3ONPA

Crystal structure of trna/rrna methyltransferase spou from rhodobacter sphaeroides
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
Knots found
sequence length
159
structure length
159
Chain Sequence
IEPVFILVRPQMGENIGAAARAMLNFGLGRLRIVDPRDGWPNPKAVAMASGAGRLLDHAGLFPTVAEAIRDCDYVFATTARGRELTKPVMTPERAMAHGRALTGEGRRVGILFGPERTGLENEDVALANAIVTVPVNPEFFSLNLAQCVLLLAYEWRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA/rRNA methyltransferase (SpoU)
publication title Crystal Structure of tRNA/rRNA Methyltransferase SpoU from Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 49
structure length 159
sequence length 159
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3onpA00
4KDZA 4YQ6A 2YY8A 1NS5A 3E5YA 3KNUA 5CO4A 2EGVA 1OY5A 4MCBA 1VHKA 5D9FA 3BBEA 1UAKA 4CNGA 3IEFA 3KY7A 4YVHA 4YQKA 4MCDA 4YQRA 1V6ZA 1VHYA 4YQAA 4X3LA 4YPZA 3ONPA 1VH0A 1X7PA 2CX8A 3KTYA 1TO0A 1K3RA 1UALA 4YQTA 4YQ4A 3OINA 4YPWA 4JAKA 4YQ0A 2QMMA 4YQ3A 5GM8A 1X7OA 1UAJA 3QUVA 4CNEA 4FAKA 2Z0YA 4YPXA 4YQCA 1UAMA 3OIIA 4H3YA 3GYQA 4YVKA 2QWVA 4CNFA 3IC6A 4YQIA 4YQDA 4YQJA 1ZJRA 4YQ2A 4J3CA 3AXZA 1Z85A 1J85A 1V2XA 3L8UA 4E8BA 4L69A 4YQ5A 1GZ0A 3NK7A 3BBHA 2HA8A 4YQLA 2V3JA 4YQGA 5FAIA 2I6DA 4YQBA 3O7BA 4YQPA 4H3ZA 4MCCA 3BBDA 1MXIA 3OIJA 3NK6A 1O6DA 1P9PA 1NXZA 4YPYA 3AIAA 3ILKA 5GMCA 5GMBA 2V3KA 2EGWA 1IPAA 4CNDA 4YVJA 4YVGA 4X3MA 4JALA 4KGNA 4YQQA 3DCMX 4YQSA 3KW2A 4XBOA 3N4KA 3N4JA 4YQ1A 4YVIA 4YQOA 3AI9X 4IG6A 2O3AA 4PZKA 4YQ7A 4RG1A 4YQ9A 4YQ8A 4YQNA
chains in the Genus database with same CATH superfamily
4KDZA 4YQ6A 2YY8A 1NS5A 3E5YA 3KNUA 5CO4A 2EGVA 1OY5A 4MCBA 1VHKA 5D9FA 3BBEA 1UAKA 4CNGA 3IEFA 3KY7A 4YVHA 4YQKA 4MCDA 4YQRA 1V6ZA 1VHYA 4YQAA 4JWGA 4X3LA 4YPZA 3ONPA 1VH0A 4JWHA 1X7PA 2CX8A 3KTYA 1TO0A 1K3RA 1UALA 4YQTA 4YQ4A 3OINA 4YPWA 4JAKA 4YQ0A 2QMMA 4YQ3A 5GM8A 1X7OA 1UAJA 4JWJA 3QUVA 4CNEA 4FAKA 2Z0YA 4YPXA 4YQCA 1UAMA 3OIIA 4H3YA 4FMWA 3GYQA 4YVKA 2QWVA 4CNFA 3IC6A 4YQIA 4YQDA 4YQJA 1ZJRA 4YQ2A 4J3CA 3AXZA 1Z85A 1J85A 1V2XA 3L8UA 4E8BA 4L69A 4YQ5A 1GZ0A 3NK7A 3BBHA 2HA8A 4YQLA 2V3JA 4YQGA 5FAIA 2I6DA 4YQBA 3O7BA 4YQPA 4H3ZA 4MCCA 3BBDA 1MXIA 3OIJA 3NK6A 1O6DA 1P9PA 1NXZA 4YPYA 3AIAA 3ILKA 5GMCA 5GMBA 2V3KA 2EGWA 1IPAA 4CNDA 4YVJA 4JWFA 4YVGA 4X3MA 4JALA 4KGNA 4YQQA 3DCMX 4YQSA 3KW2A 4XBOA 3N4KA 3N4JA 4YQ1A 4YVIA 4YQOA 3AI9X 4IG6A 2O3AA 4PZKA 4YQ7A 4RG1A 4YQ9A 4YQ8A 4YQNA
chains in the Genus database with same CATH topology
4KDZA 4YQ6A 2YY8A 1NS5A 3E5YA 3KNUA 5CO4A 2EGVA 1OY5A 4MCBA 1VHKA 5D9FA 3BBEA 1UAKA 4CNGA 3IEFA 3KY7A 4YVHA 4YQKA 4MCDA 4YQRA 1V6ZA 1VHYA 4YQAA 4JWGA 4X3LA 4YPZA 3ONPA 1VH0A 4JWHA 1X7PA 2CX8A 3KTYA 1TO0A 1K3RA 1UALA 4YQTA 4YQ4A 3OINA 4YPWA 4JAKA 4YQ0A 2QMMA 4YQ3A 5GM8A 1X7OA 1UAJA 4JWJA 3QUVA 4CNEA 4FAKA 2Z0YA 4YPXA 4YQCA 1UAMA 3OIIA 4H3YA 4FMWA 3GYQA 4YVKA 2QWVA 4CNFA 3IC6A 4YQIA 4YQDA 4YQJA 1ZJRA 4YQ2A 4J3CA 3AXZA 1Z85A 1J85A 1V2XA 3L8UA 4E8BA 4L69A 4YQ5A 1GZ0A 3NK7A 3BBHA 2HA8A 4YQLA 2V3JA 4YQGA 5FAIA 2I6DA 4YQBA 3O7BA 4YQPA 4H3ZA 4MCCA 3BBDA 1MXIA 3OIJA 3NK6A 1O6DA 1P9PA 1NXZA 4YPYA 3AIAA 3ILKA 5GMCA 5GMBA 2V3KA 2EGWA 1IPAA 4CNDA 4YVJA 4JWFA 4YVGA 4X3MA 4JALA 4KGNA 4YQQA 3DCMX 4YQSA 3KW2A 4XBOA 3N4KA 3N4JA 4YQ1A 4YVIA 4YQOA 3AI9X 4IG6A 2O3AA 4PZKA 4YQ7A 4RG1A 4YQ9A 4YQ8A 4YQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDZ A;  4YQ6 A;  2YY8 A;  1NS5 A;  3E5Y A;  3KNU A;  5CO4 A;  2EGV A;  1OY5 A;  4MCB A;  1VHK A;  5D9F A;  3BBE A;  1UAK A;  4CNG A;  3IEF A;  3KY7 A;  4YVH A;  4YQK A;  4MCD A;  4YQR A;  1V6Z A;  1VHY A;  4YQA A;  4X3L A;  4YPZ A;  3ONP A;  1VH0 A;  1X7P A;  2CX8 A;  3KTY A;  1TO0 A;  1K3R A;  1UAL A;  4YQT A;  4YQ4 A;  3OIN A;  4YPW A;  4JAK A;  4YQ0 A;  2QMM A;  4YQ3 A;  5GM8 A;  1X7O A;  1UAJ A;  3QUV A;  4CNE A;  4FAK A;  2Z0Y A;  4YPX A;  4YQC A;  1UAM A;  3OII A;  4H3Y A;  3GYQ A;  4YVK A;  2QWV A;  4CNF A;  3IC6 A;  4YQI A;  4YQD A;  4YQJ A;  1ZJR A;  4YQ2 A;  4J3C A;  3AXZ A;  1Z85 A;  1J85 A;  1V2X A;  3L8U A;  4E8B A;  4L69 A;  4YQ5 A;  1GZ0 A;  3NK7 A;  3BBH A;  2HA8 A;  4YQL A;  2V3J A;  4YQG A;  5FAI A;  2I6D A;  4YQB A;  3O7B A;  4YQP A;  4H3Z A;  4MCC A;  3BBD A;  1MXI A;  3OIJ A;  3NK6 A;  1O6D A;  1P9P A;  1NXZ A;  4YPY A;  3AIA A;  3ILK A;  5GMC A;  5GMB A;  2V3K A;  2EGW A;  1IPA A;  4CND A;  4YVJ A;  4YVG A;  4X3M A;  4JAL A;  4KGN A;  4YQQ A;  3DCM X;  4YQS A;  3KW2 A;  4XBO A;  3N4K A;  3N4J A;  4YQ1 A;  4YVI A;  4YQO A;  3AI9 X;  4IG6 A;  2O3A A;  4PZK A;  4YQ7 A;  4RG1 A;  4YQ9 A;  4YQ8 A;  4YQN A; 
#chains in the Genus database with same CATH topology
 4KDZ A;  4YQ6 A;  2YY8 A;  1NS5 A;  3E5Y A;  3KNU A;  5CO4 A;  2EGV A;  1OY5 A;  4MCB A;  1VHK A;  5D9F A;  3BBE A;  1UAK A;  4CNG A;  3IEF A;  3KY7 A;  4YVH A;  4YQK A;  4MCD A;  4YQR A;  1V6Z A;  1VHY A;  4YQA A;  4JWG A;  4X3L A;  4YPZ A;  3ONP A;  1VH0 A;  4JWH A;  1X7P A;  2CX8 A;  3KTY A;  1TO0 A;  1K3R A;  1UAL A;  4YQT A;  4YQ4 A;  3OIN A;  4YPW A;  4JAK A;  4YQ0 A;  2QMM A;  4YQ3 A;  5GM8 A;  1X7O A;  1UAJ A;  4JWJ A;  3QUV A;  4CNE A;  4FAK A;  2Z0Y A;  4YPX A;  4YQC A;  1UAM A;  3OII A;  4H3Y A;  4FMW A;  3GYQ A;  4YVK A;  2QWV A;  4CNF A;  3IC6 A;  4YQI A;  4YQD A;  4YQJ A;  1ZJR A;  4YQ2 A;  4J3C A;  3AXZ A;  1Z85 A;  1J85 A;  1V2X A;  3L8U A;  4E8B A;  4L69 A;  4YQ5 A;  1GZ0 A;  3NK7 A;  3BBH A;  2HA8 A;  4YQL A;  2V3J A;  4YQG A;  5FAI A;  2I6D A;  4YQB A;  3O7B A;  4YQP A;  4H3Z A;  4MCC A;  3BBD A;  1MXI A;  3OIJ A;  3NK6 A;  1O6D A;  1P9P A;  1NXZ A;  4YPY A;  3AIA A;  3ILK A;  5GMC A;  5GMB A;  2V3K A;  2EGW A;  1IPA A;  4CND A;  4YVJ A;  4JWF A;  4YVG A;  4X3M A;  4JAL A;  4KGN A;  4YQQ A;  3DCM X;  4YQS A;  3KW2 A;  4XBO A;  3N4K A;  3N4J A;  4YQ1 A;  4YVI A;  4YQO A;  3AI9 X;  4IG6 A;  2O3A A;  4PZK A;  4YQ7 A;  4RG1 A;  4YQ9 A;  4YQ8 A;  4YQN A; 
#chains in the Genus database with same CATH homology
 4KDZ A;  4YQ6 A;  2YY8 A;  1NS5 A;  3E5Y A;  3KNU A;  5CO4 A;  2EGV A;  1OY5 A;  4MCB A;  1VHK A;  5D9F A;  3BBE A;  1UAK A;  4CNG A;  3IEF A;  3KY7 A;  4YVH A;  4YQK A;  4MCD A;  4YQR A;  1V6Z A;  1VHY A;  4YQA A;  4JWG A;  4X3L A;  4YPZ A;  3ONP A;  1VH0 A;  4JWH A;  1X7P A;  2CX8 A;  3KTY A;  1TO0 A;  1K3R A;  1UAL A;  4YQT A;  4YQ4 A;  3OIN A;  4YPW A;  4JAK A;  4YQ0 A;  2QMM A;  4YQ3 A;  5GM8 A;  1X7O A;  1UAJ A;  4JWJ A;  3QUV A;  4CNE A;  4FAK A;  2Z0Y A;  4YPX A;  4YQC A;  1UAM A;  3OII A;  4H3Y A;  4FMW A;  3GYQ A;  4YVK A;  2QWV A;  4CNF A;  3IC6 A;  4YQI A;  4YQD A;  4YQJ A;  1ZJR A;  4YQ2 A;  4J3C A;  3AXZ A;  1Z85 A;  1J85 A;  1V2X A;  3L8U A;  4E8B A;  4L69 A;  4YQ5 A;  1GZ0 A;  3NK7 A;  3BBH A;  2HA8 A;  4YQL A;  2V3J A;  4YQG A;  5FAI A;  2I6D A;  4YQB A;  3O7B A;  4YQP A;  4H3Z A;  4MCC A;  3BBD A;  1MXI A;  3OIJ A;  3NK6 A;  1O6D A;  1P9P A;  1NXZ A;  4YPY A;  3AIA A;  3ILK A;  5GMC A;  5GMB A;  2V3K A;  2EGW A;  1IPA A;  4CND A;  4YVJ A;  4JWF A;  4YVG A;  4X3M A;  4JAL A;  4KGN A;  4YQQ A;  3DCM X;  4YQS A;  3KW2 A;  4XBO A;  3N4K A;  3N4J A;  4YQ1 A;  4YVI A;  4YQO A;  3AI9 X;  4IG6 A;  2O3A A;  4PZK A;  4YQ7 A;  4RG1 A;  4YQ9 A;  4YQ8 A;  4YQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...