4RG1A

Methyltransferase domain of c9orf114
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
Knots found
sequence length
306
structure length
285
Chain Sequence
b'RGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQACVQLARILQYLECPQYLRKAFFPKHLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLTQAGAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C9orf114
publication title The Crystal Structure of Human C9orf114 in complex with S-adenosyl-homocysteine
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 285
sequence length 306
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02598 Methyltrn_RNA_3 Putative RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4rg1A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4rg1A01
2R92G 4L5RC 4C3IH 3J81c 2C35B 3CAMA 2K50A 2WAQG 3I2ZA 1QVCA 3KJOA 2ASBA 2VNUD 2QEXA 3ULPA 2F52A 4O2DA 1C9OA 1EOVA 1PYBA 1X55A 3K80C 4MCDA 4YQ5A 3CMAA 4UY8C 4X3LA 4DNIA 1JJCB 1K8AC 3SGIA 1HZAA 1IZ6A 1XMQQ 1YNXA 3PIOA 3G6EA 4PG3A 4YCUA 2V1CC 4QL5A 4A3FG 1BKBA 5ELNA 2KHJA 5JEAG 2R93H 1AE3A 2EXDA 3HOWH 1WOCA 2AMCB 3PCOB 4DR7Q 1N33Q 1KC8C 1OXVA 2ZTEA 5ELOA 4LUVA 4YQLA 4GLAC 4HIOA 3CCEA 1CKOA 1M90C 1IXRA 1L0WA 4JI5Q 1SE8A 5DLQE 1G291 3WWVA 3HOUG 2UXDL 4AIMA 1X65A 3DM3A 4YWLA 1IBKL 3VDYA 1O7IA 1YJNA 1EIYB 4EX5A 4B3SQ 5GROA 1PHJA 4LNQA 5BR8L 2VQEL 4YQ2A 1N8RC 4GLXA 1NMGA 3I55A 4A3EG 4DV2Q 4BA2I 3GTOH 3BZKA 1C0AA 3FP9A 5M5XH 4X64L 3PF5A 2JE6I 4OONA 3TRZA 1PH9A 2NVQH 4JYAQ 2WAQE 3T1HQ 1UAMA 1EYGA 1VQMA 1MKHA 4YVGA 3UDGA 1J5EL 4DR2L 4LW1A 2PNHA 3NELA 1HZ9A 4GS3A 1X7OA 4A3CG 4TQUS 5HGQA 4IFDJ 3CPWA 1IPAA 2ZM6Q 3TEHB 1I94L 1LUZA 2QGQA 3KFUA 1PH3A 2LSSA 1HR0W 2UXCL 3OIJA 1IYJB 1CSPA 4AYBG 4B3TL 3ONPA 4LFCQ 4IFDI 1Y1VG 2BH8A 4GOPB 1FJGL 2VUMH 5D9FA 1E1OA 2YY8A 1CKNB 2ES2A 2LXJA 2KCTA 2IHEA 2R7ZH 3S1QH 5GM8A 4YQGA 2D62A 4UPAA 2YTVA 3U4ZA 1Y1WH 2ZJQA 3RR5A 4PZ6A 1YIJA 4Y7NH 3GTQH 2JA5H 4X64Q 4LF5L 3I4MH 5IT9c 2DUDA 3KTYA 3BZCA 4PMWA 4J15A 1W3SA 2R7FA 3AXZA 3U50C 3F2CA 3S15H 3S2HH 4DR5Q 5FLXc 2V3KA 3S24A 1Z85A 3HOVG 1L1OB 4GOPA 3HOYH 4KHPQ 4KLKA 4GN4B 1CKNA 1I94Q 4JBKA 3A0JA 3ICEA 4IFDG 2I6DA 3CC4A 3PO2H 5IP7G 3AQQA 4UP9A 4A93H 3G48A 4DV1L 1YZ6A 4B3TQ 4OWXB 2Y0SE 4IPGA 3I56A 1J6QA 4L5QA 4GNXB 4A3LG 1K9MC 4IOAA 2HHHL 1VQCA 4BY7H 4YQ8A 5M3MH 1JB7A 2HT1A 5FJ8H 3G4SA 2GVBA 4WJ4A 1NMFA 4AYBE 4OWWB 1L1OA 4R4IA 1C7YA 4LF5Q 5HY6A 3BBDA 1YHAA 1IL2A 4NB3A 1VQBA 1VQJA 4BBSG 3OTOL 4GN5A 3J81i 5C44H 3KJPA 1KHIA 3H3VH 2R7DA 2Z0SA 1TWHH 3UDXA 4LFAQ 2NVXH 3HKSA 3STBC 4GNXA 3S14H 1MXIA 4YPZA 2N8NA 4YCVA 4YY3L 5C3EG 4DPGA 1X3FA 2AWNA 1UEBA 3I4OA 1YITA 4GKJQ 1OXUA 4DV5Q 1YHQA 3NENA 5FLMG 2NN6I 4LF8Q 3I4NG 4LF9Q 4JI0Q 2UUCL 3K0XA 4DV7Q 3FKIG 2JA8H 1UAKA 4R4CA 4YWMA 1HR0Q 2Z6KC 2EQSA 1TXYA 2D0OA 2WB1G 3RN2A 3GD7A 3ER0A 2L15A 2WFWA 4DR1Q 4GKKL 2LXKA 2AHOB 4NPSA 5JJIA 4Y52H 5C4JH 4YQSA 4ME3A 4C3HH 4BBSH 2AKWB 2OQKA 3KF8B 4H02A 1SLJA 4YCWA 1GO3E 1JT8A 2NN6G 4YQTA 1UE1A 3CCMA 5GADC 4HIKA 1TWCH 2MO0A 3KDFB 2JA9A 2R93G 2EIFA 3OYYA 3ULLA 1XMQL 3HOWG 3U4VA 3B6YA 1I50H 2JA6H 1VQ5A 3KNUA 3QUVA 4YPWA 4LWCA 4LF4Q 3K7UC 1N33L 2B29A 1X6OA 1HZCA 4YQ4A 1I6HH 1PVOA 1QZHA 3J7ZC 3EBEA 4DV4Q 1VH0A 4JI5L 4JOIA 4A3GH 3NK6A 5GMBA 3HOXH 3PF4A 1VQNA 3U58A 3KDFA 1L2FA 4DK6C 4MNOA 4ALPA 2UUBQ 4XBOA 4B3SL 2H5XA 5JJLA 4OX9Q 4HJ5A 2EGWA 1B8AA 3L8UA 5M3FH 2VW9A 1N36L 1LM0A 4DV2L 3BBEA 1CKMA 4JI4L 1UAJA 5IYBH 1V2XA 1EWIA 3RZDH 1W2BA 1B70B 2OWOA 4WJ3M 3K81C 3PUVA 4XTCS 1IBLL 1XTDA 5LMUL 4JYAL 3RLNA 4HIMA 3RN5A 5GQOA 3T1HL 2E2HH 1SRUA 2NZHA 4YVHA 2MQHA 3CXCA 4KGNA 1N32L 4DV3Q 1LTLA 2ZM6L 2XTIA 4HIDA 3N4JA 1Q8KA 3CCUA 4DR4Q 1X56A 2IY5B 3DLLA 1PH6A 1VQ7A 3JAMc 1PH5A 2B3GA 2VUMG 1PH1A 1NY4A 4LFCL 2N49A 3T1YQ 5IP9H 2A1AA 3PV0A 2R7ZG 3HOZH 2CQOA 4QJFA 1TWFH 4A75A 2ATWA 1Q12A 1Y1WG 4JV5L 1VQDA 1O6DA 4LUZA 3M4QA 4DR6L 1N36Q 2JA5G 3I4MG 1OTCA 1IBMQ 4DV6Q 4JI4Q 2IX0A 1KAWA 1HNWQ 1WFQA 1IBLQ 1YBYA 3NBHB 5LMUQ 3O7BA 4L5SA 1V9PA 1XJVA 3KLWA 3ERSX 4C3JH 4X66Q 2ALYB 4JI1Q 4AQYQ 3HOYG 4DR5L 1N32Q 1PH8A 4YQCA 3H3VI 3PO2G 4IG6A 1SFOH 1FGUA 2QWVA 4KHPL 1P16A 4A93G 3CCRA 3KW2A 4JAKA 2E2JH 2IT1A 1J85A 3HKZG 1PH4A 1WYDA 3J80i 4BY7G 5M3MG 1D8LA 3GTGH 5FJ8G 2XGTA 1PA6A 4JC0A 3CCQA 1E22A 2OCEA 2EGVA 3M4PA 5AJ3Q 1Q86C 2I5HA 1WCMH 3CC2A 4DR6Q 5M5WH 4IOCA 1AH9A 1X7PA 1VQ8A 2CCZA 1YEZA 4KDZA 2N78A 4IO9A 4LFBL 2KENA 4FDBA 4O0AA 3TREA 4RMFA 5C44G 2QMMA 4J3CA 3G71A 4YPYA 4P73A 3A5UA 4DUZQ 1VQKA 3STBD 3S1RH 1N9WA 4LFAL 1EFWA 2VY3A 4UP7A 2YTYA 4QQBX 2FXQA 4GOPC 3PO3H 3AIAA 4X3MA 1UALA 4YQIA 4GKJL 2K4KA 4A3IH 5C4XH 4DV5L 4LF8L 4BXXH 1OXXK 2K52A 1KRSA 4LF9L 4JI0L 2JA8G 3BU2A 1VHYA 4JCVE 4YQ6A 4YHHL 4DV7L 4JI2L 3GTMH 2V3JA 1UE5A 4LF6Q 4JBMA 5GMCA 4YQBA 1HR0L 3ZJYC 3J7A5 2F4VQ 2JJQA 4DUYQ 3HKZE 1HNXQ 3TQYA 4R1JA 2I5MX 4DR1L 4LFBQ 4UP8A 1L1OC 3CCLA 4YQAA 4OWTB 4R4QA 1JMCA 5J3BA 5IYCH 3PUYA 1VQGA 3W5OA 1SR3A 1Q46A 1VQAA 1Z47A 3CCSA 1OY5A 1S72A 2Q2TA 5JJKA 2VQFQ 1VQ4A 1KXLA 4GNXC 1KD1C 3L7ZC 2IX1A 4H3ZA 3RLOA 5EAYA 4LF7Q 2JA6G 1NJIC 1NTGA 3KYHC 4IJLA 3EN2A 1GKHA 2KCMA 3KOJA 4JI2Q 4YHHQ 1BBWA 3H0GH 4LF4L 3CC7A 4HJ8A 1HNZQ 1E3PA 4A3GG 2E5LQ 3HOXG 2PI2E 1XPRA 2I5LX 2KBNA 3L0OA 4A3DG 4DV4L 4CNDA 4YVIA 1BBUA 1P9PA 3RZOH 2YV5A 2CWPA 3PSIA 4P75A 1VQFA 2ID0A 2UUBL 4R4TA 5M3FG 4OX9L 1XNQQ 2NVYH 4JI3Q 4QGUA 4JI6Q 3GTKH 5IYBG 3UDIA 2N3SA 2ZJRA 1U0LA 3AFPA 2I0QA 2MFIA 3I7FA 3W1BA 1NBWA 3AYHB 3D31A 4A3JH 1ASZA 1KL9A 3W1GA 5LMNW 4JALA 1QUQB 4YQPA 1WI5A 3OIIA 3UE1A 1E1TA 2IHFA 4OO1I 3E0EA 1G6PA 2RCNA 2VS1A 4YQQA 1S3OA 2PMZE 4DV3L 4NXNQ 1JJGA 4YQKA 2NVTH 5FAIA 4IPDA 3ULJA 1VQEA 1JE5A 4DR4L 1E24A 3CP0A 1XPUA 4YQJA 5K36G 4X65Q 5IP9G 3HOZG 1VQ9A 3PUZA 2Z0YA 4A3KH 4JOIC 2CX8A 3T1YL 1Q1BA 4A3BH 4NXMQ 1QUQA 4EQ5A 1Z9FA 2B63H 2UXBL 3MEFA 2WB1E 4K0KQ 4X62Q 4B3MQ 2YTXA 4MZ9A 1A62A 2K14A 3PUWA 4OO1G 1IBML 4DV6L 4BBRH 1HNWL 1K73C 2UU9L 3TS2A 2CFMA 3CD6A 3F2BA 1TWGH 2ZTDA 3RLFA 5C0XJ 1ASYA 1G51A 4DR3Q 4DKAC 3CCJA 1KRTA 4X66L 4AQYL 2Q2HA 4JI1L 1T9HA 3JC66 1XMOQ 1YJ9A 2JA7H 2HA8A 3CW2C 4YQRA 4TVAB 4P74A 4XIGS 4JI7Q 1X3GA 1N34L 2UUAQ 1UE7A 5C0XI 2E2IH 4YPXA 1LYLA 3TS0A 2D0PA 3AFQA 3D0FA 4P72A 5GAEC 4HJAA 1XNRL 4H3YA 4YQOA 3J81j 3S1MH 4A4IA 4A3MH 1K8GA 1WCMG 1XPOA 1GM5A 2Q2UA 1NS5A 2JEAI 4YQ3A 4JBJA 5AJ3L 3IRBA 2UXBQ 1RL2A 3K8AA 3GTPH 2PQAB 3LGJA 4BY1H 3PUXA 2UU9Q 2R6GA 1K83H 3KY7A 3NK7A 4MCCA 4JV5Q 2ZJPA 3BBHA 4OXPA 4DUZL 3AEVA 5C0XG 3CCVA 4QY7A 2GN5A 4JI8Q 3PO3G 4JG2A 3DCMX 4LUOA 5IYDH 4YQ9A 5LMNQ 4A3IG 1UWVA 1N34Q 4R4OA 1YI2A 5C4XG 4BXXG 2HIVA 1XNRQ 1KIXA 2PQAA 4CNFA 4IPHA 2BA1A 3L2PA 1NE3A 4POFA 3M9BA 5IWAL 4POGA 2R92H 1NXZA 3M3YH 3BJUA 1GZ0A 4C2MH 2YU9H 4LF6L 4B3RL 2F4VL 4DUYL 3ILKA 5CO4A 4CNEA 4GN3B 1VQLA 1HNXL 4YWKA 3GDEA 3S1NH 5IY0A 5IYCG 3E5YA 1A63A 3PIPA 5H1SE 2Y0SG 4A3FH 3GYQA 2KHIA 1V43A 2CWAA 1OXTA 1TWAH 2HQLA 2RHSB 3M7NA 3S2DH 2K5NA 2A19A 2VQFL 4QIWE 2OTLA 1VQOA 4IJHA 2UXDQ 1GVPA 5GAGC 1P8LA 3MXNB 2MNAA 3AI9X 4PZKA 3HFZB 4LF7L 4YQDA 2ZTCA 4DV0L 3OW2A 1IBKQ 3HOUH 2VZAA 3H0GG 5IWAQ 3E9IA 5BR8Q 2VQEQ 1PYSB 3KF6B 1VS0A 2DGYA 2WP8J 4B3RQ 4A76A 1HNZL 1A8VA 2E5LL 1FVIA 4A3EH 4YQ7A 3S16H 1EIFA 3S17H 1K3RA 1X3EA 4P71A 3M85A 1B7YB 2MO1A 1JJ2A 3N4KA 1J5EQ 4DR2Q 3GO5A 4AH6A 1XNQL 4JI3L 1I3QH 3EIVA 2HIXA 4KI0A 4JI6L 3GTLH 4IPCA 4YQ1A 1E7ZA 5E7NA 4A3JG 4A3CH 2AWOA 3KF6A 4JBWA 2UXCQ 1SROA 1MJCA 1X9NA 1HZBA 3CMEA 1I5FA 1H95A 3IEFA 4DV0Q 2K5VA 1D7QA 1FJGQ 5GAHC 3FHWA 1YVCA 4NXNL 1QZGA 1V1QA 1MJEA 1Y1VH 2BA0A 3UDFA 1R9TH 1QVFA 1AE2A 1YJWA 4MCBA 2OTJA 1PH2A 1PFSA 1VQ6A 1VHKA 1EQQA 4A3KG 3F8TA 4DAYB 1EUJA 1VQHA 2PI2A 4A3BG 1Y14B 4X65L 4GLVB 2JEBI 2NZOA 3JAMi 1Q7YC 2B63G 3H15A 4YVKA 4NXML 3E9HA 4BBRG 3K7AH 4HJ9A 4X62L 4K0KL 2GVAA 4B3ML 2O3AA 2A8VA 1GD7A 1QVGA 3HOVH 1MIUA 3J80c 1EQRA 1HJPA 4APVA 1V6ZA 4DV1Q 5IP7H 1SN8A 2JQOA 1X54A 1Q82C 1CSQA 1YHBA 2JA7G 3NEMA 4DR3L 3RNUA 2RF4A 1Q81C 2HHHQ 2Z6KA 1DGSA 1XMOL 4A3LH 3CQZH 1RIPA 4RG1A 2K5HA 5IE8A 4KHZA 3IC6A 3GTJH 2CKZB 1K0RA 4JI7L 1VCIA 2BH2A 2UUAL 5M5YH 2JK8A 3CPFA 1WJJA 3F1ZA 1U5KA 2QA4A 4A3MG 1CUKA 4L69A 3Q8DA 3OTOQ 4E8BA 4YQ0A 2E8GA 3A5ZB 4PZ8A 4A3DH 2RHQB 1PH7A 2Q2IA 1TO0A 4YQNA 4FAKA 4YY3Q 1S40A 4BY1G 4YVJA 1VQIA 3F2DA 3M4OH 4DAMA 4HJ7A 1PV4A 5C3EH 5JEAJ 2VL6A 4BA1I 2OQ0A 3CF5A 3OINA 1HH2P 4DK3C 1KQSA 1M1KC 2YYZA 4DR7L 1FL0A 4L5TA 3PGZA 2UUCQ 1SMXA 4MTNA 1A0IA 1UE6A 5IYDG 1BVSA 1Q1EA 5FLMH 3I4NH 4JI8L 1ZJRA 4CNGA 1OXSC 1VQPA 3FKIH 4PZ7A 4X6AH 3A74A 5LMNL 2K75A 4GKKQ 2F3IA 3UE0A
chains in the Genus database with same CATH superfamily
3I2ZA 2K50A 4BY1B 3NHHA 1PYBA 3K80C 1HUMA 4UY8C 5IGEA 1Y69U 1B2TA 2NN6H 1IZ6A 1EY4A 4YCUA 2V1CC 1KDAA 2B2WC 2EXDA 3VYSA 3HOWH 2A69D 1KC8C 2ZTEA 4TRDA 3CCEA 1CKOA 1UAPA 4X3SA 3EVQA 5DLQE 3WWVA 2UXDL 4AIMA 3DM3A 1O7IA 2VQEL 3GV3A 4GLXA 1NMGA 5CC4A 2AUJD 4A3EG 4DV2Q 4BA2I 1K8MA 3FP9A 2NVQH 1UAMA 2WAQE 3T1HQ 3UDGA 4ZYSA 3MC0B 5JAVA 1X7OA 1BXTA 4ZUJA 5FO9B 3KFUA 3J80L 1TS5A 3AU7A 2HDMA 4IUPA 4B3TL 3ONPA 3N6RA 4IFDI 1Y1VG 1LLRD 2VUMH 4U673 2OXPA 2XIWA 1STNA 4PV1C 2IHEA 2D62A 1JORA 4FNFA 4JK1C 4PZ6A 1YIJA 1QNKA 4EQNA 3I4MH 3GV6A 1W3SA 1LTAD 1W6KA 2L12A 4DR5Q 3FVQA 3HOVG 3HOYH 2C9OA 4KLKA 5CBEE 2I6DA 3K59A 4UP9A 1DOKA 1YZ6A 2Y0SE 3VR5A 2FMMA 4IPGA 5IIFA 4GNXB 4KD4A 1O7LA 2HHHL 4YQ8A 1ET9A 1JB7A 1BCPB 3RZOB 5C3XA 1WTXA 3BVZA 4AYBE 1CM9A 4EQOA 3GTKB 1E2WA 1LT6D 1YHAA 2EOTA 4M1UB 1IYUA 1JWUD 2E75C 1ZYRC 1TWHH 1BR9A 4YCVA 5G3LD 2EYJA 1EWHA 2AWNA 4JVZA 4KK7A 1KNAA 1OXUA 1YHQA 3NENA 2NN6I 1U9RA 4LF9Q 4DAYA 4JI0Q 4DV7Q 2F0KA 5D3IB 2JA8H 2EJMA 2Z6KC 4PMBA 1H9KA 1GOZA 4DR1Q 2ZXPA 4BBRB 5C3WA 3H6MA 2J0TD 4H02A 1SLJA 5J1ZA 2J4XA 5GADC 2CHBD 3KDFB 2EIFA 3OYYA 4HSVA 3ULLA 1XMQL 2LY7A 5KRUA 1Q8IA 1ENCA 1LT5D 1VQ5A 2KVMA 4LWCA 4FF4A 1N33L 1X6OA 1KABA 1HZCA 5D3DA 4A3MB 4KJNA 3KF8A 4DV4Q 1VH0A 1Y8NB 4JI5L 4JOIA 4A3GH 3PF4A 4A3DH 2Z6BA 2UUBQ 4RGNA 1A3TA 4OX9Q 1SSOA 3QOLA 2OF1A 2EY5A 1L0YB 3L8UA 3HOWB 1CKMA 3I8ZA 4JI4L 5IYBH 1UAJA 5IT9L 1S5BD 2OWOA 5TSSA 3PUVA 5LMUL 3RLNA 3RN5A 1STYA 4HTHA 1CTMA 1VDZA 3TP8A 4Q5VA 1G2TA 1EL0A 2ZM6L 2XTIA 3D4RA 3CCUA 4DR4Q 3DLLA 1A15A 4XDXA 2B3GA 3JAMc 2EDGA 2F0UA 2DY7A 4B9XA 1NY4A 1LO5D 2A1AA 2R7ZG 3VA5A 3JAME 4ZK9B 5C4HA 1Y1WG 3NTKA 2JA5G 3EROA 2SOBA 1HNWQ 2TMPA 1TIID 4OO1H 1EEID 4X3UA 5CBAE 1YBYA 1IBLQ 4C3JH 2MP1A 4NKLA 4JI1Q 2A68C 2O5IC 1D5MC 4IG6A 1SFOH 1P16A 4A93G 4JAKA 2L11A 3DEPA 3OOCA 1PH4A 1W6JA 3J80i 4BY7G 1D8LA 2SEBD 2B8FA 5FJ8G 2XGTA 3DM1A 3M4PA 3H91A 4CKBA 1AH9A 2BCOA 4LK1C 4L63B 3D6WA 4IO9A 4LFBL 4N9PA 3HOYB 2PCFB 4J3CA 2SNSA 4F8MA 1T5EA 3STBD 2L0CA 3HKZB 4GOPC 2F4IA 3D4DA 2CVRA 4GKJL 1BNZA 4A3IH 2F0DA 3IFDA 4KY6A 1OXXK 3KK7A 4YQ6A 1NNXA 4LF6Q 2KECA 2N88A 1TWHB 1HNXQ 5JJZA 1L1OC 1XX8A 3QIAA 4OWTB 4C3HG 5IYCH 3PUYA 1UEAB 3W5OA 1I4GA 1Q46A 1VQAA 3CCSA 2B2UA 1CHQD 3TZDA 2PYKA 1S72A 2VQFQ 1VQ4A 1KD1C 4I65A 5FOBB 4XT3B 3G6JB 5BN3A 5DEHA 4IJLA 4YHHQ 2FJ2A 3CC7A 5EJWA 1JOQA 1HNZQ 1AZQA 4YVIA 3BVGA 5FO8B 1P9PA 2CWPA 3PSIA 3NBIA 5C3EB 3MFGA 5E4XA 1U0LA 3I7FA 1RD9D 5K5PA 4QF4A 1SNQA 3W1GA 4JALA 3K57A 1B9MA 4OO1I 3E0EA 1G6PA 2VS1A 2NVTH 1PZKD 5FAIA 4YQJA 2PZWA 2RDFA 4X65Q 5IP9G 2PPBC 1RTNA 2M2LA 3PUZA 1VQ9A 3T1YL 1Q1BA 3HEJA 4A3BH 4NXMQ 2B63H 2A6EC 5AFWA 4MZ9A 1A62A 1IBML 4DV6L 3GQBA 1PXUA 4CGYB 2UU9L 3TS2A 2XSCA 2CFMA 1SDFA 2DJFC 1EEFD 1TWGH 1WTRA 2ZTDA 1G51A 2KJXA 3ONAB 3JC66 1KDCA 2HA8A 2K5DA 4TVAB 4XIGS 1PZJD 4YPXA 2O5JC 3TS0A 4HJAA 3DWQA 3J81j 4A4IA 5IGBA 1K8GA 1XPOA 2Q2UA 3D6CA 2JEAI 1F2ZA 1V1OA 3GTPH 3LGJA 3QOJA 2H4OA 1K83H 5DAUA 3V05A 4OXPA 4TSSA 1WTWA 3S9WA 1STEA 2GN5A 4JI8Q 3I4LA 3TP5A 4JG2A 1PRTD 4ID6A 5I9OA 4YQ9A 5C4XG 2JN4A 5FK9C 3S1QB 4LAAA 4RWSC 1NE3A 5IWAL 1B44D 1SE2A 3GTQB 3BJUA 3R2TA 3QO2A 1A3UA 4K2KA 4H7BA 4C1NI 3ILKA 3HS0C 5CO4A 4GN3B 3DXJC 4YWKA 3GDEA 1H9SA 1SJED 1A63A 2B39A 2M00A 3GYQA 5JEAH 4FO2A 4H44C 3A8JE 4QIWE 4G7ZC 1GVPA 5GAGC 3MXNB 4PZKA 4NMZA 4PMCA 3OW2A 3HOUH 1NR2A 5BR8Q 2EYOA 4B3RQ 1EQVA 2JXMB 1A8VA 3MA2B 1EIFA 4ABNA 1K3RA 1X3EA 1F9PA 5M9OA 1B7YB 2MO1A 3HP3A 1J5EQ 1WTVA 3N4KA 1LTBD 1GUGA 1CT1D 3MXPA 5E7NA 4A3CH 2TSSA 4KTAA 2UXCQ 1MJCA 1X9NA 1H95A 2B2TC 1QILA 4DV0Q 1FJGQ 1WTPA 4ZKBB 1IHZA 1QNUA 5JPMC 1QVFA 1R9TH 2MPMA 4MN3A 2OTJA 2Z8LA 1VQ6A 1OO9B 3F8TA 2PI2A 4GLVB 4YVKA 5KNCA 1VF5C 4BBRG 5KNDA 3K7AH 4DK1A 2B8GA 2GVAA 3OWFA 2NWGA 2JA6B 2O2LD 1PDQA 2FHTA 1SN8A 2K7VA 1CSQA 2JA7G 3IKJA 5EGTA 1BDOA 1YNJD 2RF4A 1DGSA 3CQZH 3T56B 2Q8RE 4LMQD 1K0RA 2BH2A 1TY2A 5M3FB 4A3MG 4KY5A 3F1ZA 2QA4A 1B9NA 3NSWA 2K32A 2KA7A 3E5SA 4YY3Q 3DWPA 1VQIA 3I70A 2BDNA 3QJYA 3CF5A 3SK5A 5I6WA 4WFN3 5EBCA 1KQSA 2YYZA 1ENAA 2UUCQ 3I4NH 2ICEC 1BVSA 1M4VA 1ZJRA 1VQPA 3EFXD 3FKIH 4DNRB 4PZ7A 4MTKA 3A74A 1MD2D 1SNCA 4EGVA 5LMNL 3NQTA 1XWEA 2KOLA 4L5RC 4C3IH 3KJOA 3GTPB 2WAQG 3TSSA 2VNUD 3ULPA 1C9OA 1KAAA 1K83B 1HTPA 3CMAA 4X3LA 4DNIA 1E0BA 1STBA 3PIOA 3G6EA 4QL5A 2R93H 2KEDA 4I7ZC 1AE3A 1WOCA 2AMCB 2EYFA 5ELFA 1K8OA 4CJ1B 1OXVA 1V8QA 3OMGA 1PFMA 1M90C 5A35A 1IXRA 1JOOA 1G291 4IUUA 4YWLA 3KLRA 1IBKL 3VDYA 4B3SQ 3MEHA 1YJNA 4YVHA 1PHJA 1N8RC 4HMIA 5CV4A 2F0SA 4RAUC 3C3LA 2PW7A 5M5XH 4JYAQ 1PH9A 3NQIA 1VQMA 1MKHA 3PO3B 4LW1A 4TQUS 3HOUB 1LUZA 2LSSA 1HR0W 3OIJA 1CQVA 1IYJB 4AYBG 3GTMB 2F0WA 3MVVA 4OIKA 1EIHA 3W3AA 2BH8A 4GOPB 4PNYA 1E1OA 1CKNB 3MTSA 2RBMA 3E3XA 5GM8A 4YQGA 2B2VC 3Q22A 3RR5A 4Y7NH 4ILWA 4X64Q 4J15A 5IODA 5I4DA 3R2IA 4QCLA 4DA2A 4DXFA 3S24A 2V3KA 4XT1B 1L1OB 4QUFA 4JBKA 3A0JA 3CC4A 3PO2H 3OIQA 3RMHA 3T16A 1FD7D 4OWXB 3I56A 1O78A 5E4WC 5M3MH 2HT1A 3G4SA 2GVBA 4WJ4A 1NMFA 4R4IA 3Q0AA 2ICIA 4LF5Q 3K7AB 3BBDA 1KDBA 1VQBA 3KLSA 3OTOL 4GN5A 3H3VH 5C44H 1KHIA 2DY8A 2QMMA 4GNXA 1LABA 2BDOA 4YPZA 2N8NA 5C3EG 2FMCA 4DFAA 3NXWA 3I4OA 4WORA 2KUMA 3CQZB 2Z9HA 4DV5Q 4LF8Q 1J9OA 1LTGD 2K5QA 5T1GA 4R4CA 4YWMA 1AP0A 1UAKA 1HR0Q 2EQSA 2D5DA 2D0OA 3ER0A 3U9SA 2WFWA 2LXKA 1EOTA 4NPSA 2EJGC 5JJIA 4Y52H 4EVOA 4F7XA 4YQSA 4BBSH 2AKWB 3VR3A 2OQKA 3BYTB 2X69A 4YCWA 3X3MA 4YQTA 4HIKA 2AQ2B 3K5LA 4YIJA 2JA9A 4IURA 1Y8PB 2NBFA 4KKUA 1YNND 2E2IB 4YPWA 4LF4Q 3K7UC 4C3IB 2B29A 1I6HH 1PVOA 5FKAC 1QZHA 3C46A 5LHY1 3I72A 3NK6A 5GMBA 3HOXH 3KDFA 1L2FA 2WACA 1WTOA 1S5DD 2H5XA 5D65A 1MSGA 2EGWA 1SYBA 2VW9A 1EZ6A 2MHVA 4OEMB 1B70B 2P5ZX 3K81C 4XTCS 1IBLL 5GMCA 1XTDA 2MGSA 2NZHA 5CV5A 2HCCA 4DV3Q 5ISRA 1D1KA 4HIDA 2RCFA 1S5FD 1JB3A 2R92B 2IY5B 3M3YB 1PH6A 1VQ7A 1AW7A 2K33A 3TBIB 3RUZA 4XQJA 1A2UA 1BUVT 1G8ZD 4LFCL 2N49A 2QKIC 3PV0A 1S5ED 2CQOA 1O6DA 4A75A 3S1NB 1DOLA 1B3AA 5LL6S 1N36Q 4R8NA 4A3FB 2IX0A 2F0TA 1WFQA 3NBHB 3O7BA 1NUCA 3KLWA 1PTOD 4X66Q 4AQYQ 3F2UA 1N32Q 5CV9A 3T51B 3H3VI 2L9HA 1ZXTA 2QF7A 4FXGC 4KHPL 3CCRA 3A7LA 3QWNA 2IT1A 1STHA 5A2QL 1TS4A 3UI2A 1EU3A 2X6GA 1B50A 1PA6A 4JC0A 4L8JA 4RCNA 2F0PA 2OCEA 3CCQA 5AJ3Q 3S17B 1Q86C 1WCMH 3CC2A 4DR6Q 1VQ8A 2CCZA 5KNBA 4KDZA 4FDBA 4RMFA 2F0OA 4YPYA 4P73A 4DUZQ 3P75A 3S1RH 1G91A 1N9WA 4LFAL 3CKIB 1X3PA 1RODA 2FXQA 5JVG3 1H9RA 1BBXC 4YQIA 5G3LF 1SE3A 4BXXH 4RKBA 4DXGA 4JCVE 1X3QA 5EBDA 4YHHL 5JVH3 2V3JA 1UE5A 4YQBA 3WDNA 3HKZE 5EQ0A 3C1EA 3TQYA 2I5MX 4NW2A 4G7HC 4YQAA 4R4QA 5CMDA 1EYCA 1D6EC 2D2CC 2Q2TA 1KXLA 1F2YA 3H94A 2R61A 2O4XA 3RLOA 1G6ZA 1D2BA 2JA6G 5A2QE 4HJ8A 4G7OC 4B9WA 3JAML 2KBNA 3L0OA 4BBSB 1EY6A 4PQXA 1O80A 4K5WA 1VQFA 4CDEC 5M3FG 5BN5A 1XNQQ 1O7YA 2ZJRA 2I0QA 1SXTA 5KGUA 1DM0B 4M8AA 3NPPA 1NBWA 1I6VC 4A3JH 3A54A 1KL9A 1QUQB 5KYIA 1WI5A 4K2LA 3SDZA 1E1TA 2IHFA 1AFPA 4DU9A 2PMZE 4NXNQ 4E6IA 2DJGC 3HOXB 2A6HC 3BVMA 4IPDA 1VQEA 3CP0A 4KHVA 1J8IA 5K36G 3HOZG 2Z0YA 4A3KH 4KN4C 4EQ5A 2N55A 1Z9FA 4K0KQ 4X62Q 4B3MQ 1PZID 2YTXA 3PUWA 2RSNA 1F2MA 1S5CD 3CD6A 3RLFA 4P2CB 2L5TA 5C0XJ 3A7AB 4DKAC 1KRTA 1TU2B 2QILA 2B2YC 1XMOQ 1JC7A 4NP5A 3L9AX 4JI7Q 1UE7A 3D0FA 4CHTB 5GAEC 5I9PA 2A74C 1NS5A 1GM5A 1CHPD 4JBJA 2NVQB 4ZUIA 3K8AA 2PQAB 2LMCB 1QOHA 1TQOA 2B2WA 3KY7A 3NK7A 4JV5Q 1TKWB 1SYGA 3QG1A 5C0XG 3CCVA 4QY7A 3PO3G 3DCMX 4HAEA 2VUMB 1LTID 2EVBA 4X3KA 1BF4A 1N34Q 1CQFA 1WCMB 1STAA 1XNRQ 1KIXA 1EY7A 4POFA 2CW0D 3LWUA 3I4MB 4C2MH 1SYEA 2YU9H 4B3RL 2F4VL 3VA7A 3HGBA 4DUYL 4RCOA 4CNEA 4FF2A 3E5YA 2HCIA 1WTHA 4WJWA 1OXTA 1TWAH 2HQLA 2K5NA 2A69C 2OTLA 2EYLA 1BCPD 2UXDQ 2MNAA 3J7AV 3AI9X 2RKSA 3HFZB 4LF7L 4YQDA 5DNFA 4DV0L 2Q8IB 1RHPA 3H0GG 1GUSA 3E9IA 4KKSA 2VQEQ 1PYSB 1DYQA 4HR7B 1NCVA 5CORA 2DGYA 1SYCA 3HG9A 4IQZA 4CJ2C 4A76A 2E5LL 4A3EH 2FFKB 1JJ2A 4QMGA 4BS9A 2VXWA 3MXNA 3GTLH 4JI3L 2F1MA 3EIVA 4JI6L 4IPCA 1E7ZA 2AWOA 4ZQ3A 4JBWA 4HMJA 3CMEA 2JA8B 4HSPA 3IEFA 2K28A 2F0EA 2K5VA 1R4PB 1IKMA 4FP5D 1V1QA 1Y1VH 3UDFA 1AE2A 1YJWA 4DAYB 1S4ZA 2JEBI 3JAMi 2PMZB 3SE0A 4A3JB 4HJ9A 1GD7A 1QVGA 3HOVH 1MBYA 4K5VA 2QDBA 4DR3L 2HHHQ 2Z6KA 4A3GB 4UHVA 4A3DB 4RG1A 2NZ1D 2K5HA 3GTJH 1VCIA 4C3IG 2UUAL 5M5YH 3CPFA 1U5KA 3Q8DA 3VYRA 4YQ0A 2E8GA 3A5ZB 1I4QA 1TO0A 2L55A 4YQNA 1DOMA 4CDDC 4BY1G 2M9VA 4YVJA 3M4OH 1SYDA 1CFMA 2VL6A 4U68A 2PW5A 1GUWA 3J7YW 3PGZA 4YVGA 4MTNA 1IL8A 5IYDG 1SJHD 1UE6A 1NR4A 4K8IA 1OXSC 3CRKC 2KQ3A 1HPCA 1K3BC 5CR3A 1SE4A 1LTTD 5KEEA 2F3IA 3KOJA 1PRTF 2R92G 2C35B 2ASBA 2QEXA 2F52A 1EOVA 3NE5B 3N52A 1D5ZC 4C3JB 1JJCB 3X3NA 3SGIA 1XMQQ 1YNXA 4A3FG 4PG3A 1LACA 1SFOB 2KHJA 4ZAIA 5FLXL 3MXUA 3PIO3 3PCOB 2EPBA 1N33Q 5ELOA 3TZUA 4LUVA 5HURA 2NTTA 1L0WA 4JI5Q 1SE8A 4RKLA 5COYA 4V0BA 4LNQA 3BS1A 4EX5A 1UNSA 3I55A 3GTOH 2XN9C 1TWAB 1HFNA 4ME5A 4X64L 2JE6I 4OONA 3TRZA 4EQPA 1EYGA 4DR2L 2PNHA 3NELA 4GS3A 1XTCD 5HGQA 1IPAA 4IFDJ 3DUZA 3CPWA 2ZM6Q 4A3IB 1PH3A 2XNAC 3C2PA 4RGMA 2MJ8A 2L4NA 5IGGA 3E6ZX 1Q90A 4A3EB 5D9FA 2YY8A 2ES2A 2LXJA 2R7ZH 4WRDA 4UPAA 5FO7B 2ZJQA 1Y1WH 3GTLB 2JA5H 4LF5L 3KTYA 3K0YA 3BZCA 4FMWA 3V2TA 2R7FA 3AXZA 3U50C 1TT2A 4IN3A 3S15H 3S2HH 1VMPA 5FLXc 1Z85A 4C56C 4GOPA 3ICEA 4GN4B 1CKNA 1I94Q 4IFDG 5FLXE 5IP7G 5J39A 4A93H 3C1FA 4DV1L 1J6QA 1C48A 4A3LG 3H3VC 1VQCA 2SDFA 4BY7H 4R9WA 2R3ZA 3URYA 5FJ8H 1I4RA 2IWHA 3NUCA 1SAPA 1L1OA 2EZVA 3AB9A 4KN7C 4XQNA 2VB3X 1B1ZA 4BBSG 3HOVB 2RDGA 2Z0SA 2NVXH 3NTIA 3HKSA 3STBC 3R93A 4DPGA 1X3FA 1SMYD 4V190 4GKJQ 2RVLA 2NVTB 1FNVA 5FLMG 3DHQA 1WD1A 1FR3A 3K0XA 3HZXA 1TXYA 2WIIB 3GD7A 4A3BB 2EY1A 2L15A 2B63B 4GKKL 2G5DA 2AHOB 5JPNC 3M4OB 4IZ8A 4FYDA 5C4JH 2CH4W 4ME3A 4C3HH 5F2DA 1PMRA 1TWGB 4DAPA 1JT8A 2NN6G 1UE1A 1JWMD 3SHLA 2IL8A 3HOWG 3U4VA 1B3QA 1I50H 3SVMA 5JOBA 4XYQA 3KNUA 3QUVA 4IUTA 4NDXA 1ILQA 4CBVA 3ITPA 1XXGA 4K6LA 1VQNA 4MNOA 4XQQA 2ZXRA 4HJ5A 2ZXOA 1GXDC 1N36L 4DV2L 1V2XA 1EWIA 2HDLA 5DM63 2F3VA 5ELDA 4K5XA 1PLFA 3T1HL 2E2HH 5GQOA 1SRUA 4DNTB 4O1NA 3CXCA 1N32L 1MSHA 4ODGA 1LTLA 3QB3A 1EQTA 3N4JA 1Z6HA 1EY9A 1Q8KA 1F9QA 1X56A 3LX0A 2IJ0A 1PH5A 2PQEA 2VUMG 1RDPD 1PH1A 3GTOB 3T1YQ 3TP6A 5IP9H 4WJ3M 4QJFA 2ATWA 1TWFH 4ZCKA 3QR8A 1TVXA 1VQDA 4DR6L 3I4MG 1IBMQ 1LTRD 3MHBA 4H0LC 4HCEA 4DV6Q 3J7AF 4UDUC 1XJVA 5CV7A 3ERSX 3HOYG 4DR5L 1PH8A 3LWEA 1LT4D 2QWVA 2HQEA 5CV6A 3BG3A 1J85A 2R7ZB 3HKZG 1WYDA 1SNDA 1KTKA 3GTGH 3NBHA 3A8IE 1E22A 1LV9A 2I5HA 3S15B 2JP1A 1X7PA 1YEZA 4OIJA 2N78A 3TREA 3KBXA 2MUYA 3T4AC 3G71A 1ZYRD 3A5UA 3V96A 4Q0FA 1EFWA 1EIGA 4BWGB 2YTYA 1NAPA 1PRTC 4QQBX 3FPPA 3AIAA 4K6DA 1UALA 1R9TB 2K4KA 5C4XH 2IX3A 3P1HA 4LF9L 1STGA 2JA8G 1VHYA 4JI0L 3IL8A 3BU2A 4DV7L 5J22A 4JBMA 3WOEA 3ZJYC 4OGQC 1EYDA 4R1JA 5I6YA 4DR1L 1VMCA 4UP8A 1WD0A 3KUPA 1F9SA 1JMCA 1HCZA 3VR2A 2B2TA 2PNRC 3L7ZC 2IX1A 4H3ZA 2DN8A 1CZWA 3CU7A 5EAYA 1NJIC 1NTGA 2K03A 2A6HD 3DEOA 1GKHA 2KCMA 4JI2Q 4LJZC 1D5XC 2G9DA 5C4JB 3K5MA 1E3PA 4A3GG 1V1PB 4A3DG 4JWGA 4DV4L 2EY6A 4CNDA 1F77A 3RZOH 2YV5A 3OMCA 4P75A 3G7LA 2F0HA 2UUBL 4OX9L 3GTKH 2NVYH 3WOFA 5IYBG 3UDIA 2N3SA 2Z4IA 2E74C 3W1BA 3I4NB 4IALA 3AYHB 5LMNW 1DD2A 3P20A 4YQPA 3OIIA 3M4YA 3FKIB 3UE1A 4O42A 2RCNA 4YQQA 1L0XB 1JJGA 4YQKA 2XVSA 2WB1B 5IGDA 2NUCA 5C5MA 4DR4L 1E24A 4JOIC 1QUQA 2OEOA 2IPKD 3FMCA 4J8QA 1JQYD 2R93B 1BO0A 4OO1G 1FYCA 4BBRH 1HNWL 1K73C 2QW7A 3W2DA 4C3JG 1EY0A 4DAVA 3CCJA 2A68D 4RGOS 1LT3D 4JI1L 1U4MA 1T9HA 2JA7H 1YNJC 1YJ9A 3TP7A 4YQRA 3K5NA 1PTOF 1X3GA 1N34L 5CV8A 4J6HA 3AFQA 1XNRL 4YQOA 3S1MH 4A3MH 3VYUA 5M5XB 3ND8A 2Z4HA 3IRBA 2UXBQ 5C6AA 2RDHA 1GHKA 3OWEB 1F2LA 2R6GA 4RHSA 3BBHA 4Z9CB 3AEVA 5EKLA 4XXEA 1QE6A 3VYTA 3GTGB 2DNEA 3OPOA 1EU4A 2EE1A 1ET6A 5BN4A 5LMNQ 4H13C 4A3IG 4R4OA 1YI2A 2HIVA 2PQAA 4CNFA 4IPHA 3L2PA 4Y7NB 4KD3A 4LF6L 5E3FA 1I4HA 1HNXL 1EYAA 1ML0D 5IYCG 1CA5A 2J7ZA 1AN8A 3PIPA 3PO2B 3MZ5A 2KHIA 3OIPA 1V43A 3M7NA 4I7AA 4FF3A 3S2DH 5C4XB 1GUOA 2VQFL 3SR1A 1VQOA 5M3MB 1MI2A 5I2XA 2BE5C 3MWYW 5KIXA 1IBKQ 2B2VA 3KF6B 1VS0A 1PYWD 2WP8J 1HNZL 2A73B 4ULLA 1JWSD 5C44B 4X3TA 1FVIA 4K14A 3S16H 2EY2A 3M85A 3GO5A 1II3A 4S3SA 4AH6A 1SEBD 4N8X1 5ELCA 4YQ1A 1IKLA 1I3QH 4KI0A 1ZKOA 1TR5A 2B2UC 1SROA 1HZBA 1D7QA 5GAHC 1YVCA 1K28A 1QZGA 4FF1A 3FRPB 3RD4A 5CYUA 1PFSA 2NVYB 1EQQA 3J81L 1VQHA 4A3BG 1Y14B 4RFBA 4X65L 1JCKB 1U4LA 2B63G 5DM73 3H15A 4NXML 3E9HA 2A6ED 2QDLA 3Q6SA 2O3AA 2A8VA 1MIUA 1EWCA 3J80c 1EQRA 1HJPA 1RKNA 1HHVA 2LKVA 1V6ZA 1I6HB 3RNUA 3J80E 3K6OA 1RIPA 2EYHA 2PZTA 2JK8A 5E1FA 2I46A 1WJJA 2BOSA 4L69A 3OTOQ 1TS3A 2KHSA 4PZ8A 3ERQA 2RHQB 1HUNA 1CZGA 2F0LA 2Q2IA 1IW7C 2Q8TA 4DAMA 4KKTA 1PV4A 5IGFA 5C3EH 5JEAJ 2JA7B 4BA1I 2OQ0A 3Q24A 1HH2P 4G4KA 4RHRA 1M1KC 1FL0A 4L5TA 1Q1EA 4JI8L 4CNGA 3S1MB 4KMUC 2F0JA 2AQ1B 2K75A 2OT2A 4QB4A 4DF7A 2NYZD 3J81c 3CAMA 3SEBA 3NTHA 1QVCA 4FVMA 4O2DA 4MCDA 1X55A 4YQ5A 4L6TB 3J81E 1AZPA 1K8AC 1HZAA 1FNWA 1BKBA 5ELNA 5JEAG 4JPBW 1EZ8A 4DR7Q 1YNNC 2DNCA 4YQLA 4ZLTF 4GLAC 4HIOA 1HXYD 2WAQB 3U9OA 3HOUG 1X65A 2AQ3B 1BCPF 1EIYB 5GROA 4YQ2A 5BR8L 4MIUA 3NK9A 4CKEA 1JICA 3BZKA 4G57A 1C4QA 1C0AA 3A8KE 3SK6A 3PF5A 3S1RB 2KEEA 2ENBA 3S2DB 1EY8A 1FNUA 1DCZA 4OHJA 1J5EL 1QJOA 3ZYYX 1HZ9A 1NSNS 2L1BA 3D8GA 4HCSA 4A3CG 3TEHB 1I94L 2QGQA 1E2VA 4K8JA 2UXCL 1CSPA 2K01A 4OL7A 2F0IA 2RA4A 4LFCQ 1PRTB 1FJGL 4JWJA 3S16B 2KCTA 3S1QH 5C5LA 3H09A 2YTVA 3U4ZA 1SBBB 1I3QB 4R8IA 3GTQH 1A3VA 2Y0SB 5IT9c 2DUDA 4PMWA 1ESRA 2AUKA 3PQIA 3F2CA 5IT9E 1PTOC 2JSOA 4AYBB 4KHPQ 1ICWA 3TMEA 2F03A 3AQQA 1A2TA 2RQXA 1WTQA 3G48A 2VB2X 4B3TQ 3P7JA 4L5QA 4IOAA 1O7ZA 1K9MC 2RSOA 5ELEA 4F87A 4HEDA 4OWWB 1C7YA 1LTSD 2XWJB 5HY6A 1SNMA 2F0GA 1IL2A 4NB3A 1VQJA 3KJPA 3J81i 2R7DA 3UDXA 3S14H 4LFAQ 1MXIA 2I07B 2C5CA 2EJFC 2K6AA 4YY3L 2SNMA 1UEBA 1YITA 1GHJA 5C4ZA 3I4NG 4CDFC 2K1BA 2UUCL 3FKIG 2F3WA 1SYFA 1RTOA 3RN2A 4A3KB 2WB1G 1IYVA 1M8AA 3EA6A 1BQQT 1GUNA 4OELB 3KF8B 3T53B 1Q3LA 1GO3E 2QCPX 3CCMA 1TWCH 2MO0A 1T5XD 4RGTA 2R93G 3IAYA 1KLUD 1R4QB 3ND9A 3B6YA 2E2DC 2F0MA 3TN2A 2JA6H 1CA6A 1ENFA 4YQ4A 3J7ZC 1ESFA 3EBEA 3FEWX 2Z1CA 3U58A 4DK6C 4XBOA 4ALPA 4B3SL 5JJLA 1B8AA 3VR6A 5M3FH 1ZEQX 3BBEA 1LM0A 3CHBD 3RZDH 2LS01 4HN7A 5NUCA 1W2BA 4JYAL 1QWYA 5ELBA 4HIMA 2B2YA 2MQHA 4KGNA 1CI3M 1H9MA 2A5HA 2F0FA 2WKCA 2WKDA 1DZ1A 3FDTA 4C2MB 2YU9B 3GP7A 5K36H 3HOZH 1Q12A 2LFNA 4LUZA 3M4QA 2EYPA 3I73A 1OTCA 4JI4Q 1KAWA 1TS2A 4IUNA 3CRLC 5LMUQ 4L5SA 1JE4A 1V9PA 4RH6A 2ALYB 4YQCA 3PO2G 1FGUA 3KW2A 3NWSA 2F0VA 2E2JH 3MFYA 3SK8A 1RF2D 1FGBD 5M3MG 2KCNA 3BDCA 2EGVA 1GJXA 4QUCA 2XRSD 3MXGA 5M5WH 4IOCA 2F0QA 3R8BA 3IFTA 3BYYB 2KENA 4O0AA 5C44G 1GUTA 1AEXA 1VQKA 4FXDA 3HRZC 3AMUA 3FPUB 2VY3A 5C0XH 4UP7A 3PO3H 2CH4A 4JWHA 4X3MA 3NP8A 1Y1VB 4IUVA 4DV5L 2PO4A 4LF8L 1H9JA 1KRSA 1HQRD 5IOCA 1RJTA 1HA6A 3GTMH 4JI2L 1B53A 1PTOH 2CW0C 3K58A 1HR0L 3J7A5 3KLSX 2F4VQ 2JJQA 4DUYQ 1D1IA 4KV6A 2G9HD 3S14B 4LFBQ 1Y8OB 5D14A 3CCLA 5J3BA 1VQGA 1SR3A 1F9RA 1Z47A 1EFID 1OY5A 5JJKA 3L3OC 1KLGD 4IUQA 4GNXC 5CGKA 1TY0A 1B4OA 1BCPC 4LF7Q 4FXKC 3KYHC 1DONA 3GTJB 4ZRZA 1KNEA 3EN2A 5M5YB 4LF4L 1BBWA 3H0GH 4UAIA 2E5LQ 3HOXG 2PI2E 1XPRA 2I5LX 1BBUA 1HA5A 2ID0A 4R4TA 1TWCB 5LL6X 5KYLA 1Z7TA 4KY7A 3SK4A 4JI3Q 4QGUA 4JI6Q 1X32A 2X6LA 3AFPA 2MFIA 3OSOA 3KBGA 2QEJC 3D31A 1ASZA 1V1PA 1C8CA 1I4XA 4F88A 1S3OA 4DV3L 2K05A 3SXHA 2EXZA 2KCCA 3ULJA 1JE5A 1U4PA 1XPUA 2EYMA 2WV6D 2XWBB 2CX8A 3RZDB 2NB0A 2UXBL 3MEFA 2WB1E 5EPJA 2K14A 1QB5D 3F2BA 4N9TA 1ASYA 4DR3Q 5EKIA 4X66L 4AQYL 2Q2HA 1ICFB 3CW2C 3PMFA 3HOZB 4P74A 2UUAQ 5C0XI 2E2IH 1LYLA 2D0PA 4P72A 4H3YA 4ZKCB 4JW0A 1WCMG 1MGSA 3Q23A 3EJIA 4YQ3A 5AJ3L 3BZDB 3OW7A 1U4RA 1RL2A 4BY1H 3PUXA 2UU9Q 2K5WA 5EPKA 4MCCA 4CJ0B 2E2JB 2ZJPA 4DUZL 3T13A 3BDOA 1SNPA 4KJOA 1ILPA 4RA8A 4LUOA 5IYDH 3K5OA 1H9SB 2V4DA 2BE5D 1HQMC 1UWVA 1BOSA 4BXXG 5M5WB 2BA1A 1Y1WB 2NTSA 3M9BA 1UUPA 4POGA 2R92H 1NXZA 3M3YH 4GZYC 2JA5B 1K0SA 1GZ0A 4QIWB 4XYOA 2HD3A 3S2HB 1JOKA 1VQLA 4DK0A 3S1NH 5IY0A 3E0JA 1XYIA 5H1SE 2Y0SG 3OHXC 4A3FH 2CWAA 2RHSB 4A93B 3PIP3 3O13A 2A19A 1PFNA 4BY7B 1ONLA 2F0NA 4IJHA 1PTOB 1P8LA 2WINB 1DXMA 2CQAA 2ZTCA 2VZAA 1MHWC 5IWAQ 4CKCA 3NWTA 4B08A 2JYOA 2HUGA 4YQ7A 2NVXB 3S17H 1HFGA 2K04A 3D4WA 4P71A 3I3CA 4DR2Q 5I2YA 1XNQL 2HIXA 4N8FA 2XRQD 3VR4A 4A3JG 3D3RA 4DN4M 3KF6A 2IW3A 3H0GB 2E76C 1I5FA 2FINB 1RCVD 3EQLC 3M7GA 3LNNA 1SNOA 3FHWA 1DJRD 4NXNL 1I4PA 1MJEA 3R3OA 2BA0A 3I90A 4MCBA 1PH2A 1VHKA 2PZUA 3DMUA 4C1NK 4C3HB 4A3KG 1EUJA 1G2SA 2NZOA 1Q7YC 1QG7A 1IW7D 4K0KL 4J1MA 4X62L 4B3ML 1PFBA 1I50B 1VF7A 4APVA 4IFDH 4DV1Q 3DWAA 2JQOA 1HTLD 1X54A 5IP7H 1Q82C 1YHBA 3NEMA 2ZT9C 1Q81C 5EKKA 1XMOL 4A3LH 4MHEA 3MAQA 1WVLA 3IC6A 5IE8A 4KHZA 4JWFA 2CKZB 4TKOB 4JI7L 4DGZA 1CK1A 1E2ZA 1CUKA 4CDCC 3TDQA 4E8BA 3I91A 1A6XA 2D9UA 5T1IA 3A55A 3A56A 1PH7A 2E2HB 4FAKA 1S40A 3F2DA 1JR0D 3BDLA 4HJ7A 5IGCA 3OINA 1SMYC 4DK3C 4JV5L 4DR7L 2H1EA 1SMXA 1A0IA 5FLMH 5L37A 1QCBD 1EY5A 2GA4B 4X6AH 1HRJA 5EPLA 1TWFB 4GKKQ 5HGTA 2K52A 3UE0A
chains in the Genus database with same CATH topology
2R92G 4L5RC 4C3IH 3J81c 2C35B 3CAMA 2K50A 2WAQG 3I2ZA 1QVCA 3KJOA 2ASBA 2VNUD 2QEXA 3ULPA 2F52A 4O2DA 1C9OA 1EOVA 1PYBA 1X55A 3K80C 4MCDA 4YQ5A 3CMAA 4UY8C 4X3LA 4DNIA 1JJCB 1K8AC 3SGIA 1HZAA 1IZ6A 1XMQQ 1YNXA 3PIOA 3G6EA 4PG3A 4YCUA 2V1CC 4QL5A 4A3FG 1BKBA 5ELNA 2KHJA 5JEAG 2R93H 1AE3A 2EXDA 3HOWH 1WOCA 2AMCB 3PCOB 4DR7Q 1N33Q 1KC8C 1OXVA 2ZTEA 5ELOA 4LUVA 4YQLA 4GLAC 4HIOA 3CCEA 1CKOA 1M90C 1IXRA 1L0WA 4JI5Q 1SE8A 5DLQE 1G291 3WWVA 3HOUG 2UXDL 4AIMA 1X65A 3DM3A 4YWLA 1IBKL 3VDYA 1O7IA 1YJNA 1EIYB 4EX5A 4B3SQ 5GROA 1PHJA 4LNQA 5BR8L 2VQEL 4YQ2A 1N8RC 4GLXA 1NMGA 3I55A 4A3EG 4DV2Q 4BA2I 3GTOH 3BZKA 1C0AA 3FP9A 5M5XH 4X64L 3PF5A 2JE6I 4OONA 3TRZA 1PH9A 2NVQH 4JYAQ 2WAQE 3T1HQ 1UAMA 1EYGA 1VQMA 1MKHA 4YVGA 3UDGA 1J5EL 4DR2L 4LW1A 2PNHA 3NELA 1HZ9A 4GS3A 1X7OA 4A3CG 4TQUS 5HGQA 4IFDJ 3CPWA 1IPAA 2ZM6Q 3TEHB 1I94L 1LUZA 2QGQA 3KFUA 1PH3A 2LSSA 1HR0W 2UXCL 3OIJA 1IYJB 1CSPA 4AYBG 4B3TL 3ONPA 4LFCQ 4IFDI 1Y1VG 2BH8A 4GOPB 1FJGL 2VUMH 4JWJA 5D9FA 1E1OA 2YY8A 1CKNB 2ES2A 2LXJA 2KCTA 2IHEA 2R7ZH 3S1QH 5GM8A 4YQGA 2D62A 4UPAA 2YTVA 3U4ZA 1Y1WH 2ZJQA 3RR5A 4PZ6A 1YIJA 4Y7NH 3GTQH 2JA5H 4X64Q 4LF5L 3I4MH 5IT9c 2DUDA 3KTYA 3BZCA 4PMWA 4J15A 1W3SA 4FMWA 2R7FA 3AXZA 3U50C 3F2CA 3S15H 3S2HH 4DR5Q 5FLXc 2V3KA 3S24A 1Z85A 3HOVG 1L1OB 4GOPA 3HOYH 4KHPQ 4KLKA 4GN4B 1CKNA 1I94Q 4JBKA 3A0JA 3ICEA 4IFDG 2I6DA 3CC4A 3PO2H 5IP7G 3AQQA 4UP9A 4A93H 3G48A 4DV1L 1YZ6A 4B3TQ 4OWXB 2Y0SE 4IPGA 3I56A 1J6QA 4L5QA 4GNXB 4A3LG 1K9MC 4IOAA 2HHHL 1VQCA 4BY7H 4YQ8A 5M3MH 1JB7A 2HT1A 5FJ8H 3G4SA 2GVBA 4WJ4A 1NMFA 4AYBE 4OWWB 1L1OA 4R4IA 1C7YA 4LF5Q 5HY6A 3BBDA 1YHAA 1IL2A 4NB3A 1VQBA 1VQJA 4BBSG 3OTOL 4GN5A 3J81i 5C44H 3KJPA 1KHIA 3H3VH 4YVIA 2R7DA 2Z0SA 1TWHH 3UDXA 4LFAQ 2NVXH 3HKSA 3STBC 4GNXA 3S14H 1MXIA 4YPZA 2N8NA 4YCVA 4YY3L 5C3EG 4DPGA 1X3FA 2AWNA 1UEBA 3I4OA 1YITA 4GKJQ 1OXUA 4DV5Q 1YHQA 3NENA 5FLMG 2NN6I 4LF8Q 3I4NG 4LF9Q 4JI0Q 2UUCL 3K0XA 4DV7Q 3FKIG 2JA8H 1UAKA 4R4CA 4YWMA 1HR0Q 2Z6KC 2EQSA 1TXYA 2D0OA 2WB1G 3RN2A 3GD7A 3ER0A 2L15A 2WFWA 4DR1Q 4GKKL 2LXKA 2AHOB 4NPSA 5JJIA 4Y52H 5C4JH 4YQSA 4ME3A 4C3HH 4BBSH 2AKWB 2OQKA 3KF8B 4H02A 1SLJA 4YCWA 1GO3E 1JT8A 2NN6G 4YQTA 1UE1A 3CCMA 5GADC 4HIKA 1TWCH 2MO0A 3KDFB 2JA9A 2R93G 2EIFA 3OYYA 3ULLA 1XMQL 3HOWG 3U4VA 3B6YA 1I50H 2JA6H 1VQ5A 3KNUA 3QUVA 4YPWA 4LWCA 4LF4Q 3K7UC 1N33L 2B29A 1X6OA 1HZCA 4YQ4A 1I6HH 1PVOA 1QZHA 3J7ZC 3EBEA 4DV4Q 1VH0A 4JI5L 4JOIA 4A3GH 3NK6A 5GMBA 3HOXH 3PF4A 1VQNA 3U58A 3KDFA 1L2FA 4DK6C 4MNOA 4ALPA 2UUBQ 4XBOA 4B3SL 2H5XA 5JJLA 4OX9Q 4HJ5A 2EGWA 1B8AA 3L8UA 5M3FH 2VW9A 1N36L 1LM0A 4DV2L 3BBEA 1CKMA 4JI4L 1UAJA 5IYBH 1V2XA 1EWIA 3RZDH 1W2BA 1B70B 2OWOA 4WJ3M 3K81C 3PUVA 4XTCS 1IBLL 1XTDA 5LMUL 4JYAL 3RLNA 4HIMA 3RN5A 5GQOA 3T1HL 2E2HH 1SRUA 2NZHA 4YVHA 2MQHA 3CXCA 4KGNA 1N32L 4DV3Q 1LTLA 2ZM6L 2XTIA 4HIDA 3N4JA 1Q8KA 3CCUA 4DR4Q 1X56A 2IY5B 3DLLA 1PH6A 1VQ7A 3JAMc 1PH5A 2B3GA 2VUMG 1PH1A 1NY4A 4LFCL 2N49A 3T1YQ 5IP9H 2A1AA 3PV0A 2R7ZG 3HOZH 2CQOA 4QJFA 1TWFH 4A75A 2ATWA 1Q12A 1Y1WG 4JV5L 1VQDA 1O6DA 4LUZA 3M4QA 4DR6L 1N36Q 2JA5G 3I4MG 1OTCA 1IBMQ 4DV6Q 4JI4Q 2IX0A 1KAWA 1HNWQ 1WFQA 1IBLQ 1YBYA 3NBHB 5LMUQ 3O7BA 4L5SA 1V9PA 1XJVA 3KLWA 3ERSX 4C3JH 4X66Q 2ALYB 4JI1Q 4AQYQ 3HOYG 4DR5L 1N32Q 1PH8A 4YQCA 3H3VI 3PO2G 4IG6A 1SFOH 1FGUA 2QWVA 4KHPL 1P16A 4A93G 3CCRA 3KW2A 4JAKA 2E2JH 2IT1A 1J85A 3HKZG 1PH4A 1WYDA 3J80i 4BY7G 5M3MG 1D8LA 3GTGH 5FJ8G 2XGTA 1PA6A 4JC0A 3CCQA 1E22A 2OCEA 2EGVA 3M4PA 5AJ3Q 1Q86C 2I5HA 1WCMH 3CC2A 4DR6Q 5M5WH 4IOCA 1AH9A 1X7PA 1VQ8A 2CCZA 1YEZA 4KDZA 2N78A 4IO9A 4LFBL 2KENA 4FDBA 4O0AA 3TREA 4RMFA 5C44G 2QMMA 4J3CA 3G71A 4YPYA 4P73A 3A5UA 4DUZQ 1VQKA 3STBD 3S1RH 1N9WA 4LFAL 1EFWA 2VY3A 4UP7A 2YTYA 4QQBX 2FXQA 4GOPC 3PO3H 3AIAA 4JWHA 4X3MA 1UALA 4YQIA 4GKJL 2K4KA 4A3IH 5C4XH 4DV5L 4LF8L 4BXXH 1OXXK 2K52A 1KRSA 4LF9L 4JI0L 2JA8G 3BU2A 1VHYA 4JCVE 4YQ6A 4YHHL 4DV7L 4JI2L 3GTMH 2V3JA 1UE5A 4LF6Q 4JBMA 5GMCA 4YQBA 1HR0L 3ZJYC 3J7A5 2F4VQ 2JJQA 4DUYQ 3HKZE 1HNXQ 3TQYA 4R1JA 2I5MX 4DR1L 4LFBQ 4UP8A 1L1OC 3CCLA 4YQAA 4OWTB 4R4QA 1JMCA 5J3BA 5IYCH 3PUYA 1VQGA 3W5OA 1SR3A 1Q46A 1VQAA 1Z47A 3CCSA 1OY5A 1S72A 2Q2TA 5JJKA 2VQFQ 1VQ4A 1KXLA 4GNXC 1KD1C 3L7ZC 2IX1A 4H3ZA 3RLOA 5EAYA 4LF7Q 2JA6G 1NJIC 1NTGA 3KYHC 4IJLA 3EN2A 1GKHA 2KCMA 3KOJA 4JI2Q 4YHHQ 1BBWA 3H0GH 4LF4L 3CC7A 4HJ8A 1HNZQ 1E3PA 4A3GG 2E5LQ 3HOXG 2PI2E 1XPRA 2I5LX 2KBNA 3L0OA 4A3DG 4DV4L 4JWGA 4CNDA 1BBUA 1P9PA 3RZOH 2YV5A 2CWPA 3PSIA 4P75A 1VQFA 2ID0A 2UUBL 4R4TA 5M3FG 4OX9L 1XNQQ 2NVYH 4JI3Q 4QGUA 4JI6Q 3GTKH 5IYBG 3UDIA 2N3SA 2ZJRA 1U0LA 3AFPA 2I0QA 2MFIA 3I7FA 3W1BA 1NBWA 3AYHB 3D31A 4A3JH 1ASZA 1KL9A 3W1GA 5LMNW 4JALA 1QUQB 4YQPA 1WI5A 3OIIA 3UE1A 1E1TA 2IHFA 4OO1I 3E0EA 1G6PA 2RCNA 2VS1A 4YQQA 1S3OA 2PMZE 4DV3L 4NXNQ 1JJGA 4YQKA 2NVTH 5FAIA 4IPDA 3ULJA 1VQEA 1JE5A 4DR4L 1E24A 3CP0A 1XPUA 4YQJA 5K36G 4X65Q 5IP9G 3HOZG 1VQ9A 3PUZA 2Z0YA 4A3KH 4JOIC 2CX8A 3T1YL 1Q1BA 4A3BH 4NXMQ 1QUQA 4EQ5A 1Z9FA 2B63H 2UXBL 3MEFA 2WB1E 4K0KQ 4X62Q 4B3MQ 2YTXA 4MZ9A 1A62A 2K14A 3PUWA 4OO1G 1IBML 4DV6L 4BBRH 1HNWL 1K73C 2UU9L 3TS2A 2CFMA 3CD6A 3F2BA 1TWGH 2ZTDA 3RLFA 5C0XJ 1ASYA 1G51A 4DR3Q 4DKAC 3CCJA 1KRTA 4X66L 4AQYL 2Q2HA 4JI1L 1T9HA 3JC66 1XMOQ 1YJ9A 2JA7H 2HA8A 3CW2C 4YQRA 4TVAB 4P74A 4XIGS 4JI7Q 1X3GA 1N34L 2UUAQ 1UE7A 5C0XI 2E2IH 4YPXA 1LYLA 3TS0A 2D0PA 3AFQA 3D0FA 4P72A 5GAEC 4HJAA 1XNRL 4H3YA 4YQOA 3J81j 3S1MH 4A4IA 4A3MH 1K8GA 1WCMG 1XPOA 1GM5A 2Q2UA 1NS5A 2JEAI 4YQ3A 4JBJA 5AJ3L 3IRBA 2UXBQ 1RL2A 3K8AA 3GTPH 2PQAB 3LGJA 4BY1H 3PUXA 2UU9Q 2R6GA 1K83H 3KY7A 3NK7A 4MCCA 4JV5Q 2ZJPA 3BBHA 4OXPA 4DUZL 3AEVA 5C0XG 3CCVA 4QY7A 2GN5A 4JI8Q 3PO3G 4JG2A 3DCMX 4LUOA 5IYDH 4YQ9A 5LMNQ 4A3IG 1UWVA 1N34Q 4R4OA 1YI2A 5C4XG 4BXXG 2HIVA 1XNRQ 1KIXA 2PQAA 4CNFA 4IPHA 2BA1A 3L2PA 1NE3A 4POFA 3M9BA 5IWAL 4POGA 2R92H 1NXZA 3M3YH 3BJUA 1GZ0A 4C2MH 2YU9H 4LF6L 4B3RL 2F4VL 4DUYL 3ILKA 5CO4A 4CNEA 4GN3B 1VQLA 1HNXL 4YWKA 3GDEA 3S1NH 5IY0A 5IYCG 3E5YA 1A63A 3PIPA 5H1SE 2Y0SG 4A3FH 3GYQA 2KHIA 1V43A 2CWAA 1OXTA 1TWAH 2HQLA 2RHSB 3M7NA 3S2DH 2K5NA 2A19A 2VQFL 4QIWE 2OTLA 1VQOA 4IJHA 2UXDQ 1GVPA 5GAGC 1P8LA 3MXNB 2MNAA 3AI9X 4PZKA 3HFZB 4LF7L 4YQDA 2ZTCA 4DV0L 3OW2A 1IBKQ 3HOUH 2VZAA 3H0GG 5IWAQ 3E9IA 5BR8Q 2VQEQ 1PYSB 3KF6B 1VS0A 2DGYA 2WP8J 4B3RQ 4A76A 1HNZL 1A8VA 2E5LL 1FVIA 4A3EH 4YQ7A 3S16H 1EIFA 3S17H 1K3RA 1X3EA 4P71A 3M85A 1B7YB 2MO1A 1JJ2A 3N4KA 1J5EQ 4DR2Q 3GO5A 4AH6A 1XNQL 4JI3L 1I3QH 3EIVA 2HIXA 4KI0A 4JI6L 3GTLH 4IPCA 4YQ1A 1E7ZA 5E7NA 4A3JG 4A3CH 2AWOA 3KF6A 4JBWA 2UXCQ 1SROA 1MJCA 1X9NA 1HZBA 3CMEA 1I5FA 1H95A 3IEFA 4DV0Q 2K5VA 1D7QA 1FJGQ 5GAHC 3FHWA 1YVCA 4NXNL 1QZGA 1V1QA 1MJEA 1Y1VH 2BA0A 3UDFA 1R9TH 1QVFA 1AE2A 1YJWA 4MCBA 2OTJA 1PH2A 1PFSA 1VQ6A 1VHKA 1EQQA 4A3KG 3F8TA 4DAYB 1EUJA 1VQHA 2PI2A 4A3BG 1Y14B 4X65L 4GLVB 2JEBI 2NZOA 3JAMi 1Q7YC 2B63G 3H15A 4YVKA 4NXML 3E9HA 4BBRG 3K7AH 4HJ9A 4X62L 4K0KL 2GVAA 4B3ML 2O3AA 2A8VA 1GD7A 1QVGA 3HOVH 1MIUA 3J80c 1EQRA 1HJPA 4APVA 1V6ZA 4DV1Q 5IP7H 1SN8A 2JQOA 1X54A 1Q82C 1CSQA 1YHBA 2JA7G 3NEMA 4DR3L 3RNUA 2RF4A 1Q81C 2HHHQ 2Z6KA 1DGSA 1XMOL 4A3LH 3CQZH 1RIPA 4RG1A 2K5HA 5IE8A 4KHZA 3IC6A 3GTJH 2CKZB 4JWFA 1K0RA 4JI7L 1VCIA 2BH2A 2UUAL 5M5YH 2JK8A 3CPFA 1WJJA 3F1ZA 1U5KA 2QA4A 4A3MG 1CUKA 4L69A 3Q8DA 3OTOQ 4E8BA 4YQ0A 2E8GA 3A5ZB 4PZ8A 4A3DH 2RHQB 1PH7A 2Q2IA 1TO0A 4YQNA 4FAKA 4YY3Q 1S40A 4BY1G 4YVJA 1VQIA 3F2DA 3M4OH 4DAMA 4HJ7A 1PV4A 5C3EH 5JEAJ 2VL6A 4BA1I 2OQ0A 3CF5A 3OINA 1HH2P 4DK3C 1KQSA 1M1KC 2YYZA 4DR7L 1FL0A 4L5TA 3PGZA 2UUCQ 1SMXA 4MTNA 1A0IA 1UE6A 5IYDG 1BVSA 1Q1EA 5FLMH 3I4NH 4JI8L 1ZJRA 4CNGA 1OXSC 1VQPA 3FKIH 4PZ7A 4X6AH 3A74A 5LMNL 2K75A 4GKKQ 2F3IA 3UE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R92 G;  4L5R C;  4C3I H;  3J81 c;  2C35 B;  3CAM A;  2K50 A;  2WAQ G;  3I2Z A;  1QVC A;  3KJO A;  2ASB A;  2VNU D;  2QEX A;  3ULP A;  2F52 A;  4O2D A;  1C9O A;  1EOV A;  1PYB A;  1X55 A;  3K80 C;  4MCD A;  4YQ5 A;  3CMA A;  4UY8 C;  4X3L A;  4DNI A;  1JJC B;  1K8A C;  3SGI A;  1HZA A;  1IZ6 A;  1XMQ Q;  1YNX A;  3PIO A;  3G6E A;  4PG3 A;  4YCU A;  2V1C C;  4QL5 A;  4A3F G;  1BKB A;  5ELN A;  2KHJ A;  5JEA G;  2R93 H;  1AE3 A;  2EXD A;  3HOW H;  1WOC A;  2AMC B;  3PCO B;  4DR7 Q;  1N33 Q;  1KC8 C;  1OXV A;  2ZTE A;  5ELO A;  4LUV A;  4YQL A;  4GLA C;  4HIO A;  3CCE A;  1CKO A;  1M90 C;  1IXR A;  1L0W A;  4JI5 Q;  1SE8 A;  5DLQ E;  1G29 1;  3WWV A;  3HOU G;  2UXD L;  4AIM A;  1X65 A;  3DM3 A;  4YWL A;  1IBK L;  3VDY A;  1O7I A;  1YJN A;  1EIY B;  4EX5 A;  4B3S Q;  5GRO A;  1PHJ A;  4LNQ A;  5BR8 L;  2VQE L;  4YQ2 A;  1N8R C;  4GLX A;  1NMG A;  3I55 A;  4A3E G;  4DV2 Q;  4BA2 I;  3GTO H;  3BZK A;  1C0A A;  3FP9 A;  5M5X H;  4X64 L;  3PF5 A;  2JE6 I;  4OON A;  3TRZ A;  1PH9 A;  2NVQ H;  4JYA Q;  2WAQ E;  3T1H Q;  1UAM A;  1EYG A;  1VQM A;  1MKH A;  4YVG A;  3UDG A;  1J5E L;  4DR2 L;  4LW1 A;  2PNH A;  3NEL A;  1HZ9 A;  4GS3 A;  1X7O A;  4A3C G;  4TQU S;  5HGQ A;  4IFD J;  3CPW A;  1IPA A;  2ZM6 Q;  3TEH B;  1I94 L;  1LUZ A;  2QGQ A;  3KFU A;  1PH3 A;  2LSS A;  1HR0 W;  2UXC L;  3OIJ A;  1IYJ B;  1CSP A;  4AYB G;  4B3T L;  3ONP A;  4LFC Q;  4IFD I;  1Y1V G;  2BH8 A;  4GOP B;  1FJG L;  2VUM H;  5D9F A;  1E1O A;  2YY8 A;  1CKN B;  2ES2 A;  2LXJ A;  2KCT A;  2IHE A;  2R7Z H;  3S1Q H;  5GM8 A;  4YQG A;  2D62 A;  4UPA A;  2YTV A;  3U4Z A;  1Y1W H;  2ZJQ A;  3RR5 A;  4PZ6 A;  1YIJ A;  4Y7N H;  3GTQ H;  2JA5 H;  4X64 Q;  4LF5 L;  3I4M H;  5IT9 c;  2DUD A;  3KTY A;  3BZC A;  4PMW A;  4J15 A;  1W3S A;  2R7F A;  3AXZ A;  3U50 C;  3F2C A;  3S15 H;  3S2H H;  4DR5 Q;  5FLX c;  2V3K A;  3S24 A;  1Z85 A;  3HOV G;  1L1O B;  4GOP A;  3HOY H;  4KHP Q;  4KLK A;  4GN4 B;  1CKN A;  1I94 Q;  4JBK A;  3A0J A;  3ICE A;  4IFD G;  2I6D A;  3CC4 A;  3PO2 H;  5IP7 G;  3AQQ A;  4UP9 A;  4A93 H;  3G48 A;  4DV1 L;  1YZ6 A;  4B3T Q;  4OWX B;  2Y0S E;  4IPG A;  3I56 A;  1J6Q A;  4L5Q A;  4GNX B;  4A3L G;  1K9M C;  4IOA A;  2HHH L;  1VQC A;  4BY7 H;  4YQ8 A;  5M3M H;  1JB7 A;  2HT1 A;  5FJ8 H;  3G4S A;  2GVB A;  4WJ4 A;  1NMF A;  4AYB E;  4OWW B;  1L1O A;  4R4I A;  1C7Y A;  4LF5 Q;  5HY6 A;  3BBD A;  1YHA A;  1IL2 A;  4NB3 A;  1VQB A;  1VQJ A;  4BBS G;  3OTO L;  4GN5 A;  3J81 i;  5C44 H;  3KJP A;  1KHI A;  3H3V H;  2R7D A;  2Z0S A;  1TWH H;  3UDX A;  4LFA Q;  2NVX H;  3HKS A;  3STB C;  4GNX A;  3S14 H;  1MXI A;  4YPZ A;  2N8N A;  4YCV A;  4YY3 L;  5C3E G;  4DPG A;  1X3F A;  2AWN A;  1UEB A;  3I4O A;  1YIT A;  4GKJ Q;  1OXU A;  4DV5 Q;  1YHQ A;  3NEN A;  5FLM G;  2NN6 I;  4LF8 Q;  3I4N G;  4LF9 Q;  4JI0 Q;  2UUC L;  3K0X A;  4DV7 Q;  3FKI G;  2JA8 H;  1UAK A;  4R4C A;  4YWM A;  1HR0 Q;  2Z6K C;  2EQS A;  1TXY A;  2D0O A;  2WB1 G;  3RN2 A;  3GD7 A;  3ER0 A;  2L15 A;  2WFW A;  4DR1 Q;  4GKK L;  2LXK A;  2AHO B;  4NPS A;  5JJI A;  4Y52 H;  5C4J H;  4YQS A;  4ME3 A;  4C3H H;  4BBS H;  2AKW B;  2OQK A;  3KF8 B;  4H02 A;  1SLJ A;  4YCW A;  1GO3 E;  1JT8 A;  2NN6 G;  4YQT A;  1UE1 A;  3CCM A;  5GAD C;  4HIK A;  1TWC H;  2MO0 A;  3KDF B;  2JA9 A;  2R93 G;  2EIF A;  3OYY A;  3ULL A;  1XMQ L;  3HOW G;  3U4V A;  3B6Y A;  1I50 H;  2JA6 H;  1VQ5 A;  3KNU A;  3QUV A;  4YPW A;  4LWC A;  4LF4 Q;  3K7U C;  1N33 L;  2B29 A;  1X6O A;  1HZC A;  4YQ4 A;  1I6H H;  1PVO A;  1QZH A;  3J7Z C;  3EBE A;  4DV4 Q;  1VH0 A;  4JI5 L;  4JOI A;  4A3G H;  3NK6 A;  5GMB A;  3HOX H;  3PF4 A;  1VQN A;  3U58 A;  3KDF A;  1L2F A;  4DK6 C;  4MNO A;  4ALP A;  2UUB Q;  4XBO A;  4B3S L;  2H5X A;  5JJL A;  4OX9 Q;  4HJ5 A;  2EGW A;  1B8A A;  3L8U A;  5M3F H;  2VW9 A;  1N36 L;  1LM0 A;  4DV2 L;  3BBE A;  1CKM A;  4JI4 L;  1UAJ A;  5IYB H;  1V2X A;  1EWI A;  3RZD H;  1W2B A;  1B70 B;  2OWO A;  4WJ3 M;  3K81 C;  3PUV A;  4XTC S;  1IBL L;  1XTD A;  5LMU L;  4JYA L;  3RLN A;  4HIM A;  3RN5 A;  5GQO A;  3T1H L;  2E2H H;  1SRU A;  2NZH A;  4YVH A;  2MQH A;  3CXC A;  4KGN A;  1N32 L;  4DV3 Q;  1LTL A;  2ZM6 L;  2XTI A;  4HID A;  3N4J A;  1Q8K A;  3CCU A;  4DR4 Q;  1X56 A;  2IY5 B;  3DLL A;  1PH6 A;  1VQ7 A;  3JAM c;  1PH5 A;  2B3G A;  2VUM G;  1PH1 A;  1NY4 A;  4LFC L;  2N49 A;  3T1Y Q;  5IP9 H;  2A1A A;  3PV0 A;  2R7Z G;  3HOZ H;  2CQO A;  4QJF A;  1TWF H;  4A75 A;  2ATW A;  1Q12 A;  1Y1W G;  4JV5 L;  1VQD A;  1O6D A;  4LUZ A;  3M4Q A;  4DR6 L;  1N36 Q;  2JA5 G;  3I4M G;  1OTC A;  1IBM Q;  4DV6 Q;  4JI4 Q;  2IX0 A;  1KAW A;  1HNW Q;  1WFQ A;  1IBL Q;  1YBY A;  3NBH B;  5LMU Q;  3O7B A;  4L5S A;  1V9P A;  1XJV A;  3KLW A;  3ERS X;  4C3J H;  4X66 Q;  2ALY B;  4JI1 Q;  4AQY Q;  3HOY G;  4DR5 L;  1N32 Q;  1PH8 A;  4YQC A;  3H3V I;  3PO2 G;  4IG6 A;  1SFO H;  1FGU A;  2QWV A;  4KHP L;  1P16 A;  4A93 G;  3CCR A;  3KW2 A;  4JAK A;  2E2J H;  2IT1 A;  1J85 A;  3HKZ G;  1PH4 A;  1WYD A;  3J80 i;  4BY7 G;  5M3M G;  1D8L A;  3GTG H;  5FJ8 G;  2XGT A;  1PA6 A;  4JC0 A;  3CCQ A;  1E22 A;  2OCE A;  2EGV A;  3M4P A;  5AJ3 Q;  1Q86 C;  2I5H A;  1WCM H;  3CC2 A;  4DR6 Q;  5M5W H;  4IOC A;  1AH9 A;  1X7P A;  1VQ8 A;  2CCZ A;  1YEZ A;  4KDZ A;  2N78 A;  4IO9 A;  4LFB L;  2KEN A;  4FDB A;  4O0A A;  3TRE A;  4RMF A;  5C44 G;  2QMM A;  4J3C A;  3G71 A;  4YPY A;  4P73 A;  3A5U A;  4DUZ Q;  1VQK A;  3STB D;  3S1R H;  1N9W A;  4LFA L;  1EFW A;  2VY3 A;  4UP7 A;  2YTY A;  4QQB X;  2FXQ A;  4GOP C;  3PO3 H;  3AIA A;  4X3M A;  1UAL A;  4YQI A;  4GKJ L;  2K4K A;  4A3I H;  5C4X H;  4DV5 L;  4LF8 L;  4BXX H;  1OXX K;  2K52 A;  1KRS A;  4LF9 L;  4JI0 L;  2JA8 G;  3BU2 A;  1VHY A;  4JCV E;  4YQ6 A;  4YHH L;  4DV7 L;  4JI2 L;  3GTM H;  2V3J A;  1UE5 A;  4LF6 Q;  4JBM A;  5GMC A;  4YQB A;  1HR0 L;  3ZJY C;  3J7A 5;  2F4V Q;  2JJQ A;  4DUY Q;  3HKZ E;  1HNX Q;  3TQY A;  4R1J A;  2I5M X;  4DR1 L;  4LFB Q;  4UP8 A;  1L1O C;  3CCL A;  4YQA A;  4OWT B;  4R4Q A;  1JMC A;  5J3B A;  5IYC H;  3PUY A;  1VQG A;  3W5O A;  1SR3 A;  1Q46 A;  1VQA A;  1Z47 A;  3CCS A;  1OY5 A;  1S72 A;  2Q2T A;  5JJK A;  2VQF Q;  1VQ4 A;  1KXL A;  4GNX C;  1KD1 C;  3L7Z C;  2IX1 A;  4H3Z A;  3RLO A;  5EAY A;  4LF7 Q;  2JA6 G;  1NJI C;  1NTG A;  3KYH C;  4IJL A;  3EN2 A;  1GKH A;  2KCM A;  3KOJ A;  4JI2 Q;  4YHH Q;  1BBW A;  3H0G H;  4LF4 L;  3CC7 A;  4HJ8 A;  1HNZ Q;  1E3P A;  4A3G G;  2E5L Q;  3HOX G;  2PI2 E;  1XPR A;  2I5L X;  2KBN A;  3L0O A;  4A3D G;  4DV4 L;  4CND A;  4YVI A;  1BBU A;  1P9P A;  3RZO H;  2YV5 A;  2CWP A;  3PSI A;  4P75 A;  1VQF A;  2ID0 A;  2UUB L;  4R4T A;  5M3F G;  4OX9 L;  1XNQ Q;  2NVY H;  4JI3 Q;  4QGU A;  4JI6 Q;  3GTK H;  5IYB G;  3UDI A;  2N3S A;  2ZJR A;  1U0L A;  3AFP A;  2I0Q A;  2MFI A;  3I7F A;  3W1B A;  1NBW A;  3AYH B;  3D31 A;  4A3J H;  1ASZ A;  1KL9 A;  3W1G A;  5LMN W;  4JAL A;  1QUQ B;  4YQP A;  1WI5 A;  3OII A;  3UE1 A;  1E1T A;  2IHF A;  4OO1 I;  3E0E A;  1G6P A;  2RCN A;  2VS1 A;  4YQQ A;  1S3O A;  2PMZ E;  4DV3 L;  4NXN Q;  1JJG A;  4YQK A;  2NVT H;  5FAI A;  4IPD A;  3ULJ A;  1VQE A;  1JE5 A;  4DR4 L;  1E24 A;  3CP0 A;  1XPU A;  4YQJ A;  5K36 G;  4X65 Q;  5IP9 G;  3HOZ G;  1VQ9 A;  3PUZ A;  2Z0Y A;  4A3K H;  4JOI C;  2CX8 A;  3T1Y L;  1Q1B A;  4A3B H;  4NXM Q;  1QUQ A;  4EQ5 A;  1Z9F A;  2B63 H;  2UXB L;  3MEF A;  2WB1 E;  4K0K Q;  4X62 Q;  4B3M Q;  2YTX A;  4MZ9 A;  1A62 A;  2K14 A;  3PUW A;  4OO1 G;  1IBM L;  4DV6 L;  4BBR H;  1HNW L;  1K73 C;  2UU9 L;  3TS2 A;  2CFM A;  3CD6 A;  3F2B A;  1TWG H;  2ZTD A;  3RLF A;  5C0X J;  1ASY A;  1G51 A;  4DR3 Q;  4DKA C;  3CCJ A;  1KRT A;  4X66 L;  4AQY L;  2Q2H A;  4JI1 L;  1T9H A;  3JC6 6;  1XMO Q;  1YJ9 A;  2JA7 H;  2HA8 A;  3CW2 C;  4YQR A;  4TVA B;  4P74 A;  4XIG S;  4JI7 Q;  1X3G A;  1N34 L;  2UUA Q;  1UE7 A;  5C0X I;  2E2I H;  4YPX A;  1LYL A;  3TS0 A;  2D0P A;  3AFQ A;  3D0F A;  4P72 A;  5GAE C;  4HJA A;  1XNR L;  4H3Y A;  4YQO A;  3J81 j;  3S1M H;  4A4I A;  4A3M H;  1K8G A;  1WCM G;  1XPO A;  1GM5 A;  2Q2U A;  1NS5 A;  2JEA I;  4YQ3 A;  4JBJ A;  5AJ3 L;  3IRB A;  2UXB Q;  1RL2 A;  3K8A A;  3GTP H;  2PQA B;  3LGJ A;  4BY1 H;  3PUX A;  2UU9 Q;  2R6G A;  1K83 H;  3KY7 A;  3NK7 A;  4MCC A;  4JV5 Q;  2ZJP A;  3BBH A;  4OXP A;  4DUZ L;  3AEV A;  5C0X G;  3CCV A;  4QY7 A;  2GN5 A;  4JI8 Q;  3PO3 G;  4JG2 A;  3DCM X;  4LUO A;  5IYD H;  4YQ9 A;  5LMN Q;  4A3I G;  1UWV A;  1N34 Q;  4R4O A;  1YI2 A;  5C4X G;  4BXX G;  2HIV A;  1XNR Q;  1KIX A;  2PQA A;  4CNF A;  4IPH A;  2BA1 A;  3L2P A;  1NE3 A;  4POF A;  3M9B A;  5IWA L;  4POG A;  2R92 H;  1NXZ A;  3M3Y H;  3BJU A;  1GZ0 A;  4C2M H;  2YU9 H;  4LF6 L;  4B3R L;  2F4V L;  4DUY L;  3ILK A;  5CO4 A;  4CNE A;  4GN3 B;  1VQL A;  1HNX L;  4YWK A;  3GDE A;  3S1N H;  5IY0 A;  5IYC G;  3E5Y A;  1A63 A;  3PIP A;  5H1S E;  2Y0S G;  4A3F H;  3GYQ A;  2KHI A;  1V43 A;  2CWA A;  1OXT A;  1TWA H;  2HQL A;  2RHS B;  3M7N A;  3S2D H;  2K5N A;  2A19 A;  2VQF L;  4QIW E;  2OTL A;  1VQO A;  4IJH A;  2UXD Q;  1GVP A;  5GAG C;  1P8L A;  3MXN B;  2MNA A;  3AI9 X;  4PZK A;  3HFZ B;  4LF7 L;  4YQD A;  2ZTC A;  4DV0 L;  3OW2 A;  1IBK Q;  3HOU H;  2VZA A;  3H0G G;  5IWA Q;  3E9I A;  5BR8 Q;  2VQE Q;  1PYS B;  3KF6 B;  1VS0 A;  2DGY A;  2WP8 J;  4B3R Q;  4A76 A;  1HNZ L;  1A8V A;  2E5L L;  1FVI A;  4A3E H;  4YQ7 A;  3S16 H;  1EIF A;  3S17 H;  1K3R A;  1X3E A;  4P71 A;  3M85 A;  1B7Y B;  2MO1 A;  1JJ2 A;  3N4K A;  1J5E Q;  4DR2 Q;  3GO5 A;  4AH6 A;  1XNQ L;  4JI3 L;  1I3Q H;  3EIV A;  2HIX A;  4KI0 A;  4JI6 L;  3GTL H;  4IPC A;  4YQ1 A;  1E7Z A;  5E7N A;  4A3J G;  4A3C H;  2AWO A;  3KF6 A;  4JBW A;  2UXC Q;  1SRO A;  1MJC A;  1X9N A;  1HZB A;  3CME A;  1I5F A;  1H95 A;  3IEF A;  4DV0 Q;  2K5V A;  1D7Q A;  1FJG Q;  5GAH C;  3FHW A;  1YVC A;  4NXN L;  1QZG A;  1V1Q A;  1MJE A;  1Y1V H;  2BA0 A;  3UDF A;  1R9T H;  1QVF A;  1AE2 A;  1YJW A;  4MCB A;  2OTJ A;  1PH2 A;  1PFS A;  1VQ6 A;  1VHK A;  1EQQ A;  4A3K G;  3F8T A;  4DAY B;  1EUJ A;  1VQH A;  2PI2 A;  4A3B G;  1Y14 B;  4X65 L;  4GLV B;  2JEB I;  2NZO A;  3JAM i;  1Q7Y C;  2B63 G;  3H15 A;  4YVK A;  4NXM L;  3E9H A;  4BBR G;  3K7A H;  4HJ9 A;  4X62 L;  4K0K L;  2GVA A;  4B3M L;  2O3A A;  2A8V A;  1GD7 A;  1QVG A;  3HOV H;  1MIU A;  3J80 c;  1EQR A;  1HJP A;  4APV A;  1V6Z A;  4DV1 Q;  5IP7 H;  1SN8 A;  2JQO A;  1X54 A;  1Q82 C;  1CSQ A;  1YHB A;  2JA7 G;  3NEM A;  4DR3 L;  3RNU A;  2RF4 A;  1Q81 C;  2HHH Q;  2Z6K A;  1DGS A;  1XMO L;  4A3L H;  3CQZ H;  1RIP A;  4RG1 A;  2K5H A;  5IE8 A;  4KHZ A;  3IC6 A;  3GTJ H;  2CKZ B;  1K0R A;  4JI7 L;  1VCI A;  2BH2 A;  2UUA L;  5M5Y H;  2JK8 A;  3CPF A;  1WJJ A;  3F1Z A;  1U5K A;  2QA4 A;  4A3M G;  1CUK A;  4L69 A;  3Q8D A;  3OTO Q;  4E8B A;  4YQ0 A;  2E8G A;  3A5Z B;  4PZ8 A;  4A3D H;  2RHQ B;  1PH7 A;  2Q2I A;  1TO0 A;  4YQN A;  4FAK A;  4YY3 Q;  1S40 A;  4BY1 G;  4YVJ A;  1VQI A;  3F2D A;  3M4O H;  4DAM A;  4HJ7 A;  1PV4 A;  5C3E H;  5JEA J;  2VL6 A;  4BA1 I;  2OQ0 A;  3CF5 A;  3OIN A;  1HH2 P;  4DK3 C;  1KQS A;  1M1K C;  2YYZ A;  4DR7 L;  1FL0 A;  4L5T A;  3PGZ A;  2UUC Q;  1SMX A;  4MTN A;  1A0I A;  1UE6 A;  5IYD G;  1BVS A;  1Q1E A;  5FLM H;  3I4N H;  4JI8 L;  1ZJR A;  4CNG A;  1OXS C;  1VQP A;  3FKI H;  4PZ7 A;  4X6A H;  3A74 A;  5LMN L;  2K75 A;  4GKK Q;  2F3I A;  3UE0 A; 
#chains in the Genus database with same CATH topology
 3I2Z A;  2K50 A;  4BY1 B;  3NHH A;  1PYB A;  3K80 C;  1HUM A;  4UY8 C;  5IGE A;  1Y69 U;  1B2T A;  2NN6 H;  1IZ6 A;  1EY4 A;  4YCU A;  2V1C C;  1KDA A;  2B2W C;  2EXD A;  3VYS A;  3HOW H;  2A69 D;  1KC8 C;  2ZTE A;  4TRD A;  3CCE A;  1CKO A;  1UAP A;  4X3S A;  3EVQ A;  5DLQ E;  3WWV A;  2UXD L;  4AIM A;  3DM3 A;  1O7I A;  2VQE L;  3GV3 A;  4GLX A;  1NMG A;  5CC4 A;  2AUJ D;  4A3E G;  4DV2 Q;  4BA2 I;  1K8M A;  3FP9 A;  2NVQ H;  1UAM A;  2WAQ E;  3T1H Q;  3UDG A;  4ZYS A;  3MC0 B;  5JAV A;  1X7O A;  1BXT A;  4ZUJ A;  5FO9 B;  3KFU A;  3J80 L;  1TS5 A;  3AU7 A;  2HDM A;  4IUP A;  4B3T L;  3ONP A;  3N6R A;  4IFD I;  1Y1V G;  1LLR D;  2VUM H;  4U67 3;  2OXP A;  2XIW A;  1STN A;  4PV1 C;  2IHE A;  2D62 A;  1JOR A;  4FNF A;  4JK1 C;  4PZ6 A;  1YIJ A;  1QNK A;  4EQN A;  3I4M H;  3GV6 A;  1W3S A;  1LTA D;  1W6K A;  2L12 A;  4DR5 Q;  3FVQ A;  3HOV G;  3HOY H;  2C9O A;  4KLK A;  5CBE E;  2I6D A;  3K59 A;  4UP9 A;  1DOK A;  1YZ6 A;  2Y0S E;  3VR5 A;  2FMM A;  4IPG A;  5IIF A;  4GNX B;  4KD4 A;  1O7L A;  2HHH L;  4YQ8 A;  1ET9 A;  1JB7 A;  1BCP B;  3RZO B;  5C3X A;  1WTX A;  3BVZ A;  4AYB E;  1CM9 A;  4EQO A;  3GTK B;  1E2W A;  1LT6 D;  1YHA A;  2EOT A;  4M1U B;  1IYU A;  1JWU D;  2E75 C;  1ZYR C;  1TWH H;  1BR9 A;  4YCV A;  5G3L D;  2EYJ A;  1EWH A;  2AWN A;  4JVZ A;  4KK7 A;  1KNA A;  1OXU A;  1YHQ A;  3NEN A;  2NN6 I;  1U9R A;  4LF9 Q;  4DAY A;  4JI0 Q;  4DV7 Q;  2F0K A;  5D3I B;  2JA8 H;  2EJM A;  2Z6K C;  4PMB A;  1H9K A;  1GOZ A;  4DR1 Q;  2ZXP A;  4BBR B;  5C3W A;  3H6M A;  2J0T D;  4H02 A;  1SLJ A;  5J1Z A;  2J4X A;  5GAD C;  2CHB D;  3KDF B;  2EIF A;  3OYY A;  4HSV A;  3ULL A;  1XMQ L;  2LY7 A;  5KRU A;  1Q8I A;  1ENC A;  1LT5 D;  1VQ5 A;  2KVM A;  4LWC A;  4FF4 A;  1N33 L;  1X6O A;  1KAB A;  1HZC A;  5D3D A;  4A3M B;  4KJN A;  3KF8 A;  4DV4 Q;  1VH0 A;  1Y8N B;  4JI5 L;  4JOI A;  4A3G H;  3PF4 A;  4A3D H;  2Z6B A;  2UUB Q;  4RGN A;  1A3T A;  4OX9 Q;  1SSO A;  3QOL A;  2OF1 A;  2EY5 A;  1L0Y B;  3L8U A;  3HOW B;  1CKM A;  3I8Z A;  4JI4 L;  5IYB H;  1UAJ A;  5IT9 L;  1S5B D;  2OWO A;  5TSS A;  3PUV A;  5LMU L;  3RLN A;  3RN5 A;  1STY A;  4HTH A;  1CTM A;  1VDZ A;  3TP8 A;  4Q5V A;  1G2T A;  1EL0 A;  2ZM6 L;  2XTI A;  3D4R A;  3CCU A;  4DR4 Q;  3DLL A;  1A15 A;  4XDX A;  2B3G A;  3JAM c;  2EDG A;  2F0U A;  2DY7 A;  4B9X A;  1NY4 A;  1LO5 D;  2A1A A;  2R7Z G;  3VA5 A;  3JAM E;  4ZK9 B;  5C4H A;  1Y1W G;  3NTK A;  2JA5 G;  3ERO A;  2SOB A;  1HNW Q;  2TMP A;  1TII D;  4OO1 H;  1EEI D;  4X3U A;  5CBA E;  1YBY A;  1IBL Q;  4C3J H;  2MP1 A;  4NKL A;  4JI1 Q;  2A68 C;  2O5I C;  1D5M C;  4IG6 A;  1SFO H;  1P16 A;  4A93 G;  4JAK A;  2L11 A;  3DEP A;  3OOC A;  1PH4 A;  1W6J A;  3J80 i;  4BY7 G;  1D8L A;  2SEB D;  2B8F A;  5FJ8 G;  2XGT A;  3DM1 A;  3M4P A;  3H91 A;  4CKB A;  1AH9 A;  2BCO A;  4LK1 C;  4L63 B;  3D6W A;  4IO9 A;  4LFB L;  4N9P A;  3HOY B;  2PCF B;  4J3C A;  2SNS A;  4F8M A;  1T5E A;  3STB D;  2L0C A;  3HKZ B;  4GOP C;  2F4I A;  3D4D A;  2CVR A;  4GKJ L;  1BNZ A;  4A3I H;  2F0D A;  3IFD A;  4KY6 A;  1OXX K;  3KK7 A;  4YQ6 A;  1NNX A;  4LF6 Q;  2KEC A;  2N88 A;  1TWH B;  1HNX Q;  5JJZ A;  1L1O C;  1XX8 A;  3QIA A;  4OWT B;  4C3H G;  5IYC H;  3PUY A;  1UEA B;  3W5O A;  1I4G A;  1Q46 A;  1VQA A;  3CCS A;  2B2U A;  1CHQ D;  3TZD A;  2PYK A;  1S72 A;  2VQF Q;  1VQ4 A;  1KD1 C;  4I65 A;  5FOB B;  4XT3 B;  3G6J B;  5BN3 A;  5DEH A;  4IJL A;  4YHH Q;  2FJ2 A;  3CC7 A;  5EJW A;  1JOQ A;  1HNZ Q;  1AZQ A;  4YVI A;  3BVG A;  5FO8 B;  1P9P A;  2CWP A;  3PSI A;  3NBI A;  5C3E B;  3MFG A;  5E4X A;  1U0L A;  3I7F A;  1RD9 D;  5K5P A;  4QF4 A;  1SNQ A;  3W1G A;  4JAL A;  3K57 A;  1B9M A;  4OO1 I;  3E0E A;  1G6P A;  2VS1 A;  2NVT H;  1PZK D;  5FAI A;  4YQJ A;  2PZW A;  2RDF A;  4X65 Q;  5IP9 G;  2PPB C;  1RTN A;  2M2L A;  3PUZ A;  1VQ9 A;  3T1Y L;  1Q1B A;  3HEJ A;  4A3B H;  4NXM Q;  2B63 H;  2A6E C;  5AFW A;  4MZ9 A;  1A62 A;  1IBM L;  4DV6 L;  3GQB A;  1PXU A;  4CGY B;  2UU9 L;  3TS2 A;  2XSC A;  2CFM A;  1SDF A;  2DJF C;  1EEF D;  1TWG H;  1WTR A;  2ZTD A;  1G51 A;  2KJX A;  3ONA B;  3JC6 6;  1KDC A;  2HA8 A;  2K5D A;  4TVA B;  4XIG S;  1PZJ D;  4YPX A;  2O5J C;  3TS0 A;  4HJA A;  3DWQ A;  3J81 j;  4A4I A;  5IGB A;  1K8G A;  1XPO A;  2Q2U A;  3D6C A;  2JEA I;  1F2Z A;  1V1O A;  3GTP H;  3LGJ A;  3QOJ A;  2H4O A;  1K83 H;  5DAU A;  3V05 A;  4OXP A;  4TSS A;  1WTW A;  3S9W A;  1STE A;  2GN5 A;  4JI8 Q;  3I4L A;  3TP5 A;  4JG2 A;  1PRT D;  4ID6 A;  5I9O A;  4YQ9 A;  5C4X G;  2JN4 A;  5FK9 C;  3S1Q B;  4LAA A;  4RWS C;  1NE3 A;  5IWA L;  1B44 D;  1SE2 A;  3GTQ B;  3BJU A;  3R2T A;  3QO2 A;  1A3U A;  4K2K A;  4H7B A;  4C1N I;  3ILK A;  3HS0 C;  5CO4 A;  4GN3 B;  3DXJ C;  4YWK A;  3GDE A;  1H9S A;  1SJE D;  1A63 A;  2B39 A;  2M00 A;  3GYQ A;  5JEA H;  4FO2 A;  4H44 C;  3A8J E;  4QIW E;  4G7Z C;  1GVP A;  5GAG C;  3MXN B;  4PZK A;  4NMZ A;  4PMC A;  3OW2 A;  3HOU H;  1NR2 A;  5BR8 Q;  2EYO A;  4B3R Q;  1EQV A;  2JXM B;  1A8V A;  3MA2 B;  1EIF A;  4ABN A;  1K3R A;  1X3E A;  1F9P A;  5M9O A;  1B7Y B;  2MO1 A;  3HP3 A;  1J5E Q;  1WTV A;  3N4K A;  1LTB D;  1GUG A;  1CT1 D;  3MXP A;  5E7N A;  4A3C H;  2TSS A;  4KTA A;  2UXC Q;  1MJC A;  1X9N A;  1H95 A;  2B2T C;  1QIL A;  4DV0 Q;  1FJG Q;  1WTP A;  4ZKB B;  1IHZ A;  1QNU A;  5JPM C;  1QVF A;  1R9T H;  2MPM A;  4MN3 A;  2OTJ A;  2Z8L A;  1VQ6 A;  1OO9 B;  3F8T A;  2PI2 A;  4GLV B;  4YVK A;  5KNC A;  1VF5 C;  4BBR G;  5KND A;  3K7A H;  4DK1 A;  2B8G A;  2GVA A;  3OWF A;  2NWG A;  2JA6 B;  2O2L D;  1PDQ A;  2FHT A;  1SN8 A;  2K7V A;  1CSQ A;  2JA7 G;  3IKJ A;  5EGT A;  1BDO A;  1YNJ D;  2RF4 A;  1DGS A;  3CQZ H;  3T56 B;  2Q8R E;  4LMQ D;  1K0R A;  2BH2 A;  1TY2 A;  5M3F B;  4A3M G;  4KY5 A;  3F1Z A;  2QA4 A;  1B9N A;  3NSW A;  2K32 A;  2KA7 A;  3E5S A;  4YY3 Q;  3DWP A;  1VQI A;  3I70 A;  2BDN A;  3QJY A;  3CF5 A;  3SK5 A;  5I6W A;  4WFN 3;  5EBC A;  1KQS A;  2YYZ A;  1ENA A;  2UUC Q;  3I4N H;  2ICE C;  1BVS A;  1M4V A;  1ZJR A;  1VQP A;  3EFX D;  3FKI H;  4DNR B;  4PZ7 A;  4MTK A;  3A74 A;  1MD2 D;  1SNC A;  4EGV A;  5LMN L;  3NQT A;  1XWE A;  2KOL A;  4L5R C;  4C3I H;  3KJO A;  3GTP B;  2WAQ G;  3TSS A;  2VNU D;  3ULP A;  1C9O A;  1KAA A;  1K83 B;  1HTP A;  3CMA A;  4X3L A;  4DNI A;  1E0B A;  1STB A;  3PIO A;  3G6E A;  4QL5 A;  2R93 H;  2KED A;  4I7Z C;  1AE3 A;  1WOC A;  2AMC B;  2EYF A;  5ELF A;  1K8O A;  4CJ1 B;  1OXV A;  1V8Q A;  3OMG A;  1PFM A;  1M90 C;  5A35 A;  1IXR A;  1JOO A;  1G29 1;  4IUU A;  4YWL A;  3KLR A;  1IBK L;  3VDY A;  4B3S Q;  3MEH A;  1YJN A;  4YVH A;  1PHJ A;  1N8R C;  4HMI A;  5CV4 A;  2F0S A;  4RAU C;  3C3L A;  2PW7 A;  5M5X H;  4JYA Q;  1PH9 A;  3NQI A;  1VQM A;  1MKH A;  3PO3 B;  4LW1 A;  4TQU S;  3HOU B;  1LUZ A;  2LSS A;  1HR0 W;  3OIJ A;  1CQV A;  1IYJ B;  4AYB G;  3GTM B;  2F0W A;  3MVV A;  4OIK A;  1EIH A;  3W3A A;  2BH8 A;  4GOP B;  4PNY A;  1E1O A;  1CKN B;  3MTS A;  2RBM A;  3E3X A;  5GM8 A;  4YQG A;  2B2V C;  3Q22 A;  3RR5 A;  4Y7N H;  4ILW A;  4X64 Q;  4J15 A;  5IOD A;  5I4D A;  3R2I A;  4QCL A;  4DA2 A;  4DXF A;  3S24 A;  2V3K A;  4XT1 B;  1L1O B;  4QUF A;  4JBK A;  3A0J A;  3CC4 A;  3PO2 H;  3OIQ A;  3RMH A;  3T16 A;  1FD7 D;  4OWX B;  3I56 A;  1O78 A;  5E4W C;  5M3M H;  2HT1 A;  3G4S A;  2GVB A;  4WJ4 A;  1NMF A;  4R4I A;  3Q0A A;  2ICI A;  4LF5 Q;  3K7A B;  3BBD A;  1KDB A;  1VQB A;  3KLS A;  3OTO L;  4GN5 A;  3H3V H;  5C44 H;  1KHI A;  2DY8 A;  2QMM A;  4GNX A;  1LAB A;  2BDO A;  4YPZ A;  2N8N A;  5C3E G;  2FMC A;  4DFA A;  3NXW A;  3I4O A;  4WOR A;  2KUM A;  3CQZ B;  2Z9H A;  4DV5 Q;  4LF8 Q;  1J9O A;  1LTG D;  2K5Q A;  5T1G A;  4R4C A;  4YWM A;  1AP0 A;  1UAK A;  1HR0 Q;  2EQS A;  2D5D A;  2D0O A;  3ER0 A;  3U9S A;  2WFW A;  2LXK A;  1EOT A;  4NPS A;  2EJG C;  5JJI A;  4Y52 H;  4EVO A;  4F7X A;  4YQS A;  4BBS H;  2AKW B;  3VR3 A;  2OQK A;  3BYT B;  2X69 A;  4YCW A;  3X3M A;  4YQT A;  4HIK A;  2AQ2 B;  3K5L A;  4YIJ A;  2JA9 A;  4IUR A;  1Y8P B;  2NBF A;  4KKU A;  1YNN D;  2E2I B;  4YPW A;  4LF4 Q;  3K7U C;  4C3I B;  2B29 A;  1I6H H;  1PVO A;  5FKA C;  1QZH A;  3C46 A;  5LHY 1;  3I72 A;  3NK6 A;  5GMB A;  3HOX H;  3KDF A;  1L2F A;  2WAC A;  1WTO A;  1S5D D;  2H5X A;  5D65 A;  1MSG A;  2EGW A;  1SYB A;  2VW9 A;  1EZ6 A;  2MHV A;  4OEM B;  1B70 B;  2P5Z X;  3K81 C;  4XTC S;  1IBL L;  5GMC A;  1XTD A;  2MGS A;  2NZH A;  5CV5 A;  2HCC A;  4DV3 Q;  5ISR A;  1D1K A;  4HID A;  2RCF A;  1S5F D;  1JB3 A;  2R92 B;  2IY5 B;  3M3Y B;  1PH6 A;  1VQ7 A;  1AW7 A;  2K33 A;  3TBI B;  3RUZ A;  4XQJ A;  1A2U A;  1BUV T;  1G8Z D;  4LFC L;  2N49 A;  2QKI C;  3PV0 A;  1S5E D;  2CQO A;  1O6D A;  4A75 A;  3S1N B;  1DOL A;  1B3A A;  5LL6 S;  1N36 Q;  4R8N A;  4A3F B;  2IX0 A;  2F0T A;  1WFQ A;  3NBH B;  3O7B A;  1NUC A;  3KLW A;  1PTO D;  4X66 Q;  4AQY Q;  3F2U A;  1N32 Q;  5CV9 A;  3T51 B;  3H3V I;  2L9H A;  1ZXT A;  2QF7 A;  4FXG C;  4KHP L;  3CCR A;  3A7L A;  3QWN A;  2IT1 A;  1STH A;  5A2Q L;  1TS4 A;  3UI2 A;  1EU3 A;  2X6G A;  1B50 A;  1PA6 A;  4JC0 A;  4L8J A;  4RCN A;  2F0P A;  2OCE A;  3CCQ A;  5AJ3 Q;  3S17 B;  1Q86 C;  1WCM H;  3CC2 A;  4DR6 Q;  1VQ8 A;  2CCZ A;  5KNB A;  4KDZ A;  4FDB A;  4RMF A;  2F0O A;  4YPY A;  4P73 A;  4DUZ Q;  3P75 A;  3S1R H;  1G91 A;  1N9W A;  4LFA L;  3CKI B;  1X3P A;  1ROD A;  2FXQ A;  5JVG 3;  1H9R A;  1BBX C;  4YQI A;  5G3L F;  1SE3 A;  4BXX H;  4RKB A;  4DXG A;  4JCV E;  1X3Q A;  5EBD A;  4YHH L;  5JVH 3;  2V3J A;  1UE5 A;  4YQB A;  3WDN A;  3HKZ E;  5EQ0 A;  3C1E A;  3TQY A;  2I5M X;  4NW2 A;  4G7H C;  4YQA A;  4R4Q A;  5CMD A;  1EYC A;  1D6E C;  2D2C C;  2Q2T A;  1KXL A;  1F2Y A;  3H94 A;  2R61 A;  2O4X A;  3RLO A;  1G6Z A;  1D2B A;  2JA6 G;  5A2Q E;  4HJ8 A;  4G7O C;  4B9W A;  3JAM L;  2KBN A;  3L0O A;  4BBS B;  1EY6 A;  4PQX A;  1O80 A;  4K5W A;  1VQF A;  4CDE C;  5M3F G;  5BN5 A;  1XNQ Q;  1O7Y A;  2ZJR A;  2I0Q A;  1SXT A;  5KGU A;  1DM0 B;  4M8A A;  3NPP A;  1NBW A;  1I6V C;  4A3J H;  3A54 A;  1KL9 A;  1QUQ B;  5KYI A;  1WI5 A;  4K2L A;  3SDZ A;  1E1T A;  2IHF A;  1AFP A;  4DU9 A;  2PMZ E;  4NXN Q;  4E6I A;  2DJG C;  3HOX B;  2A6H C;  3BVM A;  4IPD A;  1VQE A;  3CP0 A;  4KHV A;  1J8I A;  5K36 G;  3HOZ G;  2Z0Y A;  4A3K H;  4KN4 C;  4EQ5 A;  2N55 A;  1Z9F A;  4K0K Q;  4X62 Q;  4B3M Q;  1PZI D;  2YTX A;  3PUW A;  2RSN A;  1F2M A;  1S5C D;  3CD6 A;  3RLF A;  4P2C B;  2L5T A;  5C0X J;  3A7A B;  4DKA C;  1KRT A;  1TU2 B;  2QIL A;  2B2Y C;  1XMO Q;  1JC7 A;  4NP5 A;  3L9A X;  4JI7 Q;  1UE7 A;  3D0F A;  4CHT B;  5GAE C;  5I9P A;  2A74 C;  1NS5 A;  1GM5 A;  1CHP D;  4JBJ A;  2NVQ B;  4ZUI A;  3K8A A;  2PQA B;  2LMC B;  1QOH A;  1TQO A;  2B2W A;  3KY7 A;  3NK7 A;  4JV5 Q;  1TKW B;  1SYG A;  3QG1 A;  5C0X G;  3CCV A;  4QY7 A;  3PO3 G;  3DCM X;  4HAE A;  2VUM B;  1LTI D;  2EVB A;  4X3K A;  1BF4 A;  1N34 Q;  1CQF A;  1WCM B;  1STA A;  1XNR Q;  1KIX A;  1EY7 A;  4POF A;  2CW0 D;  3LWU A;  3I4M B;  4C2M H;  1SYE A;  2YU9 H;  4B3R L;  2F4V L;  3VA7 A;  3HGB A;  4DUY L;  4RCO A;  4CNE A;  4FF2 A;  3E5Y A;  2HCI A;  1WTH A;  4WJW A;  1OXT A;  1TWA H;  2HQL A;  2K5N A;  2A69 C;  2OTL A;  2EYL A;  1BCP D;  2UXD Q;  2MNA A;  3J7A V;  3AI9 X;  2RKS A;  3HFZ B;  4LF7 L;  4YQD A;  5DNF A;  4DV0 L;  2Q8I B;  1RHP A;  3H0G G;  1GUS A;  3E9I A;  4KKS A;  2VQE Q;  1PYS B;  1DYQ A;  4HR7 B;  1NCV A;  5COR A;  2DGY A;  1SYC A;  3HG9 A;  4IQZ A;  4CJ2 C;  4A76 A;  2E5L L;  4A3E H;  2FFK B;  1JJ2 A;  4QMG A;  4BS9 A;  2VXW A;  3MXN A;  3GTL H;  4JI3 L;  2F1M A;  3EIV A;  4JI6 L;  4IPC A;  1E7Z A;  2AWO A;  4ZQ3 A;  4JBW A;  4HMJ A;  3CME A;  2JA8 B;  4HSP A;  3IEF A;  2K28 A;  2F0E A;  2K5V A;  1R4P B;  1IKM A;  4FP5 D;  1V1Q A;  1Y1V H;  3UDF A;  1AE2 A;  1YJW A;  4DAY B;  1S4Z A;  2JEB I;  3JAM i;  2PMZ B;  3SE0 A;  4A3J B;  4HJ9 A;  1GD7 A;  1QVG A;  3HOV H;  1MBY A;  4K5V A;  2QDB A;  4DR3 L;  2HHH Q;  2Z6K A;  4A3G B;  4UHV A;  4A3D B;  4RG1 A;  2NZ1 D;  2K5H A;  3GTJ H;  1VCI A;  4C3I G;  2UUA L;  5M5Y H;  3CPF A;  1U5K A;  3Q8D A;  3VYR A;  4YQ0 A;  2E8G A;  3A5Z B;  1I4Q A;  1TO0 A;  2L55 A;  4YQN A;  1DOM A;  4CDD C;  4BY1 G;  2M9V A;  4YVJ A;  3M4O H;  1SYD A;  1CFM A;  2VL6 A;  4U68 A;  2PW5 A;  1GUW A;  3J7Y W;  3PGZ A;  4YVG A;  4MTN A;  1IL8 A;  5IYD G;  1SJH D;  1UE6 A;  1NR4 A;  4K8I A;  1OXS C;  3CRK C;  2KQ3 A;  1HPC A;  1K3B C;  5CR3 A;  1SE4 A;  1LTT D;  5KEE A;  2F3I A;  3KOJ A;  1PRT F;  2R92 G;  2C35 B;  2ASB A;  2QEX A;  2F52 A;  1EOV A;  3NE5 B;  3N52 A;  1D5Z C;  4C3J B;  1JJC B;  3X3N A;  3SGI A;  1XMQ Q;  1YNX A;  4A3F G;  4PG3 A;  1LAC A;  1SFO B;  2KHJ A;  4ZAI A;  5FLX L;  3MXU A;  3PIO 3;  3PCO B;  2EPB A;  1N33 Q;  5ELO A;  3TZU A;  4LUV A;  5HUR A;  2NTT A;  1L0W A;  4JI5 Q;  1SE8 A;  4RKL A;  5COY A;  4V0B A;  4LNQ A;  3BS1 A;  4EX5 A;  1UNS A;  3I55 A;  3GTO H;  2XN9 C;  1TWA B;  1HFN A;  4ME5 A;  4X64 L;  2JE6 I;  4OON A;  3TRZ A;  4EQP A;  1EYG A;  4DR2 L;  2PNH A;  3NEL A;  4GS3 A;  1XTC D;  5HGQ A;  1IPA A;  4IFD J;  3DUZ A;  3CPW A;  2ZM6 Q;  4A3I B;  1PH3 A;  2XNA C;  3C2P A;  4RGM A;  2MJ8 A;  2L4N A;  5IGG A;  3E6Z X;  1Q90 A;  4A3E B;  5D9F A;  2YY8 A;  2ES2 A;  2LXJ A;  2R7Z H;  4WRD A;  4UPA A;  5FO7 B;  2ZJQ A;  1Y1W H;  3GTL B;  2JA5 H;  4LF5 L;  3KTY A;  3K0Y A;  3BZC A;  4FMW A;  3V2T A;  2R7F A;  3AXZ A;  3U50 C;  1TT2 A;  4IN3 A;  3S15 H;  3S2H H;  1VMP A;  5FLX c;  1Z85 A;  4C56 C;  4GOP A;  3ICE A;  4GN4 B;  1CKN A;  1I94 Q;  4IFD G;  5FLX E;  5IP7 G;  5J39 A;  4A93 H;  3C1F A;  4DV1 L;  1J6Q A;  1C48 A;  4A3L G;  3H3V C;  1VQC A;  2SDF A;  4BY7 H;  4R9W A;  2R3Z A;  3URY A;  5FJ8 H;  1I4R A;  2IWH A;  3NUC A;  1SAP A;  1L1O A;  2EZV A;  3AB9 A;  4KN7 C;  4XQN A;  2VB3 X;  1B1Z A;  4BBS G;  3HOV B;  2RDG A;  2Z0S A;  2NVX H;  3NTI A;  3HKS A;  3STB C;  3R93 A;  4DPG A;  1X3F A;  1SMY D;  4V19 0;  4GKJ Q;  2RVL A;  2NVT B;  1FNV A;  5FLM G;  3DHQ A;  1WD1 A;  1FR3 A;  3K0X A;  3HZX A;  1TXY A;  2WII B;  3GD7 A;  4A3B B;  2EY1 A;  2L15 A;  2B63 B;  4GKK L;  2G5D A;  2AHO B;  5JPN C;  3M4O B;  4IZ8 A;  4FYD A;  5C4J H;  2CH4 W;  4ME3 A;  4C3H H;  5F2D A;  1PMR A;  1TWG B;  4DAP A;  1JT8 A;  2NN6 G;  1UE1 A;  1JWM D;  3SHL A;  2IL8 A;  3HOW G;  3U4V A;  1B3Q A;  1I50 H;  3SVM A;  5JOB A;  4XYQ A;  3KNU A;  3QUV A;  4IUT A;  4NDX A;  1ILQ A;  4CBV A;  3ITP A;  1XXG A;  4K6L A;  1VQN A;  4MNO A;  4XQQ A;  2ZXR A;  4HJ5 A;  2ZXO A;  1GXD C;  1N36 L;  4DV2 L;  1V2X A;  1EWI A;  2HDL A;  5DM6 3;  2F3V A;  5ELD A;  4K5X A;  1PLF A;  3T1H L;  2E2H H;  5GQO A;  1SRU A;  4DNT B;  4O1N A;  3CXC A;  1N32 L;  1MSH A;  4ODG A;  1LTL A;  3QB3 A;  1EQT A;  3N4J A;  1Z6H A;  1EY9 A;  1Q8K A;  1F9Q A;  1X56 A;  3LX0 A;  2IJ0 A;  1PH5 A;  2PQE A;  2VUM G;  1RDP D;  1PH1 A;  3GTO B;  3T1Y Q;  3TP6 A;  5IP9 H;  4WJ3 M;  4QJF A;  2ATW A;  1TWF H;  4ZCK A;  3QR8 A;  1TVX A;  1VQD A;  4DR6 L;  3I4M G;  1IBM Q;  1LTR D;  3MHB A;  4H0L C;  4HCE A;  4DV6 Q;  3J7A F;  4UDU C;  1XJV A;  5CV7 A;  3ERS X;  3HOY G;  4DR5 L;  1PH8 A;  3LWE A;  1LT4 D;  2QWV A;  2HQE A;  5CV6 A;  3BG3 A;  1J85 A;  2R7Z B;  3HKZ G;  1WYD A;  1SND A;  1KTK A;  3GTG H;  3NBH A;  3A8I E;  1E22 A;  1LV9 A;  2I5H A;  3S15 B;  2JP1 A;  1X7P A;  1YEZ A;  4OIJ A;  2N78 A;  3TRE A;  3KBX A;  2MUY A;  3T4A C;  3G71 A;  1ZYR D;  3A5U A;  3V96 A;  4Q0F A;  1EFW A;  1EIG A;  4BWG B;  2YTY A;  1NAP A;  1PRT C;  4QQB X;  3FPP A;  3AIA A;  4K6D A;  1UAL A;  1R9T B;  2K4K A;  5C4X H;  2IX3 A;  3P1H A;  4LF9 L;  1STG A;  2JA8 G;  1VHY A;  4JI0 L;  3IL8 A;  3BU2 A;  4DV7 L;  5J22 A;  4JBM A;  3WOE A;  3ZJY C;  4OGQ C;  1EYD A;  4R1J A;  5I6Y A;  4DR1 L;  1VMC A;  4UP8 A;  1WD0 A;  3KUP A;  1F9S A;  1JMC A;  1HCZ A;  3VR2 A;  2B2T A;  2PNR C;  3L7Z C;  2IX1 A;  4H3Z A;  2DN8 A;  1CZW A;  3CU7 A;  5EAY A;  1NJI C;  1NTG A;  2K03 A;  2A6H D;  3DEO A;  1GKH A;  2KCM A;  4JI2 Q;  4LJZ C;  1D5X C;  2G9D A;  5C4J B;  3K5M A;  1E3P A;  4A3G G;  1V1P B;  4A3D G;  4JWG A;  4DV4 L;  2EY6 A;  4CND A;  1F77 A;  3RZO H;  2YV5 A;  3OMC A;  4P75 A;  3G7L A;  2F0H A;  2UUB L;  4OX9 L;  3GTK H;  2NVY H;  3WOF A;  5IYB G;  3UDI A;  2N3S A;  2Z4I A;  2E74 C;  3W1B A;  3I4N B;  4IAL A;  3AYH B;  5LMN W;  1DD2 A;  3P20 A;  4YQP A;  3OII A;  3M4Y A;  3FKI B;  3UE1 A;  4O42 A;  2RCN A;  4YQQ A;  1L0X B;  1JJG A;  4YQK A;  2XVS A;  2WB1 B;  5IGD A;  2NUC A;  5C5M A;  4DR4 L;  1E24 A;  4JOI C;  1QUQ A;  2OEO A;  2IPK D;  3FMC A;  4J8Q A;  1JQY D;  2R93 B;  1BO0 A;  4OO1 G;  1FYC A;  4BBR H;  1HNW L;  1K73 C;  2QW7 A;  3W2D A;  4C3J G;  1EY0 A;  4DAV A;  3CCJ A;  2A68 D;  4RGO S;  1LT3 D;  4JI1 L;  1U4M A;  1T9H A;  2JA7 H;  1YNJ C;  1YJ9 A;  3TP7 A;  4YQR A;  3K5N A;  1PTO F;  1X3G A;  1N34 L;  5CV8 A;  4J6H A;  3AFQ A;  1XNR L;  4YQO A;  3S1M H;  4A3M H;  3VYU A;  5M5X B;  3ND8 A;  2Z4H A;  3IRB A;  2UXB Q;  5C6A A;  2RDH A;  1GHK A;  3OWE B;  1F2L A;  2R6G A;  4RHS A;  3BBH A;  4Z9C B;  3AEV A;  5EKL A;  4XXE A;  1QE6 A;  3VYT A;  3GTG B;  2DNE A;  3OPO A;  1EU4 A;  2EE1 A;  1ET6 A;  5BN4 A;  5LMN Q;  4H13 C;  4A3I G;  4R4O A;  1YI2 A;  2HIV A;  2PQA A;  4CNF A;  4IPH A;  3L2P A;  4Y7N B;  4KD3 A;  4LF6 L;  5E3F A;  1I4H A;  1HNX L;  1EYA A;  1ML0 D;  5IYC G;  1CA5 A;  2J7Z A;  1AN8 A;  3PIP A;  3PO2 B;  3MZ5 A;  2KHI A;  3OIP A;  1V43 A;  3M7N A;  4I7A A;  4FF3 A;  3S2D H;  5C4X B;  1GUO A;  2VQF L;  3SR1 A;  1VQO A;  5M3M B;  1MI2 A;  5I2X A;  2BE5 C;  3MWY W;  5KIX A;  1IBK Q;  2B2V A;  3KF6 B;  1VS0 A;  1PYW D;  2WP8 J;  1HNZ L;  2A73 B;  4ULL A;  1JWS D;  5C44 B;  4X3T A;  1FVI A;  4K14 A;  3S16 H;  2EY2 A;  3M85 A;  3GO5 A;  1II3 A;  4S3S A;  4AH6 A;  1SEB D;  4N8X 1;  5ELC A;  4YQ1 A;  1IKL A;  1I3Q H;  4KI0 A;  1ZKO A;  1TR5 A;  2B2U C;  1SRO A;  1HZB A;  1D7Q A;  5GAH C;  1YVC A;  1K28 A;  1QZG A;  4FF1 A;  3FRP B;  3RD4 A;  5CYU A;  1PFS A;  2NVY B;  1EQQ A;  3J81 L;  1VQH A;  4A3B G;  1Y14 B;  4RFB A;  4X65 L;  1JCK B;  1U4L A;  2B63 G;  5DM7 3;  3H15 A;  4NXM L;  3E9H A;  2A6E D;  2QDL A;  3Q6S A;  2O3A A;  2A8V A;  1MIU A;  1EWC A;  3J80 c;  1EQR A;  1HJP A;  1RKN A;  1HHV A;  2LKV A;  1V6Z A;  1I6H B;  3RNU A;  3J80 E;  3K6O A;  1RIP A;  2EYH A;  2PZT A;  2JK8 A;  5E1F A;  2I46 A;  1WJJ A;  2BOS A;  4L69 A;  3OTO Q;  1TS3 A;  2KHS A;  4PZ8 A;  3ERQ A;  2RHQ B;  1HUN A;  1CZG A;  2F0L A;  2Q2I A;  1IW7 C;  2Q8T A;  4DAM A;  4KKT A;  1PV4 A;  5IGF A;  5C3E H;  5JEA J;  2JA7 B;  4BA1 I;  2OQ0 A;  3Q24 A;  1HH2 P;  4G4K A;  4RHR A;  1M1K C;  1FL0 A;  4L5T A;  1Q1E A;  4JI8 L;  4CNG A;  3S1M B;  4KMU C;  2F0J A;  2AQ1 B;  2K75 A;  2OT2 A;  4QB4 A;  4DF7 A;  2NYZ D;  3J81 c;  3CAM A;  3SEB A;  3NTH A;  1QVC A;  4FVM A;  4O2D A;  4MCD A;  1X55 A;  4YQ5 A;  4L6T B;  3J81 E;  1AZP A;  1K8A C;  1HZA A;  1FNW A;  1BKB A;  5ELN A;  5JEA G;  4JPB W;  1EZ8 A;  4DR7 Q;  1YNN C;  2DNC A;  4YQL A;  4ZLT F;  4GLA C;  4HIO A;  1HXY D;  2WAQ B;  3U9O A;  3HOU G;  1X65 A;  2AQ3 B;  1BCP F;  1EIY B;  5GRO A;  4YQ2 A;  5BR8 L;  4MIU A;  3NK9 A;  4CKE A;  1JIC A;  3BZK A;  4G57 A;  1C4Q A;  1C0A A;  3A8K E;  3SK6 A;  3PF5 A;  3S1R B;  2KEE A;  2ENB A;  3S2D B;  1EY8 A;  1FNU A;  1DCZ A;  4OHJ A;  1J5E L;  1QJO A;  3ZYY X;  1HZ9 A;  1NSN S;  2L1B A;  3D8G A;  4HCS A;  4A3C G;  3TEH B;  1I94 L;  2QGQ A;  1E2V A;  4K8J A;  2UXC L;  1CSP A;  2K01 A;  4OL7 A;  2F0I A;  2RA4 A;  4LFC Q;  1PRT B;  1FJG L;  4JWJ A;  3S16 B;  2KCT A;  3S1Q H;  5C5L A;  3H09 A;  2YTV A;  3U4Z A;  1SBB B;  1I3Q B;  4R8I A;  3GTQ H;  1A3V A;  2Y0S B;  5IT9 c;  2DUD A;  4PMW A;  1ESR A;  2AUK A;  3PQI A;  3F2C A;  5IT9 E;  1PTO C;  2JSO A;  4AYB B;  4KHP Q;  1ICW A;  3TME A;  2F03 A;  3AQQ A;  1A2T A;  2RQX A;  1WTQ A;  3G48 A;  2VB2 X;  4B3T Q;  3P7J A;  4L5Q A;  4IOA A;  1O7Z A;  1K9M C;  2RSO A;  5ELE A;  4F87 A;  4HED A;  4OWW B;  1C7Y A;  1LTS D;  2XWJ B;  5HY6 A;  1SNM A;  2F0G A;  1IL2 A;  4NB3 A;  1VQJ A;  3KJP A;  3J81 i;  2R7D A;  3UDX A;  3S14 H;  4LFA Q;  1MXI A;  2I07 B;  2C5C A;  2EJF C;  2K6A A;  4YY3 L;  2SNM A;  1UEB A;  1YIT A;  1GHJ A;  5C4Z A;  3I4N G;  4CDF C;  2K1B A;  2UUC L;  3FKI G;  2F3W A;  1SYF A;  1RTO A;  3RN2 A;  4A3K B;  2WB1 G;  1IYV A;  1M8A A;  3EA6 A;  1BQQ T;  1GUN A;  4OEL B;  3KF8 B;  3T53 B;  1Q3L A;  1GO3 E;  2QCP X;  3CCM A;  1TWC H;  2MO0 A;  1T5X D;  4RGT A;  2R93 G;  3IAY A;  1KLU D;  1R4Q B;  3ND9 A;  3B6Y A;  2E2D C;  2F0M A;  3TN2 A;  2JA6 H;  1CA6 A;  1ENF A;  4YQ4 A;  3J7Z C;  1ESF A;  3EBE A;  3FEW X;  2Z1C A;  3U58 A;  4DK6 C;  4XBO A;  4ALP A;  4B3S L;  5JJL A;  1B8A A;  3VR6 A;  5M3F H;  1ZEQ X;  3BBE A;  1LM0 A;  3CHB D;  3RZD H;  2LS0 1;  4HN7 A;  5NUC A;  1W2B A;  4JYA L;  1QWY A;  5ELB A;  4HIM A;  2B2Y A;  2MQH A;  4KGN A;  1CI3 M;  1H9M A;  2A5H A;  2F0F A;  2WKC A;  2WKD A;  1DZ1 A;  3FDT A;  4C2M B;  2YU9 B;  3GP7 A;  5K36 H;  3HOZ H;  1Q12 A;  2LFN A;  4LUZ A;  3M4Q A;  2EYP A;  3I73 A;  1OTC A;  4JI4 Q;  1KAW A;  1TS2 A;  4IUN A;  3CRL C;  5LMU Q;  4L5S A;  1JE4 A;  1V9P A;  4RH6 A;  2ALY B;  4YQC A;  3PO2 G;  1FGU A;  3KW2 A;  3NWS A;  2F0V A;  2E2J H;  3MFY A;  3SK8 A;  1RF2 D;  1FGB D;  5M3M G;  2KCN A;  3BDC A;  2EGV A;  1GJX A;  4QUC A;  2XRS D;  3MXG A;  5M5W H;  4IOC A;  2F0Q A;  3R8B A;  3IFT A;  3BYY B;  2KEN A;  4O0A A;  5C44 G;  1GUT A;  1AEX A;  1VQK A;  4FXD A;  3HRZ C;  3AMU A;  3FPU B;  2VY3 A;  5C0X H;  4UP7 A;  3PO3 H;  2CH4 A;  4JWH A;  4X3M A;  3NP8 A;  1Y1V B;  4IUV A;  4DV5 L;  2PO4 A;  4LF8 L;  1H9J A;  1KRS A;  1HQR D;  5IOC A;  1RJT A;  1HA6 A;  3GTM H;  4JI2 L;  1B53 A;  1PTO H;  2CW0 C;  3K58 A;  1HR0 L;  3J7A 5;  3KLS X;  2F4V Q;  2JJQ A;  4DUY Q;  1D1I A;  4KV6 A;  2G9H D;  3S14 B;  4LFB Q;  1Y8O B;  5D14 A;  3CCL A;  5J3B A;  1VQG A;  1SR3 A;  1F9R A;  1Z47 A;  1EFI D;  1OY5 A;  5JJK A;  3L3O C;  1KLG D;  4IUQ A;  4GNX C;  5CGK A;  1TY0 A;  1B4O A;  1BCP C;  4LF7 Q;  4FXK C;  3KYH C;  1DON A;  3GTJ B;  4ZRZ A;  1KNE A;  3EN2 A;  5M5Y B;  4LF4 L;  1BBW A;  3H0G H;  4UAI A;  2E5L Q;  3HOX G;  2PI2 E;  1XPR A;  2I5L X;  1BBU A;  1HA5 A;  2ID0 A;  4R4T A;  1TWC B;  5LL6 X;  5KYL A;  1Z7T A;  4KY7 A;  3SK4 A;  4JI3 Q;  4QGU A;  4JI6 Q;  1X32 A;  2X6L A;  3AFP A;  2MFI A;  3OSO A;  3KBG A;  2QEJ C;  3D31 A;  1ASZ A;  1V1P A;  1C8C A;  1I4X A;  4F88 A;  1S3O A;  4DV3 L;  2K05 A;  3SXH A;  2EXZ A;  2KCC A;  3ULJ A;  1JE5 A;  1U4P A;  1XPU A;  2EYM A;  2WV6 D;  2XWB B;  2CX8 A;  3RZD B;  2NB0 A;  2UXB L;  3MEF A;  2WB1 E;  5EPJ A;  2K14 A;  1QB5 D;  3F2B A;  4N9T A;  1ASY A;  4DR3 Q;  5EKI A;  4X66 L;  4AQY L;  2Q2H A;  1ICF B;  3CW2 C;  3PMF A;  3HOZ B;  4P74 A;  2UUA Q;  5C0X I;  2E2I H;  1LYL A;  2D0P A;  4P72 A;  4H3Y A;  4ZKC B;  4JW0 A;  1WCM G;  1MGS A;  3Q23 A;  3EJI A;  4YQ3 A;  5AJ3 L;  3BZD B;  3OW7 A;  1U4R A;  1RL2 A;  4BY1 H;  3PUX A;  2UU9 Q;  2K5W A;  5EPK A;  4MCC A;  4CJ0 B;  2E2J B;  2ZJP A;  4DUZ L;  3T13 A;  3BDO A;  1SNP A;  4KJO A;  1ILP A;  4RA8 A;  4LUO A;  5IYD H;  3K5O A;  1H9S B;  2V4D A;  2BE5 D;  1HQM C;  1UWV A;  1BOS A;  4BXX G;  5M5W B;  2BA1 A;  1Y1W B;  2NTS A;  3M9B A;  1UUP A;  4POG A;  2R92 H;  1NXZ A;  3M3Y H;  4GZY C;  2JA5 B;  1K0S A;  1GZ0 A;  4QIW B;  4XYO A;  2HD3 A;  3S2H B;  1JOK A;  1VQL A;  4DK0 A;  3S1N H;  5IY0 A;  3E0J A;  1XYI A;  5H1S E;  2Y0S G;  3OHX C;  4A3F H;  2CWA A;  2RHS B;  4A93 B;  3PIP 3;  3O13 A;  2A19 A;  1PFN A;  4BY7 B;  1ONL A;  2F0N A;  4IJH A;  1PTO B;  1P8L A;  2WIN B;  1DXM A;  2CQA A;  2ZTC A;  2VZA A;  1MHW C;  5IWA Q;  4CKC A;  3NWT A;  4B08 A;  2JYO A;  2HUG A;  4YQ7 A;  2NVX B;  3S17 H;  1HFG A;  2K04 A;  3D4W A;  4P71 A;  3I3C A;  4DR2 Q;  5I2Y A;  1XNQ L;  2HIX A;  4N8F A;  2XRQ D;  3VR4 A;  4A3J G;  3D3R A;  4DN4 M;  3KF6 A;  2IW3 A;  3H0G B;  2E76 C;  1I5F A;  2FIN B;  1RCV D;  3EQL C;  3M7G A;  3LNN A;  1SNO A;  3FHW A;  1DJR D;  4NXN L;  1I4P A;  1MJE A;  3R3O A;  2BA0 A;  3I90 A;  4MCB A;  1PH2 A;  1VHK A;  2PZU A;  3DMU A;  4C1N K;  4C3H B;  4A3K G;  1EUJ A;  1G2S A;  2NZO A;  1Q7Y C;  1QG7 A;  1IW7 D;  4K0K L;  4J1M A;  4X62 L;  4B3M L;  1PFB A;  1I50 B;  1VF7 A;  4APV A;  4IFD H;  4DV1 Q;  3DWA A;  2JQO A;  1HTL D;  1X54 A;  5IP7 H;  1Q82 C;  1YHB A;  3NEM A;  2ZT9 C;  1Q81 C;  5EKK A;  1XMO L;  4A3L H;  4MHE A;  3MAQ A;  1WVL A;  3IC6 A;  5IE8 A;  4KHZ A;  4JWF A;  2CKZ B;  4TKO B;  4JI7 L;  4DGZ A;  1CK1 A;  1E2Z A;  1CUK A;  4CDC C;  3TDQ A;  4E8B A;  3I91 A;  1A6X A;  2D9U A;  5T1I A;  3A55 A;  3A56 A;  1PH7 A;  2E2H B;  4FAK A;  1S40 A;  3F2D A;  1JR0 D;  3BDL A;  4HJ7 A;  5IGC A;  3OIN A;  1SMY C;  4DK3 C;  4JV5 L;  4DR7 L;  2H1E A;  1SMX A;  1A0I A;  5FLM H;  5L37 A;  1QCB D;  1EY5 A;  2GA4 B;  4X6A H;  1HRJ A;  5EPL A;  1TWF B;  4GKK Q;  5HGT A;  2K52 A;  3UE0 A; 
#chains in the Genus database with same CATH homology
 2R92 G;  4L5R C;  4C3I H;  3J81 c;  2C35 B;  3CAM A;  2K50 A;  2WAQ G;  3I2Z A;  1QVC A;  3KJO A;  2ASB A;  2VNU D;  2QEX A;  3ULP A;  2F52 A;  4O2D A;  1C9O A;  1EOV A;  1PYB A;  1X55 A;  3K80 C;  4MCD A;  4YQ5 A;  3CMA A;  4UY8 C;  4X3L A;  4DNI A;  1JJC B;  1K8A C;  3SGI A;  1HZA A;  1IZ6 A;  1XMQ Q;  1YNX A;  3PIO A;  3G6E A;  4PG3 A;  4YCU A;  2V1C C;  4QL5 A;  4A3F G;  1BKB A;  5ELN A;  2KHJ A;  5JEA G;  2R93 H;  1AE3 A;  2EXD A;  3HOW H;  1WOC A;  2AMC B;  3PCO B;  4DR7 Q;  1N33 Q;  1KC8 C;  1OXV A;  2ZTE A;  5ELO A;  4LUV A;  4YQL A;  4GLA C;  4HIO A;  3CCE A;  1CKO A;  1M90 C;  1IXR A;  1L0W A;  4JI5 Q;  1SE8 A;  5DLQ E;  1G29 1;  3WWV A;  3HOU G;  2UXD L;  4AIM A;  1X65 A;  3DM3 A;  4YWL A;  1IBK L;  3VDY A;  1O7I A;  1YJN A;  1EIY B;  4EX5 A;  4B3S Q;  5GRO A;  1PHJ A;  4LNQ A;  5BR8 L;  2VQE L;  4YQ2 A;  1N8R C;  4GLX A;  1NMG A;  3I55 A;  4A3E G;  4DV2 Q;  4BA2 I;  3GTO H;  3BZK A;  1C0A A;  3FP9 A;  5M5X H;  4X64 L;  3PF5 A;  2JE6 I;  4OON A;  3TRZ A;  1PH9 A;  2NVQ H;  4JYA Q;  2WAQ E;  3T1H Q;  1UAM A;  1EYG A;  1VQM A;  1MKH A;  4YVG A;  3UDG A;  1J5E L;  4DR2 L;  4LW1 A;  2PNH A;  3NEL A;  1HZ9 A;  4GS3 A;  1X7O A;  4A3C G;  4TQU S;  5HGQ A;  4IFD J;  3CPW A;  1IPA A;  2ZM6 Q;  3TEH B;  1I94 L;  1LUZ A;  2QGQ A;  3KFU A;  1PH3 A;  2LSS A;  1HR0 W;  2UXC L;  3OIJ A;  1IYJ B;  1CSP A;  4AYB G;  4B3T L;  3ONP A;  4LFC Q;  4IFD I;  1Y1V G;  2BH8 A;  4GOP B;  1FJG L;  2VUM H;  4JWJ A;  5D9F A;  1E1O A;  2YY8 A;  1CKN B;  2ES2 A;  2LXJ A;  2KCT A;  2IHE A;  2R7Z H;  3S1Q H;  5GM8 A;  4YQG A;  2D62 A;  4UPA A;  2YTV A;  3U4Z A;  1Y1W H;  2ZJQ A;  3RR5 A;  4PZ6 A;  1YIJ A;  4Y7N H;  3GTQ H;  2JA5 H;  4X64 Q;  4LF5 L;  3I4M H;  5IT9 c;  2DUD A;  3KTY A;  3BZC A;  4PMW A;  4J15 A;  1W3S A;  4FMW A;  2R7F A;  3AXZ A;  3U50 C;  3F2C A;  3S15 H;  3S2H H;  4DR5 Q;  5FLX c;  2V3K A;  3S24 A;  1Z85 A;  3HOV G;  1L1O B;  4GOP A;  3HOY H;  4KHP Q;  4KLK A;  4GN4 B;  1CKN A;  1I94 Q;  4JBK A;  3A0J A;  3ICE A;  4IFD G;  2I6D A;  3CC4 A;  3PO2 H;  5IP7 G;  3AQQ A;  4UP9 A;  4A93 H;  3G48 A;  4DV1 L;  1YZ6 A;  4B3T Q;  4OWX B;  2Y0S E;  4IPG A;  3I56 A;  1J6Q A;  4L5Q A;  4GNX B;  4A3L G;  1K9M C;  4IOA A;  2HHH L;  1VQC A;  4BY7 H;  4YQ8 A;  5M3M H;  1JB7 A;  2HT1 A;  5FJ8 H;  3G4S A;  2GVB A;  4WJ4 A;  1NMF A;  4AYB E;  4OWW B;  1L1O A;  4R4I A;  1C7Y A;  4LF5 Q;  5HY6 A;  3BBD A;  1YHA A;  1IL2 A;  4NB3 A;  1VQB A;  1VQJ A;  4BBS G;  3OTO L;  4GN5 A;  3J81 i;  5C44 H;  3KJP A;  1KHI A;  3H3V H;  4YVI A;  2R7D A;  2Z0S A;  1TWH H;  3UDX A;  4LFA Q;  2NVX H;  3HKS A;  3STB C;  4GNX A;  3S14 H;  1MXI A;  4YPZ A;  2N8N A;  4YCV A;  4YY3 L;  5C3E G;  4DPG A;  1X3F A;  2AWN A;  1UEB A;  3I4O A;  1YIT A;  4GKJ Q;  1OXU A;  4DV5 Q;  1YHQ A;  3NEN A;  5FLM G;  2NN6 I;  4LF8 Q;  3I4N G;  4LF9 Q;  4JI0 Q;  2UUC L;  3K0X A;  4DV7 Q;  3FKI G;  2JA8 H;  1UAK A;  4R4C A;  4YWM A;  1HR0 Q;  2Z6K C;  2EQS A;  1TXY A;  2D0O A;  2WB1 G;  3RN2 A;  3GD7 A;  3ER0 A;  2L15 A;  2WFW A;  4DR1 Q;  4GKK L;  2LXK A;  2AHO B;  4NPS A;  5JJI A;  4Y52 H;  5C4J H;  4YQS A;  4ME3 A;  4C3H H;  4BBS H;  2AKW B;  2OQK A;  3KF8 B;  4H02 A;  1SLJ A;  4YCW A;  1GO3 E;  1JT8 A;  2NN6 G;  4YQT A;  1UE1 A;  3CCM A;  5GAD C;  4HIK A;  1TWC H;  2MO0 A;  3KDF B;  2JA9 A;  2R93 G;  2EIF A;  3OYY A;  3ULL A;  1XMQ L;  3HOW G;  3U4V A;  3B6Y A;  1I50 H;  2JA6 H;  1VQ5 A;  3KNU A;  3QUV A;  4YPW A;  4LWC A;  4LF4 Q;  3K7U C;  1N33 L;  2B29 A;  1X6O A;  1HZC A;  4YQ4 A;  1I6H H;  1PVO A;  1QZH A;  3J7Z C;  3EBE A;  4DV4 Q;  1VH0 A;  4JI5 L;  4JOI A;  4A3G H;  3NK6 A;  5GMB A;  3HOX H;  3PF4 A;  1VQN A;  3U58 A;  3KDF A;  1L2F A;  4DK6 C;  4MNO A;  4ALP A;  2UUB Q;  4XBO A;  4B3S L;  2H5X A;  5JJL A;  4OX9 Q;  4HJ5 A;  2EGW A;  1B8A A;  3L8U A;  5M3F H;  2VW9 A;  1N36 L;  1LM0 A;  4DV2 L;  3BBE A;  1CKM A;  4JI4 L;  1UAJ A;  5IYB H;  1V2X A;  1EWI A;  3RZD H;  1W2B A;  1B70 B;  2OWO A;  4WJ3 M;  3K81 C;  3PUV A;  4XTC S;  1IBL L;  1XTD A;  5LMU L;  4JYA L;  3RLN A;  4HIM A;  3RN5 A;  5GQO A;  3T1H L;  2E2H H;  1SRU A;  2NZH A;  4YVH A;  2MQH A;  3CXC A;  4KGN A;  1N32 L;  4DV3 Q;  1LTL A;  2ZM6 L;  2XTI A;  4HID A;  3N4J A;  1Q8K A;  3CCU A;  4DR4 Q;  1X56 A;  2IY5 B;  3DLL A;  1PH6 A;  1VQ7 A;  3JAM c;  1PH5 A;  2B3G A;  2VUM G;  1PH1 A;  1NY4 A;  4LFC L;  2N49 A;  3T1Y Q;  5IP9 H;  2A1A A;  3PV0 A;  2R7Z G;  3HOZ H;  2CQO A;  4QJF A;  1TWF H;  4A75 A;  2ATW A;  1Q12 A;  1Y1W G;  4JV5 L;  1VQD A;  1O6D A;  4LUZ A;  3M4Q A;  4DR6 L;  1N36 Q;  2JA5 G;  3I4M G;  1OTC A;  1IBM Q;  4DV6 Q;  4JI4 Q;  2IX0 A;  1KAW A;  1HNW Q;  1WFQ A;  1IBL Q;  1YBY A;  3NBH B;  5LMU Q;  3O7B A;  4L5S A;  1V9P A;  1XJV A;  3KLW A;  3ERS X;  4C3J H;  4X66 Q;  2ALY B;  4JI1 Q;  4AQY Q;  3HOY G;  4DR5 L;  1N32 Q;  1PH8 A;  4YQC A;  3H3V I;  3PO2 G;  4IG6 A;  1SFO H;  1FGU A;  2QWV A;  4KHP L;  1P16 A;  4A93 G;  3CCR A;  3KW2 A;  4JAK A;  2E2J H;  2IT1 A;  1J85 A;  3HKZ G;  1PH4 A;  1WYD A;  3J80 i;  4BY7 G;  5M3M G;  1D8L A;  3GTG H;  5FJ8 G;  2XGT A;  1PA6 A;  4JC0 A;  3CCQ A;  1E22 A;  2OCE A;  2EGV A;  3M4P A;  5AJ3 Q;  1Q86 C;  2I5H A;  1WCM H;  3CC2 A;  4DR6 Q;  5M5W H;  4IOC A;  1AH9 A;  1X7P A;  1VQ8 A;  2CCZ A;  1YEZ A;  4KDZ A;  2N78 A;  4IO9 A;  4LFB L;  2KEN A;  4FDB A;  4O0A A;  3TRE A;  4RMF A;  5C44 G;  2QMM A;  4J3C A;  3G71 A;  4YPY A;  4P73 A;  3A5U A;  4DUZ Q;  1VQK A;  3STB D;  3S1R H;  1N9W A;  4LFA L;  1EFW A;  2VY3 A;  4UP7 A;  2YTY A;  4QQB X;  2FXQ A;  4GOP C;  3PO3 H;  3AIA A;  4JWH A;  4X3M A;  1UAL A;  4YQI A;  4GKJ L;  2K4K A;  4A3I H;  5C4X H;  4DV5 L;  4LF8 L;  4BXX H;  1OXX K;  2K52 A;  1KRS A;  4LF9 L;  4JI0 L;  2JA8 G;  3BU2 A;  1VHY A;  4JCV E;  4YQ6 A;  4YHH L;  4DV7 L;  4JI2 L;  3GTM H;  2V3J A;  1UE5 A;  4LF6 Q;  4JBM A;  5GMC A;  4YQB A;  1HR0 L;  3ZJY C;  3J7A 5;  2F4V Q;  2JJQ A;  4DUY Q;  3HKZ E;  1HNX Q;  3TQY A;  4R1J A;  2I5M X;  4DR1 L;  4LFB Q;  4UP8 A;  1L1O C;  3CCL A;  4YQA A;  4OWT B;  4R4Q A;  1JMC A;  5J3B A;  5IYC H;  3PUY A;  1VQG A;  3W5O A;  1SR3 A;  1Q46 A;  1VQA A;  1Z47 A;  3CCS A;  1OY5 A;  1S72 A;  2Q2T A;  5JJK A;  2VQF Q;  1VQ4 A;  1KXL A;  4GNX C;  1KD1 C;  3L7Z C;  2IX1 A;  4H3Z A;  3RLO A;  5EAY A;  4LF7 Q;  2JA6 G;  1NJI C;  1NTG A;  3KYH C;  4IJL A;  3EN2 A;  1GKH A;  2KCM A;  3KOJ A;  4JI2 Q;  4YHH Q;  1BBW A;  3H0G H;  4LF4 L;  3CC7 A;  4HJ8 A;  1HNZ Q;  1E3P A;  4A3G G;  2E5L Q;  3HOX G;  2PI2 E;  1XPR A;  2I5L X;  2KBN A;  3L0O A;  4A3D G;  4DV4 L;  4JWG A;  4CND A;  1BBU A;  1P9P A;  3RZO H;  2YV5 A;  2CWP A;  3PSI A;  4P75 A;  1VQF A;  2ID0 A;  2UUB L;  4R4T A;  5M3F G;  4OX9 L;  1XNQ Q;  2NVY H;  4JI3 Q;  4QGU A;  4JI6 Q;  3GTK H;  5IYB G;  3UDI A;  2N3S A;  2ZJR A;  1U0L A;  3AFP A;  2I0Q A;  2MFI A;  3I7F A;  3W1B A;  1NBW A;  3AYH B;  3D31 A;  4A3J H;  1ASZ A;  1KL9 A;  3W1G A;  5LMN W;  4JAL A;  1QUQ B;  4YQP A;  1WI5 A;  3OII A;  3UE1 A;  1E1T A;  2IHF A;  4OO1 I;  3E0E A;  1G6P A;  2RCN A;  2VS1 A;  4YQQ A;  1S3O A;  2PMZ E;  4DV3 L;  4NXN Q;  1JJG A;  4YQK A;  2NVT H;  5FAI A;  4IPD A;  3ULJ A;  1VQE A;  1JE5 A;  4DR4 L;  1E24 A;  3CP0 A;  1XPU A;  4YQJ A;  5K36 G;  4X65 Q;  5IP9 G;  3HOZ G;  1VQ9 A;  3PUZ A;  2Z0Y A;  4A3K H;  4JOI C;  2CX8 A;  3T1Y L;  1Q1B A;  4A3B H;  4NXM Q;  1QUQ A;  4EQ5 A;  1Z9F A;  2B63 H;  2UXB L;  3MEF A;  2WB1 E;  4K0K Q;  4X62 Q;  4B3M Q;  2YTX A;  4MZ9 A;  1A62 A;  2K14 A;  3PUW A;  4OO1 G;  1IBM L;  4DV6 L;  4BBR H;  1HNW L;  1K73 C;  2UU9 L;  3TS2 A;  2CFM A;  3CD6 A;  3F2B A;  1TWG H;  2ZTD A;  3RLF A;  5C0X J;  1ASY A;  1G51 A;  4DR3 Q;  4DKA C;  3CCJ A;  1KRT A;  4X66 L;  4AQY L;  2Q2H A;  4JI1 L;  1T9H A;  3JC6 6;  1XMO Q;  1YJ9 A;  2JA7 H;  2HA8 A;  3CW2 C;  4YQR A;  4TVA B;  4P74 A;  4XIG S;  4JI7 Q;  1X3G A;  1N34 L;  2UUA Q;  1UE7 A;  5C0X I;  2E2I H;  4YPX A;  1LYL A;  3TS0 A;  2D0P A;  3AFQ A;  3D0F A;  4P72 A;  5GAE C;  4HJA A;  1XNR L;  4H3Y A;  4YQO A;  3J81 j;  3S1M H;  4A4I A;  4A3M H;  1K8G A;  1WCM G;  1XPO A;  1GM5 A;  2Q2U A;  1NS5 A;  2JEA I;  4YQ3 A;  4JBJ A;  5AJ3 L;  3IRB A;  2UXB Q;  1RL2 A;  3K8A A;  3GTP H;  2PQA B;  3LGJ A;  4BY1 H;  3PUX A;  2UU9 Q;  2R6G A;  1K83 H;  3KY7 A;  3NK7 A;  4MCC A;  4JV5 Q;  2ZJP A;  3BBH A;  4OXP A;  4DUZ L;  3AEV A;  5C0X G;  3CCV A;  4QY7 A;  2GN5 A;  4JI8 Q;  3PO3 G;  4JG2 A;  3DCM X;  4LUO A;  5IYD H;  4YQ9 A;  5LMN Q;  4A3I G;  1UWV A;  1N34 Q;  4R4O A;  1YI2 A;  5C4X G;  4BXX G;  2HIV A;  1XNR Q;  1KIX A;  2PQA A;  4CNF A;  4IPH A;  2BA1 A;  3L2P A;  1NE3 A;  4POF A;  3M9B A;  5IWA L;  4POG A;  2R92 H;  1NXZ A;  3M3Y H;  3BJU A;  1GZ0 A;  4C2M H;  2YU9 H;  4LF6 L;  4B3R L;  2F4V L;  4DUY L;  3ILK A;  5CO4 A;  4CNE A;  4GN3 B;  1VQL A;  1HNX L;  4YWK A;  3GDE A;  3S1N H;  5IY0 A;  5IYC G;  3E5Y A;  1A63 A;  3PIP A;  5H1S E;  2Y0S G;  4A3F H;  3GYQ A;  2KHI A;  1V43 A;  2CWA A;  1OXT A;  1TWA H;  2HQL A;  2RHS B;  3M7N A;  3S2D H;  2K5N A;  2A19 A;  2VQF L;  4QIW E;  2OTL A;  1VQO A;  4IJH A;  2UXD Q;  1GVP A;  5GAG C;  1P8L A;  3MXN B;  2MNA A;  3AI9 X;  4PZK A;  3HFZ B;  4LF7 L;  4YQD A;  2ZTC A;  4DV0 L;  3OW2 A;  1IBK Q;  3HOU H;  2VZA A;  3H0G G;  5IWA Q;  3E9I A;  5BR8 Q;  2VQE Q;  1PYS B;  3KF6 B;  1VS0 A;  2DGY A;  2WP8 J;  4B3R Q;  4A76 A;  1HNZ L;  1A8V A;  2E5L L;  1FVI A;  4A3E H;  4YQ7 A;  3S16 H;  1EIF A;  3S17 H;  1K3R A;  1X3E A;  4P71 A;  3M85 A;  1B7Y B;  2MO1 A;  1JJ2 A;  3N4K A;  1J5E Q;  4DR2 Q;  3GO5 A;  4AH6 A;  1XNQ L;  4JI3 L;  1I3Q H;  3EIV A;  2HIX A;  4KI0 A;  4JI6 L;  3GTL H;  4IPC A;  4YQ1 A;  1E7Z A;  5E7N A;  4A3J G;  4A3C H;  2AWO A;  3KF6 A;  4JBW A;  2UXC Q;  1SRO A;  1MJC A;  1X9N A;  1HZB A;  3CME A;  1I5F A;  1H95 A;  3IEF A;  4DV0 Q;  2K5V A;  1D7Q A;  1FJG Q;  5GAH C;  3FHW A;  1YVC A;  4NXN L;  1QZG A;  1V1Q A;  1MJE A;  1Y1V H;  2BA0 A;  3UDF A;  1R9T H;  1QVF A;  1AE2 A;  1YJW A;  4MCB A;  2OTJ A;  1PH2 A;  1PFS A;  1VQ6 A;  1VHK A;  1EQQ A;  4A3K G;  3F8T A;  4DAY B;  1EUJ A;  1VQH A;  2PI2 A;  4A3B G;  1Y14 B;  4X65 L;  4GLV B;  2JEB I;  2NZO A;  3JAM i;  1Q7Y C;  2B63 G;  3H15 A;  4YVK A;  4NXM L;  3E9H A;  4BBR G;  3K7A H;  4HJ9 A;  4X62 L;  4K0K L;  2GVA A;  4B3M L;  2O3A A;  2A8V A;  1GD7 A;  1QVG A;  3HOV H;  1MIU A;  3J80 c;  1EQR A;  1HJP A;  4APV A;  1V6Z A;  4DV1 Q;  5IP7 H;  1SN8 A;  2JQO A;  1X54 A;  1Q82 C;  1CSQ A;  1YHB A;  2JA7 G;  3NEM A;  4DR3 L;  3RNU A;  2RF4 A;  1Q81 C;  2HHH Q;  2Z6K A;  1DGS A;  1XMO L;  4A3L H;  3CQZ H;  1RIP A;  4RG1 A;  2K5H A;  5IE8 A;  4KHZ A;  3IC6 A;  3GTJ H;  2CKZ B;  4JWF A;  1K0R A;  4JI7 L;  1VCI A;  2BH2 A;  2UUA L;  5M5Y H;  2JK8 A;  3CPF A;  1WJJ A;  3F1Z A;  1U5K A;  2QA4 A;  4A3M G;  1CUK A;  4L69 A;  3Q8D A;  3OTO Q;  4E8B A;  4YQ0 A;  2E8G A;  3A5Z B;  4PZ8 A;  4A3D H;  2RHQ B;  1PH7 A;  2Q2I A;  1TO0 A;  4YQN A;  4FAK A;  4YY3 Q;  1S40 A;  4BY1 G;  4YVJ A;  1VQI A;  3F2D A;  3M4O H;  4DAM A;  4HJ7 A;  1PV4 A;  5C3E H;  5JEA J;  2VL6 A;  4BA1 I;  2OQ0 A;  3CF5 A;  3OIN A;  1HH2 P;  4DK3 C;  1KQS A;  1M1K C;  2YYZ A;  4DR7 L;  1FL0 A;  4L5T A;  3PGZ A;  2UUC Q;  1SMX A;  4MTN A;  1A0I A;  1UE6 A;  5IYD G;  1BVS A;  1Q1E A;  5FLM H;  3I4N H;  4JI8 L;  1ZJR A;  4CNG A;  1OXS C;  1VQP A;  3FKI H;  4PZ7 A;  4X6A H;  3A74 A;  5LMN L;  2K75 A;  4GKK Q;  2F3I A;  3UE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...