4PZKA

Crystal strucrure of putative rna methyltransferase from bacillus anthracis.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
Knots found
sequence length
159
structure length
159
Chain Sequence
GVHVVLYQPEIPANTGNIARTCAATGTELHLIRPLGFSTDDKMLKRAGLDYWQHVKITYYDSIEEFYEKNKDGEFFYLTKYGEKAHTAFDYSKREKDYYFVFGRETNGLPANVIEENFDHCLRIPMTDKVRSLNLSNTAAILIYEAFRQQNYPGLDLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (cytidine(34)-2'-O)-methyltransferase
publication title Crystal strucrure of putative RNA methyltransferase from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
total genus 54
structure length 159
sequence length 159
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4pzkA00
4YPXA 4YQ7A 3ONPA 4H3ZA 1J85A 3NK7A 2YY8A 1O6DA 1V6ZA 4MCBA 3KTYA 4YQAA 4YQ2A 3O7BA 3IEFA 4YPYA 1MXIA 4YQDA 2QMMA 1UALA 2V3JA 1VHKA 1X7OA 4X3MA 1VHYA 4L69A 3GYQA 4J3CA 4YQIA 1P9PA 3OIIA 1UAJA 1IPAA 4YQCA 4YQKA 4YQGA 4YQ3A 4YVGA 2CX8A 4YVIA 4YQRA 4YQQA 1NS5A 4CNFA 1Z85A 4YQOA 4YQPA 5GMCA 4YQ8A 2V3KA 4YQ0A 3OIJA 1ZJRA 2HA8A 4YQJA 4RG1A 1TO0A 4FAKA 2O3AA 4YVKA 4YVHA 4YQ1A 3ILKA 3AI9X 4YQ6A 3OINA 4YQBA 5FAIA 2Z0YA 3QUVA 1VH0A 4YPZA 3DCMX 5GM8A 2EGVA 3E5YA 3KNUA 4YQTA 4MCDA 1NXZA 3KY7A 4YPWA 4YQ9A 3BBDA 4KDZA 4H3YA 3BBEA 3AIAA 4YQSA 5GMBA 4X3LA 3AXZA 4JAKA 3N4JA 3L8UA 2EGWA 4CNGA 1UAMA 2I6DA 1X7PA 5CO4A 1OY5A 4YQ4A 1UAKA 4CNEA 4YQ5A 2QWVA 4KGNA 3NK6A 1GZ0A 4YVJA 4IG6A 4XBOA 3BBHA 4E8BA 4CNDA 4PZKA 1V2XA 3KW2A 3IC6A 3N4KA 4MCCA 1K3RA 4YQNA 4YQLA 4JALA 5D9FA
chains in the Genus database with same CATH superfamily
4YPXA 4YQ7A 3ONPA 4H3ZA 1J85A 3NK7A 2YY8A 1O6DA 1V6ZA 4MCBA 3KTYA 4YQAA 4YQ2A 3O7BA 3IEFA 4YPYA 1MXIA 4YQDA 2QMMA 1UALA 2V3JA 1VHKA 1X7OA 4X3MA 1VHYA 4L69A 3GYQA 4J3CA 4YQIA 1P9PA 3OIIA 4JWHA 1UAJA 1IPAA 4YQCA 4YQKA 4YQGA 4YQ3A 4YVGA 2CX8A 4YVIA 4YQRA 4YQQA 1NS5A 4CNFA 1Z85A 4YQOA 4YQPA 5GMCA 4YQ8A 2V3KA 4YQ0A 3OIJA 1ZJRA 2HA8A 4YQJA 4RG1A 1TO0A 4FAKA 4JWFA 2O3AA 4YVKA 4YVHA 4YQ1A 3ILKA 3AI9X 4YQ6A 3OINA 4YQBA 5FAIA 2Z0YA 3QUVA 1VH0A 4YPZA 3DCMX 5GM8A 2EGVA 3E5YA 3KNUA 4YQTA 4MCDA 1NXZA 3KY7A 4YPWA 4YQ9A 3BBDA 4KDZA 4H3YA 3BBEA 3AIAA 4YQSA 5GMBA 4X3LA 3AXZA 4JAKA 3N4JA 3L8UA 2EGWA 4CNGA 1UAMA 2I6DA 1X7PA 5CO4A 1OY5A 4YQ4A 1UAKA 4FMWA 4CNEA 4YQ5A 2QWVA 4KGNA 3NK6A 1GZ0A 4YVJA 4IG6A 4JWJA 4XBOA 3BBHA 4E8BA 4JWGA 4CNDA 4PZKA 1V2XA 3KW2A 3IC6A 3N4KA 4MCCA 1K3RA 4YQNA 4YQLA 4JALA 5D9FA
chains in the Genus database with same CATH topology
4YPXA 4YQ7A 3ONPA 4H3ZA 1J85A 3NK7A 2YY8A 1O6DA 1V6ZA 4MCBA 3KTYA 4YQAA 4YQ2A 3O7BA 3IEFA 4YPYA 1MXIA 4YQDA 2QMMA 1UALA 2V3JA 1VHKA 1X7OA 4X3MA 1VHYA 4L69A 3GYQA 4J3CA 4YQIA 1P9PA 3OIIA 4JWHA 1UAJA 1IPAA 4YQCA 4YQKA 4YQGA 4YQ3A 4YVGA 2CX8A 4YVIA 4YQRA 4YQQA 1NS5A 4CNFA 1Z85A 4YQOA 4YQPA 5GMCA 4YQ8A 2V3KA 4YQ0A 3OIJA 1ZJRA 2HA8A 4YQJA 4RG1A 1TO0A 4FAKA 4JWFA 2O3AA 4YVKA 4YVHA 4YQ1A 3ILKA 3AI9X 4YQ6A 3OINA 4YQBA 5FAIA 2Z0YA 3QUVA 1VH0A 4YPZA 3DCMX 5GM8A 2EGVA 3E5YA 3KNUA 4YQTA 4MCDA 1NXZA 3KY7A 4YPWA 4YQ9A 3BBDA 4KDZA 4H3YA 3BBEA 3AIAA 4YQSA 5GMBA 4X3LA 3AXZA 4JAKA 3N4JA 3L8UA 2EGWA 4CNGA 1UAMA 2I6DA 1X7PA 5CO4A 1OY5A 4YQ4A 1UAKA 4FMWA 4CNEA 4YQ5A 2QWVA 4KGNA 3NK6A 1GZ0A 4YVJA 4IG6A 4JWJA 4XBOA 3BBHA 4E8BA 4JWGA 4CNDA 4PZKA 1V2XA 3KW2A 3IC6A 3N4KA 4MCCA 1K3RA 4YQNA 4YQLA 4JALA 5D9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPX A;  4YQ7 A;  3ONP A;  4H3Z A;  1J85 A;  3NK7 A;  2YY8 A;  1O6D A;  1V6Z A;  4MCB A;  3KTY A;  4YQA A;  4YQ2 A;  3O7B A;  3IEF A;  4YPY A;  1MXI A;  4YQD A;  2QMM A;  1UAL A;  2V3J A;  1VHK A;  1X7O A;  4X3M A;  1VHY A;  4L69 A;  3GYQ A;  4J3C A;  4YQI A;  1P9P A;  3OII A;  1UAJ A;  1IPA A;  4YQC A;  4YQK A;  4YQG A;  4YQ3 A;  4YVG A;  2CX8 A;  4YVI A;  4YQR A;  4YQQ A;  1NS5 A;  4CNF A;  1Z85 A;  4YQO A;  4YQP A;  5GMC A;  4YQ8 A;  2V3K A;  4YQ0 A;  3OIJ A;  1ZJR A;  2HA8 A;  4YQJ A;  4RG1 A;  1TO0 A;  4FAK A;  2O3A A;  4YVK A;  4YVH A;  4YQ1 A;  3ILK A;  3AI9 X;  4YQ6 A;  3OIN A;  4YQB A;  5FAI A;  2Z0Y A;  3QUV A;  1VH0 A;  4YPZ A;  3DCM X;  5GM8 A;  2EGV A;  3E5Y A;  3KNU A;  4YQT A;  4MCD A;  1NXZ A;  3KY7 A;  4YPW A;  4YQ9 A;  3BBD A;  4KDZ A;  4H3Y A;  3BBE A;  3AIA A;  4YQS A;  5GMB A;  4X3L A;  3AXZ A;  4JAK A;  3N4J A;  3L8U A;  2EGW A;  4CNG A;  1UAM A;  2I6D A;  1X7P A;  5CO4 A;  1OY5 A;  4YQ4 A;  1UAK A;  4CNE A;  4YQ5 A;  2QWV A;  4KGN A;  3NK6 A;  1GZ0 A;  4YVJ A;  4IG6 A;  4XBO A;  3BBH A;  4E8B A;  4CND A;  4PZK A;  1V2X A;  3KW2 A;  3IC6 A;  3N4K A;  4MCC A;  1K3R A;  4YQN A;  4YQL A;  4JAL A;  5D9F A; 
#chains in the Genus database with same CATH topology
 4YPX A;  4YQ7 A;  3ONP A;  4H3Z A;  1J85 A;  3NK7 A;  2YY8 A;  1O6D A;  1V6Z A;  4MCB A;  3KTY A;  4YQA A;  4YQ2 A;  3O7B A;  3IEF A;  4YPY A;  1MXI A;  4YQD A;  2QMM A;  1UAL A;  2V3J A;  1VHK A;  1X7O A;  4X3M A;  1VHY A;  4L69 A;  3GYQ A;  4J3C A;  4YQI A;  1P9P A;  3OII A;  4JWH A;  1UAJ A;  1IPA A;  4YQC A;  4YQK A;  4YQG A;  4YQ3 A;  4YVG A;  2CX8 A;  4YVI A;  4YQR A;  4YQQ A;  1NS5 A;  4CNF A;  1Z85 A;  4YQO A;  4YQP A;  5GMC A;  4YQ8 A;  2V3K A;  4YQ0 A;  3OIJ A;  1ZJR A;  2HA8 A;  4YQJ A;  4RG1 A;  1TO0 A;  4FAK A;  4JWF A;  2O3A A;  4YVK A;  4YVH A;  4YQ1 A;  3ILK A;  3AI9 X;  4YQ6 A;  3OIN A;  4YQB A;  5FAI A;  2Z0Y A;  3QUV A;  1VH0 A;  4YPZ A;  3DCM X;  5GM8 A;  2EGV A;  3E5Y A;  3KNU A;  4YQT A;  4MCD A;  1NXZ A;  3KY7 A;  4YPW A;  4YQ9 A;  3BBD A;  4KDZ A;  4H3Y A;  3BBE A;  3AIA A;  4YQS A;  5GMB A;  4X3L A;  3AXZ A;  4JAK A;  3N4J A;  3L8U A;  2EGW A;  4CNG A;  1UAM A;  2I6D A;  1X7P A;  5CO4 A;  1OY5 A;  4YQ4 A;  1UAK A;  4FMW A;  4CNE A;  4YQ5 A;  2QWV A;  4KGN A;  3NK6 A;  1GZ0 A;  4YVJ A;  4IG6 A;  4JWJ A;  4XBO A;  3BBH A;  4E8B A;  4JWG A;  4CND A;  4PZK A;  1V2X A;  3KW2 A;  3IC6 A;  3N4K A;  4MCC A;  1K3R A;  4YQN A;  4YQL A;  4JAL A;  5D9F A; 
#chains in the Genus database with same CATH homology
 4YPX A;  4YQ7 A;  3ONP A;  4H3Z A;  1J85 A;  3NK7 A;  2YY8 A;  1O6D A;  1V6Z A;  4MCB A;  3KTY A;  4YQA A;  4YQ2 A;  3O7B A;  3IEF A;  4YPY A;  1MXI A;  4YQD A;  2QMM A;  1UAL A;  2V3J A;  1VHK A;  1X7O A;  4X3M A;  1VHY A;  4L69 A;  3GYQ A;  4J3C A;  4YQI A;  1P9P A;  3OII A;  4JWH A;  1UAJ A;  1IPA A;  4YQC A;  4YQK A;  4YQG A;  4YQ3 A;  4YVG A;  2CX8 A;  4YVI A;  4YQR A;  4YQQ A;  1NS5 A;  4CNF A;  1Z85 A;  4YQO A;  4YQP A;  5GMC A;  4YQ8 A;  2V3K A;  4YQ0 A;  3OIJ A;  1ZJR A;  2HA8 A;  4YQJ A;  4RG1 A;  1TO0 A;  4FAK A;  4JWF A;  2O3A A;  4YVK A;  4YVH A;  4YQ1 A;  3ILK A;  3AI9 X;  4YQ6 A;  3OIN A;  4YQB A;  5FAI A;  2Z0Y A;  3QUV A;  1VH0 A;  4YPZ A;  3DCM X;  5GM8 A;  2EGV A;  3E5Y A;  3KNU A;  4YQT A;  4MCD A;  1NXZ A;  3KY7 A;  4YPW A;  4YQ9 A;  3BBD A;  4KDZ A;  4H3Y A;  3BBE A;  3AIA A;  4YQS A;  5GMB A;  4X3L A;  3AXZ A;  4JAK A;  3N4J A;  3L8U A;  2EGW A;  4CNG A;  1UAM A;  2I6D A;  1X7P A;  5CO4 A;  1OY5 A;  4YQ4 A;  1UAK A;  4FMW A;  4CNE A;  4YQ5 A;  2QWV A;  4KGN A;  3NK6 A;  1GZ0 A;  4YVJ A;  4IG6 A;  4JWJ A;  4XBO A;  3BBH A;  4E8B A;  4JWG A;  4CND A;  4PZK A;  1V2X A;  3KW2 A;  3IC6 A;  3N4K A;  4MCC A;  1K3R A;  4YQN A;  4YQL A;  4JAL A;  5D9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...