3ONPA

Crystal structure of trna/rrna methyltransferase spou from rhodobacter sphaeroides
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
Knots found
sequence length
159
structure length
159
Chain Sequence
IEPVFILVRPQMGENIGAAARAMLNFGLGRLRIVDPRDGWPNPKAVAMASGAGRLLDHAGLFPTVAEAIRDCDYVFATTARGRELTKPVMTPERAMAHGRALTGEGRRVGILFGPERTGLENEDVALANAIVTVPVNPEFFSLNLAQCVLLLAYEWRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA/rRNA methyltransferase (SpoU)
publication title Crystal Structure of tRNA/rRNA Methyltransferase SpoU from Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
total genus 49
structure length 159
sequence length 159
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3onpA00
4YPZA 2O3AA 4XBOA 1P9PA 4YQOA 4YQPA 4YQQA 4YQ3A 3AI9X 4YQTA 1VH0A 1TO0A 4CNEA 4PZKA 1UALA 4MCDA 4YQ2A 1VHYA 1V6ZA 5CO4A 3IEFA 1X7PA 4MCBA 4YQ5A 4YVJA 4YVKA 4CNFA 3OIJA 2HA8A 3GYQA 1MXIA 4YVHA 1IPAA 3OINA 1O6DA 5GMBA 5FAIA 2I6DA 4J3CA 4FAKA 3E5YA 4YQAA 3IC6A 3NK7A 4X3LA 4YPWA 1VHKA 1OY5A 2V3KA 4YQRA 3NK6A 1UAMA 4CNGA 4CNDA 3O7BA 4JALA 4YQ4A 1UAKA 3KTYA 1GZ0A 4YQ1A 3AIAA 3AXZA 4RG1A 3OIIA 4YQGA 1ZJRA 4YQ8A 4YVGA 4YVIA 2EGVA 2QMMA 2CX8A 2YY8A 3BBEA 4MCCA 4YQKA 3QUVA 1UAJA 4YQLA 5GMCA 2QWVA 3N4KA 4X3MA 1J85A 1NS5A 3ONPA 4JAKA 4YQDA 4KGNA 4YQSA 4YQ7A 2EGWA 4YQ6A 3BBDA 2V3JA 4YQNA 1K3RA 4YQCA 4KDZA 4YQJA 3ILKA 4H3YA 4YPYA 1NXZA 4YQ9A 4YPXA 4H3ZA 2Z0YA 4E8BA 4YQBA 4YQIA 3BBHA 3KY7A 5D9FA 5GM8A 4YQ0A 4L69A 1X7OA 3KW2A 4IG6A 1Z85A 3KNUA 3L8UA 1V2XA 3N4JA 3DCMX
chains in the Genus database with same CATH superfamily
4YPZA 2O3AA 4XBOA 1P9PA 4YQOA 4YQPA 4YQQA 4YQ3A 3AI9X 4YQTA 1VH0A 1TO0A 4CNEA 4PZKA 1UALA 4FMWA 4MCDA 4YQ2A 1VHYA 4JWHA 1V6ZA 5CO4A 4JWJA 3IEFA 1X7PA 4MCBA 4YQ5A 4YVJA 4YVKA 4CNFA 3OIJA 2HA8A 3GYQA 1MXIA 4YVHA 1IPAA 3OINA 1O6DA 5GMBA 5FAIA 2I6DA 4J3CA 4FAKA 3E5YA 4YQAA 3IC6A 3NK7A 4X3LA 4YPWA 1VHKA 1OY5A 2V3KA 4YQRA 3NK6A 1UAMA 4CNGA 4CNDA 3O7BA 4JALA 4YQ4A 1UAKA 3KTYA 1GZ0A 4YQ1A 3AIAA 3AXZA 4RG1A 3OIIA 4YQGA 1ZJRA 4YQ8A 4YVGA 4YVIA 2EGVA 2QMMA 2CX8A 2YY8A 3BBEA 4MCCA 4YQKA 3QUVA 1UAJA 4YQLA 4JWFA 5GMCA 2QWVA 3N4KA 4X3MA 1J85A 1NS5A 3ONPA 4JAKA 4YQDA 4KGNA 4YQSA 4YQ7A 2EGWA 4YQ6A 3BBDA 2V3JA 4YQNA 1K3RA 4YQCA 4KDZA 4YQJA 3ILKA 4H3YA 4YPYA 1NXZA 4YQ9A 4YPXA 4H3ZA 2Z0YA 4E8BA 4YQBA 4YQIA 3BBHA 3KY7A 5D9FA 5GM8A 4YQ0A 4JWGA 4L69A 1X7OA 3KW2A 4IG6A 1Z85A 3KNUA 3L8UA 1V2XA 3N4JA 3DCMX
chains in the Genus database with same CATH topology
4YPZA 2O3AA 4XBOA 1P9PA 4YQOA 4YQPA 4YQQA 4YQ3A 3AI9X 4YQTA 1VH0A 1TO0A 4CNEA 4PZKA 1UALA 4FMWA 4MCDA 4YQ2A 1VHYA 4JWHA 1V6ZA 5CO4A 4JWJA 3IEFA 1X7PA 4MCBA 4YQ5A 4YVJA 4YVKA 4CNFA 3OIJA 2HA8A 3GYQA 1MXIA 4YVHA 1IPAA 3OINA 1O6DA 5GMBA 5FAIA 2I6DA 4J3CA 4FAKA 3E5YA 4YQAA 3IC6A 3NK7A 4X3LA 4YPWA 1VHKA 1OY5A 2V3KA 4YQRA 3NK6A 1UAMA 4CNGA 4CNDA 3O7BA 4JALA 4YQ4A 1UAKA 3KTYA 1GZ0A 4YQ1A 3AIAA 3AXZA 4RG1A 3OIIA 4YQGA 1ZJRA 4YQ8A 4YVGA 4YVIA 2EGVA 2QMMA 2CX8A 2YY8A 3BBEA 4MCCA 4YQKA 3QUVA 1UAJA 4YQLA 4JWFA 5GMCA 2QWVA 3N4KA 4X3MA 1J85A 1NS5A 3ONPA 4JAKA 4YQDA 4KGNA 4YQSA 4YQ7A 2EGWA 4YQ6A 3BBDA 2V3JA 4YQNA 1K3RA 4YQCA 4KDZA 4YQJA 3ILKA 4H3YA 4YPYA 1NXZA 4YQ9A 4YPXA 4H3ZA 2Z0YA 4E8BA 4YQBA 4YQIA 3BBHA 3KY7A 5D9FA 5GM8A 4YQ0A 4JWGA 4L69A 1X7OA 3KW2A 4IG6A 1Z85A 3KNUA 3L8UA 1V2XA 3N4JA 3DCMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPZ A;  2O3A A;  4XBO A;  1P9P A;  4YQO A;  4YQP A;  4YQQ A;  4YQ3 A;  3AI9 X;  4YQT A;  1VH0 A;  1TO0 A;  4CNE A;  4PZK A;  1UAL A;  4MCD A;  4YQ2 A;  1VHY A;  1V6Z A;  5CO4 A;  3IEF A;  1X7P A;  4MCB A;  4YQ5 A;  4YVJ A;  4YVK A;  4CNF A;  3OIJ A;  2HA8 A;  3GYQ A;  1MXI A;  4YVH A;  1IPA A;  3OIN A;  1O6D A;  5GMB A;  5FAI A;  2I6D A;  4J3C A;  4FAK A;  3E5Y A;  4YQA A;  3IC6 A;  3NK7 A;  4X3L A;  4YPW A;  1VHK A;  1OY5 A;  2V3K A;  4YQR A;  3NK6 A;  1UAM A;  4CNG A;  4CND A;  3O7B A;  4JAL A;  4YQ4 A;  1UAK A;  3KTY A;  1GZ0 A;  4YQ1 A;  3AIA A;  3AXZ A;  4RG1 A;  3OII A;  4YQG A;  1ZJR A;  4YQ8 A;  4YVG A;  4YVI A;  2EGV A;  2QMM A;  2CX8 A;  2YY8 A;  3BBE A;  4MCC A;  4YQK A;  3QUV A;  1UAJ A;  4YQL A;  5GMC A;  2QWV A;  3N4K A;  4X3M A;  1J85 A;  1NS5 A;  3ONP A;  4JAK A;  4YQD A;  4KGN A;  4YQS A;  4YQ7 A;  2EGW A;  4YQ6 A;  3BBD A;  2V3J A;  4YQN A;  1K3R A;  4YQC A;  4KDZ A;  4YQJ A;  3ILK A;  4H3Y A;  4YPY A;  1NXZ A;  4YQ9 A;  4YPX A;  4H3Z A;  2Z0Y A;  4E8B A;  4YQB A;  4YQI A;  3BBH A;  3KY7 A;  5D9F A;  5GM8 A;  4YQ0 A;  4L69 A;  1X7O A;  3KW2 A;  4IG6 A;  1Z85 A;  3KNU A;  3L8U A;  1V2X A;  3N4J A;  3DCM X; 
#chains in the Genus database with same CATH topology
 4YPZ A;  2O3A A;  4XBO A;  1P9P A;  4YQO A;  4YQP A;  4YQQ A;  4YQ3 A;  3AI9 X;  4YQT A;  1VH0 A;  1TO0 A;  4CNE A;  4PZK A;  1UAL A;  4FMW A;  4MCD A;  4YQ2 A;  1VHY A;  4JWH A;  1V6Z A;  5CO4 A;  4JWJ A;  3IEF A;  1X7P A;  4MCB A;  4YQ5 A;  4YVJ A;  4YVK A;  4CNF A;  3OIJ A;  2HA8 A;  3GYQ A;  1MXI A;  4YVH A;  1IPA A;  3OIN A;  1O6D A;  5GMB A;  5FAI A;  2I6D A;  4J3C A;  4FAK A;  3E5Y A;  4YQA A;  3IC6 A;  3NK7 A;  4X3L A;  4YPW A;  1VHK A;  1OY5 A;  2V3K A;  4YQR A;  3NK6 A;  1UAM A;  4CNG A;  4CND A;  3O7B A;  4JAL A;  4YQ4 A;  1UAK A;  3KTY A;  1GZ0 A;  4YQ1 A;  3AIA A;  3AXZ A;  4RG1 A;  3OII A;  4YQG A;  1ZJR A;  4YQ8 A;  4YVG A;  4YVI A;  2EGV A;  2QMM A;  2CX8 A;  2YY8 A;  3BBE A;  4MCC A;  4YQK A;  3QUV A;  1UAJ A;  4YQL A;  4JWF A;  5GMC A;  2QWV A;  3N4K A;  4X3M A;  1J85 A;  1NS5 A;  3ONP A;  4JAK A;  4YQD A;  4KGN A;  4YQS A;  4YQ7 A;  2EGW A;  4YQ6 A;  3BBD A;  2V3J A;  4YQN A;  1K3R A;  4YQC A;  4KDZ A;  4YQJ A;  3ILK A;  4H3Y A;  4YPY A;  1NXZ A;  4YQ9 A;  4YPX A;  4H3Z A;  2Z0Y A;  4E8B A;  4YQB A;  4YQI A;  3BBH A;  3KY7 A;  5D9F A;  5GM8 A;  4YQ0 A;  4JWG A;  4L69 A;  1X7O A;  3KW2 A;  4IG6 A;  1Z85 A;  3KNU A;  3L8U A;  1V2X A;  3N4J A;  3DCM X; 
#chains in the Genus database with same CATH homology
 4YPZ A;  2O3A A;  4XBO A;  1P9P A;  4YQO A;  4YQP A;  4YQQ A;  4YQ3 A;  3AI9 X;  4YQT A;  1VH0 A;  1TO0 A;  4CNE A;  4PZK A;  1UAL A;  4FMW A;  4MCD A;  4YQ2 A;  1VHY A;  4JWH A;  1V6Z A;  5CO4 A;  4JWJ A;  3IEF A;  1X7P A;  4MCB A;  4YQ5 A;  4YVJ A;  4YVK A;  4CNF A;  3OIJ A;  2HA8 A;  3GYQ A;  1MXI A;  4YVH A;  1IPA A;  3OIN A;  1O6D A;  5GMB A;  5FAI A;  2I6D A;  4J3C A;  4FAK A;  3E5Y A;  4YQA A;  3IC6 A;  3NK7 A;  4X3L A;  4YPW A;  1VHK A;  1OY5 A;  2V3K A;  4YQR A;  3NK6 A;  1UAM A;  4CNG A;  4CND A;  3O7B A;  4JAL A;  4YQ4 A;  1UAK A;  3KTY A;  1GZ0 A;  4YQ1 A;  3AIA A;  3AXZ A;  4RG1 A;  3OII A;  4YQG A;  1ZJR A;  4YQ8 A;  4YVG A;  4YVI A;  2EGV A;  2QMM A;  2CX8 A;  2YY8 A;  3BBE A;  4MCC A;  4YQK A;  3QUV A;  1UAJ A;  4YQL A;  4JWF A;  5GMC A;  2QWV A;  3N4K A;  4X3M A;  1J85 A;  1NS5 A;  3ONP A;  4JAK A;  4YQD A;  4KGN A;  4YQS A;  4YQ7 A;  2EGW A;  4YQ6 A;  3BBD A;  2V3J A;  4YQN A;  1K3R A;  4YQC A;  4KDZ A;  4YQJ A;  3ILK A;  4H3Y A;  4YPY A;  1NXZ A;  4YQ9 A;  4YPX A;  4H3Z A;  2Z0Y A;  4E8B A;  4YQB A;  4YQI A;  3BBH A;  3KY7 A;  5D9F A;  5GM8 A;  4YQ0 A;  4JWG A;  4L69 A;  1X7O A;  3KW2 A;  4IG6 A;  1Z85 A;  3KNU A;  3L8U A;  1V2X A;  3N4J A;  3DCM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...