4RG1A

Methyltransferase domain of c9orf114
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
Knots found
sequence length
306
structure length
285
Chain Sequence
RGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQACVQLARILQYLECPQYLRKAFFPKHLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLTQAGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human C9orf114 in complex with S-adenosyl-homocysteine
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords C9orf114
total genus 89
structure length 285
sequence length 306
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02598 Methyltrn_RNA_3 Putative RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4rg1A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4rg1A01
2Y0SG 3M9BA 3MEFA 3GTQH 2O3AA 3HKZE 1VCIA 4GNXC 2R93H 1HR0L 4GKKL 1HZ9A 4P75A 4X66Q 5IYDG 3U4ZA 3KF8B 1IPAA 1UE1A 3L7ZC 3HKSA 2E2HH 4YCWA 3K81C 4JI8L 4HJ8A 4A3JG 3S1RH 1K8AC 2JA6H 1OXUA 2HIVA 2YV5A 3S1QH 1EQRA 3KLWA 5M3FH 1HJPA 4IOAA 3PUZA 2VS1A 4IPDA 3AQQA 1XMQQ 4A3JH 2WAQE 2L15A 3GDEA 4C3IH 5JEAG 5C44G 3AXZA 3CMAA 3F2BA 3CCVA 3U58A 1K8GA 3OTOL 4YWMA 3DLLA 4LWCA 2RHQB 1NMFA 1N34L 2OWOA 1VQGA 5C4JH 4ME3A 3J81i 1DGSA 3TS0A 3PO2H 5JJLA 1NJIC 3A0JA 1QVCA 4JAKA 4ALPA 3E9IA 3HOWH 4CNGA 3GTJH 4X3LA 1MXIA 3OIJA 1WOCA 4GOPA 1XPRA 2JA5G 4YQAA 3NELA 2VQEL 2V1CC 3F8TA 4P71A 3PSIA 3G6EA 4DR4L 4A3EH 2CCZA 4LUVA 2IY5B 1CKOA 3J7A5 1KIXA 2ZTEA 3KYHC 1CUKA 4OWXB 4X62L 1L2FA 1KRTA 4YCUA 5FJ8G 4DV5L 1KD1C 1I94L 1VQ6A 1VQIA 1YEZA 4A3CG 4KHPQ 4YQ4A 5FLMG 4XIGS 2OQKA 4LFAL 4DV4Q 4LF9L 2Z6KA 4A3MG 2JJQA 4PZ7A 1PV4A 2ASBA 4JI3Q 2AMCB 2UUAQ 2A1AA 2EGWA 3KY7A 4YQ2A 2F4VL 4BA1I 3RZOH 5FJ8H 2Q2UA 2KHJA 1JT8A 4YQ1A 4YVIA 3CCEA 2R7DA 4DNIA 3PO3G 5AJ3L 2N49A 1Y14B 4DUYL 4IFDI 4DR3Q 3HOVH 1P9PA 4MZ9A 1C9OA 3D31A 4JBMA 4JI0L 4YVJA 2R7ZH 4A3GG 3CW2C 5IP7H 2ZM6Q 3CXCA 1EQQA 1SE8A 2ZJPA 1FJGQ 2DUDA 1X7PA 1VQAA 4P73A 3CCQA 1C7YA 3S14H 4YQCA 4K0KQ 1JJ2A 3WWVA 4X6AH 1L1OA 2ID0A 3M85A 4UPAA 1VQOA 2A8VA 3GTOH 4DR6L 1E3PA 1L1OB 1U0LA 2D0OA 3T1YL 1XMOQ 1KQSA 3CF5A 4IPCA 1CSPA 2K5VA 3BU2A 4YQJA 1XPOA 1U5KA 4LF7Q 1V6ZA 5IYCG 4A3GH 2JA9A 1Q46A 1TWGH 2JK8A 3B6YA 4JI2Q 5IY0A 3HOXH 4NB3A 4GNXA 4LF5Q 1V43A 4LNQA 3K7AH 2QMMA 4RMFA 4YQ3A 3STBD 1XNRQ 4DAYB 1TWFH 2K50A 2MO1A 5M3FG 1IBLQ 4UY8C 4LFCQ 1JJCB 4A4IA 1Y1WG 2XGTA 1E22A 4LFCL 4LF6Q 1D8LA 1J85A 1B70B 1EUJA 3STBC 4A3MH 4X64L 1WFQA 3A5UA 4GN4B 1XPUA 4X64Q 2Q2IA 1VQFA 2WB1G 4CNDA 1HZCA 4IOCA 1HR0W 3PIPA 4KDZA 4MCDA 3W1BA 4X66L 3RNUA 4NXNQ 4YQ0A 1KRSA 1BKBA 2I0QA 2EGVA 1FGUA 2WP8J 5E7NA 4A3KG 3HFZB 2UXCL 4GLXA 3BBEA 3E9HA 4PG3A 1KXLA 1CKMA 1N8RC 4A3FG 3OIIA 2Q2TA 1YHQA 1A62A 2CFMA 4XTCS 5IWAL 4YPXA 2UXDQ 1RL2A 4B3RQ 1SN8A 4IFDJ 2UXDL 5AJ3Q 4A3IG 4GLVB 1YIJA 4J3CA 4GN5A 4JI1L 4X65Q 4DR3L 3PIOA 4HJ9A 1X9NA 4JI0Q 4WJ3M 3A5ZB 4A3LG 1GZ0A 2WAQG 2OCEA 1VHYA 1VQEA 4YQTA 3GTPH 1UE5A 4L5QA 4DR1L 4BY1H 1UE7A 2HHHQ 5EAYA 2UXBL 4BBRH 1VQKA 4YHHQ 4OX9Q 2CX8A 2UXBQ 1YNXA 3VDYA 4YHHL 2ZJRA 4DV2Q 4OX9L 3AFPA 2VQFQ 1G51A 1HNZL 4JV5L 1TWAH 1SRUA 4KLKA 1D7QA 1KL9A 3JAMc 1QVFA 1S3OA 1WYDA 2ATWA 3QUVA 4A3DG 3TS2A 4QIWE 4X62Q 3AEVA 1UAMA 4L5SA 4DR2L 3GTGH 1R9TH 5GADC 4JI3L 4BY7H 2R93G 1I50H 1N36L 4YPYA 1GVPA 4JOIC 1E7ZA 1EIFA 1PH3A 2VNUD 3KW2A 2IT1A 3L0OA 3ONPA 2NN6I 1FVIA 3TEHB 4GS3A 1SR3A 3KFUA 3KJPA 1WI5A 3CAMA 4KHZA 3S2DH 1UAKA 4IFDG 1Z85A 1Z47A 1OXVA 2LXKA 2NVQH 1Q1BA 2BA0A 5C0XG 1HNWQ 2K4KA 2KHIA 1I3QH 4QQBX 2HIXA 3F2DA 3GO5A 2VZAA 4JI8Q 2BH2A 3M7NA 4DR7Q 1FJGL 2K5NA 3O7BA 1XMQL 3J81j 4B3ML 4AIMA 4DV1Q 4GOPB 3CD6A 4IPHA 4FAKA 3ZJYC 4OWWB 3I4NH 3T1YQ 1CSQA 5GQOA 5IWAQ 3H15A 1WCMG 1XMOL 1PH6A 3CQZH 3U50C 1N33Q 4DR6Q 3IC6A 4LF8L 4CNEA 1L1OC 1X6OA 4YQDA 1PH2A 2Z0SA 3FHWA 1M90C 1EYGA 1VQ5A 1QUQA 3ICEA 4EX5A 4GKJL 2NN6G 4Y52H 5JJKA 4YQ8A 3Q8DA 3TREA 2DGYA 4KGNA 2E5LQ 3J80c 3E5YA 3DM3A 3EIVA 4O0AA 2A19A 4DK3C 4CNFA 4OWTB 1NS5A 5IP7G 1LYLA 3GD7A 2K14A 2R7ZG 1K0RA 1OXXK 2JA7G 3KNUA 1GD7A 1KC8C 1Z9FA 1Q81C 2UUBL 3HOUH 1B8AA 4JG2A 5C4XH 2EXDA 3EN2A 5GROA 2E8GA 2R92H 2YY8A 1IL2A 1SMXA 5FLXc 1I5FA 4JC0A 1YZ6A 5IYDH 4MCBA 4P72A 4O2DA 4OO1I 2KCTA 3HOUG 1X3FA 2LSSA 1Q12A 4MNOA 5M5YH 1JMCA 4YQKA 1S72A 4YY3Q 5K36G 4JI1Q 4X65L 3EBEA 4YPZA 3ERSX 2IX0A 3TQYA 3S2HH 4IO9A 3AI9X 4A75A 5IP9H 1IBKQ 3GTKH 4LFBL 1Q82C 3H0GH 4P74A 3JC66 3GTLH 2UUCQ 2IHEA 3BBHA 1PYSB 3UE0A 5M3MH 2UUCL 2IX1A 4K0KL 4E8BA 2AHOB 1IBMQ 2VQEQ 4JBJA 2VQFL 5BR8L 2MQHA 3NK6A 5M3MG 1C0AA 4JOIA 2AWNA 3PF4A 3PUXA 1EIYB 4HJ7A 2HA8A 4JYAQ 5C0XJ 3MXNB 2OTJA 3HOYH 2XTIA 4AYBG 4DR2Q 4A3DH 5ELOA 5LMUL 2NVXH 3GYQA 5GAEC 1IBLL 1VQLA 2ZTCA 1OXSC 2YYZA 2F4VQ 3JAMi 4B3SQ 4JCVE 3S1NH 4B3SL 5J3BA 3RLFA 2RF4A 1E1OA 5C0XI 1ASYA 3I4OA 2Q2HA 3K8AA 4JI5L 3UE1A 2KCMA 4DV7L 2R92G 1EWIA 2PQAB 3CPFA 2AWOA 3CP0A 4GKKQ 1A8VA 3CCMA 2UXCQ 3KF6A 4LF4Q 5GMBA 2C35B 3KJOA 1T9HA 1PVOA 3J81c 1NMGA 4JI7L 3PUYA 1K73C 3I2ZA 2YTXA 4HIDA 3RZDH 4B3RL 4DV3L 3I4MH 1A0IA 5GM8A 3M4QA 4MTNA 2PQAA 2I5HA 4NPSA 1GKHA 2WFWA 4QY7A 1N34Q 4YQIA 4YY3L 5C44H 3TRZA 3CCLA 1PH8A 3KDFB 4JI6L 3CMEA 4JI6Q 1VQ9A 1NY4A 2EQSA 2VL6A 1YJNA 2JA8H 1J5EQ 4YQNA 4YVGA 4RG1A 2JA6G 3OW2A 3S16H 4DR1Q 1MJEA 4L5RC 1MKHA 2HHHL 2K5HA 1A63A 3HOZG 4BBSH 3G71A 4DKAC 2V3JA 1AE2A 3IRBA 1XJVA 2E5LL 3HOYG 4YQGA 5FLMH 4GNXB 4AQYL 2JA8G 5JJIA 2QA4A 4DV5Q 1I94Q 2N78A 2HT1A 4IG6A 4H02A 3RN2A 3KTYA 2BA1A 4YQSA 4A3EG 1Y1VG 1N32Q 1VQ4A 1VQHA 1KAWA 4TQUS 4DV4L 1PH5A 2UU9Q 1N36Q 2UU9L 1PYBA 1RIPA 4IJLA 1YITA 1TXYA 1YHAA 3M4OH 2I5LX 3N4JA 1X56A 1B7YB 1VS0A 4YQ7A 4DPGA 3H3VI 1UAJA 1Y1VH 4YQLA 2KENA 4GOPC 2V3KA 1Q7YC 4DV7Q 2PNHA 3PO2G 1JJGA 2CKZB 1HZBA 4R4QA 4B3TL 2H5XA 1HNWL 1ZJRA 3K80C 4LFBQ 2I6DA 1AE3A 3I7FA 1G6PA 3HOZH 4BBSG 1I6HH 2VUMG 4DR5L 3NK7A 5GAHC 1X54A 1FL0A 3KOJA 5LMNW 4DR5Q 1VQDA 4DV1L 1IBML 2CQOA 1N33L 4NXMQ 3PV0A 5LMNL 3RLNA 3T1HQ 1O6DA 2R6GA 3E0EA 4YVHA 5BR8Q 4BY1G 3RN5A 1V2XA 1VQNA 5GAGC 3N4KA 4HJAA 1EFWA 3ULLA 4JYAL 1GM5A 3CPWA 1HH2P 1CKNB 3ULPA 4YQ5A 4GKJQ 4POFA 2RCNA 4LF5L 3CCJA 1PA6A 2QGQA 1SROA 2QWVA 1VQ7A 3H3VH 4DAMA 4JI4Q 4POGA 4JI4L 2NVTH 1PFSA 4YQBA 3BZCA 2NVYH 4A3FH 4JBKA 4DR4Q 1NXZA 2PMZE 2Y0SE 3D0FA 4AQYQ 2JEAI 3HOVG 4YQOA 4LUZA 5FAIA 4YPWA 4UP7A 1N32L 1X65A 4FDBA 3I55A 2IHFA 1YVCA 1PH1A 4XBOA 4BXXH 1PH9A 1UE6A 3SGIA 3BZKA 2HQLA 4JALA 2MFIA 2NZHA 2B63H 4H3ZA 4PZ8A 1BBUA 3I56A 1MJCA 1XTDA 3PCOB 5IYBH 4DV6Q 4IPGA 2AKWB 2ALYB 5ELNA 2E2IH 4DV3Q 1OY5A 3CCRA 3F1ZA 1EOVA 1HZAA 3KF6B 3K7UC 1O7IA 3NBHB 1HNXQ 3CCSA 2N3SA 1PH7A 4UP9A 3CC4A 5HY6A 4KI0A 1OXTA 3CC7A 2YU9H 1V1QA 1IXRA 4YWKA 4QL5A 2OTLA 5JEAJ 1OTCA 3HOWG 4BY7G 1YJ9A 1IYJB 3I4MG 3H0GG 3L8UA 2PI2A 3UDIA 4LUOA 5CO4A 1QZGA 1Q8KA 3BJUA 4NXML 4LW1A 1QUQB 4HIMA 2Z6KC 3CCUA 4YWLA 2GN5A 1KHIA 3G48A 3S15H 2BH8A 5D9FA 3ULJA 4BBRG 4DK6C 1Q1EA 4QJFA 2UUAL 1X3GA 2B29A 3PO3H 2JA7H 2ZJQA 1BVSA 3PUVA 2ZTDA 1M1KC 4YQRA 1J6QA 3I4NG 4JBWA 2GVAA 5H1SE 3J7ZC 4A76A 5C4XG 4R4CA 3IEFA 3S24A 3W5OA 3PF5A 1H95A 1TWCH 1VH0A 2K52A 2I5MX 1W3SA 1SFOH 4HJ5A 1HR0Q 1QVGA 4B3TQ 2YTVA 4OONA 4A3CH 2MNAA 4AYBE 4HIOA 1E1TA 2JE6I 4C3HH 4LF4L 2NZOA 3BBDA 2WB1E 2F52A 4HIKA 1PH4A 3AFQA 4JI7Q 1K3RA 4PMWA 2RHSB 1W2BA 4DV0L 4TVAB 2LXJA 1BBWA 3RLOA 5IT9c 4DV0Q 3DCMX 3A74A 4LF8Q 4YQPA 2OQ0A 2VY3A 4GLAC 3OTOQ 1P8LA 3RR5A 1E24A 2R7FA 4DUZL 1L0WA 3UDFA 2QEXA 4R1JA 1TWHH 1HNXL 3ILKA 5C3EG 1VQPA 4BA2I 1K83H 1PHJA 1TO0A 2KBNA 5IP9G 2EIFA 1LM0A 1P16A 1NBWA 2FXQA 1J5EL 3FKIG 5LMUQ 4WJ4A 1XNRL 2N8NA 2CWAA 2K75A 3F2CA 4H3YA 4LF6L 1YHBA 5DLQE 4JV5Q 1HNZQ 2Z0YA 1GO3E 4R4IA 3HOXG 1ASZA 4YVKA 2VW9A 4JI5Q 4L69A 3HKZG 3FKIH 3OINA 3NENA 2UUBQ 1YJWA 2PI2E 4NXNL 4A3BG 4LF9Q 1G291 5C3EH 4KHPL 4AH6A 4A3LH 2GVBA 4A93G 1YI2A 4X3MA 3M3YH 1UALA 5M5WH 2MO0A 1UWVA 1VQBA 3AIAA 3CC2A 1MIUA 1NE3A 2F3IA 4L5TA 4MCCA 4PZ6A 4R4TA 2CWPA 1WJJA 4A93H 3NEMA 1YBYA 3LGJA 1LTLA 4A3BH 4PZKA 4DV6L 4DUYQ 4A3KH 4YQ9A 1X7OA 1JE5A 1IBKL 5GMCA 1N9WA 1VQ8A 2ZM6L 2ES2A 2B3GA 1IZ6A 1K9MC 4APVA 3PGZA 1UEBA 2VUMH 1WCMH 3ER0A 4OXPA 2B63G 1S40A 3K0XA 1X55A 2E2JH 4DR7L 4OO1G 4C3JH 3PUWA 5IYBG 4Y7NH 5IE8A 1Y1WH 4EQ5A 5HGQA 4DV2L 3KDFA 4C2MH 4J15A 4R4OA 4B3MQ 4BXXG 3UDXA 5M5XH 4A3IH 4YQQA 1VQMA 5LMNQ 2D0PA 3T1HL 2YTYA 3GTMH 5IYCH 4YCVA 4DUZQ 3S17H 3AYHB 3M4PA 2JA5H 3W1GA 4UP8A 1NTGA 3J80i 4LFAQ 3G4SA 1VQCA 2JEBI 4JI2L 3UDGA 4LF7L 1LUZA 4IJHA 1CKNA 1VQJA 3U4VA 2D62A 1VHKA 1V9PA 1QZHA 3FP9A 1AH9A 4GN3B 1Q86C 1JB7A 4YQ6A 1SLJA 3OYYA 1XNQQ 1X3EA 4QGUA 3S1MH 2JQOA 1XNQL 3L2PA
chains in the Genus database with same CATH superfamily
3TDQA 3GTQH 1G2SA 1HR0L 5I2YA 2NYZD 2F0QA 3KF8B 3S1RB 1IPAA 1Z7TA 3L7ZC 1B3QA 4YCWA 4KY7A 2AUJD 2EJGC 5A2QE 3BYTB 2XVSA 2HIVA 4XDXA 1K8AC 2JA6H 3S1QH 4KTAA 3PUZA 4TKOB 1JWSD 2WAQE 3CMAA 4RGNA 3F2BA 2F0FA 1QG7A 1I4RA 3D6CA 2J0TD 3PO2H 5JJLA 4WFN3 3A0JA 1QVCA 4ALPA 1DYQA 3GTJH 1PFNA 4G4KA 1K83B 4YQAA 2V1CC 2NVXB 1E2VA 1SE2A 4DR4L 5C4ZA 2CCZA 3TN2A 4OWXB 1CUKA 1KD1C 5FJ8G 3OWFA 2OT2A 1I94L 4YQ4A 1SYBA 4KHPQ 5FLMG 1SE3A 2OQKA 5AFWA 2Z6KA 2JJQA 2ASBA 4JI3Q 4I7AA 2HQEA 1XX8A 3RZOH 2Q2UA 4YVIA 4IN3A 2PQEA 5AJ3L 1CM9A 4TSSA 1C9OA 3D31A 4I65A 2R7ZH 1TKWB 4A3GG 3CXCA 2ZJPA 1VQAA 3JAME 3NPPA 2F3WA 4YQCA 4IZ8A 3WWVA 1SXTA 2A8VA 1E3PA 1KAAA 5JAVA 4U68A 1KQSA 2CQAA 1T5EA 2K5VA 4A3EB 4RFBA 5IYCG 2JA9A 4A3GH 1TWGH 4DXGA 5IY0A 4NB3A 4MN3A 3N52A 1CTMA 1TWFH 5M3FG 1JOQA 1Y1WG 2XGTA 4A3MH 2KQ3A 1XPUA 1PTOH 1OO9B 2WB1G 2EZVA 4IOCA 3PIPA 4MCDA 1JWMD 3SVMA 2FFKB 4YQ0A 1KRSA 1BKBA 1FGUA 1PFBA 2WP8J 3BBEA 4GLXA 1HXYD 3RMHA 2Q2TA 1TY0A 1YHQA 4YPXA 4BBRB 2UXDQ 2R93B 5I9PA 3BVGA 2MJ8A 1YIJA 4J3CA 3PIOA 4HJ9A 4JI0Q 4A3LG 3MTSA 1D6EC 4L5QA 1I4XA 4DR1L 2HHHQ 5C4JB 4BBRH 2CX8A 3VDYA 3AFPA 3A54A 1J9OA 4KLKA 4U673 1FGBD 4QIWB 1WYDA 3QUVA 3KBXA 3D4RA 1HHVA 3EVQA 1I50H 1A2TA 1GVPA 3KW2A 1PTOD 1ZKOA 2NN6I 3TEHB 2XNAC 4IUPA 2CVRA 3CAMA 4A3GB 3S2DH 4IFDG 1OXVA 1S4ZA 1TY2A 2KEDA 3NP8A 5C0XG 4ABNA 4QQBX 2HIXA 3F2DA 4JI8Q 3M7NA 4DR7Q 1JE4A 4HN7A 4IUQA 2KECA 3EA6A 4DV1Q 3CD6A 4IPHA 1CSQA 3VR6A 5IWAQ 2CW0C 1S5BD 3FVQA 3U50C 3GTKB 1BCPB 4L8JA 1MHWC 5KNBA 3IFTA 3W3AA 5C0XH 2CHBD 1QUQA 4QUFA 5C3XA 1XXGA 2E74C 4GKJL 2Q8IB 3C3LA 3HEJA 1A3UA 1HA6A 3NTIA 4K8JA 3DM3A 2BE5D 1NS5A 3K5OA 1SNDA 1LYLA 5K36H 2K14A 5A2QL 2LKVA 3T4AC 1B8AA 2B2UC 3EN2A 5GROA 3X3MA 1SMXA 5FLXc 1I5FA 1LLRD 2K32A 4MCBA 2EYPA 4O2DA 2KCTA 3LWUA 1X3FA 1UAPA 4JI1Q 4X65L 2Z8LA 3NWSA 3JC66 5IT9L 2IHEA 1GUGA 3K5NA 2UUCL 3UE0A 3S15B 3BBHA 3NWTA 2IX1A 3HOYB 2BCOA 1I4HA 2IWHA 5LL6S 5BR8L 1O7ZA 4ZAIA 5G3LF 4HJ7A 2OF1A 4NW2A 3TZDA 2XTIA 1LTAD 2H1EA 3H0GB 1CZGA 1OXSC 1V1PB 2NVYB 4JCVE 3S1NH 3RLFA 2QDLA 3I4OA 3GV3A 3K8AA 4C1NI 2A73B 1A8VA 1DZ1A 3VYTA 3ITPA 5GMBA 2R92B 3BG3A 4Q5VA 3KK7A 4JI7L 3G7LA 5ELBA 3I4MH 3KLSX 1FNVA 5GM8A 2PQAA 2I5HA 4YQIA 2WFWA 1PTOC 1N34Q 1VMCA 5C44H 3S2DB 2JA8B 3KDFB 3TMEA 1QOHA 4JI6Q 1NY4A 2EQSA 3NHHA 4YVGA 4RG1A 5E4WC 4DR1Q 3MXNA 1A63A 1I50B 3G71A 1PFMA 5KYIA 1XJVA 2E5LL 4HEDA 1H9RA 3P1HA 5FLMH 3W2DA 5JPNC 5C3EB 3K59A 4GNXB 2JA8G 4IG6A 2BA1A 4YQSA 1SBBB 1N32Q 3A7LA 1PH5A 5L37A 1T5XD 2ZXPA 4IFDH 1SNPA 1PYBA 2UU9L 3M4OH 1YHAA 2PW5A 2EPBA 1B7YB 1GUSA 4WRDA 4BBSB 5ELFA 2KENA 4GOPC 2V3KA 3PO2G 5M9OA 3R8BA 2CKZB 4R4QA 1EY9A 1SAPA 1HNWL 4LFBQ 4DAPA 3I7FA 3OHXC 1QE6A 3Q0AA 1M8AA 4JW0A 4XYQA 1IBML 2CQOA 1ML0D 4NP5A 1TS3A 3RN5A 2B8FA 3N4KA 1EFWA 3ULLA 2O2LD 2L4NA 1HH2P 3ULPA 4POFA 1PRTC 2RCNA 4DXFA 1RF2D 2QWVA 1VQ7A 4JI4Q 1BOSA 1NUCA 4POGA 1K3BC 4OGQC 4A3KB 4JBKA 3SK8A 4A3JB 3HOVG 4YQOA 1X65A 4FDBA 5CV7A 1PH1A 2IHFA 1EYCA 3BZKA 5IODA 2HQLA 2MFIA 3K0YA 1XTDA 5IYBH 3S2HB 4DV3Q 2R7ZB 4MIUA 1BNZA 3NBHB 3K5MA 3DWQA 2MUYA 4FXGC 2MHVA 1IXRA 2B2YC 4BY7G 3R2IA 4LUOA 1JQYD 5DEHA 2PCFB 1QZGA 4NXML 3P7JA 1IW7C 1Y8PB 2Z6KC 1JOKA 1X32A 4BY1B 4QUCA 3WDNA 2SOBA 4CDCC 3S15H 2E75C 3GTJB 1STNA 2PZTA 5I6YA 3HP3A 3J7YW 4DK6C 1Q1EA 4QJFA 4KN7C 2B29A 3ONAB 3PUVA 1M1KC 1J6QA 3IEFA 1BBXC 5DAUA 2I5MX 2HCIA 2YTVA 4AYBE 1ZYRD 3K58A 4C3HH 2NZOA 2L11A 2Z6BA 5C6AA 4HIKA 3AFQA 2JA6B 3IAYA 3BDLA 5IT9c 2F0PA 2C5CA 1CQVA 1E24A 1L0WA 4R1JA 1TWHH 1HCZA 1STYA 4BA2I 5IP9G 2EIFA 3SEBA 4FYDA 2IJ0A 2CWAA 3F2CA 4JV5Q 2Z0YA 4JVZA 1U4MA 4YVKA 3OINA 1CT1D 1U4RA 4C3IB 5IGEA 1Y1WB 4X3MA 1JORA 2D2CC 5M5WH 1UWVA 3AIAA 4KKTA 4L5TA 2E76C 2A69C 4PZ6A 1DCZA 2CWPA 1I6HB 2B39A 3I91A 3NEMA 1RJTA 3D6WA 2RKSA 3SHLA 4PZKA 4DUYQ 4A3KH 1JE5A 2HD3A 1IBKL 1N9WA 5KYLA 1ESFA 1IZ6A 4APVA 4J1MA 3SE0A 3MA2B 4DR7L 4RKBA 4E6IA 1X55A 5IE8A 4C2MH 4BXXG 4YIJA 2HDMA 5EKIA 5M5XH 5LMNQ 1BXTA 3T1HL 3TP8A 4JWFA 1TWCB 3M4PA 4LFAQ 3J80i 3VR3A 1A3TA 1AH9A 2F0NA 2A69D 3PIP3 3G6JB 2IW3A 4GZYC 4DAVA 2QF7A 1VCIA 4GNXC 2R93H 4GKKL 1HZ9A 2E2DC 3HGBA 3HKZB 4P75A 3U4ZA 4M8AA 4KN4C 3JAML 2E2HH 4HJ8A 4JI8L 4A3JG 1NAPA 4FXDA 1EQRA 5M3FH 5CMDA 4IPDA 1Y8NB 3AQQA 3V05A 5C44G 1TWAB 1HUMA 4YWMA 2JN4A 1PZJD 3ND8A 1VQGA 4K14A 4JWHA 2QW7A 3AU7A 4JAKA 3HOVB 4GOPA 2JA5G 1WTRA 4P71A 3G6EA 4A3EH 3H6MA 4LUVA 2IY5B 1KIXA 3KYHC 4X62L 1VQ6A 1YEZA 5CYUA 4A3CG 4LF9L 4PMBA 4A3MG 1TS4A 2UUAQ 2A1AA 2L0CA 2XSCA 4BA1I 2YU9B 2XRQD 1JT8A 4YQ1A 3PO3G 3C2PA 1Y14B 4DUYL 5C5LA 3HOVH 1P9PA 4MZ9A 5EJWA 3CW2C 2ZM6Q 1EQQA 1SYEA 1WVLA 1FJGQ 2DUDA 4P73A 3CCQA 3D4DA 1HRJA 1L1OA 1X3QA 4ZK9B 3HOZB 3GTOH 4DR6L 4NKLA 2D0OA 5D14A 2ZXRA 4IALA 3CF5A 4CBVA 1ILPA 2BDNA 2JK8A 3HOXH 3B6YA 2QMMA 4GNXA 4LNQA 3K7AH 1TWHB 4DAYB 2MO1A 4UY8C 1STHA 5CORA 4LFCQ 1JJCB 1AZPA 1E22A 4LF6Q 1D8LA 3A5UA 2PZWA 3BDOA 1MD2D 1IKLA 3W1BA 4X66L 1U4PA 3CQZB 4RA8A 4PG3A 2KVMA 5ELDA 1LTID 5CV4A 2CH4A 4K5VA 1BUVT 2SNMA 4C2MB 4B3RQ 1SN8A 4IFDJ 4N8X1 1BQQT 2L55A 4GN5A 4JI1L 4X65Q 2OCEA 2WAQG 4FNFA 4BY1H 3OIJA 1WTQA 4YHHQ 4OX9Q 2UXBQ 1YNXA 3NTKA 1V8QA 4YHHL 4OX9L 3CRKC 1SRUA 1D7QA 4MTKA 2XRSD 1SNOA 1S3OA 2ATWA 4OELB 1LTTD 2F0MA 2WAQB 4X62Q 4KJNA 4HAEA 1R9TH 1SFOB 5GADC 1JOOA 1N36L 1A6XA 1EZ8A 1EIFA 2R61A 2IT1A 4Z9CB 2SEBD 1FVIA 3KFUA 1WI5A 3QWNA 4KHZA 1Q3LA 3MFYA 1KLUD 1Z47A 2LXKA 1Q1BA 2BA0A 4XT1B 4ZLTF 1IYUA 2VZAA 1FJGL 3HOUB 1AN8A 4HTHA 4AIMA 4GOPB 1LO5D 1WTHA 2RCFA 5K5PA 3I4NH 5GQOA 1LV9A 3H15A 3CQZH 5KNDA 4QF4A 4EVOA 4OO1H 1L1OC 1ET6A 1X6OA 3NUCA 1PH2A 2JP1A 2B2TC 2NUCA 1QNUA 4C3HG 3QOJA 4EX5A 1EY8A 3FMCA 1GHKA 4G7ZC 2F0TA 3J80c 3E5YA 5IP7G 1M4VA 3BYYB 3GD7A 1TVXA 1OXXK 2AQ2B 1Q81C 2UUBL 2EYFA 4JG2A 3J80L 1PZID 2F0UA 2QCPX 2KCNA 4RHRA 2F03A 3T56B 4JC0A 1STBA 1QB5D 5EBDA 5LL6X 5IYDH 3GTLB 4P72A 4OO1I 3SK5A 3CU7A 3ND9A 1Q12A 4MNOA 2RDFA 1KLGD 3KLRA 2IX3A 1S72A 5K36G 1AFPA 3EBEA 3ERSX 4OIKA 3AI9X 4IO9A 4A75A 5FO9B 3DEPA 4DFAA 1KNEA 1PYSB 5M3MH 4K0KL 4E8BA 2WV6D 1ESRA 2AHOB 2VQEQ 2DN8A 1G2TA 3PF4A 1JICA 3PUXA 1EIYB 2HA8A 5C0XJ 1E2WA 3GTPB 2OTJA 4CJ1B 3SR1A 4A3DH 5ELOA 4K8IA 5GAEC 1UUPA 3J7AF 2YYZA 3RD4A 1Y69U 3JAMi 3I8ZA 5J3BA 1E1OA 1ASYA 1K8OA 2D9UA 3UE1A 1EWIA 2CH4W 2MP1A 4GKKQ 1MGSA 3CCMA 2UXCQ 3KF6A 3S17B 1BF4A 4LF4Q 3KJOA 3MXGA 2EYHA 2NWGA 1NMGA 2L5TA 3AMUA 4B3RL 1A0IA 3S1NB 1GKHA 1B1ZA 3HS0C 1PH8A 3CCLA 2FHTA 2VL6A 1IL8A 2JA6G 1B4OA 1ENCA 1LACA 1MJEA 1MKHA 2K28A 4TRDA 4BBSH 2V3JA 5D3IB 4B08A 4K6LA 3IRBA 2KA7A 3HOYG 3LNNA 3NSWA 4AQYL 1SMYD 5JJIA 1I94Q 4RCNA 2N78A 2PW7A 4H02A 1H9JA 3RN2A 1VQHA 1KAWA 3DEOA 1PXUA 5EPLA 4DV4L 2UU9Q 1N36Q 3R2TA 1RIPA 4IJLA 3N4JA 3K7AB 1BCPC 5KIXA 3H3VI 1Y1VH 1ICFB 3QG1A 5KEEA 2G5DA 3K80C 1KDCA 4RAUC 1YNJC 1DD2A 2MGSA 3HOZH 3NXWA 1I6HH 3KOJA 5LMNW 1N33L 4DV1L 5NUCA 3FEWX 1LABA 1S5FD 3FRPB 3RLNA 2RSOA 4F8MA 2R6GA 1V2XA 1VQNA 4YQ5A 4GKJQ 3NBIA 2L9HA 1G8ZD 1PA6A 3H3VH 5FOBB 1PFSA 4EGVA 2NVYH 1Z6HA 2Y0SE 3UI2A 2ZT9C 5FAIA 2A68D 2A74C 1EYAA 1PRTB 1C48A 1CI3M 4XBOA 1A3VA 4H7BA 4HR7B 2B63H 1MJCA 4C3HB 2AKWB 2RVLA 2NZ1D 4CHTB 1Q8IA 2BDOA 3CCRA 4N9TA 3F1ZA 3KF6B 3K7UC 1O7IA 4R9WA 2F0KA 5CV9A 3CCSA 2N3SA 1PH7A 2PZUA 2F1MA 5KRUA 2E2IB 4R8IA 5M3FB 1F9QA 1OTCA 1STEA 4RWSC 5CO4A 2LS01 4LK1C 1Q8KA 4LW1A 2MPMA 2GA4B 1KHIA 2VB3X 2J7ZA 5FO8B 1L0XB 1SJHD 2C9OA 5D9FA 3ULJA 2A6EC 3VA5A 1B53A 4YQRA 3I4NG 4ZYSA 5C4XG 3M4OB 3S24A 3W5OA 1H95A 1TWCH 1W3SA 3IKJA 1HR0Q 1QVGA 1X3PA 4HSPA 3HRZC 1RTNA 5JVG3 4ZCKA 2MNAA 4LF4L 1DOMA 2WB1E 2F52A 1B3AA 5IGGA 1PH4A 4DV0L 3RLOA 2LXJA 4YQPA 4DV0Q 3A74A 1RKNA 4X3TA 4GLAC 3DUZA 2E2JB 1HNXL 5I9OA 3VYUA 1TO0A 5C44B 4WJ4A 1J5EL 1GUOA 3FKIG 1XNRL 2K5DA 1GUWA 1YHBA 5DLQE 4XQJA 5M5WB 1GO3E 2X6LA 4R4IA 3OWEB 3KUPA 4L69A 1AW7A 3FKIH 4A3IB 3NENA 2PI2E 4ODGA 4NXNL 4O42A 3GTMB 1G291 4KHPL 4A93G 1XTCD 4DGZA 1UALA 4FVMA 1RDPD 1QILA 3VR2A 4R4TA 3D8GA 1WJJA 1ENFA 1LTLA 2LFNA 4A3BH 5I2XA 2K1BA 4F7XA 4KV6A 1MSGA 2ES2A 2VUMH 1CFMA 2R3ZA 4OXPA 1S40A 1F9RA 3K0XA 3TSSA 4C3JH 3PUWA 4Y7NH 1Z85A 5F2DA 4EQ5A 1SNCA 5HGQA 4R4OA 2Z1CA 5LHY1 2RDHA 4DUZQ 1NTGA 1ICWA 1ZYRC 3UDGA 3NK9A 1VQJA 4WORA 2L1BA 3U4VA 1SLJA 3OYYA 1X3EA 1ZEQX 2JQOA 3L2PA 1TWFB 3M9BA 3MEFA 1R4PB 1HTPA 1Y8OB 3CRLC 4X66Q 1B9MA 1WTOA 3HKSA 2XWJB 3S1RH 1OXUA 2YV5A 4IOAA 3DMUA 3KLWA 3V2TA 1TU2B 1FNWA 1XMQQ 2AUKA 3GDEA 4C3IH 5JEAG 3AXZA 1K8GA 1E0BA 2OWOA 2B2YA 4ME3A 3K6OA 5COYA 3PMFA 3E9IA 4DU9A 3HOWH 3DWAA 4X3LA 3K57A 1MXIA 1WOCA 1CZWA 2NTSA 3NELA 4K2KA 5CBEE 3F8TA 1O80A 3PSIA 2K03A 3C1EA 1F2YA 2AQ3B 1L2FA 1KRTA 4YCUA 5D3DA 1EEID 3QIAA 3NQIA 4DV4Q 3H09A 2DY7A 4PZ7A 1PV4A 4YQ2A 1SJED 2EGWA 3KY7A 3P20A 1WTPA 2F4VL 5FJ8H 3QJYA 2TSSA 1IHZA 3CCEA 3J7AV 3Q23A 4G7HC 4YVJA 1MSHA 2DJFC 3F2UA 5IT9E 5IP7H 5JJZA 1SE8A 1C7YA 1SNMA 3S14H 4K0KQ 2EY6A 5FLXL 3P75A 2ID0A 1F2ZA 2M00A 1LTRD 4KJOA 2O5IC 1L1OB 1U0LA 3T1YL 4IUVA 3TZUA 4IPCA 4YQJA 1S5CD 1XPOA 1U5KA 5IOCA 4LF7Q 1TR5A 1Q46A 5E3FA 4LF5Q 1BO0A 2A6ED 1I6VC 4J8QA 4YQ3A 3STBD 1D1IA 1XNRQ 1WD1A 1IBLQ 1EQVA 1D5ZC 4LFCL 1C4QA 1B70B 1LT3D 1WFQA 2Q2IA 1VQFA 4CNDA 1HZCA 2PMZB 3IFDA 2K04A 4NXNQ 2EGVA 3HFZB 2Z9HA 2UXCL 4A3MB 1KXLA 1S5DD 4A3FG 2EYLA 1A62A 4XTCS 5IWAL 1RL2A 3FPUB 2UXDL 4WJ3M 3A5ZB 1GZ0A 2EYOA 4A3DB 4YQTA 3GTPH 1UE5A 1UE7A 1EQTA 2UXBL 1VQKA 1DJRD 2ZJRA 4JV5L 1HNZL 1TWAH 1QVFA 3JAMc 3HZXA 3EQLC 4A3DG 1JCKB 4QIWE 3AEVA 3TS2A 4L5SA 4C1NK 1SYCA 1TS2A 4JI3L 4RGMA 2I46A 3MFGA 2VNUD 1E7ZA 1PH3A 4RGTA 3L0OA 2BE5C 1SR3A 3D3RA 1I4PA 1JB3A 2A6HC 1BDOA 1HNWQ 2K4KA 1I3QH 2WB1B 3GO5A 1TT2A 5DM63 1UNSA 3FPPA 1SE4A 3TP7A 3J81j 1XMQL 4B3ML 3S14B 4FAKA 4OWWB 3T1YQ 2BOSA 1N33Q 1PH6A 1WCMG 5M5XB 2NTTA 2V4DA 3CKIB 3QR8A 2K33A 1NSNS 4B9WA 3OMGA 3FHWA 3R3OA 1EYGA 1VQ5A 5CV5A 1O7YA 3ICEA 2F0WA 2NN6G 4YQ8A 4UHVA 3Q8DA 4NDXA 2F0OA 3ZYYX 2JXMB 2E5LQ 4Q0FA 5FKAC 4DK3C 1PTOF 5EPJA 3U9OA 5EGTA 4K2LA 2JA7G 4PQXA 1SEBD 1KC8C 3HOUH 3MHBA 1F9SA 2EXDA 1TS5A 2R92H 1IL2A 1CHQD 1K28A 1RODA 1EY7A 1JMCA 5M5YH 5FK9C 4YY3Q 4YPZA 1PMRA 4QCLA 1EWCA 3TQYA 3S2HH 1CHPD 3GTKH 2M9VA 3H0GH 4P74A 2UUCQ 5TSSA 3MAQA 3RZOB 1NR4A 3BZDB 4KY6A 2VQFL 2F0GA 3NK6A 3FDTA 1C0AA 4FO2A 3J81E 3L3OC 2EJMA 3MXNB 3HOYH 4AYBG 2N88A 2NVXH 3GYQA 3MZ5A 1VQLA 3A7AB 2ZTCA 2F4VQ 2QILA 2FMCA 2PO4A 4B3SL 5D65A 3R93A 4XT3B 5C5MA 4JI5L 2R92G 4DV7L 2DNCA 2KCMA 3PO2B 2PQAB 2QKIC 4L6TB 4KD4A 5C3WA 2F0DA 3NQTA 4LAAA 1T9HA 4EQPA 1BR9A 1PVOA 4ZUIA 4CJ0B 3J81c 2O4XA 1I4QA 3S1QB 1K73C 1HA5A 3I2ZA 4B9XA 4DV3L 3M4QA 3MC0B 4QY7A 4YY3L 2QDBA 2AQ1B 1DOLA 1D5MC 1YJNA 4YQNA 1J5EQ 2A6HD 3HOXB 4PMCA 3S9WA 3S16H 5IGFA 2HHHL 1STGA 1VF7A 1AE2A 2F3VA 4YQGA 2NBFA 2F0EA 2XIWA 4JK1C 3VR4A 4G57A 2QA4A 4DV5Q 1SSOA 2HT1A 1PYWD 1B50A 3URYA 5JOBA 1AEXA 1NR2A 2EY1A 2K5WA 1GJXA 1XWEA 3EFXD 1YITA 2KHSA 2FINB 2I5LX 1EU4A 2TMPA 1KNAA 1ET9A 1VS0A 2F0LA 4YQ7A 3H91A 4DPGA 3A55A 4YQLA 5IIFA 3ERQA 1Q7YC 2PNHA 1D5XC 3BVMA 2VXWA 1JJGA 4CDDC 4B3TL 1ZJRA 4C3IG 2I6DA 1IYVA 3KBGA 5C4XB 1RHPA 1AE3A 3OPOA 1G6PA 4C56C 4DR5L 3NK7A 5GAHC 4DR5Q 1HFGA 5LMNL 3T1HQ 2ZXOA 1O6DA 3WOEA 3E0EA 4YVHA 1K8MA 2WKCA 4KK7A 5GAGC 4FP5D 4JWJA 1GM5A 3CPWA 4LF5L 3S16B 3CCJA 1SROA 2DJGC 4DAMA 4XQQA 4JI4L 2NVTH 4EQNA 3BZCA 4A3FH 4YQBA 4DR4Q 2SDFA 1NXZA 4FXKC 1B44D 4LUZA 4YPWA 4IQZA 1N32L 3I55A 1PH9A 1DOKA 3SXHA 2O5JC 1TIID 3SGIA 4JALA 4H3ZA 2F0IA 4JPBW 1HPCA 2E2IH 4DV6Q 2ALYB 2KJXA 4H0LC 1NCVA 1OY5A 1EOVA 4KD3A 1HNXQ 4XQNA 1OXTA 3D4WA 4QL5A 2OTLA 1LTBD 3H0GG 2B63B 1FYCA 3BJUA 4DAYA 1VF5C 2OXPA 4YWLA 2GN5A 1NNXA 1SYFA 2OEOA 2B2WA 4DK0A 5CV6A 1HQRD 2ZJQA 1BVSA 2ZTDA 4PV1C 4JBWA 3J7ZC 4A76A 2JYOA 4CKCA 2LY7A 5M5YB 2K52A 1QCBD 1SFOH 1EFID 4M1UB 4HJ5A 1R9TB 3MXUA 3NTHA 2EVBA 4OONA 2JE6I 5A35A 3A8KE 2KUMA 1K3RA 4PMWA 1SDFA 1A2UA 1W2BA 1CA6A 4TVAB 3DCMX 1EY6A 4LF8Q 5ELCA 2VY3A 1PDQA 3RR5A 1QJOA 3ILKA 5KGUA 1VQPA 1K83H 1PHJA 2KBNA 3GV6A 2NVQB 1LM0A 1P16A 1NBWA 2FXQA 5J39A 1RTOA 2B8GA 2F0JA 5IGDA 4H3YA 4R8NA 4LF6L 3HOXG 1ASZA 3H94A 2VW9A 3OIPA 3HKZG 1EZ6A 2G9HD 3GTGB 1YJWA 1V1PA 4LF9Q 4A3LH 2PPBC 4Y7NB 3M3YH 2I07B 3OIQA 3EJIA 5EBCA 2F3IA 4MCCA 4ZQ3A 4KKSA 4H13C 2NN6H 2X6GA 1YBYA 1MBYA 3LGJA 4DV6L 5IGBA 1VDZA 4J6HA 1VQ8A 5CC4A 2ZM6L 4G7OC 2EY2A 2B3GA 1O7LA 2DY8A 1K9MC 3PGZA 1EY4A 1WCMH 3ER0A 2B63G 4FF3A 4OO1G 5C4HA 4B3MQ 1H9SB 1G6ZA 1ZXTA 4DNTB 2B2WC 4A3IH 1H9MA 4YQQA 5I4DA 1PTOB 1VQMA 4C3JG 2D0PA 3GTMH 2YTYA 2H4OA 5EQ0A 1ILQA 3S17H 4JI2L 3W1GA 3G4SA 1K0SA 1VQCA 3M4YA 4EQOA 4CKEA 4IJHA 1CKNA 4OHJA 1L0YB 2D62A 1V9PA 1QZHA 3FP9A 1Q86C 2KEEA 2L12A 2E2JH 4FMWA 2Y0SG 2O3AA 4RH6A 3HKZE 3DWPA 2WINB 5IYDG 1UE1A 3K81C 1HUNA 4HMJA 3X3NA 1HJPA 3H3VC 1S5ED 2VS1A 4A3JH 2L15A 2NB0A 1W6JA 1ONLA 5EPKA 3CCVA 3U58A 3OTOL 3DLLA 3BS1A 4LWCA 2RHQB 1NMFA 1N34L 1PRTD 1VMPA 4OL7A 5C4JH 3LWEA 2IL8A 1JWUD 1DGSA 3J81i 3TS0A 1C8CA 5FO7B 1NJIC 4CNGA 4ZKCB 3N6RA 3VYSA 1SYGA 1XPRA 2A5HA 2ICEC 4JWGA 2VQEL 3OSOA 5HURA 1CKOA 3J7A5 2B2UA 2ZTEA 4LJZC 4UAIA 1LTSD 4DV5L 1VQIA 4XIGS 4LFAL 4MHEA 1EIGA 2AMCB 1XYIA 5T1GA 2KHJA 2PNRC 2R7DA 4DNIA 2N49A 3SDZA 4IFDI 4DR3Q 4JBMA 4JI0L 4ZKBB 3M3YB 5BN3A 1X7PA 3PO3B 3I73A 1A15A 2Z4HA 3I4NB 1JJ2A 3Q6SA 4X6AH 3M85A 1O78A 2X69A 4UPAA 1VQOA 3DHQA 2EYJA 1XMOQ 1LT5D 1HFNA 1CSPA 3BU2A 1QNKA 3T51B 3V96A 4F88A 1V6ZA 4JI2Q 4LMQD 4KMUC 1V43A 1GXDC 2EDGA 4RMFA 3A8IE 1EU3A 2EOTA 4S3SA 3HOWB 2K50A 4L63B 4A4IA 1G91A 2P5ZX 3I3CA 1J85A 1EUJA 3STBC 4X64L 4PNYA 1D1KA 4GN4B 4X64Q 5KNCA 4KDZA 1HR0W 4X3KA 3PQIA 3RNUA 2I0QA 1YNND 5E7NA 5BN4A 4A3KG 2IPKD 3QOLA 3E9HA 2G9DA 3K5LA 1CKMA 5E1FA 1N8RC 3OIIA 4HCEA 2CFMA 1F9PA 1YNJD 5AJ3Q 4A3IG 4GLVB 1BCPD 3T13A 4DR3L 1X9NA 1VHYA 3TP5A 1VQEA 5DM73 3J80E 1JR0D 1FR3A 4CDEC 5I6WA 5JEAH 1KDBA 5EAYA 1RD9D 3VA7A 4DV2Q 2VQFQ 1FD7D 1G51A 1KL9A 3DXJC 1UAMA 1GOZA 2FMMA 1V1OA 4RHSA 4DR2L 1EL0A 2EYMA 3MEHA 3GTGH 4C3JB 4BY7H 3E0JA 2R93G 4YPYA 4WJWA 4JOIC 3ONPA 3GTQB 4FF4A 4GS3A 5CV8A 3KJPA 1UAKA 2RA4A 2XWBB 4A3BB 2NVQH 4ZUJA 2KHIA 3OOCA 2BH2A 3GTOB 2A68C 2K5NA 1AZQA 3O7BA 2JA5B 1EY0A 3OW7A 2HDLA 3ZJYC 1DM0B 3FKIB 4IUTA 1XMOL 4DR6Q 3KLSA 2NVTB 3IC6A 1WTWA 4LF8L 1II3A 4CNEA 4X3UA 4YQDA 5E4XA 2HUGA 2Z0SA 1M90C 2K5QA 4DK1A 5JJKA 4Y52H 3L9AX 2HCCA 3TREA 2DGYA 4KGNA 4CKBA 3MVVA 5G3LD 4P2CB 3EIVA 1DXMA 2A19A 4O0AA 4CNFA 1SYDA 4OWTB 3BVZA 1GUNA 4DNRB 1K0RA 2R7ZG 3KNUA 1GD7A 3RZDB 1Z9FA 1HTLD 1U4LA 5C4XH 1B9NA 2E8GA 4HMIA 3J81L 4IURA 2YY8A 1YZ6A 2DNEA 3QB3A 3HOUG 2LSSA 3CHBD 1GUTA 4YQKA 5DNFA 2IX0A 3C46A 5ISRA 4LFBL 5IP9H 1IBKQ 1ENAA 1Q82C 3GTLH 3C1FA 1J8IA 3E3XA 1YNNC 2EXZA 2K7VA 1IBMQ 2D5DA 4K6DA 5CR3A 4JBJA 3GQBA 2MQHA 5M3MG 4JOIA 2AWNA 4CJ2C 1WCMB 1B2TA 2E2HB 1D2BA 1R4QB 3E6ZX 4JYAQ 3A56A 4DR2Q 1PZKD 1KABA 5LMUL 2RSNA 3RUZA 1IBLL 4A3FB 4BY7B 4ILWA 3LX0A 2CW0D 4B3SQ 1RCVD 4ULLA 2RF4A 2SNSA 4I7ZC 5C0XI 2Q2HA 2JA7B 4O1NA 1PRTF 3CPFA 2LMCB 2AWOA 3NE5B 3CP0A 5J22A 1JC7A 2RDGA 2C35B 1PLFA 3U9SA 1CA5A 1HQMC 2EY5A 2F0HA 3PUYA 2YTXA 4HIDA 3RZDH 3E5SA 4MTNA 4NPSA 1SNQA 5EKLA 3TRZA 4JI6L 3O13A 3CMEA 1VQ9A 2JA8H 1GHJA 1TWGB 3NBHA 3MWYW 3OW2A 4CDFC 4KKUA 4L5RC 2K5HA 2KCCA 3HOZG 4DKAC 4K5WA 2B2TA 3BDCA 1WTVA 1H9SA 3KTYA 4A3EG 1Y1VG 1VQ4A 4KY5A 4TQUS 1I4GA 3Q24A 1TXYA 3TBIB 4F87A 1X56A 2RBMA 1UAJA 4ID6A 4DV7Q 1Y1VB 1HZBA 2H5XA 4ZRZA 4BBSG 2EJFC 3HG9A 4V190 2VUMG 1X54A 1FL0A 1VQDA 3I90A 4NXMQ 3PV0A 2Q8TA 2ENBA 5BR8Q 4BY1G 3VYRA 3I4LA 4HJAA 4JYAL 1E2ZA 1QWYA 1CKNB 2WIIB 2VUMB 2B2VC 2QGQA 3IL8A 5CGKA 3MXPA 1MI2A 1UEAB 2F0VA 1IKMA 5CBAE 2K05A 2PMZE 3D0FA 4AQYQ 2JEAI 1LTGD 2Q8RE 1CK1A 4UP7A 4HCSA 3OMCA 1YVCA 2F0SA 1I3QB 4BXXH 1UE6A 4IUNA 2NZHA 4PZ8A 1BBUA 4DA2A 3I56A 3PCOB 4IPGA 5ELNA 3S1MB 1HZAA 2ICIA 3KF8A 4DN4M 3M7GA 4CGYB 2F4IA 3CC4A 1LT6D 4UP9A 5HY6A 3SK6A 4FF1A 1F2LA 4KI0A 3CC7A 2YU9H 2XN9C 4XXEA 1V1QA 4OIJA 4YWKA 2Z4IA 5JEAJ 5BN5A 3HOWG 1YJ9A 1IYJB 4OEMB 3I4MG 3L8UA 2PI2A 3UDIA 4RKLA 5T1IA 4XYOA 5FLXE 1QUQB 4HIMA 1BCPF 1W6KA 3CCUA 1IW7D 3G48A 4H44C 1WTXA 5M3MB 2BH8A 2RQXA 4NMZA 3VR5A 4K5XA 2KOLA 4BBRG 3PO3H 2UUAL 1X3GA 3DM1A 2JA7H 3Q22A 1AP0A 5H1SE 1TQOA 2GVAA 4R4CA 3I72A 3GP7A 3PF5A 4A93B 1VH0A 1Q90A 1STAA 4V0BA 4HSVA 4B3TQ 1WD0A 4KHVA 4A3CH 4QMGA 3EROA 4UDUC 4HIOA 1E1TA 3BBDA 3SK4A 4JI7Q 1EWHA 2RHSB 1BBWA 2QEJC 2OQ0A 3OTOQ 1P8LA 2R7FA 4DUZL 3UDFA 2QEXA 2WACA 2J4XA 4QB4A 2JSOA 5C3EG 1KDAA 4N8FA 1EEFD 1EIHA 1F77A 5LMUQ 3I70A 2N8NA 2K75A 1EYDA 4DF7A 1HNZQ 3T53B 2B2VA 4JI5Q 4ME5A 1KTKA 2UUBQ 2EE1A 4A3BG 5C3EH 4AH6A 3PIO3 2GVBA 1YI2A 2MO0A 1VQBA 2K01A 3CC2A 1MIUA 1NE3A 2K6AA 4A93H 3T16A 5ELEA 1U9RA 5J1ZA 4YQ9A 1F2MA 1X7OA 2N55A 3WOFA 2VB2X 5GMCA 1EOTA 4X3SA 2Y0SB 5HGTA 4FF2A 1UEBA 5JPMC 1Y1WH 5IYBG 3I4MB 2PYKA 4DV2L 3KDFA 4IUUA 4J15A 1DONA 3UDXA 4AYBB 1EY5A 3QO2A 4BWGB 4BS9A 4N9PA 3A8JE 3TP6A 5IYCH 4YCVA 2M2LA 1FNUA 3AYHB 4RGOS 2JA5H 4UP8A 4LF7L 1LT4D 1H9KA 2JEBI 1LUZA 1SMYC 5JVH3 2FJ2A 1VHKA 4RCOA 1CQFA 4GN3B 5IGCA 1JB7A 4YQ6A 1XNQQ 4QGUA 3S1MH 5EKKA 1XNQL 2WKDA 3AB9A
chains in the Genus database with same CATH topology
2Y0SG 3M9BA 3MEFA 3GTQH 2O3AA 3HKZE 1VCIA 4GNXC 2R93H 1HR0L 4GKKL 1HZ9A 4P75A 4X66Q 5IYDG 3U4ZA 3KF8B 1IPAA 1UE1A 3L7ZC 3HKSA 2E2HH 4YCWA 3K81C 4JI8L 4HJ8A 4A3JG 3S1RH 1K8AC 2JA6H 1OXUA 2HIVA 2YV5A 3S1QH 1EQRA 3KLWA 5M3FH 1HJPA 4IOAA 3PUZA 2VS1A 4IPDA 3AQQA 1XMQQ 4A3JH 2WAQE 2L15A 3GDEA 4C3IH 5JEAG 5C44G 3AXZA 3CMAA 3F2BA 3CCVA 3U58A 1K8GA 3OTOL 4YWMA 3DLLA 4LWCA 2RHQB 1NMFA 1N34L 2OWOA 1VQGA 4JWHA 5C4JH 4ME3A 3J81i 1DGSA 3TS0A 3PO2H 5JJLA 1NJIC 3A0JA 1QVCA 4JAKA 4ALPA 3E9IA 3HOWH 4CNGA 3GTJH 4X3LA 1MXIA 3OIJA 1WOCA 4GOPA 1XPRA 2JA5G 4JWGA 4YQAA 3NELA 2VQEL 2V1CC 3F8TA 4P71A 3PSIA 3G6EA 4DR4L 4A3EH 2CCZA 4LUVA 2IY5B 1CKOA 3J7A5 1KIXA 2ZTEA 3KYHC 1CUKA 4OWXB 4X62L 1L2FA 1KRTA 4YCUA 5FJ8G 4DV5L 1KD1C 1I94L 1VQ6A 1VQIA 1YEZA 4A3CG 4KHPQ 4YQ4A 5FLMG 4XIGS 2OQKA 4LFAL 4DV4Q 4LF9L 2Z6KA 4A3MG 2JJQA 4PZ7A 1PV4A 2ASBA 4JI3Q 2AMCB 2UUAQ 2A1AA 2EGWA 3KY7A 4YQ2A 2F4VL 4BA1I 3RZOH 5FJ8H 2Q2UA 2KHJA 1JT8A 4YQ1A 4YVIA 3CCEA 2R7DA 4DNIA 3PO3G 5AJ3L 2N49A 1Y14B 4DUYL 4IFDI 4DR3Q 3HOVH 1P9PA 4MZ9A 1C9OA 3D31A 4JBMA 4JI0L 4YVJA 2R7ZH 4A3GG 3CW2C 5IP7H 2ZM6Q 3CXCA 1EQQA 1SE8A 2ZJPA 1FJGQ 2DUDA 1X7PA 1VQAA 4P73A 3CCQA 1C7YA 3S14H 4YQCA 4K0KQ 1JJ2A 3WWVA 4X6AH 1L1OA 2ID0A 3M85A 4UPAA 1VQOA 2A8VA 3GTOH 4DR6L 1E3PA 1L1OB 1U0LA 2D0OA 3T1YL 1XMOQ 1KQSA 3CF5A 4IPCA 1CSPA 2K5VA 3BU2A 4YQJA 1XPOA 1U5KA 4LF7Q 1V6ZA 5IYCG 4A3GH 2JA9A 1Q46A 1TWGH 2JK8A 3B6YA 4JI2Q 5IY0A 3HOXH 4NB3A 4GNXA 4LF5Q 1V43A 4LNQA 3K7AH 2QMMA 4RMFA 4YQ3A 3STBD 1XNRQ 4DAYB 1TWFH 2K50A 2MO1A 5M3FG 1IBLQ 4UY8C 4LFCQ 1JJCB 4A4IA 1Y1WG 2XGTA 1E22A 4LFCL 4LF6Q 1D8LA 1J85A 1B70B 1EUJA 3STBC 4A3MH 4X64L 1WFQA 3A5UA 4GN4B 1XPUA 4X64Q 2Q2IA 1VQFA 2WB1G 4CNDA 1HZCA 4IOCA 1HR0W 3PIPA 4KDZA 4MCDA 3W1BA 4X66L 3RNUA 4NXNQ 4YQ0A 1KRSA 1BKBA 2I0QA 2EGVA 1FGUA 2WP8J 5E7NA 4A3KG 3HFZB 2UXCL 4GLXA 3BBEA 3E9HA 4PG3A 1KXLA 1CKMA 1N8RC 4A3FG 3OIIA 2Q2TA 1YHQA 1A62A 2CFMA 4XTCS 5IWAL 4YPXA 2UXDQ 1RL2A 4B3RQ 1SN8A 4IFDJ 2UXDL 5AJ3Q 4A3IG 4GLVB 1YIJA 4J3CA 4GN5A 4JI1L 4X65Q 4DR3L 3PIOA 4HJ9A 1X9NA 4JI0Q 4WJ3M 3A5ZB 4A3LG 1GZ0A 2WAQG 2OCEA 1VHYA 1VQEA 4YQTA 3GTPH 1UE5A 4L5QA 4DR1L 4BY1H 1UE7A 2HHHQ 5EAYA 2UXBL 4BBRH 1VQKA 4YHHQ 4OX9Q 2CX8A 2UXBQ 1YNXA 3VDYA 4YHHL 2ZJRA 4DV2Q 4OX9L 3AFPA 2VQFQ 1G51A 1HNZL 4JV5L 1TWAH 1SRUA 4KLKA 1D7QA 1KL9A 3JAMc 1QVFA 1S3OA 1WYDA 2ATWA 3QUVA 4A3DG 3TS2A 4QIWE 4X62Q 3AEVA 1UAMA 4L5SA 4DR2L 3GTGH 1R9TH 5GADC 4JI3L 4BY7H 2R93G 1I50H 1N36L 4YPYA 1GVPA 4JOIC 1E7ZA 1EIFA 1PH3A 2VNUD 3KW2A 2IT1A 3L0OA 3ONPA 2NN6I 1FVIA 3TEHB 4GS3A 1SR3A 3KFUA 3KJPA 1WI5A 3CAMA 4KHZA 3S2DH 1UAKA 4IFDG 1Z85A 1Z47A 1OXVA 2LXKA 2NVQH 1Q1BA 2BA0A 5C0XG 1HNWQ 2K4KA 2KHIA 1I3QH 4QQBX 2HIXA 3F2DA 3GO5A 2VZAA 4JI8Q 2BH2A 3M7NA 4DR7Q 1FJGL 2K5NA 3O7BA 1XMQL 3J81j 4B3ML 4AIMA 4DV1Q 4GOPB 3CD6A 4IPHA 4FAKA 3ZJYC 4OWWB 3I4NH 3T1YQ 1CSQA 5GQOA 5IWAQ 3H15A 1WCMG 1XMOL 1PH6A 3CQZH 3U50C 1N33Q 4DR6Q 3IC6A 4LF8L 4CNEA 1L1OC 1X6OA 4YQDA 1PH2A 2Z0SA 3FHWA 1M90C 1EYGA 1VQ5A 1QUQA 3ICEA 4EX5A 4GKJL 2NN6G 4Y52H 5JJKA 4YQ8A 3Q8DA 3TREA 2DGYA 4KGNA 2E5LQ 3J80c 3E5YA 3DM3A 3EIVA 4O0AA 2A19A 4DK3C 4CNFA 4OWTB 1NS5A 5IP7G 1LYLA 3GD7A 2K14A 2R7ZG 1K0RA 1OXXK 2JA7G 3KNUA 1GD7A 1KC8C 1Z9FA 1Q81C 2UUBL 3HOUH 1B8AA 4JG2A 5C4XH 2EXDA 3EN2A 5GROA 2E8GA 2R92H 2YY8A 1IL2A 1SMXA 5FLXc 1I5FA 4JC0A 1YZ6A 5IYDH 4MCBA 4P72A 4O2DA 4OO1I 2KCTA 3HOUG 1X3FA 2LSSA 1Q12A 4MNOA 5M5YH 1JMCA 4YQKA 1S72A 4YY3Q 5K36G 4JI1Q 4X65L 3EBEA 4YPZA 3ERSX 2IX0A 3TQYA 3S2HH 4IO9A 3AI9X 4A75A 5IP9H 1IBKQ 3GTKH 4LFBL 1Q82C 3H0GH 4P74A 3JC66 3GTLH 2UUCQ 2IHEA 3BBHA 1PYSB 3UE0A 5M3MH 2UUCL 2IX1A 4K0KL 4E8BA 2AHOB 1IBMQ 2VQEQ 4JBJA 2VQFL 5BR8L 2MQHA 3NK6A 5M3MG 1C0AA 4JOIA 2AWNA 3PF4A 3PUXA 1EIYB 4HJ7A 2HA8A 4JYAQ 5C0XJ 3MXNB 2OTJA 3HOYH 2XTIA 4AYBG 4DR2Q 4A3DH 5ELOA 5LMUL 2NVXH 3GYQA 5GAEC 1IBLL 1VQLA 2ZTCA 1OXSC 2YYZA 2F4VQ 3JAMi 4B3SQ 4JCVE 3S1NH 4B3SL 5J3BA 3RLFA 2RF4A 1E1OA 5C0XI 1ASYA 3I4OA 2Q2HA 3K8AA 4JI5L 3UE1A 2KCMA 4DV7L 2R92G 1EWIA 2PQAB 3CPFA 2AWOA 3CP0A 4GKKQ 1A8VA 3CCMA 2UXCQ 3KF6A 4LF4Q 5GMBA 2C35B 3KJOA 1T9HA 1PVOA 3J81c 1NMGA 4JI7L 3PUYA 1K73C 3I2ZA 2YTXA 4HIDA 3RZDH 4B3RL 4DV3L 3I4MH 1A0IA 5GM8A 3M4QA 4MTNA 2PQAA 2I5HA 4NPSA 1GKHA 2WFWA 4QY7A 1N34Q 4YQIA 4YY3L 5C44H 3TRZA 3CCLA 1PH8A 3KDFB 4JI6L 3CMEA 4JI6Q 1VQ9A 1NY4A 2EQSA 2VL6A 1YJNA 2JA8H 1J5EQ 4YQNA 4YVGA 4RG1A 2JA6G 3OW2A 3S16H 4DR1Q 1MJEA 4L5RC 1MKHA 2HHHL 2K5HA 1A63A 3HOZG 4BBSH 3G71A 4DKAC 2V3JA 1AE2A 3IRBA 1XJVA 2E5LL 3HOYG 4YQGA 5FLMH 4GNXB 4AQYL 2JA8G 5JJIA 2QA4A 4DV5Q 1I94Q 2N78A 2HT1A 4IG6A 4H02A 3RN2A 3KTYA 2BA1A 4YQSA 4A3EG 1Y1VG 1N32Q 1VQ4A 1VQHA 1KAWA 4TQUS 4DV4L 1PH5A 2UU9Q 1N36Q 2UU9L 1PYBA 1RIPA 4IJLA 1YITA 1TXYA 1YHAA 3M4OH 2I5LX 3N4JA 1X56A 1B7YB 1VS0A 4YQ7A 4DPGA 3H3VI 1UAJA 1Y1VH 4YQLA 2KENA 4GOPC 2V3KA 1Q7YC 4DV7Q 2PNHA 3PO2G 1JJGA 2CKZB 1HZBA 4R4QA 4B3TL 2H5XA 1HNWL 1ZJRA 3K80C 4LFBQ 2I6DA 1AE3A 3I7FA 1G6PA 3HOZH 4BBSG 1I6HH 2VUMG 4DR5L 3NK7A 5GAHC 1X54A 1FL0A 3KOJA 5LMNW 4DR5Q 1VQDA 4DV1L 1IBML 2CQOA 1N33L 4NXMQ 3PV0A 5LMNL 3RLNA 3T1HQ 1O6DA 2R6GA 3E0EA 4YVHA 5BR8Q 4BY1G 3RN5A 1V2XA 1VQNA 5GAGC 3N4KA 4HJAA 1EFWA 3ULLA 4JYAL 4JWJA 1GM5A 3CPWA 1HH2P 1CKNB 3ULPA 4YQ5A 4GKJQ 4POFA 2RCNA 4LF5L 3CCJA 1PA6A 2QGQA 1SROA 2QWVA 1VQ7A 3H3VH 4DAMA 4JI4Q 4POGA 4JI4L 2NVTH 1PFSA 4YQBA 3BZCA 2NVYH 4A3FH 4JBKA 4DR4Q 1NXZA 2PMZE 2Y0SE 3D0FA 4AQYQ 2JEAI 3HOVG 4YQOA 4LUZA 4FMWA 5FAIA 4YPWA 4UP7A 1N32L 1X65A 4FDBA 3I55A 2IHFA 1YVCA 1PH1A 4XBOA 4BXXH 1PH9A 1UE6A 3SGIA 3BZKA 2HQLA 4JALA 2MFIA 2NZHA 2B63H 4H3ZA 4PZ8A 1BBUA 3I56A 1MJCA 1XTDA 3PCOB 5IYBH 4DV6Q 4IPGA 2AKWB 2ALYB 5ELNA 2E2IH 4DV3Q 1OY5A 3CCRA 3F1ZA 1EOVA 1HZAA 3KF6B 3K7UC 1O7IA 3NBHB 1HNXQ 3CCSA 2N3SA 1PH7A 4UP9A 3CC4A 5HY6A 4KI0A 1OXTA 3CC7A 2YU9H 1V1QA 1IXRA 4YWKA 4QL5A 2OTLA 5JEAJ 1OTCA 3HOWG 4BY7G 1YJ9A 1IYJB 3I4MG 3H0GG 3L8UA 2PI2A 3UDIA 4LUOA 5CO4A 1QZGA 1Q8KA 3BJUA 4NXML 4LW1A 1QUQB 4HIMA 2Z6KC 3CCUA 4YWLA 2GN5A 1KHIA 3G48A 3S15H 2BH8A 5D9FA 3ULJA 4BBRG 4DK6C 1Q1EA 4QJFA 2UUAL 1X3GA 2B29A 3PO3H 2JA7H 2ZJQA 1BVSA 3PUVA 2ZTDA 1M1KC 4YQRA 1J6QA 3I4NG 4JBWA 2GVAA 5H1SE 3J7ZC 4A76A 5C4XG 4R4CA 3IEFA 3S24A 3W5OA 3PF5A 1H95A 1TWCH 1VH0A 2K52A 2I5MX 1W3SA 1SFOH 4HJ5A 1HR0Q 1QVGA 4B3TQ 2YTVA 4OONA 4A3CH 2MNAA 4AYBE 4HIOA 1E1TA 2JE6I 4C3HH 4LF4L 2NZOA 3BBDA 2WB1E 2F52A 4HIKA 1PH4A 3AFQA 4JI7Q 1K3RA 4PMWA 2RHSB 1W2BA 4DV0L 4TVAB 2LXJA 1BBWA 3RLOA 5IT9c 4DV0Q 3DCMX 3A74A 4LF8Q 4YQPA 2OQ0A 2VY3A 4GLAC 3OTOQ 1P8LA 3RR5A 1E24A 2R7FA 4DUZL 1L0WA 3UDFA 2QEXA 4R1JA 1TWHH 1HNXL 3ILKA 5C3EG 1VQPA 4BA2I 1K83H 1PHJA 1TO0A 2KBNA 5IP9G 2EIFA 1LM0A 1P16A 1NBWA 2FXQA 1J5EL 3FKIG 5LMUQ 4WJ4A 1XNRL 2N8NA 2CWAA 2K75A 3F2CA 4H3YA 4LF6L 1YHBA 5DLQE 4JV5Q 1HNZQ 2Z0YA 1GO3E 4R4IA 3HOXG 1ASZA 4YVKA 2VW9A 4JI5Q 4L69A 3HKZG 3FKIH 3OINA 3NENA 2UUBQ 1YJWA 2PI2E 4NXNL 4A3BG 4LF9Q 1G291 5C3EH 4KHPL 4AH6A 4A3LH 2GVBA 4A93G 1YI2A 4X3MA 3M3YH 1UALA 5M5WH 2MO0A 1UWVA 1VQBA 3AIAA 3CC2A 1MIUA 1NE3A 2F3IA 4L5TA 4MCCA 4PZ6A 4R4TA 2CWPA 1WJJA 4A93H 3NEMA 1YBYA 3LGJA 1LTLA 4A3BH 4PZKA 4DV6L 4DUYQ 4A3KH 4YQ9A 1X7OA 1JE5A 1IBKL 5GMCA 1N9WA 1VQ8A 2ZM6L 2ES2A 2B3GA 1IZ6A 1K9MC 4APVA 3PGZA 1UEBA 2VUMH 1WCMH 3ER0A 4OXPA 2B63G 1S40A 3K0XA 1X55A 2E2JH 4DR7L 4OO1G 4C3JH 3PUWA 5IYBG 4Y7NH 5IE8A 1Y1WH 4EQ5A 5HGQA 4DV2L 3KDFA 4C2MH 4J15A 4R4OA 4B3MQ 4BXXG 3UDXA 5M5XH 4A3IH 4YQQA 1VQMA 5LMNQ 2D0PA 3T1HL 2YTYA 3GTMH 5IYCH 4JWFA 4YCVA 4DUZQ 3S17H 3AYHB 3M4PA 2JA5H 3W1GA 4UP8A 1NTGA 3J80i 4LFAQ 3G4SA 1VQCA 2JEBI 4JI2L 3UDGA 4LF7L 1LUZA 4IJHA 1CKNA 1VQJA 3U4VA 2D62A 1VHKA 1V9PA 1QZHA 3FP9A 1AH9A 4GN3B 1Q86C 1JB7A 4YQ6A 1SLJA 3OYYA 1XNQQ 1X3EA 4QGUA 3S1MH 2JQOA 1XNQL 3L2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S G;  3M9B A;  3MEF A;  3GTQ H;  2O3A A;  3HKZ E;  1VCI A;  4GNX C;  2R93 H;  1HR0 L;  4GKK L;  1HZ9 A;  4P75 A;  4X66 Q;  5IYD G;  3U4Z A;  3KF8 B;  1IPA A;  1UE1 A;  3L7Z C;  3HKS A;  2E2H H;  4YCW A;  3K81 C;  4JI8 L;  4HJ8 A;  4A3J G;  3S1R H;  1K8A C;  2JA6 H;  1OXU A;  2HIV A;  2YV5 A;  3S1Q H;  1EQR A;  3KLW A;  5M3F H;  1HJP A;  4IOA A;  3PUZ A;  2VS1 A;  4IPD A;  3AQQ A;  1XMQ Q;  4A3J H;  2WAQ E;  2L15 A;  3GDE A;  4C3I H;  5JEA G;  5C44 G;  3AXZ A;  3CMA A;  3F2B A;  3CCV A;  3U58 A;  1K8G A;  3OTO L;  4YWM A;  3DLL A;  4LWC A;  2RHQ B;  1NMF A;  1N34 L;  2OWO A;  1VQG A;  5C4J H;  4ME3 A;  3J81 i;  1DGS A;  3TS0 A;  3PO2 H;  5JJL A;  1NJI C;  3A0J A;  1QVC A;  4JAK A;  4ALP A;  3E9I A;  3HOW H;  4CNG A;  3GTJ H;  4X3L A;  1MXI A;  3OIJ A;  1WOC A;  4GOP A;  1XPR A;  2JA5 G;  4YQA A;  3NEL A;  2VQE L;  2V1C C;  3F8T A;  4P71 A;  3PSI A;  3G6E A;  4DR4 L;  4A3E H;  2CCZ A;  4LUV A;  2IY5 B;  1CKO A;  3J7A 5;  1KIX A;  2ZTE A;  3KYH C;  1CUK A;  4OWX B;  4X62 L;  1L2F A;  1KRT A;  4YCU A;  5FJ8 G;  4DV5 L;  1KD1 C;  1I94 L;  1VQ6 A;  1VQI A;  1YEZ A;  4A3C G;  4KHP Q;  4YQ4 A;  5FLM G;  4XIG S;  2OQK A;  4LFA L;  4DV4 Q;  4LF9 L;  2Z6K A;  4A3M G;  2JJQ A;  4PZ7 A;  1PV4 A;  2ASB A;  4JI3 Q;  2AMC B;  2UUA Q;  2A1A A;  2EGW A;  3KY7 A;  4YQ2 A;  2F4V L;  4BA1 I;  3RZO H;  5FJ8 H;  2Q2U A;  2KHJ A;  1JT8 A;  4YQ1 A;  4YVI A;  3CCE A;  2R7D A;  4DNI A;  3PO3 G;  5AJ3 L;  2N49 A;  1Y14 B;  4DUY L;  4IFD I;  4DR3 Q;  3HOV H;  1P9P A;  4MZ9 A;  1C9O A;  3D31 A;  4JBM A;  4JI0 L;  4YVJ A;  2R7Z H;  4A3G G;  3CW2 C;  5IP7 H;  2ZM6 Q;  3CXC A;  1EQQ A;  1SE8 A;  2ZJP A;  1FJG Q;  2DUD A;  1X7P A;  1VQA A;  4P73 A;  3CCQ A;  1C7Y A;  3S14 H;  4YQC A;  4K0K Q;  1JJ2 A;  3WWV A;  4X6A H;  1L1O A;  2ID0 A;  3M85 A;  4UPA A;  1VQO A;  2A8V A;  3GTO H;  4DR6 L;  1E3P A;  1L1O B;  1U0L A;  2D0O A;  3T1Y L;  1XMO Q;  1KQS A;  3CF5 A;  4IPC A;  1CSP A;  2K5V A;  3BU2 A;  4YQJ A;  1XPO A;  1U5K A;  4LF7 Q;  1V6Z A;  5IYC G;  4A3G H;  2JA9 A;  1Q46 A;  1TWG H;  2JK8 A;  3B6Y A;  4JI2 Q;  5IY0 A;  3HOX H;  4NB3 A;  4GNX A;  4LF5 Q;  1V43 A;  4LNQ A;  3K7A H;  2QMM A;  4RMF A;  4YQ3 A;  3STB D;  1XNR Q;  4DAY B;  1TWF H;  2K50 A;  2MO1 A;  5M3F G;  1IBL Q;  4UY8 C;  4LFC Q;  1JJC B;  4A4I A;  1Y1W G;  2XGT A;  1E22 A;  4LFC L;  4LF6 Q;  1D8L A;  1J85 A;  1B70 B;  1EUJ A;  3STB C;  4A3M H;  4X64 L;  1WFQ A;  3A5U A;  4GN4 B;  1XPU A;  4X64 Q;  2Q2I A;  1VQF A;  2WB1 G;  4CND A;  1HZC A;  4IOC A;  1HR0 W;  3PIP A;  4KDZ A;  4MCD A;  3W1B A;  4X66 L;  3RNU A;  4NXN Q;  4YQ0 A;  1KRS A;  1BKB A;  2I0Q A;  2EGV A;  1FGU A;  2WP8 J;  5E7N A;  4A3K G;  3HFZ B;  2UXC L;  4GLX A;  3BBE A;  3E9H A;  4PG3 A;  1KXL A;  1CKM A;  1N8R C;  4A3F G;  3OII A;  2Q2T A;  1YHQ A;  1A62 A;  2CFM A;  4XTC S;  5IWA L;  4YPX A;  2UXD Q;  1RL2 A;  4B3R Q;  1SN8 A;  4IFD J;  2UXD L;  5AJ3 Q;  4A3I G;  4GLV B;  1YIJ A;  4J3C A;  4GN5 A;  4JI1 L;  4X65 Q;  4DR3 L;  3PIO A;  4HJ9 A;  1X9N A;  4JI0 Q;  4WJ3 M;  3A5Z B;  4A3L G;  1GZ0 A;  2WAQ G;  2OCE A;  1VHY A;  1VQE A;  4YQT A;  3GTP H;  1UE5 A;  4L5Q A;  4DR1 L;  4BY1 H;  1UE7 A;  2HHH Q;  5EAY A;  2UXB L;  4BBR H;  1VQK A;  4YHH Q;  4OX9 Q;  2CX8 A;  2UXB Q;  1YNX A;  3VDY A;  4YHH L;  2ZJR A;  4DV2 Q;  4OX9 L;  3AFP A;  2VQF Q;  1G51 A;  1HNZ L;  4JV5 L;  1TWA H;  1SRU A;  4KLK A;  1D7Q A;  1KL9 A;  3JAM c;  1QVF A;  1S3O A;  1WYD A;  2ATW A;  3QUV A;  4A3D G;  3TS2 A;  4QIW E;  4X62 Q;  3AEV A;  1UAM A;  4L5S A;  4DR2 L;  3GTG H;  1R9T H;  5GAD C;  4JI3 L;  4BY7 H;  2R93 G;  1I50 H;  1N36 L;  4YPY A;  1GVP A;  4JOI C;  1E7Z A;  1EIF A;  1PH3 A;  2VNU D;  3KW2 A;  2IT1 A;  3L0O A;  3ONP A;  2NN6 I;  1FVI A;  3TEH B;  4GS3 A;  1SR3 A;  3KFU A;  3KJP A;  1WI5 A;  3CAM A;  4KHZ A;  3S2D H;  1UAK A;  4IFD G;  1Z85 A;  1Z47 A;  1OXV A;  2LXK A;  2NVQ H;  1Q1B A;  2BA0 A;  5C0X G;  1HNW Q;  2K4K A;  2KHI A;  1I3Q H;  4QQB X;  2HIX A;  3F2D A;  3GO5 A;  2VZA A;  4JI8 Q;  2BH2 A;  3M7N A;  4DR7 Q;  1FJG L;  2K5N A;  3O7B A;  1XMQ L;  3J81 j;  4B3M L;  4AIM A;  4DV1 Q;  4GOP B;  3CD6 A;  4IPH A;  4FAK A;  3ZJY C;  4OWW B;  3I4N H;  3T1Y Q;  1CSQ A;  5GQO A;  5IWA Q;  3H15 A;  1WCM G;  1XMO L;  1PH6 A;  3CQZ H;  3U50 C;  1N33 Q;  4DR6 Q;  3IC6 A;  4LF8 L;  4CNE A;  1L1O C;  1X6O A;  4YQD A;  1PH2 A;  2Z0S A;  3FHW A;  1M90 C;  1EYG A;  1VQ5 A;  1QUQ A;  3ICE A;  4EX5 A;  4GKJ L;  2NN6 G;  4Y52 H;  5JJK A;  4YQ8 A;  3Q8D A;  3TRE A;  2DGY A;  4KGN A;  2E5L Q;  3J80 c;  3E5Y A;  3DM3 A;  3EIV A;  4O0A A;  2A19 A;  4DK3 C;  4CNF A;  4OWT B;  1NS5 A;  5IP7 G;  1LYL A;  3GD7 A;  2K14 A;  2R7Z G;  1K0R A;  1OXX K;  2JA7 G;  3KNU A;  1GD7 A;  1KC8 C;  1Z9F A;  1Q81 C;  2UUB L;  3HOU H;  1B8A A;  4JG2 A;  5C4X H;  2EXD A;  3EN2 A;  5GRO A;  2E8G A;  2R92 H;  2YY8 A;  1IL2 A;  1SMX A;  5FLX c;  1I5F A;  4JC0 A;  1YZ6 A;  5IYD H;  4MCB A;  4P72 A;  4O2D A;  4OO1 I;  2KCT A;  3HOU G;  1X3F A;  2LSS A;  1Q12 A;  4MNO A;  5M5Y H;  1JMC A;  4YQK A;  1S72 A;  4YY3 Q;  5K36 G;  4JI1 Q;  4X65 L;  3EBE A;  4YPZ A;  3ERS X;  2IX0 A;  3TQY A;  3S2H H;  4IO9 A;  3AI9 X;  4A75 A;  5IP9 H;  1IBK Q;  3GTK H;  4LFB L;  1Q82 C;  3H0G H;  4P74 A;  3JC6 6;  3GTL H;  2UUC Q;  2IHE A;  3BBH A;  1PYS B;  3UE0 A;  5M3M H;  2UUC L;  2IX1 A;  4K0K L;  4E8B A;  2AHO B;  1IBM Q;  2VQE Q;  4JBJ A;  2VQF L;  5BR8 L;  2MQH A;  3NK6 A;  5M3M G;  1C0A A;  4JOI A;  2AWN A;  3PF4 A;  3PUX A;  1EIY B;  4HJ7 A;  2HA8 A;  4JYA Q;  5C0X J;  3MXN B;  2OTJ A;  3HOY H;  2XTI A;  4AYB G;  4DR2 Q;  4A3D H;  5ELO A;  5LMU L;  2NVX H;  3GYQ A;  5GAE C;  1IBL L;  1VQL A;  2ZTC A;  1OXS C;  2YYZ A;  2F4V Q;  3JAM i;  4B3S Q;  4JCV E;  3S1N H;  4B3S L;  5J3B A;  3RLF A;  2RF4 A;  1E1O A;  5C0X I;  1ASY A;  3I4O A;  2Q2H A;  3K8A A;  4JI5 L;  3UE1 A;  2KCM A;  4DV7 L;  2R92 G;  1EWI A;  2PQA B;  3CPF A;  2AWO A;  3CP0 A;  4GKK Q;  1A8V A;  3CCM A;  2UXC Q;  3KF6 A;  4LF4 Q;  5GMB A;  2C35 B;  3KJO A;  1T9H A;  1PVO A;  3J81 c;  1NMG A;  4JI7 L;  3PUY A;  1K73 C;  3I2Z A;  2YTX A;  4HID A;  3RZD H;  4B3R L;  4DV3 L;  3I4M H;  1A0I A;  5GM8 A;  3M4Q A;  4MTN A;  2PQA A;  2I5H A;  4NPS A;  1GKH A;  2WFW A;  4QY7 A;  1N34 Q;  4YQI A;  4YY3 L;  5C44 H;  3TRZ A;  3CCL A;  1PH8 A;  3KDF B;  4JI6 L;  3CME A;  4JI6 Q;  1VQ9 A;  1NY4 A;  2EQS A;  2VL6 A;  1YJN A;  2JA8 H;  1J5E Q;  4YQN A;  4YVG A;  4RG1 A;  2JA6 G;  3OW2 A;  3S16 H;  4DR1 Q;  1MJE A;  4L5R C;  1MKH A;  2HHH L;  2K5H A;  1A63 A;  3HOZ G;  4BBS H;  3G71 A;  4DKA C;  2V3J A;  1AE2 A;  3IRB A;  1XJV A;  2E5L L;  3HOY G;  4YQG A;  5FLM H;  4GNX B;  4AQY L;  2JA8 G;  5JJI A;  2QA4 A;  4DV5 Q;  1I94 Q;  2N78 A;  2HT1 A;  4IG6 A;  4H02 A;  3RN2 A;  3KTY A;  2BA1 A;  4YQS A;  4A3E G;  1Y1V G;  1N32 Q;  1VQ4 A;  1VQH A;  1KAW A;  4TQU S;  4DV4 L;  1PH5 A;  2UU9 Q;  1N36 Q;  2UU9 L;  1PYB A;  1RIP A;  4IJL A;  1YIT A;  1TXY A;  1YHA A;  3M4O H;  2I5L X;  3N4J A;  1X56 A;  1B7Y B;  1VS0 A;  4YQ7 A;  4DPG A;  3H3V I;  1UAJ A;  1Y1V H;  4YQL A;  2KEN A;  4GOP C;  2V3K A;  1Q7Y C;  4DV7 Q;  2PNH A;  3PO2 G;  1JJG A;  2CKZ B;  1HZB A;  4R4Q A;  4B3T L;  2H5X A;  1HNW L;  1ZJR A;  3K80 C;  4LFB Q;  2I6D A;  1AE3 A;  3I7F A;  1G6P A;  3HOZ H;  4BBS G;  1I6H H;  2VUM G;  4DR5 L;  3NK7 A;  5GAH C;  1X54 A;  1FL0 A;  3KOJ A;  5LMN W;  4DR5 Q;  1VQD A;  4DV1 L;  1IBM L;  2CQO A;  1N33 L;  4NXM Q;  3PV0 A;  5LMN L;  3RLN A;  3T1H Q;  1O6D A;  2R6G A;  3E0E A;  4YVH A;  5BR8 Q;  4BY1 G;  3RN5 A;  1V2X A;  1VQN A;  5GAG C;  3N4K A;  4HJA A;  1EFW A;  3ULL A;  4JYA L;  1GM5 A;  3CPW A;  1HH2 P;  1CKN B;  3ULP A;  4YQ5 A;  4GKJ Q;  4POF A;  2RCN A;  4LF5 L;  3CCJ A;  1PA6 A;  2QGQ A;  1SRO A;  2QWV A;  1VQ7 A;  3H3V H;  4DAM A;  4JI4 Q;  4POG A;  4JI4 L;  2NVT H;  1PFS A;  4YQB A;  3BZC A;  2NVY H;  4A3F H;  4JBK A;  4DR4 Q;  1NXZ A;  2PMZ E;  2Y0S E;  3D0F A;  4AQY Q;  2JEA I;  3HOV G;  4YQO A;  4LUZ A;  5FAI A;  4YPW A;  4UP7 A;  1N32 L;  1X65 A;  4FDB A;  3I55 A;  2IHF A;  1YVC A;  1PH1 A;  4XBO A;  4BXX H;  1PH9 A;  1UE6 A;  3SGI A;  3BZK A;  2HQL A;  4JAL A;  2MFI A;  2NZH A;  2B63 H;  4H3Z A;  4PZ8 A;  1BBU A;  3I56 A;  1MJC A;  1XTD A;  3PCO B;  5IYB H;  4DV6 Q;  4IPG A;  2AKW B;  2ALY B;  5ELN A;  2E2I H;  4DV3 Q;  1OY5 A;  3CCR A;  3F1Z A;  1EOV A;  1HZA A;  3KF6 B;  3K7U C;  1O7I A;  3NBH B;  1HNX Q;  3CCS A;  2N3S A;  1PH7 A;  4UP9 A;  3CC4 A;  5HY6 A;  4KI0 A;  1OXT A;  3CC7 A;  2YU9 H;  1V1Q A;  1IXR A;  4YWK A;  4QL5 A;  2OTL A;  5JEA J;  1OTC A;  3HOW G;  4BY7 G;  1YJ9 A;  1IYJ B;  3I4M G;  3H0G G;  3L8U A;  2PI2 A;  3UDI A;  4LUO A;  5CO4 A;  1QZG A;  1Q8K A;  3BJU A;  4NXM L;  4LW1 A;  1QUQ B;  4HIM A;  2Z6K C;  3CCU A;  4YWL A;  2GN5 A;  1KHI A;  3G48 A;  3S15 H;  2BH8 A;  5D9F A;  3ULJ A;  4BBR G;  4DK6 C;  1Q1E A;  4QJF A;  2UUA L;  1X3G A;  2B29 A;  3PO3 H;  2JA7 H;  2ZJQ A;  1BVS A;  3PUV A;  2ZTD A;  1M1K C;  4YQR A;  1J6Q A;  3I4N G;  4JBW A;  2GVA A;  5H1S E;  3J7Z C;  4A76 A;  5C4X G;  4R4C A;  3IEF A;  3S24 A;  3W5O A;  3PF5 A;  1H95 A;  1TWC H;  1VH0 A;  2K52 A;  2I5M X;  1W3S A;  1SFO H;  4HJ5 A;  1HR0 Q;  1QVG A;  4B3T Q;  2YTV A;  4OON A;  4A3C H;  2MNA A;  4AYB E;  4HIO A;  1E1T A;  2JE6 I;  4C3H H;  4LF4 L;  2NZO A;  3BBD A;  2WB1 E;  2F52 A;  4HIK A;  1PH4 A;  3AFQ A;  4JI7 Q;  1K3R A;  4PMW A;  2RHS B;  1W2B A;  4DV0 L;  4TVA B;  2LXJ A;  1BBW A;  3RLO A;  5IT9 c;  4DV0 Q;  3DCM X;  3A74 A;  4LF8 Q;  4YQP A;  2OQ0 A;  2VY3 A;  4GLA C;  3OTO Q;  1P8L A;  3RR5 A;  1E24 A;  2R7F A;  4DUZ L;  1L0W A;  3UDF A;  2QEX A;  4R1J A;  1TWH H;  1HNX L;  3ILK A;  5C3E G;  1VQP A;  4BA2 I;  1K83 H;  1PHJ A;  1TO0 A;  2KBN A;  5IP9 G;  2EIF A;  1LM0 A;  1P16 A;  1NBW A;  2FXQ A;  1J5E L;  3FKI G;  5LMU Q;  4WJ4 A;  1XNR L;  2N8N A;  2CWA A;  2K75 A;  3F2C A;  4H3Y A;  4LF6 L;  1YHB A;  5DLQ E;  4JV5 Q;  1HNZ Q;  2Z0Y A;  1GO3 E;  4R4I A;  3HOX G;  1ASZ A;  4YVK A;  2VW9 A;  4JI5 Q;  4L69 A;  3HKZ G;  3FKI H;  3OIN A;  3NEN A;  2UUB Q;  1YJW A;  2PI2 E;  4NXN L;  4A3B G;  4LF9 Q;  1G29 1;  5C3E H;  4KHP L;  4AH6 A;  4A3L H;  2GVB A;  4A93 G;  1YI2 A;  4X3M A;  3M3Y H;  1UAL A;  5M5W H;  2MO0 A;  1UWV A;  1VQB A;  3AIA A;  3CC2 A;  1MIU A;  1NE3 A;  2F3I A;  4L5T A;  4MCC A;  4PZ6 A;  4R4T A;  2CWP A;  1WJJ A;  4A93 H;  3NEM A;  1YBY A;  3LGJ A;  1LTL A;  4A3B H;  4PZK A;  4DV6 L;  4DUY Q;  4A3K H;  4YQ9 A;  1X7O A;  1JE5 A;  1IBK L;  5GMC A;  1N9W A;  1VQ8 A;  2ZM6 L;  2ES2 A;  2B3G A;  1IZ6 A;  1K9M C;  4APV A;  3PGZ A;  1UEB A;  2VUM H;  1WCM H;  3ER0 A;  4OXP A;  2B63 G;  1S40 A;  3K0X A;  1X55 A;  2E2J H;  4DR7 L;  4OO1 G;  4C3J H;  3PUW A;  5IYB G;  4Y7N H;  5IE8 A;  1Y1W H;  4EQ5 A;  5HGQ A;  4DV2 L;  3KDF A;  4C2M H;  4J15 A;  4R4O A;  4B3M Q;  4BXX G;  3UDX A;  5M5X H;  4A3I H;  4YQQ A;  1VQM A;  5LMN Q;  2D0P A;  3T1H L;  2YTY A;  3GTM H;  5IYC H;  4YCV A;  4DUZ Q;  3S17 H;  3AYH B;  3M4P A;  2JA5 H;  3W1G A;  4UP8 A;  1NTG A;  3J80 i;  4LFA Q;  3G4S A;  1VQC A;  2JEB I;  4JI2 L;  3UDG A;  4LF7 L;  1LUZ A;  4IJH A;  1CKN A;  1VQJ A;  3U4V A;  2D62 A;  1VHK A;  1V9P A;  1QZH A;  3FP9 A;  1AH9 A;  4GN3 B;  1Q86 C;  1JB7 A;  4YQ6 A;  1SLJ A;  3OYY A;  1XNQ Q;  1X3E A;  4QGU A;  3S1M H;  2JQO A;  1XNQ L;  3L2P A; 
#chains in the Genus database with same CATH topology
 3TDQ A;  3GTQ H;  1G2S A;  1HR0 L;  5I2Y A;  2NYZ D;  2F0Q A;  3KF8 B;  3S1R B;  1IPA A;  1Z7T A;  3L7Z C;  1B3Q A;  4YCW A;  4KY7 A;  2AUJ D;  2EJG C;  5A2Q E;  3BYT B;  2XVS A;  2HIV A;  4XDX A;  1K8A C;  2JA6 H;  3S1Q H;  4KTA A;  3PUZ A;  4TKO B;  1JWS D;  2WAQ E;  3CMA A;  4RGN A;  3F2B A;  2F0F A;  1QG7 A;  1I4R A;  3D6C A;  2J0T D;  3PO2 H;  5JJL A;  4WFN 3;  3A0J A;  1QVC A;  4ALP A;  1DYQ A;  3GTJ H;  1PFN A;  4G4K A;  1K83 B;  4YQA A;  2V1C C;  2NVX B;  1E2V A;  1SE2 A;  4DR4 L;  5C4Z A;  2CCZ A;  3TN2 A;  4OWX B;  1CUK A;  1KD1 C;  5FJ8 G;  3OWF A;  2OT2 A;  1I94 L;  4YQ4 A;  1SYB A;  4KHP Q;  5FLM G;  1SE3 A;  2OQK A;  5AFW A;  2Z6K A;  2JJQ A;  2ASB A;  4JI3 Q;  4I7A A;  2HQE A;  1XX8 A;  3RZO H;  2Q2U A;  4YVI A;  4IN3 A;  2PQE A;  5AJ3 L;  1CM9 A;  4TSS A;  1C9O A;  3D31 A;  4I65 A;  2R7Z H;  1TKW B;  4A3G G;  3CXC A;  2ZJP A;  1VQA A;  3JAM E;  3NPP A;  2F3W A;  4YQC A;  4IZ8 A;  3WWV A;  1SXT A;  2A8V A;  1E3P A;  1KAA A;  5JAV A;  4U68 A;  1KQS A;  2CQA A;  1T5E A;  2K5V A;  4A3E B;  4RFB A;  5IYC G;  2JA9 A;  4A3G H;  1TWG H;  4DXG A;  5IY0 A;  4NB3 A;  4MN3 A;  3N52 A;  1CTM A;  1TWF H;  5M3F G;  1JOQ A;  1Y1W G;  2XGT A;  4A3M H;  2KQ3 A;  1XPU A;  1PTO H;  1OO9 B;  2WB1 G;  2EZV A;  4IOC A;  3PIP A;  4MCD A;  1JWM D;  3SVM A;  2FFK B;  4YQ0 A;  1KRS A;  1BKB A;  1FGU A;  1PFB A;  2WP8 J;  3BBE A;  4GLX A;  1HXY D;  3RMH A;  2Q2T A;  1TY0 A;  1YHQ A;  4YPX A;  4BBR B;  2UXD Q;  2R93 B;  5I9P A;  3BVG A;  2MJ8 A;  1YIJ A;  4J3C A;  3PIO A;  4HJ9 A;  4JI0 Q;  4A3L G;  3MTS A;  1D6E C;  4L5Q A;  1I4X A;  4DR1 L;  2HHH Q;  5C4J B;  4BBR H;  2CX8 A;  3VDY A;  3AFP A;  3A54 A;  1J9O A;  4KLK A;  4U67 3;  1FGB D;  4QIW B;  1WYD A;  3QUV A;  3KBX A;  3D4R A;  1HHV A;  3EVQ A;  1I50 H;  1A2T A;  1GVP A;  3KW2 A;  1PTO D;  1ZKO A;  2NN6 I;  3TEH B;  2XNA C;  4IUP A;  2CVR A;  3CAM A;  4A3G B;  3S2D H;  4IFD G;  1OXV A;  1S4Z A;  1TY2 A;  2KED A;  3NP8 A;  5C0X G;  4ABN A;  4QQB X;  2HIX A;  3F2D A;  4JI8 Q;  3M7N A;  4DR7 Q;  1JE4 A;  4HN7 A;  4IUQ A;  2KEC A;  3EA6 A;  4DV1 Q;  3CD6 A;  4IPH A;  1CSQ A;  3VR6 A;  5IWA Q;  2CW0 C;  1S5B D;  3FVQ A;  3U50 C;  3GTK B;  1BCP B;  4L8J A;  1MHW C;  5KNB A;  3IFT A;  3W3A A;  5C0X H;  2CHB D;  1QUQ A;  4QUF A;  5C3X A;  1XXG A;  2E74 C;  4GKJ L;  2Q8I B;  3C3L A;  3HEJ A;  1A3U A;  1HA6 A;  3NTI A;  4K8J A;  3DM3 A;  2BE5 D;  1NS5 A;  3K5O A;  1SND A;  1LYL A;  5K36 H;  2K14 A;  5A2Q L;  2LKV A;  3T4A C;  1B8A A;  2B2U C;  3EN2 A;  5GRO A;  3X3M A;  1SMX A;  5FLX c;  1I5F A;  1LLR D;  2K32 A;  4MCB A;  2EYP A;  4O2D A;  2KCT A;  3LWU A;  1X3F A;  1UAP A;  4JI1 Q;  4X65 L;  2Z8L A;  3NWS A;  3JC6 6;  5IT9 L;  2IHE A;  1GUG A;  3K5N A;  2UUC L;  3UE0 A;  3S15 B;  3BBH A;  3NWT A;  2IX1 A;  3HOY B;  2BCO A;  1I4H A;  2IWH A;  5LL6 S;  5BR8 L;  1O7Z A;  4ZAI A;  5G3L F;  4HJ7 A;  2OF1 A;  4NW2 A;  3TZD A;  2XTI A;  1LTA D;  2H1E A;  3H0G B;  1CZG A;  1OXS C;  1V1P B;  2NVY B;  4JCV E;  3S1N H;  3RLF A;  2QDL A;  3I4O A;  3GV3 A;  3K8A A;  4C1N I;  2A73 B;  1A8V A;  1DZ1 A;  3VYT A;  3ITP A;  5GMB A;  2R92 B;  3BG3 A;  4Q5V A;  3KK7 A;  4JI7 L;  3G7L A;  5ELB A;  3I4M H;  3KLS X;  1FNV A;  5GM8 A;  2PQA A;  2I5H A;  4YQI A;  2WFW A;  1PTO C;  1N34 Q;  1VMC A;  5C44 H;  3S2D B;  2JA8 B;  3KDF B;  3TME A;  1QOH A;  4JI6 Q;  1NY4 A;  2EQS A;  3NHH A;  4YVG A;  4RG1 A;  5E4W C;  4DR1 Q;  3MXN A;  1A63 A;  1I50 B;  3G71 A;  1PFM A;  5KYI A;  1XJV A;  2E5L L;  4HED A;  1H9R A;  3P1H A;  5FLM H;  3W2D A;  5JPN C;  5C3E B;  3K59 A;  4GNX B;  2JA8 G;  4IG6 A;  2BA1 A;  4YQS A;  1SBB B;  1N32 Q;  3A7L A;  1PH5 A;  5L37 A;  1T5X D;  2ZXP A;  4IFD H;  1SNP A;  1PYB A;  2UU9 L;  3M4O H;  1YHA A;  2PW5 A;  2EPB A;  1B7Y B;  1GUS A;  4WRD A;  4BBS B;  5ELF A;  2KEN A;  4GOP C;  2V3K A;  3PO2 G;  5M9O A;  3R8B A;  2CKZ B;  4R4Q A;  1EY9 A;  1SAP A;  1HNW L;  4LFB Q;  4DAP A;  3I7F A;  3OHX C;  1QE6 A;  3Q0A A;  1M8A A;  4JW0 A;  4XYQ A;  1IBM L;  2CQO A;  1ML0 D;  4NP5 A;  1TS3 A;  3RN5 A;  2B8F A;  3N4K A;  1EFW A;  3ULL A;  2O2L D;  2L4N A;  1HH2 P;  3ULP A;  4POF A;  1PRT C;  2RCN A;  4DXF A;  1RF2 D;  2QWV A;  1VQ7 A;  4JI4 Q;  1BOS A;  1NUC A;  4POG A;  1K3B C;  4OGQ C;  4A3K B;  4JBK A;  3SK8 A;  4A3J B;  3HOV G;  4YQO A;  1X65 A;  4FDB A;  5CV7 A;  1PH1 A;  2IHF A;  1EYC A;  3BZK A;  5IOD A;  2HQL A;  2MFI A;  3K0Y A;  1XTD A;  5IYB H;  3S2H B;  4DV3 Q;  2R7Z B;  4MIU A;  1BNZ A;  3NBH B;  3K5M A;  3DWQ A;  2MUY A;  4FXG C;  2MHV A;  1IXR A;  2B2Y C;  4BY7 G;  3R2I A;  4LUO A;  1JQY D;  5DEH A;  2PCF B;  1QZG A;  4NXM L;  3P7J A;  1IW7 C;  1Y8P B;  2Z6K C;  1JOK A;  1X32 A;  4BY1 B;  4QUC A;  3WDN A;  2SOB A;  4CDC C;  3S15 H;  2E75 C;  3GTJ B;  1STN A;  2PZT A;  5I6Y A;  3HP3 A;  3J7Y W;  4DK6 C;  1Q1E A;  4QJF A;  4KN7 C;  2B29 A;  3ONA B;  3PUV A;  1M1K C;  1J6Q A;  3IEF A;  1BBX C;  5DAU A;  2I5M X;  2HCI A;  2YTV A;  4AYB E;  1ZYR D;  3K58 A;  4C3H H;  2NZO A;  2L11 A;  2Z6B A;  5C6A A;  4HIK A;  3AFQ A;  2JA6 B;  3IAY A;  3BDL A;  5IT9 c;  2F0P A;  2C5C A;  1CQV A;  1E24 A;  1L0W A;  4R1J A;  1TWH H;  1HCZ A;  1STY A;  4BA2 I;  5IP9 G;  2EIF A;  3SEB A;  4FYD A;  2IJ0 A;  2CWA A;  3F2C A;  4JV5 Q;  2Z0Y A;  4JVZ A;  1U4M A;  4YVK A;  3OIN A;  1CT1 D;  1U4R A;  4C3I B;  5IGE A;  1Y1W B;  4X3M A;  1JOR A;  2D2C C;  5M5W H;  1UWV A;  3AIA A;  4KKT A;  4L5T A;  2E76 C;  2A69 C;  4PZ6 A;  1DCZ A;  2CWP A;  1I6H B;  2B39 A;  3I91 A;  3NEM A;  1RJT A;  3D6W A;  2RKS A;  3SHL A;  4PZK A;  4DUY Q;  4A3K H;  1JE5 A;  2HD3 A;  1IBK L;  1N9W A;  5KYL A;  1ESF A;  1IZ6 A;  4APV A;  4J1M A;  3SE0 A;  3MA2 B;  4DR7 L;  4RKB A;  4E6I A;  1X55 A;  5IE8 A;  4C2M H;  4BXX G;  4YIJ A;  2HDM A;  5EKI A;  5M5X H;  5LMN Q;  1BXT A;  3T1H L;  3TP8 A;  4JWF A;  1TWC B;  3M4P A;  4LFA Q;  3J80 i;  3VR3 A;  1A3T A;  1AH9 A;  2F0N A;  2A69 D;  3PIP 3;  3G6J B;  2IW3 A;  4GZY C;  4DAV A;  2QF7 A;  1VCI A;  4GNX C;  2R93 H;  4GKK L;  1HZ9 A;  2E2D C;  3HGB A;  3HKZ B;  4P75 A;  3U4Z A;  4M8A A;  4KN4 C;  3JAM L;  2E2H H;  4HJ8 A;  4JI8 L;  4A3J G;  1NAP A;  4FXD A;  1EQR A;  5M3F H;  5CMD A;  4IPD A;  1Y8N B;  3AQQ A;  3V05 A;  5C44 G;  1TWA B;  1HUM A;  4YWM A;  2JN4 A;  1PZJ D;  3ND8 A;  1VQG A;  4K14 A;  4JWH A;  2QW7 A;  3AU7 A;  4JAK A;  3HOV B;  4GOP A;  2JA5 G;  1WTR A;  4P71 A;  3G6E A;  4A3E H;  3H6M A;  4LUV A;  2IY5 B;  1KIX A;  3KYH C;  4X62 L;  1VQ6 A;  1YEZ A;  5CYU A;  4A3C G;  4LF9 L;  4PMB A;  4A3M G;  1TS4 A;  2UUA Q;  2A1A A;  2L0C A;  2XSC A;  4BA1 I;  2YU9 B;  2XRQ D;  1JT8 A;  4YQ1 A;  3PO3 G;  3C2P A;  1Y14 B;  4DUY L;  5C5L A;  3HOV H;  1P9P A;  4MZ9 A;  5EJW A;  3CW2 C;  2ZM6 Q;  1EQQ A;  1SYE A;  1WVL A;  1FJG Q;  2DUD A;  4P73 A;  3CCQ A;  3D4D A;  1HRJ A;  1L1O A;  1X3Q A;  4ZK9 B;  3HOZ B;  3GTO H;  4DR6 L;  4NKL A;  2D0O A;  5D14 A;  2ZXR A;  4IAL A;  3CF5 A;  4CBV A;  1ILP A;  2BDN A;  2JK8 A;  3HOX H;  3B6Y A;  2QMM A;  4GNX A;  4LNQ A;  3K7A H;  1TWH B;  4DAY B;  2MO1 A;  4UY8 C;  1STH A;  5COR A;  4LFC Q;  1JJC B;  1AZP A;  1E22 A;  4LF6 Q;  1D8L A;  3A5U A;  2PZW A;  3BDO A;  1MD2 D;  1IKL A;  3W1B A;  4X66 L;  1U4P A;  3CQZ B;  4RA8 A;  4PG3 A;  2KVM A;  5ELD A;  1LTI D;  5CV4 A;  2CH4 A;  4K5V A;  1BUV T;  2SNM A;  4C2M B;  4B3R Q;  1SN8 A;  4IFD J;  4N8X 1;  1BQQ T;  2L55 A;  4GN5 A;  4JI1 L;  4X65 Q;  2OCE A;  2WAQ G;  4FNF A;  4BY1 H;  3OIJ A;  1WTQ A;  4YHH Q;  4OX9 Q;  2UXB Q;  1YNX A;  3NTK A;  1V8Q A;  4YHH L;  4OX9 L;  3CRK C;  1SRU A;  1D7Q A;  4MTK A;  2XRS D;  1SNO A;  1S3O A;  2ATW A;  4OEL B;  1LTT D;  2F0M A;  2WAQ B;  4X62 Q;  4KJN A;  4HAE A;  1R9T H;  1SFO B;  5GAD C;  1JOO A;  1N36 L;  1A6X A;  1EZ8 A;  1EIF A;  2R61 A;  2IT1 A;  4Z9C B;  2SEB D;  1FVI A;  3KFU A;  1WI5 A;  3QWN A;  4KHZ A;  1Q3L A;  3MFY A;  1KLU D;  1Z47 A;  2LXK A;  1Q1B A;  2BA0 A;  4XT1 B;  4ZLT F;  1IYU A;  2VZA A;  1FJG L;  3HOU B;  1AN8 A;  4HTH A;  4AIM A;  4GOP B;  1LO5 D;  1WTH A;  2RCF A;  5K5P A;  3I4N H;  5GQO A;  1LV9 A;  3H15 A;  3CQZ H;  5KND A;  4QF4 A;  4EVO A;  4OO1 H;  1L1O C;  1ET6 A;  1X6O A;  3NUC A;  1PH2 A;  2JP1 A;  2B2T C;  2NUC A;  1QNU A;  4C3H G;  3QOJ A;  4EX5 A;  1EY8 A;  3FMC A;  1GHK A;  4G7Z C;  2F0T A;  3J80 c;  3E5Y A;  5IP7 G;  1M4V A;  3BYY B;  3GD7 A;  1TVX A;  1OXX K;  2AQ2 B;  1Q81 C;  2UUB L;  2EYF A;  4JG2 A;  3J80 L;  1PZI D;  2F0U A;  2QCP X;  2KCN A;  4RHR A;  2F03 A;  3T56 B;  4JC0 A;  1STB A;  1QB5 D;  5EBD A;  5LL6 X;  5IYD H;  3GTL B;  4P72 A;  4OO1 I;  3SK5 A;  3CU7 A;  3ND9 A;  1Q12 A;  4MNO A;  2RDF A;  1KLG D;  3KLR A;  2IX3 A;  1S72 A;  5K36 G;  1AFP A;  3EBE A;  3ERS X;  4OIK A;  3AI9 X;  4IO9 A;  4A75 A;  5FO9 B;  3DEP A;  4DFA A;  1KNE A;  1PYS B;  5M3M H;  4K0K L;  4E8B A;  2WV6 D;  1ESR A;  2AHO B;  2VQE Q;  2DN8 A;  1G2T A;  3PF4 A;  1JIC A;  3PUX A;  1EIY B;  2HA8 A;  5C0X J;  1E2W A;  3GTP B;  2OTJ A;  4CJ1 B;  3SR1 A;  4A3D H;  5ELO A;  4K8I A;  5GAE C;  1UUP A;  3J7A F;  2YYZ A;  3RD4 A;  1Y69 U;  3JAM i;  3I8Z A;  5J3B A;  1E1O A;  1ASY A;  1K8O A;  2D9U A;  3UE1 A;  1EWI A;  2CH4 W;  2MP1 A;  4GKK Q;  1MGS A;  3CCM A;  2UXC Q;  3KF6 A;  3S17 B;  1BF4 A;  4LF4 Q;  3KJO A;  3MXG A;  2EYH A;  2NWG A;  1NMG A;  2L5T A;  3AMU A;  4B3R L;  1A0I A;  3S1N B;  1GKH A;  1B1Z A;  3HS0 C;  1PH8 A;  3CCL A;  2FHT A;  2VL6 A;  1IL8 A;  2JA6 G;  1B4O A;  1ENC A;  1LAC A;  1MJE A;  1MKH A;  2K28 A;  4TRD A;  4BBS H;  2V3J A;  5D3I B;  4B08 A;  4K6L A;  3IRB A;  2KA7 A;  3HOY G;  3LNN A;  3NSW A;  4AQY L;  1SMY D;  5JJI A;  1I94 Q;  4RCN A;  2N78 A;  2PW7 A;  4H02 A;  1H9J A;  3RN2 A;  1VQH A;  1KAW A;  3DEO A;  1PXU A;  5EPL A;  4DV4 L;  2UU9 Q;  1N36 Q;  3R2T A;  1RIP A;  4IJL A;  3N4J A;  3K7A B;  1BCP C;  5KIX A;  3H3V I;  1Y1V H;  1ICF B;  3QG1 A;  5KEE A;  2G5D A;  3K80 C;  1KDC A;  4RAU C;  1YNJ C;  1DD2 A;  2MGS A;  3HOZ H;  3NXW A;  1I6H H;  3KOJ A;  5LMN W;  1N33 L;  4DV1 L;  5NUC A;  3FEW X;  1LAB A;  1S5F D;  3FRP B;  3RLN A;  2RSO A;  4F8M A;  2R6G A;  1V2X A;  1VQN A;  4YQ5 A;  4GKJ Q;  3NBI A;  2L9H A;  1G8Z D;  1PA6 A;  3H3V H;  5FOB B;  1PFS A;  4EGV A;  2NVY H;  1Z6H A;  2Y0S E;  3UI2 A;  2ZT9 C;  5FAI A;  2A68 D;  2A74 C;  1EYA A;  1PRT B;  1C48 A;  1CI3 M;  4XBO A;  1A3V A;  4H7B A;  4HR7 B;  2B63 H;  1MJC A;  4C3H B;  2AKW B;  2RVL A;  2NZ1 D;  4CHT B;  1Q8I A;  2BDO A;  3CCR A;  4N9T A;  3F1Z A;  3KF6 B;  3K7U C;  1O7I A;  4R9W A;  2F0K A;  5CV9 A;  3CCS A;  2N3S A;  1PH7 A;  2PZU A;  2F1M A;  5KRU A;  2E2I B;  4R8I A;  5M3F B;  1F9Q A;  1OTC A;  1STE A;  4RWS C;  5CO4 A;  2LS0 1;  4LK1 C;  1Q8K A;  4LW1 A;  2MPM A;  2GA4 B;  1KHI A;  2VB3 X;  2J7Z A;  5FO8 B;  1L0X B;  1SJH D;  2C9O A;  5D9F A;  3ULJ A;  2A6E C;  3VA5 A;  1B53 A;  4YQR A;  3I4N G;  4ZYS A;  5C4X G;  3M4O B;  3S24 A;  3W5O A;  1H95 A;  1TWC H;  1W3S A;  3IKJ A;  1HR0 Q;  1QVG A;  1X3P A;  4HSP A;  3HRZ C;  1RTN A;  5JVG 3;  4ZCK A;  2MNA A;  4LF4 L;  1DOM A;  2WB1 E;  2F52 A;  1B3A A;  5IGG A;  1PH4 A;  4DV0 L;  3RLO A;  2LXJ A;  4YQP A;  4DV0 Q;  3A74 A;  1RKN A;  4X3T A;  4GLA C;  3DUZ A;  2E2J B;  1HNX L;  5I9O A;  3VYU A;  1TO0 A;  5C44 B;  4WJ4 A;  1J5E L;  1GUO A;  3FKI G;  1XNR L;  2K5D A;  1GUW A;  1YHB A;  5DLQ E;  4XQJ A;  5M5W B;  1GO3 E;  2X6L A;  4R4I A;  3OWE B;  3KUP A;  4L69 A;  1AW7 A;  3FKI H;  4A3I B;  3NEN A;  2PI2 E;  4ODG A;  4NXN L;  4O42 A;  3GTM B;  1G29 1;  4KHP L;  4A93 G;  1XTC D;  4DGZ A;  1UAL A;  4FVM A;  1RDP D;  1QIL A;  3VR2 A;  4R4T A;  3D8G A;  1WJJ A;  1ENF A;  1LTL A;  2LFN A;  4A3B H;  5I2X A;  2K1B A;  4F7X A;  4KV6 A;  1MSG A;  2ES2 A;  2VUM H;  1CFM A;  2R3Z A;  4OXP A;  1S40 A;  1F9R A;  3K0X A;  3TSS A;  4C3J H;  3PUW A;  4Y7N H;  1Z85 A;  5F2D A;  4EQ5 A;  1SNC A;  5HGQ A;  4R4O A;  2Z1C A;  5LHY 1;  2RDH A;  4DUZ Q;  1NTG A;  1ICW A;  1ZYR C;  3UDG A;  3NK9 A;  1VQJ A;  4WOR A;  2L1B A;  3U4V A;  1SLJ A;  3OYY A;  1X3E A;  1ZEQ X;  2JQO A;  3L2P A;  1TWF B;  3M9B A;  3MEF A;  1R4P B;  1HTP A;  1Y8O B;  3CRL C;  4X66 Q;  1B9M A;  1WTO A;  3HKS A;  2XWJ B;  3S1R H;  1OXU A;  2YV5 A;  4IOA A;  3DMU A;  3KLW A;  3V2T A;  1TU2 B;  1FNW A;  1XMQ Q;  2AUK A;  3GDE A;  4C3I H;  5JEA G;  3AXZ A;  1K8G A;  1E0B A;  2OWO A;  2B2Y A;  4ME3 A;  3K6O A;  5COY A;  3PMF A;  3E9I A;  4DU9 A;  3HOW H;  3DWA A;  4X3L A;  3K57 A;  1MXI A;  1WOC A;  1CZW A;  2NTS A;  3NEL A;  4K2K A;  5CBE E;  3F8T A;  1O80 A;  3PSI A;  2K03 A;  3C1E A;  1F2Y A;  2AQ3 B;  1L2F A;  1KRT A;  4YCU A;  5D3D A;  1EEI D;  3QIA A;  3NQI A;  4DV4 Q;  3H09 A;  2DY7 A;  4PZ7 A;  1PV4 A;  4YQ2 A;  1SJE D;  2EGW A;  3KY7 A;  3P20 A;  1WTP A;  2F4V L;  5FJ8 H;  3QJY A;  2TSS A;  1IHZ A;  3CCE A;  3J7A V;  3Q23 A;  4G7H C;  4YVJ A;  1MSH A;  2DJF C;  3F2U A;  5IT9 E;  5IP7 H;  5JJZ A;  1SE8 A;  1C7Y A;  1SNM A;  3S14 H;  4K0K Q;  2EY6 A;  5FLX L;  3P75 A;  2ID0 A;  1F2Z A;  2M00 A;  1LTR D;  4KJO A;  2O5I C;  1L1O B;  1U0L A;  3T1Y L;  4IUV A;  3TZU A;  4IPC A;  4YQJ A;  1S5C D;  1XPO A;  1U5K A;  5IOC A;  4LF7 Q;  1TR5 A;  1Q46 A;  5E3F A;  4LF5 Q;  1BO0 A;  2A6E D;  1I6V C;  4J8Q A;  4YQ3 A;  3STB D;  1D1I A;  1XNR Q;  1WD1 A;  1IBL Q;  1EQV A;  1D5Z C;  4LFC L;  1C4Q A;  1B70 B;  1LT3 D;  1WFQ A;  2Q2I A;  1VQF A;  4CND A;  1HZC A;  2PMZ B;  3IFD A;  2K04 A;  4NXN Q;  2EGV A;  3HFZ B;  2Z9H A;  2UXC L;  4A3M B;  1KXL A;  1S5D D;  4A3F G;  2EYL A;  1A62 A;  4XTC S;  5IWA L;  1RL2 A;  3FPU B;  2UXD L;  4WJ3 M;  3A5Z B;  1GZ0 A;  2EYO A;  4A3D B;  4YQT A;  3GTP H;  1UE5 A;  1UE7 A;  1EQT A;  2UXB L;  1VQK A;  1DJR D;  2ZJR A;  4JV5 L;  1HNZ L;  1TWA H;  1QVF A;  3JAM c;  3HZX A;  3EQL C;  4A3D G;  1JCK B;  4QIW E;  3AEV A;  3TS2 A;  4L5S A;  4C1N K;  1SYC A;  1TS2 A;  4JI3 L;  4RGM A;  2I46 A;  3MFG A;  2VNU D;  1E7Z A;  1PH3 A;  4RGT A;  3L0O A;  2BE5 C;  1SR3 A;  3D3R A;  1I4P A;  1JB3 A;  2A6H C;  1BDO A;  1HNW Q;  2K4K A;  1I3Q H;  2WB1 B;  3GO5 A;  1TT2 A;  5DM6 3;  1UNS A;  3FPP A;  1SE4 A;  3TP7 A;  3J81 j;  1XMQ L;  4B3M L;  3S14 B;  4FAK A;  4OWW B;  3T1Y Q;  2BOS A;  1N33 Q;  1PH6 A;  1WCM G;  5M5X B;  2NTT A;  2V4D A;  3CKI B;  3QR8 A;  2K33 A;  1NSN S;  4B9W A;  3OMG A;  3FHW A;  3R3O A;  1EYG A;  1VQ5 A;  5CV5 A;  1O7Y A;  3ICE A;  2F0W A;  2NN6 G;  4YQ8 A;  4UHV A;  3Q8D A;  4NDX A;  2F0O A;  3ZYY X;  2JXM B;  2E5L Q;  4Q0F A;  5FKA C;  4DK3 C;  1PTO F;  5EPJ A;  3U9O A;  5EGT A;  4K2L A;  2JA7 G;  4PQX A;  1SEB D;  1KC8 C;  3HOU H;  3MHB A;  1F9S A;  2EXD A;  1TS5 A;  2R92 H;  1IL2 A;  1CHQ D;  1K28 A;  1ROD A;  1EY7 A;  1JMC A;  5M5Y H;  5FK9 C;  4YY3 Q;  4YPZ A;  1PMR A;  4QCL A;  1EWC A;  3TQY A;  3S2H H;  1CHP D;  3GTK H;  2M9V A;  3H0G H;  4P74 A;  2UUC Q;  5TSS A;  3MAQ A;  3RZO B;  1NR4 A;  3BZD B;  4KY6 A;  2VQF L;  2F0G A;  3NK6 A;  3FDT A;  1C0A A;  4FO2 A;  3J81 E;  3L3O C;  2EJM A;  3MXN B;  3HOY H;  4AYB G;  2N88 A;  2NVX H;  3GYQ A;  3MZ5 A;  1VQL A;  3A7A B;  2ZTC A;  2F4V Q;  2QIL A;  2FMC A;  2PO4 A;  4B3S L;  5D65 A;  3R93 A;  4XT3 B;  5C5M A;  4JI5 L;  2R92 G;  4DV7 L;  2DNC A;  2KCM A;  3PO2 B;  2PQA B;  2QKI C;  4L6T B;  4KD4 A;  5C3W A;  2F0D A;  3NQT A;  4LAA A;  1T9H A;  4EQP A;  1BR9 A;  1PVO A;  4ZUI A;  4CJ0 B;  3J81 c;  2O4X A;  1I4Q A;  3S1Q B;  1K73 C;  1HA5 A;  3I2Z A;  4B9X A;  4DV3 L;  3M4Q A;  3MC0 B;  4QY7 A;  4YY3 L;  2QDB A;  2AQ1 B;  1DOL A;  1D5M C;  1YJN A;  4YQN A;  1J5E Q;  2A6H D;  3HOX B;  4PMC A;  3S9W A;  3S16 H;  5IGF A;  2HHH L;  1STG A;  1VF7 A;  1AE2 A;  2F3V A;  4YQG A;  2NBF A;  2F0E A;  2XIW A;  4JK1 C;  3VR4 A;  4G57 A;  2QA4 A;  4DV5 Q;  1SSO A;  2HT1 A;  1PYW D;  1B50 A;  3URY A;  5JOB A;  1AEX A;  1NR2 A;  2EY1 A;  2K5W A;  1GJX A;  1XWE A;  3EFX D;  1YIT A;  2KHS A;  2FIN B;  2I5L X;  1EU4 A;  2TMP A;  1KNA A;  1ET9 A;  1VS0 A;  2F0L A;  4YQ7 A;  3H91 A;  4DPG A;  3A55 A;  4YQL A;  5IIF A;  3ERQ A;  1Q7Y C;  2PNH A;  1D5X C;  3BVM A;  2VXW A;  1JJG A;  4CDD C;  4B3T L;  1ZJR A;  4C3I G;  2I6D A;  1IYV A;  3KBG A;  5C4X B;  1RHP A;  1AE3 A;  3OPO A;  1G6P A;  4C56 C;  4DR5 L;  3NK7 A;  5GAH C;  4DR5 Q;  1HFG A;  5LMN L;  3T1H Q;  2ZXO A;  1O6D A;  3WOE A;  3E0E A;  4YVH A;  1K8M A;  2WKC A;  4KK7 A;  5GAG C;  4FP5 D;  4JWJ A;  1GM5 A;  3CPW A;  4LF5 L;  3S16 B;  3CCJ A;  1SRO A;  2DJG C;  4DAM A;  4XQQ A;  4JI4 L;  2NVT H;  4EQN A;  3BZC A;  4A3F H;  4YQB A;  4DR4 Q;  2SDF A;  1NXZ A;  4FXK C;  1B44 D;  4LUZ A;  4YPW A;  4IQZ A;  1N32 L;  3I55 A;  1PH9 A;  1DOK A;  3SXH A;  2O5J C;  1TII D;  3SGI A;  4JAL A;  4H3Z A;  2F0I A;  4JPB W;  1HPC A;  2E2I H;  4DV6 Q;  2ALY B;  2KJX A;  4H0L C;  1NCV A;  1OY5 A;  1EOV A;  4KD3 A;  1HNX Q;  4XQN A;  1OXT A;  3D4W A;  4QL5 A;  2OTL A;  1LTB D;  3H0G G;  2B63 B;  1FYC A;  3BJU A;  4DAY A;  1VF5 C;  2OXP A;  4YWL A;  2GN5 A;  1NNX A;  1SYF A;  2OEO A;  2B2W A;  4DK0 A;  5CV6 A;  1HQR D;  2ZJQ A;  1BVS A;  2ZTD A;  4PV1 C;  4JBW A;  3J7Z C;  4A76 A;  2JYO A;  4CKC A;  2LY7 A;  5M5Y B;  2K52 A;  1QCB D;  1SFO H;  1EFI D;  4M1U B;  4HJ5 A;  1R9T B;  3MXU A;  3NTH A;  2EVB A;  4OON A;  2JE6 I;  5A35 A;  3A8K E;  2KUM A;  1K3R A;  4PMW A;  1SDF A;  1A2U A;  1W2B A;  1CA6 A;  4TVA B;  3DCM X;  1EY6 A;  4LF8 Q;  5ELC A;  2VY3 A;  1PDQ A;  3RR5 A;  1QJO A;  3ILK A;  5KGU A;  1VQP A;  1K83 H;  1PHJ A;  2KBN A;  3GV6 A;  2NVQ B;  1LM0 A;  1P16 A;  1NBW A;  2FXQ A;  5J39 A;  1RTO A;  2B8G A;  2F0J A;  5IGD A;  4H3Y A;  4R8N A;  4LF6 L;  3HOX G;  1ASZ A;  3H94 A;  2VW9 A;  3OIP A;  3HKZ G;  1EZ6 A;  2G9H D;  3GTG B;  1YJW A;  1V1P A;  4LF9 Q;  4A3L H;  2PPB C;  4Y7N B;  3M3Y H;  2I07 B;  3OIQ A;  3EJI A;  5EBC A;  2F3I A;  4MCC A;  4ZQ3 A;  4KKS A;  4H13 C;  2NN6 H;  2X6G A;  1YBY A;  1MBY A;  3LGJ A;  4DV6 L;  5IGB A;  1VDZ A;  4J6H A;  1VQ8 A;  5CC4 A;  2ZM6 L;  4G7O C;  2EY2 A;  2B3G A;  1O7L A;  2DY8 A;  1K9M C;  3PGZ A;  1EY4 A;  1WCM H;  3ER0 A;  2B63 G;  4FF3 A;  4OO1 G;  5C4H A;  4B3M Q;  1H9S B;  1G6Z A;  1ZXT A;  4DNT B;  2B2W C;  4A3I H;  1H9M A;  4YQQ A;  5I4D A;  1PTO B;  1VQM A;  4C3J G;  2D0P A;  3GTM H;  2YTY A;  2H4O A;  5EQ0 A;  1ILQ A;  3S17 H;  4JI2 L;  3W1G A;  3G4S A;  1K0S A;  1VQC A;  3M4Y A;  4EQO A;  4CKE A;  4IJH A;  1CKN A;  4OHJ A;  1L0Y B;  2D62 A;  1V9P A;  1QZH A;  3FP9 A;  1Q86 C;  2KEE A;  2L12 A;  2E2J H;  4FMW A;  2Y0S G;  2O3A A;  4RH6 A;  3HKZ E;  3DWP A;  2WIN B;  5IYD G;  1UE1 A;  3K81 C;  1HUN A;  4HMJ A;  3X3N A;  1HJP A;  3H3V C;  1S5E D;  2VS1 A;  4A3J H;  2L15 A;  2NB0 A;  1W6J A;  1ONL A;  5EPK A;  3CCV A;  3U58 A;  3OTO L;  3DLL A;  3BS1 A;  4LWC A;  2RHQ B;  1NMF A;  1N34 L;  1PRT D;  1VMP A;  4OL7 A;  5C4J H;  3LWE A;  2IL8 A;  1JWU D;  1DGS A;  3J81 i;  3TS0 A;  1C8C A;  5FO7 B;  1NJI C;  4CNG A;  4ZKC B;  3N6R A;  3VYS A;  1SYG A;  1XPR A;  2A5H A;  2ICE C;  4JWG A;  2VQE L;  3OSO A;  5HUR A;  1CKO A;  3J7A 5;  2B2U A;  2ZTE A;  4LJZ C;  4UAI A;  1LTS D;  4DV5 L;  1VQI A;  4XIG S;  4LFA L;  4MHE A;  1EIG A;  2AMC B;  1XYI A;  5T1G A;  2KHJ A;  2PNR C;  2R7D A;  4DNI A;  2N49 A;  3SDZ A;  4IFD I;  4DR3 Q;  4JBM A;  4JI0 L;  4ZKB B;  3M3Y B;  5BN3 A;  1X7P A;  3PO3 B;  3I73 A;  1A15 A;  2Z4H A;  3I4N B;  1JJ2 A;  3Q6S A;  4X6A H;  3M85 A;  1O78 A;  2X69 A;  4UPA A;  1VQO A;  3DHQ A;  2EYJ A;  1XMO Q;  1LT5 D;  1HFN A;  1CSP A;  3BU2 A;  1QNK A;  3T51 B;  3V96 A;  4F88 A;  1V6Z A;  4JI2 Q;  4LMQ D;  4KMU C;  1V43 A;  1GXD C;  2EDG A;  4RMF A;  3A8I E;  1EU3 A;  2EOT A;  4S3S A;  3HOW B;  2K50 A;  4L63 B;  4A4I A;  1G91 A;  2P5Z X;  3I3C A;  1J85 A;  1EUJ A;  3STB C;  4X64 L;  4PNY A;  1D1K A;  4GN4 B;  4X64 Q;  5KNC A;  4KDZ A;  1HR0 W;  4X3K A;  3PQI A;  3RNU A;  2I0Q A;  1YNN D;  5E7N A;  5BN4 A;  4A3K G;  2IPK D;  3QOL A;  3E9H A;  2G9D A;  3K5L A;  1CKM A;  5E1F A;  1N8R C;  3OII A;  4HCE A;  2CFM A;  1F9P A;  1YNJ D;  5AJ3 Q;  4A3I G;  4GLV B;  1BCP D;  3T13 A;  4DR3 L;  1X9N A;  1VHY A;  3TP5 A;  1VQE A;  5DM7 3;  3J80 E;  1JR0 D;  1FR3 A;  4CDE C;  5I6W A;  5JEA H;  1KDB A;  5EAY A;  1RD9 D;  3VA7 A;  4DV2 Q;  2VQF Q;  1FD7 D;  1G51 A;  1KL9 A;  3DXJ C;  1UAM A;  1GOZ A;  2FMM A;  1V1O A;  4RHS A;  4DR2 L;  1EL0 A;  2EYM A;  3MEH A;  3GTG H;  4C3J B;  4BY7 H;  3E0J A;  2R93 G;  4YPY A;  4WJW A;  4JOI C;  3ONP A;  3GTQ B;  4FF4 A;  4GS3 A;  5CV8 A;  3KJP A;  1UAK A;  2RA4 A;  2XWB B;  4A3B B;  2NVQ H;  4ZUJ A;  2KHI A;  3OOC A;  2BH2 A;  3GTO B;  2A68 C;  2K5N A;  1AZQ A;  3O7B A;  2JA5 B;  1EY0 A;  3OW7 A;  2HDL A;  3ZJY C;  1DM0 B;  3FKI B;  4IUT A;  1XMO L;  4DR6 Q;  3KLS A;  2NVT B;  3IC6 A;  1WTW A;  4LF8 L;  1II3 A;  4CNE A;  4X3U A;  4YQD A;  5E4X A;  2HUG A;  2Z0S A;  1M90 C;  2K5Q A;  4DK1 A;  5JJK A;  4Y52 H;  3L9A X;  2HCC A;  3TRE A;  2DGY A;  4KGN A;  4CKB A;  3MVV A;  5G3L D;  4P2C B;  3EIV A;  1DXM A;  2A19 A;  4O0A A;  4CNF A;  1SYD A;  4OWT B;  3BVZ A;  1GUN A;  4DNR B;  1K0R A;  2R7Z G;  3KNU A;  1GD7 A;  3RZD B;  1Z9F A;  1HTL D;  1U4L A;  5C4X H;  1B9N A;  2E8G A;  4HMI A;  3J81 L;  4IUR A;  2YY8 A;  1YZ6 A;  2DNE A;  3QB3 A;  3HOU G;  2LSS A;  3CHB D;  1GUT A;  4YQK A;  5DNF A;  2IX0 A;  3C46 A;  5ISR A;  4LFB L;  5IP9 H;  1IBK Q;  1ENA A;  1Q82 C;  3GTL H;  3C1F A;  1J8I A;  3E3X A;  1YNN C;  2EXZ A;  2K7V A;  1IBM Q;  2D5D A;  4K6D A;  5CR3 A;  4JBJ A;  3GQB A;  2MQH A;  5M3M G;  4JOI A;  2AWN A;  4CJ2 C;  1WCM B;  1B2T A;  2E2H B;  1D2B A;  1R4Q B;  3E6Z X;  4JYA Q;  3A56 A;  4DR2 Q;  1PZK D;  1KAB A;  5LMU L;  2RSN A;  3RUZ A;  1IBL L;  4A3F B;  4BY7 B;  4ILW A;  3LX0 A;  2CW0 D;  4B3S Q;  1RCV D;  4ULL A;  2RF4 A;  2SNS A;  4I7Z C;  5C0X I;  2Q2H A;  2JA7 B;  4O1N A;  1PRT F;  3CPF A;  2LMC B;  2AWO A;  3NE5 B;  3CP0 A;  5J22 A;  1JC7 A;  2RDG A;  2C35 B;  1PLF A;  3U9S A;  1CA5 A;  1HQM C;  2EY5 A;  2F0H A;  3PUY A;  2YTX A;  4HID A;  3RZD H;  3E5S A;  4MTN A;  4NPS A;  1SNQ A;  5EKL A;  3TRZ A;  4JI6 L;  3O13 A;  3CME A;  1VQ9 A;  2JA8 H;  1GHJ A;  1TWG B;  3NBH A;  3MWY W;  3OW2 A;  4CDF C;  4KKU A;  4L5R C;  2K5H A;  2KCC A;  3HOZ G;  4DKA C;  4K5W A;  2B2T A;  3BDC A;  1WTV A;  1H9S A;  3KTY A;  4A3E G;  1Y1V G;  1VQ4 A;  4KY5 A;  4TQU S;  1I4G A;  3Q24 A;  1TXY A;  3TBI B;  4F87 A;  1X56 A;  2RBM A;  1UAJ A;  4ID6 A;  4DV7 Q;  1Y1V B;  1HZB A;  2H5X A;  4ZRZ A;  4BBS G;  2EJF C;  3HG9 A;  4V19 0;  2VUM G;  1X54 A;  1FL0 A;  1VQD A;  3I90 A;  4NXM Q;  3PV0 A;  2Q8T A;  2ENB A;  5BR8 Q;  4BY1 G;  3VYR A;  3I4L A;  4HJA A;  4JYA L;  1E2Z A;  1QWY A;  1CKN B;  2WII B;  2VUM B;  2B2V C;  2QGQ A;  3IL8 A;  5CGK A;  3MXP A;  1MI2 A;  1UEA B;  2F0V A;  1IKM A;  5CBA E;  2K05 A;  2PMZ E;  3D0F A;  4AQY Q;  2JEA I;  1LTG D;  2Q8R E;  1CK1 A;  4UP7 A;  4HCS A;  3OMC A;  1YVC A;  2F0S A;  1I3Q B;  4BXX H;  1UE6 A;  4IUN A;  2NZH A;  4PZ8 A;  1BBU A;  4DA2 A;  3I56 A;  3PCO B;  4IPG A;  5ELN A;  3S1M B;  1HZA A;  2ICI A;  3KF8 A;  4DN4 M;  3M7G A;  4CGY B;  2F4I A;  3CC4 A;  1LT6 D;  4UP9 A;  5HY6 A;  3SK6 A;  4FF1 A;  1F2L A;  4KI0 A;  3CC7 A;  2YU9 H;  2XN9 C;  4XXE A;  1V1Q A;  4OIJ A;  4YWK A;  2Z4I A;  5JEA J;  5BN5 A;  3HOW G;  1YJ9 A;  1IYJ B;  4OEM B;  3I4M G;  3L8U A;  2PI2 A;  3UDI A;  4RKL A;  5T1I A;  4XYO A;  5FLX E;  1QUQ B;  4HIM A;  1BCP F;  1W6K A;  3CCU A;  1IW7 D;  3G48 A;  4H44 C;  1WTX A;  5M3M B;  2BH8 A;  2RQX A;  4NMZ A;  3VR5 A;  4K5X A;  2KOL A;  4BBR G;  3PO3 H;  2UUA L;  1X3G A;  3DM1 A;  2JA7 H;  3Q22 A;  1AP0 A;  5H1S E;  1TQO A;  2GVA A;  4R4C A;  3I72 A;  3GP7 A;  3PF5 A;  4A93 B;  1VH0 A;  1Q90 A;  1STA A;  4V0B A;  4HSV A;  4B3T Q;  1WD0 A;  4KHV A;  4A3C H;  4QMG A;  3ERO A;  4UDU C;  4HIO A;  1E1T A;  3BBD A;  3SK4 A;  4JI7 Q;  1EWH A;  2RHS B;  1BBW A;  2QEJ C;  2OQ0 A;  3OTO Q;  1P8L A;  2R7F A;  4DUZ L;  3UDF A;  2QEX A;  2WAC A;  2J4X A;  4QB4 A;  2JSO A;  5C3E G;  1KDA A;  4N8F A;  1EEF D;  1EIH A;  1F77 A;  5LMU Q;  3I70 A;  2N8N A;  2K75 A;  1EYD A;  4DF7 A;  1HNZ Q;  3T53 B;  2B2V A;  4JI5 Q;  4ME5 A;  1KTK A;  2UUB Q;  2EE1 A;  4A3B G;  5C3E H;  4AH6 A;  3PIO 3;  2GVB A;  1YI2 A;  2MO0 A;  1VQB A;  2K01 A;  3CC2 A;  1MIU A;  1NE3 A;  2K6A A;  4A93 H;  3T16 A;  5ELE A;  1U9R A;  5J1Z A;  4YQ9 A;  1F2M A;  1X7O A;  2N55 A;  3WOF A;  2VB2 X;  5GMC A;  1EOT A;  4X3S A;  2Y0S B;  5HGT A;  4FF2 A;  1UEB A;  5JPM C;  1Y1W H;  5IYB G;  3I4M B;  2PYK A;  4DV2 L;  3KDF A;  4IUU A;  4J15 A;  1DON A;  3UDX A;  4AYB B;  1EY5 A;  3QO2 A;  4BWG B;  4BS9 A;  4N9P A;  3A8J E;  3TP6 A;  5IYC H;  4YCV A;  2M2L A;  1FNU A;  3AYH B;  4RGO S;  2JA5 H;  4UP8 A;  4LF7 L;  1LT4 D;  1H9K A;  2JEB I;  1LUZ A;  1SMY C;  5JVH 3;  2FJ2 A;  1VHK A;  4RCO A;  1CQF A;  4GN3 B;  5IGC A;  1JB7 A;  4YQ6 A;  1XNQ Q;  4QGU A;  3S1M H;  5EKK A;  1XNQ L;  2WKD A;  3AB9 A; 
#chains in the Genus database with same CATH homology
 2Y0S G;  3M9B A;  3MEF A;  3GTQ H;  2O3A A;  3HKZ E;  1VCI A;  4GNX C;  2R93 H;  1HR0 L;  4GKK L;  1HZ9 A;  4P75 A;  4X66 Q;  5IYD G;  3U4Z A;  3KF8 B;  1IPA A;  1UE1 A;  3L7Z C;  3HKS A;  2E2H H;  4YCW A;  3K81 C;  4JI8 L;  4HJ8 A;  4A3J G;  3S1R H;  1K8A C;  2JA6 H;  1OXU A;  2HIV A;  2YV5 A;  3S1Q H;  1EQR A;  3KLW A;  5M3F H;  1HJP A;  4IOA A;  3PUZ A;  2VS1 A;  4IPD A;  3AQQ A;  1XMQ Q;  4A3J H;  2WAQ E;  2L15 A;  3GDE A;  4C3I H;  5JEA G;  5C44 G;  3AXZ A;  3CMA A;  3F2B A;  3CCV A;  3U58 A;  1K8G A;  3OTO L;  4YWM A;  3DLL A;  4LWC A;  2RHQ B;  1NMF A;  1N34 L;  2OWO A;  1VQG A;  4JWH A;  5C4J H;  4ME3 A;  3J81 i;  1DGS A;  3TS0 A;  3PO2 H;  5JJL A;  1NJI C;  3A0J A;  1QVC A;  4JAK A;  4ALP A;  3E9I A;  3HOW H;  4CNG A;  3GTJ H;  4X3L A;  1MXI A;  3OIJ A;  1WOC A;  4GOP A;  1XPR A;  2JA5 G;  4JWG A;  4YQA A;  3NEL A;  2VQE L;  2V1C C;  3F8T A;  4P71 A;  3PSI A;  3G6E A;  4DR4 L;  4A3E H;  2CCZ A;  4LUV A;  2IY5 B;  1CKO A;  3J7A 5;  1KIX A;  2ZTE A;  3KYH C;  1CUK A;  4OWX B;  4X62 L;  1L2F A;  1KRT A;  4YCU A;  5FJ8 G;  4DV5 L;  1KD1 C;  1I94 L;  1VQ6 A;  1VQI A;  1YEZ A;  4A3C G;  4KHP Q;  4YQ4 A;  5FLM G;  4XIG S;  2OQK A;  4LFA L;  4DV4 Q;  4LF9 L;  2Z6K A;  4A3M G;  2JJQ A;  4PZ7 A;  1PV4 A;  2ASB A;  4JI3 Q;  2AMC B;  2UUA Q;  2A1A A;  2EGW A;  3KY7 A;  4YQ2 A;  2F4V L;  4BA1 I;  3RZO H;  5FJ8 H;  2Q2U A;  2KHJ A;  1JT8 A;  4YQ1 A;  4YVI A;  3CCE A;  2R7D A;  4DNI A;  3PO3 G;  5AJ3 L;  2N49 A;  1Y14 B;  4DUY L;  4IFD I;  4DR3 Q;  3HOV H;  1P9P A;  4MZ9 A;  1C9O A;  3D31 A;  4JBM A;  4JI0 L;  4YVJ A;  2R7Z H;  4A3G G;  3CW2 C;  5IP7 H;  2ZM6 Q;  3CXC A;  1EQQ A;  1SE8 A;  2ZJP A;  1FJG Q;  2DUD A;  1X7P A;  1VQA A;  4P73 A;  3CCQ A;  1C7Y A;  3S14 H;  4YQC A;  4K0K Q;  1JJ2 A;  3WWV A;  4X6A H;  1L1O A;  2ID0 A;  3M85 A;  4UPA A;  1VQO A;  2A8V A;  3GTO H;  4DR6 L;  1E3P A;  1L1O B;  1U0L A;  2D0O A;  3T1Y L;  1XMO Q;  1KQS A;  3CF5 A;  4IPC A;  1CSP A;  2K5V A;  3BU2 A;  4YQJ A;  1XPO A;  1U5K A;  4LF7 Q;  1V6Z A;  5IYC G;  4A3G H;  2JA9 A;  1Q46 A;  1TWG H;  2JK8 A;  3B6Y A;  4JI2 Q;  5IY0 A;  3HOX H;  4NB3 A;  4GNX A;  4LF5 Q;  1V43 A;  4LNQ A;  3K7A H;  2QMM A;  4RMF A;  4YQ3 A;  3STB D;  1XNR Q;  4DAY B;  1TWF H;  2K50 A;  2MO1 A;  5M3F G;  1IBL Q;  4UY8 C;  4LFC Q;  1JJC B;  4A4I A;  1Y1W G;  2XGT A;  1E22 A;  4LFC L;  4LF6 Q;  1D8L A;  1J85 A;  1B70 B;  1EUJ A;  3STB C;  4A3M H;  4X64 L;  1WFQ A;  3A5U A;  4GN4 B;  1XPU A;  4X64 Q;  2Q2I A;  1VQF A;  2WB1 G;  4CND A;  1HZC A;  4IOC A;  1HR0 W;  3PIP A;  4KDZ A;  4MCD A;  3W1B A;  4X66 L;  3RNU A;  4NXN Q;  4YQ0 A;  1KRS A;  1BKB A;  2I0Q A;  2EGV A;  1FGU A;  2WP8 J;  5E7N A;  4A3K G;  3HFZ B;  2UXC L;  4GLX A;  3BBE A;  3E9H A;  4PG3 A;  1KXL A;  1CKM A;  1N8R C;  4A3F G;  3OII A;  2Q2T A;  1YHQ A;  1A62 A;  2CFM A;  4XTC S;  5IWA L;  4YPX A;  2UXD Q;  1RL2 A;  4B3R Q;  1SN8 A;  4IFD J;  2UXD L;  5AJ3 Q;  4A3I G;  4GLV B;  1YIJ A;  4J3C A;  4GN5 A;  4JI1 L;  4X65 Q;  4DR3 L;  3PIO A;  4HJ9 A;  1X9N A;  4JI0 Q;  4WJ3 M;  3A5Z B;  4A3L G;  1GZ0 A;  2WAQ G;  2OCE A;  1VHY A;  1VQE A;  4YQT A;  3GTP H;  1UE5 A;  4L5Q A;  4DR1 L;  4BY1 H;  1UE7 A;  2HHH Q;  5EAY A;  2UXB L;  4BBR H;  1VQK A;  4YHH Q;  4OX9 Q;  2CX8 A;  2UXB Q;  1YNX A;  3VDY A;  4YHH L;  2ZJR A;  4DV2 Q;  4OX9 L;  3AFP A;  2VQF Q;  1G51 A;  1HNZ L;  4JV5 L;  1TWA H;  1SRU A;  4KLK A;  1D7Q A;  1KL9 A;  3JAM c;  1QVF A;  1S3O A;  1WYD A;  2ATW A;  3QUV A;  4A3D G;  3TS2 A;  4QIW E;  4X62 Q;  3AEV A;  1UAM A;  4L5S A;  4DR2 L;  3GTG H;  1R9T H;  5GAD C;  4JI3 L;  4BY7 H;  2R93 G;  1I50 H;  1N36 L;  4YPY A;  1GVP A;  4JOI C;  1E7Z A;  1EIF A;  1PH3 A;  2VNU D;  3KW2 A;  2IT1 A;  3L0O A;  3ONP A;  2NN6 I;  1FVI A;  3TEH B;  4GS3 A;  1SR3 A;  3KFU A;  3KJP A;  1WI5 A;  3CAM A;  4KHZ A;  3S2D H;  1UAK A;  4IFD G;  1Z85 A;  1Z47 A;  1OXV A;  2LXK A;  2NVQ H;  1Q1B A;  2BA0 A;  5C0X G;  1HNW Q;  2K4K A;  2KHI A;  1I3Q H;  4QQB X;  2HIX A;  3F2D A;  3GO5 A;  2VZA A;  4JI8 Q;  2BH2 A;  3M7N A;  4DR7 Q;  1FJG L;  2K5N A;  3O7B A;  1XMQ L;  3J81 j;  4B3M L;  4AIM A;  4DV1 Q;  4GOP B;  3CD6 A;  4IPH A;  4FAK A;  3ZJY C;  4OWW B;  3I4N H;  3T1Y Q;  1CSQ A;  5GQO A;  5IWA Q;  3H15 A;  1WCM G;  1XMO L;  1PH6 A;  3CQZ H;  3U50 C;  1N33 Q;  4DR6 Q;  3IC6 A;  4LF8 L;  4CNE A;  1L1O C;  1X6O A;  4YQD A;  1PH2 A;  2Z0S A;  3FHW A;  1M90 C;  1EYG A;  1VQ5 A;  1QUQ A;  3ICE A;  4EX5 A;  4GKJ L;  2NN6 G;  4Y52 H;  5JJK A;  4YQ8 A;  3Q8D A;  3TRE A;  2DGY A;  4KGN A;  2E5L Q;  3J80 c;  3E5Y A;  3DM3 A;  3EIV A;  4O0A A;  2A19 A;  4DK3 C;  4CNF A;  4OWT B;  1NS5 A;  5IP7 G;  1LYL A;  3GD7 A;  2K14 A;  2R7Z G;  1K0R A;  1OXX K;  2JA7 G;  3KNU A;  1GD7 A;  1KC8 C;  1Z9F A;  1Q81 C;  2UUB L;  3HOU H;  1B8A A;  4JG2 A;  5C4X H;  2EXD A;  3EN2 A;  5GRO A;  2E8G A;  2R92 H;  2YY8 A;  1IL2 A;  1SMX A;  5FLX c;  1I5F A;  4JC0 A;  1YZ6 A;  5IYD H;  4MCB A;  4P72 A;  4O2D A;  4OO1 I;  2KCT A;  3HOU G;  1X3F A;  2LSS A;  1Q12 A;  4MNO A;  5M5Y H;  1JMC A;  4YQK A;  1S72 A;  4YY3 Q;  5K36 G;  4JI1 Q;  4X65 L;  3EBE A;  4YPZ A;  3ERS X;  2IX0 A;  3TQY A;  3S2H H;  4IO9 A;  3AI9 X;  4A75 A;  5IP9 H;  1IBK Q;  3GTK H;  4LFB L;  1Q82 C;  3H0G H;  4P74 A;  3JC6 6;  3GTL H;  2UUC Q;  2IHE A;  3BBH A;  1PYS B;  3UE0 A;  5M3M H;  2UUC L;  2IX1 A;  4K0K L;  4E8B A;  2AHO B;  1IBM Q;  2VQE Q;  4JBJ A;  2VQF L;  5BR8 L;  2MQH A;  3NK6 A;  5M3M G;  1C0A A;  4JOI A;  2AWN A;  3PF4 A;  3PUX A;  1EIY B;  4HJ7 A;  2HA8 A;  4JYA Q;  5C0X J;  3MXN B;  2OTJ A;  3HOY H;  2XTI A;  4AYB G;  4DR2 Q;  4A3D H;  5ELO A;  5LMU L;  2NVX H;  3GYQ A;  5GAE C;  1IBL L;  1VQL A;  2ZTC A;  1OXS C;  2YYZ A;  2F4V Q;  3JAM i;  4B3S Q;  4JCV E;  3S1N H;  4B3S L;  5J3B A;  3RLF A;  2RF4 A;  1E1O A;  5C0X I;  1ASY A;  3I4O A;  2Q2H A;  3K8A A;  4JI5 L;  3UE1 A;  2KCM A;  4DV7 L;  2R92 G;  1EWI A;  2PQA B;  3CPF A;  2AWO A;  3CP0 A;  4GKK Q;  1A8V A;  3CCM A;  2UXC Q;  3KF6 A;  4LF4 Q;  5GMB A;  2C35 B;  3KJO A;  1T9H A;  1PVO A;  3J81 c;  1NMG A;  4JI7 L;  3PUY A;  1K73 C;  3I2Z A;  2YTX A;  4HID A;  3RZD H;  4B3R L;  4DV3 L;  3I4M H;  1A0I A;  5GM8 A;  3M4Q A;  4MTN A;  2PQA A;  2I5H A;  4NPS A;  1GKH A;  2WFW A;  4QY7 A;  1N34 Q;  4YQI A;  4YY3 L;  5C44 H;  3TRZ A;  3CCL A;  1PH8 A;  3KDF B;  4JI6 L;  3CME A;  4JI6 Q;  1VQ9 A;  1NY4 A;  2EQS A;  2VL6 A;  1YJN A;  2JA8 H;  1J5E Q;  4YQN A;  4YVG A;  4RG1 A;  2JA6 G;  3OW2 A;  3S16 H;  4DR1 Q;  1MJE A;  4L5R C;  1MKH A;  2HHH L;  2K5H A;  1A63 A;  3HOZ G;  4BBS H;  3G71 A;  4DKA C;  2V3J A;  1AE2 A;  3IRB A;  1XJV A;  2E5L L;  3HOY G;  4YQG A;  5FLM H;  4GNX B;  4AQY L;  2JA8 G;  5JJI A;  2QA4 A;  4DV5 Q;  1I94 Q;  2N78 A;  2HT1 A;  4IG6 A;  4H02 A;  3RN2 A;  3KTY A;  2BA1 A;  4YQS A;  4A3E G;  1Y1V G;  1N32 Q;  1VQ4 A;  1VQH A;  1KAW A;  4TQU S;  4DV4 L;  1PH5 A;  2UU9 Q;  1N36 Q;  2UU9 L;  1PYB A;  1RIP A;  4IJL A;  1YIT A;  1TXY A;  1YHA A;  3M4O H;  2I5L X;  3N4J A;  1X56 A;  1B7Y B;  1VS0 A;  4YQ7 A;  4DPG A;  3H3V I;  1UAJ A;  1Y1V H;  4YQL A;  2KEN A;  4GOP C;  2V3K A;  1Q7Y C;  4DV7 Q;  2PNH A;  3PO2 G;  1JJG A;  2CKZ B;  1HZB A;  4R4Q A;  4B3T L;  2H5X A;  1HNW L;  1ZJR A;  3K80 C;  4LFB Q;  2I6D A;  1AE3 A;  3I7F A;  1G6P A;  3HOZ H;  4BBS G;  1I6H H;  2VUM G;  4DR5 L;  3NK7 A;  5GAH C;  1X54 A;  1FL0 A;  3KOJ A;  5LMN W;  4DR5 Q;  1VQD A;  4DV1 L;  1IBM L;  2CQO A;  1N33 L;  4NXM Q;  3PV0 A;  5LMN L;  3RLN A;  3T1H Q;  1O6D A;  2R6G A;  3E0E A;  4YVH A;  5BR8 Q;  4BY1 G;  3RN5 A;  1V2X A;  1VQN A;  5GAG C;  3N4K A;  4HJA A;  1EFW A;  3ULL A;  4JYA L;  4JWJ A;  1GM5 A;  3CPW A;  1HH2 P;  1CKN B;  3ULP A;  4YQ5 A;  4GKJ Q;  4POF A;  2RCN A;  4LF5 L;  3CCJ A;  1PA6 A;  2QGQ A;  1SRO A;  2QWV A;  1VQ7 A;  3H3V H;  4DAM A;  4JI4 Q;  4POG A;  4JI4 L;  2NVT H;  1PFS A;  4YQB A;  3BZC A;  2NVY H;  4A3F H;  4JBK A;  4DR4 Q;  1NXZ A;  2PMZ E;  2Y0S E;  3D0F A;  4AQY Q;  2JEA I;  3HOV G;  4YQO A;  4LUZ A;  4FMW A;  5FAI A;  4YPW A;  4UP7 A;  1N32 L;  1X65 A;  4FDB A;  3I55 A;  2IHF A;  1YVC A;  1PH1 A;  4XBO A;  4BXX H;  1PH9 A;  1UE6 A;  3SGI A;  3BZK A;  2HQL A;  4JAL A;  2MFI A;  2NZH A;  2B63 H;  4H3Z A;  4PZ8 A;  1BBU A;  3I56 A;  1MJC A;  1XTD A;  3PCO B;  5IYB H;  4DV6 Q;  4IPG A;  2AKW B;  2ALY B;  5ELN A;  2E2I H;  4DV3 Q;  1OY5 A;  3CCR A;  3F1Z A;  1EOV A;  1HZA A;  3KF6 B;  3K7U C;  1O7I A;  3NBH B;  1HNX Q;  3CCS A;  2N3S A;  1PH7 A;  4UP9 A;  3CC4 A;  5HY6 A;  4KI0 A;  1OXT A;  3CC7 A;  2YU9 H;  1V1Q A;  1IXR A;  4YWK A;  4QL5 A;  2OTL A;  5JEA J;  1OTC A;  3HOW G;  4BY7 G;  1YJ9 A;  1IYJ B;  3I4M G;  3H0G G;  3L8U A;  2PI2 A;  3UDI A;  4LUO A;  5CO4 A;  1QZG A;  1Q8K A;  3BJU A;  4NXM L;  4LW1 A;  1QUQ B;  4HIM A;  2Z6K C;  3CCU A;  4YWL A;  2GN5 A;  1KHI A;  3G48 A;  3S15 H;  2BH8 A;  5D9F A;  3ULJ A;  4BBR G;  4DK6 C;  1Q1E A;  4QJF A;  2UUA L;  1X3G A;  2B29 A;  3PO3 H;  2JA7 H;  2ZJQ A;  1BVS A;  3PUV A;  2ZTD A;  1M1K C;  4YQR A;  1J6Q A;  3I4N G;  4JBW A;  2GVA A;  5H1S E;  3J7Z C;  4A76 A;  5C4X G;  4R4C A;  3IEF A;  3S24 A;  3W5O A;  3PF5 A;  1H95 A;  1TWC H;  1VH0 A;  2K52 A;  2I5M X;  1W3S A;  1SFO H;  4HJ5 A;  1HR0 Q;  1QVG A;  4B3T Q;  2YTV A;  4OON A;  4A3C H;  2MNA A;  4AYB E;  4HIO A;  1E1T A;  2JE6 I;  4C3H H;  4LF4 L;  2NZO A;  3BBD A;  2WB1 E;  2F52 A;  4HIK A;  1PH4 A;  3AFQ A;  4JI7 Q;  1K3R A;  4PMW A;  2RHS B;  1W2B A;  4DV0 L;  4TVA B;  2LXJ A;  1BBW A;  3RLO A;  5IT9 c;  4DV0 Q;  3DCM X;  3A74 A;  4LF8 Q;  4YQP A;  2OQ0 A;  2VY3 A;  4GLA C;  3OTO Q;  1P8L A;  3RR5 A;  1E24 A;  2R7F A;  4DUZ L;  1L0W A;  3UDF A;  2QEX A;  4R1J A;  1TWH H;  1HNX L;  3ILK A;  5C3E G;  1VQP A;  4BA2 I;  1K83 H;  1PHJ A;  1TO0 A;  2KBN A;  5IP9 G;  2EIF A;  1LM0 A;  1P16 A;  1NBW A;  2FXQ A;  1J5E L;  3FKI G;  5LMU Q;  4WJ4 A;  1XNR L;  2N8N A;  2CWA A;  2K75 A;  3F2C A;  4H3Y A;  4LF6 L;  1YHB A;  5DLQ E;  4JV5 Q;  1HNZ Q;  2Z0Y A;  1GO3 E;  4R4I A;  3HOX G;  1ASZ A;  4YVK A;  2VW9 A;  4JI5 Q;  4L69 A;  3HKZ G;  3FKI H;  3OIN A;  3NEN A;  2UUB Q;  1YJW A;  2PI2 E;  4NXN L;  4A3B G;  4LF9 Q;  1G29 1;  5C3E H;  4KHP L;  4AH6 A;  4A3L H;  2GVB A;  4A93 G;  1YI2 A;  4X3M A;  3M3Y H;  1UAL A;  5M5W H;  2MO0 A;  1UWV A;  1VQB A;  3AIA A;  3CC2 A;  1MIU A;  1NE3 A;  2F3I A;  4L5T A;  4MCC A;  4PZ6 A;  4R4T A;  2CWP A;  1WJJ A;  4A93 H;  3NEM A;  1YBY A;  3LGJ A;  1LTL A;  4A3B H;  4PZK A;  4DV6 L;  4DUY Q;  4A3K H;  4YQ9 A;  1X7O A;  1JE5 A;  1IBK L;  5GMC A;  1N9W A;  1VQ8 A;  2ZM6 L;  2ES2 A;  2B3G A;  1IZ6 A;  1K9M C;  4APV A;  3PGZ A;  1UEB A;  2VUM H;  1WCM H;  3ER0 A;  4OXP A;  2B63 G;  1S40 A;  3K0X A;  1X55 A;  2E2J H;  4DR7 L;  4OO1 G;  4C3J H;  3PUW A;  5IYB G;  4Y7N H;  5IE8 A;  1Y1W H;  4EQ5 A;  5HGQ A;  4DV2 L;  3KDF A;  4C2M H;  4J15 A;  4R4O A;  4B3M Q;  4BXX G;  3UDX A;  5M5X H;  4A3I H;  4YQQ A;  1VQM A;  5LMN Q;  2D0P A;  3T1H L;  2YTY A;  3GTM H;  5IYC H;  4JWF A;  4YCV A;  4DUZ Q;  3S17 H;  3AYH B;  3M4P A;  2JA5 H;  3W1G A;  4UP8 A;  1NTG A;  3J80 i;  4LFA Q;  3G4S A;  1VQC A;  2JEB I;  4JI2 L;  3UDG A;  4LF7 L;  1LUZ A;  4IJH A;  1CKN A;  1VQJ A;  3U4V A;  2D62 A;  1VHK A;  1V9P A;  1QZH A;  3FP9 A;  1AH9 A;  4GN3 B;  1Q86 C;  1JB7 A;  4YQ6 A;  1SLJ A;  3OYY A;  1XNQ Q;  1X3E A;  4QGU A;  3S1M H;  2JQO A;  1XNQ L;  3L2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...