4RG1A

Methyltransferase domain of c9orf114
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
Knots found
sequence length
306
structure length
285
Chain Sequence
RGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQACVQLARILQYLECPQYLRKAFFPKHLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLTQAGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human C9orf114 in complex with S-adenosyl-homocysteine
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords C9orf114
total genus 89
structure length 285
sequence length 306
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02598 Methyltrn_RNA_3 Putative RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4rg1A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4rg1A01
1CUKA 1IZ6A 1IBKQ 2WFWA 2H5XA 3BBEA 2YTVA 2HIXA 4DV7Q 3M3YH 1VQJA 3CCMA 2QA4A 4NXMQ 3PO2G 2ID0A 5FLMG 1QZGA 1SRUA 1OTCA 3H3VI 1PH7A 2YU9H 4DR6L 5GMBA 4IPCA 1JE5A 1SLJA 4GLVB 5IP9H 2UU9Q 2CWAA 1PH1A 1HJPA 3OYYA 3SGIA 3I55A 1CSPA 4P72A 4PMWA 3PF5A 3JAMc 4A3CG 4CNDA 4X62L 1UEBA 3PIPA 2UUAL 1W2BA 4YVGA 4DK3C 2XTIA 3HOZH 1VQ9A 4KI0A 4GLXA 2VNUD 1TWHH 1E1TA 1TWFH 1VS0A 1Q82C 2HQLA 2BH8A 3I2ZA 1Q7YC 4LF7Q 2V3JA 1VH0A 4X3MA 3CCQA 2PQAA 1QVGA 1VQ8A 1XNRQ 3S1MH 4LUVA 4DV3L 4DR2L 3GTOH 4BBSG 4KDZA 5BR8Q 1L2FA 3NK7A 3STBC 2FXQA 4X65L 3ULLA 2Q2TA 1XNQL 4IOCA 2IX1A 3MXNB 2LXKA 3M9BA 4YQIA 1VQIA 4DV7L 3KF6B 3GTJH 4L5QA 4R4IA 2UXBL 4KHPQ 4GS3A 4YVIA 3F2DA 4JI2L 2NVYH 2VUMH 4MCCA 3Q8DA 3GTPH 1IBLL 4OO1I 3M85A 3OINA 1OXUA 4JI4Q 3S2DH 3J81i 4UPAA 1N33L 3AFQA 3KJPA 1L1OC 4PZ8A 4JC0A 4AQYL 2E2IH 4DR3Q 2K5VA 5C44H 2UXDL 1YJ9A 2PMZE 3PIOA 1YVCA 1XMOL 3AEVA 1KXLA 1M1KC 4JI6L 2VUMG 4JG2A 4A3FH 1SR3A 3I4OA 4JBKA 2RHQB 2EQSA 2OTLA 4IFDI 1UAKA 3UDIA 1IBMQ 2NN6I 2OQ0A 3CXCA 5M3FG 3S2HH 1HZ9A 3CMAA 4P71A 4HIDA 1WJJA 3E9IA 4B3MQ 4DR4L 1QUQA 3CCEA 1MIUA 5AJ3L 4HIOA 1GM5A 1ASZA 1RL2A 3BJUA 4GKJQ 1KIXA 5IE8A 1HNZL 5ELOA 1VQBA 4C2MH 4A93H 1P9PA 1HZAA 4XBOA 4OXPA 1Y14B 2KCTA 3GDEA 4L5TA 5C3EG 1KL9A 4ALPA 1XPRA 3GTLH 3ER0A 3ZJYC 2VQEQ 3J7A5 4A3BG 1Q46A 4LNQA 2JA6H 1XJVA 4AYBG 3A0JA 4DUYL 1X9NA 2NZHA 3VDYA 1JJCB 1P16A 2K52A 4A4IA 4DV1L 4A3GH 4TQUS 4YWMA 3DLLA 3KFUA 4QQBX 4X64Q 1C0AA 4GN3B 1EOVA 4POFA 1HR0W 4A93G 1VQAA 2ZJQA 4CNGA 3HOYG 3EN2A 5FJ8G 1D8LA 4GN5A 1W3SA 3CCVA 3G48A 2JA7H 4GKKL 2OTJA 4LUOA 3IEFA 1CKMA 3HKZE 4EQ5A 3TEHB 2E8GA 1HZBA 4BY7H 1AE2A 1J6QA 1O7IA 4DV1Q 4JI6Q 3GTGH 2JA8G 2EGVA 4DR1Q 2ZJRA 4DV5L 3CC2A 3CCUA 4QIWE 1PHJA 3H15A 1K8AC 1VQGA 1VQEA 3HOXG 2UUBL 3PO3H 4LF6L 3DM3A 1DGSA 3PSIA 3M4OH 1UWVA 4HJ9A 1L1OB 2KENA 4HJAA 5LMNW 1K73C 1PH6A 1K0RA 1X54A 4DAYB 3KJOA 2R92G 4BY7G 5CO4A 4BBRH 3HOVH 5FLMH 4KHPL 2Q2HA 4A76A 4POGA 4UY8C 3KY7A 1NE3A 4GOPC 4YQAA 5M5WH 2RF4A 3FHWA 3OW2A 3S14H 5IP7H 2UUBQ 1IPAA 2Q2UA 4YQRA 2MFIA 4ME3A 1Q8KA 3F2BA 1SFOH 1N32Q 3NK6A 1A8VA 3NBHB 3CW2C 4BBRG 3HOVG 1JJGA 1YJWA 4A3MH 3CQZH 4A3IG 1WFQA 2CCZA 1SE8A 2MO1A 4WJ4A 5GQOA 1M90C 4H3YA 1IYJB 2LXJA 4GOPB 2IHEA 2R7FA 3F1ZA 2ES2A 1N33Q 4GKKQ 3DCMX 3UDXA 1X65A 1L0WA 1J5EL 1NBWA 1A62A 1IBLQ 4P75A 4YHHL 3RLFA 3RN5A 5GAGC 4JI2Q 2B29A 2UXBQ 1EIYB 3CCLA 1AH9A 1FGUA 1UE7A 1VQMA 1VHKA 4YQ0A 3RLOA 4H3ZA 4YQJA 1XTDA 2I5MX 4DV0Q 4JI5Q 1YHAA 2F3IA 2IT1A 4JCVE 3EBEA 2Y0SG 2LSSA 3K80C 2R93G 4YVKA 1E22A 4OWTB 1KAWA 1OXVA 4YCWA 3A5UA 5M5YH 2CWPA 1Q12A 1IBKL 3ERSX 4DR7L 5C44G 4OO1G 4YQ4A 3D31A 1G51A 4FDBA 2QWVA 1I6HH 1PH4A 4DR4Q 3KW2A 3S1QH 1SMXA 1E3PA 4A3FG 3TS2A 2D0OA 2V1CC 3CCJA 4GOPA 2VL6A 4HIKA 4LF8L 3RR5A 4QL5A 4X6AH 1Q86C 1I94Q 4YQTA 1QVCA 3CP0A 5GADC 2F4VQ 4UP7A 4IFDG 4GLAC 1X6OA 2VQFQ 4JBMA 3FKIG 3RZDH 3A74A 4AQYQ 3HOWG 5IY0A 1K8GA 3K7UC 1PA6A 5E7NA 1SN8A 3TQYA 1NMFA 2Y0SE 3AXZA 4JI4L 3KNUA 1RIPA 2JA5H 1CSQA 4A3BH 1E24A 2RCNA 4B3SL 1HNXL 4K0KQ 3ONPA 4A3KG 1FJGQ 1TXYA 2K5HA 1VQNA 4YQBA 4X3LA 3KF8B 1XNQQ 3J7ZC 4DV6L 1TO0A 2QGQA 3U4ZA 2MQHA 5IWAL 4DV3Q 4P74A 4DV4L 3J80i 1PH5A 4OWXB 2F52A 4LF5L 1IL2A 2ZM6L 4YPYA 4E8BA 1XMQQ 1C9OA 4MCBA 5H1SE 4YWLA 3UE0A 4LF4L 3KLWA 3KYHC 1X3EA 5GAEC 1J85A 2HA8A 4YY3L 4LFCL 1BBWA 3G6EA 2I5HA 4IPDA 3A5ZB 1UAJA 1OXTA 2B63H 2WP8J 3I7FA 3PCOB 1FVIA 4AIMA 3U4VA 5IWAQ 2HT1A 4IFDJ 1KC8C 1XPOA 5JJKA 1UALA 1V2XA 3ILKA 4YQ5A 4GNXC 2CFMA 4JI3Q 2ATWA 4QJFA 3GTKH 2A1AA 1TWAH 3E9HA 1G291 3BBDA 4L5RC 1LTLA 2EXDA 4GN4B 3PF4A 1PVOA 1EWIA 2ZTEA 1TWCH 4BY1H 2I6DA 3WWVA 2RHSB 4A3JH 4HJ8A 4NXML 2C35B 4TVAB 2R7ZG 1N32L 4YQ3A 3D0FA 1WYDA 3CC7A 1KD1C 4A3EH 2HIVA 4PZKA 1WCMG 1UAMA 4OONA 5K36G 4YQNA 1VQHA 3N4JA 2UUCQ 3H3VH 4KHZA 4DAMA 5C4XH 4A3LH 4BY1G 4YQDA 1VQDA 3PO2H 1FL0A 4YCVA 3I4MH 4A3MG 4JOIA 3CPWA 4JALA 3I4NG 1N36Q 4JI3L 2B3GA 3M4QA 1YHQA 3HKSA 3J80c 1YITA 5GROA 2IY5B 4O2DA 1Z85A 2MNAA 1JMCA 1KRTA 3G4SA 2HHHL 3W5OA 1KRSA 3CF5A 1WOCA 4OX9Q 1KQSA 4A3LG 5LMUQ 5C4XG 1YHBA 2BA0A 4DUZL 2I0QA 1GVPA 5D9FA 4A3DG 4B3TL 3HOZG 3L2PA 4WJ3M 3KTYA 4LF5Q 4YQ7A 4LW1A 1AE3A 2OCEA 4JI8Q 4HJ7A 2WB1G 4IJHA 4GNXA 3ICEA 2ASBA 4B3RL 3AQQA 3UDFA 1Q1BA 3F2CA 3PUXA 2Z0YA 4L69A 2UXCQ 2R6GA 3NENA 1YEZA 3AIAA 4IG6A 1HR0Q 2GN5A 4MZ9A 3KF6A 2N49A 4R1JA 1HNXQ 5ELNA 4A3IH 1U0LA 4K0KL 4A3DH 1HR0L 3ULJA 1HNWQ 1PV4A 2JJQA 4HJ5A 1YJNA 4NPSA 4B3RQ 4JV5L 3E0EA 4JI8L 3GTMH 3O7BA 3CC4A 1I50H 4B3TQ 3S15H 4A3CH 3BZCA 1R9TH 4J3CA 1OXXK 3S1RH 4UP8A 4YQSA 1VQLA 2K4KA 1XMQL 2YTYA 3RLNA 1MJCA 1O6DA 2K75A 1HZCA 1VQOA 4LF8Q 1PYBA 5HY6A 2DGYA 2WB1E 4MTNA 5C0XG 1GD7A 3TRZA 4RMFA 3PGZA 4J15A 1N36L 4BBSH 5IYCG 3S24A 4DR5L 1FJGL 2Z0SA 1XPUA 3L0OA 3F8TA 4XIGS 3CCRA 2Z6KA 4B3SQ 1VQFA 2JA5G 4AYBE 4DR7Q 3T1HL 3M7NA 2UUCL 1NTGA 1VQ4A 3KDFA 1Q1EA 1S40A 1VQ7A 1BBUA 1Z9FA 3H0GH 3NELA 5EAYA 2VW9A 1X3FA 3T1HQ 1Y1WG 1N8RC 4JI7L 3GTQH 3AI9X 2K50A 4YQ2A 1N9WA 1GZ0A 3OTOQ 2N3SA 2VQFL 2O3AA 1NJIC 1GKHA 4CNEA 1PH2A 4DR5Q 3K7AH 5C3EH 2JK8A 4Y7NH 4X66Q 5GM8A 4YQQA 1WI5A 4XTCS 4LF9Q 2AWNA 3H0GG 1CKNA 1LYLA 4KGNA 4A3GG 4YQ1A 2DUDA 2XGTA 2A8VA 2QEXA 2NZOA 4CNFA 2I5LX 3S16H 5M3FH 3RN2A 2OWOA 4YQKA 3J81j 4LFCQ 1K3RA 4JBJA 2JEAI 2JE6I 1VQKA 3IC6A 2Z6KC 5M3MH 2E5LQ 3OIIA 2WAQE 5JJIA 3GD7A 1QZHA 1I5FA 4DK6C 4LF9L 3S17H 2CQOA 2JEBI 2R7ZH 2K14A 4X66L 3S1NH 1U5KA 4JOIC 2D0PA 2D62A 1WCMH 2UXCL 5HGQA 3PO3G 3N4KA 1EIFA 3B6YA 5M3MG 1UE5A 1PH3A 4YVJA 4IO9A 4IPHA 1S3OA 2AKWB 1EYGA 4JI7Q 3CD6A 4YQPA 1J5EQ 2E5LL 1K83H 4LF6Q 3QUVA 5FLXc 4DV2Q 4YQOA 5LMUL 2YY8A 4YQ9A 4LFAQ 2HHHQ 2OQKA 4NXNQ 3I56A 1JB7A 4O0AA 4LWCA 4DR1L 4JI0Q 2E2JH 4YWKA 2ZTDA 2IHFA 2VZAA 2NVTH 1X7OA 4YQCA 2WAQG 5C4JH 2JA8H 1V43A 2V3KA 4LUZA 3E5YA 5IYBG 2NVQH 2BH2A 4JBWA 1B8AA 5IP9G 3STBD 4JI0L 3HOXH 4NXNL 1MXIA 1KHIA 4LFAL 3M4PA 1Z47A 3BBHA 3HKZG 4DV2L 2R92H 2GVAA 4DUYQ 2PNHA 1I3QH 3FP9A 1Y1VH 4YPZA 1L1OA 1YNXA 3PUWA 4QGUA 2KBNA 1A63A 2L15A 3HOUH 4DKAC 3PV0A 1PH8A 1HNWL 1EFWA 4MCDA 1A0IA 5IP7G 2GVBA 1PYSB 4R4TA 4DV5Q 4BA1I 4GKJL 4UP9A 4FAKA 1ASYA 3K0XA 5JEAJ 2R93H 5IYDH 3ULPA 4YQLA 3CAMA 3JAMi 1BVSA 3K81C 1LM0A 3U58A 1YI2A 4B3ML 1MJEA 2CKZB 2YTXA 3HOUG 1VQPA 1PH9A 2VS1A 1UE6A 1IBML 4IOAA 3U50C 4YQ8A 4YPXA 1T9HA 3K8AA 5M5XH 1TWGH 4X64L 3GO5A 2CX8A 4HIMA 4DV4Q 5IYDG 5IYCH 2IX0A 4PZ6A 4A75A 4DR6Q 4JV5Q 1ZJRA 3OIJA 1NY4A 1XMOQ 3UE1A 1K9MC 1V9PA 2N8NA 5C0XI 2VQEL 3CCSA 1VQ6A 2KHJA 3RZOH 1EQQA 4DPGA 1C7YA 5J3BA 1B7YB 1E1OA 3TREA 3FKIH 4OWWB 3HOWH 2ALYB 3PUVA 1JJ2A 2ZTCA 1D7QA 4YQ6A 3AYHB 4BA2I 3OTOL 1UE1A 1YZ6A 1LUZA 3J81c 2KHIA 1V1QA 3LGJA 2A19A 1B70B 4QY7A 4GNXB 4X65Q 2PI2E 5C0XJ 4C3HH 3EIVA 1V6ZA 4PG3A 4A3KH 5BR8L 1OXSC 1QUQB 4DR2Q 2R7DA 4OX9L 1I94L 1X56A 1N34L 3TS0A 4JI1Q 5IT9c 4LF7L 3BZKA 4YCUA 4NB3A 4R4CA 3CPFA 3IRBA 4DR3L 2UXDQ 3W1BA 3W1GA 5FAIA 2AWOA 2NN6G 5DLQE 2JA6G 4X62Q 4YVHA 1E7ZA 1G6PA 5JJLA 4YY3Q 1Y1WH 4JAKA 2K5NA 4P73A 1IXRA 2PI2A 1SROA 3HFZB 3NEMA 4IJLA 1VQCA 4KLKA 4R4QA 4AH6A 2JA9A 5GAHC 2B63G 4LFBL 2EGWA 5GMCA 2UU9L 1CKOA 5FJ8H 2JA7G 3PUZA 3RNUA 1X3GA 4JI5L 4DV0L 2E2HH 1X7PA 2KCMA 1MKHA 3L7ZC 2QMMA 1H95A 1XNRL 1JT8A 3KDFB 3KOJA 3PUYA 4L5SA 4Y52H 4YHHQ 2BA1A 1HNZQ 1NS5A 4LFBQ 1Q81C 4APVA 1OY5A 1P8LA 4R4OA 3T1YL 1NMGA 1VCIA 4A3EG 3UDGA 4YPWA 3MEFA 1EQRA 1NXZA 1EUJA 5AJ3Q 1HH2P 2PQAB 4C3IH 4C3JH 4JYAL 3JC66 2ZJPA 2UUAQ 4BXXH 3CMEA 1QVFA 2AMCB 3G71A 1VHYA 2AHOB 3L8UA 2Q2IA 2YV5A 4LF4Q 3I4MG 1GO3E 4DUZQ 4MNOA 2F4VL 4PZ7A 5LMNL 3I4NH 4JI1L 4RG1A 4EX5A 1BKBA 2JQOA 1VQ5A 1CKNB 5IYBH 2ZM6Q 1N34Q 2NVXH 2EIFA 3HOYH 2VY3A 5JEAG 3GYQA 2MO0A 5LMNQ 1YBYA 2YYZA 4BXXG 4DV6Q 1YIJA 3BU2A 3AFPA 4H02A 4IPGA 1PFSA 4YQGA 4A3JG 2N78A 4JYAQ 1X55A 1Y1VG 4DNIA 1S72A 3T1YQ
chains in the Genus database with same CATH superfamily
1D5XC 1IZ6A 1IBKQ 1ZKOA 1F9PA 2HIXA 3MEHA 2KVMA 4DV7Q 4NXMQ 3NWTA 5GMBA 1SRUA 2BCOA 2YU9H 3HOZB 4IPCA 4GLVB 1PZJD 1SLJA 1SYBA 2CWAA 3OYYA 3I55A 1JWUD 1HPCA 2F0QA 3JAMc 4A3CG 3TP8A 5FLXE 2UUAL 1W2BA 4DK3C 2XTIA 1VQ9A 4GLXA 1I4QA 2CHBD 1VS0A 1H9KA 4N9PA 3ONAB 2O5JC 4X3MA 1N32L 1XNRQ 2EJMA 4KN7C 4DR2L 5BR8Q 1DJRD 4X65L 2Q2TA 3NHHA 2IX1A 2PZTA 2RDFA 1VQIA 2F0UA 4L8JA 4DV7L 3A8KE 4L5QA 5FKAC 2UXBL 1BXTA 4GS3A 4JI2L 4YVIA 2VUMH 4MCCA 3U9SA 4OO1I 2PNRC 3S2DH 3J81i 1SEBD 4H0LC 2E2IH 4AQYL 3HKZB 1G2TA 2PMZE 3PIOA 1M1KC 2ZXPA 1A2TA 5E1FA 2EY5A 2CW0C 5M3FG 1ENCA 5EPLA 3GTGB 3BDCA 3OHXC 4P71A 1BUVT 3D6CA 4XYQA 5M5XB 3J7AF 2KA7A 1QUQA 1GM5A 4G7HC 2YU9B 1RL2A 3BJUA 5M9OA 2XSCA 2CH4A 1I4PA 1HNZL 2E2IB 1VQBA 1P9PA 5E4XA 4L5TA 2KCTA 2EYFA 3G7LA 3ZJYC 1JOOA 2PW7A 1Q46A 1XJVA 2NZHA 5KNBA 1SDFA 3T4AC 2O5IC 3WDNA 4TQUS 1C0AA 5AFWA 1QNUA 5COYA 4JWJA 4GZYC 1RTNA 4A3KB 4GKKL 3G48A 3IEFA 2F1MA 4G4KA 1F2LA 4DV1Q 5E3FA 2JA8G 3E0JA 4DR1Q 2Z1CA 4B08A 4QIWE 3H15A 4I65A 1VQEA 1E2VA 3SVMA 2AQ1B 3QOJA 3M4OH 4HJ9A 4HJAA 2A74C 5A2QE 5BN5A 5FLMH 4POGA 1BCPD 3KY7A 4GOPC 5M5WH 4L63B 2D2CC 5IP7H 2EXZA 1SFOH 3F2BA 1A8VA 4LAAA 2B39A 4CJ0B 2XIWA 3I73A 3SXHA 1KNAA 1WFQA 3TP7A 2MO1A 2Z4IA 5CC4A 1T5XD 3F1ZA 1H9SB 4A3BB 3DCMX 1J5EL 4K6DA 3T56B 1AP0A 4YHHL 3RLFA 3RN5A 5GAGC 1LTTD 4JI2Q 1CZGA 2UXBQ 3CCLA 1TS5A 4DV0Q 2H1EA 5JPMC 5EBDA 3K80C 1E22A 5HURA 2NWGA 3I70A 3A5UA 3ERSX 5C44G 4RWSC 2KEEA 2QWVA 2RDGA 3PIO3 4M8AA 2V1CC 4IALA 2VL6A 1YNND 2L4NA 2KJXA 3H09A 4HIKA 1WTXA 4QL5A 4YQTA 1QVCA 3CP0A 5ELCA 1WCMB 2L1BA 3FKIG 2E2DC 1DONA 1K8GA 5E7NA 1SN8A 4K5VA 3J80L 4JI4L 1R4PB 1E24A 4A3KG 3RZDB 2K5HA 1VQNA 1PTOB 3J7ZC 4DV6L 3U4ZA 2MQHA 1TY0A 2E74C 3GTMB 2ZM6L 2ZXRA 4YWLA 1U4PA 5GAEC 3NBIA 1FYCA 1BBWA 1O80A 2B2YA 2TMPA 2B63H 2WP8J 1KLUD 4RGNA 1FVIA 1UALA 2SOBA 3H0GB 4QJFA 2A1AA 3BZDB 4ODGA 3PF4A 2EXDA 1PTOD 2Q8IB 1EQTA 5FO7B 3A54A 4RHSA 3T16A 3D0FA 1WYDA 2G5DA 1G8ZD 2HIVA 1UAMA 5K36G 2F0TA 3VR2A 1EY7A 1EY6A 2ZT9C 3K6OA 2R61A 1CQFA 3H3VH 4A3LH 1NSNS 3QB3A 1VQDA 4A3MG 4JOIA 4JALA 1D1IA 4ID6A 3VR5A 2B3GA 3CQZB 3M4QA 1EYAA 3HKSA 1Z85A 3PIP3 1RHPA 2MNAA 1KTKA 2HHHL 4KMUC 5C4XG 4UDUC 3IKJA 4HN7A 3KTYA 1AE3A 2OCEA 4HJ7A 4A3IB 2WB1G 4ZRZA 1FGBD 4ZLTF 1Q1BA 3MTSA 2Z0YA 2UXCQ 2K32A 2WACA 1HR0Q 2VB3X 1QJOA 3K5NA 2N49A 3A8IE 4A3DH 2NBFA 4K5WA 2PZWA 2KECA 3GTMH 3O7BA 1PFMA 4FP5D 4B3TQ 4EQOA 4A3CH 4BBSB 1WTWA 1GHKA 4QUFA 4YQSA 1VQLA 3VYTA 1MD2D 3RLNA 3QIAA 1HZCA 4HMJA 1D5MC 5ELBA 1CI3M 1I4GA 2Z0SA 4BY1B 3F8TA 1NCVA 5E4WC 4A93B 2JA5G 3HG9A 3L3OC 2UUCL 1SMYC 1VQ4A 1S40A 1JE4A 1VQ7A 1Z9FA 1QB5D 2RBMA 2AUJD 1Y8OB 2N3SA 5KEEA 5C3EH 4X66Q 4OGQC 2F0MA 4XTCS 2MPMA 1QWYA 4YQ1A 2DUDA 2XGTA 2A8VA 1HXYD 1EQVA 2C9OA 2F0EA 1SYGA 1B3QA 3IC6A 2QF7A 1I5FA 3S1NH 2ENBA 4JOIC 1WCMH 2IL8A 2UXCL 3PO3G 2EYJA 3SK5A 1EIFA 3N4KA 5ELFA 2M2LA 5M3MG 1B9MA 3N6RA 4IO9A 4I7ZC 1EYGA 2F0VA 3CD6A 4YQPA 1J5EQ 1IHZA 2LKVA 4DV2Q 4YQOA 4CGYB 2KOLA 1Z6HA 2HHHQ 4WFN3 4DR1L 2E2JH 4YWKA 2EOTA 2VZAA 2NVTH 1QOHA 5C4JH 2JA8H 1V43A 4CKCA 1HA6A 2V3KA 1HHVA 2BH2A 4RA8A 1B8AA 4KJNA 5K36H 3Q0AA 4LJZC 4K2KA 2CH4W 3BBHA 1I4HA 4DV2L 2R92H 2MP1A 3PUWA 3H6MA 5DAUA 5CV5A 2GVBA 1PYSB 4R4TA 4V0BA 1I3QB 1HTLD 4UP9A 3W3AA 5JEAJ 5IYDH 3ULPA 2Q8RE 3CAMA 2DY7A 3JAMi 3K81C 3I4LA 3TP5A 1MJEA 3S16B 1VQPA 5D65A 1PH9A 3U50C 3KK7A 1TWGH 1K8OA 2CX8A 1NAPA 4HIMA 3HS0C 1GUOA 1ML0D 1SNDA 3M4OB 2N8NA 1VQ6A 4FXKC 2KHJA 2B8GA 4C56C 3KLRA 3E6ZX 3T51B 1D7QA 4BA2I 1F2ZA 1BR9A 4K2LA 2J7ZA 5EPKA 1B70B 2PPBC 4X65Q 1V6ZA 4C3HH 3EIVA 4FNFA 5BR8L 4PMBA 1JR0D 4DR2Q 1DOKA 5CBEE 1N34L 1LACA 3HEJA 3TP6A 4IUNA 4NB3A 4U673 2R92B 4R4CA 2EYHA 4WORA 4P2CB 5BN3A 1HFNA 4YVHA 1E7ZA 4DXFA 4CDEC 1KABA 1TS3A 1LT5D 5GAHC 2JA9A 1LTAD 2JA7G 3GTKB 4JI5L 4DFAA 1GOZA 3I8ZA 1SE4A 3KDFB 3KOJA 4L5SA 4Y52H 2Z8LA 4YHHQ 1XYIA 4LFBQ 1IKMA 4EQPA 1OY5A 4R4OA 1NMGA 4ZCKA 1EQRA 5AJ3Q 1EZ8A 1HH2P 2NYZD 4JYAL 3JC66 2GA4B 2ZJPA 2UUAQ 3R8BA 2FFKB 3G71A 2AHOB 2Q2IA 2B2TC 3DXJC 4MNOA 3I4NH 4RG1A 2NVXH 2JQOA 1D5ZC 5IYBH 3HOYH 2HUGA 5JEAG 2MO0A 2L5TA 3FDTA 1CM9A 1YIJA 3BU2A 1RKNA 2DNCA 1ONLA 1X55A 2K6AA 1S72A 3T1YQ 2JA6B 1CUKA 1FNUA 2D5DA 2FMMA 4FO2A 2Z4HA 3BBEA 5K5PA 2YTVA 1JORA 4FVMA 1ET9A 1PFNA 1EWHA 3CCMA 3M4YA 2CQAA 3NTIA 3PO2G 3H3VI 2B2WA 3EVQA 2A6HC 1OTCA 1K8MA 3NQIA 1CSPA 3SK4A 4CNDA 1UEBA 2P5ZX 4KI0A 5CV9A 1TWHH 4RKBA 1TWFH 2BE5C 1Q82C 4XQJA 3I2ZA 1EIHA 2B2UA 2XRQD 2V3JA 1Y8NB 5C0XH 1QVGA 2F0SA 4R8IA 3GTOH 4BBSG 1L2FA 1DD2A 1B44D 4IUPA 2BOSA 2FINB 3MXNB 1ZYRD 4ZUIA 3KF6B 4KHPQ 2L55A 4C3HB 5FOBB 2K5DA 4JI4Q 1UUPA 1V1PB 2RSOA 3AFQA 3KJPA 2NTSA 1L0YB 1XMOL 1KXLA 1WTRA 3Q23A 3E3XA 4JG2A 3NWSA 5A35A 3I4OA 4UHVA 2K5QA 4AYBB 2OTLA 1IBMQ 2NN6I 4HAEA 3K5OA 1IW7D 5IGBA 4HIDA 3W2DA 4A3FB 4HIOA 1A3UA 4K8IA 3SHLA 3RUZA 4XBOA 1ET6A 4X3SA 1KL9A 3J7A5 1MBYA 1STNA 3ER0A 4C3JG 4LNQA 4DUYL 2JA7B 1STAA 3VDYA 1F2YA 2K52A 4A4IA 3WOFA 1O7LA 2A73B 5C4HA 5IGFA 4A93G 1VQAA 2ZJQA 2PZUA 2M9VA 3EN2A 4GN5A 2PYKA 2RDHA 2E8GA 3D6WA 4R8NA 4BY7H 3GTGH 4DV5L 3S1QB 2JYOA 1K8AC 3PO3H 1ENAA 3DM3A 4JW0A 2EY2A 1L1OB 2KENA 1BNZA 4HR7B 5CO4A 1K0RA 1X54A 4DAYB 4BBRH 3HOVH 1CHQD 4KHPL 2Q2HA 4A76A 4UY8C 1X3QA 1GUSA 3FHWA 2UUBQ 1IPAA 1HQRD 4ZYSA 2Q2UA 4YQRA 4ME3A 2JA5B 2XVSA 4KV6A 3NK6A 2JN4A 4ZK9B 3NBHB 4CDDC 3CW2C 4BBRG 1A2UA 3HOVG 1YJWA 1IYVA 4A3IG 1Y1WB 1SE8A 1AEXA 3FRPB 5GQOA 2MUYA 2LXJA 2R7FA 5EJWA 2ES2A 1N33Q 1BDOA 1SJED 1X65A 1L0WA 1A62A 4RGMA 4P75A 3U9OA 1EIGA 1YNNC 5KIXA 4YQJA 2IT1A 4JCVE 1I6HB 3EBEA 2KUMA 2LSSA 2R93G 4BS9A 4YVKA 4OWTB 3P75A 4C1NI 5M5YH 1HRJA 3A7AB 4FDBA 5KYIA 1AZPA 3S1QH 4A3FG 3CCJA 1GUNA 4LF8L 3N52A 1JQYD 2F4VQ 1K83B 5DM73 2Y0SB 1X6OA 2VQFQ 2F0OA 3RZDH 4AQYQ 2B2YC 4A3GB 1PTOF 1NMFA 3HOUB 2XRSD 5EBCA 5JPNC 2EYMA 1HCZA 1WD1A 4A3BH 3S1NB 1O7ZA 2F0KA 3MWYW 1MGSA 1EWCA 3V05A 5IWAL 5KGUA 2XWBB 3J80i 4LF5L 2J4XA 1XMQQ 4JWHA 1GHJA 4LF4L 3KLWA 2WB1B 5JOBA 1X3EA 2WIIB 1J85A 2HA8A 3FPPA 2I5HA 3A5ZB 1UAJA 1OXTA 4IFDJ 3MA2B 4AIMA 3N4JA 3TSSA 5JJKA 3U4VA 4IUQA 1STGA 1T5EA 1CA5A 3GTKH 1BF4A 1G291 2EYOA 1LTLA 1TWCH 1UAPA 1SNMA 2RHSB 3WWVA 4DAYA 4DXGA 4NXML 2R7ZG 4TVAB 5DM63 4A3EH 3CRKC 4DK0A 3PMFA 3O13A 1JOKA 4X3KA 1TQOA 4BY1G 4YQDA 1C4QA 1CHPD 3PO2H 2XN9C 1SMYD 1N36Q 3DHQA 1YHQA 3J80c 3BDLA 1YITA 5GROA 1XX8A 2IY5B 3KUPA 1JMCA 1L0XB 5CV8A 1S5DD 1CFMA 3CF5A 5EPJA 4DUZL 2BA0A 3VR6A 4YQ7A 4B3TL 4LF5Q 2ASBA 3DEPA 1JB3A 5D14A 2R6GA 3NENA 1EZ6A 3AIAA 4UAIA 3GV6A 2GN5A 3KF6A 3DMUA 4R1JA 5ELNA 4A3IH 1HNWQ 1HR0L 3ULJA 3HP3A 1PV4A 2L11A 1LTBD 1G91A 4B9WA 4NPSA 2NVYB 2A68D 1I50H 4OELB 1R9TH 1LABA 4UP8A 2DJGC 1XMQL 4FF2A 3LNNA 4ZKCB 3D4DA 1TS2A 4Z9CB 3NSWA 2WB1E 1GD7A 4RMFA 4J15A 3FMCA 1RDPD 3CKIB 1TWCB 4XIGS 2Z6KA 3I91A 1VQFA 1A15A 1V1OA 3K7AB 4JWFA 3LX0A 2I0QA 1BBUA 5EAYA 1QG7A 5GMCA 3AI9X 1X3FA 2LMCB 2K50A 2PMZB 1GZ0A 1NJIC 4CNEA 3KLSA 4DR5Q 2N88A 3MXGA 2NVTB 2EY1A 4Y7NH 3A56A 5GM8A 4YQQA 3P7JA 4TRDA 4M1UB 3H0GG 4KGNA 2NZOA 4J8QA 5FK9C 1K3RA 1VQKA 2NN6H 3S1RB 1DYQA 2WAQE 1GJXA 3UI2A 3QR8A 4LF9L 2R7ZH 1QCBD 2K14A 4CJ1B 1U5KA 5I6WA 2D62A 3EROA 1TVXA 3X3MA 5HGQA 2VXWA 1S3OA 2AKWB 3VYUA 3NTKA 2E5LL 3NUCA 4JWGA 5FLXc 1FD7D 2K01A 1ZXTA 1AW7A 4NXNQ 3I56A 1JB7A 4LWCA 4JI0Q 4HMIA 4FXGC 2G9DA 3NP8A 2WAQG 5IYBG 3BYTB 2NVQH 1J8IA 5IP9G 2E2HB 1PTOH 4FYDA 1DCZA 3M4PA 3PO2B 1QNKA 3HKZG 3K59A 4DUYQ 4R9WA 3FP9A 2AUKA 1L1OA 3EQLC 3OIQA 2QW7A 1CTMA 2L15A 1PH8A 1EFWA 4F8MA 1ESRA 4BA1I 3VR3A 1TIID 2R93H 5EKLA 2ZXOA 1R9TB 2RSNA 2SDFA 1VMCA 1ICFB 2VS1A 1UE6A 1IBML 4YPXA 4XXEA 4WRDA 3K8AA 1IW7C 1TT2A 5I4DA 2X6LA 2L9HA 1EYDA 4DV4Q 4A75A 5IYCH 2IX0A 1ZJRA 3NK9A 3UE1A 1V9PA 2VQEL 3CCSA 4DPGA 1C7YA 4FF3A 3SR1A 1C48A 1EY4A 3HRZC 3L9AX 3FKIH 2NTTA 3TDQA 3AYHB 1F9SA 3OTOL 3OW7A 2PI2E 4PG3A 1LTID 5LL6S 2R7DA 3R93A 1EL0A 1ICWA 1X56A 5IT9c 1RODA 4LF7L 2O4XA 3J7AV 5IT9L 4KTAA 4YCUA 3C3LA 4K8JA 3IRBA 4DR3L 3W1GA 1G2SA 1I50B 1G6PA 1Y1WH 3TBIB 3I3CA 3J81E 4IJLA 4ZAIA 1UEAB 1VQCA 4KLKA 4R4QA 4AH6A 1EY5A 2SNMA 2EGWA 2UU9L 3GTLB 2B2TA 4TSSA 1R4QB 3PUZA 3RNUA 1X3GA 3SEBA 2KCMA 1MKHA 3NQTA 1SBBB 4QUCA 3RZOB 1Q8IA 1Q81C 1DZ1A 4APVA 4A3EG 1W6KA 1VCIA 3URYA 1NXZA 4C3JH 4HEDA 3K57A 4LK1C 2SEBD 2YV5A 4DUZQ 4MHEA 4PZ7A 4JI1L 4EX5A 3RD4A 4X3TA 1VQ5A 4FAKA 1CKNB 2EIFA 4RGOS 2KCCA 5ELEA 4BXXG 1JWSD 4H02A 4IPGA 4H7BA 4YQGA 3BVMA 2IWHA 4A3JG 1WD0A 1JOQA 3RMHA 5KRUA 1SJHD 4A3MB 4DNIA 1TR5A 1EU3A 2WFWA 2H5XA 1K0SA 3M3YH 1VQJA 4EVOA 2ID0A 5IOCA 2QILA 5FLMG 2EJFC 2NVQB 1QZGA 2TSSA 4U68A 1NR2A 2A68C 2QKIC 5IP9H 3DUZA 3SGIA 1SNQA 4PMWA 4YVGA 2X6GA 2BDNA 1QE6A 1E1TA 2HQLA 2BH8A 1Q7YC 3J80E 3S1MH 3I4MB 1D1KA 4NP5A 3NK7A 3STBC 5BN4A 1XNQL 4IOCA 2LXKA 3M9BA 4YQIA 1O7YA 3GTJH 3F2DA 2NVYH 3QG1A 3SE0A 5IIFA 3OOCA 3M85A 4KKTA 1OXUA 4KKUA 1L1OC 1ZEQX 1YJ9A 1PLFA 3AEVA 1YVCA 3FKIB 4JI6L 2VUMG 1MHWC 4A3FH 1SR3A 2EVBA 2K5WA 4JBKA 2EQSA 4DNTB 1UAKA 3UDIA 2OQ0A 4IUTA 5C3EB 3S2HH 1SNPA 1A3TA 1V1PA 2MGSA 4B3MQ 4O42A 1MIUA 1ASZA 1SAPA 4GKJQ 1KIXA 5IE8A 3NE5B 4C2MH 4OXPA 1Y14B 3GDEA 3MXNA 5C3EG 4ALPA 3GTLH 4F88A 3FVQA 1X9NA 3A0JA 3DWAA 4DV1L 2ICEC 3KFUA 4X64Q 2OEOA 1EOVA 1HR0W 1KLGD 4XT1B 5CBAE 4CNGA 3HOYG 2JA7H 1W3SA 3T13A 5HGTA 3IAYA 2XWJB 3HKZE 3TZUA 4EQ5A 3MHBA 2IW3A 5EKKA 1AE2A 1J6QA 4JI6Q 2EGVA 3PQIA 4JPBW 2ZJRA 3CCUA 1PHJA 1H9JA 4C3JB 1VQGA 5D3IB 2UUBL 3HOXG 4LF6L 1DGSA 2E75C 4DK1A 2A6ED 2BDOA 1D6EC 1PH6A 4BY7G 3KJOA 2MHVA 2VB2X 3VYSA 1NE3A 3S2DB 3C46A 4YQAA 2RF4A 1J9OA 4N8X1 4FXDA 2K28A 1FNWA 2MFIA 1N32Q 1Q8KA 1MI2A 4PQXA 1JJGA 4MN3A 4OL7A 3CQZH 2EE1A 2EY6A 2V4DA 4KKSA 1M90C 4H3YA 1IYJB 4GOPB 3ND9A 3UDXA 1CZWA 3MVVA 1CT1D 4KD4A 1NBWA 1ESFA 3JAML 2R3ZA 2B29A 1EIYB 1AH9A 4YQ0A 1FGUA 1UE7A 1VQMA 1WVLA 3RLOA 4H3ZA 4JI5Q 1BQQT 3C1FA 1DXMA 2Y0SG 5KYLA 2RKSA 1I6VC 1OXVA 1IBKL 1U9RA 2M00A 4OO1G 4YQ4A 3D31A 1I6HH 4X3UA 1PH4A 4DR4Q 1TY2A 1SMXA 3TS2A 2D0OA 5M5YB 4GOPA 3NBHA 5FO8B 4L6TB 4X6AH 2NB0A 1Q86C 1I94Q 4Q0FA 5GADC 1SNOA 4N8FA 4UP7A 3GP7A 1C8CA 4IFDG 2JP1A 3K7UC 2EYLA 3SDZA 3TQYA 2Y0SE 2KQ3A 2NUCA 3AXZA 2KEDA 1RIPA 1SFOB 1D2BA 1CSQA 4B3SL 1E0BA 2RCNA 5ISRA 4K0KQ 3HOYB 2F0DA 2QDLA 2F0PA 4QB4A 4X3LA 2PCFB 2FHTA 1TWFB 1EU4A 2QGQA 4DV3Q 4P74A 1Y69U 1PH5A 2RQXA 4OWXB 2F52A 1LTSD 3G6JB 1IL2A 4YPYA 4CBVA 5H1SE 5LHY1 3KYHC 3MAQA 4LFCL 3G6EA 4IPDA 2HT1A 1B4OA 3I7FA 2K04A 5IWAQ 2B2UC 1XPOA 1V2XA 3ILKA 2CFMA 3SK6A 3IL8A 3E9HA 3BBDA 4L5RC 3HZXA 1EWIA 2ZTEA 5G3LF 3IFTA 5CV7A 5J39A 1O78A 3OMCA 4BY1H 4DGZA 4A3JH 2I6DA 5C4ZA 4HJ8A 2C35B 4RHRA 1H9MA 3QJYA 4RCNA 1KD1C 1AZQA 4PZKA 1WCMG 4OONA 4NKLA 1VQHA 4DAMA 1FL0A 4YCVA 1GXDC 3CPWA 1Y1VB 3I4NG 2B2WC 4O2DA 2PO4A 1PRTB 5C4JB 3W5OA 1KRSA 1LO5D 5LMUQ 1YHBA 5D9FA 3HOZG 3L2PA 1ILQA 4LMQD 3IFDA 1CQVA 2AQ3B 3DEOA 2HDLA 3AQQA 3I90A 4I7AA 3UDFA 4DF7A 3PUXA 3F2CA 4V190 4L69A 1SYCA 3DWQA 4MZ9A 4K0KL 1U0LA 3VA5A 4NMZA 1S5FD 1NNXA 2A69C 3WOEA 1STEA 4HJ5A 2EZVA 3Q24A 4B3RQ 1KAAA 5T1IA 4JI8L 3CC4A 1ZYRC 1PZID 3BZCA 2HCCA 3S1RH 2LFNA 1XTCD 1PRTF 2YTYA 1O6DA 4J1MA 2K75A 4PNYA 1VQOA 4IFDH 5HY6A 2DGYA 5EQ0A 3TRZA 1N36L 5LL6X 1LT4D 5IYCG 1XPUA 3C2PA 1HUMA 3CCRA 4B3SQ 4XDXA 1NTGA 3KDFA 1Q1EA 4KY7A 1E2WA 2K03A 2NZ1D 3H0GH 3NELA 3LWEA 2VW9A 3GTQH 4YQ2A 2O2LD 4XYOA 1II3A 4ZKBB 3ZYYX 1N9WA 3MFYA 1GKHA 2F03A 3NXWA 3T53B 3K7AH 2FMCA 3M3YB 5I2XA 4LF9Q 2SNSA 2WINB 1AFPA 1KDAA 1LYLA 5F2DA 4RKLA 5KNCA 1GUWA 2JXMB 2Q8TA 4CNFA 1X32A 4BY7B 3S16H 2R7ZB 2CVRA 5M3FH 3RN2A 2OWOA 4YQKA 3P20A 4JBJA 1KDCA 4CKBA 5M3MB 1U4MA 1HTPA 3OPOA 5C3XA 2E5LQ 3S17H 4DK6C 2CQOA 2JEBI 1X3PA 2F0FA 1K3BC 4ZQ3A 3MFGA 1H9RA 3K5LA 1PH3A 1UE5A 4QF4A 3A7LA 4IPHA 2A5HA 4JI7Q 2A6HD 5M3FB 1K83H 4LF6Q 5LMUL 2YY8A 4K5XA 2OQKA 4C3IB 4O0AA 4JVZA 2ZTDA 4K6LA 2IHFA 5IGEA 3E5SA 4JK1C 1VDZA 2K1BA 5J1ZA 4LUZA 5C5LA 3E5YA 3K58A 2X69A 5JEAH 3STBD 3HOXH 1BBXC 1Z47A 1WTHA 2GVAA 4YPZA 1YNXA 3H94A 3HOUH 4DKAC 3PV0A 1HNWL 5IP7G 3KBXA 5JVH3 1RCVD 1VF5C 3D4WA 1ASYA 4GKJL 4YQLA 4QCLA 1PXUA 1BVSA 1PMRA 4B3ML 3U58A 1A6XA 2CKZB 3HOXB 4G7ZC 1GUTA 1FNVA 1EY0A 4X64L 1LTRD 3BG3A 1MSHA 4PZ6A 4DR6Q 4JV5Q 2B8FA 1WTOA 3OIJA 4IUUA 1K9MC 5C0XI 3RZOH 1EQQA 1B7YB 1E1OA 3VR4A 3HOWH 3GTQB 4YQ6A 2ALYB 1JJ2A 1XWEA 1NUCA 2ICIA 1UE1A 3BDOA 5C4XB 1V1QA 3LGJA 4PV1C 4QY7A 4GNXB 1XXGA 3MC0B 3GTPB 4OX9L 1I94L 2RA4A 3TS0A 1I4XA 1HUNA 2KHSA 2MJ8A 1MSGA 3CPFA 5A2QL 4ILWA 4C3HG 5JJLA 4YY3Q 4JAKA 2K5NA 4P73A 2PI2A 3NEMA 3HFZB 5CV6A 4LFBL 1S5BD 1CKOA 5CORA 2PW5A 2I46A 4DV0L 1GUGA 1TWHB 4DAVA 5I9PA 1STYA 3L7ZC 3OWEB 3VYRA 1XNRL 1JT8A 3PUYA 1BCPF 2WKCA 2B63B 2BA1A 1NS5A 2K33A 3K0YA 4YPWA 5EGTA 3UDGA 3MEFA 2PQAB 4C3IH 3ERQA 4BXXH 3MZ5A 1QVFA 2DN8A 2AMCB 2PQEA 1VHYA 3L8UA 5JJZA 4LF4Q 1GO3E 2F4VL 3I4MG 5LMNL 1UNSA 5CV4A 1N34Q 3EFXD 4IURA 4F87A 2VY3A 5CGKA 2IX3A 1IL8A 2L12A 3AFPA 1PFSA 2EJGC 2N78A 1F2MA 4RFBA 3JAME 2WAQB 4NW2A 1S5ED 4BBRB 3D4RA 3HOVB 4ULLA 2QA4A 2RVLA 3V96A 1U4LA 1PH7A 4DR6L 1HA5A 2K05A 1JE5A 2UU9Q 4HTHA 1PH1A 4O1NA 1HJPA 4P72A 4G57A 5KNDA 3PF5A 2A69D 2I07B 4X62L 3PIPA 3HOZH 1YNJD 2VNUD 5ELDA 2HD3A 4LF7Q 5C44B 1VH0A 3ND8A 3CCQA 2PQAA 1VQ8A 4KDZA 1Z7TA 2VUMB 4LUVA 4EQNA 4DV3L 2F3VA 4RCOA 2QDBA 2FXQA 3ULLA 4R4IA 3GTJB 5FLXL 1DOLA 2WKDA 3Q8DA 4HSPA 1IBLL 3GTPH 2NVXB 3OINA 4A3DB 1AN8A 1RTOA 4UPAA 1N33L 2FJ2A 3OIPA 4PZ8A 4JC0A 4WJ3M 4DR3Q 2K5VA 5C44H 2UXDL 3HOWB 3FPUB 2RHQB 4IFDI 2WV6D 3J81L 3CXCA 2J0TD 1HZ9A 3CMAA 1BOSA 5DNFA 1WJJA 3E9IA 4DR4L 1EOTA 2HDMA 2RCFA 3CCEA 5AJ3L 3NPPA 5ELOA 4A93H 1B53A 1HZAA 4J6HA 4CDFC 1XPRA 2VQEQ 4A3BG 2JA6H 4AYBG 1JJCB 1P16A 5TSSA 4A3GH 5C3WA 3DLLA 4N9TA 1B3AA 4YWMA 3GQBA 4QQBX 1WTPA 4GN3B 4POFA 2EPBA 5FJ8G 1D8LA 3J7YW 3CCVA 2OTJA 4LUOA 5JAVA 1CKMA 1K28A 3TEHB 1ENFA 1HZBA 2LS01 1FR3A 1SNCA 3D3RA 1O7IA 3S2HB 2F3WA 1STBA 3CC2A 5G3LD 3KF8A 2K7VA 1LT3D 2AQ2B 4C3IG 3PSIA 1UWVA 1M4VA 1K73C 5LMNW 1LTGD 2R92G 1SSOA 2JA8B 5IGGA 2L0CA 2DY8A 3OW2A 2E76C 4PMCA 3S14H 3R2TA 3A55A 3Q22A 3LWUA 1H9SA 1QILA 1KNEA 4A3MH 2R93B 2CCZA 4WJ4A 1PTOC 1EY8A 2F0HA 1RD9D 2IHEA 4GKKQ 1PDQA 4RAUC 1IBLQ 2B2VA 1B2TA 3ITPA 1IKLA 1NR4A 3S14B 4FF4A 1VHKA 1XTDA 2I5MX 3TMEA 1YHAA 1M8AA 2F3IA 2BE5D 2Z6BA 4DU9A 3H3VC 1KAWA 4YCWA 2CWPA 1Q12A 4DR7L 5D3DA 1EY9A 1G51A 1PZKD 3KW2A 5DEHA 1E3PA 5I6YA 1JCKB 4XQQA 2OT2A 1PRTD 5CYUA 5FO9B 4QMGA 3RR5A 4IZ8A 1CA6A 1KDBA 4EGVA 4GLAC 2IJ0A 4JBMA 5IGCA 4DA2A 3A74A 3HOWG 5IY0A 1DOMA 5J22A 1PA6A 1Y8PB 1S5CD 3S17B 3KNUA 2JA5H 1B50A 1B1ZA 1HNXL 3ONPA 4CDCC 3CRLC 5C5MA 1FJGQ 1TXYA 3KF8B 3BYYB 4E6IA 1XNQQ 1TO0A 1JICA 4DV4L 3EA6A 3OWFA 1EFID 4E8BA 1C9OA 4XQNA 4MCBA 3UE0A 1HQMC 3PO3B 1BCPC 1Q3LA 2IPKD 4DAPA 4OIJA 4YY3L 4YQBA 1PYWD 3PCOB 4Y7NB 1KC8C 4HSVA 4YQ5A 1RJTA 4GNXC 4JI3Q 2ATWA 1YNJC 4Q5VA 3DM1A 1TWAH 4GN4B 1PVOA 3P1HA 4OIKA 5IGDA 2HQEA 4XT3B 1LV9A 3MXPA 3KBGA 4YQ3A 3CC7A 4YQNA 1PRTC 1SE3A 4OEMB 2UUCQ 4KHZA 2Z9HA 3X3NA 1F9QA 5C4XH 3I4MH 1U4RA 3S9WA 2F0IA 1SYDA 3OSOA 3Q6SA 1G6ZA 4JI3L 2XNAC 1EEID 2F0WA 4MTKA 1KRTA 3VA7A 1IYUA 3G4SA 1OO9B 5JVG3 4OX9Q 1WOCA 4A3LG 4CKEA 1KQSA 4C1NK 4ZUJA 1GVPA 3QO2A 4A3DG 1LT6D 1SXTA 4LW1A 1CK1A 5T1GA 4JI8Q 4GNXA 3ICEA 4KK7A 4IJHA 2C5CA 4B3RL 2G9HD 1YEZA 1F9RA 5IODA 4H44C 5C6AA 4IG6A 1RF2D 1B9NA 1HNXQ 4OO1H 3CU7A 2JJQA 1VF7A 4KY5A 1YJNA 5IT9E 3C1EA 4JV5L 3E0EA 3S15H 4J3CA 1STHA 1OXXK 3BVGA 2K4KA 1MJCA 4LF8Q 1PYBA 1W6JA 1WTVA 4MTNA 5C0XG 4FF1A 1DM0B 3PGZA 4HCEA 4BBSH 4RH6A 3S24A 2F0GA 4DR5L 1FJGL 3BVZA 3L0OA 4ABNA 2CW0D 4C2MB 4AYBE 4DR7Q 3T1HL 3M7NA 3I72A 2KCNA 3R2IA 2EYPA 4KHVA 1N8RC 4JI7L 1Y1WG 3T1HQ 4QIWB 4DN4M 3D8GA 3OTOQ 1ILPA 3EJIA 2VQFL 4KD3A 2O3AA 1PH2A 1S4ZA 1JC7A 2JK8A 1WI5A 2AWNA 1CKNA 4A3GG 1PFBA 2QEXA 3BS1A 4MIUA 3V2TA 3R3OA 4G7OC 1TS4A 2I5LX 5CMDA 3F2UA 3J81j 1SE2A 4LFCQ 2F0NA 2JEAI 2JE6I 4CJ2C 2Z6KC 4DNRB 2F0JA 5M3MH 3OIIA 5JJIA 3GD7A 1QZHA 2LY7A 4X66L 4IQZA 2JSOA 1I4RA 2D0PA 3S15B 2QCPX 3QOLA 4HCSA 3B6YA 3QWNA 4F7XA 1SYFA 3QUVA 4CHTB 4YQ9A 3M7GA 3NTHA 1TWAB 4LFAQ 3GV3A 5I9OA 2QEJC 3DWPA 4NDXA 1X7OA 4YQCA 4S3SA 4BWGB 1TWGB 3A8JE 2F0LA 2HCIA 4FMWA 4JBWA 4JI0L 1A3VA 4NXNL 1MXIA 1KHIA 4LFAL 5EKIA 3H91A 4B9XA 2PNHA 1I3QH 3TN2A 1Y1VH 1A63A 1TKWB 2DNEA 4QGUA 2KBNA 4H13C 4MCDA 1A0IA 4DV5Q 4YVJA 3CHBD 3K0XA 3GTOB 1YI2A 2OF1A 1LM0A 2YTXA 3HOUG 1EEFD 3SK8A 4IOAA 4YQ8A 5L37A 1T9HA 5M5XH 3GO5A 5I2YA 1V8QA 4YIJA 5IYDG 1E2ZA 2H4OA 2F4IA 2E2JB 1NY4A 4ME5A 1XMOQ 4OHJA 3AB9A 5J3BA 5NUCA 3TREA 3MXUA 4WJWA 4OWWB 3K5MA 3PUVA 2ZTCA 2B2VC 1BCPB 3KLSX 2EDGA 1YZ6A 1LUZA 2DJFC 3J81c 2KHIA 1WTQA 2A19A 5CR3A 1EYCA 5C0XJ 4A3KH 2D9UA 1OXSC 1JWMD 1QUQB 2A6EC 4IUVA 4JI1Q 3BZKA 4A3JB 3FEWX 4KY6A 4KJOA 2UXDQ 3S1MB 4IN3A 3W1BA 5FAIA 2AWOA 2NN6G 5DLQE 2JA6G 4X62Q 2N55A 1IXRA 1SROA 2B63G 5FJ8H 5M5WB 1X7PA 2E2HH 2OXPA 1SYEA 2QMMA 4TKOB 1F77A 1H95A 1HNZQ 1BO0A 1P8LA 3T1YL 1HFGA 4RGTA 1EUJA 3CMEA 4KN4C 3AU7A 1BKBA 3AMUA 4K14A 2ZM6Q 3GYQA 1VMPA 3HGBA 3TZDA 3OMGA 5LMNQ 1YBYA 2YYZA 4DV6Q 1Q90A 1LLRD 4JYAQ 1TU2B 1Y1VG 4A3EB 3I4NB
chains in the Genus database with same CATH topology
1CUKA 1IZ6A 1IBKQ 2WFWA 2H5XA 3BBEA 2YTVA 2HIXA 4DV7Q 3M3YH 1VQJA 3CCMA 2QA4A 4NXMQ 3PO2G 2ID0A 5FLMG 1QZGA 1SRUA 1OTCA 3H3VI 1PH7A 2YU9H 4DR6L 5GMBA 4IPCA 1JE5A 1SLJA 4GLVB 5IP9H 2UU9Q 2CWAA 1PH1A 1HJPA 3OYYA 3SGIA 3I55A 1CSPA 4P72A 4PMWA 3PF5A 3JAMc 4A3CG 4CNDA 4X62L 1UEBA 3PIPA 2UUAL 1W2BA 4YVGA 4DK3C 2XTIA 3HOZH 1VQ9A 4KI0A 4GLXA 2VNUD 1TWHH 1E1TA 1TWFH 1VS0A 1Q82C 2HQLA 2BH8A 3I2ZA 1Q7YC 4LF7Q 2V3JA 1VH0A 4X3MA 3CCQA 2PQAA 1QVGA 1VQ8A 1XNRQ 3S1MH 4LUVA 4DV3L 4DR2L 3GTOH 4BBSG 4KDZA 5BR8Q 1L2FA 3NK7A 3STBC 2FXQA 4X65L 3ULLA 2Q2TA 1XNQL 4IOCA 2IX1A 3MXNB 2LXKA 3M9BA 4YQIA 1VQIA 4DV7L 3KF6B 3GTJH 4L5QA 4R4IA 2UXBL 4KHPQ 4GS3A 4YVIA 3F2DA 4JI2L 2NVYH 2VUMH 4MCCA 3Q8DA 3GTPH 1IBLL 4OO1I 3M85A 3OINA 1OXUA 4JI4Q 3S2DH 3J81i 4UPAA 1N33L 3AFQA 3KJPA 1L1OC 4PZ8A 4JC0A 4AQYL 2E2IH 4DR3Q 2K5VA 5C44H 2UXDL 1YJ9A 2PMZE 3PIOA 1YVCA 1XMOL 3AEVA 1KXLA 1M1KC 4JI6L 2VUMG 4JG2A 4A3FH 1SR3A 3I4OA 4JBKA 2RHQB 2EQSA 2OTLA 4IFDI 1UAKA 3UDIA 1IBMQ 2NN6I 2OQ0A 3CXCA 5M3FG 3S2HH 1HZ9A 3CMAA 4P71A 4HIDA 1WJJA 3E9IA 4B3MQ 4DR4L 1QUQA 3CCEA 1MIUA 5AJ3L 4HIOA 1GM5A 1ASZA 1RL2A 3BJUA 4GKJQ 1KIXA 5IE8A 1HNZL 5ELOA 1VQBA 4C2MH 4A93H 1P9PA 1HZAA 4XBOA 4OXPA 1Y14B 2KCTA 3GDEA 4L5TA 5C3EG 1KL9A 4ALPA 1XPRA 3GTLH 3ER0A 3ZJYC 2VQEQ 3J7A5 4A3BG 1Q46A 4LNQA 2JA6H 1XJVA 4AYBG 3A0JA 4DUYL 1X9NA 2NZHA 3VDYA 1JJCB 1P16A 2K52A 4A4IA 4DV1L 4A3GH 4TQUS 4YWMA 3DLLA 3KFUA 4QQBX 4X64Q 1C0AA 4GN3B 1EOVA 4POFA 1HR0W 4A93G 4JWJA 1VQAA 2ZJQA 4CNGA 3HOYG 3EN2A 5FJ8G 1D8LA 4GN5A 1W3SA 3CCVA 3G48A 2JA7H 4GKKL 2OTJA 4LUOA 3IEFA 1CKMA 3HKZE 4EQ5A 3TEHB 2E8GA 1HZBA 4BY7H 1AE2A 1J6QA 1O7IA 4DV1Q 4JI6Q 3GTGH 2JA8G 2EGVA 4DR1Q 2ZJRA 4DV5L 3CC2A 3CCUA 4QIWE 1PHJA 3H15A 1K8AC 1VQGA 1VQEA 3HOXG 2UUBL 3PO3H 4LF6L 3DM3A 1DGSA 3PSIA 3M4OH 1UWVA 4HJ9A 1L1OB 2KENA 4HJAA 5LMNW 1K73C 1PH6A 1K0RA 1X54A 4DAYB 3KJOA 2R92G 4BY7G 5CO4A 4BBRH 3HOVH 5FLMH 4KHPL 2Q2HA 4A76A 4POGA 4UY8C 3KY7A 1NE3A 4GOPC 4YQAA 5M5WH 2RF4A 3FHWA 3OW2A 3S14H 5IP7H 2UUBQ 1IPAA 2Q2UA 4YQRA 2MFIA 4ME3A 1Q8KA 3F2BA 1SFOH 1N32Q 3NK6A 1A8VA 3NBHB 3CW2C 4BBRG 3HOVG 1JJGA 1YJWA 4A3MH 3CQZH 4A3IG 1WFQA 2CCZA 1SE8A 2MO1A 4WJ4A 5GQOA 1M90C 4H3YA 1IYJB 2LXJA 4GOPB 2IHEA 2R7FA 3F1ZA 2ES2A 1N33Q 4GKKQ 3DCMX 3UDXA 1X65A 1L0WA 1J5EL 1NBWA 1A62A 1IBLQ 4P75A 4YHHL 3RLFA 3RN5A 5GAGC 4JI2Q 2B29A 2UXBQ 1EIYB 3CCLA 1AH9A 1FGUA 1UE7A 1VQMA 1VHKA 4YQ0A 3RLOA 4H3ZA 4YQJA 1XTDA 2I5MX 4DV0Q 4JI5Q 1YHAA 2F3IA 2IT1A 4JCVE 3EBEA 2Y0SG 2LSSA 3K80C 2R93G 4YVKA 1E22A 4OWTB 1KAWA 1OXVA 4YCWA 3A5UA 5M5YH 2CWPA 1Q12A 1IBKL 3ERSX 4DR7L 5C44G 4OO1G 4YQ4A 3D31A 1G51A 4FDBA 2QWVA 1I6HH 1PH4A 4DR4Q 3KW2A 3S1QH 1SMXA 1E3PA 4A3FG 3TS2A 2D0OA 2V1CC 3CCJA 4GOPA 2VL6A 4HIKA 4LF8L 3RR5A 4QL5A 4X6AH 1Q86C 1I94Q 4YQTA 1QVCA 3CP0A 5GADC 2F4VQ 4UP7A 4IFDG 4GLAC 1X6OA 2VQFQ 4JBMA 3FKIG 3RZDH 3A74A 4AQYQ 3HOWG 5IY0A 1K8GA 3K7UC 1PA6A 5E7NA 1SN8A 3TQYA 1NMFA 2Y0SE 3AXZA 4JI4L 3KNUA 1RIPA 2JA5H 1CSQA 4A3BH 1E24A 2RCNA 4B3SL 1HNXL 4K0KQ 3ONPA 4A3KG 1FJGQ 1TXYA 2K5HA 1VQNA 4YQBA 4X3LA 3KF8B 1XNQQ 3J7ZC 4DV6L 1TO0A 2QGQA 3U4ZA 2MQHA 5IWAL 4DV3Q 4P74A 4DV4L 3J80i 1PH5A 4OWXB 2F52A 4LF5L 1IL2A 2ZM6L 4YPYA 4E8BA 1XMQQ 1C9OA 4MCBA 5H1SE 4YWLA 4JWHA 3UE0A 4LF4L 3KLWA 3KYHC 1X3EA 5GAEC 1J85A 2HA8A 4YY3L 4LFCL 1BBWA 3G6EA 2I5HA 4IPDA 3A5ZB 1UAJA 1OXTA 2B63H 2WP8J 3I7FA 3PCOB 1FVIA 4AIMA 3U4VA 5IWAQ 2HT1A 4IFDJ 1KC8C 1XPOA 5JJKA 1UALA 1V2XA 3ILKA 4YQ5A 4GNXC 2CFMA 4JI3Q 2ATWA 4QJFA 3GTKH 2A1AA 1TWAH 3E9HA 1G291 3BBDA 4L5RC 1LTLA 2EXDA 4GN4B 3PF4A 1PVOA 1EWIA 2ZTEA 1TWCH 4BY1H 2I6DA 3WWVA 2RHSB 4A3JH 4HJ8A 4NXML 2C35B 4TVAB 2R7ZG 1N32L 4YQ3A 3D0FA 1WYDA 3CC7A 1KD1C 4A3EH 2HIVA 4PZKA 1WCMG 1UAMA 4OONA 5K36G 4YQNA 1VQHA 3N4JA 2UUCQ 3H3VH 4KHZA 4DAMA 5C4XH 4A3LH 4BY1G 4YQDA 1VQDA 3PO2H 1FL0A 4YCVA 3I4MH 4A3MG 4JOIA 3CPWA 4JALA 3I4NG 1N36Q 4JI3L 2B3GA 3M4QA 1YHQA 3HKSA 3J80c 1YITA 5GROA 2IY5B 4O2DA 1Z85A 2MNAA 1JMCA 1KRTA 3G4SA 2HHHL 3W5OA 1KRSA 3CF5A 1WOCA 4OX9Q 1KQSA 4A3LG 5LMUQ 5C4XG 1YHBA 2BA0A 4DUZL 2I0QA 1GVPA 5D9FA 4A3DG 4B3TL 3HOZG 3L2PA 4WJ3M 3KTYA 4LF5Q 4YQ7A 4LW1A 1AE3A 2OCEA 4JI8Q 4HJ7A 2WB1G 4IJHA 4GNXA 3ICEA 2ASBA 4B3RL 3AQQA 3UDFA 1Q1BA 3F2CA 3PUXA 2Z0YA 4L69A 2UXCQ 2R6GA 3NENA 1YEZA 3AIAA 4IG6A 1HR0Q 2GN5A 4MZ9A 3KF6A 2N49A 4R1JA 1HNXQ 5ELNA 4A3IH 1U0LA 4K0KL 4A3DH 1HR0L 3ULJA 1HNWQ 1PV4A 2JJQA 4HJ5A 1YJNA 4NPSA 4B3RQ 4JV5L 3E0EA 4JI8L 3GTMH 3O7BA 3CC4A 1I50H 4B3TQ 3S15H 4A3CH 3BZCA 1R9TH 4J3CA 1OXXK 3S1RH 4UP8A 4YQSA 1VQLA 2K4KA 1XMQL 2YTYA 3RLNA 1MJCA 1O6DA 2K75A 1HZCA 1VQOA 4LF8Q 1PYBA 5HY6A 2DGYA 2WB1E 4MTNA 5C0XG 1GD7A 3TRZA 4RMFA 3PGZA 4J15A 1N36L 4BBSH 5IYCG 3S24A 4DR5L 1FJGL 2Z0SA 1XPUA 3L0OA 3F8TA 4XIGS 3CCRA 2Z6KA 4B3SQ 1VQFA 2JA5G 4AYBE 4DR7Q 3T1HL 3M7NA 2UUCL 1NTGA 1VQ4A 3KDFA 1Q1EA 4JWFA 1S40A 1VQ7A 1BBUA 1Z9FA 3H0GH 3NELA 5EAYA 2VW9A 1X3FA 3T1HQ 1Y1WG 1N8RC 4JI7L 3GTQH 3AI9X 2K50A 4YQ2A 1N9WA 1GZ0A 3OTOQ 2N3SA 2VQFL 2O3AA 1NJIC 1GKHA 4CNEA 1PH2A 4DR5Q 3K7AH 5C3EH 2JK8A 4Y7NH 4X66Q 5GM8A 4YQQA 1WI5A 4XTCS 4LF9Q 2AWNA 3H0GG 1CKNA 1LYLA 4KGNA 4A3GG 4YQ1A 2DUDA 2XGTA 2A8VA 2QEXA 2NZOA 4CNFA 2I5LX 3S16H 5M3FH 3RN2A 2OWOA 4YQKA 3J81j 4LFCQ 1K3RA 4JBJA 2JEAI 2JE6I 1VQKA 3IC6A 2Z6KC 5M3MH 2E5LQ 3OIIA 2WAQE 5JJIA 3GD7A 1QZHA 1I5FA 4DK6C 4LF9L 3S17H 2CQOA 2JEBI 2R7ZH 2K14A 4X66L 3S1NH 1U5KA 4JOIC 2D0PA 2D62A 1WCMH 2UXCL 5HGQA 3PO3G 3N4KA 1EIFA 3B6YA 5M3MG 1UE5A 1PH3A 4YVJA 4IO9A 4IPHA 1S3OA 2AKWB 1EYGA 4JI7Q 3CD6A 4YQPA 1J5EQ 2E5LL 1K83H 4LF6Q 4JWGA 3QUVA 5FLXc 4DV2Q 4YQOA 5LMUL 2YY8A 4YQ9A 4LFAQ 2HHHQ 2OQKA 4NXNQ 3I56A 1JB7A 4O0AA 4LWCA 4DR1L 4JI0Q 2E2JH 4YWKA 2ZTDA 2IHFA 2VZAA 2NVTH 1X7OA 4YQCA 2WAQG 5C4JH 2JA8H 1V43A 2V3KA 4LUZA 3E5YA 5IYBG 2NVQH 2BH2A 4FMWA 4JBWA 1B8AA 5IP9G 3STBD 4JI0L 3HOXH 4NXNL 1MXIA 1KHIA 4LFAL 3M4PA 1Z47A 3BBHA 3HKZG 4DV2L 2R92H 2GVAA 4DUYQ 2PNHA 1I3QH 3FP9A 1Y1VH 4YPZA 1L1OA 1YNXA 3PUWA 4QGUA 2KBNA 1A63A 2L15A 3HOUH 4DKAC 3PV0A 1PH8A 1HNWL 1EFWA 4MCDA 1A0IA 5IP7G 2GVBA 1PYSB 4R4TA 4DV5Q 4BA1I 4GKJL 4UP9A 4FAKA 1ASYA 3K0XA 5JEAJ 2R93H 5IYDH 3ULPA 4YQLA 3CAMA 3JAMi 1BVSA 3K81C 1LM0A 3U58A 1YI2A 4B3ML 1MJEA 2CKZB 2YTXA 3HOUG 1VQPA 1PH9A 2VS1A 1UE6A 1IBML 4IOAA 3U50C 4YQ8A 4YPXA 1T9HA 3K8AA 5M5XH 1TWGH 4X64L 3GO5A 2CX8A 4HIMA 4DV4Q 5IYDG 5IYCH 2IX0A 4PZ6A 4A75A 4DR6Q 4JV5Q 1ZJRA 3OIJA 1NY4A 1XMOQ 3UE1A 1K9MC 1V9PA 2N8NA 5C0XI 2VQEL 3CCSA 1VQ6A 2KHJA 3RZOH 1EQQA 4DPGA 1C7YA 5J3BA 1B7YB 1E1OA 3TREA 3FKIH 4OWWB 3HOWH 2ALYB 3PUVA 1JJ2A 2ZTCA 1D7QA 4YQ6A 3AYHB 4BA2I 3OTOL 1UE1A 1YZ6A 1LUZA 3J81c 2KHIA 1V1QA 3LGJA 2A19A 1B70B 4QY7A 4GNXB 4X65Q 2PI2E 5C0XJ 4C3HH 3EIVA 1V6ZA 4PG3A 4A3KH 5BR8L 1OXSC 1QUQB 4DR2Q 2R7DA 4OX9L 1I94L 1X56A 1N34L 3TS0A 4JI1Q 5IT9c 4LF7L 3BZKA 4YCUA 4NB3A 4R4CA 3CPFA 3IRBA 4DR3L 2UXDQ 3W1BA 3W1GA 5FAIA 2AWOA 2NN6G 5DLQE 2JA6G 4X62Q 4YVHA 1E7ZA 1G6PA 5JJLA 4YY3Q 1Y1WH 4JAKA 2K5NA 4P73A 1IXRA 2PI2A 1SROA 3HFZB 3NEMA 4IJLA 1VQCA 4KLKA 4R4QA 4AH6A 2JA9A 5GAHC 2B63G 4LFBL 2EGWA 5GMCA 2UU9L 1CKOA 5FJ8H 2JA7G 3PUZA 3RNUA 1X3GA 4JI5L 4DV0L 2E2HH 1X7PA 2KCMA 1MKHA 3L7ZC 2QMMA 1H95A 1XNRL 1JT8A 3KDFB 3KOJA 3PUYA 4L5SA 4Y52H 4YHHQ 2BA1A 1HNZQ 1NS5A 4LFBQ 1Q81C 4APVA 1OY5A 1P8LA 4R4OA 3T1YL 1NMGA 1VCIA 4A3EG 3UDGA 4YPWA 3MEFA 1EQRA 1NXZA 1EUJA 5AJ3Q 1HH2P 2PQAB 4C3IH 4C3JH 4JYAL 3JC66 2ZJPA 2UUAQ 4BXXH 3CMEA 1QVFA 2AMCB 3G71A 1VHYA 2AHOB 3L8UA 2Q2IA 2YV5A 4LF4Q 3I4MG 1GO3E 4DUZQ 4MNOA 2F4VL 4PZ7A 5LMNL 3I4NH 4JI1L 4RG1A 4EX5A 1BKBA 2JQOA 1VQ5A 1CKNB 5IYBH 2ZM6Q 1N34Q 2NVXH 2EIFA 3HOYH 2VY3A 5JEAG 3GYQA 2MO0A 5LMNQ 1YBYA 2YYZA 4BXXG 4DV6Q 1YIJA 3BU2A 3AFPA 4H02A 4IPGA 1PFSA 4YQGA 4A3JG 2N78A 4JYAQ 1X55A 1Y1VG 4DNIA 1S72A 3T1YQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUK A;  1IZ6 A;  1IBK Q;  2WFW A;  2H5X A;  3BBE A;  2YTV A;  2HIX A;  4DV7 Q;  3M3Y H;  1VQJ A;  3CCM A;  2QA4 A;  4NXM Q;  3PO2 G;  2ID0 A;  5FLM G;  1QZG A;  1SRU A;  1OTC A;  3H3V I;  1PH7 A;  2YU9 H;  4DR6 L;  5GMB A;  4IPC A;  1JE5 A;  1SLJ A;  4GLV B;  5IP9 H;  2UU9 Q;  2CWA A;  1PH1 A;  1HJP A;  3OYY A;  3SGI A;  3I55 A;  1CSP A;  4P72 A;  4PMW A;  3PF5 A;  3JAM c;  4A3C G;  4CND A;  4X62 L;  1UEB A;  3PIP A;  2UUA L;  1W2B A;  4YVG A;  4DK3 C;  2XTI A;  3HOZ H;  1VQ9 A;  4KI0 A;  4GLX A;  2VNU D;  1TWH H;  1E1T A;  1TWF H;  1VS0 A;  1Q82 C;  2HQL A;  2BH8 A;  3I2Z A;  1Q7Y C;  4LF7 Q;  2V3J A;  1VH0 A;  4X3M A;  3CCQ A;  2PQA A;  1QVG A;  1VQ8 A;  1XNR Q;  3S1M H;  4LUV A;  4DV3 L;  4DR2 L;  3GTO H;  4BBS G;  4KDZ A;  5BR8 Q;  1L2F A;  3NK7 A;  3STB C;  2FXQ A;  4X65 L;  3ULL A;  2Q2T A;  1XNQ L;  4IOC A;  2IX1 A;  3MXN B;  2LXK A;  3M9B A;  4YQI A;  1VQI A;  4DV7 L;  3KF6 B;  3GTJ H;  4L5Q A;  4R4I A;  2UXB L;  4KHP Q;  4GS3 A;  4YVI A;  3F2D A;  4JI2 L;  2NVY H;  2VUM H;  4MCC A;  3Q8D A;  3GTP H;  1IBL L;  4OO1 I;  3M85 A;  3OIN A;  1OXU A;  4JI4 Q;  3S2D H;  3J81 i;  4UPA A;  1N33 L;  3AFQ A;  3KJP A;  1L1O C;  4PZ8 A;  4JC0 A;  4AQY L;  2E2I H;  4DR3 Q;  2K5V A;  5C44 H;  2UXD L;  1YJ9 A;  2PMZ E;  3PIO A;  1YVC A;  1XMO L;  3AEV A;  1KXL A;  1M1K C;  4JI6 L;  2VUM G;  4JG2 A;  4A3F H;  1SR3 A;  3I4O A;  4JBK A;  2RHQ B;  2EQS A;  2OTL A;  4IFD I;  1UAK A;  3UDI A;  1IBM Q;  2NN6 I;  2OQ0 A;  3CXC A;  5M3F G;  3S2H H;  1HZ9 A;  3CMA A;  4P71 A;  4HID A;  1WJJ A;  3E9I A;  4B3M Q;  4DR4 L;  1QUQ A;  3CCE A;  1MIU A;  5AJ3 L;  4HIO A;  1GM5 A;  1ASZ A;  1RL2 A;  3BJU A;  4GKJ Q;  1KIX A;  5IE8 A;  1HNZ L;  5ELO A;  1VQB A;  4C2M H;  4A93 H;  1P9P A;  1HZA A;  4XBO A;  4OXP A;  1Y14 B;  2KCT A;  3GDE A;  4L5T A;  5C3E G;  1KL9 A;  4ALP A;  1XPR A;  3GTL H;  3ER0 A;  3ZJY C;  2VQE Q;  3J7A 5;  4A3B G;  1Q46 A;  4LNQ A;  2JA6 H;  1XJV A;  4AYB G;  3A0J A;  4DUY L;  1X9N A;  2NZH A;  3VDY A;  1JJC B;  1P16 A;  2K52 A;  4A4I A;  4DV1 L;  4A3G H;  4TQU S;  4YWM A;  3DLL A;  3KFU A;  4QQB X;  4X64 Q;  1C0A A;  4GN3 B;  1EOV A;  4POF A;  1HR0 W;  4A93 G;  1VQA A;  2ZJQ A;  4CNG A;  3HOY G;  3EN2 A;  5FJ8 G;  1D8L A;  4GN5 A;  1W3S A;  3CCV A;  3G48 A;  2JA7 H;  4GKK L;  2OTJ A;  4LUO A;  3IEF A;  1CKM A;  3HKZ E;  4EQ5 A;  3TEH B;  2E8G A;  1HZB A;  4BY7 H;  1AE2 A;  1J6Q A;  1O7I A;  4DV1 Q;  4JI6 Q;  3GTG H;  2JA8 G;  2EGV A;  4DR1 Q;  2ZJR A;  4DV5 L;  3CC2 A;  3CCU A;  4QIW E;  1PHJ A;  3H15 A;  1K8A C;  1VQG A;  1VQE A;  3HOX G;  2UUB L;  3PO3 H;  4LF6 L;  3DM3 A;  1DGS A;  3PSI A;  3M4O H;  1UWV A;  4HJ9 A;  1L1O B;  2KEN A;  4HJA A;  5LMN W;  1K73 C;  1PH6 A;  1K0R A;  1X54 A;  4DAY B;  3KJO A;  2R92 G;  4BY7 G;  5CO4 A;  4BBR H;  3HOV H;  5FLM H;  4KHP L;  2Q2H A;  4A76 A;  4POG A;  4UY8 C;  3KY7 A;  1NE3 A;  4GOP C;  4YQA A;  5M5W H;  2RF4 A;  3FHW A;  3OW2 A;  3S14 H;  5IP7 H;  2UUB Q;  1IPA A;  2Q2U A;  4YQR A;  2MFI A;  4ME3 A;  1Q8K A;  3F2B A;  1SFO H;  1N32 Q;  3NK6 A;  1A8V A;  3NBH B;  3CW2 C;  4BBR G;  3HOV G;  1JJG A;  1YJW A;  4A3M H;  3CQZ H;  4A3I G;  1WFQ A;  2CCZ A;  1SE8 A;  2MO1 A;  4WJ4 A;  5GQO A;  1M90 C;  4H3Y A;  1IYJ B;  2LXJ A;  4GOP B;  2IHE A;  2R7F A;  3F1Z A;  2ES2 A;  1N33 Q;  4GKK Q;  3DCM X;  3UDX A;  1X65 A;  1L0W A;  1J5E L;  1NBW A;  1A62 A;  1IBL Q;  4P75 A;  4YHH L;  3RLF A;  3RN5 A;  5GAG C;  4JI2 Q;  2B29 A;  2UXB Q;  1EIY B;  3CCL A;  1AH9 A;  1FGU A;  1UE7 A;  1VQM A;  1VHK A;  4YQ0 A;  3RLO A;  4H3Z A;  4YQJ A;  1XTD A;  2I5M X;  4DV0 Q;  4JI5 Q;  1YHA A;  2F3I A;  2IT1 A;  4JCV E;  3EBE A;  2Y0S G;  2LSS A;  3K80 C;  2R93 G;  4YVK A;  1E22 A;  4OWT B;  1KAW A;  1OXV A;  4YCW A;  3A5U A;  5M5Y H;  2CWP A;  1Q12 A;  1IBK L;  3ERS X;  4DR7 L;  5C44 G;  4OO1 G;  4YQ4 A;  3D31 A;  1G51 A;  4FDB A;  2QWV A;  1I6H H;  1PH4 A;  4DR4 Q;  3KW2 A;  3S1Q H;  1SMX A;  1E3P A;  4A3F G;  3TS2 A;  2D0O A;  2V1C C;  3CCJ A;  4GOP A;  2VL6 A;  4HIK A;  4LF8 L;  3RR5 A;  4QL5 A;  4X6A H;  1Q86 C;  1I94 Q;  4YQT A;  1QVC A;  3CP0 A;  5GAD C;  2F4V Q;  4UP7 A;  4IFD G;  4GLA C;  1X6O A;  2VQF Q;  4JBM A;  3FKI G;  3RZD H;  3A74 A;  4AQY Q;  3HOW G;  5IY0 A;  1K8G A;  3K7U C;  1PA6 A;  5E7N A;  1SN8 A;  3TQY A;  1NMF A;  2Y0S E;  3AXZ A;  4JI4 L;  3KNU A;  1RIP A;  2JA5 H;  1CSQ A;  4A3B H;  1E24 A;  2RCN A;  4B3S L;  1HNX L;  4K0K Q;  3ONP A;  4A3K G;  1FJG Q;  1TXY A;  2K5H A;  1VQN A;  4YQB A;  4X3L A;  3KF8 B;  1XNQ Q;  3J7Z C;  4DV6 L;  1TO0 A;  2QGQ A;  3U4Z A;  2MQH A;  5IWA L;  4DV3 Q;  4P74 A;  4DV4 L;  3J80 i;  1PH5 A;  4OWX B;  2F52 A;  4LF5 L;  1IL2 A;  2ZM6 L;  4YPY A;  4E8B A;  1XMQ Q;  1C9O A;  4MCB A;  5H1S E;  4YWL A;  3UE0 A;  4LF4 L;  3KLW A;  3KYH C;  1X3E A;  5GAE C;  1J85 A;  2HA8 A;  4YY3 L;  4LFC L;  1BBW A;  3G6E A;  2I5H A;  4IPD A;  3A5Z B;  1UAJ A;  1OXT A;  2B63 H;  2WP8 J;  3I7F A;  3PCO B;  1FVI A;  4AIM A;  3U4V A;  5IWA Q;  2HT1 A;  4IFD J;  1KC8 C;  1XPO A;  5JJK A;  1UAL A;  1V2X A;  3ILK A;  4YQ5 A;  4GNX C;  2CFM A;  4JI3 Q;  2ATW A;  4QJF A;  3GTK H;  2A1A A;  1TWA H;  3E9H A;  1G29 1;  3BBD A;  4L5R C;  1LTL A;  2EXD A;  4GN4 B;  3PF4 A;  1PVO A;  1EWI A;  2ZTE A;  1TWC H;  4BY1 H;  2I6D A;  3WWV A;  2RHS B;  4A3J H;  4HJ8 A;  4NXM L;  2C35 B;  4TVA B;  2R7Z G;  1N32 L;  4YQ3 A;  3D0F A;  1WYD A;  3CC7 A;  1KD1 C;  4A3E H;  2HIV A;  4PZK A;  1WCM G;  1UAM A;  4OON A;  5K36 G;  4YQN A;  1VQH A;  3N4J A;  2UUC Q;  3H3V H;  4KHZ A;  4DAM A;  5C4X H;  4A3L H;  4BY1 G;  4YQD A;  1VQD A;  3PO2 H;  1FL0 A;  4YCV A;  3I4M H;  4A3M G;  4JOI A;  3CPW A;  4JAL A;  3I4N G;  1N36 Q;  4JI3 L;  2B3G A;  3M4Q A;  1YHQ A;  3HKS A;  3J80 c;  1YIT A;  5GRO A;  2IY5 B;  4O2D A;  1Z85 A;  2MNA A;  1JMC A;  1KRT A;  3G4S A;  2HHH L;  3W5O A;  1KRS A;  3CF5 A;  1WOC A;  4OX9 Q;  1KQS A;  4A3L G;  5LMU Q;  5C4X G;  1YHB A;  2BA0 A;  4DUZ L;  2I0Q A;  1GVP A;  5D9F A;  4A3D G;  4B3T L;  3HOZ G;  3L2P A;  4WJ3 M;  3KTY A;  4LF5 Q;  4YQ7 A;  4LW1 A;  1AE3 A;  2OCE A;  4JI8 Q;  4HJ7 A;  2WB1 G;  4IJH A;  4GNX A;  3ICE A;  2ASB A;  4B3R L;  3AQQ A;  3UDF A;  1Q1B A;  3F2C A;  3PUX A;  2Z0Y A;  4L69 A;  2UXC Q;  2R6G A;  3NEN A;  1YEZ A;  3AIA A;  4IG6 A;  1HR0 Q;  2GN5 A;  4MZ9 A;  3KF6 A;  2N49 A;  4R1J A;  1HNX Q;  5ELN A;  4A3I H;  1U0L A;  4K0K L;  4A3D H;  1HR0 L;  3ULJ A;  1HNW Q;  1PV4 A;  2JJQ A;  4HJ5 A;  1YJN A;  4NPS A;  4B3R Q;  4JV5 L;  3E0E A;  4JI8 L;  3GTM H;  3O7B A;  3CC4 A;  1I50 H;  4B3T Q;  3S15 H;  4A3C H;  3BZC A;  1R9T H;  4J3C A;  1OXX K;  3S1R H;  4UP8 A;  4YQS A;  1VQL A;  2K4K A;  1XMQ L;  2YTY A;  3RLN A;  1MJC A;  1O6D A;  2K75 A;  1HZC A;  1VQO A;  4LF8 Q;  1PYB A;  5HY6 A;  2DGY A;  2WB1 E;  4MTN A;  5C0X G;  1GD7 A;  3TRZ A;  4RMF A;  3PGZ A;  4J15 A;  1N36 L;  4BBS H;  5IYC G;  3S24 A;  4DR5 L;  1FJG L;  2Z0S A;  1XPU A;  3L0O A;  3F8T A;  4XIG S;  3CCR A;  2Z6K A;  4B3S Q;  1VQF A;  2JA5 G;  4AYB E;  4DR7 Q;  3T1H L;  3M7N A;  2UUC L;  1NTG A;  1VQ4 A;  3KDF A;  1Q1E A;  1S40 A;  1VQ7 A;  1BBU A;  1Z9F A;  3H0G H;  3NEL A;  5EAY A;  2VW9 A;  1X3F A;  3T1H Q;  1Y1W G;  1N8R C;  4JI7 L;  3GTQ H;  3AI9 X;  2K50 A;  4YQ2 A;  1N9W A;  1GZ0 A;  3OTO Q;  2N3S A;  2VQF L;  2O3A A;  1NJI C;  1GKH A;  4CNE A;  1PH2 A;  4DR5 Q;  3K7A H;  5C3E H;  2JK8 A;  4Y7N H;  4X66 Q;  5GM8 A;  4YQQ A;  1WI5 A;  4XTC S;  4LF9 Q;  2AWN A;  3H0G G;  1CKN A;  1LYL A;  4KGN A;  4A3G G;  4YQ1 A;  2DUD A;  2XGT A;  2A8V A;  2QEX A;  2NZO A;  4CNF A;  2I5L X;  3S16 H;  5M3F H;  3RN2 A;  2OWO A;  4YQK A;  3J81 j;  4LFC Q;  1K3R A;  4JBJ A;  2JEA I;  2JE6 I;  1VQK A;  3IC6 A;  2Z6K C;  5M3M H;  2E5L Q;  3OII A;  2WAQ E;  5JJI A;  3GD7 A;  1QZH A;  1I5F A;  4DK6 C;  4LF9 L;  3S17 H;  2CQO A;  2JEB I;  2R7Z H;  2K14 A;  4X66 L;  3S1N H;  1U5K A;  4JOI C;  2D0P A;  2D62 A;  1WCM H;  2UXC L;  5HGQ A;  3PO3 G;  3N4K A;  1EIF A;  3B6Y A;  5M3M G;  1UE5 A;  1PH3 A;  4YVJ A;  4IO9 A;  4IPH A;  1S3O A;  2AKW B;  1EYG A;  4JI7 Q;  3CD6 A;  4YQP A;  1J5E Q;  2E5L L;  1K83 H;  4LF6 Q;  3QUV A;  5FLX c;  4DV2 Q;  4YQO A;  5LMU L;  2YY8 A;  4YQ9 A;  4LFA Q;  2HHH Q;  2OQK A;  4NXN Q;  3I56 A;  1JB7 A;  4O0A A;  4LWC A;  4DR1 L;  4JI0 Q;  2E2J H;  4YWK A;  2ZTD A;  2IHF A;  2VZA A;  2NVT H;  1X7O A;  4YQC A;  2WAQ G;  5C4J H;  2JA8 H;  1V43 A;  2V3K A;  4LUZ A;  3E5Y A;  5IYB G;  2NVQ H;  2BH2 A;  4JBW A;  1B8A A;  5IP9 G;  3STB D;  4JI0 L;  3HOX H;  4NXN L;  1MXI A;  1KHI A;  4LFA L;  3M4P A;  1Z47 A;  3BBH A;  3HKZ G;  4DV2 L;  2R92 H;  2GVA A;  4DUY Q;  2PNH A;  1I3Q H;  3FP9 A;  1Y1V H;  4YPZ A;  1L1O A;  1YNX A;  3PUW A;  4QGU A;  2KBN A;  1A63 A;  2L15 A;  3HOU H;  4DKA C;  3PV0 A;  1PH8 A;  1HNW L;  1EFW A;  4MCD A;  1A0I A;  5IP7 G;  2GVB A;  1PYS B;  4R4T A;  4DV5 Q;  4BA1 I;  4GKJ L;  4UP9 A;  4FAK A;  1ASY A;  3K0X A;  5JEA J;  2R93 H;  5IYD H;  3ULP A;  4YQL A;  3CAM A;  3JAM i;  1BVS A;  3K81 C;  1LM0 A;  3U58 A;  1YI2 A;  4B3M L;  1MJE A;  2CKZ B;  2YTX A;  3HOU G;  1VQP A;  1PH9 A;  2VS1 A;  1UE6 A;  1IBM L;  4IOA A;  3U50 C;  4YQ8 A;  4YPX A;  1T9H A;  3K8A A;  5M5X H;  1TWG H;  4X64 L;  3GO5 A;  2CX8 A;  4HIM A;  4DV4 Q;  5IYD G;  5IYC H;  2IX0 A;  4PZ6 A;  4A75 A;  4DR6 Q;  4JV5 Q;  1ZJR A;  3OIJ A;  1NY4 A;  1XMO Q;  3UE1 A;  1K9M C;  1V9P A;  2N8N A;  5C0X I;  2VQE L;  3CCS A;  1VQ6 A;  2KHJ A;  3RZO H;  1EQQ A;  4DPG A;  1C7Y A;  5J3B A;  1B7Y B;  1E1O A;  3TRE A;  3FKI H;  4OWW B;  3HOW H;  2ALY B;  3PUV A;  1JJ2 A;  2ZTC A;  1D7Q A;  4YQ6 A;  3AYH B;  4BA2 I;  3OTO L;  1UE1 A;  1YZ6 A;  1LUZ A;  3J81 c;  2KHI A;  1V1Q A;  3LGJ A;  2A19 A;  1B70 B;  4QY7 A;  4GNX B;  4X65 Q;  2PI2 E;  5C0X J;  4C3H H;  3EIV A;  1V6Z A;  4PG3 A;  4A3K H;  5BR8 L;  1OXS C;  1QUQ B;  4DR2 Q;  2R7D A;  4OX9 L;  1I94 L;  1X56 A;  1N34 L;  3TS0 A;  4JI1 Q;  5IT9 c;  4LF7 L;  3BZK A;  4YCU A;  4NB3 A;  4R4C A;  3CPF A;  3IRB A;  4DR3 L;  2UXD Q;  3W1B A;  3W1G A;  5FAI A;  2AWO A;  2NN6 G;  5DLQ E;  2JA6 G;  4X62 Q;  4YVH A;  1E7Z A;  1G6P A;  5JJL A;  4YY3 Q;  1Y1W H;  4JAK A;  2K5N A;  4P73 A;  1IXR A;  2PI2 A;  1SRO A;  3HFZ B;  3NEM A;  4IJL A;  1VQC A;  4KLK A;  4R4Q A;  4AH6 A;  2JA9 A;  5GAH C;  2B63 G;  4LFB L;  2EGW A;  5GMC A;  2UU9 L;  1CKO A;  5FJ8 H;  2JA7 G;  3PUZ A;  3RNU A;  1X3G A;  4JI5 L;  4DV0 L;  2E2H H;  1X7P A;  2KCM A;  1MKH A;  3L7Z C;  2QMM A;  1H95 A;  1XNR L;  1JT8 A;  3KDF B;  3KOJ A;  3PUY A;  4L5S A;  4Y52 H;  4YHH Q;  2BA1 A;  1HNZ Q;  1NS5 A;  4LFB Q;  1Q81 C;  4APV A;  1OY5 A;  1P8L A;  4R4O A;  3T1Y L;  1NMG A;  1VCI A;  4A3E G;  3UDG A;  4YPW A;  3MEF A;  1EQR A;  1NXZ A;  1EUJ A;  5AJ3 Q;  1HH2 P;  2PQA B;  4C3I H;  4C3J H;  4JYA L;  3JC6 6;  2ZJP A;  2UUA Q;  4BXX H;  3CME A;  1QVF A;  2AMC B;  3G71 A;  1VHY A;  2AHO B;  3L8U A;  2Q2I A;  2YV5 A;  4LF4 Q;  3I4M G;  1GO3 E;  4DUZ Q;  4MNO A;  2F4V L;  4PZ7 A;  5LMN L;  3I4N H;  4JI1 L;  4RG1 A;  4EX5 A;  1BKB A;  2JQO A;  1VQ5 A;  1CKN B;  5IYB H;  2ZM6 Q;  1N34 Q;  2NVX H;  2EIF A;  3HOY H;  2VY3 A;  5JEA G;  3GYQ A;  2MO0 A;  5LMN Q;  1YBY A;  2YYZ A;  4BXX G;  4DV6 Q;  1YIJ A;  3BU2 A;  3AFP A;  4H02 A;  4IPG A;  1PFS A;  4YQG A;  4A3J G;  2N78 A;  4JYA Q;  1X55 A;  1Y1V G;  4DNI A;  1S72 A;  3T1Y Q; 
#chains in the Genus database with same CATH topology
 1D5X C;  1IZ6 A;  1IBK Q;  1ZKO A;  1F9P A;  2HIX A;  3MEH A;  2KVM A;  4DV7 Q;  4NXM Q;  3NWT A;  5GMB A;  1SRU A;  2BCO A;  2YU9 H;  3HOZ B;  4IPC A;  4GLV B;  1PZJ D;  1SLJ A;  1SYB A;  2CWA A;  3OYY A;  3I55 A;  1JWU D;  1HPC A;  2F0Q A;  3JAM c;  4A3C G;  3TP8 A;  5FLX E;  2UUA L;  1W2B A;  4DK3 C;  2XTI A;  1VQ9 A;  4GLX A;  1I4Q A;  2CHB D;  1VS0 A;  1H9K A;  4N9P A;  3ONA B;  2O5J C;  4X3M A;  1N32 L;  1XNR Q;  2EJM A;  4KN7 C;  4DR2 L;  5BR8 Q;  1DJR D;  4X65 L;  2Q2T A;  3NHH A;  2IX1 A;  2PZT A;  2RDF A;  1VQI A;  2F0U A;  4L8J A;  4DV7 L;  3A8K E;  4L5Q A;  5FKA C;  2UXB L;  1BXT A;  4GS3 A;  4JI2 L;  4YVI A;  2VUM H;  4MCC A;  3U9S A;  4OO1 I;  2PNR C;  3S2D H;  3J81 i;  1SEB D;  4H0L C;  2E2I H;  4AQY L;  3HKZ B;  1G2T A;  2PMZ E;  3PIO A;  1M1K C;  2ZXP A;  1A2T A;  5E1F A;  2EY5 A;  2CW0 C;  5M3F G;  1ENC A;  5EPL A;  3GTG B;  3BDC A;  3OHX C;  4P71 A;  1BUV T;  3D6C A;  4XYQ A;  5M5X B;  3J7A F;  2KA7 A;  1QUQ A;  1GM5 A;  4G7H C;  2YU9 B;  1RL2 A;  3BJU A;  5M9O A;  2XSC A;  2CH4 A;  1I4P A;  1HNZ L;  2E2I B;  1VQB A;  1P9P A;  5E4X A;  4L5T A;  2KCT A;  2EYF A;  3G7L A;  3ZJY C;  1JOO A;  2PW7 A;  1Q46 A;  1XJV A;  2NZH A;  5KNB A;  1SDF A;  3T4A C;  2O5I C;  3WDN A;  4TQU S;  1C0A A;  5AFW A;  1QNU A;  5COY A;  4JWJ A;  4GZY C;  1RTN A;  4A3K B;  4GKK L;  3G48 A;  3IEF A;  2F1M A;  4G4K A;  1F2L A;  4DV1 Q;  5E3F A;  2JA8 G;  3E0J A;  4DR1 Q;  2Z1C A;  4B08 A;  4QIW E;  3H15 A;  4I65 A;  1VQE A;  1E2V A;  3SVM A;  2AQ1 B;  3QOJ A;  3M4O H;  4HJ9 A;  4HJA A;  2A74 C;  5A2Q E;  5BN5 A;  5FLM H;  4POG A;  1BCP D;  3KY7 A;  4GOP C;  5M5W H;  4L63 B;  2D2C C;  5IP7 H;  2EXZ A;  1SFO H;  3F2B A;  1A8V A;  4LAA A;  2B39 A;  4CJ0 B;  2XIW A;  3I73 A;  3SXH A;  1KNA A;  1WFQ A;  3TP7 A;  2MO1 A;  2Z4I A;  5CC4 A;  1T5X D;  3F1Z A;  1H9S B;  4A3B B;  3DCM X;  1J5E L;  4K6D A;  3T56 B;  1AP0 A;  4YHH L;  3RLF A;  3RN5 A;  5GAG C;  1LTT D;  4JI2 Q;  1CZG A;  2UXB Q;  3CCL A;  1TS5 A;  4DV0 Q;  2H1E A;  5JPM C;  5EBD A;  3K80 C;  1E22 A;  5HUR A;  2NWG A;  3I70 A;  3A5U A;  3ERS X;  5C44 G;  4RWS C;  2KEE A;  2QWV A;  2RDG A;  3PIO 3;  4M8A A;  2V1C C;  4IAL A;  2VL6 A;  1YNN D;  2L4N A;  2KJX A;  3H09 A;  4HIK A;  1WTX A;  4QL5 A;  4YQT A;  1QVC A;  3CP0 A;  5ELC A;  1WCM B;  2L1B A;  3FKI G;  2E2D C;  1DON A;  1K8G A;  5E7N A;  1SN8 A;  4K5V A;  3J80 L;  4JI4 L;  1R4P B;  1E24 A;  4A3K G;  3RZD B;  2K5H A;  1VQN A;  1PTO B;  3J7Z C;  4DV6 L;  3U4Z A;  2MQH A;  1TY0 A;  2E74 C;  3GTM B;  2ZM6 L;  2ZXR A;  4YWL A;  1U4P A;  5GAE C;  3NBI A;  1FYC A;  1BBW A;  1O80 A;  2B2Y A;  2TMP A;  2B63 H;  2WP8 J;  1KLU D;  4RGN A;  1FVI A;  1UAL A;  2SOB A;  3H0G B;  4QJF A;  2A1A A;  3BZD B;  4ODG A;  3PF4 A;  2EXD A;  1PTO D;  2Q8I B;  1EQT A;  5FO7 B;  3A54 A;  4RHS A;  3T16 A;  3D0F A;  1WYD A;  2G5D A;  1G8Z D;  2HIV A;  1UAM A;  5K36 G;  2F0T A;  3VR2 A;  1EY7 A;  1EY6 A;  2ZT9 C;  3K6O A;  2R61 A;  1CQF A;  3H3V H;  4A3L H;  1NSN S;  3QB3 A;  1VQD A;  4A3M G;  4JOI A;  4JAL A;  1D1I A;  4ID6 A;  3VR5 A;  2B3G A;  3CQZ B;  3M4Q A;  1EYA A;  3HKS A;  1Z85 A;  3PIP 3;  1RHP A;  2MNA A;  1KTK A;  2HHH L;  4KMU C;  5C4X G;  4UDU C;  3IKJ A;  4HN7 A;  3KTY A;  1AE3 A;  2OCE A;  4HJ7 A;  4A3I B;  2WB1 G;  4ZRZ A;  1FGB D;  4ZLT F;  1Q1B A;  3MTS A;  2Z0Y A;  2UXC Q;  2K32 A;  2WAC A;  1HR0 Q;  2VB3 X;  1QJO A;  3K5N A;  2N49 A;  3A8I E;  4A3D H;  2NBF A;  4K5W A;  2PZW A;  2KEC A;  3GTM H;  3O7B A;  1PFM A;  4FP5 D;  4B3T Q;  4EQO A;  4A3C H;  4BBS B;  1WTW A;  1GHK A;  4QUF A;  4YQS A;  1VQL A;  3VYT A;  1MD2 D;  3RLN A;  3QIA A;  1HZC A;  4HMJ A;  1D5M C;  5ELB A;  1CI3 M;  1I4G A;  2Z0S A;  4BY1 B;  3F8T A;  1NCV A;  5E4W C;  4A93 B;  2JA5 G;  3HG9 A;  3L3O C;  2UUC L;  1SMY C;  1VQ4 A;  1S40 A;  1JE4 A;  1VQ7 A;  1Z9F A;  1QB5 D;  2RBM A;  2AUJ D;  1Y8O B;  2N3S A;  5KEE A;  5C3E H;  4X66 Q;  4OGQ C;  2F0M A;  4XTC S;  2MPM A;  1QWY A;  4YQ1 A;  2DUD A;  2XGT A;  2A8V A;  1HXY D;  1EQV A;  2C9O A;  2F0E A;  1SYG A;  1B3Q A;  3IC6 A;  2QF7 A;  1I5F A;  3S1N H;  2ENB A;  4JOI C;  1WCM H;  2IL8 A;  2UXC L;  3PO3 G;  2EYJ A;  3SK5 A;  1EIF A;  3N4K A;  5ELF A;  2M2L A;  5M3M G;  1B9M A;  3N6R A;  4IO9 A;  4I7Z C;  1EYG A;  2F0V A;  3CD6 A;  4YQP A;  1J5E Q;  1IHZ A;  2LKV A;  4DV2 Q;  4YQO A;  4CGY B;  2KOL A;  1Z6H A;  2HHH Q;  4WFN 3;  4DR1 L;  2E2J H;  4YWK A;  2EOT A;  2VZA A;  2NVT H;  1QOH A;  5C4J H;  2JA8 H;  1V43 A;  4CKC A;  1HA6 A;  2V3K A;  1HHV A;  2BH2 A;  4RA8 A;  1B8A A;  4KJN A;  5K36 H;  3Q0A A;  4LJZ C;  4K2K A;  2CH4 W;  3BBH A;  1I4H A;  4DV2 L;  2R92 H;  2MP1 A;  3PUW A;  3H6M A;  5DAU A;  5CV5 A;  2GVB A;  1PYS B;  4R4T A;  4V0B A;  1I3Q B;  1HTL D;  4UP9 A;  3W3A A;  5JEA J;  5IYD H;  3ULP A;  2Q8R E;  3CAM A;  2DY7 A;  3JAM i;  3K81 C;  3I4L A;  3TP5 A;  1MJE A;  3S16 B;  1VQP A;  5D65 A;  1PH9 A;  3U50 C;  3KK7 A;  1TWG H;  1K8O A;  2CX8 A;  1NAP A;  4HIM A;  3HS0 C;  1GUO A;  1ML0 D;  1SND A;  3M4O B;  2N8N A;  1VQ6 A;  4FXK C;  2KHJ A;  2B8G A;  4C56 C;  3KLR A;  3E6Z X;  3T51 B;  1D7Q A;  4BA2 I;  1F2Z A;  1BR9 A;  4K2L A;  2J7Z A;  5EPK A;  1B70 B;  2PPB C;  4X65 Q;  1V6Z A;  4C3H H;  3EIV A;  4FNF A;  5BR8 L;  4PMB A;  1JR0 D;  4DR2 Q;  1DOK A;  5CBE E;  1N34 L;  1LAC A;  3HEJ A;  3TP6 A;  4IUN A;  4NB3 A;  4U67 3;  2R92 B;  4R4C A;  2EYH A;  4WOR A;  4P2C B;  5BN3 A;  1HFN A;  4YVH A;  1E7Z A;  4DXF A;  4CDE C;  1KAB A;  1TS3 A;  1LT5 D;  5GAH C;  2JA9 A;  1LTA D;  2JA7 G;  3GTK B;  4JI5 L;  4DFA A;  1GOZ A;  3I8Z A;  1SE4 A;  3KDF B;  3KOJ A;  4L5S A;  4Y52 H;  2Z8L A;  4YHH Q;  1XYI A;  4LFB Q;  1IKM A;  4EQP A;  1OY5 A;  4R4O A;  1NMG A;  4ZCK A;  1EQR A;  5AJ3 Q;  1EZ8 A;  1HH2 P;  2NYZ D;  4JYA L;  3JC6 6;  2GA4 B;  2ZJP A;  2UUA Q;  3R8B A;  2FFK B;  3G71 A;  2AHO B;  2Q2I A;  2B2T C;  3DXJ C;  4MNO A;  3I4N H;  4RG1 A;  2NVX H;  2JQO A;  1D5Z C;  5IYB H;  3HOY H;  2HUG A;  5JEA G;  2MO0 A;  2L5T A;  3FDT A;  1CM9 A;  1YIJ A;  3BU2 A;  1RKN A;  2DNC A;  1ONL A;  1X55 A;  2K6A A;  1S72 A;  3T1Y Q;  2JA6 B;  1CUK A;  1FNU A;  2D5D A;  2FMM A;  4FO2 A;  2Z4H A;  3BBE A;  5K5P A;  2YTV A;  1JOR A;  4FVM A;  1ET9 A;  1PFN A;  1EWH A;  3CCM A;  3M4Y A;  2CQA A;  3NTI A;  3PO2 G;  3H3V I;  2B2W A;  3EVQ A;  2A6H C;  1OTC A;  1K8M A;  3NQI A;  1CSP A;  3SK4 A;  4CND A;  1UEB A;  2P5Z X;  4KI0 A;  5CV9 A;  1TWH H;  4RKB A;  1TWF H;  2BE5 C;  1Q82 C;  4XQJ A;  3I2Z A;  1EIH A;  2B2U A;  2XRQ D;  2V3J A;  1Y8N B;  5C0X H;  1QVG A;  2F0S A;  4R8I A;  3GTO H;  4BBS G;  1L2F A;  1DD2 A;  1B44 D;  4IUP A;  2BOS A;  2FIN B;  3MXN B;  1ZYR D;  4ZUI A;  3KF6 B;  4KHP Q;  2L55 A;  4C3H B;  5FOB B;  2K5D A;  4JI4 Q;  1UUP A;  1V1P B;  2RSO A;  3AFQ A;  3KJP A;  2NTS A;  1L0Y B;  1XMO L;  1KXL A;  1WTR A;  3Q23 A;  3E3X A;  4JG2 A;  3NWS A;  5A35 A;  3I4O A;  4UHV A;  2K5Q A;  4AYB B;  2OTL A;  1IBM Q;  2NN6 I;  4HAE A;  3K5O A;  1IW7 D;  5IGB A;  4HID A;  3W2D A;  4A3F B;  4HIO A;  1A3U A;  4K8I A;  3SHL A;  3RUZ A;  4XBO A;  1ET6 A;  4X3S A;  1KL9 A;  3J7A 5;  1MBY A;  1STN A;  3ER0 A;  4C3J G;  4LNQ A;  4DUY L;  2JA7 B;  1STA A;  3VDY A;  1F2Y A;  2K52 A;  4A4I A;  3WOF A;  1O7L A;  2A73 B;  5C4H A;  5IGF A;  4A93 G;  1VQA A;  2ZJQ A;  2PZU A;  2M9V A;  3EN2 A;  4GN5 A;  2PYK A;  2RDH A;  2E8G A;  3D6W A;  4R8N A;  4BY7 H;  3GTG H;  4DV5 L;  3S1Q B;  2JYO A;  1K8A C;  3PO3 H;  1ENA A;  3DM3 A;  4JW0 A;  2EY2 A;  1L1O B;  2KEN A;  1BNZ A;  4HR7 B;  5CO4 A;  1K0R A;  1X54 A;  4DAY B;  4BBR H;  3HOV H;  1CHQ D;  4KHP L;  2Q2H A;  4A76 A;  4UY8 C;  1X3Q A;  1GUS A;  3FHW A;  2UUB Q;  1IPA A;  1HQR D;  4ZYS A;  2Q2U A;  4YQR A;  4ME3 A;  2JA5 B;  2XVS A;  4KV6 A;  3NK6 A;  2JN4 A;  4ZK9 B;  3NBH B;  4CDD C;  3CW2 C;  4BBR G;  1A2U A;  3HOV G;  1YJW A;  1IYV A;  4A3I G;  1Y1W B;  1SE8 A;  1AEX A;  3FRP B;  5GQO A;  2MUY A;  2LXJ A;  2R7F A;  5EJW A;  2ES2 A;  1N33 Q;  1BDO A;  1SJE D;  1X65 A;  1L0W A;  1A62 A;  4RGM A;  4P75 A;  3U9O A;  1EIG A;  1YNN C;  5KIX A;  4YQJ A;  2IT1 A;  4JCV E;  1I6H B;  3EBE A;  2KUM A;  2LSS A;  2R93 G;  4BS9 A;  4YVK A;  4OWT B;  3P75 A;  4C1N I;  5M5Y H;  1HRJ A;  3A7A B;  4FDB A;  5KYI A;  1AZP A;  3S1Q H;  4A3F G;  3CCJ A;  1GUN A;  4LF8 L;  3N52 A;  1JQY D;  2F4V Q;  1K83 B;  5DM7 3;  2Y0S B;  1X6O A;  2VQF Q;  2F0O A;  3RZD H;  4AQY Q;  2B2Y C;  4A3G B;  1PTO F;  1NMF A;  3HOU B;  2XRS D;  5EBC A;  5JPN C;  2EYM A;  1HCZ A;  1WD1 A;  4A3B H;  3S1N B;  1O7Z A;  2F0K A;  3MWY W;  1MGS A;  1EWC A;  3V05 A;  5IWA L;  5KGU A;  2XWB B;  3J80 i;  4LF5 L;  2J4X A;  1XMQ Q;  4JWH A;  1GHJ A;  4LF4 L;  3KLW A;  2WB1 B;  5JOB A;  1X3E A;  2WII B;  1J85 A;  2HA8 A;  3FPP A;  2I5H A;  3A5Z B;  1UAJ A;  1OXT A;  4IFD J;  3MA2 B;  4AIM A;  3N4J A;  3TSS A;  5JJK A;  3U4V A;  4IUQ A;  1STG A;  1T5E A;  1CA5 A;  3GTK H;  1BF4 A;  1G29 1;  2EYO A;  1LTL A;  1TWC H;  1UAP A;  1SNM A;  2RHS B;  3WWV A;  4DAY A;  4DXG A;  4NXM L;  2R7Z G;  4TVA B;  5DM6 3;  4A3E H;  3CRK C;  4DK0 A;  3PMF A;  3O13 A;  1JOK A;  4X3K A;  1TQO A;  4BY1 G;  4YQD A;  1C4Q A;  1CHP D;  3PO2 H;  2XN9 C;  1SMY D;  1N36 Q;  3DHQ A;  1YHQ A;  3J80 c;  3BDL A;  1YIT A;  5GRO A;  1XX8 A;  2IY5 B;  3KUP A;  1JMC A;  1L0X B;  5CV8 A;  1S5D D;  1CFM A;  3CF5 A;  5EPJ A;  4DUZ L;  2BA0 A;  3VR6 A;  4YQ7 A;  4B3T L;  4LF5 Q;  2ASB A;  3DEP A;  1JB3 A;  5D14 A;  2R6G A;  3NEN A;  1EZ6 A;  3AIA A;  4UAI A;  3GV6 A;  2GN5 A;  3KF6 A;  3DMU A;  4R1J A;  5ELN A;  4A3I H;  1HNW Q;  1HR0 L;  3ULJ A;  3HP3 A;  1PV4 A;  2L11 A;  1LTB D;  1G91 A;  4B9W A;  4NPS A;  2NVY B;  2A68 D;  1I50 H;  4OEL B;  1R9T H;  1LAB A;  4UP8 A;  2DJG C;  1XMQ L;  4FF2 A;  3LNN A;  4ZKC B;  3D4D A;  1TS2 A;  4Z9C B;  3NSW A;  2WB1 E;  1GD7 A;  4RMF A;  4J15 A;  3FMC A;  1RDP D;  3CKI B;  1TWC B;  4XIG S;  2Z6K A;  3I91 A;  1VQF A;  1A15 A;  1V1O A;  3K7A B;  4JWF A;  3LX0 A;  2I0Q A;  1BBU A;  5EAY A;  1QG7 A;  5GMC A;  3AI9 X;  1X3F A;  2LMC B;  2K50 A;  2PMZ B;  1GZ0 A;  1NJI C;  4CNE A;  3KLS A;  4DR5 Q;  2N88 A;  3MXG A;  2NVT B;  2EY1 A;  4Y7N H;  3A56 A;  5GM8 A;  4YQQ A;  3P7J A;  4TRD A;  4M1U B;  3H0G G;  4KGN A;  2NZO A;  4J8Q A;  5FK9 C;  1K3R A;  1VQK A;  2NN6 H;  3S1R B;  1DYQ A;  2WAQ E;  1GJX A;  3UI2 A;  3QR8 A;  4LF9 L;  2R7Z H;  1QCB D;  2K14 A;  4CJ1 B;  1U5K A;  5I6W A;  2D62 A;  3ERO A;  1TVX A;  3X3M A;  5HGQ A;  2VXW A;  1S3O A;  2AKW B;  3VYU A;  3NTK A;  2E5L L;  3NUC A;  4JWG A;  5FLX c;  1FD7 D;  2K01 A;  1ZXT A;  1AW7 A;  4NXN Q;  3I56 A;  1JB7 A;  4LWC A;  4JI0 Q;  4HMI A;  4FXG C;  2G9D A;  3NP8 A;  2WAQ G;  5IYB G;  3BYT B;  2NVQ H;  1J8I A;  5IP9 G;  2E2H B;  1PTO H;  4FYD A;  1DCZ A;  3M4P A;  3PO2 B;  1QNK A;  3HKZ G;  3K59 A;  4DUY Q;  4R9W A;  3FP9 A;  2AUK A;  1L1O A;  3EQL C;  3OIQ A;  2QW7 A;  1CTM A;  2L15 A;  1PH8 A;  1EFW A;  4F8M A;  1ESR A;  4BA1 I;  3VR3 A;  1TII D;  2R93 H;  5EKL A;  2ZXO A;  1R9T B;  2RSN A;  2SDF A;  1VMC A;  1ICF B;  2VS1 A;  1UE6 A;  1IBM L;  4YPX A;  4XXE A;  4WRD A;  3K8A A;  1IW7 C;  1TT2 A;  5I4D A;  2X6L A;  2L9H A;  1EYD A;  4DV4 Q;  4A75 A;  5IYC H;  2IX0 A;  1ZJR A;  3NK9 A;  3UE1 A;  1V9P A;  2VQE L;  3CCS A;  4DPG A;  1C7Y A;  4FF3 A;  3SR1 A;  1C48 A;  1EY4 A;  3HRZ C;  3L9A X;  3FKI H;  2NTT A;  3TDQ A;  3AYH B;  1F9S A;  3OTO L;  3OW7 A;  2PI2 E;  4PG3 A;  1LTI D;  5LL6 S;  2R7D A;  3R93 A;  1EL0 A;  1ICW A;  1X56 A;  5IT9 c;  1ROD A;  4LF7 L;  2O4X A;  3J7A V;  5IT9 L;  4KTA A;  4YCU A;  3C3L A;  4K8J A;  3IRB A;  4DR3 L;  3W1G A;  1G2S A;  1I50 B;  1G6P A;  1Y1W H;  3TBI B;  3I3C A;  3J81 E;  4IJL A;  4ZAI A;  1UEA B;  1VQC A;  4KLK A;  4R4Q A;  4AH6 A;  1EY5 A;  2SNM A;  2EGW A;  2UU9 L;  3GTL B;  2B2T A;  4TSS A;  1R4Q B;  3PUZ A;  3RNU A;  1X3G A;  3SEB A;  2KCM A;  1MKH A;  3NQT A;  1SBB B;  4QUC A;  3RZO B;  1Q8I A;  1Q81 C;  1DZ1 A;  4APV A;  4A3E G;  1W6K A;  1VCI A;  3URY A;  1NXZ A;  4C3J H;  4HED A;  3K57 A;  4LK1 C;  2SEB D;  2YV5 A;  4DUZ Q;  4MHE A;  4PZ7 A;  4JI1 L;  4EX5 A;  3RD4 A;  4X3T A;  1VQ5 A;  4FAK A;  1CKN B;  2EIF A;  4RGO S;  2KCC A;  5ELE A;  4BXX G;  1JWS D;  4H02 A;  4IPG A;  4H7B A;  4YQG A;  3BVM A;  2IWH A;  4A3J G;  1WD0 A;  1JOQ A;  3RMH A;  5KRU A;  1SJH D;  4A3M B;  4DNI A;  1TR5 A;  1EU3 A;  2WFW A;  2H5X A;  1K0S A;  3M3Y H;  1VQJ A;  4EVO A;  2ID0 A;  5IOC A;  2QIL A;  5FLM G;  2EJF C;  2NVQ B;  1QZG A;  2TSS A;  4U68 A;  1NR2 A;  2A68 C;  2QKI C;  5IP9 H;  3DUZ A;  3SGI A;  1SNQ A;  4PMW A;  4YVG A;  2X6G A;  2BDN A;  1QE6 A;  1E1T A;  2HQL A;  2BH8 A;  1Q7Y C;  3J80 E;  3S1M H;  3I4M B;  1D1K A;  4NP5 A;  3NK7 A;  3STB C;  5BN4 A;  1XNQ L;  4IOC A;  2LXK A;  3M9B A;  4YQI A;  1O7Y A;  3GTJ H;  3F2D A;  2NVY H;  3QG1 A;  3SE0 A;  5IIF A;  3OOC A;  3M85 A;  4KKT A;  1OXU A;  4KKU A;  1L1O C;  1ZEQ X;  1YJ9 A;  1PLF A;  3AEV A;  1YVC A;  3FKI B;  4JI6 L;  2VUM G;  1MHW C;  4A3F H;  1SR3 A;  2EVB A;  2K5W A;  4JBK A;  2EQS A;  4DNT B;  1UAK A;  3UDI A;  2OQ0 A;  4IUT A;  5C3E B;  3S2H H;  1SNP A;  1A3T A;  1V1P A;  2MGS A;  4B3M Q;  4O42 A;  1MIU A;  1ASZ A;  1SAP A;  4GKJ Q;  1KIX A;  5IE8 A;  3NE5 B;  4C2M H;  4OXP A;  1Y14 B;  3GDE A;  3MXN A;  5C3E G;  4ALP A;  3GTL H;  4F88 A;  3FVQ A;  1X9N A;  3A0J A;  3DWA A;  4DV1 L;  2ICE C;  3KFU A;  4X64 Q;  2OEO A;  1EOV A;  1HR0 W;  1KLG D;  4XT1 B;  5CBA E;  4CNG A;  3HOY G;  2JA7 H;  1W3S A;  3T13 A;  5HGT A;  3IAY A;  2XWJ B;  3HKZ E;  3TZU A;  4EQ5 A;  3MHB A;  2IW3 A;  5EKK A;  1AE2 A;  1J6Q A;  4JI6 Q;  2EGV A;  3PQI A;  4JPB W;  2ZJR A;  3CCU A;  1PHJ A;  1H9J A;  4C3J B;  1VQG A;  5D3I B;  2UUB L;  3HOX G;  4LF6 L;  1DGS A;  2E75 C;  4DK1 A;  2A6E D;  2BDO A;  1D6E C;  1PH6 A;  4BY7 G;  3KJO A;  2MHV A;  2VB2 X;  3VYS A;  1NE3 A;  3S2D B;  3C46 A;  4YQA A;  2RF4 A;  1J9O A;  4N8X 1;  4FXD A;  2K28 A;  1FNW A;  2MFI A;  1N32 Q;  1Q8K A;  1MI2 A;  4PQX A;  1JJG A;  4MN3 A;  4OL7 A;  3CQZ H;  2EE1 A;  2EY6 A;  2V4D A;  4KKS A;  1M90 C;  4H3Y A;  1IYJ B;  4GOP B;  3ND9 A;  3UDX A;  1CZW A;  3MVV A;  1CT1 D;  4KD4 A;  1NBW A;  1ESF A;  3JAM L;  2R3Z A;  2B29 A;  1EIY B;  1AH9 A;  4YQ0 A;  1FGU A;  1UE7 A;  1VQM A;  1WVL A;  3RLO A;  4H3Z A;  4JI5 Q;  1BQQ T;  3C1F A;  1DXM A;  2Y0S G;  5KYL A;  2RKS A;  1I6V C;  1OXV A;  1IBK L;  1U9R A;  2M00 A;  4OO1 G;  4YQ4 A;  3D31 A;  1I6H H;  4X3U A;  1PH4 A;  4DR4 Q;  1TY2 A;  1SMX A;  3TS2 A;  2D0O A;  5M5Y B;  4GOP A;  3NBH A;  5FO8 B;  4L6T B;  4X6A H;  2NB0 A;  1Q86 C;  1I94 Q;  4Q0F A;  5GAD C;  1SNO A;  4N8F A;  4UP7 A;  3GP7 A;  1C8C A;  4IFD G;  2JP1 A;  3K7U C;  2EYL A;  3SDZ A;  3TQY A;  2Y0S E;  2KQ3 A;  2NUC A;  3AXZ A;  2KED A;  1RIP A;  1SFO B;  1D2B A;  1CSQ A;  4B3S L;  1E0B A;  2RCN A;  5ISR A;  4K0K Q;  3HOY B;  2F0D A;  2QDL A;  2F0P A;  4QB4 A;  4X3L A;  2PCF B;  2FHT A;  1TWF B;  1EU4 A;  2QGQ A;  4DV3 Q;  4P74 A;  1Y69 U;  1PH5 A;  2RQX A;  4OWX B;  2F52 A;  1LTS D;  3G6J B;  1IL2 A;  4YPY A;  4CBV A;  5H1S E;  5LHY 1;  3KYH C;  3MAQ A;  4LFC L;  3G6E A;  4IPD A;  2HT1 A;  1B4O A;  3I7F A;  2K04 A;  5IWA Q;  2B2U C;  1XPO A;  1V2X A;  3ILK A;  2CFM A;  3SK6 A;  3IL8 A;  3E9H A;  3BBD A;  4L5R C;  3HZX A;  1EWI A;  2ZTE A;  5G3L F;  3IFT A;  5CV7 A;  5J39 A;  1O78 A;  3OMC A;  4BY1 H;  4DGZ A;  4A3J H;  2I6D A;  5C4Z A;  4HJ8 A;  2C35 B;  4RHR A;  1H9M A;  3QJY A;  4RCN A;  1KD1 C;  1AZQ A;  4PZK A;  1WCM G;  4OON A;  4NKL A;  1VQH A;  4DAM A;  1FL0 A;  4YCV A;  1GXD C;  3CPW A;  1Y1V B;  3I4N G;  2B2W C;  4O2D A;  2PO4 A;  1PRT B;  5C4J B;  3W5O A;  1KRS A;  1LO5 D;  5LMU Q;  1YHB A;  5D9F A;  3HOZ G;  3L2P A;  1ILQ A;  4LMQ D;  3IFD A;  1CQV A;  2AQ3 B;  3DEO A;  2HDL A;  3AQQ A;  3I90 A;  4I7A A;  3UDF A;  4DF7 A;  3PUX A;  3F2C A;  4V19 0;  4L69 A;  1SYC A;  3DWQ A;  4MZ9 A;  4K0K L;  1U0L A;  3VA5 A;  4NMZ A;  1S5F D;  1NNX A;  2A69 C;  3WOE A;  1STE A;  4HJ5 A;  2EZV A;  3Q24 A;  4B3R Q;  1KAA A;  5T1I A;  4JI8 L;  3CC4 A;  1ZYR C;  1PZI D;  3BZC A;  2HCC A;  3S1R H;  2LFN A;  1XTC D;  1PRT F;  2YTY A;  1O6D A;  4J1M A;  2K75 A;  4PNY A;  1VQO A;  4IFD H;  5HY6 A;  2DGY A;  5EQ0 A;  3TRZ A;  1N36 L;  5LL6 X;  1LT4 D;  5IYC G;  1XPU A;  3C2P A;  1HUM A;  3CCR A;  4B3S Q;  4XDX A;  1NTG A;  3KDF A;  1Q1E A;  4KY7 A;  1E2W A;  2K03 A;  2NZ1 D;  3H0G H;  3NEL A;  3LWE A;  2VW9 A;  3GTQ H;  4YQ2 A;  2O2L D;  4XYO A;  1II3 A;  4ZKB B;  3ZYY X;  1N9W A;  3MFY A;  1GKH A;  2F03 A;  3NXW A;  3T53 B;  3K7A H;  2FMC A;  3M3Y B;  5I2X A;  4LF9 Q;  2SNS A;  2WIN B;  1AFP A;  1KDA A;  1LYL A;  5F2D A;  4RKL A;  5KNC A;  1GUW A;  2JXM B;  2Q8T A;  4CNF A;  1X32 A;  4BY7 B;  3S16 H;  2R7Z B;  2CVR A;  5M3F H;  3RN2 A;  2OWO A;  4YQK A;  3P20 A;  4JBJ A;  1KDC A;  4CKB A;  5M3M B;  1U4M A;  1HTP A;  3OPO A;  5C3X A;  2E5L Q;  3S17 H;  4DK6 C;  2CQO A;  2JEB I;  1X3P A;  2F0F A;  1K3B C;  4ZQ3 A;  3MFG A;  1H9R A;  3K5L A;  1PH3 A;  1UE5 A;  4QF4 A;  3A7L A;  4IPH A;  2A5H A;  4JI7 Q;  2A6H D;  5M3F B;  1K83 H;  4LF6 Q;  5LMU L;  2YY8 A;  4K5X A;  2OQK A;  4C3I B;  4O0A A;  4JVZ A;  2ZTD A;  4K6L A;  2IHF A;  5IGE A;  3E5S A;  4JK1 C;  1VDZ A;  2K1B A;  5J1Z A;  4LUZ A;  5C5L A;  3E5Y A;  3K58 A;  2X69 A;  5JEA H;  3STB D;  3HOX H;  1BBX C;  1Z47 A;  1WTH A;  2GVA A;  4YPZ A;  1YNX A;  3H94 A;  3HOU H;  4DKA C;  3PV0 A;  1HNW L;  5IP7 G;  3KBX A;  5JVH 3;  1RCV D;  1VF5 C;  3D4W A;  1ASY A;  4GKJ L;  4YQL A;  4QCL A;  1PXU A;  1BVS A;  1PMR A;  4B3M L;  3U58 A;  1A6X A;  2CKZ B;  3HOX B;  4G7Z C;  1GUT A;  1FNV A;  1EY0 A;  4X64 L;  1LTR D;  3BG3 A;  1MSH A;  4PZ6 A;  4DR6 Q;  4JV5 Q;  2B8F A;  1WTO A;  3OIJ A;  4IUU A;  1K9M C;  5C0X I;  3RZO H;  1EQQ A;  1B7Y B;  1E1O A;  3VR4 A;  3HOW H;  3GTQ B;  4YQ6 A;  2ALY B;  1JJ2 A;  1XWE A;  1NUC A;  2ICI A;  1UE1 A;  3BDO A;  5C4X B;  1V1Q A;  3LGJ A;  4PV1 C;  4QY7 A;  4GNX B;  1XXG A;  3MC0 B;  3GTP B;  4OX9 L;  1I94 L;  2RA4 A;  3TS0 A;  1I4X A;  1HUN A;  2KHS A;  2MJ8 A;  1MSG A;  3CPF A;  5A2Q L;  4ILW A;  4C3H G;  5JJL A;  4YY3 Q;  4JAK A;  2K5N A;  4P73 A;  2PI2 A;  3NEM A;  3HFZ B;  5CV6 A;  4LFB L;  1S5B D;  1CKO A;  5COR A;  2PW5 A;  2I46 A;  4DV0 L;  1GUG A;  1TWH B;  4DAV A;  5I9P A;  1STY A;  3L7Z C;  3OWE B;  3VYR A;  1XNR L;  1JT8 A;  3PUY A;  1BCP F;  2WKC A;  2B63 B;  2BA1 A;  1NS5 A;  2K33 A;  3K0Y A;  4YPW A;  5EGT A;  3UDG A;  3MEF A;  2PQA B;  4C3I H;  3ERQ A;  4BXX H;  3MZ5 A;  1QVF A;  2DN8 A;  2AMC B;  2PQE A;  1VHY A;  3L8U A;  5JJZ A;  4LF4 Q;  1GO3 E;  2F4V L;  3I4M G;  5LMN L;  1UNS A;  5CV4 A;  1N34 Q;  3EFX D;  4IUR A;  4F87 A;  2VY3 A;  5CGK A;  2IX3 A;  1IL8 A;  2L12 A;  3AFP A;  1PFS A;  2EJG C;  2N78 A;  1F2M A;  4RFB A;  3JAM E;  2WAQ B;  4NW2 A;  1S5E D;  4BBR B;  3D4R A;  3HOV B;  4ULL A;  2QA4 A;  2RVL A;  3V96 A;  1U4L A;  1PH7 A;  4DR6 L;  1HA5 A;  2K05 A;  1JE5 A;  2UU9 Q;  4HTH A;  1PH1 A;  4O1N A;  1HJP A;  4P72 A;  4G57 A;  5KND A;  3PF5 A;  2A69 D;  2I07 B;  4X62 L;  3PIP A;  3HOZ H;  1YNJ D;  2VNU D;  5ELD A;  2HD3 A;  4LF7 Q;  5C44 B;  1VH0 A;  3ND8 A;  3CCQ A;  2PQA A;  1VQ8 A;  4KDZ A;  1Z7T A;  2VUM B;  4LUV A;  4EQN A;  4DV3 L;  2F3V A;  4RCO A;  2QDB A;  2FXQ A;  3ULL A;  4R4I A;  3GTJ B;  5FLX L;  1DOL A;  2WKD A;  3Q8D A;  4HSP A;  1IBL L;  3GTP H;  2NVX B;  3OIN A;  4A3D B;  1AN8 A;  1RTO A;  4UPA A;  1N33 L;  2FJ2 A;  3OIP A;  4PZ8 A;  4JC0 A;  4WJ3 M;  4DR3 Q;  2K5V A;  5C44 H;  2UXD L;  3HOW B;  3FPU B;  2RHQ B;  4IFD I;  2WV6 D;  3J81 L;  3CXC A;  2J0T D;  1HZ9 A;  3CMA A;  1BOS A;  5DNF A;  1WJJ A;  3E9I A;  4DR4 L;  1EOT A;  2HDM A;  2RCF A;  3CCE A;  5AJ3 L;  3NPP A;  5ELO A;  4A93 H;  1B53 A;  1HZA A;  4J6H A;  4CDF C;  1XPR A;  2VQE Q;  4A3B G;  2JA6 H;  4AYB G;  1JJC B;  1P16 A;  5TSS A;  4A3G H;  5C3W A;  3DLL A;  4N9T A;  1B3A A;  4YWM A;  3GQB A;  4QQB X;  1WTP A;  4GN3 B;  4POF A;  2EPB A;  5FJ8 G;  1D8L A;  3J7Y W;  3CCV A;  2OTJ A;  4LUO A;  5JAV A;  1CKM A;  1K28 A;  3TEH B;  1ENF A;  1HZB A;  2LS0 1;  1FR3 A;  1SNC A;  3D3R A;  1O7I A;  3S2H B;  2F3W A;  1STB A;  3CC2 A;  5G3L D;  3KF8 A;  2K7V A;  1LT3 D;  2AQ2 B;  4C3I G;  3PSI A;  1UWV A;  1M4V A;  1K73 C;  5LMN W;  1LTG D;  2R92 G;  1SSO A;  2JA8 B;  5IGG A;  2L0C A;  2DY8 A;  3OW2 A;  2E76 C;  4PMC A;  3S14 H;  3R2T A;  3A55 A;  3Q22 A;  3LWU A;  1H9S A;  1QIL A;  1KNE A;  4A3M H;  2R93 B;  2CCZ A;  4WJ4 A;  1PTO C;  1EY8 A;  2F0H A;  1RD9 D;  2IHE A;  4GKK Q;  1PDQ A;  4RAU C;  1IBL Q;  2B2V A;  1B2T A;  3ITP A;  1IKL A;  1NR4 A;  3S14 B;  4FF4 A;  1VHK A;  1XTD A;  2I5M X;  3TME A;  1YHA A;  1M8A A;  2F3I A;  2BE5 D;  2Z6B A;  4DU9 A;  3H3V C;  1KAW A;  4YCW A;  2CWP A;  1Q12 A;  4DR7 L;  5D3D A;  1EY9 A;  1G51 A;  1PZK D;  3KW2 A;  5DEH A;  1E3P A;  5I6Y A;  1JCK B;  4XQQ A;  2OT2 A;  1PRT D;  5CYU A;  5FO9 B;  4QMG A;  3RR5 A;  4IZ8 A;  1CA6 A;  1KDB A;  4EGV A;  4GLA C;  2IJ0 A;  4JBM A;  5IGC A;  4DA2 A;  3A74 A;  3HOW G;  5IY0 A;  1DOM A;  5J22 A;  1PA6 A;  1Y8P B;  1S5C D;  3S17 B;  3KNU A;  2JA5 H;  1B50 A;  1B1Z A;  1HNX L;  3ONP A;  4CDC C;  3CRL C;  5C5M A;  1FJG Q;  1TXY A;  3KF8 B;  3BYY B;  4E6I A;  1XNQ Q;  1TO0 A;  1JIC A;  4DV4 L;  3EA6 A;  3OWF A;  1EFI D;  4E8B A;  1C9O A;  4XQN A;  4MCB A;  3UE0 A;  1HQM C;  3PO3 B;  1BCP C;  1Q3L A;  2IPK D;  4DAP A;  4OIJ A;  4YY3 L;  4YQB A;  1PYW D;  3PCO B;  4Y7N B;  1KC8 C;  4HSV A;  4YQ5 A;  1RJT A;  4GNX C;  4JI3 Q;  2ATW A;  1YNJ C;  4Q5V A;  3DM1 A;  1TWA H;  4GN4 B;  1PVO A;  3P1H A;  4OIK A;  5IGD A;  2HQE A;  4XT3 B;  1LV9 A;  3MXP A;  3KBG A;  4YQ3 A;  3CC7 A;  4YQN A;  1PRT C;  1SE3 A;  4OEM B;  2UUC Q;  4KHZ A;  2Z9H A;  3X3N A;  1F9Q A;  5C4X H;  3I4M H;  1U4R A;  3S9W A;  2F0I A;  1SYD A;  3OSO A;  3Q6S A;  1G6Z A;  4JI3 L;  2XNA C;  1EEI D;  2F0W A;  4MTK A;  1KRT A;  3VA7 A;  1IYU A;  3G4S A;  1OO9 B;  5JVG 3;  4OX9 Q;  1WOC A;  4A3L G;  4CKE A;  1KQS A;  4C1N K;  4ZUJ A;  1GVP A;  3QO2 A;  4A3D G;  1LT6 D;  1SXT A;  4LW1 A;  1CK1 A;  5T1G A;  4JI8 Q;  4GNX A;  3ICE A;  4KK7 A;  4IJH A;  2C5C A;  4B3R L;  2G9H D;  1YEZ A;  1F9R A;  5IOD A;  4H44 C;  5C6A A;  4IG6 A;  1RF2 D;  1B9N A;  1HNX Q;  4OO1 H;  3CU7 A;  2JJQ A;  1VF7 A;  4KY5 A;  1YJN A;  5IT9 E;  3C1E A;  4JV5 L;  3E0E A;  3S15 H;  4J3C A;  1STH A;  1OXX K;  3BVG A;  2K4K A;  1MJC A;  4LF8 Q;  1PYB A;  1W6J A;  1WTV A;  4MTN A;  5C0X G;  4FF1 A;  1DM0 B;  3PGZ A;  4HCE A;  4BBS H;  4RH6 A;  3S24 A;  2F0G A;  4DR5 L;  1FJG L;  3BVZ A;  3L0O A;  4ABN A;  2CW0 D;  4C2M B;  4AYB E;  4DR7 Q;  3T1H L;  3M7N A;  3I72 A;  2KCN A;  3R2I A;  2EYP A;  4KHV A;  1N8R C;  4JI7 L;  1Y1W G;  3T1H Q;  4QIW B;  4DN4 M;  3D8G A;  3OTO Q;  1ILP A;  3EJI A;  2VQF L;  4KD3 A;  2O3A A;  1PH2 A;  1S4Z A;  1JC7 A;  2JK8 A;  1WI5 A;  2AWN A;  1CKN A;  4A3G G;  1PFB A;  2QEX A;  3BS1 A;  4MIU A;  3V2T A;  3R3O A;  4G7O C;  1TS4 A;  2I5L X;  5CMD A;  3F2U A;  3J81 j;  1SE2 A;  4LFC Q;  2F0N A;  2JEA I;  2JE6 I;  4CJ2 C;  2Z6K C;  4DNR B;  2F0J A;  5M3M H;  3OII A;  5JJI A;  3GD7 A;  1QZH A;  2LY7 A;  4X66 L;  4IQZ A;  2JSO A;  1I4R A;  2D0P A;  3S15 B;  2QCP X;  3QOL A;  4HCS A;  3B6Y A;  3QWN A;  4F7X A;  1SYF A;  3QUV A;  4CHT B;  4YQ9 A;  3M7G A;  3NTH A;  1TWA B;  4LFA Q;  3GV3 A;  5I9O A;  2QEJ C;  3DWP A;  4NDX A;  1X7O A;  4YQC A;  4S3S A;  4BWG B;  1TWG B;  3A8J E;  2F0L A;  2HCI A;  4FMW A;  4JBW A;  4JI0 L;  1A3V A;  4NXN L;  1MXI A;  1KHI A;  4LFA L;  5EKI A;  3H91 A;  4B9X A;  2PNH A;  1I3Q H;  3TN2 A;  1Y1V H;  1A63 A;  1TKW B;  2DNE A;  4QGU A;  2KBN A;  4H13 C;  4MCD A;  1A0I A;  4DV5 Q;  4YVJ A;  3CHB D;  3K0X A;  3GTO B;  1YI2 A;  2OF1 A;  1LM0 A;  2YTX A;  3HOU G;  1EEF D;  3SK8 A;  4IOA A;  4YQ8 A;  5L37 A;  1T9H A;  5M5X H;  3GO5 A;  5I2Y A;  1V8Q A;  4YIJ A;  5IYD G;  1E2Z A;  2H4O A;  2F4I A;  2E2J B;  1NY4 A;  4ME5 A;  1XMO Q;  4OHJ A;  3AB9 A;  5J3B A;  5NUC A;  3TRE A;  3MXU A;  4WJW A;  4OWW B;  3K5M A;  3PUV A;  2ZTC A;  2B2V C;  1BCP B;  3KLS X;  2EDG A;  1YZ6 A;  1LUZ A;  2DJF C;  3J81 c;  2KHI A;  1WTQ A;  2A19 A;  5CR3 A;  1EYC A;  5C0X J;  4A3K H;  2D9U A;  1OXS C;  1JWM D;  1QUQ B;  2A6E C;  4IUV A;  4JI1 Q;  3BZK A;  4A3J B;  3FEW X;  4KY6 A;  4KJO A;  2UXD Q;  3S1M B;  4IN3 A;  3W1B A;  5FAI A;  2AWO A;  2NN6 G;  5DLQ E;  2JA6 G;  4X62 Q;  2N55 A;  1IXR A;  1SRO A;  2B63 G;  5FJ8 H;  5M5W B;  1X7P A;  2E2H H;  2OXP A;  1SYE A;  2QMM A;  4TKO B;  1F77 A;  1H95 A;  1HNZ Q;  1BO0 A;  1P8L A;  3T1Y L;  1HFG A;  4RGT A;  1EUJ A;  3CME A;  4KN4 C;  3AU7 A;  1BKB A;  3AMU A;  4K14 A;  2ZM6 Q;  3GYQ A;  1VMP A;  3HGB A;  3TZD A;  3OMG A;  5LMN Q;  1YBY A;  2YYZ A;  4DV6 Q;  1Q90 A;  1LLR D;  4JYA Q;  1TU2 B;  1Y1V G;  4A3E B;  3I4N B; 
#chains in the Genus database with same CATH homology
 1CUK A;  1IZ6 A;  1IBK Q;  2WFW A;  2H5X A;  3BBE A;  2YTV A;  2HIX A;  4DV7 Q;  3M3Y H;  1VQJ A;  3CCM A;  2QA4 A;  4NXM Q;  3PO2 G;  2ID0 A;  5FLM G;  1QZG A;  1SRU A;  1OTC A;  3H3V I;  1PH7 A;  2YU9 H;  4DR6 L;  5GMB A;  4IPC A;  1JE5 A;  1SLJ A;  4GLV B;  5IP9 H;  2UU9 Q;  2CWA A;  1PH1 A;  1HJP A;  3OYY A;  3SGI A;  3I55 A;  1CSP A;  4P72 A;  4PMW A;  3PF5 A;  3JAM c;  4A3C G;  4CND A;  4X62 L;  1UEB A;  3PIP A;  2UUA L;  1W2B A;  4YVG A;  4DK3 C;  2XTI A;  3HOZ H;  1VQ9 A;  4KI0 A;  4GLX A;  2VNU D;  1TWH H;  1E1T A;  1TWF H;  1VS0 A;  1Q82 C;  2HQL A;  2BH8 A;  3I2Z A;  1Q7Y C;  4LF7 Q;  2V3J A;  1VH0 A;  4X3M A;  3CCQ A;  2PQA A;  1QVG A;  1VQ8 A;  1XNR Q;  3S1M H;  4LUV A;  4DV3 L;  4DR2 L;  3GTO H;  4BBS G;  4KDZ A;  5BR8 Q;  1L2F A;  3NK7 A;  3STB C;  2FXQ A;  4X65 L;  3ULL A;  2Q2T A;  1XNQ L;  4IOC A;  2IX1 A;  3MXN B;  2LXK A;  3M9B A;  4YQI A;  1VQI A;  4DV7 L;  3KF6 B;  3GTJ H;  4L5Q A;  4R4I A;  2UXB L;  4KHP Q;  4GS3 A;  4YVI A;  3F2D A;  4JI2 L;  2NVY H;  2VUM H;  4MCC A;  3Q8D A;  3GTP H;  1IBL L;  4OO1 I;  3M85 A;  3OIN A;  1OXU A;  4JI4 Q;  3S2D H;  3J81 i;  4UPA A;  1N33 L;  3AFQ A;  3KJP A;  1L1O C;  4PZ8 A;  4JC0 A;  4AQY L;  2E2I H;  4DR3 Q;  2K5V A;  5C44 H;  2UXD L;  1YJ9 A;  2PMZ E;  3PIO A;  1YVC A;  1XMO L;  3AEV A;  1KXL A;  1M1K C;  4JI6 L;  2VUM G;  4JG2 A;  4A3F H;  1SR3 A;  3I4O A;  4JBK A;  2RHQ B;  2EQS A;  2OTL A;  4IFD I;  1UAK A;  3UDI A;  1IBM Q;  2NN6 I;  2OQ0 A;  3CXC A;  5M3F G;  3S2H H;  1HZ9 A;  3CMA A;  4P71 A;  4HID A;  1WJJ A;  3E9I A;  4B3M Q;  4DR4 L;  1QUQ A;  3CCE A;  1MIU A;  5AJ3 L;  4HIO A;  1GM5 A;  1ASZ A;  1RL2 A;  3BJU A;  4GKJ Q;  1KIX A;  5IE8 A;  1HNZ L;  5ELO A;  1VQB A;  4C2M H;  4A93 H;  1P9P A;  1HZA A;  4XBO A;  4OXP A;  1Y14 B;  2KCT A;  3GDE A;  4L5T A;  5C3E G;  1KL9 A;  4ALP A;  1XPR A;  3GTL H;  3ER0 A;  3ZJY C;  2VQE Q;  3J7A 5;  4A3B G;  1Q46 A;  4LNQ A;  2JA6 H;  1XJV A;  4AYB G;  3A0J A;  4DUY L;  1X9N A;  2NZH A;  3VDY A;  1JJC B;  1P16 A;  2K52 A;  4A4I A;  4DV1 L;  4A3G H;  4TQU S;  4YWM A;  3DLL A;  3KFU A;  4QQB X;  4X64 Q;  1C0A A;  4GN3 B;  1EOV A;  4POF A;  1HR0 W;  4A93 G;  4JWJ A;  1VQA A;  2ZJQ A;  4CNG A;  3HOY G;  3EN2 A;  5FJ8 G;  1D8L A;  4GN5 A;  1W3S A;  3CCV A;  3G48 A;  2JA7 H;  4GKK L;  2OTJ A;  4LUO A;  3IEF A;  1CKM A;  3HKZ E;  4EQ5 A;  3TEH B;  2E8G A;  1HZB A;  4BY7 H;  1AE2 A;  1J6Q A;  1O7I A;  4DV1 Q;  4JI6 Q;  3GTG H;  2JA8 G;  2EGV A;  4DR1 Q;  2ZJR A;  4DV5 L;  3CC2 A;  3CCU A;  4QIW E;  1PHJ A;  3H15 A;  1K8A C;  1VQG A;  1VQE A;  3HOX G;  2UUB L;  3PO3 H;  4LF6 L;  3DM3 A;  1DGS A;  3PSI A;  3M4O H;  1UWV A;  4HJ9 A;  1L1O B;  2KEN A;  4HJA A;  5LMN W;  1K73 C;  1PH6 A;  1K0R A;  1X54 A;  4DAY B;  3KJO A;  2R92 G;  4BY7 G;  5CO4 A;  4BBR H;  3HOV H;  5FLM H;  4KHP L;  2Q2H A;  4A76 A;  4POG A;  4UY8 C;  3KY7 A;  1NE3 A;  4GOP C;  4YQA A;  5M5W H;  2RF4 A;  3FHW A;  3OW2 A;  3S14 H;  5IP7 H;  2UUB Q;  1IPA A;  2Q2U A;  4YQR A;  2MFI A;  4ME3 A;  1Q8K A;  3F2B A;  1SFO H;  1N32 Q;  3NK6 A;  1A8V A;  3NBH B;  3CW2 C;  4BBR G;  3HOV G;  1JJG A;  1YJW A;  4A3M H;  3CQZ H;  4A3I G;  1WFQ A;  2CCZ A;  1SE8 A;  2MO1 A;  4WJ4 A;  5GQO A;  1M90 C;  4H3Y A;  1IYJ B;  2LXJ A;  4GOP B;  2IHE A;  2R7F A;  3F1Z A;  2ES2 A;  1N33 Q;  4GKK Q;  3DCM X;  3UDX A;  1X65 A;  1L0W A;  1J5E L;  1NBW A;  1A62 A;  1IBL Q;  4P75 A;  4YHH L;  3RLF A;  3RN5 A;  5GAG C;  4JI2 Q;  2B29 A;  2UXB Q;  1EIY B;  3CCL A;  1AH9 A;  1FGU A;  1UE7 A;  1VQM A;  1VHK A;  4YQ0 A;  3RLO A;  4H3Z A;  4YQJ A;  1XTD A;  2I5M X;  4DV0 Q;  4JI5 Q;  1YHA A;  2F3I A;  2IT1 A;  4JCV E;  3EBE A;  2Y0S G;  2LSS A;  3K80 C;  2R93 G;  4YVK A;  1E22 A;  4OWT B;  1KAW A;  1OXV A;  4YCW A;  3A5U A;  5M5Y H;  2CWP A;  1Q12 A;  1IBK L;  3ERS X;  4DR7 L;  5C44 G;  4OO1 G;  4YQ4 A;  3D31 A;  1G51 A;  4FDB A;  2QWV A;  1I6H H;  1PH4 A;  4DR4 Q;  3KW2 A;  3S1Q H;  1SMX A;  1E3P A;  4A3F G;  3TS2 A;  2D0O A;  2V1C C;  3CCJ A;  4GOP A;  2VL6 A;  4HIK A;  4LF8 L;  3RR5 A;  4QL5 A;  4X6A H;  1Q86 C;  1I94 Q;  4YQT A;  1QVC A;  3CP0 A;  5GAD C;  2F4V Q;  4UP7 A;  4IFD G;  4GLA C;  1X6O A;  2VQF Q;  4JBM A;  3FKI G;  3RZD H;  3A74 A;  4AQY Q;  3HOW G;  5IY0 A;  1K8G A;  3K7U C;  1PA6 A;  5E7N A;  1SN8 A;  3TQY A;  1NMF A;  2Y0S E;  3AXZ A;  4JI4 L;  3KNU A;  1RIP A;  2JA5 H;  1CSQ A;  4A3B H;  1E24 A;  2RCN A;  4B3S L;  1HNX L;  4K0K Q;  3ONP A;  4A3K G;  1FJG Q;  1TXY A;  2K5H A;  1VQN A;  4YQB A;  4X3L A;  3KF8 B;  1XNQ Q;  3J7Z C;  4DV6 L;  1TO0 A;  2QGQ A;  3U4Z A;  2MQH A;  5IWA L;  4DV3 Q;  4P74 A;  4DV4 L;  3J80 i;  1PH5 A;  4OWX B;  2F52 A;  4LF5 L;  1IL2 A;  2ZM6 L;  4YPY A;  4E8B A;  1XMQ Q;  1C9O A;  4MCB A;  5H1S E;  4YWL A;  4JWH A;  3UE0 A;  4LF4 L;  3KLW A;  3KYH C;  1X3E A;  5GAE C;  1J85 A;  2HA8 A;  4YY3 L;  4LFC L;  1BBW A;  3G6E A;  2I5H A;  4IPD A;  3A5Z B;  1UAJ A;  1OXT A;  2B63 H;  2WP8 J;  3I7F A;  3PCO B;  1FVI A;  4AIM A;  3U4V A;  5IWA Q;  2HT1 A;  4IFD J;  1KC8 C;  1XPO A;  5JJK A;  1UAL A;  1V2X A;  3ILK A;  4YQ5 A;  4GNX C;  2CFM A;  4JI3 Q;  2ATW A;  4QJF A;  3GTK H;  2A1A A;  1TWA H;  3E9H A;  1G29 1;  3BBD A;  4L5R C;  1LTL A;  2EXD A;  4GN4 B;  3PF4 A;  1PVO A;  1EWI A;  2ZTE A;  1TWC H;  4BY1 H;  2I6D A;  3WWV A;  2RHS B;  4A3J H;  4HJ8 A;  4NXM L;  2C35 B;  4TVA B;  2R7Z G;  1N32 L;  4YQ3 A;  3D0F A;  1WYD A;  3CC7 A;  1KD1 C;  4A3E H;  2HIV A;  4PZK A;  1WCM G;  1UAM A;  4OON A;  5K36 G;  4YQN A;  1VQH A;  3N4J A;  2UUC Q;  3H3V H;  4KHZ A;  4DAM A;  5C4X H;  4A3L H;  4BY1 G;  4YQD A;  1VQD A;  3PO2 H;  1FL0 A;  4YCV A;  3I4M H;  4A3M G;  4JOI A;  3CPW A;  4JAL A;  3I4N G;  1N36 Q;  4JI3 L;  2B3G A;  3M4Q A;  1YHQ A;  3HKS A;  3J80 c;  1YIT A;  5GRO A;  2IY5 B;  4O2D A;  1Z85 A;  2MNA A;  1JMC A;  1KRT A;  3G4S A;  2HHH L;  3W5O A;  1KRS A;  3CF5 A;  1WOC A;  4OX9 Q;  1KQS A;  4A3L G;  5LMU Q;  5C4X G;  1YHB A;  2BA0 A;  4DUZ L;  2I0Q A;  1GVP A;  5D9F A;  4A3D G;  4B3T L;  3HOZ G;  3L2P A;  4WJ3 M;  3KTY A;  4LF5 Q;  4YQ7 A;  4LW1 A;  1AE3 A;  2OCE A;  4JI8 Q;  4HJ7 A;  2WB1 G;  4IJH A;  4GNX A;  3ICE A;  2ASB A;  4B3R L;  3AQQ A;  3UDF A;  1Q1B A;  3F2C A;  3PUX A;  2Z0Y A;  4L69 A;  2UXC Q;  2R6G A;  3NEN A;  1YEZ A;  3AIA A;  4IG6 A;  1HR0 Q;  2GN5 A;  4MZ9 A;  3KF6 A;  2N49 A;  4R1J A;  1HNX Q;  5ELN A;  4A3I H;  1U0L A;  4K0K L;  4A3D H;  1HR0 L;  3ULJ A;  1HNW Q;  1PV4 A;  2JJQ A;  4HJ5 A;  1YJN A;  4NPS A;  4B3R Q;  4JV5 L;  3E0E A;  4JI8 L;  3GTM H;  3O7B A;  3CC4 A;  1I50 H;  4B3T Q;  3S15 H;  4A3C H;  3BZC A;  1R9T H;  4J3C A;  1OXX K;  3S1R H;  4UP8 A;  4YQS A;  1VQL A;  2K4K A;  1XMQ L;  2YTY A;  3RLN A;  1MJC A;  1O6D A;  2K75 A;  1HZC A;  1VQO A;  4LF8 Q;  1PYB A;  5HY6 A;  2DGY A;  2WB1 E;  4MTN A;  5C0X G;  1GD7 A;  3TRZ A;  4RMF A;  3PGZ A;  4J15 A;  1N36 L;  4BBS H;  5IYC G;  3S24 A;  4DR5 L;  1FJG L;  2Z0S A;  1XPU A;  3L0O A;  3F8T A;  4XIG S;  3CCR A;  2Z6K A;  4B3S Q;  1VQF A;  2JA5 G;  4AYB E;  4DR7 Q;  3T1H L;  3M7N A;  2UUC L;  1NTG A;  1VQ4 A;  3KDF A;  1Q1E A;  4JWF A;  1S40 A;  1VQ7 A;  1BBU A;  1Z9F A;  3H0G H;  3NEL A;  5EAY A;  2VW9 A;  1X3F A;  3T1H Q;  1Y1W G;  1N8R C;  4JI7 L;  3GTQ H;  3AI9 X;  2K50 A;  4YQ2 A;  1N9W A;  1GZ0 A;  3OTO Q;  2N3S A;  2VQF L;  2O3A A;  1NJI C;  1GKH A;  4CNE A;  1PH2 A;  4DR5 Q;  3K7A H;  5C3E H;  2JK8 A;  4Y7N H;  4X66 Q;  5GM8 A;  4YQQ A;  1WI5 A;  4XTC S;  4LF9 Q;  2AWN A;  3H0G G;  1CKN A;  1LYL A;  4KGN A;  4A3G G;  4YQ1 A;  2DUD A;  2XGT A;  2A8V A;  2QEX A;  2NZO A;  4CNF A;  2I5L X;  3S16 H;  5M3F H;  3RN2 A;  2OWO A;  4YQK A;  3J81 j;  4LFC Q;  1K3R A;  4JBJ A;  2JEA I;  2JE6 I;  1VQK A;  3IC6 A;  2Z6K C;  5M3M H;  2E5L Q;  3OII A;  2WAQ E;  5JJI A;  3GD7 A;  1QZH A;  1I5F A;  4DK6 C;  4LF9 L;  3S17 H;  2CQO A;  2JEB I;  2R7Z H;  2K14 A;  4X66 L;  3S1N H;  1U5K A;  4JOI C;  2D0P A;  2D62 A;  1WCM H;  2UXC L;  5HGQ A;  3PO3 G;  3N4K A;  1EIF A;  3B6Y A;  5M3M G;  1UE5 A;  1PH3 A;  4YVJ A;  4IO9 A;  4IPH A;  1S3O A;  2AKW B;  1EYG A;  4JI7 Q;  3CD6 A;  4YQP A;  1J5E Q;  2E5L L;  1K83 H;  4LF6 Q;  4JWG A;  3QUV A;  5FLX c;  4DV2 Q;  4YQO A;  5LMU L;  2YY8 A;  4YQ9 A;  4LFA Q;  2HHH Q;  2OQK A;  4NXN Q;  3I56 A;  1JB7 A;  4O0A A;  4LWC A;  4DR1 L;  4JI0 Q;  2E2J H;  4YWK A;  2ZTD A;  2IHF A;  2VZA A;  2NVT H;  1X7O A;  4YQC A;  2WAQ G;  5C4J H;  2JA8 H;  1V43 A;  2V3K A;  4LUZ A;  3E5Y A;  5IYB G;  2NVQ H;  2BH2 A;  4FMW A;  4JBW A;  1B8A A;  5IP9 G;  3STB D;  4JI0 L;  3HOX H;  4NXN L;  1MXI A;  1KHI A;  4LFA L;  3M4P A;  1Z47 A;  3BBH A;  3HKZ G;  4DV2 L;  2R92 H;  2GVA A;  4DUY Q;  2PNH A;  1I3Q H;  3FP9 A;  1Y1V H;  4YPZ A;  1L1O A;  1YNX A;  3PUW A;  4QGU A;  2KBN A;  1A63 A;  2L15 A;  3HOU H;  4DKA C;  3PV0 A;  1PH8 A;  1HNW L;  1EFW A;  4MCD A;  1A0I A;  5IP7 G;  2GVB A;  1PYS B;  4R4T A;  4DV5 Q;  4BA1 I;  4GKJ L;  4UP9 A;  4FAK A;  1ASY A;  3K0X A;  5JEA J;  2R93 H;  5IYD H;  3ULP A;  4YQL A;  3CAM A;  3JAM i;  1BVS A;  3K81 C;  1LM0 A;  3U58 A;  1YI2 A;  4B3M L;  1MJE A;  2CKZ B;  2YTX A;  3HOU G;  1VQP A;  1PH9 A;  2VS1 A;  1UE6 A;  1IBM L;  4IOA A;  3U50 C;  4YQ8 A;  4YPX A;  1T9H A;  3K8A A;  5M5X H;  1TWG H;  4X64 L;  3GO5 A;  2CX8 A;  4HIM A;  4DV4 Q;  5IYD G;  5IYC H;  2IX0 A;  4PZ6 A;  4A75 A;  4DR6 Q;  4JV5 Q;  1ZJR A;  3OIJ A;  1NY4 A;  1XMO Q;  3UE1 A;  1K9M C;  1V9P A;  2N8N A;  5C0X I;  2VQE L;  3CCS A;  1VQ6 A;  2KHJ A;  3RZO H;  1EQQ A;  4DPG A;  1C7Y A;  5J3B A;  1B7Y B;  1E1O A;  3TRE A;  3FKI H;  4OWW B;  3HOW H;  2ALY B;  3PUV A;  1JJ2 A;  2ZTC A;  1D7Q A;  4YQ6 A;  3AYH B;  4BA2 I;  3OTO L;  1UE1 A;  1YZ6 A;  1LUZ A;  3J81 c;  2KHI A;  1V1Q A;  3LGJ A;  2A19 A;  1B70 B;  4QY7 A;  4GNX B;  4X65 Q;  2PI2 E;  5C0X J;  4C3H H;  3EIV A;  1V6Z A;  4PG3 A;  4A3K H;  5BR8 L;  1OXS C;  1QUQ B;  4DR2 Q;  2R7D A;  4OX9 L;  1I94 L;  1X56 A;  1N34 L;  3TS0 A;  4JI1 Q;  5IT9 c;  4LF7 L;  3BZK A;  4YCU A;  4NB3 A;  4R4C A;  3CPF A;  3IRB A;  4DR3 L;  2UXD Q;  3W1B A;  3W1G A;  5FAI A;  2AWO A;  2NN6 G;  5DLQ E;  2JA6 G;  4X62 Q;  4YVH A;  1E7Z A;  1G6P A;  5JJL A;  4YY3 Q;  1Y1W H;  4JAK A;  2K5N A;  4P73 A;  1IXR A;  2PI2 A;  1SRO A;  3HFZ B;  3NEM A;  4IJL A;  1VQC A;  4KLK A;  4R4Q A;  4AH6 A;  2JA9 A;  5GAH C;  2B63 G;  4LFB L;  2EGW A;  5GMC A;  2UU9 L;  1CKO A;  5FJ8 H;  2JA7 G;  3PUZ A;  3RNU A;  1X3G A;  4JI5 L;  4DV0 L;  2E2H H;  1X7P A;  2KCM A;  1MKH A;  3L7Z C;  2QMM A;  1H95 A;  1XNR L;  1JT8 A;  3KDF B;  3KOJ A;  3PUY A;  4L5S A;  4Y52 H;  4YHH Q;  2BA1 A;  1HNZ Q;  1NS5 A;  4LFB Q;  1Q81 C;  4APV A;  1OY5 A;  1P8L A;  4R4O A;  3T1Y L;  1NMG A;  1VCI A;  4A3E G;  3UDG A;  4YPW A;  3MEF A;  1EQR A;  1NXZ A;  1EUJ A;  5AJ3 Q;  1HH2 P;  2PQA B;  4C3I H;  4C3J H;  4JYA L;  3JC6 6;  2ZJP A;  2UUA Q;  4BXX H;  3CME A;  1QVF A;  2AMC B;  3G71 A;  1VHY A;  2AHO B;  3L8U A;  2Q2I A;  2YV5 A;  4LF4 Q;  3I4M G;  1GO3 E;  4DUZ Q;  4MNO A;  2F4V L;  4PZ7 A;  5LMN L;  3I4N H;  4JI1 L;  4RG1 A;  4EX5 A;  1BKB A;  2JQO A;  1VQ5 A;  1CKN B;  5IYB H;  2ZM6 Q;  1N34 Q;  2NVX H;  2EIF A;  3HOY H;  2VY3 A;  5JEA G;  3GYQ A;  2MO0 A;  5LMN Q;  1YBY A;  2YYZ A;  4BXX G;  4DV6 Q;  1YIJ A;  3BU2 A;  3AFP A;  4H02 A;  4IPG A;  1PFS A;  4YQG A;  4A3J G;  2N78 A;  4JYA Q;  1X55 A;  1Y1V G;  4DNI A;  1S72 A;  3T1Y Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...