 5BR8L 3L2PA 2ZM6L 4DR4L 2ZTEA 4LFCL 4JYAQ 4RMFA 4DR3Q 3I56A 4BA2I 2WB1G 1EOVA 3AFPA 1UE5A 1K73C 2D62A 3CPFA 1E3PA 3HKZG 3M4PA 5GQOA 2E2IH 1VQKA 3NK7A 1V9PA 4NXNL 1YITA 1E7ZA 5C4XH 1L1OC 1SROA 5M3FG 1TWCH 4JI6L 2Y0SG 4EX5A 4EQ5A 1ZJRA 4OWXB 1E1OA 4DV7L 4UY8C 3GTGH 4ALPA 3CCLA 4YQ7A 1PV4A 4LF8L 5IYDG 5K36G 1FVIA 3OW2A 1Q7YC 1VQNA 1SMXA 4JWGA 1XNQQ 4LWCA 2BA1A 1YZ6A 4JI4L 4YQ2A 2ZTCA 4YCUA 4JI3Q 4JOIA 4YQ9A 3CAMA 4OX9Q 1N32L 4LF7Q 1HR0W 1T9HA 2Z6KC 4YQRA 3ERSX 5IYCH 3RLNA 1VHYA 2IX1A 2Z0YA 3SGIA 5IT9c 2F4VQ 2JA8G 4YQBA 5IY0A 4YQ4A 5IE8A 1PH7A 3HOUG 5H1SE 5FLMG 1N8RC 3E9HA 4YPZA 3J81j 2PI2A 3G4SA 2UUCQ 1VQDA 1PH9A 1EIFA 3TS0A 2I6DA 2D0PA 3IEFA 3CQZH 3PUZA 1MKHA 2HT1A 1NBWA 3STBC 4LF9L 4ME3A 1E1TA 4P72A 1N36Q 4YVIA 2IHEA 2JK8A 4DNIA 4Y52H 5CO4A 5GADC 4IO9A 4JI0L 4H3YA 2RHQB 4YQQA 1Y1VG 1UE7A 1UEBA 2KBNA 2VQEL 4CNEA 2B63G 3I7FA 1AE2A 4JALA 4R4TA 2LXJA 3ER0A 1UWVA 2JA7G 3KYHC 2PNHA 3TRZA 1S72A 4IFDJ 1TWAH 4NPSA 1IBLQ 4B3ML 3RLFA 4IPHA 4YQGA 1I3QH 3GTKH 4BY7G 1PHJA 4IFDI 1HJPA 3HOXG 4A3MG 2KENA 4DV0Q 3UE0A 2N3SA 1OXVA 2R7FA 4R1JA 1SN8A 2K5HA 3UE1A 2K75A 3WWVA 4HJAA 1JJ2A 4B3RL 3T1HQ 1YBYA 5IP7G 1HR0L 1QZHA 3AQQA 2UXCL 2VUMG 4KHPQ 4KI0A 4HIOA 4PMWA 1YI2A 4JBWA 1WI5A 5IYDH 3I4OA 4JBMA 4QY7A 1SLJA 2O3AA 3BBHA 1EUJA 2E8GA 3EIVA 2MO0A 3RNUA 3RN2A 2K52A 4YQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMC A;  2CFM A;  1J5E L;  5IWA Q;  1OXS C;  4O0A A;  3ULP A;  1N33 L;  3HOV G;  4DR5 L;  1YJN A;  4X6A H;  1X7P A;  5C0X G;  3M3Y H;  4DKA C;  4YWL A;  4A3C H;  1HNZ L;  4DV2 L;  3CC7 A;  5JJL A;  2N49 A;  5LMU Q;  1KHI A;  1W2B A;  2JA6 G;  3HOU H;  5FLM H;  4LFA Q;  4POG A;  4YCW A;  3PUX A;  1HNW Q;  2A1A A;  2WB1 E;  4OON A;  1V1Q A;  4A4I A;  1VQH A;  1WCM G;  1EYG A;  4YQJ A;  1X65 A;  3HKZ E;  4QL5 A;  3H3V H;  2F3I A;  4LUV A;  2QMM A;  4X3M A;  4YQ8 A;  4DV6 L;  1PFS A;  1QZG A;  4JI7 L;  5C0X I;  2JQO A;  3PV0 A;  1PH5 A;  5AJ3 Q;  4DR2 Q;  5LMN Q;  1BVS A;  2VNU D;  3UDF A;  2UXB Q;  1RL2 A;  2VY3 A;  3GTM H;  4BY1 G;  1P9P A;  3BBD A;  3HOZ G;  1K83 H;  4LUZ A;  1TXY A;  4L5Q A;  3G71 A;  1VS0 A;  2UXD L;  1X3G A;  3BJU A;  1VQP A;  1WYD A;  1K8G A;  2JA7 H;  2AWN A;  3PO2 H;  5IYB G;  1PYS B;  4TVA B;  1VHK A;  1H95 A;  4CND A;  2LXK A;  1A63 A;  2ALY B;  2Q2T A;  4A3M H;  3MEF A;  4A3K G;  2UUB L;  3CP0 A;  1IXR A;  4FDB A;  4IPG A;  3F2D A;  1YHA A;  4HID A;  1YHQ A;  4NXM L;  2NVQ H;  2R93 G;  3UDG A;  1QVG A;  4A76 A;  1SR3 A;  3PGZ A;  1XNR Q;  4X64 Q;  2HA8 A;  5IP7 H;  4RG1 A;  2MNA A;  3J80 c;  1IYJ B;  1V43 A;  2BA0 A;  1Q12 A;  3JAM i;  2VUM H;  4YVG A;  1X3F A;  1RIP A;  1E22 A;  4HJ9 A;  1Y1W G;  1UE6 A;  1VQ4 A;  1Q46 A;  2ZJQ A;  3TS2 A;  4YPW A;  1VQM A;  2IT1 A;  1AH9 A;  4A3E G;  3PUW A;  4YQ5 A;  4HJ8 A;  1NE3 A;  2CWA A;  4JYA L;  2GVB A;  4DR3 L;  4AQY Q;  4DUY Q;  4UP8 A;  3M85 A;  2MO1 A;  2KHI A;  3S2H H;  1PYB A;  2R7Z G;  1OXX K;  1P16 A;  4JI1 Q;  3HOV H;  4POF A;  1X55 A;  4A93 G;  3HOW G;  3STB D;  5HY6 A;  1FJG Q;  1LYL A;  4DUZ Q;  3RZD H;  3K81 C;  4DV3 L;  3CC2 A;  5C3E G;  2R92 H;  3QUV A;  1Z9F A;  1B7Y B;  3OIN A;  5C44 H;  1TWG H;  4A93 H;  1Q81 C;  1L1O A;  1XNQ L;  2PI2 E;  4A3F H;  4LFB Q;  4JI3 L;  4OO1 G;  3CD6 A;  1LM0 A;  1YJ9 A;  3S16 H;  1HZA A;  1E24 A;  5ELN A;  2VL6 A;  3I2Z A;  5HGQ A;  4LF7 L;  1I94 Q;  1FGU A;  1WJJ A;  2HQL A;  4B3S Q;  3S1R H;  3M9B A;  4JG2 A;  2YTY A;  4P73 A;  2F4V L;  4MCD A;  2NN6 G;  1Z47 A;  4NB3 A;  3U4Z A;  4A3L G;  4YQ3 A;  4BBS G;  1KC8 C;  1UAK A;  3UDI A;  2Z6K A;  1XMO Q;  5M5Y H;  2UUC L;  2L15 A;  3DM3 A;  4DK3 C;  5IYB H;  4C3I H;  5C4J H;  2ES2 A;  2QWV A;  4JBJ A;  1PH3 A;  1Q1B A;  3NEL A;  3CCQ A;  1VQL A;  3ICE A;  4X3L A;  1A62 A;  1YHB A;  1HZ9 A;  3HOY H;  1UE1 A;  3FHW A;  3ULJ A;  4A3K H;  1XPO A;  2OTJ A;  3CCJ A;  4A3I H;  3CC4 A;  4IOA A;  3KF8 B;  4PZ6 A;  1C7Y A;  2R93 H;  2YYZ A;  2JEA I;  3BBE A;  2NN6 I;  1PVO A;  1PH4 A;  3BZK A;  5GM8 A;  3E9I A;  4GKJ Q;  3GTJ H;  2OWO A;  2YU9 H;  4YQO A;  1A0I A;  5IP9 G;  4X65 Q;  3J7Z C;  3CXC A;  4GOP C;  4GOP A;  3OIJ A;  2VZA A;  2Q2H A;  1VQO A;  3AEV A;  1X56 A;  4GLX A;  4A3E H;  1CKM A;  3W1G A;  1IBL L;  1ASY A;  3CCM A;  4GN4 B;  2VW9 A;  1Q1E A;  2IX0 A;  1PH6 A;  5GMC A;  1VQC A;  1QUQ A;  1K0R A;  3K8A A;  3CCU A;  4DV0 L;  4YVJ A;  2JJQ A;  1XTD A;  1KL9 A;  1B70 B;  1WFQ A;  4P74 A;  5GAG C;  3NBH B;  1XMQ L;  4DV1 L;  3T1H L;  1OXT A;  4UP9 A;  2IHF A;  4LW1 A;  1N34 L;  4A3B G;  3K7A H;  1O6D A;  1CSP A;  3S14 H;  4KHP L;  4PZ7 A;  5C3E H;  3U50 C;  1L2F A;  2DUD A;  1SRU A;  4IJH A;  5GAE C;  5M3F H;  1OY5 A;  2V3J A;  1X7O A;  1OXU A;  3KNU A;  2CQO A;  1VQG A;  2JA9 A;  1LTL A;  2R6G A;  1XJV A;  5IWA L;  4OO1 I;  3W1B A;  1IPA A;  1L1O B;  2WFW A;  3GD7 A;  4LUO A;  5JJK A;  4C3J H;  1EWI A;  4PG3 A;  4A3D G;  3JC6 6;  2XGT A;  2IY5 B;  3K80 C;  4AIM A;  3T1Y Q;  4YQ0 A;  1CKN B;  1VQJ A;  5GMB A;  1HNX Q;  2BH8 A;  5FLX c;  1P8L A;  5LMU L;  4B3T L;  4PZK A;  3TQY A;  4LF5 Q;  4LFA L;  2PMZ E;  3N4K A;  1VQA A;  4L5S A;  3W5O A;  1HNW L;  3O7B A;  1VQ8 A;  2OTL A;  1D8L A;  4A3G G;  1YVC A;  1Z85 A;  1VQ5 A;  2JA8 H;  3KTY A;  3CCR A;  4YY3 Q;  1NTG A;  2MFI A;  4AH6 A;  4B3M Q;  2EGV A;  4APV A;  3OTO Q;  1MJC A;  1QVC A;  1S3O A;  4JCV E;  2I5L X;  3A74 A;  1X54 A;  5AJ3 L;  2GVA A;  5C0X J;  5LMN L;  4DR2 L;  1PA6 A;  4MCC A;  3J81 i;  4YQA A;  2JA5 G;  1O7I A;  1PH8 A;  3GTP H;  4K0K Q;  4A75 A;  3RZO H;  4MNO A;  4JI2 Q;  5E7N A;  2UXC Q;  4L69 A;  1UAM A;  3EBE A;  3M4Q A;  3PSI A;  3A5Z B;  4DV5 Q;  3K0X A;  2I0Q A;  1Q8K A;  1YIJ A;  4HJ7 A;  1Y1V H;  2KCT A;  3GTO H;  4KDZ A;  4YPY A;  3I55 A;  1VQF A;  4X62 Q;  2B63 H;  3HKS A;  2CX8 A;  3L0O A;  4GOP B;  3M7N A;  4R4I A;  5DLQ E;  3I4N G;  4JV5 Q;  4JBK A;  3NEM A;  1NJI C;  5FAI A;  4YQN A;  1J6Q A;  1XNR L;  2A19 A;  3LGJ A;  2OQK A;  4X64 L;  2D0O A;  4P71 A;  4DV4 L;  1KQS A;  1KAW A;  3S1Q H;  4BY7 H;  1QUQ B;  4BXX G;  3HOX H;  1CUK A;  4C3H H;  4YQK A;  3I4M G;  1I5F A;  5JEA G;  1YNX A;  1XPR A;  1SE8 A;  4R4O A;  1B8A A;  3G48 A;  4XTC S;  1NMG A;  4DUY L;  4UP7 A;  3VDY A;  1NY4 A;  3F2C A;  4LF4 Q;  3D31 A;  3F8T A;  4Y7N H;  4X66 Q;  4GKK Q;  4H3Z A;  4JI1 L;  1AE3 A;  1BKB A;  4JAK A;  4DV6 Q;  1M1K C;  3RLO A;  4A3D H;  2CKZ B;  1KRS A;  3U4V A;  2QA4 A;  2Z0S A;  4GNX C;  4GNX A;  4DUZ L;  4AYB G;  4L5R C;  1IZ6 A;  4YCV A;  3KDF A;  1R9T H;  1KXL A;  1VQB A;  3PCO B;  3N4J A;  5J3B A;  4CNF A;  4DPG A;  1PH2 A;  2UXD Q;  3PUY A;  5GAH C;  2DGY A;  1M90 C;  4A3G H;  2GN5 A;  1HZB A;  4OWT B;  4R4C A;  1EQQ A;  2E5L Q;  3ZJY C;  4DR7 Q;  2JA6 H;  4YQ1 A;  1KIX A;  4WJ4 A;  2MQH A;  3L8U A;  4JI5 Q;  1EQR A;  1I94 L;  3S15 H;  4LF6 Q;  1NXZ A;  1TO0 A;  1U5K A;  4YHH Q;  4B3S L;  4MTN A;  2UUB Q;  1WCM H;  4MCB A;  2HIV A;  2F52 A;  4NXM Q;  1K9M C;  3NK6 A;  2JA5 H;  1G51 A;  4DR1 Q;  4OX9 L;  2EGW A;  1CKN A;  2UU9 Q;  4YVK A;  2UUA Q;  1VQ7 A;  4YQD A;  4WJ3 M;  1VCI A;  2ZJR A;  1XMO L;  4OWW B;  3H0G G;  1DGS A;  4KLK A;  4DR6 Q;  1VQE A;  1IBM Q;  4O2D A;  3Q8D A;  1J85 A;  4J15 A;  4JI8 Q;  3JAM c;  4BY1 H;  2VQF Q;  3HOZ H;  2NZO A;  2PQA A;  4BA1 I;  4HJ5 A;  1L0W A;  5M3M G;  3I4N H;  3DLL A;  2OCE A;  3PIP A;  1IBK Q;  2HHH Q;  3EN2 A;  3MXN B;  5FJ8 G;  5BR8 Q;  4DR4 Q;  2ZM6 Q;  3GYQ A;  3K7U C;  1S40 A;  4LFC Q;  4BXX H;  4GKJ L;  3CMA A;  1G29 1;  4X65 L;  3I4M H;  1A8V A;  1N36 L;  4DV3 Q;  4IG6 A;  2VS1 A;  3PF5 A;  1TWH H;  1K8A C;  1TWF H;  3B6Y A;  1SFO H;  4NXN Q;  2H5X A;  2NVT H;  4UPA A;  1K3R A;  4YWM A;  2A8V A;  4JI6 Q;  3A0J A;  3FKI G;  4JOI C;  4H02 A;  1Y1W H;  4DV7 Q;  3GDE A;  4MZ9 A;  3S17 H;  3ONP A;  4QQB X;  3TRE A;  1Q86 C;  4LF8 Q;  4J3C A;  2RHS B;  4IOC A;  3DCM X;  5ELO A;  4YPX A;  2RF4 A;  4JI4 Q;  1W3S A;  4DAM A;  5LMN W;  4IPD A;  4A3C G;  1YEZ A;  3CPW A;  3AFQ A;  2R7Z H;  1EIY B;  4YQL A;  3U58 A;  1N32 Q;  2B3G A;  1VQI A;  1GM5 A;  2ATW A;  3HOW H;  1GVP A;  3L7Z C;  4A3J G;  2I5H A;  2WAQ G;  4HIM A;  4GNX B;  3NEN A;  2AWO A;  3D0F A;  1CSQ A;  3A5U A;  3GTL H;  3TEH B;  4XBO A;  3KDF B;  2KHJ A;  5M5X H;  2XTI A;  4YQC A;  4IFD G;  4P75 A;  4BBR G;  3PUV A;  1WOC A;  4LNQ A;  2N8N A;  3PO3 G;  3KF6 B;  1HH2 P;  2K5V A;  3T1Y L;  1Y14 B;  2K14 A;  2K50 A;  1HNX L;  4C2M H;  1X9N A;  4LF5 L;  2OQ0 A;  1X3E A;  1KRT A;  1XPU A;  4LF9 Q;  3H0G H;  3OYY A;  1KD1 C;  3HFZ B;  3E5Y A;  3F1Z A;  4GN3 B;  3PO2 G;  2CWP A;  1JB7 A;  4TQU S;  3GTQ H;  3OII A;  4JI0 Q;  3KFU A;  4A3L H;  4E8B A;  3CCV A;  4YY3 L;  2VQE Q;  4BBS H;  3H3V I;  5M3M H;  3OTO L;  3H15 A;  3F2B A;  4YVH A;  3IC6 A;  2LSS A;  2Q2I A;  4GLA C;  4AYB E;  5FJ8 H;  5D9F A;  2YTX A;  1GD7 A;  2YTV A;  1BBU A;  1JJC B;  3BU2 A;  3KOJ A;  4DK6 C;  5M5W H;  2PQA B;  4DV1 Q;  4QJF A;  1XMQ Q;  4K0K L;  4JI2 L;  4DAY B;  1N34 Q;  3CW2 C;  1V6Z A;  2E2H H;  4DV5 L;  1GO3 E;  3AI9 X;  1Q82 C;  3AYH B;  2NVY H;  1X6O A;  1EFW A;  1JJG A;  4X62 L;  4B3R Q;  2UXB L;  1HR0 Q;  3RR5 A;  5IP9 H;  3FKI H;  1MJE A;  3S2D H;  2WP8 J;  1HZC A;  4JV5 L;  2ZJP A;  1LUZ A;  2KCM A;  2JEB I;  1JT8 A;  4R4Q A;  3KW2 A;  1YJW A;  2EIF A;  2ZTD A;  2C35 B;  3KJP A;  2R7D A;  1UAL A;  4XIG S;  2K4K A;  3J80 i;  4GS3 A;  3J7A 5;  1U0L A;  4YQP A;  4B3T Q;  1J5E Q;  4JC0 A;  1C0A A;  2AHO B;  5EAY A;  2R92 G;  2FXQ A;  4KHZ A;  5C44 G;  1CKO A;  1NMF A;  4YWK A;  3UDX A;  3CCS A;  4DR5 Q;  4A3J H;  1N33 Q;  4A3B H;  5C4X G;  3GO5 A;  4IPC A;  4A3F G;  4LF4 L;  4L5T A;  2NVX H;  1HNZ Q;  1MIU A;  4DV2 Q;  1PH1 A;  1QVF A;  3S1M H;  4OXP A;  4X66 L;  2EXD A;  4HIK A;  2YV5 A;  3KJO A;  2E2J H;  4GKK L;  3CF5 A;  3KLW A;  2RCN A;  4BBR H;  2CCZ A;  4AQY L;  2N78 A;  3PO3 H;  2YY8 A;  2Y0S E;  3CME A;  1JE5 A;  3AIA A;  1MXI A;  5GRO A;  2I5M X;  2V1C C;  3RN5 A;  1GZ0 A;  2BH2 A;  3CCE A;  2HIX A;  5JEA J;  1VQ9 A;  2V3K A;  1ASZ A;  2QGQ A;  4GLV B;  4KGN A;  1C9O A;  5IYC G;  1N9W A;  4JI7 Q;  3J81 c;  2ID0 A;  3BZC A;  1FJG L;  5JJI A;  2NZH A;  3ULL A;  4DR7 L;  1GKH A;  2E5L L;  4GN5 A;  4JI5 L;  3G6E A;  4LF6 L;  4YQI A;  1VH0 A;  2JE6 I;  1I50 H;  4QIW E;  4IJL A;  4YHH L;  3HOY G;  4LFB L;  2Q2U A;  4A3I G;  2AMC B;  3KF6 A;  3KY7 A;  4QGU A;  4YQS A;  4PZ8 A;  2EQS A;  4DR1 L;  1NS5 A;  3E0E A;  2UU9 L;  1IL2 A;  1FL0 A;  2UUA L;  4DV4 Q;  1V2X A;  2WAQ E;  4FAK A;  3S24 A;  2ASB A;  4DR6 L;  1D7Q A;  1IBM L;  1G6P A;  4CNG A;  4JI8 L;  3ILK A;  2B29 A;  1OTC A;  2VQF L;  1I6H H;  3PF4 A;  2QEX A;  4YQT A;  3M4O H;  2AKW B;  1VQ6 A;  2K5N A;  3FP9 A;  3PIO A;  1IBK L;  2HHH L;  3S1N H;  3IRB A;  1UAJ A;  3AXZ A;  1BBW A;  5BR8 L;  3L2P A;  2ZM6 L;  4DR4 L;  2ZTE A;  4LFC L;  4JYA Q;  4RMF A;  4DR3 Q;  3I56 A;  4BA2 I;  2WB1 G;  1EOV A;  3AFP A;  1UE5 A;  1K73 C;  2D62 A;  3CPF A;  1E3P A;  3HKZ G;  3M4P A;  5GQO A;  2E2I H;  1VQK A;  3NK7 A;  1V9P A;  4NXN L;  1YIT A;  1E7Z A;  5C4X H;  1L1O C;  1SRO A;  5M3F G;  1TWC H;  4JI6 L;  2Y0S G;  4EX5 A;  4EQ5 A;  1ZJR A;  4OWX B;  1E1O A;  4DV7 L;  4UY8 C;  3GTG H;  4ALP A;  3CCL A;  4YQ7 A;  1PV4 A;  4LF8 L;  5IYD G;  5K36 G;  1FVI A;  3OW2 A;  1Q7Y C;  1VQN A;  1SMX A;  4YQ2 A;  1XNQ Q;  4LWC A;  2BA1 A;  1YZ6 A;  4JI4 L;  2ZTC A;  4YCU A;  4JI3 Q;  4JOI A;  4YQ9 A;  3CAM A;  4OX9 Q;  1N32 L;  4LF7 Q;  1HR0 W;  1T9H A;  2Z6K C;  4YQR A;  3ERS X;  5IYC H;  3RLN A;  1VHY A;  2IX1 A;  2Z0Y A;  3SGI A;  5IT9 c;  2F4V Q;  2JA8 G;  4YQB A;  5IY0 A;  4YQ4 A;  5IE8 A;  1PH7 A;  3HOU G;  5H1S E;  5FLM G;  1N8R C;  3E9H A;  4YPZ A;  3J81 j;  2PI2 A;  3G4S A;  2UUC Q;  1VQD A;  1PH9 A;  1EIF A;  3TS0 A;  2I6D A;  2D0P A;  3IEF A;  3CQZ H;  3PUZ A;  1MKH A;  2HT1 A;  1NBW A;  3STB C;  4LF9 L;  4ME3 A;  1E1T A;  4P72 A;  1N36 Q;  4YVI A;  2IHE A;  2JK8 A;  4DNI A;  4Y52 H;  5CO4 A;  5GAD C;  4IO9 A;  4JI0 L;  4H3Y A;  2RHQ B;  4YQQ A;  1Y1V G;  1UE7 A;  1UEB A;  2KBN A;  2VQE L;  4CNE A;  2B63 G;  3I7F A;  1AE2 A;  4JAL A;  4R4T A;  2LXJ A;  3ER0 A;  1UWV A;  2JA7 G;  3KYH C;  2PNH A;  3TRZ A;  1S72 A;  4IFD J;  1TWA H;  4NPS A;  1IBL Q;  4B3M L;  3RLF A;  4IPH A;  4YQG A;  1I3Q H;  3GTK H;  4BY7 G;  1PHJ A;  4IFD I;  1HJP A;  3HOX G;  4A3M G;  2KEN A;  4DV0 Q;  3UE0 A;  2N3S A;  1OXV A;  2R7F A;  4R1J A;  1SN8 A;  2K5H A;  3UE1 A;  2K75 A;  3WWV A;  4HJA A;  1JJ2 A;  4B3R L;  3T1H Q;  1YBY A;  5IP7 G;  1HR0 L;  1QZH A;  3AQQ A;  2UXC L;  2VUM G;  4KHP Q;  4KI0 A;  4HIO A;  4PMW A;  1YI2 A;  4JBW A;  1WI5 A;  5IYD H;  3I4O A;  4JBM A;  4QY7 A;  1SLJ A;  2O3A A;  3BBH A;  1EUJ A;  2E8G A;  3EIV A;  2MO0 A;  3RNU A;  3RN2 A;  2K52 A;  4YQ6 A; 
#chains in the Genus database with same CATH topology
 2QIL A;  1J5E L;  3R2T A;  3HOV G;  5C0X G;  3M3Y H;  4A3C H;  4RGT A;  4DV2 L;  3CC7 A;  1WTQ A;  3OSO A;  5LMU Q;  2JA6 G;  1EZ6 A;  4LFA Q;  2KA7 A;  1HNW Q;  1RTN A;  2JXM B;  4OIJ A;  1V1Q A;  1EYG A;  4YQJ A;  1PRT B;  3HKZ E;  1SJE D;  3OMC A;  4LUV A;  2QMM A;  1R4P B;  3S1Q B;  4IFD H;  5C6A A;  5C0X I;  3NPP A;  5IGF A;  3J80 L;  1PH5 A;  4KKU A;  5CBA E;  1EY0 A;  3UDF A;  3GTM H;  4BY1 G;  1K83 H;  4L5Q A;  3TSS A;  1HPC A;  1LTR D;  1VQP A;  1CK1 A;  4Y7N B;  5IYB G;  1PYS B;  1BDO A;  4TVA B;  4ZCK A;  4CND A;  4A3D B;  5C5L A;  1A63 A;  1LT3 D;  3MEF A;  1FNW A;  4FDB A;  2NVQ H;  1YNN C;  3UDG A;  1QVG A;  5IP7 H;  3JAM i;  1KLG D;  1EEF D;  3VR3 A;  1T5E A;  1ZKO A;  1VQM A;  4YQ5 A;  1NR4 A;  2CWA A;  2GVB A;  2QEJ C;  4RGM A;  4RWS C;  2BCO A;  1PZK D;  1X55 A;  2F0N A;  4L6T B;  3TZD A;  1ZEQ X;  2F1M A;  3I90 A;  2R92 H;  3V05 A;  4OIK A;  3VA5 A;  1PFM A;  5ELE A;  1SMY D;  2VL6 A;  4PNY A;  4PV1 C;  4LF7 L;  1I94 Q;  1WJJ A;  1G6Z A;  3EFX D;  3I8Z A;  3M9B A;  1EYA A;  2YTY A;  5T1I A;  4MCD A;  2NN6 G;  1Z47 A;  2NUC A;  4NB3 A;  4RA8 A;  4A3L G;  1D6E C;  1SNQ A;  1KC8 C;  1LTI D;  2Z6K A;  3KLS X;  4QCL A;  4DK3 C;  3S17 B;  2QWV A;  1LO5 D;  4IUN A;  5C3X A;  1PH3 A;  1Q1B A;  3CCQ A;  4N8X 1;  3ICE A;  3DWQ A;  1XPO A;  3CC4 A;  2R93 H;  3KF8 B;  4PZ6 A;  1C7Y A;  4JWJ A;  2NN6 I;  1PVO A;  1PH4 A;  1IW7 D;  4GKJ Q;  2OWO A;  2YU9 H;  4XT1 B;  2PW7 A;  1S5E D;  2AQ2 B;  2A69 D;  2RSO A;  4X65 Q;  3VYT A;  4F7X A;  1ASY A;  4RHS A;  1VQC A;  2K5W A;  1K0R A;  4NMZ A;  3VYU A;  5DM7 3;  4C2M B;  3NBH B;  3T1H L;  2CHB D;  4EQO A;  5FLX L;  4A3B G;  1N34 L;  3L3O C;  3GTQ B;  4KHP L;  1B3A A;  1AW7 A;  1EY8 A;  5CV4 A;  2RQX A;  2DUD A;  1SRU A;  4CBV A;  3DEO A;  5GAE C;  1H9S B;  1S5B D;  1X7O A;  4RGO S;  2CQO A;  5BN3 A;  4LK1 C;  3KNU A;  3Q23 A;  2JA9 A;  2PO4 A;  1XJV A;  3W1B A;  5JJK A;  4LUO A;  4C3J H;  4PG3 A;  1F77 A;  3JC6 6;  2XGT A;  1F9R A;  1V1P B;  3T1Y Q;  5GMB A;  5JVH 3;  4B3T L;  3LNN A;  3N4K A;  4FYD A;  3SXH A;  1AEX A;  3FKI B;  1B1Z A;  1K3B C;  4X3U A;  1D8L A;  5IOD A;  4B3M Q;  2MFI A;  1LAC A;  1LTB D;  1QVC A;  3R2I A;  1ET6 A;  1KNE A;  1D5M C;  2GVA A;  5C0X J;  1UUP A;  4I7Z C;  3GTP H;  1WTP A;  2D5D A;  3RZO H;  4RCO A;  3AB9 A;  2WIN B;  1UAM A;  2I0Q A;  1Q8K A;  1YIJ A;  1STE A;  3MXN A;  2CX8 A;  3L0O A;  2A74 C;  5COR A;  4GOP B;  4R4I A;  5DLQ E;  5JVG 3;  3FPU B;  1NJI C;  5FAI A;  1QE6 A;  3MXU A;  2A19 A;  4ABN A;  4P71 A;  4BY7 H;  1CZW A;  2A6E C;  4UP7 A;  1NY4 A;  3D31 A;  1PMR A;  1M1K C;  3U4V A;  3WOF A;  5J39 A;  2Z0S A;  4YIJ A;  4GNX A;  2HDM A;  1IZ6 A;  5C0X H;  1M90 C;  4A3G H;  1HZB A;  5A2Q E;  1EYD A;  2JA6 H;  3L8U A;  2G9H D;  1EQR A;  3S15 H;  1TO0 A;  4B3S L;  1K9M C;  3NK6 A;  4OX9 L;  1G51 A;  3PMF A;  2K04 A;  2NBF A;  4YVK A;  1VQ7 A;  2EYP A;  4OWW B;  2K32 A;  3A54 A;  2Q8T A;  4CKC A;  1LT4 D;  2CVR A;  2F0W A;  4BY1 H;  3SDZ A;  1A2U A;  3KBG A;  2PQA A;  4BA1 I;  4HJ5 A;  1L0W A;  5FJ8 G;  2EE1 A;  2ZXO A;  3K7U C;  1S40 A;  4LFC Q;  5LL6 X;  1G29 1;  1A8V A;  1N36 L;  4IG6 A;  2VS1 A;  1EL0 A;  2F0S A;  1SFO H;  4E6I A;  2IPK D;  2O5I C;  4LMQ D;  3A0J A;  3BZD B;  4H02 A;  1ML0 D;  2AQ1 B;  3CQZ B;  4MZ9 A;  3SHL A;  1FYC A;  1WTV A;  4LF8 Q;  5JPM C;  5I2X A;  2RCF A;  4DAP A;  2XWJ B;  5LMN W;  4N9P A;  4WOR A;  3U58 A;  2B3G A;  4K8J A;  3L7Z C;  2AWO A;  1EOT A;  3A5U A;  1TWA B;  4XBO A;  5M5X H;  4OEL B;  5J22 A;  2B2W C;  2Z6B A;  2XTI A;  3QOL A;  1EU4 A;  1XYI A;  1I3Q B;  4YQC A;  4LNQ A;  3PO3 G;  1HH2 P;  1MSG A;  3MEH A;  3DMU A;  4LF5 L;  1X3E A;  1XPU A;  4RGN A;  5CV8 A;  3F1Z A;  3PO2 G;  1JB7 A;  1D1K A;  2L0C A;  3KFU A;  2NN6 H;  5I6W A;  4A3L H;  4YY3 L;  2VQE Q;  3H3V I;  1F9Q A;  2L9H A;  3F2B A;  1A15 A;  2XWB B;  5IGG A;  3KOJ A;  1JJC B;  4G57 A;  2E74 C;  3EQL C;  3TP6 A;  4QJF A;  1EIG A;  2A68 D;  3D6W A;  1N34 Q;  1JOR A;  2E2H H;  1GO3 E;  2E2D C;  1X6O A;  1EFW A;  1JJG A;  4B3R Q;  2UXB L;  4CKE A;  2KVM A;  2ZJP A;  1BO0 A;  1CZG A;  2LFN A;  3KW2 A;  3K6O A;  4NKL A;  1DYQ A;  2FFK B;  3BVG A;  3HZX A;  4B3T Q;  3J81 L;  5EAY A;  1EY5 A;  4KTA A;  3R93 A;  5CMD A;  4A3J H;  5C4X G;  4A3B H;  1TS4 A;  3GO5 A;  1HNZ Q;  1U4R A;  2EXD A;  4HIK A;  3I4L A;  4FF1 A;  2Y0S E;  1MXI A;  3PQI A;  1EWH A;  3RN5 A;  2QKI C;  3D4W A;  1ASZ A;  4GLV B;  4KGN A;  1C9O A;  5IYC G;  1N9W A;  1FJG L;  4FVM A;  2ZXP A;  3ULL A;  4C3I G;  2E5L L;  3VA7 A;  2F0K A;  2D2C C;  4QIW E;  5CGK A;  4YHH L;  2Q2U A;  3KY7 A;  1HCZ A;  4PZ8 A;  2UU9 L;  1Z7T A;  1ZYR D;  4B9X A;  2ASB A;  2K6A A;  1G6P A;  4CNG A;  1IHZ A;  1STA A;  2ENB A;  5C44 B;  3D6C A;  1RKN A;  3PF4 A;  1ICF B;  2L4N A;  4EQP A;  2F03 A;  4YQT A;  1A3U A;  1KDA A;  1VQ6 A;  2KCC A;  3FP9 A;  3PIO A;  2HHH L;  4K8I A;  5KNB A;  4DR4 L;  1KNA A;  2SOB A;  4BA2 I;  1KTK A;  1UE5 A;  5KYL A;  1K73 C;  3M4P A;  5GQO A;  2CQA A;  3NK7 A;  1C48 A;  5IT9 L;  4UDU C;  5M5Y B;  1F2Z A;  4B9W A;  2EOT A;  4OWX B;  4UY8 C;  3GTG H;  4ALP A;  1WTR A;  1PV4 A;  1FVI A;  3OW2 A;  3HOY B;  4JWG A;  5A35 A;  1XNQ Q;  1RDP D;  1SYB A;  2BA1 A;  4LWC A;  4JI4 L;  1STN A;  2ZTC A;  3K58 A;  4A3I B;  1EY6 A;  3DWA A;  4OX9 Q;  1N32 L;  1T9H A;  2Z6K C;  3GTJ B;  1HXY D;  5CR3 A;  1HHV A;  1CM9 A;  2OEO A;  5H1S E;  1QWY A;  2PI2 A;  3G4S A;  3BVM A;  2UUC Q;  3J7A V;  3EVQ A;  3IEF A;  2XNA C;  2HT1 A;  2WB1 B;  3STB C;  3K7A B;  4RH6 A;  1N36 Q;  1VF5 C;  2IHE A;  4Y52 H;  5C3E B;  4JI0 L;  4H3Y A;  1LV9 A;  1YNJ C;  1UEB A;  2LY7 A;  5M9O A;  1BXT A;  3D4D A;  2FIN B;  5K5P A;  4CDD C;  2LXJ A;  3Q22 A;  1B3Q A;  2OXP A;  3T51 B;  2EVB A;  3RLF A;  1HUM A;  1SDF A;  4I7A A;  4OGQ C;  4IFD I;  1HJP A;  2KEN A;  1OXV A;  2R7F A;  4R1J A;  4YQ7 A;  4HJA A;  5HUR A;  1YBY A;  5IP7 G;  3SEB A;  2TSS A;  3AQQ A;  3QOJ A;  4MN3 A;  2JA8 B;  4HIO A;  1YI2 A;  4JBW A;  1H9M A;  2B2T A;  2A73 B;  2K52 A;  4MIU A;  1YNN D;  1JMC A;  2CFM A;  1OXS C;  4O0A A;  5COY A;  3ULP A;  3SK8 A;  1JQY D;  3DXJ C;  1TS3 A;  3OMG A;  4QF4 A;  3R8B A;  5JJL A;  2F3W A;  3GTO B;  4CDC C;  4CKB A;  3HEJ A;  5FLM H;  4YCW A;  1R4Q B;  3QWN A;  1TR5 A;  1X65 A;  4ZKB B;  4FXK C;  3H3V H;  4DV6 L;  4ZQ3 A;  1PFS A;  2K05 A;  4C3H B;  3PV0 A;  5AJ3 Q;  1AN8 A;  5LMN Q;  4DR2 Q;  2UXB Q;  2NB0 A;  1NNX A;  4LUZ A;  3G71 A;  5ELB A;  2UXD L;  2F0I A;  1K8G A;  3PO2 H;  3KF8 A;  1VHK A;  2LXK A;  2DY7 A;  2ALY B;  2Q2T A;  1L0X B;  1GUW A;  5GM8 A;  3CP0 A;  1IXR A;  4IPG A;  4G4K A;  3F2D A;  1YHA A;  3VR5 A;  4HID A;  1YHQ A;  2R93 G;  1SYE A;  1SR3 A;  3PGZ A;  1R9T B;  4X64 Q;  2I6D A;  4RG1 A;  1IYJ B;  1V43 A;  2BA0 A;  5JAV A;  2VUM H;  4K14 A;  5CV7 A;  2PZW A;  1X3F A;  1RIP A;  1E22 A;  2QCP X;  1UE6 A;  1QJO A;  4CHT B;  3TS2 A;  3FPP A;  1AH9 A;  4HJ8 A;  1NE3 A;  4DR3 L;  4DUY Q;  4UP8 A;  2KHI A;  1LAB A;  4FXG C;  2JA5 B;  1P16 A;  2LMC B;  4HCS A;  5BN4 A;  4POF A;  3SK5 A;  5HY6 A;  1H9S A;  1FJG Q;  2K5D A;  1LYL A;  4DUZ Q;  3C46 A;  3K81 C;  3NWS A;  4OEM B;  1C8C A;  1PFB A;  3C1F A;  1Z9F A;  1B7Y B;  1HQM C;  3DHQ A;  3HOZ B;  2B2V A;  4CDE C;  2PI2 E;  2CW0 C;  3I4N B;  1SJH D;  2B2Y A;  4DGZ A;  3J80 E;  1E24 A;  5ELN A;  1S5D D;  3I2Z A;  1FGU A;  1CT1 D;  3I4M B;  4K5W A;  2FMM A;  4ZAI A;  1TWH B;  1TWF B;  4FF4 A;  1X32 A;  5C3W A;  1UAK A;  2FJ2 A;  1XMO Q;  4ID6 A;  1Y1W B;  5IGC A;  2ZXR A;  4C3I H;  5C4J H;  4CJ0 B;  3C2P A;  1A62 A;  1VMC A;  1B9M A;  3H91 A;  4A3K H;  2Z9H A;  4IOA A;  2YYZ A;  3H3V C;  3BBE A;  3HOW B;  4YQO A;  4G7H C;  5IP9 G;  4GOP A;  3GTL B;  2VZA A;  2Q2H A;  1SYG A;  4A3E H;  4MHE A;  3W1G A;  1IBL L;  2IX3 A;  5KGU A;  2K28 A;  4EGV A;  2KCN A;  1H9R A;  3H6M A;  4YVJ A;  2JJQ A;  1XTD A;  1KL9 A;  1B70 B;  2EYF A;  2PCF B;  4P74 A;  4DV1 L;  3H0G B;  2IHF A;  1LLR D;  3HGB A;  4BBS B;  1L2F A;  4X3K A;  2Z4H A;  1OY5 A;  5EBD A;  2V3J A;  5CYU A;  1TU2 B;  5M5W B;  2R6G A;  5IWA L;  1IPA A;  1L1O B;  5G3L D;  1EWI A;  3VR4 A;  1QG7 A;  1CKN B;  1VQJ A;  2NVY B;  1G2S A;  3E3X A;  5CV6 A;  1HNX Q;  1M4V A;  2PMZ E;  4L5S A;  3S2D B;  1VQ8 A;  3K5O A;  5NUC A;  1PTO C;  4A3G G;  1YVC A;  1EWC A;  3J7Y W;  1NTG A;  2PW5 A;  4JK1 C;  5EQ0 A;  4JWF A;  4JCV E;  2J0T D;  4HTH A;  3A74 A;  3RMH A;  1X54 A;  1PA6 A;  1B2T A;  1O7I A;  1PH8 A;  4K0K Q;  5E7N A;  2M2L A;  3EBE A;  3PSI A;  2NVX B;  2E2J B;  2KCT A;  4YPY A;  4X62 Q;  2PQE A;  3OWF A;  1A2T A;  1NSN S;  2X6G A;  5FLX E;  1EU3 A;  1PZI D;  5ELC A;  5DEH A;  4JBK A;  4JV5 Q;  4YQN A;  3OIP A;  1XNR L;  3LGJ A;  1EYC A;  3S1Q H;  1QUQ B;  4YQK A;  4RKB A;  2KUM A;  4ZKC B;  1YNX A;  4KD4 A;  1XPR A;  5EBC A;  3VDY A;  1GXD C;  1I50 B;  4LF4 Q;  1DZ1 A;  3IL8 A;  4Y7N H;  4X66 Q;  2SDF A;  4JI1 L;  2PZT A;  4DV6 Q;  2F0D A;  3RLO A;  4A3D H;  1KRS A;  3A8I E;  1KAA A;  1RD9 D;  3H94 A;  1F9P A;  1PZJ D;  1JR0 D;  4YCV A;  4CNF A;  2UXD Q;  4CJ1 B;  5GAH C;  4XYQ A;  2GN5 A;  3FEW X;  4DR7 Q;  1EQQ A;  4YQ1 A;  3BG3 A;  2MQH A;  4TSS A;  3H09 A;  1NXZ A;  4MTN A;  4DR1 Q;  3WDN A;  3TP8 A;  4FO2 A;  3NTK A;  4YQD A;  1TWC B;  3Q6S A;  4KLK A;  1DGS A;  4DR6 Q;  4JI8 Q;  3JAM c;  4HAE A;  2AUK A;  2OCE A;  1IBK Q;  3C1E A;  4IUP A;  5BR8 Q;  2ZM6 Q;  3GYQ A;  2PMZ B;  4BXX H;  4AYB B;  4DU9 A;  1K8A C;  3B6Y A;  4UPA A;  4NW2 A;  1X3Q A;  1K3R A;  4K5X A;  1U4M A;  1UAP A;  1DCZ A;  4IZ8 A;  2BDO A;  2MJ8 A;  3S17 H;  3TRE A;  1CA6 A;  1Q86 C;  4F87 A;  4NP5 A;  3URY A;  1UNS A;  2I07 B;  1D5Z C;  3MVV A;  4IPD A;  1PRT C;  3AFQ A;  1EIY B;  4PMC A;  4KY7 A;  5IIF A;  1VQI A;  1GM5 A;  4A3J G;  2I5H A;  1Q8I A;  4PQX A;  3KDF B;  1HFN A;  4RFB A;  3K0Y A;  4Z9C B;  5M3M B;  4XT3 B;  5KIX A;  2N8N A;  1SNO A;  1U9R A;  2K50 A;  2IWH A;  4C2M H;  3NBI A;  1X9N A;  3KUP A;  3C3L A;  4LF9 Q;  2P5Z X;  1K8M A;  2CWP A;  4XXE A;  4TQU S;  3GTQ H;  1Y8P B;  1EY4 A;  1STH A;  5M3M H;  3OTO L;  4N8F A;  2Q2I A;  1DOL A;  2YTX A;  1GD7 A;  4DV1 Q;  4JI2 L;  4DAY B;  2EY2 A;  4DV5 L;  1D2B A;  1BUV T;  3E6Z X;  1Q82 C;  2B2T C;  3HOU B;  2DNC A;  1I4H A;  1B9N A;  3FKI H;  5IP9 H;  1MJE A;  2WP8 J;  1QCB D;  2F0E A;  3FDT A;  1LUZ A;  2KCM A;  2B8G A;  4R4Q A;  1JT8 A;  3I3C A;  1WTH A;  1YJW A;  2RBM A;  2ZTD A;  2C35 B;  4ZUI A;  2A6H C;  1I4R A;  4XIG S;  2K4K A;  3J80 i;  4GS3 A;  1U0L A;  1J5E Q;  1SYD A;  4KHZ A;  3NUC A;  1NUC A;  4YWK A;  5C44 G;  4YPW A;  2JA7 B;  2HDL A;  4L5T A;  1MIU A;  2BE5 D;  4DV2 Q;  2EYM A;  1PH1 A;  4GKK L;  2YV5 A;  3KJO A;  3CF5 A;  2RCN A;  2CCZ A;  1IKM A;  5FO8 B;  3AIA A;  2I5M X;  3DWP A;  2O5J C;  2BH2 A;  3CCE A;  2HIX A;  3OOC A;  1EFI D;  2KOL A;  2ID0 A;  2NZH A;  2K03 A;  4GN5 A;  4JI5 L;  4FMW A;  4LF6 L;  4YQI A;  3HOY G;  5D3D A;  1QOH A;  4A3I G;  3KF6 A;  1IYU A;  3E0E A;  1IL2 A;  1FL0 A;  2UUA L;  3HOV B;  1GUG A;  3RZD B;  1IBM L;  2C9O A;  1D1I A;  2B29 A;  1TWG B;  4A93 B;  2VQF L;  2QDB A;  4A3F B;  3AXZ A;  3S16 B;  4EVO A;  1WVL A;  1H9J A;  2ZTE A;  3J81 E;  2WB1 G;  4OHJ A;  2RDH A;  3WOE A;  1E3P A;  1V9P A;  2PNR C;  4NXN L;  1Q3L A;  4ODG A;  2B2V C;  4JI6 L;  2Y0S G;  1ZJR A;  4DV7 L;  1ENA A;  3CCL A;  2EDG A;  2PPB C;  5K36 G;  1Q7Y C;  1VQN A;  1CI3 M;  2EZV A;  1YZ6 A;  4YCU A;  4JOI A;  3ERO A;  1Q90 A;  1WTW A;  4QB4 A;  4LF7 Q;  4HMI A;  5EGT A;  1HR0 W;  3IFD A;  1GHK A;  4YQR A;  4DXG A;  3RLN A;  3T16 A;  1BBX C;  1EY9 A;  2JA8 G;  4DNR B;  3NSW A;  2NWG A;  5IE8 A;  3PIO 3;  4YQ4 A;  5FLM G;  4M1U B;  2F0U A;  3J81 j;  1SAP A;  4DK1 A;  1VQD A;  1PH9 A;  3TS0 A;  3CQZ H;  3PUZ A;  2G9D A;  2L55 A;  3K5L A;  1KLU D;  1E1T A;  4DNI A;  3S14 B;  4B08 A;  1PLF A;  2E75 C;  5M3F B;  2I46 A;  4JAL A;  1MBY A;  3KYH C;  2PNH A;  1QIL A;  1TWA H;  1SMY C;  3LWE A;  5E3F A;  1I3Q H;  5IT9 E;  1PHJ A;  5E4X A;  2N3S A;  1SN8 A;  2K5H A;  3MHB A;  2K75 A;  4JVZ A;  3I70 A;  3T1H Q;  1HR0 L;  5JJZ A;  2VUM G;  2WII B;  4KHP Q;  2FHT A;  3P20 A;  5IYD H;  4QY7 A;  2PYK A;  1EUJ A;  3GQB A;  2MO0 A;  3RNU A;  2ICI A;  3NE5 B;  3RN2 A;  2BOS A;  4J8Q A;  4JPB W;  1J8I A;  1XWE A;  1N33 L;  4DR5 L;  1YJN A;  1X7P A;  2A69 C;  4DKA C;  1HA6 A;  4QUC A;  1HFG A;  4YWL A;  1IKL A;  1SE2 A;  2C5C A;  3ITP A;  1Y1V B;  2B63 B;  1F2Y A;  3PUX A;  2WB1 E;  4OON A;  1VQH A;  5E4W C;  2F3I A;  4YQ8 A;  3HOX B;  4JI7 L;  1BVS A;  1AZP A;  1BF4 A;  1PFN A;  3BBD A;  3HOZ G;  3HG9 A;  1TXY A;  1VS0 A;  1X3G A;  3BJU A;  4L8J A;  5DNF A;  5D3I B;  3G7L A;  2EY1 A;  4A3K G;  2UUB L;  3S2H B;  3MC0 B;  1KDC A;  4A76 A;  1ENC A;  1NAP A;  2HA8 A;  3K57 A;  1Q12 A;  3LX0 A;  5C5M A;  2ZJQ A;  4HJ9 A;  1FNU A;  1Y1W G;  3SK4 A;  5C4Z A;  1Q46 A;  1VQ4 A;  2IT1 A;  4XQN A;  4A3E G;  3PUW A;  1BCP D;  2N88 A;  1FR3 A;  4JYA L;  1BR9 A;  2EYJ A;  4IN3 A;  2MO1 A;  1WCM B;  3V2T A;  4C1N K;  3M85 A;  3S2H H;  2SEB D;  4KD3 A;  2J7Z A;  3HOW G;  1EY7 A;  4FF2 A;  1BCP F;  4KK7 A;  3QUV A;  5C44 H;  1Q81 C;  1L1O A;  4JI3 L;  4ULL A;  3CD6 A;  1LM0 A;  3NTH A;  4KKT A;  1YJ9 A;  1HZA A;  3R3O A;  2KQ3 A;  3RUZ A;  1E2W A;  1B4O A;  1PXU A;  2HQL A;  4B3S Q;  3OIQ A;  1D5X C;  5ELF A;  2F4V L;  1CFM A;  4RKL A;  5KYI A;  2NVT B;  4BBS G;  5T1G A;  4YQ3 A;  3CHB D;  3UDI A;  5M5Y H;  2F0T A;  2L15 A;  3DM3 A;  5HGT A;  5IOC A;  3ONA B;  1JWS D;  2XRQ D;  1YHB A;  3HOY H;  1UE1 A;  3FHW A;  1TII D;  2OTJ A;  3CCJ A;  4A3I H;  2R7Z B;  1G91 A;  1SEB D;  2MP1 A;  1KDB A;  2J4X A;  3E9I A;  1E0B A;  3GTJ H;  1PTO D;  1VQO A;  3AEV A;  4GLX A;  1NR2 A;  3CCM A;  1F2L A;  4GN4 B;  1WD1 A;  1Q1E A;  4CGY B;  5GMC A;  2X69 A;  1QUQ A;  3K8A A;  4J6H A;  3HS0 C;  3MZ5 A;  4DV0 L;  1A3T A;  2MHV A;  3M7G A;  1OXT A;  4UP9 A;  1LTA D;  3K7A H;  1CSP A;  4R8I A;  4XQJ A;  4PZ7 A;  5C3E H;  3U50 C;  4G7Z C;  3PIP 3;  4IJH A;  1DOM A;  4FP5 D;  1I6V C;  1OXU A;  1K28 A;  1GJX A;  1SYF A;  1LTL A;  2O4X A;  5K36 H;  3GD7 A;  4KV6 A;  4A3D G;  1L0Y B;  3K80 C;  4AIM A;  3NWT A;  2HQE A;  5LMU L;  1P8L A;  4DA2 A;  4LF5 Q;  4LFA L;  1VQA A;  2B2U A;  3W5O A;  1HNW L;  3O7B A;  4U67 3;  5ISR A;  2OTL A;  3CRK C;  2KEC A;  1SNC A;  4K5V A;  1VQ5 A;  2JA8 H;  3CCR A;  5E1F A;  4YY3 Q;  3IKJ A;  4IUU A;  1DON A;  2EGV A;  4APV A;  2G5D A;  1TS5 A;  1S3O A;  1BNZ A;  3J81 i;  1BCP B;  4A75 A;  4MNO A;  2Q8R E;  2NTT A;  4L63 B;  3A5Z B;  3S1M B;  4HJ7 A;  3GTO H;  5DAU A;  4KDZ A;  3I55 A;  1VQF A;  2B8F A;  3HKS A;  4U68 A;  3PO3 B;  1RCV D;  3M7N A;  4HCE A;  5D65 A;  4MTK A;  4OO1 H;  2EY5 A;  1ONL A;  2L5T A;  4DV4 L;  1LTS D;  1KAW A;  3D8G A;  1KQS A;  4BXX G;  1HTP A;  4C3H H;  4DN4 M;  1I5F A;  2NYZ D;  4KJN A;  2DY8 A;  1G8Z D;  1SE8 A;  2MPM A;  1EZ8 A;  1B8A A;  2OT2 A;  4ME5 A;  3F2C A;  1AE3 A;  1BKB A;  2Z4I A;  3NBH A;  4GNX C;  2N55 A;  4AYB G;  4L5R C;  3KDF A;  1R9T H;  1I6H B;  1KXL A;  3N4J A;  5J3B A;  1DXM A;  3JAM L;  1PH2 A;  3M4O B;  3PUY A;  3S1N B;  4R4C A;  4OWT B;  2E5L Q;  1U4P A;  1VF7 A;  4F88 A;  1AP0 A;  4WJ4 A;  1SNM A;  3EJI A;  1B53 A;  1I94 L;  4Q0F A;  1U5K A;  4YHH Q;  1I4X A;  2UUB Q;  2E2I B;  1PTO B;  4MCB A;  2F52 A;  1F9S A;  2JA5 H;  1V1P A;  2UU9 Q;  5C4X B;  3NQI A;  2K01 A;  4WJ3 M;  1K8O A;  3GV3 A;  3O13 A;  1W6K A;  4K2K A;  3Q8D A;  1J85 A;  4J15 A;  1UEA B;  1S4Z A;  3HOZ H;  2KJX A;  2NZO A;  4UAI A;  5M3M G;  1JB3 A;  4DAY A;  3I4N H;  2JYO A;  3DLL A;  3PIP A;  2HHH Q;  3VYS A;  3EN2 A;  4DR4 Q;  4K6D A;  1JIC A;  4GKJ L;  1DJR D;  1XX8 A;  4X65 L;  3I4M H;  1EQT A;  2XN9 C;  5JEA H;  2F0Q A;  1TWH H;  1TWF H;  4KN7 C;  2H5X A;  5KRU A;  3BYT B;  1VDZ A;  5L37 A;  2A8V A;  4JOI C;  3FKI G;  1Y1W H;  4XYO A;  3ONP A;  4QQB X;  3W2D A;  4JW0 A;  3X3N A;  5ELO A;  5I9O A;  4P2C B;  4JI4 Q;  1W3S A;  1YEZ A;  1N32 Q;  2XVS A;  2ATW A;  3HOW H;  4HIM A;  3NEN A;  5IGD A;  1ILQ A;  1CSQ A;  4V0B A;  1AZQ A;  3GTL H;  4V19 0;  4HSV A;  2KHJ A;  2B2W A;  2A6H D;  2QW7 A;  3M4Y A;  3GTK B;  2EXZ A;  2L12 A;  3PUV A;  2HCC A;  4CJ2 C;  3T1Y L;  1Y14 B;  2K14 A;  1KRT A;  1W6J A;  3H0G H;  3HFZ B;  4TKO B;  4GN3 B;  3DUZ A;  2MGS A;  4JI0 Q;  5EPL A;  3CCV A;  4BBS H;  1TVX A;  2A6E D;  4H13 C;  1NCV A;  3ND8 A;  2IL8 A;  4YVH A;  3IC6 A;  4BS9 A;  2LSS A;  2NTS A;  4AYB E;  5G3L F;  5M5W H;  4DK6 C;  2BDN A;  4LJZ C;  3CW2 C;  3CU7 A;  3NK9 A;  5KNC A;  1V6Z A;  1GOZ A;  2NVY H;  2WAQ B;  1VMP A;  3S2D H;  3SVM A;  1HZC A;  1Y8O B;  4HN7 A;  2JEB I;  4BBR B;  1GUT A;  2R7D A;  1UAL A;  1ROD A;  4BWG B;  4YQP A;  1T5X D;  1GUO A;  1C0A A;  2AHO B;  3OWE B;  4O42 A;  3GTM B;  4A93 G;  1CKO A;  1NMF A;  3UDX A;  1K83 B;  2AUJ D;  4A3F G;  3BS1 A;  2NVX H;  4J3C A;  1QVF A;  1SYC A;  3T4A C;  2E2J H;  4BBR H;  2YY8 A;  4AQY L;  5IGE A;  1JE5 A;  4UHV A;  2NVQ B;  4WRD A;  5GRO A;  2V1C C;  3TDQ A;  1GZ0 A;  3TME A;  2VXW A;  5JJI A;  1O7Z A;  3I72 A;  1GKH A;  1PYW D;  3G6E A;  1B50 A;  2F0M A;  2K1B A;  3OPO A;  1VH0 A;  1I50 H;  4LFB L;  4YQS A;  4QGU A;  4C1N I;  1JOQ A;  4DV4 Q;  1SSO A;  1V2X A;  3BVZ A;  4O1N A;  3S24 A;  3LWU A;  1JCK B;  3FRP B;  2R92 B;  1TT2 A;  3ILK A;  1OTC A;  2Z8L A;  2AQ3 B;  3NHH A;  5J1Z A;  2AKW B;  4WJW A;  5JPN C;  5AFW A;  3L2P A;  3D4R A;  4LFC L;  1J9O A;  4RMF A;  4DR3 Q;  4KHV A;  1EOV A;  3U9O A;  1WTO A;  3CPF A;  4KMU C;  4FF3 A;  2WKD A;  1YIT A;  1SND A;  1L1O C;  5FKA C;  1SRO A;  5M3F G;  1GUS A;  1TWC H;  2HUG A;  2RKS A;  4EX5 A;  2GA4 B;  3MA2 B;  4LF8 L;  3T53 B;  5I6Y A;  5IYD G;  4DFA A;  4YQ2 A;  4ILW A;  3BDC A;  4IUT A;  4YQ9 A;  2R93 B;  4DF7 A;  2EJF C;  2YU9 B;  3AU7 A;  1VHY A;  2F3V A;  3D3R A;  2Z0Y A;  2RVL A;  1SXT A;  3SGI A;  4YQB A;  1PH7 A;  1N8R C;  3E9H A;  4YPZ A;  1EEI D;  3NXW A;  5KND A;  2OF1 A;  2XSC A;  3GP7 A;  2A5H A;  2PZU A;  3ZYY X;  4ME3 A;  4KN4 C;  4I65 A;  1HUN A;  2JSO A;  5CO4 A;  3HKZ B;  5GAD C;  4XQQ A;  1EIH A;  1Y1V G;  1DOK A;  2VQE L;  1Y69 U;  2B63 G;  1AE2 A;  3ER0 A;  1UWV A;  2EJM A;  2E76 C;  4NPS A;  4RCN A;  3BYY B;  1IBL Q;  4RAU C;  4YQG A;  4C3J B;  2FMC A;  3HOX G;  3UE0 A;  3IAY A;  2M00 A;  3WWV A;  4B3R L;  5CC4 A;  1QZH A;  1CA5 A;  2UXC L;  3MTS A;  3A56 A;  4KI0 A;  3TP5 A;  4PMW A;  3K5M A;  2IJ0 A;  3I4O A;  3VR2 A;  4JBM A;  1SLJ A;  1STY A;  2O3A A;  4YQ6 A;  2ZT9 C;  1S5C D;  5IWA Q;  3BDO A;  3GTP B;  2B2U C;  3RZO B;  4X6A H;  1ENF A;  1HNZ L;  1LTG D;  1LT5 D;  3DEP A;  2N49 A;  1W2B A;  1KHI A;  3HOU H;  4POG A;  2VB3 X;  2A1A A;  3ND9 A;  4A4I A;  1WCM G;  3Q0A A;  1HTL D;  3T56 B;  4QL5 A;  3SK6 A;  4X3M A;  4IUQ A;  2F0H A;  1SE3 A;  3T13 A;  4BY7 B;  4A3M B;  1QZG A;  3K5N A;  2QDL A;  2JQO A;  4H0L C;  2VNU D;  1RL2 A;  2VY3 A;  1P9P A;  2HCI A;  3SE0 A;  2JA7 H;  1WYD A;  2F0J A;  2AWN A;  2RDG A;  1O80 A;  1H95 A;  1KAB A;  4A3M H;  1LT6 D;  3CKI B;  1A3V A;  3A7L A;  4NXM L;  1XNR Q;  3NTI A;  2MNA A;  3J80 c;  2VB2 X;  4YVG A;  4A3G B;  1FD7 D;  5I9P A;  2JA6 B;  3FVQ A;  1GUN A;  5IGB A;  3S15 B;  3A8K E;  4AQY Q;  4TRD A;  4ZUJ A;  2KEE A;  5DM6 3;  5EKI A;  1PYB A;  2R7Z G;  3QO2 A;  1OXX K;  4JI1 Q;  3HOV H;  3STB D;  1ESF A;  3S1R B;  1CHQ D;  3TBI B;  4DV3 L;  3RZD H;  3CC2 A;  3P7J A;  5C3E G;  1YNJ D;  1K0S A;  3OIN A;  3QB3 A;  4BY1 B;  4A93 H;  1TWG H;  2QF7 A;  1XNQ L;  4A3F H;  4LFB Q;  2B2Y C;  2F0L A;  3S16 H;  3MAQ A;  4DXF A;  4XDX A;  5CBE E;  4K6L A;  5HGQ A;  2EYH A;  3S1R H;  4JG2 A;  4P73 A;  1SNP A;  3MXP A;  3S9W A;  1SFO B;  3U4Z A;  4PMB A;  3A7A B;  1HA5 A;  3CRL C;  4ZLT F;  2UUC L;  5IYB H;  2ES2 A;  2ICE C;  4JBJ A;  1VQL A;  3NEL A;  4LAA A;  4X3L A;  1CQV A;  1HZ9 A;  2LKV A;  3ULJ A;  2WAC A;  2R61 A;  2JEA I;  2HD3 A;  4R8N A;  3BZK A;  5FO9 B;  1A0I A;  3CXC A;  3J7Z C;  4GOP C;  3OIJ A;  1X56 A;  5M5X B;  1CKM A;  4KY6 A;  2VW9 A;  2IX0 A;  1PH6 A;  1TY2 A;  1TS2 A;  5TSS A;  4IAL A;  3CCU A;  3AMU A;  4OO1 G;  1WFQ A;  2CH4 A;  5GAG C;  1XMQ L;  2EYL A;  4LW1 A;  1O6D A;  1RF2 D;  4C3H G;  3S14 H;  1AFP A;  1O7Y A;  2JN4 A;  3L9A X;  3Q24 A;  5M3F H;  1GHJ A;  1VQG A;  4OO1 I;  2WFW A;  3MFG A;  1LTT D;  2IY5 B;  5FOB B;  2E2H B;  5EJW A;  4YQ0 A;  1SBB B;  3HP3 A;  1PDQ A;  2BH8 A;  1V1O A;  3UI2 A;  5FLX c;  4PZK A;  3TQY A;  2L1B A;  1IW7 C;  4HED A;  3KTY A;  1Z85 A;  2RDF A;  2DNE A;  1TKW B;  1I4Q A;  2DJG C;  2R3Z A;  4AH6 A;  2F4I A;  3OTO Q;  1MJC A;  5A2Q L;  2F0F A;  1I4P A;  1JOO A;  2I5L X;  5AJ3 L;  4DR2 L;  5LMN L;  1DM0 B;  4MCC A;  4YQA A;  2JA5 G;  4A3J B;  4A3B B;  4JI2 Q;  2UXC Q;  4L69 A;  1MHW C;  2XRS D;  3M4Q A;  4DV5 Q;  3K0X A;  1G2T A;  2F0O A;  1Y1V H;  2B63 H;  1ICW A;  2CW0 D;  3I4N G;  3NEM A;  5I4D A;  3GV6 A;  1J6Q A;  2OQK A;  4X64 L;  2D0O A;  3HOX H;  1CUK A;  3RD4 A;  3I4M G;  1QNU A;  5JEA G;  1C4Q A;  5I2Y A;  4H44 C;  1ET9 A;  4R4O A;  3G48 A;  4XTC S;  1NMG A;  1RJT A;  4DUY L;  3KLR A;  4KJO A;  3F8T A;  4GKK Q;  4H3Z A;  4JAK A;  2CKZ B;  2QA4 A;  2XIW A;  1CHP D;  4DUZ L;  1ZXT A;  1IYV A;  1VQB A;  3PCO B;  1CTM A;  4DPG A;  2NZ1 D;  1E2Z A;  2DGY A;  3ZJY C;  1KIX A;  4JI5 Q;  4IQZ A;  4LF6 Q;  2B39 A;  1STG A;  1WCM H;  4OL7 A;  2HIV A;  2D9U A;  4NXM Q;  3QJY A;  1X3P A;  2EGW A;  1CKN A;  3J7A F;  2UUA Q;  4H7B A;  3NQT A;  1VCI A;  2WKC A;  2ZJR A;  1XMO L;  3A8J E;  3H0G G;  3K59 A;  3GTG B;  1VQE A;  3P1H A;  1IBM Q;  2BE5 C;  4O2D A;  5D14 A;  4HR7 B;  2VQF Q;  5LHY 1;  1MD2 D;  3X3M A;  1EQV A;  1FNV A;  2KED A;  3SR1 A;  3FMC A;  1QB5 D;  5LL6 S;  5JOB A;  3MXN B;  3EA6 A;  3CMA A;  2F0V A;  4DV3 Q;  5FO7 B;  1F2M A;  1HQR D;  3PF5 A;  4NXN Q;  1FGB D;  2NVT H;  4YWM A;  4JI6 Q;  3V96 A;  2RSN A;  4DV7 Q;  3GDE A;  1RTO A;  2RHS B;  4IOC A;  3DCM X;  3KLS A;  4YPX A;  2RF4 A;  4DAM A;  3JAM E;  4A3C G;  3CPW A;  1U4L A;  2R7Z H;  4YQL A;  1JWM D;  4IUV A;  1WD0 A;  2K5Q A;  4ZK9 B;  1GVP A;  2WAQ G;  1PTO F;  4GNX B;  3D0F A;  2DN8 A;  3ERQ A;  3TEH B;  2TMP A;  4KY5 A;  4DNT B;  1JOK A;  4IFD G;  4P75 A;  5FK9 C;  4BBR G;  1WOC A;  3KK7 A;  3KF6 B;  3VYR A;  2K5V A;  1QNK A;  1HNX L;  5EKK A;  2OQ0 A;  5BN5 A;  2Y0S B;  4HSP A;  3OYY A;  1KD1 C;  3E5Y A;  2CH4 W;  3OII A;  4E8B A;  1Z6H A;  1TY0 A;  3QG1 A;  5ELD A;  4EQN A;  3H15 A;  3QR8 A;  3P75 A;  5FJ8 H;  4GLA C;  1XXG A;  3E0J A;  4QMG A;  5D9F A;  1BBU A;  2YTV A;  3BU2 A;  2Q8I B;  1WTX A;  1XMQ Q;  2RA4 A;  2PQA B;  3BDL A;  1JC7 A;  2H4O A;  4QIW B;  4K0K L;  1V8Q A;  3AI9 X;  1STB A;  3AYH B;  4QUF A;  2F0P A;  4X62 L;  1E2V A;  1HR0 Q;  3RR5 A;  3MFY A;  4JV5 L;  3TZU A;  2EIF A;  3KJP A;  3J7A 5;  2EYO A;  4DK0 A;  4X3T A;  1I4G A;  3N52 A;  4JC0 A;  2R92 G;  2WV6 D;  2FXQ A;  1N33 Q;  3CCS A;  4DR5 Q;  4CDF C;  4IPC A;  4LF4 L;  3PO2 B;  1JE4 A;  2SNS A;  2Z1C A;  1RHP A;  4DAV A;  3S1M H;  4OXP A;  4X66 L;  5C4H A;  3KLW A;  2N78 A;  3PO3 H;  4NDX A;  3VR6 A;  3CME A;  1BQQ T;  2M9V A;  1TQO A;  2MUY A;  1S5F D;  2SNM A;  5JEA J;  2O2L D;  1VQ9 A;  1CQF A;  2VUM B;  2V3K A;  2QGQ A;  2A68 C;  4JI7 Q;  3J81 c;  3BZC A;  4DR7 L;  2EY6 A;  3MWY W;  2JE6 I;  2LS0 1;  4IJL A;  2AMC B;  3N6R A;  1M8A A;  5EPJ A;  2EQS A;  5F2D A;  4DR1 L;  1NS5 A;  1Y8N B;  3QIA A;  1H9K A;  2WAQ E;  5KEE A;  4FAK A;  4WFN 3;  4DR6 L;  1D7Q A;  3KBX A;  1IL8 A;  1PRT D;  1OO9 B;  4JWH A;  4JI8 L;  3OW7 A;  1MGS A;  1I6H H;  4IUR A;  2QEX A;  3I91 A;  3M4O H;  2K5N A;  1IBK L;  1A6X A;  1UAJ A;  3S1N H;  3IRB A;  2X6L A;  1BBW A;  5BR8 L;  1MSH A;  2ZM6 L;  4JYA Q;  4HMJ A;  3I56 A;  3W3A A;  1PRT F;  2JP1 A;  3AFP A;  3IFT A;  4ZYS A;  1PTO H;  2D62 A;  2E2I H;  1VQK A;  3HKZ G;  3I73 A;  2EJG C;  3MXG A;  1ILP A;  1E7Z A;  4G7O C;  2KHS A;  4R9W A;  5C4X H;  4C56 C;  4EQ5 A;  1E1O A;  1XTC D;  4C3I B;  5C4J B;  5CV9 A;  4RHR A;  4KKS A;  3NP8 A;  1SMX A;  1MI2 A;  4C3J G;  4A3K B;  4JI3 Q;  4S3S A;  1SE4 A;  4N9T A;  3CAM A;  4X3S A;  5CV5 A;  1B44 D;  3E5S A;  1ZYR C;  3ERS X;  5IYC H;  2V4D A;  2IX1 A;  5IT9 c;  2F4V Q;  4A3E B;  5EKL A;  2K7V A;  5IY0 A;  3HOU G;  1BCP C;  2F0G A;  3U9S A;  2EPB A;  2K33 A;  3DM1 A;  2H1E A;  1EIF A;  2D0P A;  1MKH A;  1NBW A;  4LF9 L;  4P72 A;  1HRJ A;  1II3 A;  4YVI A;  2JK8 A;  5EPK A;  4IO9 A;  2RHQ B;  4YQQ A;  1UE7 A;  2KBN A;  2IW3 A;  4CNE A;  3I7F A;  4M8A A;  4R4T A;  3F2U A;  3OHX C;  2JA7 G;  3A55 A;  1BOS A;  1S72 A;  3TRZ A;  4IFD J;  4GZY C;  4B3M L;  4IPH A;  1DD2 A;  4Q5V A;  3GTK H;  4J1M A;  4BY7 G;  4ZRZ A;  4A3M G;  3HRZ C;  3TP7 A;  4DV0 Q;  1JWU D;  1ESR A;  1O78 A;  4K2L A;  3UE1 A;  4F8M A;  1JJ2 A;  3M3Y B;  3G6J B;  4FXD A;  1WI5 A;  2DJF C;  3TN2 A;  3BBH A;  2L11 A;  2E8G A;  3EIV A;  1O7L A;  4FNF A; 
#chains in the Genus database with same CATH homology
 1JMC A;  2CFM A;  1J5E L;  5IWA Q;  1OXS C;  4O0A A;  3ULP A;  1N33 L;  3HOV G;  4DR5 L;  1YJN A;  4X6A H;  1X7P A;  5C0X G;  3M3Y H;  4DKA C;  4YWL A;  4A3C H;  1HNZ L;  4DV2 L;  3CC7 A;  5JJL A;  2N49 A;  5LMU Q;  1KHI A;  1W2B A;  2JA6 G;  3HOU H;  5FLM H;  4LFA Q;  4POG A;  4YCW A;  3PUX A;  1HNW Q;  2A1A A;  2WB1 E;  4OON A;  1V1Q A;  4A4I A;  1VQH A;  1WCM G;  1EYG A;  4YQJ A;  1X65 A;  3HKZ E;  4QL5 A;  3H3V H;  2F3I A;  4LUV A;  2QMM A;  4X3M A;  4YQ8 A;  4DV6 L;  1PFS A;  1QZG A;  4JI7 L;  5C0X I;  2JQO A;  3PV0 A;  1PH5 A;  5AJ3 Q;  4DR2 Q;  5LMN Q;  1BVS A;  2VNU D;  3UDF A;  2UXB Q;  1RL2 A;  2VY3 A;  3GTM H;  4BY1 G;  1P9P A;  3BBD A;  3HOZ G;  1K83 H;  4LUZ A;  1TXY A;  4L5Q A;  3G71 A;  1VS0 A;  2UXD L;  1X3G A;  3BJU A;  1VQP A;  1WYD A;  1K8G A;  2JA7 H;  2AWN A;  3PO2 H;  5IYB G;  1PYS B;  4TVA B;  1VHK A;  1H95 A;  4CND A;  2LXK A;  1A63 A;  2ALY B;  2Q2T A;  4A3M H;  3MEF A;  4A3K G;  2UUB L;  3CP0 A;  1IXR A;  4FDB A;  4IPG A;  3F2D A;  1YHA A;  4HID A;  1YHQ A;  4NXM L;  2NVQ H;  2R93 G;  3UDG A;  1QVG A;  4A76 A;  1SR3 A;  3PGZ A;  1XNR Q;  4X64 Q;  2HA8 A;  5IP7 H;  4RG1 A;  2MNA A;  3J80 c;  1IYJ B;  1V43 A;  2BA0 A;  1Q12 A;  3JAM i;  2VUM H;  4YVG A;  1X3F A;  1RIP A;  1E22 A;  4HJ9 A;  1Y1W G;  1UE6 A;  1VQ4 A;  1Q46 A;  2ZJQ A;  3TS2 A;  4YPW A;  1VQM A;  2IT1 A;  1AH9 A;  4A3E G;  3PUW A;  4YQ5 A;  4HJ8 A;  1NE3 A;  2CWA A;  4JYA L;  2GVB A;  4DR3 L;  4AQY Q;  4DUY Q;  4UP8 A;  3M85 A;  2MO1 A;  2KHI A;  3S2H H;  1PYB A;  2R7Z G;  1OXX K;  1P16 A;  4JI1 Q;  3HOV H;  4POF A;  1X55 A;  4A93 G;  3HOW G;  3STB D;  5HY6 A;  1FJG Q;  1LYL A;  4DUZ Q;  3RZD H;  3K81 C;  4DV3 L;  3CC2 A;  5C3E G;  2R92 H;  3QUV A;  1Z9F A;  1B7Y B;  3OIN A;  5C44 H;  1TWG H;  4A93 H;  1Q81 C;  1L1O A;  1XNQ L;  2PI2 E;  4A3F H;  4LFB Q;  4JI3 L;  4OO1 G;  3CD6 A;  1LM0 A;  1YJ9 A;  3S16 H;  1HZA A;  1E24 A;  5ELN A;  2VL6 A;  3I2Z A;  5HGQ A;  4LF7 L;  1I94 Q;  1FGU A;  1WJJ A;  2HQL A;  4B3S Q;  3S1R H;  3M9B A;  4JG2 A;  2YTY A;  4P73 A;  2F4V L;  4MCD A;  2NN6 G;  1Z47 A;  4NB3 A;  3U4Z A;  4A3L G;  4YQ3 A;  4BBS G;  1KC8 C;  1UAK A;  3UDI A;  2Z6K A;  1XMO Q;  5M5Y H;  2UUC L;  2L15 A;  3DM3 A;  4DK3 C;  5IYB H;  4C3I H;  5C4J H;  2ES2 A;  2QWV A;  4JBJ A;  1PH3 A;  1Q1B A;  3NEL A;  3CCQ A;  1VQL A;  3ICE A;  4X3L A;  1A62 A;  1YHB A;  1HZ9 A;  3HOY H;  1UE1 A;  3FHW A;  3ULJ A;  4A3K H;  1XPO A;  2OTJ A;  3CCJ A;  4A3I H;  3CC4 A;  4IOA A;  3KF8 B;  4PZ6 A;  1C7Y A;  2R93 H;  2YYZ A;  2JEA I;  4JWJ A;  3BBE A;  2NN6 I;  1PVO A;  1PH4 A;  3BZK A;  5GM8 A;  3E9I A;  4GKJ Q;  3GTJ H;  2OWO A;  2YU9 H;  4YQO A;  1A0I A;  5IP9 G;  4X65 Q;  3J7Z C;  3CXC A;  4GOP C;  4GOP A;  3OIJ A;  2VZA A;  2Q2H A;  1VQO A;  3AEV A;  1X56 A;  4GLX A;  4A3E H;  1CKM A;  3W1G A;  1IBL L;  1ASY A;  3CCM A;  4GN4 B;  2VW9 A;  1Q1E A;  2IX0 A;  1PH6 A;  5GMC A;  1VQC A;  1QUQ A;  1K0R A;  3K8A A;  3CCU A;  4DV0 L;  4YVJ A;  2JJQ A;  1XTD A;  1KL9 A;  1B70 B;  1WFQ A;  4P74 A;  5GAG C;  3NBH B;  1XMQ L;  4DV1 L;  3T1H L;  1OXT A;  4UP9 A;  2IHF A;  4LW1 A;  1N34 L;  4A3B G;  3K7A H;  1O6D A;  1CSP A;  3S14 H;  4KHP L;  4PZ7 A;  5C3E H;  3U50 C;  1L2F A;  2DUD A;  1SRU A;  4IJH A;  5GAE C;  5M3F H;  1OY5 A;  2V3J A;  1X7O A;  1OXU A;  3KNU A;  2CQO A;  1VQG A;  2JA9 A;  1LTL A;  2R6G A;  1XJV A;  5IWA L;  4OO1 I;  3W1B A;  1IPA A;  1L1O B;  2WFW A;  3GD7 A;  4LUO A;  5JJK A;  4C3J H;  1EWI A;  4PG3 A;  4A3D G;  3JC6 6;  2XGT A;  2IY5 B;  3K80 C;  4AIM A;  3T1Y Q;  4YQ0 A;  1CKN B;  1VQJ A;  5GMB A;  1HNX Q;  2BH8 A;  5FLX c;  1P8L A;  5LMU L;  4B3T L;  4PZK A;  3TQY A;  4LF5 Q;  4LFA L;  2PMZ E;  3N4K A;  1VQA A;  4L5S A;  3W5O A;  1HNW L;  3O7B A;  1VQ8 A;  2OTL A;  1D8L A;  4A3G G;  1YVC A;  1Z85 A;  1VQ5 A;  2JA8 H;  3KTY A;  3CCR A;  4YY3 Q;  1NTG A;  2MFI A;  4AH6 A;  4B3M Q;  2EGV A;  4JWF A;  4APV A;  3OTO Q;  1MJC A;  1QVC A;  1S3O A;  4JCV E;  2I5L X;  3A74 A;  1X54 A;  5AJ3 L;  2GVA A;  5C0X J;  5LMN L;  4DR2 L;  1PA6 A;  4MCC A;  3J81 i;  4YQA A;  2JA5 G;  1O7I A;  1PH8 A;  3GTP H;  4K0K Q;  4A75 A;  3RZO H;  4MNO A;  4JI2 Q;  5E7N A;  2UXC Q;  4L69 A;  1UAM A;  3EBE A;  3M4Q A;  3PSI A;  3A5Z B;  4DV5 Q;  3K0X A;  2I0Q A;  1Q8K A;  1YIJ A;  4HJ7 A;  1Y1V H;  2KCT A;  3GTO H;  4KDZ A;  4YPY A;  3I55 A;  1VQF A;  4X62 Q;  2B63 H;  3HKS A;  2CX8 A;  3L0O A;  4GOP B;  3M7N A;  4R4I A;  5DLQ E;  3I4N G;  4JV5 Q;  4JBK A;  3NEM A;  1NJI C;  5FAI A;  4YQN A;  1J6Q A;  1XNR L;  2A19 A;  3LGJ A;  2OQK A;  4X64 L;  2D0O A;  4P71 A;  4DV4 L;  1KQS A;  1KAW A;  3S1Q H;  4BY7 H;  1QUQ B;  4BXX G;  3HOX H;  1CUK A;  4C3H H;  4YQK A;  3I4M G;  1I5F A;  5JEA G;  1YNX A;  1XPR A;  1SE8 A;  4R4O A;  1B8A A;  3G48 A;  4XTC S;  1NMG A;  4DUY L;  4UP7 A;  3VDY A;  1NY4 A;  3F2C A;  4LF4 Q;  3D31 A;  3F8T A;  4Y7N H;  4X66 Q;  4GKK Q;  4H3Z A;  4JI1 L;  1AE3 A;  1BKB A;  4JAK A;  4DV6 Q;  1M1K C;  3RLO A;  4A3D H;  2CKZ B;  1KRS A;  3U4V A;  2QA4 A;  2Z0S A;  4GNX C;  4GNX A;  4DUZ L;  4AYB G;  4L5R C;  1IZ6 A;  4YCV A;  3KDF A;  1R9T H;  1KXL A;  1VQB A;  3PCO B;  3N4J A;  5J3B A;  4CNF A;  4DPG A;  1PH2 A;  2UXD Q;  3PUY A;  5GAH C;  2DGY A;  1M90 C;  4A3G H;  2GN5 A;  1HZB A;  4OWT B;  4R4C A;  1EQQ A;  2E5L Q;  3ZJY C;  4DR7 Q;  2JA6 H;  4YQ1 A;  1KIX A;  4WJ4 A;  2MQH A;  3L8U A;  4JI5 Q;  1EQR A;  1I94 L;  3S15 H;  4LF6 Q;  1NXZ A;  1TO0 A;  1U5K A;  4YHH Q;  4B3S L;  4MTN A;  2UUB Q;  1WCM H;  4MCB A;  2HIV A;  2F52 A;  4NXM Q;  1K9M C;  3NK6 A;  2JA5 H;  1G51 A;  4DR1 Q;  4OX9 L;  2EGW A;  1CKN A;  2UU9 Q;  4YVK A;  2UUA Q;  1VQ7 A;  4YQD A;  4WJ3 M;  1VCI A;  2ZJR A;  1XMO L;  4OWW B;  3H0G G;  1DGS A;  4KLK A;  4DR6 Q;  1VQE A;  1IBM Q;  4O2D A;  3Q8D A;  1J85 A;  4J15 A;  4JI8 Q;  3JAM c;  4BY1 H;  2VQF Q;  3HOZ H;  2NZO A;  2PQA A;  4BA1 I;  4HJ5 A;  1L0W A;  5M3M G;  3I4N H;  3DLL A;  2OCE A;  3PIP A;  1IBK Q;  2HHH Q;  3EN2 A;  3MXN B;  5FJ8 G;  5BR8 Q;  4DR4 Q;  2ZM6 Q;  3GYQ A;  3K7U C;  1S40 A;  4LFC Q;  4BXX H;  4GKJ L;  3CMA A;  1G29 1;  4X65 L;  3I4M H;  1A8V A;  1N36 L;  4DV3 Q;  4IG6 A;  2VS1 A;  3PF5 A;  1TWH H;  1K8A C;  1TWF H;  3B6Y A;  1SFO H;  4NXN Q;  2H5X A;  2NVT H;  4UPA A;  1K3R A;  4YWM A;  2A8V A;  4JI6 Q;  3A0J A;  3FKI G;  4JOI C;  4H02 A;  1Y1W H;  4DV7 Q;  3GDE A;  4MZ9 A;  3S17 H;  3ONP A;  4QQB X;  3TRE A;  1Q86 C;  4LF8 Q;  4J3C A;  2RHS B;  4IOC A;  3DCM X;  5ELO A;  4YPX A;  2RF4 A;  4JI4 Q;  1W3S A;  4DAM A;  5LMN W;  4IPD A;  4A3C G;  1YEZ A;  3CPW A;  3AFQ A;  2R7Z H;  1EIY B;  4YQL A;  3U58 A;  1N32 Q;  2B3G A;  1VQI A;  1GM5 A;  2ATW A;  3HOW H;  1GVP A;  3L7Z C;  4A3J G;  2I5H A;  2WAQ G;  4HIM A;  4GNX B;  3NEN A;  2AWO A;  3D0F A;  1CSQ A;  3A5U A;  3GTL H;  3TEH B;  4XBO A;  3KDF B;  2KHJ A;  5M5X H;  2XTI A;  4YQC A;  4IFD G;  4P75 A;  4BBR G;  3PUV A;  1WOC A;  4LNQ A;  2N8N A;  3PO3 G;  3KF6 B;  1HH2 P;  2K5V A;  3T1Y L;  1Y14 B;  2K14 A;  2K50 A;  1HNX L;  4C2M H;  1X9N A;  4LF5 L;  2OQ0 A;  1X3E A;  1KRT A;  1XPU A;  4LF9 Q;  3H0G H;  3OYY A;  1KD1 C;  3HFZ B;  3E5Y A;  3F1Z A;  4GN3 B;  3PO2 G;  2CWP A;  1JB7 A;  4TQU S;  3GTQ H;  3OII A;  4JI0 Q;  3KFU A;  4A3L H;  4E8B A;  3CCV A;  4YY3 L;  2VQE Q;  4BBS H;  3H3V I;  5M3M H;  3OTO L;  3H15 A;  3F2B A;  4YVH A;  3IC6 A;  2LSS A;  2Q2I A;  4GLA C;  4AYB E;  5FJ8 H;  5D9F A;  2YTX A;  1GD7 A;  2YTV A;  1BBU A;  1JJC B;  3BU2 A;  3KOJ A;  4DK6 C;  5M5W H;  2PQA B;  4DV1 Q;  4QJF A;  1XMQ Q;  4K0K L;  4JI2 L;  4DAY B;  1N34 Q;  3CW2 C;  1V6Z A;  2E2H H;  4DV5 L;  1GO3 E;  3AI9 X;  1Q82 C;  3AYH B;  2NVY H;  1X6O A;  1EFW A;  1JJG A;  4X62 L;  4B3R Q;  2UXB L;  1HR0 Q;  3RR5 A;  5IP9 H;  3FKI H;  1MJE A;  3S2D H;  2WP8 J;  1HZC A;  4JV5 L;  2ZJP A;  1LUZ A;  2KCM A;  2JEB I;  1JT8 A;  4R4Q A;  3KW2 A;  1YJW A;  2EIF A;  2ZTD A;  2C35 B;  3KJP A;  2R7D A;  1UAL A;  4XIG S;  2K4K A;  3J80 i;  4GS3 A;  3J7A 5;  1U0L A;  4YQP A;  4B3T Q;  1J5E Q;  4JC0 A;  1C0A A;  2AHO B;  5EAY A;  2R92 G;  2FXQ A;  4KHZ A;  5C44 G;  1CKO A;  1NMF A;  4YWK A;  3UDX A;  3CCS A;  4DR5 Q;  4A3J H;  1N33 Q;  4A3B H;  5C4X G;  3GO5 A;  4IPC A;  4A3F G;  4LF4 L;  4L5T A;  2NVX H;  1HNZ Q;  1MIU A;  4DV2 Q;  1PH1 A;  1QVF A;  3S1M H;  4OXP A;  4X66 L;  2EXD A;  4HIK A;  2YV5 A;  3KJO A;  2E2J H;  4GKK L;  3CF5 A;  3KLW A;  2RCN A;  4BBR H;  2CCZ A;  4AQY L;  2N78 A;  3PO3 H;  2YY8 A;  2Y0S E;  3CME A;  1JE5 A;  3AIA A;  1MXI A;  5GRO A;  2I5M X;  2V1C C;  3RN5 A;  1GZ0 A;  2BH2 A;  3CCE A;  2HIX A;  5JEA J;  1VQ9 A;  2V3K A;  1ASZ A;  2QGQ A;  4GLV B;  4KGN A;  1C9O A;  5IYC G;  1N9W A;  4JI7 Q;  3J81 c;  2ID0 A;  3BZC A;  1FJG L;  5JJI A;  2NZH A;  3ULL A;  4DR7 L;  1GKH A;  2E5L L;  4GN5 A;  4JI5 L;  3G6E A;  4FMW A;  4LF6 L;  4YQI A;  1VH0 A;  2JE6 I;  1I50 H;  4QIW E;  4IJL A;  4YHH L;  3HOY G;  4LFB L;  2Q2U A;  4A3I G;  2AMC B;  3KF6 A;  3KY7 A;  4QGU A;  4YQS A;  4PZ8 A;  2EQS A;  4DR1 L;  1NS5 A;  3E0E A;  2UU9 L;  1IL2 A;  1FL0 A;  2UUA L;  4DV4 Q;  1V2X A;  2WAQ E;  4FAK A;  3S24 A;  2ASB A;  4DR6 L;  1D7Q A;  1IBM L;  1G6P A;  4CNG A;  4JWH A;  4JI8 L;  3ILK A;  2B29 A;  1OTC A;  2VQF L;  1I6H H;  3PF4 A;  2QEX A;  4YQT A;  3M4O H;  2AKW B;  1VQ6 A;  2K5N A;  3FP9 A;  3PIO A;  1IBK L;  2HHH L;  3S1N H;  3IRB A;  1UAJ A;  3AXZ A;  1BBW A;  5BR8 L;  3L2P A;  2ZM6 L;  4DR4 L;  2ZTE A;  4LFC L;  4JYA Q;  4RMF A;  4DR3 Q;  3I56 A;  4BA2 I;  2WB1 G;  1EOV A;  3AFP A;  1UE5 A;  1K73 C;  2D62 A;  3CPF A;  1E3P A;  3HKZ G;  3M4P A;  5GQO A;  2E2I H;  1VQK A;  3NK7 A;  1V9P A;  4NXN L;  1YIT A;  1E7Z A;  5C4X H;  1L1O C;  1SRO A;  5M3F G;  1TWC H;  4JI6 L;  2Y0S G;  4EX5 A;  4EQ5 A;  1ZJR A;  4OWX B;  1E1O A;  4DV7 L;  4UY8 C;  3GTG H;  4ALP A;  3CCL A;  4YQ7 A;  1PV4 A;  4LF8 L;  5IYD G;  5K36 G;  1FVI A;  3OW2 A;  1Q7Y C;  1VQN A;  1SMX A;  4JWG A;  1XNQ Q;  4LWC A;  2BA1 A;  1YZ6 A;  4JI4 L;  4YQ2 A;  2ZTC A;  4YCU A;  4JI3 Q;  4JOI A;  4YQ9 A;  3CAM A;  4OX9 Q;  1N32 L;  4LF7 Q;  1HR0 W;  1T9H A;  2Z6K C;  4YQR A;  3ERS X;  5IYC H;  3RLN A;  1VHY A;  2IX1 A;  2Z0Y A;  3SGI A;  5IT9 c;  2F4V Q;  2JA8 G;  4YQB A;  5IY0 A;  4YQ4 A;  5IE8 A;  1PH7 A;  3HOU G;  5H1S E;  5FLM G;  1N8R C;  3E9H A;  4YPZ A;  3J81 j;  2PI2 A;  3G4S A;  2UUC Q;  1VQD A;  1PH9 A;  1EIF A;  3TS0 A;  2I6D A;  2D0P A;  3IEF A;  3CQZ H;  3PUZ A;  1MKH A;  2HT1 A;  1NBW A;  3STB C;  4LF9 L;  4ME3 A;  1E1T A;  4P72 A;  1N36 Q;  4YVI A;  2IHE A;  2JK8 A;  4DNI A;  4Y52 H;  5CO4 A;  5GAD C;  4IO9 A;  4JI0 L;  4H3Y A;  2RHQ B;  4YQQ A;  1Y1V G;  1UE7 A;  1UEB A;  2KBN A;  2VQE L;  4CNE A;  2B63 G;  3I7F A;  1AE2 A;  4JAL A;  4R4T A;  2LXJ A;  3ER0 A;  1UWV A;  2JA7 G;  3KYH C;  2PNH A;  3TRZ A;  1S72 A;  4IFD J;  1TWA H;  4NPS A;  1IBL Q;  4B3M L;  3RLF A;  4IPH A;  4YQG A;  1I3Q H;  3GTK H;  4BY7 G;  1PHJ A;  4IFD I;  1HJP A;  3HOX G;  4A3M G;  2KEN A;  4DV0 Q;  3UE0 A;  2N3S A;  1OXV A;  2R7F A;  4R1J A;  1SN8 A;  2K5H A;  3UE1 A;  2K75 A;  3WWV A;  4HJA A;  1JJ2 A;  4B3R L;  3T1H Q;  1YBY A;  5IP7 G;  1HR0 L;  1QZH A;  3AQQ A;  2UXC L;  2VUM G;  4KHP Q;  4KI0 A;  4HIO A;  4PMW A;  1YI2 A;  4JBW A;  1WI5 A;  5IYD H;  3I4O A;  4JBM A;  4QY7 A;  1SLJ A;  2O3A A;  3BBH A;  1EUJ A;  2E8G A;  3EIV A;  2MO0 A;  3RNU A;  3RN2 A;  2K52 A;  4YQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...